BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25564_g1_i1 len=2244 path=[1:0-324 326:325-342 344:343-368
8119:369-371 373:372-393 395:394-423 425:424-461 463:462-500
502:501-526 8156:527-542 544:543-576 578:577-698 700:699-714
716:715-743 745:744-762 764:763-815 817:816-855 857:856-878
880:879-916 918:917-956 958:957-963 965:964-1014 1016:1015-1066
1068:1067-1090 1092:1091-1122 8416:1123-1184 1186:1185-1277
1279:1278-1467 1469:1468-1516 1518:1517-1661 1663:1662-1745
1747:1746-1904 1906:1905-1911 1913:1912-1955 1957:1956-2061
2063:2062-2243]

Length=2244
                                                                      Score     E

ref|XP_009779551.1|  PREDICTED: indole-3-acetic acid-amido synthe...    913   0.0     
ref|XP_009621450.1|  PREDICTED: indole-3-acetic acid-amido synthe...    912   0.0     
ref|XP_006360545.1|  PREDICTED: indole-3-acetic acid-amido synthe...    885   0.0     
ref|XP_010240996.1|  PREDICTED: indole-3-acetic acid-amido synthe...    880   0.0     
ref|XP_002283229.2|  PREDICTED: indole-3-acetic acid-amido synthe...    879   0.0     Vitis vinifera
emb|CAN83696.1|  hypothetical protein VITISV_013365                     879   0.0     Vitis vinifera
ref|XP_002533739.1|  Indole-3-acetic acid-amido synthetase GH3.6,...    877   0.0     Ricinus communis
emb|CDP05830.1|  unnamed protein product                                875   0.0     
gb|KDP39002.1|  hypothetical protein JCGZ_00759                         872   0.0     
ref|XP_010092269.1|  hypothetical protein L484_021129                   872   0.0     
ref|XP_006447440.1|  hypothetical protein CICLE_v10017968mg             872   0.0     
ref|XP_009615928.1|  PREDICTED: indole-3-acetic acid-amido synthe...    871   0.0     
gb|AGH61310.1|  indole-3-acetic acid amido synthetase                   870   0.0     
gb|KDO47749.1|  hypothetical protein CISIN_1g046696mg                   870   0.0     
ref|XP_010267862.1|  PREDICTED: indole-3-acetic acid-amido synthe...    869   0.0     
ref|XP_011009953.1|  PREDICTED: indole-3-acetic acid-amido synthe...    867   0.0     
ref|XP_006370580.1|  DWARF IN LIGHT 1 family protein                    867   0.0     
ref|XP_002319398.1|  hypothetical protein POPTR_0013s14740g             865   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009377289.1|  PREDICTED: indole-3-acetic acid-amido synthe...    864   0.0     
ref|XP_002316954.1|  DWARF IN LIGHT 1 family protein                    864   0.0     Populus trichocarpa [western balsam poplar]
emb|CDP11866.1|  unnamed protein product                                864   0.0     
ref|XP_006401565.1|  hypothetical protein EUTSA_v10012997mg             864   0.0     
ref|XP_007043391.1|  Auxin-responsive GH3 family protein                864   0.0     
ref|XP_008359299.1|  PREDICTED: indole-3-acetic acid-amido synthe...    863   0.0     
ref|XP_010062931.1|  PREDICTED: indole-3-acetic acid-amido synthe...    863   0.0     
ref|XP_011020987.1|  PREDICTED: indole-3-acetic acid-amido synthe...    863   0.0     
gb|KFK27060.1|  hypothetical protein AALP_AA8G329100                    863   0.0     
ref|XP_004294315.1|  PREDICTED: indole-3-acetic acid-amido synthe...    863   0.0     
ref|XP_003540050.1|  PREDICTED: indole-3-acetic acid-amido synthe...    862   0.0     
gb|KHG29342.1|  Indole-3-acetic acid-amido synthetase GH3.6 -like...    861   0.0     
ref|XP_009763610.1|  PREDICTED: indole-3-acetic acid-amido synthe...    861   0.0     
emb|CDY43824.1|  BnaC03g14570D                                          861   0.0     
ref|XP_009355553.1|  PREDICTED: indole-3-acetic acid-amido synthe...    860   0.0     
ref|XP_007021139.1|  Auxin-responsive GH3 family protein                860   0.0     
ref|XP_002866046.1|  hypothetical protein ARALYDRAFT_918581             860   0.0     
ref|XP_002276241.2|  PREDICTED: indole-3-acetic acid-amido synthe...    860   0.0     Vitis vinifera
ref|XP_009132438.1|  PREDICTED: indole-3-acetic acid-amido synthe...    859   0.0     
emb|CDY43037.1|  BnaA03g11840D                                          859   0.0     
ref|XP_006280192.1|  hypothetical protein CARUB_v10026098mg             859   0.0     
ref|NP_200262.1|  indole-3-acetic acid-amido synthetase GH3.6           858   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008365943.1|  PREDICTED: indole-3-acetic acid-amido synthe...    858   0.0     
ref|XP_003526154.1|  PREDICTED: indole-3-acetic acid-amido synthe...    858   0.0     
ref|XP_008359298.1|  PREDICTED: indole-3-acetic acid-amido synthe...    857   0.0     
ref|XP_008226758.1|  PREDICTED: indole-3-acetic acid-amido synthe...    857   0.0     
ref|XP_011095287.1|  PREDICTED: indole-3-acetic acid-amido synthe...    856   0.0     
ref|XP_006475255.1|  PREDICTED: indole-3-acetic acid-amido synthe...    856   0.0     
ref|XP_007133123.1|  hypothetical protein PHAVU_011G153400g             856   0.0     
ref|XP_009346484.1|  PREDICTED: indole-3-acetic acid-amido synthe...    855   0.0     
ref|XP_011030915.1|  PREDICTED: indole-3-acetic acid-amido synthe...    855   0.0     
gb|AAL47444.1|  AT5g54510/F24B18_13                                     855   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KHG17209.1|  Indole-3-acetic acid-amido synthetase GH3.6 -like...    855   0.0     
ref|XP_009127083.1|  PREDICTED: indole-3-acetic acid-amido synthe...    855   0.0     
ref|XP_011097950.1|  PREDICTED: indole-3-acetic acid-amido synthe...    854   0.0     
emb|CDY62097.1|  BnaCnng39150D                                          854   0.0     
ref|XP_006452114.1|  hypothetical protein CICLE_v10007746mg             854   0.0     
gb|KHG06705.1|  Indole-3-acetic acid-amido synthetase GH3.6 -like...    854   0.0     
emb|CDY67943.1|  BnaAnng25610D                                          854   0.0     
ref|XP_006360114.1|  PREDICTED: indole-3-acetic acid-amido synthe...    853   0.0     
ref|XP_007214798.1|  hypothetical protein PRUPE_ppa002986mg             853   0.0     
ref|XP_004244168.1|  PREDICTED: indole-3-acetic acid-amido synthe...    852   0.0     
gb|KEH19704.1|  indole-3-acetic acid-amido synthetase                   852   0.0     
ref|XP_004510013.1|  PREDICTED: indole-3-acetic acid-amido synthe...    852   0.0     
ref|XP_004243428.1|  PREDICTED: indole-3-acetic acid-amido synthe...    850   0.0     
ref|XP_007149669.1|  hypothetical protein PHAVU_005G089200g             850   0.0     
ref|XP_010448236.1|  PREDICTED: indole-3-acetic acid-amido synthe...    848   0.0     
ref|XP_009137648.1|  PREDICTED: indole-3-acetic acid-amido synthe...    848   0.0     
emb|CDX92823.1|  BnaC07g40810D                                          847   0.0     
emb|CDY46653.1|  BnaA03g48550D                                          846   0.0     
ref|XP_010438643.1|  PREDICTED: indole-3-acetic acid-amido synthe...    846   0.0     
ref|XP_010694299.1|  PREDICTED: indole-3-acetic acid-amido synthe...    846   0.0     
ref|XP_010520883.1|  PREDICTED: indole-3-acetic acid-amido synthe...    845   0.0     
ref|XP_006283319.1|  hypothetical protein CARUB_v10004357mg             845   0.0     
ref|XP_010448162.1|  PREDICTED: indole-3-acetic acid-amido synthe...    843   0.0     
emb|CDY29291.1|  BnaC01g19430D                                          843   0.0     
ref|XP_007132598.1|  hypothetical protein PHAVU_011G108500g             843   0.0     
ref|XP_010539260.1|  PREDICTED: indole-3-acetic acid-amido synthe...    843   0.0     
emb|CDX89263.1|  BnaA01g16300D                                          842   0.0     
ref|XP_006413097.1|  hypothetical protein EUTSA_v10024696mg             842   0.0     
gb|KHN27995.1|  Indole-3-acetic acid-amido synthetase GH3.6             842   0.0     
ref|XP_003540863.1|  PREDICTED: indole-3-acetic acid-amido synthe...    842   0.0     
ref|NP_194456.1|  indole-3-acetic acid-amido synthetase GH3.5           841   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_003543279.1|  PREDICTED: indole-3-acetic acid-amido synthe...    840   0.0     
gb|EYU19184.1|  hypothetical protein MIMGU_mgv1a003042mg                840   0.0     
ref|XP_002869571.1|  GH3.5/WES1                                         839   0.0     
ref|XP_009143243.1|  PREDICTED: indole-3-acetic acid-amido synthe...    837   0.0     
ref|XP_003527474.1|  PREDICTED: indole-3-acetic acid-amido synthe...    838   0.0     
gb|KHN41185.1|  Indole-3-acetic acid-amido synthetase GH3.6             837   0.0     
ref|XP_006363511.1|  PREDICTED: indole-3-acetic acid-amido synthe...    836   0.0     
ref|XP_009137649.1|  PREDICTED: indole-3-acetic acid-amido synthe...    834   0.0     
ref|XP_004251485.1|  PREDICTED: indole-3-acetic acid-amido synthe...    834   0.0     
ref|XP_006851205.1|  hypothetical protein AMTR_s00043p00208540          829   0.0     
ref|XP_003541929.2|  PREDICTED: indole-3-acetic acid-amido synthe...    829   0.0     
ref|XP_004149186.1|  PREDICTED: indole-3-acetic acid-amido synthe...    826   0.0     
ref|XP_010485124.1|  PREDICTED: indole-3-acetic acid-amido synthe...    824   0.0     
ref|XP_008454612.1|  PREDICTED: indole-3-acetic acid-amido synthe...    824   0.0     
gb|KHN06043.1|  Indole-3-acetic acid-amido synthetase GH3.6             824   0.0     
ref|XP_009631635.1|  PREDICTED: indole-3-acetic acid-amido synthe...    822   0.0     
ref|XP_004487633.1|  PREDICTED: indole-3-acetic acid-amido synthe...    822   0.0     
ref|XP_009790943.1|  PREDICTED: indole-3-acetic acid-amido synthe...    818   0.0     
ref|XP_003596546.1|  Indole-3-acetic acid-amido synthetase GH3.6        816   0.0     
gb|KHN25755.1|  Indole-3-acetic acid-amido synthetase GH3.6             815   0.0     
ref|XP_009790940.1|  PREDICTED: indole-3-acetic acid-amido synthe...    813   0.0     
ref|XP_006362917.1|  PREDICTED: indole-3-acetic acid-amido synthe...    810   0.0     
ref|XP_009586735.1|  PREDICTED: indole-3-acetic acid-amido synthe...    810   0.0     
ref|XP_008452341.1|  PREDICTED: indole-3-acetic acid-amido synthe...    809   0.0     
ref|XP_004149936.1|  PREDICTED: indole-3-acetic acid-amido synthe...    806   0.0     
ref|XP_007149929.1|  hypothetical protein PHAVU_005G111000g             808   0.0     
ref|XP_010327157.1|  PREDICTED: indole-3-acetic acid-amido synthe...    806   0.0     
ref|XP_010095194.1|  hypothetical protein L484_008731                   804   0.0     
gb|KEH29592.1|  indole-3-acetic acid-amido synthetase                   803   0.0     
ref|XP_003539512.2|  PREDICTED: indole-3-acetic acid-amido synthe...    800   0.0     
ref|XP_006362911.1|  PREDICTED: indole-3-acetic acid-amido synthe...    798   0.0     
gb|EYU33579.1|  hypothetical protein MIMGU_mgv1a002987mg                794   0.0     
ref|XP_010924006.1|  PREDICTED: probable indole-3-acetic acid-ami...    789   0.0     
ref|XP_010928643.1|  PREDICTED: probable indole-3-acetic acid-ami...    783   0.0     
emb|CBI20465.3|  unnamed protein product                                781   0.0     
ref|XP_008789772.1|  PREDICTED: probable indole-3-acetic acid-ami...    781   0.0     
ref|XP_010443025.1|  PREDICTED: indole-3-acetic acid-amido synthe...    776   0.0     
ref|XP_009408668.1|  PREDICTED: probable indole-3-acetic acid-ami...    778   0.0     
ref|XP_008797411.1|  PREDICTED: probable indole-3-acetic acid-ami...    776   0.0     
gb|EPS63059.1|  hypothetical protein M569_11729                         773   0.0     
gb|KHN22868.1|  Indole-3-acetic acid-amido synthetase GH3.6             768   0.0     
gb|KHN36576.1|  Indole-3-acetic acid-amido synthetase GH3.5             765   0.0     
ref|XP_009402880.1|  PREDICTED: probable indole-3-acetic acid-ami...    766   0.0     
ref|XP_004970208.1|  PREDICTED: probable indole-3-acetic acid-ami...    766   0.0     
ref|XP_006362920.1|  PREDICTED: indole-3-acetic acid-amido synthe...    761   0.0     
gb|KDP32021.1|  hypothetical protein JCGZ_12482                         758   0.0     
ref|NP_001044467.1|  Os01g0785400                                       756   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_008674951.1|  PREDICTED: LOW QUALITY PROTEIN: probable ind...    754   0.0     
ref|XP_009611719.1|  PREDICTED: indole-3-acetic acid-amido synthe...    753   0.0     
ref|XP_002456458.1|  hypothetical protein SORBIDRAFT_03g036680          752   0.0     Sorghum bicolor [broomcorn]
ref|XP_004230721.1|  PREDICTED: probable indole-3-acetic acid-ami...    750   0.0     
emb|CAJ14972.1|  auxin-induced GH3 protein                              750   0.0     Pinus pinaster [cluster pine]
emb|CDM84494.1|  unnamed protein product                                749   0.0     
ref|XP_011088186.1|  PREDICTED: probable indole-3-acetic acid-ami...    748   0.0     
ref|XP_007208307.1|  hypothetical protein PRUPE_ppa003126mg             746   0.0     
ref|XP_011001484.1|  PREDICTED: probable indole-3-acetic acid-ami...    746   0.0     
ref|XP_008238544.1|  PREDICTED: probable indole-3-acetic acid-ami...    746   0.0     
gb|AAD32141.1|AF123503_1  Nt-gh3 deduced protein                        744   0.0     Nicotiana tabacum [American tobacco]
ref|XP_006644816.1|  PREDICTED: LOW QUALITY PROTEIN: probable ind...    745   0.0     
ref|XP_007042570.1|  Auxin-responsive GH3 family protein                743   0.0     
pdb|4B2G|A  Chain A, Crystal Structure Of An Indole-3-acetic Acid...    743   0.0     
ref|XP_002271252.1|  PREDICTED: probable indole-3-acetic acid-ami...    743   0.0     Vitis vinifera
ref|XP_009772040.1|  PREDICTED: probable indole-3-acetic acid-ami...    743   0.0     
ref|XP_006486962.1|  PREDICTED: probable indole-3-acetic acid-ami...    743   0.0     
ref|XP_006346338.1|  PREDICTED: probable indole-3-acetic acid-ami...    742   0.0     
ref|XP_009611720.1|  PREDICTED: indole-3-acetic acid-amido synthe...    743   0.0     
ref|XP_002313887.2|  hypothetical protein POPTR_0009s09590g             745   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_003564364.1|  PREDICTED: probable indole-3-acetic acid-ami...    742   0.0     
ref|XP_004961601.1|  PREDICTED: probable indole-3-acetic acid-ami...    742   0.0     
ref|XP_009598101.1|  PREDICTED: probable indole-3-acetic acid-ami...    741   0.0     
ref|XP_010277152.1|  PREDICTED: probable indole-3-acetic acid-ami...    741   0.0     
ref|XP_011030377.1|  PREDICTED: probable indole-3-acetic acid-ami...    741   0.0     
gb|KDP44447.1|  hypothetical protein JCGZ_16280                         740   0.0     
ref|XP_009611722.1|  PREDICTED: indole-3-acetic acid-amido synthe...    740   0.0     
gb|AAS02074.1|  auxin and ethylene responsive GH3-like protein          739   0.0     Capsicum chinense [bonnet pepper]
ref|XP_006422877.1|  hypothetical protein CICLE_v10028058mg             739   0.0     
ref|XP_002524947.1|  Indole-3-acetic acid-amido synthetase GH3.3,...    738   0.0     Ricinus communis
ref|XP_010271511.1|  PREDICTED: probable indole-3-acetic acid-ami...    736   0.0     
ref|NP_001055967.1|  Os05g0500900                                       738   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|KDO47942.1|  hypothetical protein CISIN_1g007532mg                   736   0.0     
ref|XP_011092528.1|  PREDICTED: probable indole-3-acetic acid-ami...    735   0.0     
ref|XP_004231891.1|  PREDICTED: probable indole-3-acetic acid-ami...    735   0.0     
ref|XP_009757027.1|  PREDICTED: indole-3-acetic acid-amido synthe...    737   0.0     
ref|XP_002300248.2|  auxin-responsive GH3 family protein                734   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_004233446.1|  PREDICTED: probable indole-3-acetic acid-ami...    734   0.0     
ref|XP_010028390.1|  PREDICTED: probable indole-3-acetic acid-ami...    734   0.0     
ref|XP_006339838.1|  PREDICTED: probable indole-3-acetic acid-ami...    734   0.0     
ref|XP_009617606.1|  PREDICTED: probable indole-3-acetic acid-ami...    734   0.0     
gb|ADK27716.1|  GH3                                                     734   0.0     
ref|XP_003539320.1|  PREDICTED: probable indole-3-acetic acid-ami...    734   0.0     
ref|XP_010691643.1|  PREDICTED: probable indole-3-acetic acid-ami...    733   0.0     
ref|XP_011097389.1|  PREDICTED: probable indole-3-acetic acid-ami...    733   0.0     
ref|XP_009782242.1|  PREDICTED: probable indole-3-acetic acid-ami...    733   0.0     
gb|KHG22898.1|  Uncharacterized protein F383_10696                      733   0.0     
ref|XP_006351399.1|  PREDICTED: indole-3-acetic acid-amido synthe...    732   0.0     
ref|XP_004289743.1|  PREDICTED: probable indole-3-acetic acid-ami...    732   0.0     
ref|XP_007047426.1|  Auxin-responsive GH3 family protein                731   0.0     
gb|KHN36267.1|  Putative indole-3-acetic acid-amido synthetase GH3.1    730   0.0     
ref|XP_004490325.1|  PREDICTED: probable indole-3-acetic acid-ami...    731   0.0     
ref|XP_006573649.1|  PREDICTED: probable indole-3-acetic acid-ami...    729   0.0     
ref|XP_011012296.1|  PREDICTED: probable indole-3-acetic acid-ami...    729   0.0     
ref|XP_009350660.1|  PREDICTED: probable indole-3-acetic acid-ami...    729   0.0     
ref|XP_010099059.1|  hypothetical protein L484_011493                   729   0.0     
ref|XP_007157602.1|  hypothetical protein PHAVU_002G083100g             729   0.0     
ref|XP_006380674.1|  hypothetical protein POPTR_0007s10350g             729   0.0     
ref|XP_003518806.1|  PREDICTED: probable indole-3-acetic acid-ami...    729   0.0     
ref|XP_009367779.1|  PREDICTED: probable indole-3-acetic acid-ami...    729   0.0     
ref|XP_002527466.1|  Indole-3-acetic acid-amido synthetase GH3.3,...    729   0.0     Ricinus communis
ref|XP_010679563.1|  PREDICTED: probable indole-3-acetic acid-ami...    727   0.0     
ref|XP_010087275.1|  hypothetical protein L484_009408                   728   0.0     
ref|XP_010547971.1|  PREDICTED: probable indole-3-acetic acid-ami...    728   0.0     
gb|KCW59512.1|  hypothetical protein EUGRSUZ_H02264                     727   0.0     
ref|XP_008236406.1|  PREDICTED: probable indole-3-acetic acid-ami...    728   0.0     
ref|XP_007199763.1|  hypothetical protein PRUPE_ppa003134mg             728   0.0     
gb|EYU37610.1|  hypothetical protein MIMGU_mgv1a003251mg                727   0.0     
ref|XP_010070615.1|  PREDICTED: probable indole-3-acetic acid-ami...    727   0.0     
ref|XP_009622718.1|  PREDICTED: probable indole-3-acetic acid-ami...    727   0.0     
gb|KHG08695.1|  Uncharacterized protein F383_11873                      727   0.0     
ref|XP_004141893.1|  PREDICTED: probable indole-3-acetic acid-ami...    728   0.0     
ref|XP_011099346.1|  PREDICTED: probable indole-3-acetic acid-ami...    727   0.0     
ref|XP_004163839.1|  PREDICTED: probable indole-3-acetic acid-ami...    727   0.0     
ref|XP_006367190.1|  PREDICTED: probable indole-3-acetic acid-ami...    727   0.0     
ref|XP_008373075.1|  PREDICTED: probable indole-3-acetic acid-ami...    727   0.0     
ref|XP_008365651.1|  PREDICTED: probable indole-3-acetic acid-ami...    726   0.0     
ref|XP_010939642.1|  PREDICTED: probable indole-3-acetic acid-ami...    725   0.0     
ref|XP_009339499.1|  PREDICTED: probable indole-3-acetic acid-ami...    724   0.0     
ref|XP_002283886.1|  PREDICTED: probable indole-3-acetic acid-ami...    724   0.0     Vitis vinifera
ref|XP_008440335.1|  PREDICTED: probable indole-3-acetic acid-ami...    724   0.0     
emb|CAN70815.1|  hypothetical protein VITISV_042944                     724   0.0     Vitis vinifera
ref|XP_009760129.1|  PREDICTED: probable indole-3-acetic acid-ami...    724   0.0     
ref|XP_002973755.1|  hypothetical protein SELMODRAFT_99818              723   0.0     
ref|XP_008465614.1|  PREDICTED: probable indole-3-acetic acid-ami...    723   0.0     
ref|XP_004287982.1|  PREDICTED: probable indole-3-acetic acid-ami...    722   0.0     
ref|XP_002441339.1|  hypothetical protein SORBIDRAFT_09g024710          724   0.0     Sorghum bicolor [broomcorn]
ref|XP_002975803.1|  hypothetical protein SELMODRAFT_103740             722   0.0     
gb|KEH17188.1|  indole-3-acetic acid-amido synthetase                   721   0.0     
ref|XP_010028148.1|  PREDICTED: probable indole-3-acetic acid-ami...    721   0.0     
ref|XP_003611653.1|  Indole-3-acetic acid-amido synthetase GH3.3        721   0.0     
gb|AFW82417.1|  hypothetical protein ZEAMMB73_006681                    722   0.0     
ref|XP_009411073.1|  PREDICTED: probable indole-3-acetic acid-ami...    721   0.0     
ref|XP_004157348.1|  PREDICTED: LOW QUALITY PROTEIN: probable ind...    720   0.0     
ref|XP_004140723.1|  PREDICTED: probable indole-3-acetic acid-ami...    720   0.0     
gb|KHN29920.1|  Putative indole-3-acetic acid-amido synthetase GH3.1    718   0.0     
gb|ADK27717.1|  GH3                                                     719   0.0     
ref|NP_001146696.1|  uncharacterized protein LOC100280297               719   0.0     Zea mays [maize]
ref|XP_004141994.1|  PREDICTED: probable indole-3-acetic acid-ami...    717   0.0     
gb|AFC36444.1|  GH3-1                                                   717   0.0     
ref|XP_007156752.1|  hypothetical protein PHAVU_002G014400g             716   0.0     
ref|XP_003566071.1|  PREDICTED: probable indole-3-acetic acid-ami...    717   0.0     
ref|XP_009395628.1|  PREDICTED: probable indole-3-acetic acid-ami...    717   0.0     
emb|CAA42636.1|  auxin-responsive GH3 product                           716   0.0     Glycine max [soybeans]
ref|XP_008338396.1|  PREDICTED: probable indole-3-acetic acid-ami...    715   0.0     
ref|XP_009399301.1|  PREDICTED: probable indole-3-acetic acid-ami...    714   0.0     
ref|XP_009394335.1|  PREDICTED: probable indole-3-acetic acid-ami...    715   0.0     
ref|XP_010548443.1|  PREDICTED: indole-3-acetic acid-amido synthe...    713   0.0     
ref|XP_003524670.1|  PREDICTED: probable indole-3-acetic acid-ami...    713   0.0     
ref|XP_009372462.1|  PREDICTED: probable indole-3-acetic acid-ami...    713   0.0     
ref|XP_007155870.1|  hypothetical protein PHAVU_003G238700g             713   0.0     
ref|XP_009123229.1|  PREDICTED: probable indole-3-acetic acid-ami...    712   0.0     
ref|XP_003550026.1|  PREDICTED: probable indole-3-acetic acid-ami...    712   0.0     
ref|XP_004983963.1|  PREDICTED: probable indole-3-acetic acid-ami...    712   0.0     
ref|XP_006426015.1|  hypothetical protein CICLE_v10025211mg             711   0.0     
gb|KDO79042.1|  hypothetical protein CISIN_1g007558mg                   711   0.0     
ref|XP_009397263.1|  PREDICTED: probable indole-3-acetic acid-ami...    711   0.0     
gb|AEL22119.1|  GH31                                                    711   0.0     
emb|CDY54470.1|  BnaA09g52740D                                          710   0.0     
gb|KHN27054.1|  Indole-3-acetic acid-amido synthetase GH3.3             710   0.0     
ref|XP_009394764.1|  PREDICTED: probable indole-3-acetic acid-ami...    710   0.0     
emb|CDY52419.1|  BnaCnng22400D                                          708   0.0     
ref|XP_006466527.1|  PREDICTED: probable indole-3-acetic acid-ami...    708   0.0     
ref|XP_006362966.1|  PREDICTED: indole-3-acetic acid-amido synthe...    707   0.0     
ref|XP_008440334.1|  PREDICTED: probable indole-3-acetic acid-ami...    707   0.0     
ref|XP_008779774.1|  PREDICTED: probable indole-3-acetic acid-ami...    707   0.0     
ref|XP_010936557.1|  PREDICTED: probable indole-3-acetic acid-ami...    707   0.0     
gb|KFK39993.1|  hypothetical protein AALP_AA3G316200                    706   0.0     
emb|CDX69296.1|  BnaC01g01570D                                          706   0.0     
ref|XP_002885948.1|  GH3.1                                              704   0.0     
ref|NP_179101.1|  putative indole-3-acetic acid-amido synthetase ...    704   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009123833.1|  PREDICTED: indole-3-acetic acid-amido synthe...    704   0.0     
gb|EYU34549.1|  hypothetical protein MIMGU_mgv1a023361mg                704   0.0     
tpg|DAA45873.1|  TPA: hypothetical protein ZEAMMB73_156027              705   0.0     
gb|EPS59124.1|  nt-gh3 deduced protein                                  703   0.0     
ref|XP_006829263.1|  hypothetical protein AMTR_s00001p00272720          703   0.0     
ref|XP_006299420.1|  hypothetical protein CARUB_v10015580mg             703   0.0     
gb|AFC36443.1|  GH3-1                                                   702   0.0     
ref|XP_010517936.1|  PREDICTED: probable indole-3-acetic acid-ami...    701   0.0     
ref|XP_006411897.1|  hypothetical protein EUTSA_v10024716mg             700   0.0     
ref|XP_010467277.1|  PREDICTED: probable indole-3-acetic acid-ami...    699   0.0     
ref|NP_001169263.1|  hypothetical protein                               700   0.0     Zea mays [maize]
ref|XP_010446666.1|  PREDICTED: indole-3-acetic acid-amido synthe...    700   0.0     
ref|NP_001060163.1|  Os07g0592600                                       700   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010488935.1|  PREDICTED: probable indole-3-acetic acid-ami...    698   0.0     
ref|XP_006409612.1|  hypothetical protein EUTSA_v10023027mg             697   0.0     
ref|XP_003569888.1|  PREDICTED: probable indole-3-acetic acid-ami...    698   0.0     
ref|XP_010432064.1|  PREDICTED: indole-3-acetic acid-amido synthe...    697   0.0     
ref|XP_002456397.1|  hypothetical protein SORBIDRAFT_03g035500          698   0.0     Sorghum bicolor [broomcorn]
ref|XP_006283369.1|  hypothetical protein CARUB_v10004412mg             697   0.0     
ref|XP_009388916.1|  PREDICTED: probable indole-3-acetic acid-ami...    696   0.0     
ref|XP_006646355.1|  PREDICTED: probable indole-3-acetic acid-ami...    696   0.0     
gb|ADN93114.1|  indole-3-acetic acid-amido synthetase                   696   0.0     
emb|CDM84342.1|  unnamed protein product                                696   0.0     
ref|NP_001044345.1|  Os01g0764800                                       695   0.0     
ref|XP_002868993.1|  hypothetical protein ARALYDRAFT_490882             694   0.0     
ref|XP_006404785.1|  hypothetical protein EUTSA_v10000101mg             694   0.0     
ref|XP_004970078.1|  PREDICTED: probable indole-3-acetic acid-ami...    694   0.0     
gb|KFK30362.1|  hypothetical protein AALP_AA7G251400                    692   0.0     
ref|XP_006657906.1|  PREDICTED: probable indole-3-acetic acid-ami...    692   0.0     
ref|XP_002467673.1|  hypothetical protein SORBIDRAFT_01g032020          692   0.0     
emb|CDY46090.1|  BnaA09g42140D                                          691   0.0     
ref|XP_010429260.1|  PREDICTED: indole-3-acetic acid-amido synthe...    691   0.0     
ref|XP_006293849.1|  hypothetical protein CARUB_v10022833mg             692   0.0     
tpg|DAA57327.1|  TPA: hypothetical protein ZEAMMB73_719431              692   0.0     
ref|XP_009117296.1|  PREDICTED: indole-3-acetic acid-amido synthe...    690   0.0     
ref|NP_195455.1|  indole-3-acetic acid-amido synthetase GH3.2           690   0.0     
ref|XP_004958192.1|  PREDICTED: probable indole-3-acetic acid-ami...    689   0.0     
ref|XP_002463118.1|  hypothetical protein SORBIDRAFT_02g038170          689   0.0     
ref|XP_003636674.1|  Indole-3-acetic acid-amido synthetase GH3.6        684   0.0     
ref|XP_010417072.1|  PREDICTED: indole-3-acetic acid-amido synthe...    687   0.0     
gb|ACN27604.1|  unknown                                                 686   0.0     
ref|NP_001151752.1|  indole-3-acetic acid-amido synthetase GH3.8        686   0.0     
gb|ACI46148.1|  indole-3-acetic acid amido synthetase                   685   0.0     
ref|XP_010437234.1|  PREDICTED: indole-3-acetic acid-amido synthe...    684   0.0     
ref|XP_002886679.1|  GH3.4                                              683   0.0     
dbj|BAJ99350.1|  predicted protein                                      685   0.0     
ref|NP_179898.1|  indole-3-acetic acid-amido synthetase GH3.3           682   0.0     
ref|XP_010472316.1|  PREDICTED: indole-3-acetic acid-amido synthe...    681   0.0     
ref|XP_006486960.1|  PREDICTED: probable indole-3-acetic acid-ami...    680   0.0     
ref|NP_001146837.1|  indole-3-acetic acid amido synthetase              681   0.0     
gb|KDO47931.1|  hypothetical protein CISIN_1g007728mg                   679   0.0     
tpg|DAA41299.1|  TPA: indole-3-acetic acid amido synthetase             680   0.0     
ref|XP_002880486.1|  GH3.3                                              679   0.0     
gb|KFK32769.1|  hypothetical protein AALP_AA6G286300                    678   0.0     
dbj|BAG68923.1|  IAA-amido synthetase                                   676   0.0     
gb|EMT18426.1|  hypothetical protein F775_07058                         676   0.0     
ref|XP_003562778.1|  PREDICTED: probable indole-3-acetic acid-ami...    676   0.0     
emb|CDX76870.1|  BnaC08g34560D                                          673   0.0     
gb|AEM36357.1|  At1g59500                                               673   0.0     
dbj|BAJ95141.1|  predicted protein                                      672   0.0     
ref|XP_002268278.2|  PREDICTED: indole-3-acetic acid-amido synthe...    669   0.0     
ref|NP_176159.1|  indole-3-acetic acid-amido synthetase GH3.4           667   0.0     
ref|XP_010433389.1|  PREDICTED: indole-3-acetic acid-amido synthe...    660   0.0     
ref|XP_003611652.1|  Indole-3-acetic acid-amido synthetase GH3.3        668   0.0     
ref|XP_002512687.1|  Indole-3-acetic acid-amido synthetase GH3.17...    652   0.0     
ref|XP_008222270.1|  PREDICTED: indole-3-acetic acid-amido synthe...    649   0.0     
ref|XP_008454158.1|  PREDICTED: indole-3-acetic acid-amido synthe...    649   0.0     
ref|XP_006844646.1|  hypothetical protein AMTR_s00016p00234260          648   0.0     
ref|XP_007222041.1|  hypothetical protein PRUPE_ppa003065mg             648   0.0     
ref|XP_010066475.1|  PREDICTED: indole-3-acetic acid-amido synthe...    648   0.0     
ref|XP_002299361.1|  auxin-responsive GH3 family protein                647   0.0     
ref|XP_011036210.1|  PREDICTED: indole-3-acetic acid-amido synthe...    646   0.0     
ref|XP_004152165.1|  PREDICTED: indole-3-acetic acid-amido synthe...    645   0.0     
ref|XP_007043752.1|  Auxin-responsive GH3 family protein                647   0.0     
emb|CAN78161.1|  hypothetical protein VITISV_040921                     647   0.0     
gb|KDO46538.1|  hypothetical protein CISIN_1g007149mg                   641   0.0     
ref|XP_006494790.1|  PREDICTED: indole-3-acetic acid-amido synthe...    641   0.0     
ref|XP_002303740.2|  auxin-responsive GH3 family protein                638   0.0     
gb|AFG33002.1|  GH3 family protein                                      636   0.0     
ref|XP_008390224.1|  PREDICTED: indole-3-acetic acid-amido synthe...    636   0.0     
ref|XP_008355612.1|  PREDICTED: indole-3-acetic acid-amido synthe...    635   0.0     
ref|XP_010249302.1|  PREDICTED: indole-3-acetic acid-amido synthe...    633   0.0     
ref|XP_009353499.1|  PREDICTED: indole-3-acetic acid-amido synthe...    633   0.0     
ref|XP_009380137.1|  PREDICTED: indole-3-acetic acid-amido synthe...    632   0.0     
ref|XP_011020911.1|  PREDICTED: indole-3-acetic acid-amido synthe...    632   0.0     
ref|NP_174134.1|  indole-3-acetic acid-amido synthetase GH3.17          631   0.0     
gb|ACF88044.1|  unknown                                                 627   0.0     
ref|XP_008448232.1|  PREDICTED: indole-3-acetic acid-amido synthe...    630   0.0     
ref|XP_009359857.1|  PREDICTED: indole-3-acetic acid-amido synthe...    630   0.0     
ref|XP_006432395.1|  hypothetical protein CICLE_v10000544mg             631   0.0     
ref|XP_008797151.1|  PREDICTED: indole-3-acetic acid-amido synthe...    629   0.0     
ref|XP_004170795.1|  PREDICTED: LOW QUALITY PROTEIN: indole-3-ace...    629   0.0     
gb|ACL52529.1|  unknown                                                 626   0.0     
emb|CDP02556.1|  unnamed protein product                                624   0.0     
ref|XP_002890761.1|  GH3.17                                             627   0.0     
ref|XP_010538163.1|  PREDICTED: indole-3-acetic acid-amido synthe...    627   0.0     
ref|XP_004140044.1|  PREDICTED: indole-3-acetic acid-amido synthe...    626   0.0     
gb|KFK44683.1|  hypothetical protein AALP_AA1G290100                    625   0.0     
ref|XP_006303207.1|  hypothetical protein CARUB_v10011293mg             625   0.0     
ref|XP_010540435.1|  PREDICTED: indole-3-acetic acid-amido synthe...    625   0.0     
ref|XP_006415692.1|  hypothetical protein EUTSA_v10007112mg             624   0.0     
ref|XP_008386644.1|  PREDICTED: putative indole-3-acetic acid-ami...    624   0.0     
ref|XP_010250483.1|  PREDICTED: indole-3-acetic acid-amido synthe...    625   0.0     
emb|CDY15692.1|  BnaA07g08630D                                          623   0.0     
ref|XP_004290773.1|  PREDICTED: putative indole-3-acetic acid-ami...    623   0.0     
ref|XP_010478176.1|  PREDICTED: indole-3-acetic acid-amido synthe...    622   0.0     
ref|XP_010445414.1|  PREDICTED: indole-3-acetic acid-amido synthe...    621   0.0     
ref|XP_009102930.1|  PREDICTED: indole-3-acetic acid-amido synthe...    621   0.0     
ref|XP_010929717.1|  PREDICTED: indole-3-acetic acid-amido synthe...    621   0.0     
ref|XP_010460587.1|  PREDICTED: indole-3-acetic acid-amido synthe...    621   0.0     
ref|XP_006840504.1|  hypothetical protein AMTR_s00045p00199760          620   0.0     
ref|XP_006286048.1|  hypothetical protein CARUB_v10007580mg             620   0.0     
ref|XP_009113698.1|  PREDICTED: indole-3-acetic acid-amido synthe...    618   0.0     
ref|XP_002449599.1|  hypothetical protein SORBIDRAFT_05g019810          620   0.0     
ref|XP_008789923.1|  PREDICTED: probable indole-3-acetic acid-ami...    617   0.0     
ref|XP_010499312.1|  PREDICTED: indole-3-acetic acid-amido synthe...    617   0.0     
emb|CDY63330.1|  BnaCnng41900D                                          617   0.0     
ref|XP_010436584.1|  PREDICTED: indole-3-acetic acid-amido synthe...    616   0.0     
ref|XP_008368983.1|  PREDICTED: putative indole-3-acetic acid-ami...    614   0.0     
ref|XP_009342127.1|  PREDICTED: putative indole-3-acetic acid-ami...    612   0.0     
ref|XP_010112000.1|  hypothetical protein L484_004686                   612   0.0     
ref|XP_004980151.1|  PREDICTED: probable indole-3-acetic acid-ami...    612   0.0     
ref|XP_002263353.1|  PREDICTED: putative indole-3-acetic acid-ami...    611   0.0     
ref|XP_010540432.1|  PREDICTED: indole-3-acetic acid-amido synthe...    612   0.0     
ref|XP_010269496.1|  PREDICTED: putative indole-3-acetic acid-ami...    611   0.0     
ref|XP_002531876.1|  Indole-3-acetic acid-amido synthetase GH3.17...    610   0.0     
ref|XP_007199764.1|  hypothetical protein PRUPE_ppa003141mg             609   0.0     
gb|EYU42175.1|  hypothetical protein MIMGU_mgv1a003400mg                608   0.0     
gb|EAZ40405.1|  hypothetical protein OsJ_24856                          608   0.0     
ref|XP_010938422.1|  PREDICTED: probable indole-3-acetic acid-ami...    607   0.0     
ref|XP_008235040.1|  PREDICTED: putative indole-3-acetic acid-ami...    607   0.0     
ref|XP_010269495.1|  PREDICTED: putative indole-3-acetic acid-ami...    607   0.0     
emb|CDP03514.1|  unnamed protein product                                607   0.0     
sp|Q9SZT9.3|GH32_ARATH  RecName: Full=Indole-3-acetic acid-amido ...    604   0.0     
ref|XP_004496050.1|  PREDICTED: putative indole-3-acetic acid-ami...    605   0.0     
gb|AAL25575.1|  AT4g37390/F6G17_40                                      602   0.0     
ref|XP_004980566.1|  PREDICTED: indole-3-acetic acid-amido synthe...    607   0.0     
emb|CDY22728.1|  BnaA08g05580D                                          603   0.0     
ref|XP_002302704.1|  auxin-responsive GH3 family protein                602   0.0     
ref|XP_010545027.1|  PREDICTED: putative indole-3-acetic acid-ami...    602   0.0     
ref|XP_007143845.1|  hypothetical protein PHAVU_007G106600g             602   0.0     
gb|KEH43223.1|  indole-3-acetic acid-amido synthetase                   602   0.0     
ref|XP_003576014.2|  PREDICTED: probable indole-3-acetic acid-ami...    602   0.0     
ref|XP_009122951.1|  PREDICTED: indole-3-acetic acid-amido synthe...    601   0.0     
gb|EAY81150.1|  hypothetical protein OsI_36332                          601   0.0     
ref|XP_011009307.1|  PREDICTED: putative indole-3-acetic acid-ami...    598   0.0     
ref|XP_007050866.1|  Indole-3-acetic acid-amido synthetase GH3.9,...    598   0.0     
ref|XP_010090808.1|  hypothetical protein L484_009086                   598   0.0     
ref|XP_003536201.1|  PREDICTED: putative indole-3-acetic acid-ami...    597   0.0     
tpg|DAA42049.1|  TPA: hypothetical protein ZEAMMB73_501171              599   0.0     
emb|CDP17267.1|  unnamed protein product                                597   0.0     
gb|KHG01600.1|  Uncharacterized protein F383_23170                      597   0.0     
gb|EYU46693.1|  hypothetical protein MIMGU_mgv1a003107mg                597   0.0     
ref|XP_003559815.1|  PREDICTED: probable indole-3-acetic acid-ami...    596   0.0     
ref|XP_008670756.1|  PREDICTED: probable indole-3-acetic acid-ami...    599   0.0     
ref|XP_003518956.1|  PREDICTED: putative indole-3-acetic acid-ami...    596   0.0     
ref|XP_004958633.1|  PREDICTED: probable indole-3-acetic acid-ami...    595   0.0     
ref|XP_006444284.1|  hypothetical protein CICLE_v10019393mg             595   0.0     
ref|XP_011079705.1|  PREDICTED: putative indole-3-acetic acid-ami...    595   0.0     
ref|XP_004138974.1|  PREDICTED: indole-3-acetic acid-amido synthe...    594   0.0     
ref|XP_008361439.1|  PREDICTED: uncharacterized protein LOC103425146    616   0.0     
ref|XP_008441807.1|  PREDICTED: indole-3-acetic acid-amido synthe...    593   0.0     
ref|XP_003550991.1|  PREDICTED: indole-3-acetic acid-amido synthe...    588   0.0     
ref|XP_009604191.1|  PREDICTED: putative indole-3-acetic acid-ami...    592   0.0     
ref|XP_010936558.1|  PREDICTED: probable indole-3-acetic acid-ami...    587   0.0     
ref|XP_010467278.1|  PREDICTED: probable indole-3-acetic acid-ami...    586   0.0     
sp|P0C0M3.1|GH311_ORYSJ  RecName: Full=Probable indole-3-acetic a...    590   0.0     
gb|EMT24142.1|  hypothetical protein F775_11820                         588   0.0     
ref|XP_004977474.1|  PREDICTED: probable indole-3-acetic acid-ami...    587   0.0     
gb|EEC82663.1|  hypothetical protein OsI_27288                          587   0.0     
gb|EMS61902.1|  hypothetical protein TRIUR3_17511                       586   0.0     
gb|KFK25570.1|  hypothetical protein AALP_AA8G132100                    584   0.0     
ref|XP_008781030.1|  PREDICTED: probable indole-3-acetic acid-ami...    582   0.0     
ref|XP_006658096.1|  PREDICTED: probable indole-3-acetic acid-ami...    583   0.0     
emb|CDY53016.1|  BnaC04g00140D                                          582   0.0     
gb|EEC82318.1|  hypothetical protein OsI_26596                          583   0.0     
ref|XP_002882130.1|  auxin-responsive GH3 family protein                581   0.0     
ref|XP_008653453.1|  PREDICTED: probable indole-3-acetic acid-ami...    579   0.0     
emb|CDX80131.1|  BnaA05g00250D                                          579   0.0     
ref|XP_006397970.1|  hypothetical protein EUTSA_v10001368mg             578   0.0     
ref|XP_008360909.1|  PREDICTED: probable indole-3-acetic acid-ami...    578   0.0     
ref|XP_009775768.1|  PREDICTED: putative indole-3-acetic acid-ami...    578   0.0     
ref|XP_009142505.1|  PREDICTED: putative indole-3-acetic acid-ami...    577   0.0     
ref|XP_010684416.1|  PREDICTED: putative indole-3-acetic acid-ami...    576   0.0     
ref|XP_002442697.1|  hypothetical protein SORBIDRAFT_08g001330          576   0.0     
ref|NP_196840.1|  auxin-responsive GH3 family protein                   573   0.0     
ref|XP_009125904.1|  PREDICTED: indole-3-acetic acid-amido synthe...    572   0.0     
ref|XP_006399828.1|  hypothetical protein EUTSA_v10013038mg             572   0.0     
ref|XP_010497199.1|  PREDICTED: indole-3-acetic acid-amido synthe...    567   0.0     
emb|CDP20889.1|  unnamed protein product                                570   0.0     
ref|XP_010038195.1|  PREDICTED: putative indole-3-acetic acid-ami...    571   0.0     
ref|XP_006293888.1|  hypothetical protein CARUB_v10022875mg             570   0.0     
ref|NP_001190301.1|  auxin-responsive GH3 family protein                573   0.0     
emb|CDY67949.1|  BnaAnng25660D                                          571   0.0     
emb|CDX91130.1|  BnaC02g04670D                                          569   0.0     
ref|NP_182296.1|  putative indole-3-acetic acid-amido synthetase ...    566   0.0     
ref|XP_002871564.1|  auxin-responsive GH3 family protein                565   0.0     
ref|XP_009131333.1|  PREDICTED: indole-3-acetic acid-amido synthe...    564   0.0     
ref|NP_196841.2|  auxin-responsive GH3 family protein                   564   0.0     
gb|KHN27056.1|  Indole-3-acetic acid-amido synthetase GH3.2             559   0.0     
gb|KFK25569.1|  hypothetical protein AALP_AA8G132000                    563   0.0     
emb|CDX78518.1|  BnaA03g04300D                                          563   0.0     
ref|XP_006399829.1|  hypothetical protein EUTSA_v10013044mg             561   0.0     
tpg|DAA45874.1|  TPA: hypothetical protein ZEAMMB73_156027              557   0.0     
ref|XP_010492083.1|  PREDICTED: indole-3-acetic acid-amido synthe...    560   0.0     
ref|XP_009110116.1|  PREDICTED: 4-substituted benzoates-glutamate...    557   0.0     
emb|CBI33740.3|  unnamed protein product                                553   0.0     
ref|XP_006658099.1|  PREDICTED: probable indole-3-acetic acid-ami...    555   0.0     
ref|XP_010556088.1|  PREDICTED: 4-substituted benzoates-glutamate...    556   0.0     
ref|XP_002871563.1|  auxin-responsive GH3 family protein                556   0.0     
ref|XP_010556087.1|  PREDICTED: 4-substituted benzoates-glutamate...    556   0.0     
ref|XP_008653454.1|  PREDICTED: probable indole-3-acetic acid-ami...    553   0.0     
ref|XP_009121771.1|  PREDICTED: 4-substituted benzoates-glutamate...    552   0.0     
emb|CDX69648.1|  BnaA10g19970D                                          552   0.0     
ref|NP_173729.1|  auxin-responsive GH3 family protein                   551   0.0     
emb|CDX91132.1|  BnaC02g04650D                                          550   0.0     
ref|NP_196839.1|  auxin-responsive GH3 family protein                   551   0.0     
ref|XP_010419911.1|  PREDICTED: indole-3-acetic acid-amido synthe...    551   0.0     
emb|CAB87144.1|  auxin reponsive-like protein                           550   0.0     
tpg|DAA63422.1|  TPA: hypothetical protein ZEAMMB73_662398              545   0.0     
emb|CDX69645.1|  BnaA10g19940D                                          550   0.0     
ref|XP_010521407.1|  PREDICTED: indole-3-acetic acid-amido synthe...    550   0.0     
emb|CDY09786.1|  BnaC09g43750D                                          548   0.0     
ref|XP_010519098.1|  PREDICTED: indole-3-acetic acid-amido synthe...    548   0.0     
ref|XP_007043750.1|  Indole-3-acetic acid-amido synthetase GH3.17       548   0.0     
ref|XP_007021990.1|  Indole-3-acetic acid-amido synthetase GH3.17       551   0.0     
ref|NP_196842.2|  auxin-responsive GH3 family protein                   548   0.0     
ref|XP_009125902.1|  PREDICTED: 4-substituted benzoates-glutamate...    546   0.0     
ref|XP_007021514.1|  Indole-3-acetic acid-amido synthetase GH3.17       547   0.0     
ref|XP_006290085.1|  hypothetical protein CARUB_v10003724mg             548   0.0     
emb|CDX85657.1|  BnaA02g01560D                                          546   0.0     
ref|XP_007021517.1|  Indole-3-acetic acid-amido synthetase GH3.17       546   0.0     
ref|XP_010419913.1|  PREDICTED: indole-3-acetic acid-amido synthe...    546   0.0     
ref|XP_006289050.1|  hypothetical protein CARUB_v10002450mg             545   0.0     
ref|XP_009121768.1|  PREDICTED: indole-3-acetic acid-amido synthe...    545   0.0     
tpg|DAA41298.1|  TPA: indole-3-acetic acid amido synthetase             540   0.0     
ref|XP_010507858.1|  PREDICTED: putative indole-3-acetic acid-ami...    544   0.0     
emb|CAB87145.1|  auxin reponsive-like protein                           543   0.0     
gb|KFK35356.1|  hypothetical protein AALP_AA5G274100                    543   0.0     
ref|XP_010453409.1|  PREDICTED: indole-3-acetic acid-amido synthe...    543   0.0     
ref|XP_010556077.1|  PREDICTED: indole-3-acetic acid-amido synthe...    542   0.0     



>ref|XP_009779551.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Nicotiana 
sylvestris]
Length=603

 Score =   913 bits (2360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/601 (72%), Positives = 511/601 (85%), Gaps = 5/601 (1%)
 Frame = -1

Query  2076  MTDALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNG  1897
             M +A  + SD+ + +E+N ++LQF E++TTNA +VQ++VL  ILS NAGVEYL RHGLNG
Sbjct  1     MPEAPSALSDDGSFDENNKKLLQFFENITTNADEVQKKVLNEILSRNAGVEYLQRHGLNG  60

Query  1896  STDRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTT  1717
              TD ETFKK++PVVTYED+KPDI+R+A+G+ SSI+CS PISEF TSSGTS GE KL+PT 
Sbjct  61    KTDYETFKKIMPVVTYEDLKPDIDRIADGDRSSILCSQPISEFLTSSGTSGGERKLMPTV  120

Query  1716  EEELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSY  1537
             EEEL R+SL  SLLMPV++QFVPDLHKGK MYFLF++ EAKTPGGLLARPVLTS  K SY
Sbjct  121   EEELGRRSLLYSLLMPVMDQFVPDLHKGKGMYFLFIKSEAKTPGGLLARPVLTSYYKSSY  180

Query  1536  FKKRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHF  1357
             FKKR Y +PYT+ TSP ETILC DS+QSMYSQ+LCGL    QVLRVG +FAS FIRAI F
Sbjct  181   FKKRPY-DPYTNYTSPNETILCLDSYQSMYSQILCGLCQNTQVLRVGAVFASGFIRAIRF  239

Query  1356  LEKHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRI  1177
             LEKHW +LC+DI+TG+LNP+ITDP VREAV +I+KPNP LAEFIE EC+KESWKGIIPR+
Sbjct  240   LEKHWPILCNDIKTGSLNPQITDPEVREAVLKILKPNPKLAEFIETECSKESWKGIIPRL  299

Query  1176  WRNTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTI  997
             W NTKY+DV+VTG MSQYIPTLNY+GN LPLV T Y SSEC F INLNPL KP+EVAYT+
Sbjct  300   WPNTKYVDVIVTGTMSQYIPTLNYYGNHLPLVCTMYASSECYFGINLNPLCKPSEVAYTL  359

Query  996   IPTMAYFEFLPVSREIGVPEP----NPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDI  829
             IPTM YFEFLP +RE   PE     +  +++DLVDV+LG EYE+VVTTYAGLYRYRVGDI
Sbjct  360   IPTMGYFEFLPTAREDEGPEKASTYDKNDLVDLVDVELGHEYELVVTTYAGLYRYRVGDI  419

Query  828   LRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHA  649
             L+VAGFKN  PQF+FVCRKNVALSID+DKTDEVELH+AV  AS  LLPF+ASLIEYTS A
Sbjct  420   LKVAGFKNKAPQFHFVCRKNVALSIDSDKTDEVELHDAVVKASIHLLPFEASLIEYTSFA  479

Query  648   NTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRI  469
             +TS IPGHYVLYWE+ +SSE  IP  +F+DCC  +EESLNSVYR+CRVSDKSIGPLEI++
Sbjct  480   DTSAIPGHYVLYWELNKSSETIIPTTVFQDCCLTIEESLNSVYRQCRVSDKSIGPLEIKV  539

Query  468   VENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             VENGTFDK+MDYAI++G+SI+QYK PRCV  API+ELL+SRV+SNYFSP  P+W PGHK 
Sbjct  540   VENGTFDKLMDYAISNGASINQYKAPRCVKYAPIIELLNSRVISNYFSPTCPKWVPGHKQ  599

Query  288   W  286
             W
Sbjct  600   W  600



>ref|XP_009621450.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Nicotiana 
tomentosiformis]
Length=603

 Score =   912 bits (2358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/601 (72%), Positives = 511/601 (85%), Gaps = 5/601 (1%)
 Frame = -1

Query  2076  MTDALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNG  1897
             M +A  + SD+ + +E+N ++LQF E++TTNA +VQ++VL  ILS NAGVEYL RHGLNG
Sbjct  1     MPEAPSALSDDSSFDENNKKLLQFFENITTNADEVQKKVLNEILSRNAGVEYLQRHGLNG  60

Query  1896  STDRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTT  1717
              TD ETFKK++P+VTYED+KPDI+R+A+G+ SSI+CS PISEF TSSGTS GE KL+PT 
Sbjct  61    KTDYETFKKIMPLVTYEDLKPDIDRIADGDRSSILCSQPISEFLTSSGTSGGERKLMPTV  120

Query  1716  EEELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSY  1537
             EEEL R+SL  SLLMPV++QFVPDLHKGK MYFLF++ EAKTPGGLLARPVLTS  K SY
Sbjct  121   EEELGRRSLLYSLLMPVMDQFVPDLHKGKGMYFLFIKSEAKTPGGLLARPVLTSYYKSSY  180

Query  1536  FKKRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHF  1357
             FKKR Y +PYT+ TSP ETILC DS+QSMYSQ+LCGL    QVLRVG +FAS FIRAI F
Sbjct  181   FKKRPY-DPYTNYTSPNETILCLDSYQSMYSQILCGLCQNTQVLRVGAVFASGFIRAIRF  239

Query  1356  LEKHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRI  1177
             LEKHW +LC+DI+TG+LNP+ITDP VREAV +I+KPNP LAEFIE EC KESWKGIIPR+
Sbjct  240   LEKHWPILCNDIKTGSLNPQITDPEVREAVMKILKPNPKLAEFIETECCKESWKGIIPRL  299

Query  1176  WRNTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTI  997
             W NTKY+DV+VTG MSQYIPTLNY+GNDLPLV T Y SSEC F INLNPL KP+EVAYT+
Sbjct  300   WPNTKYVDVIVTGTMSQYIPTLNYYGNDLPLVCTMYASSECYFGINLNPLCKPSEVAYTL  359

Query  996   IPTMAYFEFLPVSREI-GVPEPNPVE---VLDLVDVKLGQEYEVVVTTYAGLYRYRVGDI  829
             IPTM YFEFLPV+RE  G  + N  +   ++DLVDV+LG EYE+VVTTYAGLYRYRVGDI
Sbjct  360   IPTMGYFEFLPVAREDEGAEKANTYDKNDLVDLVDVELGHEYELVVTTYAGLYRYRVGDI  419

Query  828   LRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHA  649
             L+VAGFKN  PQF+FVCRKNVALSID+DKTDEVELH+AV  AS  LLPF+ASL EYTS +
Sbjct  420   LKVAGFKNKAPQFHFVCRKNVALSIDSDKTDEVELHDAVVKASIHLLPFEASLTEYTSFS  479

Query  648   NTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRI  469
             +TS IPGHYVLYWEI +SSE  IP  +F+DCC  +EESLNSVYR+CRVSDKSIGPLEI++
Sbjct  480   DTSAIPGHYVLYWEINKSSETIIPTTVFQDCCLTIEESLNSVYRQCRVSDKSIGPLEIKV  539

Query  468   VENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             VENGTFDK+MDYAI++G+SI+QYK PRCV  API+ELL+SRV++NYFSPK P W PGHK 
Sbjct  540   VENGTFDKLMDYAISNGASINQYKAPRCVKYAPIIELLNSRVIANYFSPKCPNWVPGHKQ  599

Query  288   W  286
             W
Sbjct  600   W  600



>ref|XP_006360545.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Solanum 
tuberosum]
Length=606

 Score =   885 bits (2286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/599 (71%), Positives = 500/599 (83%), Gaps = 10/599 (2%)
 Frame = -1

Query  2055  SSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGL---NGSTDR  1885
             S D+ N +E+N ++LQF ED+T+NA  VQ+ VL  ILS N+GVEYL RHGL   + + D 
Sbjct  6     SIDDGNFDENNKKLLQFFEDITSNANDVQKNVLNEILSRNSGVEYLQRHGLIINDNNDDY  65

Query  1884  ETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEEL  1705
             E FKK++P+VTYED+KPDI+R+A+G+ SSI+CS PISEF TSSGTS GE KL+PT EEEL
Sbjct  66    ENFKKIMPIVTYEDLKPDIDRIADGDRSSILCSQPISEFLTSSGTSGGERKLMPTIEEEL  125

Query  1704  ERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKR  1525
              R+SL  SLLMPV+N+FVPDL KGK MYFLF++ EAKTPGGLLARPVLTS  K SYFKKR
Sbjct  126   GRRSLLYSLLMPVMNKFVPDLQKGKGMYFLFIKSEAKTPGGLLARPVLTSYYKSSYFKKR  185

Query  1524  TYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKH  1345
              Y +PYT+ TSP ETILC DS+QSMYSQMLCGL    QVLRVG +FAS FIRAIHFLEKH
Sbjct  186   PY-DPYTNYTSPNETILCLDSYQSMYSQMLCGLCQNTQVLRVGAVFASGFIRAIHFLEKH  244

Query  1344  WRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNT  1165
             W +LC DI+TGTLNP+I DP VRE+V +I+KP+PDLAEFIE EC+KESWKGIIPR+W NT
Sbjct  245   WPILCRDIKTGTLNPQINDPMVRESVMKILKPDPDLAEFIEMECSKESWKGIIPRLWPNT  304

Query  1164  KYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTM  985
             KY+DV+VTG MSQYIPTL Y+GNDLPLV T Y SSEC F INL+PL KP+EVAYT+IPTM
Sbjct  305   KYVDVIVTGTMSQYIPTLKYYGNDLPLVCTMYASSECYFGINLDPLCKPSEVAYTLIPTM  364

Query  984   AYFEFLPVSREIGVPEP----NPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVA  817
              +FEFLPV+R+   PE     +   ++DLVDVKLG EYE+VVTTYAGLYRYRVGDIL+VA
Sbjct  365   GFFEFLPVARDDQGPEKSNKYDKDNLVDLVDVKLGHEYELVVTTYAGLYRYRVGDILKVA  424

Query  816   GFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTST  637
             GFKN  PQF+FVCRKNVALSID+DKTDEVELH+AV  AS  L+PF+ SL EYTS+A+TST
Sbjct  425   GFKNKAPQFHFVCRKNVALSIDSDKTDEVELHDAVLKASTHLVPFETSLTEYTSYADTST  484

Query  636   IPGHYVLYWEIT--QSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVE  463
              PGHYVLYWEI   +S E  IP  +FEDCC  +EESLNSVYR+CRVSDKSIGPLEI++VE
Sbjct  485   NPGHYVLYWEINNDESDETLIPTSVFEDCCLTIEESLNSVYRQCRVSDKSIGPLEIKVVE  544

Query  462   NGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             NGTFDK+MDYAI++G+SI+QYK PRCV  API+ELL+SRV+S+YFSPK P+W PG K W
Sbjct  545   NGTFDKLMDYAISNGASINQYKAPRCVNYAPIIELLNSRVVSSYFSPKCPKWVPGQKQW  603



>ref|XP_010240996.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Nelumbo 
nucifera]
Length=621

 Score =   880 bits (2275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/600 (71%), Positives = 493/600 (82%), Gaps = 11/600 (2%)
 Frame = -1

Query  2046  ERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKL  1867
             + N  + N   L+FIEDVTTNA ++Q+RVL  ILS +A VEYL RHGLNG TDRETFKK+
Sbjct  20    DHNRPDVNQNALEFIEDVTTNADEIQKRVLAEILSRSAHVEYLQRHGLNGRTDRETFKKV  79

Query  1866  IPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLY  1687
             +PVVTYED++ DINR+ANG+ S I+C  PISEF TSSGTS GE KL+PT EEELER+SL 
Sbjct  80    MPVVTYEDLQSDINRIANGDTSPILCGLPISEFLTSSGTSAGERKLMPTIEEELERRSLL  139

Query  1686  SSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPY  1507
              SLLMPV++QFVP L KGK MYFLF++ EAKTPGGL+ARPVLTS  K  +FK R Y +PY
Sbjct  140   YSLLMPVMDQFVPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSLHFKHRPY-DPY  198

Query  1506  TDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCH  1327
             T+ TSP ETILC DS+QSMYSQ+LCGL    QVLRVG +FAS FIRAI FLEKHW LLC+
Sbjct  199   TNYTSPNETILCPDSYQSMYSQLLCGLCQNKQVLRVGAVFASGFIRAIRFLEKHWSLLCN  258

Query  1326  DIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVV  1147
             DIRTG +NP+ITDPSVR+AV RI+KP+P+LA+FIE EC +E+W+GII R+W NTKYIDV+
Sbjct  259   DIRTGAINPQITDPSVRDAVLRILKPDPELADFIESECTREAWQGIITRLWPNTKYIDVI  318

Query  1146  VTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL  967
             VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP EV+YT+IPTMAYFEFL
Sbjct  319   VTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGLNLNPLCKPNEVSYTLIPTMAYFEFL  378

Query  966   PVSR------EIGVP----EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVA  817
             PV R       I VP    E    +++DLVDVKLGQEYE+VVTTYAGLYRYRVGD+LRVA
Sbjct  379   PVHRNNGFTTSISVPKSLNEKEQQDLVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLRVA  438

Query  816   GFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTST  637
             GFKN  PQFNFVCRKNV LSID+DKTDEVEL  AVK+A N L+PFDASLIEYTS+A+T+T
Sbjct  439   GFKNKAPQFNFVCRKNVVLSIDSDKTDEVELQAAVKDAINHLVPFDASLIEYTSYADTTT  498

Query  636   IPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENG  457
             IPGHYVLYWE+   S  PIP  +FEDCC  +EESLNSVYR+ RVSDKSIGPLEI+IVE G
Sbjct  499   IPGHYVLYWELRHDSTTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKIVETG  558

Query  456   TFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             TFDK+MDYAI+ G+SI+QYK PRCV  APIVELL+SRV+SNYFSPK P+W PGHK W T 
Sbjct  559   TFDKLMDYAISRGASINQYKTPRCVKFAPIVELLNSRVLSNYFSPKCPKWVPGHKQWCTQ  618



>ref|XP_002283229.2| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Vitis 
vinifera]
Length=654

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/608 (69%), Positives = 499/608 (82%), Gaps = 10/608 (2%)
 Frame = -1

Query  2082  DAMTDALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGL  1903
             +A   + +++  +  L E N + LQFIEDVTTNA QVQ+RVL  IL+ NA VEYL RHGL
Sbjct  44    EAPKKSFKATGHDYCLAEKNKKALQFIEDVTTNADQVQKRVLAEILTRNAHVEYLHRHGL  103

Query  1902  NGSTDRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIP  1723
              G TDR+TFKKL+PV+TYED++PDI R+ANG+ S I+CS PISEF TSSGTS GE KL+P
Sbjct  104   GGHTDRDTFKKLMPVITYEDLQPDITRIANGDTSLILCSNPISEFLTSSGTSGGERKLMP  163

Query  1722  TTEEELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKR  1543
             T EEELER+SL  SLLMPV++Q V  L KGK MYFLF++ EAKTPGGL+ARPVLTS  K 
Sbjct  164   TIEEELERRSLLYSLLMPVMSQSVQGLEKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKS  223

Query  1542  SYFKKRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAI  1363
             S+F++R Y +PYT+ TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI
Sbjct  224   SHFRERPY-DPYTNYTSPNETILCPDSYQSMYSQMLCGLVQNKEVLRVGAVFASGFIRAI  282

Query  1362  HFLEKHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIP  1183
              FLEKHW LLC DIRTGT++ +ITDPSVREAV R++KP+P LA+F+E EC KESW+GII 
Sbjct  283   RFLEKHWTLLCRDIRTGTIDQQITDPSVREAVMRVLKPDPKLADFVEGECRKESWQGIIT  342

Query  1182  RIWRNTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAY  1003
             R+W NTKY+DV+VTG MSQYIPTL+Y+ NDLPLV T Y SSEC F +NLNPL KP+EV+Y
Sbjct  343   RLWPNTKYVDVIVTGTMSQYIPTLDYYSNDLPLVCTMYASSECYFGVNLNPLCKPSEVSY  402

Query  1002  TIIPTMAYFEFLPVSR-----EIGVP----EPNPVEVLDLVDVKLGQEYEVVVTTYAGLY  850
             T+IPTMAYFEFLPV R      I VP    +    +++DLVDVKLGQEYE+VVTTYAGLY
Sbjct  403   TLIPTMAYFEFLPVHRNNGTNSISVPKSLNDKEQQDLVDLVDVKLGQEYELVVTTYAGLY  462

Query  849   RYRVGDILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASL  670
             RYRVGD+LRVAGFKN  PQFNFVCRKNV LSID+DKTDEVEL  AVKNA N L+PFDA+L
Sbjct  463   RYRVGDVLRVAGFKNKAPQFNFVCRKNVVLSIDSDKTDEVELQAAVKNAVNHLMPFDATL  522

Query  669   IEYTSHANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSI  490
              EYTS+A+T+TIPGHYVLYWE++     PIP  +FEDCC  VEESLNSVYR+ RVSDKSI
Sbjct  523   TEYTSYADTTTIPGHYVLYWELSLRGSTPIPPSVFEDCCLTVEESLNSVYRQGRVSDKSI  582

Query  489   GPLEIRIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPE  310
             GPLE++IVE+GTFDK+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+SNYFSPK P+
Sbjct  583   GPLEMKIVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPK  642

Query  309   WAPGHKHW  286
             W PGHK W
Sbjct  643   WIPGHKQW  650



>emb|CAN83696.1| hypothetical protein VITISV_013365 [Vitis vinifera]
Length=613

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/608 (69%), Positives = 499/608 (82%), Gaps = 10/608 (2%)
 Frame = -1

Query  2082  DAMTDALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGL  1903
             +A   + +++  +  L E N + LQFIEDVTTNA QVQ+RVL  IL+ NA VEYL RHGL
Sbjct  3     EAPKKSFKATGHDYCLAEKNKKALQFIEDVTTNADQVQKRVLAEILTRNAHVEYLHRHGL  62

Query  1902  NGSTDRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIP  1723
              G TDR+TFKKL+PV+TYED++PDI R+ANG+ S I+CS PISEF TSSGTS GE KL+P
Sbjct  63    GGHTDRDTFKKLMPVITYEDLQPDITRIANGDTSLILCSNPISEFLTSSGTSGGERKLMP  122

Query  1722  TTEEELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKR  1543
             T EEELER+SL  SLLMPV++Q V  L KGK MYFLF++ EAKTPGGL+ARPVLTS  K 
Sbjct  123   TIEEELERRSLLYSLLMPVMSQSVQGLEKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKS  182

Query  1542  SYFKKRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAI  1363
             S+F++R Y +PYT+ TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI
Sbjct  183   SHFRERPY-DPYTNYTSPNETILCPDSYQSMYSQMLCGLVQNKEVLRVGAVFASGFIRAI  241

Query  1362  HFLEKHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIP  1183
              FLEKHW LLC DIRTGT++ +ITDPSVREAV R++KP+P LA+F+E EC KESW+GII 
Sbjct  242   RFLEKHWTLLCRDIRTGTIDQQITDPSVREAVMRVLKPDPKLADFVEGECRKESWQGIIT  301

Query  1182  RIWRNTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAY  1003
             R+W NTKY+DV+VTG MSQYIPTL+Y+ NDLPLV T Y SSEC F +NLNPL KP+EV+Y
Sbjct  302   RLWPNTKYVDVIVTGTMSQYIPTLDYYSNDLPLVCTMYASSECYFGVNLNPLCKPSEVSY  361

Query  1002  TIIPTMAYFEFLPVSR-----EIGVP----EPNPVEVLDLVDVKLGQEYEVVVTTYAGLY  850
             T+IPTMAYFEFLPV R      I VP    +    +++DLVDVKLGQEYE+VVTTYAGLY
Sbjct  362   TLIPTMAYFEFLPVHRNNGTNSISVPKSLNDKEQQDLVDLVDVKLGQEYELVVTTYAGLY  421

Query  849   RYRVGDILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASL  670
             RYRVGD+LRVAGFKN  PQFNFVCRKNV LSID+DKTDEVEL  AVKNA N L+PFDA+L
Sbjct  422   RYRVGDVLRVAGFKNKAPQFNFVCRKNVVLSIDSDKTDEVELQAAVKNAVNHLMPFDATL  481

Query  669   IEYTSHANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSI  490
              EYTS+A+T+TIPGHYVLYWE++     PIP  +FEDCC  VEESLNSVYR+ RVSDKSI
Sbjct  482   TEYTSYADTTTIPGHYVLYWELSLRGSTPIPPSVFEDCCLTVEESLNSVYRQGRVSDKSI  541

Query  489   GPLEIRIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPE  310
             GPLE++IVE+GTFDK+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+SNYFSPK P+
Sbjct  542   GPLEMKIVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPK  601

Query  309   WAPGHKHW  286
             W PGHK W
Sbjct  602   WIPGHKQW  609



>ref|XP_002533739.1| Indole-3-acetic acid-amido synthetase GH3.6, putative [Ricinus 
communis]
 gb|EEF28642.1| Indole-3-acetic acid-amido synthetase GH3.6, putative [Ricinus 
communis]
Length=612

 Score =   877 bits (2266),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/599 (70%), Positives = 496/599 (83%), Gaps = 11/599 (2%)
 Frame = -1

Query  2052  SDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFK  1873
             S + NL E N + LQFIEDVT+N  +VQ++VL+ IL+ NA VEYL +HGLNG TDRE+FK
Sbjct  11    SSDYNLSEKNRKTLQFIEDVTSNPDEVQKKVLEEILTRNARVEYLQKHGLNGYTDRESFK  70

Query  1872  KLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKS  1693
             K++PV+ YED++P INR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL R+S
Sbjct  71    KIMPVIAYEDIQPHINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELGRRS  130

Query  1692  LYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTN  1513
             L  SLLMPV+NQFVP L KGK MYFLF++ EAKTPGGL+ARPVLTS  K S+FK R + +
Sbjct  131   LLYSLLMPVMNQFVPGLEKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKDRPF-D  189

Query  1512  PYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLL  1333
             PYT+ TSP ETILC DS+QSMYSQMLCGL   + VLRVG +FAS FIRAI FLEKHW+LL
Sbjct  190   PYTNYTSPNETILCPDSYQSMYSQMLCGLCQRNDVLRVGAVFASGFIRAIRFLEKHWQLL  249

Query  1332  CHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYID  1153
             C+DIRTGT+NP+ITD SVREAV +I+KP+P LA+FI  EC++ESW+GII R+W NTKY+D
Sbjct  250   CNDIRTGTVNPQITDLSVREAVMKILKPDPKLADFIAAECSQESWQGIITRLWPNTKYVD  309

Query  1152  VVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFE  973
             V+VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+EV+YT+IPTMAYFE
Sbjct  310   VIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMAYFE  369

Query  972   FLPVSREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILR  823
             FLPV R  GV           E    E++DLVDVKLGQEYE+VVTTYAGLYRYRVGD+LR
Sbjct  370   FLPVHRNNGVTNSISMPKSLNEKEQQELVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLR  429

Query  822   VAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANT  643
             VAGFKN  PQFNF+CRKNV LSID+DKTDEVEL NAVKNA N L+PFDA+L EYTS+A+T
Sbjct  430   VAGFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFDATLAEYTSYADT  489

Query  642   STIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVE  463
             ++IPGHYVL+WEIT +   PIP  IFEDCC  +EESLNSVYR+ RVSDKSIGPLEI+IVE
Sbjct  490   TSIPGHYVLFWEITLNGSTPIPPSIFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKIVE  549

Query  462   NGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
              GTFDK+MDYAI+ G+SI+QYK PRCV  APIVELL+SRV+S+YFSPK P+W PGHK W
Sbjct  550   PGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYFSPKCPKWVPGHKQW  608



>emb|CDP05830.1| unnamed protein product [Coffea canephora]
Length=621

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/596 (70%), Positives = 490/596 (82%), Gaps = 11/596 (2%)
 Frame = -1

Query  2034  EESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVV  1855
             EE N + LQFIE+VT NA +VQ+RVL  ILS NA VE L RHGLNG TDRETFKK++PV 
Sbjct  25    EEKNKKFLQFIEEVTANADEVQKRVLAEILSRNAHVECLKRHGLNGQTDRETFKKIMPVT  84

Query  1854  TYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLL  1675
             TYED++PD+NR+ANG+ S IICS PISEF TSSGTS GE KL+PTTEEELER+SL  +LL
Sbjct  85    TYEDIQPDVNRIANGDKSQIICSQPISEFLTSSGTSGGERKLMPTTEEELERRSLLYNLL  144

Query  1674  MPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCT  1495
             MPV++QFVP L +GK MYFLF++ EAKTPGGL+ARPVLTS  K S+FK R++ +PY + T
Sbjct  145   MPVMSQFVPGLERGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKNRSF-DPYMNYT  203

Query  1494  SPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRT  1315
             SP ETILC DS+QSM+SQMLCGL    +VLRVG +FAS FIRAI FLEKHW LLC+DIRT
Sbjct  204   SPNETILCPDSYQSMFSQMLCGLCLNKEVLRVGAVFASGFIRAIRFLEKHWSLLCNDIRT  263

Query  1314  GTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGA  1135
             GTLNPRITDPSVREAV +I+KP+P LAEFIE EC  ESW+GII R+W NTKYIDV+VTG 
Sbjct  264   GTLNPRITDPSVREAVMKILKPDPQLAEFIEGECGMESWQGIITRLWPNTKYIDVIVTGT  323

Query  1134  MSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSR  955
             MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+EV+YT+IPT+ YFEFLPV R
Sbjct  324   MSQYIPTLDYYSNGLPLVCTMYASSECFFGVNLNPLCKPSEVSYTLIPTLGYFEFLPVDR  383

Query  954   EIGVPE----PNPV------EVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKN  805
               GV      P  +      E++DL DVKLGQEYE+VVTTYAGLYRYRVGD+LRVAGFKN
Sbjct  384   NNGVTNCISMPKSLNGKEKQELVDLADVKLGQEYELVVTTYAGLYRYRVGDVLRVAGFKN  443

Query  804   NTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGH  625
               PQFNF+CRKNV LSIDADKTDEVEL NAVKNA + L+PFDA + +YTS+A+T+TIPGH
Sbjct  444   KAPQFNFICRKNVVLSIDADKTDEVELQNAVKNAESHLVPFDAQVTDYTSYADTTTIPGH  503

Query  624   YVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDK  445
             YVL+WE++ +   PIP  +FEDCC AVEESLNSVYR+ RVSDKSIGPLEI+IVE GTFDK
Sbjct  504   YVLFWELSLNGSTPIPPSVFEDCCLAVEESLNSVYRQGRVSDKSIGPLEIKIVEAGTFDK  563

Query  444   MMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             +MDYA+  G+SI+QYK PRCV  APIVELL+SRV ++Y SPK P+W  GHK WN N
Sbjct  564   LMDYALILGASINQYKTPRCVKFAPIVELLNSRVKASYCSPKCPKWIAGHKQWNIN  619



>gb|KDP39002.1| hypothetical protein JCGZ_00759 [Jatropha curcas]
Length=613

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/595 (70%), Positives = 493/595 (83%), Gaps = 11/595 (2%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             NL E N ++L++IEDVT+NA +VQ++VL+ IL+ NA VEYL RHG NG TDRETFKK +P
Sbjct  16    NLVEKNKKLLEYIEDVTSNADEVQKKVLEEILTCNAHVEYLQRHGFNGYTDRETFKKTLP  75

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             V+TYED++ DINR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL R+SL  S
Sbjct  76    VITYEDIQTDINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELGRRSLLYS  135

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV+NQFVP L KGK MYFLF++ EAKTPGGL+ARPVLTS  K S+FK R Y +PYT+
Sbjct  136   LLMPVMNQFVPGLEKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKDRPY-DPYTN  194

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ETILC DS+QSMYSQMLCGL   ++VLRVG +FAS FIRAI FLEKHW+LLC DI
Sbjct  195   YTSPNETILCPDSYQSMYSQMLCGLCQRNEVLRVGAVFASGFIRAIRFLEKHWQLLCDDI  254

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             RTGT+NP+ITD SVREAV +I+KP+P LA+F+E EC K+SW+GII RIW NTKY+DV+VT
Sbjct  255   RTGTINPQITDLSVREAVMKILKPDPKLADFLETECRKDSWQGIITRIWPNTKYVDVIVT  314

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIPTL+Y+ N LPLV T Y SSEC F +NL P+ KP+EV+YT+IPTMAYFEFLPV
Sbjct  315   GTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLKPICKPSEVSYTLIPTMAYFEFLPV  374

Query  960   SREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGF  811
              R  GV           E    E++DLVDVKLGQEYE+VVTTYAGLYRYRVGD+LRVAGF
Sbjct  375   QRNNGVTNSISMPKSLNEKEQQELVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLRVAGF  434

Query  810   KNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIP  631
             KN  PQFNF+CRKNV LSID+DKTDEVEL NAVKNA N L+PFDA+L EYTS+A+T++IP
Sbjct  435   KNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFDATLAEYTSYADTTSIP  494

Query  630   GHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTF  451
             GHYVL+WE++ +   PIP  IFEDCC  +EESLNSVYR+ RVSDKSIGPLEI+IVE GTF
Sbjct  495   GHYVLFWELSLNGSTPIPPSIFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKIVEPGTF  554

Query  450   DKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             DK+MDYAI+ G+SI+QYK PRCV  APIVELL+SRV+S+Y SPK P+W PGHK W
Sbjct  555   DKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPKCPKWIPGHKQW  609



>ref|XP_010092269.1| hypothetical protein L484_021129 [Morus notabilis]
 gb|EXB50903.1| hypothetical protein L484_021129 [Morus notabilis]
Length=611

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/591 (70%), Positives = 492/591 (83%), Gaps = 7/591 (1%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             NL+E N + L+FIEDVT NA +VQ+RVL  ILS NA VEYL RHGLNG TDR+TFKKLIP
Sbjct  18    NLQEKNAKALEFIEDVTANADEVQKRVLAEILSSNANVEYLKRHGLNGHTDRDTFKKLIP  77

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             V+TYED++PDI+R+A G+ S I+CS PISEF TSSGTS GE KL+PT EEE+ R+SL  S
Sbjct  78    VITYEDIQPDIDRIAKGDTSQILCSKPISEFLTSSGTSGGERKLMPTIEEEMGRRSLLYS  137

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV++QFVP L KGK MYFLF++ EAKTPGGL+ARPVLT+  K S+F+ R Y +PYT+
Sbjct  138   LLMPVMSQFVPGLEKGKGMYFLFIKSEAKTPGGLVARPVLTAYYKSSHFRDRPY-DPYTN  196

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP E ILC DS+QSMYSQ+LCGL    +VLRVG +FAS FIRAI FLEKHWR+LC+DI
Sbjct  197   YTSPNEAILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWRVLCNDI  256

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             RTGTLNP+ITDP+VR+AV +I++P+P LA+FIE EC+KESW+GII R+W NTKY+DV+VT
Sbjct  257   RTGTLNPQITDPAVRDAVGKILQPDPKLADFIESECSKESWQGIITRLWPNTKYVDVIVT  316

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+EV+YT+IPTMAYFEFLPV
Sbjct  317   GTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLYKPSEVSYTLIPTMAYFEFLPV  376

Query  960   SRE------IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNT  799
             +R       +       +E ++L DVKLGQEYE+VVTTYAGLYRYRVGD+LRVAGFKN  
Sbjct  377   NRSNNSINGVTNNSKEHLEPVNLADVKLGQEYELVVTTYAGLYRYRVGDVLRVAGFKNKA  436

Query  798   PQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYV  619
             PQF+F+CRKNV LSID+DKTDEVEL NAVKNA N L+PFDA++ EYTS+ANT+TIPGHYV
Sbjct  437   PQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFDANVSEYTSYANTTTIPGHYV  496

Query  618   LYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMM  439
             LYWE++     PIP  +FEDCC  +EESLNSVYR+ RVSDKSIGPLEI+IVE GTFDK+M
Sbjct  497   LYWEMSLKGSTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKIVEAGTFDKLM  556

Query  438   DYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             DYAI+ G+SI+QYK PRCV  APIVELL+SRV++ YFSPK P+W PGHK W
Sbjct  557   DYAISLGASINQYKTPRCVKFAPIVELLNSRVVTEYFSPKCPKWVPGHKKW  607



>ref|XP_006447440.1| hypothetical protein CICLE_v10017968mg [Citrus clementina]
 ref|XP_006469782.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Citrus 
sinensis]
 gb|ESR60680.1| hypothetical protein CICLE_v10017968mg [Citrus clementina]
Length=609

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/604 (69%), Positives = 501/604 (83%), Gaps = 4/604 (1%)
 Frame = -1

Query  2082  DAMTDALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGL  1903
             +A  + LE +  +  + ++N + LQFIE VT+ A +VQ+RVL  ILS +A VEYL R+GL
Sbjct  3     EAPQNLLERAEHDGLVSDNNKKALQFIESVTSQADEVQDRVLAEILSCSANVEYLQRYGL  62

Query  1902  NGSTDRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIP  1723
             NG  D+ TFKK++PV+TYED+KP ++R+ANG+ S I+CS PISEF TSSGTS GE KL+P
Sbjct  63    NGHVDKGTFKKVMPVITYEDLKPYVDRIANGDCSPILCSQPISEFLTSSGTSGGERKLMP  122

Query  1722  TTEEELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKR  1543
             T EEELER+SL  SLLMPV++QFVP L KGK MYFLF++ EAKTPGGL+ARPVLTS  K 
Sbjct  123   TIEEELERRSLLYSLLMPVVDQFVPGLDKGKAMYFLFIKSEAKTPGGLVARPVLTSYYKS  182

Query  1542  SYFKKRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAI  1363
             S FK R + +PYT+ TSP ETILC DS+QSMYSQMLCGL    QVLRVG +FAS FIRAI
Sbjct  183   SLFKDRPF-DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQNLQVLRVGAVFASGFIRAI  241

Query  1362  HFLEKHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIP  1183
              FLEKHW LLC+DIR GT++P+ITDPSVREAV +I+KPN  LA+FIE EC+KESWKGII 
Sbjct  242   RFLEKHWPLLCNDIRKGTIDPKITDPSVREAVLKILKPNTQLADFIEAECSKESWKGIIT  301

Query  1182  RIWRNTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAY  1003
             R+W NTKYIDV+VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNP+  P+EV+Y
Sbjct  302   RLWPNTKYIDVIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGLNLNPMCNPSEVSY  361

Query  1002  TIIPTMAYFEFLPVSREIGVPEP---NPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGD  832
             T++PTMAYFEFLPV+R+ G P+    +  +VLDL DV+LGQEYE+VVTTYAGLYRYRVGD
Sbjct  362   TLLPTMAYFEFLPVNRKNGEPKSLKEDQQQVLDLTDVELGQEYELVVTTYAGLYRYRVGD  421

Query  831   ILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSH  652
             IL+VAGFKN  PQFNFVCRKNVALSID+DKTDEVEL NAVKNA+N L PFDASLIEYTS+
Sbjct  422   ILKVAGFKNKAPQFNFVCRKNVALSIDSDKTDEVELQNAVKNAANHLSPFDASLIEYTSY  481

Query  651   ANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIR  472
             A+TSTIPG YVL+WEI+QS    IP  +FEDCC ++EESLNSVYR+ RVSDKSIGPLEI+
Sbjct  482   ADTSTIPGRYVLFWEISQSGATQIPPSVFEDCCLSIEESLNSVYRQGRVSDKSIGPLEIK  541

Query  471   IVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             +VE+GTFDK+MDYA++ G+SI+QYK PRCV  API+ELL+S+V+SNYFSPK P+W PG K
Sbjct  542   LVESGTFDKLMDYALSQGASINQYKTPRCVKYAPIIELLNSKVVSNYFSPKCPKWVPGQK  601

Query  291   HWNT  280
              W T
Sbjct  602   QWCT  605



>ref|XP_009615928.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009615930.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009615931.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform 
X3 [Nicotiana tomentosiformis]
Length=609

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/595 (70%), Positives = 490/595 (82%), Gaps = 11/595 (2%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             + E+N ++LQFIE+VTTNA +VQ+RVL  ILS NA VEYL RH LNG TDR+TFKK++PV
Sbjct  13    VAENNKKVLQFIEEVTTNADEVQKRVLAEILSQNAHVEYLHRHDLNGHTDRDTFKKIMPV  72

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             +TYED++ DI R+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL R+S   SL
Sbjct  73    ITYEDIQSDITRIANGDKSPILCSQPISEFLTSSGTSGGERKLMPTIEEELVRRSKLYSL  132

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV++QFVPDL KGK MYFLF++ EAKTPGGL ARPVLTS  K  +FK R   +PYT+ 
Sbjct  133   LMPVMSQFVPDLEKGKGMYFLFIKSEAKTPGGLPARPVLTSYYKSPHFKNRR-PDPYTNY  191

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP ETILC+DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW LLCHDIR
Sbjct  192   TSPNETILCSDSYQSMYSQMLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWSLLCHDIR  251

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             TGT+N +ITDPSVREAV +I+KP+  LA+FIE EC+K+SW+GII R+W NTKYIDV+VTG
Sbjct  252   TGTINSQITDPSVREAVMKILKPDNKLADFIEVECSKKSWQGIITRLWPNTKYIDVIVTG  311

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
              MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+EVAYT+IPTM YFEFLPV 
Sbjct  312   TMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVAYTLIPTMGYFEFLPVH  371

Query  957   REIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFK  808
             R  GV           E    E++DLVDVK+GQEYE+VVTTYAGLYRYRVGD+LRVAGFK
Sbjct  372   RNNGVTNSISMPKSLNEKEQQELVDLVDVKIGQEYELVVTTYAGLYRYRVGDVLRVAGFK  431

Query  807   NNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPG  628
             NN PQFNF+CRKNV LSIDADKTDEVEL NAVKNA + L+PFDA +IEYTS+A+T+TIPG
Sbjct  432   NNAPQFNFICRKNVVLSIDADKTDEVELQNAVKNAVSHLMPFDAHVIEYTSYADTTTIPG  491

Query  627   HYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
             HYVL+WE+  +   P+P  +FEDCC  +EESLNSVYR+ R SDKSIGPLEI+IVENGTFD
Sbjct  492   HYVLFWELNVNGSTPVPPSVFEDCCLTIEESLNSVYRQGRASDKSIGPLEIKIVENGTFD  551

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
             K+MDYAI+ G+SI+QYK PRCV  APIVELL+SRV+S+YFSPK P+W PG K WN
Sbjct  552   KLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYFSPKCPKWVPGLKQWN  606



>gb|AGH61310.1| indole-3-acetic acid amido synthetase [Morus alba var. multicaulis]
Length=611

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/591 (69%), Positives = 490/591 (83%), Gaps = 7/591 (1%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             NL+E N + L+FIEDVT NA +VQ+RVL  ILS NA VEYL RHGLNG TDR+TFKK+IP
Sbjct  18    NLQEKNAKALEFIEDVTANADEVQKRVLAEILSSNANVEYLKRHGLNGHTDRDTFKKVIP  77

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             V+TYED++PDI R+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEE+ R+SL  S
Sbjct  78    VITYEDIQPDIKRIANGDTSQILCSKPISEFLTSSGTSGGERKLMPTIEEEMGRRSLLYS  137

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV++QFVP L KGK MYFLF++ EAKTPGGL+ARPVLT+  K S+F+ R Y +PYT+
Sbjct  138   LLMPVMSQFVPGLEKGKGMYFLFIKSEAKTPGGLVARPVLTAYYKSSHFRNRPY-DPYTN  196

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP E ILC DS+QSMYSQ+LCGL    +VLRVG +FAS FIRAI FLEKHWR+LC+D+
Sbjct  197   YTSPNEAILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWRVLCNDV  256

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             RTG LNP+ITDP+VR+AV +I++P+P LA+FIE EC+KESW+GII R+W NTKY+DV+VT
Sbjct  257   RTGNLNPQITDPAVRDAVGKILQPDPKLADFIESECSKESWQGIITRLWPNTKYVDVIVT  316

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL +P EV+YT+IPTMAYFEFLPV
Sbjct  317   GTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLYEPCEVSYTLIPTMAYFEFLPV  376

Query  960   SRE------IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNT  799
             +R       +       +E+++L DVKLGQEYE+VVTTYAGLYRYRVGD+LRVAGFKN  
Sbjct  377   NRSNNSINGVTNNSKEHLELVNLADVKLGQEYELVVTTYAGLYRYRVGDVLRVAGFKNKA  436

Query  798   PQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYV  619
             PQF+F+CRKNV LSIDADKTDEVEL NAVKNA N L+PFDA++ EYTS+ANT+TIPGHYV
Sbjct  437   PQFSFICRKNVVLSIDADKTDEVELQNAVKNAVNHLVPFDANVSEYTSYANTTTIPGHYV  496

Query  618   LYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMM  439
             LYWE++     PIP  +FEDCC  +EESLNSVYR+ RVSDKSIGPLEI+IVE GTFDK+M
Sbjct  497   LYWEMSLKGSTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKIVEAGTFDKLM  556

Query  438   DYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             DYAI+ G+SI+QYK PRCV  APIVELL+SRV + YFSPK P+W PGHK W
Sbjct  557   DYAISRGASINQYKTPRCVKFAPIVELLNSRVEAEYFSPKCPKWVPGHKQW  607



>gb|KDO47749.1| hypothetical protein CISIN_1g046696mg [Citrus sinensis]
Length=609

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/604 (69%), Positives = 501/604 (83%), Gaps = 4/604 (1%)
 Frame = -1

Query  2082  DAMTDALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGL  1903
             +A  + LE +  +  + ++N + L+FIE VT+ A +VQ+RVL  ILS +A VEYL R+GL
Sbjct  3     EAPQNLLERAEHDGLVSDNNKKALKFIESVTSQADEVQDRVLAEILSCSANVEYLQRYGL  62

Query  1902  NGSTDRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIP  1723
             NG  D+ TFKK++PV+TYED+KP ++R+ANG+ S I+CS PISEF TSSGTS GE KL+P
Sbjct  63    NGHVDKGTFKKVMPVITYEDLKPYVDRIANGDCSPILCSQPISEFLTSSGTSGGERKLMP  122

Query  1722  TTEEELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKR  1543
             T EEELER+SL  SLLMPV++QFVP L KGK MYFLF++ EAKTPGGL+ARPVLTS  K 
Sbjct  123   TIEEELERRSLLYSLLMPVVDQFVPGLDKGKAMYFLFIKSEAKTPGGLVARPVLTSYYKS  182

Query  1542  SYFKKRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAI  1363
             S FK R + +PYT+ TSP ETILC DS+QSMYSQMLCGL    QVLRVG +FAS FIRAI
Sbjct  183   SLFKDRPF-DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQNLQVLRVGAVFASGFIRAI  241

Query  1362  HFLEKHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIP  1183
              FLEKHW LLC+DIR GT++P+ITDPSVREAV +I+KPN  LA+FIE EC+KESWKGII 
Sbjct  242   RFLEKHWPLLCNDIRKGTIDPKITDPSVREAVLKILKPNTQLADFIEAECSKESWKGIIT  301

Query  1182  RIWRNTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAY  1003
             R+W NTKYIDV+VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNP+  P+EV+Y
Sbjct  302   RLWPNTKYIDVIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGLNLNPMCNPSEVSY  361

Query  1002  TIIPTMAYFEFLPVSREIGVPEP---NPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGD  832
             T++PTMAYFEFLPV+R+ G P+    +  +VLDL DV+LGQEYE+VVTTYAGLYRYRVGD
Sbjct  362   TLLPTMAYFEFLPVNRKNGEPKSLKEDQQQVLDLTDVELGQEYELVVTTYAGLYRYRVGD  421

Query  831   ILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSH  652
             IL+VAGFKN  PQFNFVCRKNVALSID+DKTDEVEL NAVKNA+N L PFDASLIEYTS+
Sbjct  422   ILKVAGFKNKAPQFNFVCRKNVALSIDSDKTDEVELQNAVKNAANHLSPFDASLIEYTSY  481

Query  651   ANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIR  472
             A+TSTIPG YVL+WEI+QS    IP  +FEDCC ++EESLNSVYR+ RVSDKSIGPLEI+
Sbjct  482   ADTSTIPGRYVLFWEISQSGATQIPPSVFEDCCLSIEESLNSVYRQGRVSDKSIGPLEIK  541

Query  471   IVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             +VE+GTFDK+MDYA++ G+SI+QYK PRCV  API+ELL+S+V+SNYFSPK P+W PG K
Sbjct  542   LVESGTFDKLMDYALSQGASINQYKTPRCVKYAPIIELLNSKVVSNYFSPKCPKWVPGQK  601

Query  291   HWNT  280
              W T
Sbjct  602   QWCT  605



>ref|XP_010267862.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Nelumbo 
nucifera]
Length=616

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/600 (69%), Positives = 493/600 (82%), Gaps = 11/600 (2%)
 Frame = -1

Query  2046  ERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKL  1867
             +R+  ++N + LQFIEDVT NA QVQ++VL  ILS +A VEYL R GLNG TDRETFKK+
Sbjct  17    DRDGTDANKKALQFIEDVTINADQVQKQVLAEILSRSAHVEYLQRRGLNGRTDRETFKKV  76

Query  1866  IPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLY  1687
             IPVV+YED++ DINR+ANG+ S I+C  PISEF TSSGTS GE KL+PT EEEL R+SL 
Sbjct  77    IPVVSYEDLQSDINRIANGDTSPILCGLPISEFLTSSGTSAGERKLMPTIEEELNRRSLL  136

Query  1686  SSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPY  1507
              SLLMPV++QFVP L KGK MYFLF++ EAKTPGGL+ARPVLTS  K S+FK+R Y +PY
Sbjct  137   YSLLMPVMDQFVPGLDKGKGMYFLFIKSEAKTPGGLIARPVLTSYYKSSHFKRRPY-DPY  195

Query  1506  TDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCH  1327
             T+ TSP ETILC DS+QSMY+Q+LCGL   ++VLRVG +FAS FIRAI FLEKHW LLC+
Sbjct  196   TNYTSPNETILCPDSYQSMYTQLLCGLCQNEEVLRVGAVFASGFIRAIRFLEKHWSLLCN  255

Query  1326  DIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVV  1147
             DIRTGT+NP+I+D SVR+AV++I+KP P+LA+FIE EC KE+W+GII R+W NTKYIDV+
Sbjct  256   DIRTGTINPQISDASVRDAVSKILKPKPELADFIEAECRKETWQGIITRLWPNTKYIDVI  315

Query  1146  VTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL  967
             VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+EV YT+IPTMAYFEFL
Sbjct  316   VTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGLNLNPLCKPSEVCYTLIPTMAYFEFL  375

Query  966   PVSREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVA  817
             PV R  GV           E    +++DL DVKLGQEYE+VVTTYAGLYRYRVGD+LRVA
Sbjct  376   PVQRNNGVANSVSVPKSLNEKEQQDLVDLTDVKLGQEYELVVTTYAGLYRYRVGDVLRVA  435

Query  816   GFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTST  637
             GFKNN PQFNF+CRKNV LSID+DKTDEVEL  AVKNA+N L+PFDA+L EYTS+A+T+T
Sbjct  436   GFKNNAPQFNFICRKNVVLSIDSDKTDEVELQAAVKNATNHLVPFDATLTEYTSYADTTT  495

Query  636   IPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENG  457
             IPGHYVLYWE+      PIP  +FEDCC  +EESLNSVYR+ R SDKSIGPLEI++VE+G
Sbjct  496   IPGHYVLYWELRHDGVTPIPPSVFEDCCLTIEESLNSVYRQGRSSDKSIGPLEIKVVESG  555

Query  456   TFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             TFDK+MDYAI+ G+SI+QYK PRCV  APIVELL+SRV SNYFSPK P+W PG K W T+
Sbjct  556   TFDKLMDYAISRGASINQYKTPRCVKFAPIVELLNSRVRSNYFSPKCPKWVPGQKQWCTH  615



>ref|XP_011009953.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Populus 
euphratica]
Length=611

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/602 (69%), Positives = 494/602 (82%), Gaps = 11/602 (2%)
 Frame = -1

Query  2052  SDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFK  1873
             + + NL E N   LQFIEDVT+NA +VQ++VL+ IL  NA VEYL RHGLNG T+RETFK
Sbjct  11    TSDYNLAEKNKISLQFIEDVTSNADEVQKKVLEEILCRNAHVEYLQRHGLNGQTNRETFK  70

Query  1872  KLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKS  1693
             K +PV+TYED++PDINR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL R+S
Sbjct  71    KAVPVITYEDIQPDINRIANGDASQILCSKPISEFLTSSGTSGGERKLMPTIEEELGRRS  130

Query  1692  LYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTN  1513
             L  SLLMPV+ QFVP L KGK MYFLF++ EAKTPGGL+ARPVLTS  K ++FK R Y +
Sbjct  131   LLYSLLMPVMTQFVPGLEKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSTHFKDRPY-D  189

Query  1512  PYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLL  1333
             PYT+ TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW+LL
Sbjct  190   PYTNYTSPNETILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIRFLEKHWKLL  249

Query  1332  CHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYID  1153
              +DIRTG ++P+ITDPSVREAV +I+K +P LA+FIE EC+KESW+GII R+W NTKY+D
Sbjct  250   ANDIRTGIIDPQITDPSVREAVMKILKSDPKLADFIEAECSKESWQGIITRLWPNTKYVD  309

Query  1152  VVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFE  973
             V+VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNP+ KP+EV+YT+IPTMAYFE
Sbjct  310   VIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPICKPSEVSYTLIPTMAYFE  369

Query  972   FLPVSREIG----------VPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILR  823
             FLPV R  G          + E    E++DLVDVKL QEYE+VVTTYAGLYRYRVGD+LR
Sbjct  370   FLPVHRNNGAINSVSMPKSLNEKEQQELVDLVDVKLDQEYELVVTTYAGLYRYRVGDVLR  429

Query  822   VAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANT  643
             VAGFKN  PQF+F+CRKNV LSID+DKTDEVEL +AVKNA N L+PFDA+L EYTS+A+T
Sbjct  430   VAGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQSAVKNAVNHLIPFDATLAEYTSYADT  489

Query  642   STIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVE  463
             +TIPGHYVL+WE++ +   PIP  +FEDCC  +EESLNSVYR+ R SDKSIGPLEI+IVE
Sbjct  490   TTIPGHYVLFWELSLNGSTPIPPSVFEDCCLTIEESLNSVYRQGRASDKSIGPLEIKIVE  549

Query  462   NGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
              GTFDK+MDYAI+ G+SI+QYK PRCV  APIVELL+SRV++ YFSPK P+WAPGHK W+
Sbjct  550   PGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVTCYFSPKCPKWAPGHKQWS  609

Query  282   TN  277
              N
Sbjct  610   KN  611



>ref|XP_006370580.1| DWARF IN LIGHT 1 family protein [Populus trichocarpa]
 gb|ERP67149.1| DWARF IN LIGHT 1 family protein [Populus trichocarpa]
Length=611

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/602 (69%), Positives = 494/602 (82%), Gaps = 11/602 (2%)
 Frame = -1

Query  2052  SDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFK  1873
             + + NL E N   LQFIEDVT+NA +VQ++VL+ ILS NA VEYL RHGLNG T+RETFK
Sbjct  11    TSDYNLAEKNKISLQFIEDVTSNADEVQKKVLEEILSRNAHVEYLQRHGLNGQTNRETFK  70

Query  1872  KLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKS  1693
             K +PV+TYED++PDINR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL R+S
Sbjct  71    KAVPVITYEDIQPDINRIANGDTSQILCSKPISEFLTSSGTSGGERKLMPTIEEELGRRS  130

Query  1692  LYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTN  1513
             L  SLLMPV+ QFVP L KGK MYFLF++ EAKTPGGL+ARPVLTS  K ++FK R Y +
Sbjct  131   LLYSLLMPVMTQFVPGLEKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSTHFKDRPY-D  189

Query  1512  PYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLL  1333
             PYT+ TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW+LL
Sbjct  190   PYTNYTSPNETILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIRFLEKHWKLL  249

Query  1332  CHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYID  1153
              +DIRTG ++P+ITDPSVREAV +I+K +P LA+FIE EC+KESW+GII R+W NTKY+D
Sbjct  250   ANDIRTGIIDPQITDPSVREAVMKILKSDPKLADFIEAECSKESWQGIITRLWPNTKYVD  309

Query  1152  VVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFE  973
             V+VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNP+ KP+EV+YT+IPTMAYFE
Sbjct  310   VIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPICKPSEVSYTLIPTMAYFE  369

Query  972   FLPVSREIGV----------PEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILR  823
             FLPV R  GV           E    E++DLVDVKL QEYE+VVTTYAGLYRYRVGD+LR
Sbjct  370   FLPVHRNNGVINSVSMPKSLNEKEQQELVDLVDVKLDQEYELVVTTYAGLYRYRVGDVLR  429

Query  822   VAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANT  643
             V GFKN  P+F+F+CRKNV LSID+DKTDEVEL +AVKNA N L+PFDA+L EYTS+A+T
Sbjct  430   VVGFKNKAPRFSFICRKNVVLSIDSDKTDEVELQSAVKNAVNHLIPFDATLAEYTSYADT  489

Query  642   STIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVE  463
             +TIPGHYVL+WE++ +   PIP  +FEDCC  +EESLNSVYR+ R SDKSIGPLEI+IVE
Sbjct  490   TTIPGHYVLFWELSLNGSTPIPPSVFEDCCLTIEESLNSVYRQGRASDKSIGPLEIKIVE  549

Query  462   NGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
              GTFDK+MDYAI+ G+SI+QYK PRCV  APIVELL+SRV++ YFSPK P+WAPGHK W+
Sbjct  550   PGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVTCYFSPKCPKWAPGHKQWS  609

Query  282   TN  277
              N
Sbjct  610   KN  611



>ref|XP_002319398.1| hypothetical protein POPTR_0013s14740g [Populus trichocarpa]
 gb|EEE95321.1| hypothetical protein POPTR_0013s14740g [Populus trichocarpa]
Length=608

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/595 (70%), Positives = 488/595 (82%), Gaps = 12/595 (2%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGS-TDRETFKKLIPVV  1855
             E + + LQFIEDVT NA +VQ +VL  ILS NA VEYL R+GLNG+  DRE FKK++PVV
Sbjct  13    EKSRKALQFIEDVTRNADEVQRKVLAEILSRNANVEYLQRYGLNGNKADREAFKKVMPVV  72

Query  1854  TYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLL  1675
             +YED+KPDI+R+ANG+ S IICS PISEF TSSGTS GE KL+PT EEEL R+SL  SLL
Sbjct  73    SYEDLKPDIDRIANGDTSQIICSQPISEFLTSSGTSAGERKLMPTIEEELGRRSLLYSLL  132

Query  1674  MPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCT  1495
             MPV+NQFVP L +GK MYFLF++ E KTPGGLLARPVLTS  K SYF+ R Y +PYT+ T
Sbjct  133   MPVMNQFVPGLDRGKGMYFLFIKSETKTPGGLLARPVLTSYYKSSYFRDRPY-DPYTNYT  191

Query  1494  SPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRT  1315
             SP ETILC DS+QSMYSQ+LCGL+    VLRVG +FAS FIRAI FLEKHW LLC+DIR 
Sbjct  192   SPNETILCQDSYQSMYSQLLCGLYQNYDVLRVGAVFASGFIRAIKFLEKHWILLCNDIRN  251

Query  1314  GTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGA  1135
             GT++P+I+DPSVREAV +I+KPN  LA+FIE EC +ESWKGII R+W NTKYIDV+VTG 
Sbjct  252   GTIDPKISDPSVREAVLKILKPNQKLADFIEAECTRESWKGIITRLWPNTKYIDVIVTGT  311

Query  1134  MSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSR  955
             MSQYIPTL+Y+ + LPLV T Y SSEC F +NLNPLSKP+EV+YT+IPTMAYFEFLPV+R
Sbjct  312   MSQYIPTLDYYCDGLPLVCTMYASSECYFGLNLNPLSKPSEVSYTLIPTMAYFEFLPVNR  371

Query  954   EIGV----------PEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKN  805
             + G+           +    E++DLVDVKLG+EYE+VVTTYAGLYRYRVGDILRVAGFKN
Sbjct  372   KNGLINSITAPTSLDQKKDQELVDLVDVKLGEEYELVVTTYAGLYRYRVGDILRVAGFKN  431

Query  804   NTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGH  625
               PQFNFVCRKNV LSID+DKTDEVEL NAV+NA+N LLPF ASL EYTS+A+TS IPGH
Sbjct  432   KAPQFNFVCRKNVVLSIDSDKTDEVELQNAVQNAANHLLPFGASLTEYTSYADTSKIPGH  491

Query  624   YVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDK  445
             YVL+WEI  S   PIP  +FEDCC A+EESLNSVYR+ RVSDKSIGPLEIRI E G FDK
Sbjct  492   YVLFWEICLSGTTPIPPSVFEDCCLAIEESLNSVYRQGRVSDKSIGPLEIRITERGAFDK  551

Query  444   MMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNT  280
             +MD+A++ G+SI+QYK PRCV  API+ELL+SRV+SNY SPK P+W PGHK W T
Sbjct  552   LMDFALSQGASINQYKAPRCVKYAPIIELLNSRVVSNYISPKCPKWVPGHKQWCT  606



>ref|XP_009377289.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Pyrus 
x bretschneideri]
Length=614

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/601 (69%), Positives = 490/601 (82%), Gaps = 14/601 (2%)
 Frame = -1

Query  2052  SDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFK  1873
             +++ NL++ NN+IL FIE+VT    +VQ+RVL  IL+ NA VEYL RHGLNG TDR+TFK
Sbjct  12    TEDYNLQDKNNKILHFIEEVTKTPHEVQKRVLAEILTRNAHVEYLQRHGLNGHTDRDTFK  71

Query  1872  KLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKS  1693
             K++PV+ YED++ DINR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEELER+S
Sbjct  72    KIMPVIKYEDIQSDINRIANGDTSHILCSKPISEFLTSSGTSGGERKLMPTIEEELERRS  131

Query  1692  LYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTN  1513
             L  SLLMPV++Q+VP L KGK MYFLF++ EAKTPGGL+ARPVLTS  K S+FK+R Y +
Sbjct  132   LLYSLLMPVMSQYVPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKQRPY-D  190

Query  1512  PYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLL  1333
             PYT+ TSP ETILC DS+QSMYSQ+LCGL    +VLRVG +FAS FIRAI FLEKHW +L
Sbjct  191   PYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWTIL  250

Query  1332  CHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYID  1153
             C DI +GTLNP+ITDPSVREAV +I+KP+P LA FIE EC K+SW GII R+W NTKY+D
Sbjct  251   CKDIASGTLNPQITDPSVREAVMKILKPDPKLASFIEGECRKDSWHGIITRLWPNTKYVD  310

Query  1152  VVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFE  973
             V+VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+EV+YT+IPTM YFE
Sbjct  311   VIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMGYFE  370

Query  972   FLPVSREIGVPEPNPV------------EVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDI  829
             FLPV R  G+   NPV            E++DL DVKLGQEYE+VVTTYAGLYRYRVGD+
Sbjct  371   FLPVQRNNGI-NTNPVSVRKSLNEKEQQELVDLADVKLGQEYELVVTTYAGLYRYRVGDV  429

Query  828   LRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHA  649
             LRVA FKN  PQFNF+CRKNV LSID+DKTDEVEL NAVKNA N L+PFDA++ EYTS+A
Sbjct  430   LRVASFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFDATVTEYTSYA  489

Query  648   NTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRI  469
             +T+TIPGHYVL+WE+  +   PIP  +FEDCC  VEESLNSVYR+ R SDKSIGPLEI+I
Sbjct  490   DTTTIPGHYVLFWELGLNGTTPIPPSVFEDCCLTVEESLNSVYRQGRASDKSIGPLEIKI  549

Query  468   VENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             VE GTFDK+MDYAI+ G+SI+QYK PRCV  APIVELL +RV+SNY+SPK P+W PGHK 
Sbjct  550   VETGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLTTRVVSNYYSPKCPKWVPGHKQ  609

Query  288   W  286
             W
Sbjct  610   W  610



>ref|XP_002316954.1| DWARF IN LIGHT 1 family protein [Populus trichocarpa]
 gb|EEE97566.1| DWARF IN LIGHT 1 family protein [Populus trichocarpa]
Length=611

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/598 (69%), Positives = 492/598 (82%), Gaps = 11/598 (2%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             NL E N + LQFIEDVT+NA + Q++VL+ ILS NA VEYL RHGLNG T+RETFKK++P
Sbjct  15    NLAEKNKKSLQFIEDVTSNADEAQKKVLEEILSRNAHVEYLQRHGLNGQTNRETFKKVMP  74

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             V+ YED++PDINR+ANG+ S I+CS PISEF TSSGTS GE KL+PT  EEL R+SL  S
Sbjct  75    VINYEDIQPDINRIANGDASPILCSKPISEFLTSSGTSGGERKLMPTIVEELGRRSLLYS  134

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV++QFVPDL KGK MYFLF++ EAKTPGGL+ARPVLTS  K ++FK R Y +PYT+
Sbjct  135   LLMPVMSQFVPDLEKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSTHFKDRPY-DPYTN  193

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEK+W+ L +DI
Sbjct  194   YTSPNETILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIRFLEKYWKFLANDI  253

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             RTG ++P+ITDPS+REAV +I+KP+  LA+FIE EC+KESW+GII R+W NTKY+DV+VT
Sbjct  254   RTGIIDPQITDPSIREAVMKILKPDAKLADFIEAECSKESWQGIITRLWPNTKYVDVIVT  313

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNP+ KP+EV+YT+IPTMAYFEFLPV
Sbjct  314   GTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPICKPSEVSYTLIPTMAYFEFLPV  373

Query  960   SREIG----------VPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGF  811
             +R  G          + E    E++DLVDVKL QEYE+VVTTYAGLYRYRVGD+LRV GF
Sbjct  374   NRNNGGINSVSRPKSLKEKEQQELVDLVDVKLDQEYELVVTTYAGLYRYRVGDVLRVVGF  433

Query  810   KNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIP  631
             KN  PQF+F+CRKNV LSID+DKTDEVEL +AVKNA N L+PFDA+L EYTS+A+T+TIP
Sbjct  434   KNKAPQFSFICRKNVVLSIDSDKTDEVELQSAVKNAVNHLIPFDATLAEYTSYADTTTIP  493

Query  630   GHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTF  451
             GHYVL+WE++ S   PIP  +FEDCC  +EESLNSVYR+ RVSDKSIGPLEI+IVE GTF
Sbjct  494   GHYVLFWELSLSGSTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKIVEPGTF  553

Query  450   DKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             DK+MDYAI+ G+SI+QYK PRCV  APIVELL+SR +S YFSPK P+W PGHK WN N
Sbjct  554   DKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRAVSRYFSPKCPKWVPGHKQWNKN  611



>emb|CDP11866.1| unnamed protein product [Coffea canephora]
Length=606

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/601 (70%), Positives = 489/601 (81%), Gaps = 11/601 (2%)
 Frame = -1

Query  2058  SSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRET  1879
             ++  E  L++ N ++LQFIEDVT+NA +VQ RVL  ILS NAGVEYL RHG NG  D ET
Sbjct  10    TNHQESCLDDKNQQVLQFIEDVTSNAKEVQRRVLNEILSRNAGVEYLQRHGFNGQIDYET  69

Query  1878  FKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELER  1699
             FK   PVVTY+D+KPD++R+ANG+ S I+CS PISE  TSSGTS GE KL+PT EEEL R
Sbjct  70    FKSTFPVVTYDDLKPDVDRIANGDTSPILCSQPISECLTSSGTSGGERKLMPTIEEELGR  129

Query  1698  KSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTY  1519
             +S   SLLMPV+NQFV DL KGK MYFLFV+ EAKTPGGLLARPVLTS  K S+F+ R Y
Sbjct  130   RSFLYSLLMPVMNQFVLDLDKGKGMYFLFVKSEAKTPGGLLARPVLTSYYKSSHFRDRPY  189

Query  1518  TNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWR  1339
              +PY   TSP E ILC+DS+QSMYSQMLCGL   D+VLRVG +FAS FIRAI FL+ HW 
Sbjct  190   -DPYASYTSPNEAILCSDSYQSMYSQMLCGLCQKDEVLRVGAVFASGFIRAIRFLQNHWP  248

Query  1338  LLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKY  1159
             LLC+DIRTGTLNP I DPSVREAV +I+KPNP LAE +E EC KESWKGIIPRIW NTKY
Sbjct  249   LLCNDIRTGTLNPEIIDPSVREAVVKILKPNPQLAEVLEAECRKESWKGIIPRIWPNTKY  308

Query  1158  IDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAY  979
             IDV+VTG MSQYI TLN++GN+LPLV T Y SSEC F +NLNPL  P+EV YT+IPTMAY
Sbjct  309   IDVIVTGTMSQYIDTLNFYGNNLPLVCTMYASSECYFGVNLNPLCMPSEVVYTLIPTMAY  368

Query  978   FEFLPVSREIGVPEPNPV------EVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVA  817
             FEFLPV+ E    EP P+      +++DLVDV+LGQ+YE+V+TTYAGLYRY VGDILRVA
Sbjct  369   FEFLPVTSE---NEPVPLNPNKHHKLVDLVDVQLGQDYELVITTYAGLYRYHVGDILRVA  425

Query  816   GFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNI-LLPFDASLIEYTSHANTS  640
             GFKN  PQF F+CRKNVALSID+DKTDEVELHNAV  A+N  LL FDASLIEYTS+A+TS
Sbjct  426   GFKNKAPQFTFICRKNVALSIDSDKTDEVELHNAVTKAANSHLLQFDASLIEYTSYADTS  485

Query  639   TIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVEN  460
             TIPGHYVLYWEI  +S   IP  +FEDCC  VEESLNSVYR+ RVSD SIGPLEI++V+N
Sbjct  486   TIPGHYVLYWEIGFNSAKSIPESVFEDCCLTVEESLNSVYRQGRVSDNSIGPLEIKVVKN  545

Query  459   GTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNT  280
             GTFDK+MD+AI++G+SI+QYK PRCV  APIVE+L+S V+ NYFSPK P+W+PGHK W T
Sbjct  546   GTFDKVMDFAISNGASINQYKAPRCVKYAPIVEILNSGVVFNYFSPKCPKWSPGHKQWCT  605

Query  279   N  277
             N
Sbjct  606   N  606



>ref|XP_006401565.1| hypothetical protein EUTSA_v10012997mg [Eutrema salsugineum]
 gb|ESQ43018.1| hypothetical protein EUTSA_v10012997mg [Eutrema salsugineum]
Length=612

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/597 (70%), Positives = 483/597 (81%), Gaps = 11/597 (2%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             L E N   LQFIE+VTTNA  VQ RVL+ IL+ NA VEYL RHGL G TDRETFK ++PV
Sbjct  17    LAEKNKNKLQFIEEVTTNADDVQRRVLEEILTRNADVEYLKRHGLQGRTDRETFKHVMPV  76

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             VTYED++P+INR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL+R+SL  SL
Sbjct  77    VTYEDIQPEINRIANGDKSQILCSNPISEFLTSSGTSGGERKLMPTIEEELDRRSLLYSL  136

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV+NQFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S FK R Y +PYT+ 
Sbjct  137   LMPVMNQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSQFKNRPY-DPYTNY  195

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP +TILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW  L HDIR
Sbjct  196   TSPNQTILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKHWPELAHDIR  255

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             TGTLN  ITD SVREAV  I+KP+P LA+F+E EC K SW+GII R+W NTKY+DV+VTG
Sbjct  256   TGTLNSEITDVSVREAVGEILKPDPRLADFVEWECRKTSWQGIITRLWPNTKYVDVIVTG  315

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
              MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IPTMAYFEFLPV 
Sbjct  316   TMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMAYFEFLPVH  375

Query  957   REIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFK  808
             R  GV           E    E++DLVDVKLGQEYE+VVTTYAGLYRYRVGD+LRVAGFK
Sbjct  376   RNSGVTSSISLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLRVAGFK  435

Query  807   NNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPG  628
             NN PQF+F+CRKNV LSIDADKTDEVEL NAVKNA   L+PFDASL EYTS+A+TS+IPG
Sbjct  436   NNAPQFSFICRKNVVLSIDADKTDEVELQNAVKNAVTHLVPFDASLSEYTSYADTSSIPG  495

Query  627   HYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
             HYVL+WE+  +   PIP  +FEDCCF +EESLNSVYR+ RVSDKSIGPLEI+IVE+GTFD
Sbjct  496   HYVLFWELCLNGNTPIPPSVFEDCCFTIEESLNSVYRQGRVSDKSIGPLEIKIVESGTFD  555

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             K+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+  YFSPK P+W PGHK W +N
Sbjct  556   KLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVKTYFSPKCPKWVPGHKQWGSN  612



>ref|XP_007043391.1| Auxin-responsive GH3 family protein [Theobroma cacao]
 gb|EOX99222.1| Auxin-responsive GH3 family protein [Theobroma cacao]
Length=618

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/592 (70%), Positives = 488/592 (82%), Gaps = 11/592 (2%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E+NN+ L+FIEDVT +A +VQ+RVL  ILS +A  EYL R+GLNG TDRETFKK+IPVV+
Sbjct  24    ENNNKALKFIEDVTRDADEVQKRVLSEILSRSANAEYLQRNGLNGCTDRETFKKVIPVVS  83

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED+KPDI R+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL+R+SL  SLLM
Sbjct  84    YEDLKPDIERIANGDTSPILCSQPISEFLTSSGTSAGERKLMPTIEEELDRRSLLYSLLM  143

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+NQFVP L KGK MYFLF++ EAKTPGGL+ARPVLTS  K  +FK R Y +PYT+ TS
Sbjct  144   PVMNQFVPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSLHFKDRPY-DPYTNYTS  202

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P ETILC +S+QSMY+Q+LCGL    +VLRVG +FAS FIRAI FLEKHW LLC DIR+G
Sbjct  203   PNETILCVNSYQSMYAQLLCGLCQNKEVLRVGAVFASGFIRAIQFLEKHWSLLCRDIRSG  262

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
              ++ +ITD SVREAV +I+KPN  LA+FIE EC+K SWKGII R+W NTKYIDV+VTG M
Sbjct  263   NIHSKITDASVREAVLKILKPNSKLADFIEAECSKGSWKGIITRLWPNTKYIDVIVTGTM  322

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             SQYIPTL+Y+ N LPLV T Y SSEC F INLNPL KP+EV+YT+IPTMAYFEFLPV+ +
Sbjct  323   SQYIPTLDYYSNGLPLVCTMYASSECYFGINLNPLCKPSEVSYTLIPTMAYFEFLPVNGQ  382

Query  951   IGVPEPN----------PVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNN  802
              G+   N            E++DLV VKLGQ+YE+VVTTYAGLYRYRVGDILRVAGFKNN
Sbjct  383   KGLTGSNSEPASLNDKEKQELVDLVSVKLGQDYELVVTTYAGLYRYRVGDILRVAGFKNN  442

Query  801   TPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHY  622
              PQFNF+CRKNV LSID+DKTDEVEL +AVKNA+N LLPFDASLIEYTS+A+TS IPGHY
Sbjct  443   APQFNFICRKNVVLSIDSDKTDEVELQHAVKNAANQLLPFDASLIEYTSYADTSAIPGHY  502

Query  621   VLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKM  442
             VLYWEI+ +    IP  +FEDCCF VEESLNSVYR+ RV DKSIGPLEI+IVENGTFDK+
Sbjct  503   VLYWEISVNDATLIPASVFEDCCFTVEESLNSVYRQGRVWDKSIGPLEIKIVENGTFDKL  562

Query  441   MDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             MD+A++ G+SI+QYK PRCV   PI+ELL+SRV+S+YFSPK P W PGHK W
Sbjct  563   MDFALSQGASINQYKTPRCVKYVPIIELLNSRVISSYFSPKCPRWTPGHKQW  614



>ref|XP_008359299.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like isoform 
X2 [Malus domestica]
Length=614

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/603 (68%), Positives = 489/603 (81%), Gaps = 14/603 (2%)
 Frame = -1

Query  2058  SSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRET  1879
             +S+++ NL++ NN+IL FIE+VT N  +VQ+RVL  IL+ NA VEYL RHGLNG TDR+T
Sbjct  10    NSTEDYNLQDKNNKILHFIEEVTKNPDEVQKRVLAEILTRNAHVEYLQRHGLNGHTDRDT  69

Query  1878  FKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELER  1699
             FKK++PV+ YED++ DINR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL+R
Sbjct  70    FKKMMPVIKYEDIQSDINRIANGDTSQILCSKPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1698  KSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTY  1519
             +SL  SLLMPV++Q+VP L KGK MYFLF++ EAKTPGGL+ARPVLTS  K S+FK+R Y
Sbjct  130   RSLLYSLLMPVMSQYVPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKQRPY  189

Query  1518  TNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWR  1339
              +PYT+ TSP ETILC DS+QSMYSQ+LC L    +VLRVG +FAS FIRAI FLEKHW 
Sbjct  190   -DPYTNYTSPXETILCPDSYQSMYSQLLCSLCQNKEVLRVGAVFASGFIRAIRFLEKHWT  248

Query  1338  LLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKY  1159
             LLC DI +GTLNP+ITDPSVR+AV +I+KP+P LA FIE EC K SW GII R+W NTKY
Sbjct  249   LLCKDIASGTLNPQITDPSVRQAVMKILKPDPKLASFIEAECGKASWHGIITRLWPNTKY  308

Query  1158  IDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAY  979
             +DV+VTG MSQYIPTL Y+ N LP V T Y SSEC F +NLNPL KP+EV+YT+IPTM Y
Sbjct  309   VDVIVTGTMSQYIPTLEYYSNGLPQVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMGY  368

Query  978   FEFLPVSREIGVPEPNPVEV------------LDLVDVKLGQEYEVVVTTYAGLYRYRVG  835
             FEFLPV R  G+   NP+ V            +DL DVKLGQEYE+VVTTYAGLYRYRVG
Sbjct  369   FEFLPVQRNNGI-NSNPLSVPKSLNEKEQQQLVDLADVKLGQEYELVVTTYAGLYRYRVG  427

Query  834   DILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTS  655
             D+LRVA FKNN PQFNF+CRKNV LSID+DKTDEVEL NAVKNA N L+PFDA++ EYTS
Sbjct  428   DVLRVASFKNNAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFDATVTEYTS  487

Query  654   HANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEI  475
              A+T+TIPGHYVL+WE++ +   PIP  +FEDCCF  EESLNSVYR+ R SDKSIGPLEI
Sbjct  488   FADTTTIPGHYVLFWELSLNGTTPIPPSVFEDCCFTAEESLNSVYRQGRASDKSIGPLEI  547

Query  474   RIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGH  295
             +IVE GTFDK+MDYAI+ G+SI+QYK PRCV  APIVELL +RV+S+YFSPK P+W PGH
Sbjct  548   KIVEAGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLSTRVVSSYFSPKCPKWVPGH  607

Query  294   KHW  286
             K W
Sbjct  608   KQW  610



>ref|XP_010062931.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Eucalyptus 
grandis]
 gb|KCW70081.1| hypothetical protein EUGRSUZ_F03386 [Eucalyptus grandis]
Length=611

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/600 (69%), Positives = 490/600 (82%), Gaps = 14/600 (2%)
 Frame = -1

Query  2046  ERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKL  1867
             + NL + N + LQFIEDVT NA +VQ RVL  ILS NA VEYL RHGL+G TDRE+FKK 
Sbjct  13    DDNLHDKNRKALQFIEDVTANADEVQRRVLAEILSRNAHVEYLRRHGLDGQTDRESFKKT  72

Query  1866  IPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLY  1687
             +PV+TYED++PD+ R+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL R+SL 
Sbjct  73    LPVITYEDLQPDVTRIANGDKSPILCSHPISEFLTSSGTSGGERKLMPTIEEELNRRSLL  132

Query  1686  SSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPY  1507
              SLLMPV++Q+VP+L KGK MYFLF++ EAKTPGGL+ARPVLTS  K S+FK+R Y +PY
Sbjct  133   YSLLMPVMSQYVPNLEKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKERPY-DPY  191

Query  1506  TDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCH  1327
             T+ TSP ETILC DS+QSMYSQ+LCGL    +VLRVG +FAS FIRAI FLE HW LLC 
Sbjct  192   TNYTSPNETILCPDSYQSMYSQLLCGLCQHKEVLRVGAVFASGFIRAIRFLENHWALLCR  251

Query  1326  DIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVV  1147
             DIRTG++NP ITDP++REAV RI+KP+P LA+FIE EC  +SW GII R+W NTKY+DV+
Sbjct  252   DIRTGSINPEITDPAIREAVMRILKPDPKLADFIEAECGNDSWGGIITRLWPNTKYVDVI  311

Query  1146  VTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL  967
             VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+EV+YT+IPTMAYFEFL
Sbjct  312   VTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMAYFEFL  371

Query  966   PVSREIGVPEPNPV------------EVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILR  823
             PV R  G    NP+            +++DLVDVKLGQEYE+VVTTYAGLYRYRVGD+LR
Sbjct  372   PVHRNNGAAN-NPISMPKSLNEKEQRDLVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLR  430

Query  822   VAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANT  643
             VAGFKN  PQFNF+CRKNV LSID+DKTDEVEL NAVKNA N L PFDA + EYTS+A+T
Sbjct  431   VAGFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNALNHLAPFDAIVAEYTSYADT  490

Query  642   STIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVE  463
             STIPGHYVL+WE++ +  NPIP  +FEDCC AVEESLNSVYR+ RVSD+SIGPLEI+IVE
Sbjct  491   STIPGHYVLFWELSLNGSNPIPPSVFEDCCLAVEESLNSVYRQGRVSDRSIGPLEIKIVE  550

Query  462   NGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
              GTFDK+MD AI+ G+SI+QYK PRCV  AP++E+L+SRV+S YFSPK P+W PGHK W+
Sbjct  551   PGTFDKLMDCAISYGASINQYKTPRCVKFAPLLEILNSRVVSKYFSPKCPKWVPGHKQWS  610



>ref|XP_011020987.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Populus 
euphratica]
 ref|XP_011048519.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Populus 
euphratica]
Length=608

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/596 (70%), Positives = 490/596 (82%), Gaps = 12/596 (2%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGS-TDRETFKKLIPVV  1855
             E + + LQFIEDVT NA +VQ +VL  ILS NA VEYL R+GL G+  DRETFKK++PVV
Sbjct  13    EKSRKALQFIEDVTRNADEVQSKVLAEILSRNANVEYLQRYGLKGNKADRETFKKVMPVV  72

Query  1854  TYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLL  1675
             +YED+KPDI+R+ANG+   IICS PISEF TSSGTS GE KL+PT EEEL R+SL  SLL
Sbjct  73    SYEDLKPDIDRIANGDTCQIICSQPISEFLTSSGTSAGERKLMPTIEEELGRRSLLYSLL  132

Query  1674  MPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCT  1495
             MPV+NQFVP L +GK MYFLF++ EAKTPGGLLARPVLTS  K SYF+ R Y +PY + T
Sbjct  133   MPVMNQFVPGLDRGKGMYFLFIKSEAKTPGGLLARPVLTSYYKSSYFRDRPY-DPYNNYT  191

Query  1494  SPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRT  1315
             SP ETILC DS+QSMYSQ+LCGL+    VLRVG +FAS FIRAI FLEKHW +LC+DIR 
Sbjct  192   SPNETILCQDSYQSMYSQLLCGLYQNYDVLRVGAVFASGFIRAIKFLEKHWIMLCNDIRN  251

Query  1314  GTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGA  1135
             GT++P+I+DPSVREAV +I+KPN  LA+F+E EC +ESWKGII R+W NTKYIDV+VTG 
Sbjct  252   GTIDPKISDPSVREAVLKILKPNQKLADFVEAECTRESWKGIITRLWPNTKYIDVIVTGT  311

Query  1134  MSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSR  955
             MSQYIPTL+Y+ + LPLV T Y SSEC F +NLNPLSKP+EV+YT+IPTMAYFEFLPV+R
Sbjct  312   MSQYIPTLDYYCDGLPLVCTMYASSECYFGLNLNPLSKPSEVSYTLIPTMAYFEFLPVNR  371

Query  954   EIG----VPEPNPV------EVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKN  805
             + G    +  P  +      E++DLVDVKLG+EYE+VVTTYAGLYRYRVGDILRVAGFKN
Sbjct  372   KNGLINSITAPTSLDQKKDEELVDLVDVKLGEEYELVVTTYAGLYRYRVGDILRVAGFKN  431

Query  804   NTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGH  625
               PQFNFVCRKNV LSID+DKTDEVEL NAV+NA+N LLPF ASL EYTS+A+TS IPGH
Sbjct  432   KAPQFNFVCRKNVVLSIDSDKTDEVELQNAVQNAANHLLPFGASLTEYTSYADTSKIPGH  491

Query  624   YVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDK  445
             YVL+WEI  S   PIP  +FEDCC A+EESLNSVYR+ RVSDKSIGPLEIRI E GTFDK
Sbjct  492   YVLFWEICLSGTTPIPPSVFEDCCLAIEESLNSVYRQGRVSDKSIGPLEIRITERGTFDK  551

Query  444   MMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             +MD+A++ G+SI+QYK PRCV  API+ELL+SRV+SNY SPK P+W PGHK W T+
Sbjct  552   LMDFALSQGASINQYKAPRCVKYAPIIELLNSRVVSNYISPKCPKWVPGHKQWCTS  607



>gb|KFK27060.1| hypothetical protein AALP_AA8G329100 [Arabis alpina]
Length=612

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/607 (69%), Positives = 493/607 (81%), Gaps = 13/607 (2%)
 Frame = -1

Query  2067  ALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTD  1888
             ALE S  +++L E N   LQFIE+VT+NA  VQ RVL+AILS NA VEYL RHGL G TD
Sbjct  9     ALEVS--DQSLVEKNKSKLQFIEEVTSNADDVQRRVLEAILSRNADVEYLKRHGLQGRTD  66

Query  1887  RETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEE  1708
             RETFK ++PVVTYED++P+INR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEE
Sbjct  67    RETFKHVLPVVTYEDIQPEINRIANGDKSQILCSNPISEFLTSSGTSGGERKLMPTIEEE  126

Query  1707  LERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKK  1528
             L+R+SL  SLLMPV++QFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FKK
Sbjct  127   LDRRSLLYSLLMPVMDQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKK  186

Query  1527  RTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEK  1348
             R Y +PYT+ TSP +TILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEK
Sbjct  187   RPY-DPYTNYTSPNQTILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEK  245

Query  1347  HWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRN  1168
             HW  L  DIRTGTLN  ITDPSVREAV  I+KP+P LA+F+E EC K SW+GII R+W N
Sbjct  246   HWPELALDIRTGTLNSEITDPSVREAVGEILKPDPKLADFVESECRKSSWQGIITRLWPN  305

Query  1167  TKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPT  988
             TKY+DV+VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IPT
Sbjct  306   TKYVDVIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPT  365

Query  987   MAYFEFLPVSREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRV  838
             MAYFEFLPV R  GV           E    E++DLVDVKLGQEYE+VVTTYAGLYRYRV
Sbjct  366   MAYFEFLPVHRNSGVTSSISLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLYRYRV  425

Query  837   GDILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYT  658
             GD+LRVAGFKNN PQF+F+CRKNVALSIDADKTDEVEL NAVKNA   L+PFDA+L EYT
Sbjct  426   GDVLRVAGFKNNAPQFSFICRKNVALSIDADKTDEVELQNAVKNAVTHLVPFDATLSEYT  485

Query  657   SHANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLE  478
             S+A+TS+IPGHYVL+WE+  +    IP  +FEDCC  +EESLNSVYR+ RVSD+SIGPLE
Sbjct  486   SYADTSSIPGHYVLFWELCMNGNTAIPPSVFEDCCLTIEESLNSVYRQGRVSDRSIGPLE  545

Query  477   IRIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPG  298
             I+IVE+GTFDK+MDYAI+ G+SI+QYK PRCV  API+ELL++RV+ +YFSPK P+W PG
Sbjct  546   IKIVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNTRVVDSYFSPKCPKWVPG  605

Query  297   HKHWNTN  277
             +K W +N
Sbjct  606   YKQWGSN  612



>ref|XP_004294315.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Fragaria 
vesca subsp. vesca]
Length=607

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/601 (68%), Positives = 491/601 (82%), Gaps = 12/601 (2%)
 Frame = -1

Query  2046  ERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKL  1867
             + +L+E N + L+FIE VT NA +VQ+RVL  IL+ NA VEYL RHGLNG TDRETFKKL
Sbjct  6     KNSLKEKNEKALKFIESVTENADEVQKRVLSEILAANAHVEYLQRHGLNGHTDRETFKKL  65

Query  1866  IPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLY  1687
             +PV+TY+ ++PDINR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEELER+SL 
Sbjct  66    MPVITYDHIQPDINRIANGDTSQILCSKPISEFLTSSGTSGGERKLMPTIEEELERRSLL  125

Query  1686  SSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPY  1507
              SLLMPV++Q+VP+L  GK MYFLFV+ EAKTPGGL+ARPVLTS  K S+FK+R Y +PY
Sbjct  126   YSLLMPVMSQYVPELETGKGMYFLFVKSEAKTPGGLVARPVLTSYYKSSHFKQRPY-DPY  184

Query  1506  TDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCH  1327
             T+ TSP ETILC DS+QSMYSQ+LCGL    +VLRVG +FAS FIRAI FLEKHW +LC 
Sbjct  185   TNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWSILCK  244

Query  1326  DIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVV  1147
             DI +GTLN +ITDPSVR++V++I+KP+P LA FI  EC K+SW+GII R+W NTKY+DV+
Sbjct  245   DIESGTLNSQITDPSVRDSVSKILKPDPKLAGFIATECGKKSWQGIITRLWPNTKYVDVI  304

Query  1146  VTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL  967
             VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNP+ KP+EV+YT+IPTM YFEFL
Sbjct  305   VTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPMCKPSEVSYTLIPTMCYFEFL  364

Query  966   PVSREIGV-----------PEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRV  820
             PV+R  GV            E   ++++DLVDVKLGQEYE+VVTTYAGLYRYRVGD+LRV
Sbjct  365   PVNRNNGVNSDSVSVPESLTEKEQLQLVDLVDVKLGQEYELVVTTYAGLYRYRVGDLLRV  424

Query  819   AGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTS  640
             AGFKN  PQFNF+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDA++ EYTS+A+TS
Sbjct  425   AGFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDANVGEYTSYADTS  484

Query  639   TIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVEN  460
              IPGHYVL+WE++ +   PIP  +FEDCC A+EESLNSVYR+ R SDKSIGPLEI+IVE 
Sbjct  485   KIPGHYVLFWELSLNGTTPIPPSVFEDCCLAIEESLNSVYRQGRASDKSIGPLEIKIVEA  544

Query  459   GTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNT  280
             GTFDK+MDYAI+ G+SI+QYK PRCV  APIVELL+SRV S YFSPK P+W PGHK W  
Sbjct  545   GTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVASTYFSPKCPKWVPGHKQWCK  604

Query  279   N  277
             N
Sbjct  605   N  605



>ref|XP_003540050.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Glycine 
max]
Length=607

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/596 (69%), Positives = 484/596 (81%), Gaps = 12/596 (2%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             NL E N + L+FIEDVT NA QVQ+RVL  ILS NA VEYL RH L+G TDRETFKKL+P
Sbjct  9     NLFEQNKKTLEFIEDVTANADQVQKRVLSEILSNNANVEYLKRHDLHGQTDRETFKKLLP  68

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             V+TYED++PDINR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL R+SL  S
Sbjct  69    VITYEDIQPDINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELGRRSLLYS  128

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV++QFVP L KGK MY +F++ EAKTPGG++ARPVLTS  K SYFK R Y +PYT+
Sbjct  129   LLMPVMSQFVPGLEKGKGMYLMFIKSEAKTPGGIVARPVLTSYYKSSYFKDRPY-DPYTN  187

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ET+LC DS+QSMYSQ+LCGL    +VLRVG +FAS FIRAI FLEKHW LLCHDI
Sbjct  188   YTSPNETVLCPDSYQSMYSQLLCGLCQHKEVLRVGAVFASGFIRAIRFLEKHWPLLCHDI  247

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             RTGT+N  ITD SVR+AV +I+KP+P L + I+ EC K SW+GII R+W NTKY+DV+VT
Sbjct  248   RTGTINNTITDLSVRDAVMKILKPDPRLGDLIQSECGKSSWQGIITRLWPNTKYVDVIVT  307

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+EV+YT+IPTM Y+EFLPV
Sbjct  308   GTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMCYYEFLPV  367

Query  960   SREIGVP-----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAG  814
             +R  GV            E    E+++LVDVKLGQEYE+VVTTYAGLYRYRVGD+LRVAG
Sbjct  368   NRSNGVSHDSLHTPRSLNEKEQQELVELVDVKLGQEYELVVTTYAGLYRYRVGDVLRVAG  427

Query  813   FKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTI  634
             FKN  PQFNFVCRKNV LSID+DKTDEVEL NA+KNA   L+PFDAS+ EYTS+A+T+TI
Sbjct  428   FKNKAPQFNFVCRKNVVLSIDSDKTDEVELQNAMKNAVTHLVPFDASVSEYTSYADTTTI  487

Query  633   PGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGT  454
             PGHYVLYWE++     PIP  +FEDCC A+EESLNSVYR+ RVSDKSIGPLEI+IVE GT
Sbjct  488   PGHYVLYWELSLKGSTPIPPCVFEDCCLAIEESLNSVYRQGRVSDKSIGPLEIKIVEQGT  547

Query  453   FDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             FDK+MDYAI+ G+SI+QYK PRCV  AP+VELL+SRV+  YFSPK P+W PGHK W
Sbjct  548   FDKLMDYAISLGASINQYKTPRCVKFAPVVELLNSRVVEKYFSPKCPKWVPGHKQW  603



>gb|KHG29342.1| Indole-3-acetic acid-amido synthetase GH3.6 -like protein [Gossypium 
arboreum]
Length=613

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/612 (68%), Positives = 497/612 (81%), Gaps = 12/612 (2%)
 Frame = -1

Query  2082  DAMTDALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGL  1903
             +A  + L+ ++D  NLE  N + LQFIEDVT+NA +VQ++VL+ ILS NA VEY  RHGL
Sbjct  3     EAPKNTLKPTAD-YNLELKNKKTLQFIEDVTSNADEVQKKVLEEILSRNAHVEYFQRHGL  61

Query  1902  NGSTDRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIP  1723
             NG TDRETFK ++PV+TYED++P ++R+ANG+ S I+ S PISEF TSSGTS GE KL+P
Sbjct  62    NGHTDRETFKTIMPVITYEDIQPYVDRIANGDTSPILSSHPISEFLTSSGTSGGERKLMP  121

Query  1722  TTEEELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKR  1543
             T EEEL R+SL  SLLMPV++QFVP L KGK MYFLF++ EAKTP GL+ARPVLTS  K 
Sbjct  122   TIEEELGRRSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKSEAKTPSGLVARPVLTSYYKS  181

Query  1542  SYFKKRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAI  1363
             ++FK R Y +PYT+ TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI
Sbjct  182   THFKDRPY-DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAI  240

Query  1362  HFLEKHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIP  1183
              FLEKHWR LC+DIRTGT++ +I D SVREAV +I+KP+P LA+FIE EC+K+SW+GII 
Sbjct  241   KFLEKHWRFLCNDIRTGTIDSQINDQSVREAVTKILKPDPKLADFIEAECSKDSWQGIIT  300

Query  1182  RIWRNTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAY  1003
             R+W NTKY+DV+VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+EV+Y
Sbjct  301   RLWPNTKYVDVIVTGTMSQYIPTLDYYTNGLPLVCTMYASSECYFGVNLNPLCKPSEVSY  360

Query  1002  TIIPTMAYFEFLPVSREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGL  853
             T+IPTMAYFEFLPV R  GV           E    E++DLVDVKLGQEYE+VVTTY+GL
Sbjct  361   TLIPTMAYFEFLPVQRNNGVTSSISVPKTLNEKEQQELVDLVDVKLGQEYELVVTTYSGL  420

Query  852   YRYRVGDILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDAS  673
             YRYRVGD+LRVAGFKNN PQFNF+CRKNV L ID+DKTDEVEL NAVKNA N LLPF A+
Sbjct  421   YRYRVGDVLRVAGFKNNAPQFNFICRKNVVLCIDSDKTDEVELQNAVKNAVNHLLPFGAT  480

Query  672   LIEYTSHANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKS  493
             L EYTS+A+T+TIPGHYVLYWE++ +   PIP  +FEDCC  +EESLNSVYR+ RV DKS
Sbjct  481   LAEYTSYADTTTIPGHYVLYWELSLNGNTPIPPSVFEDCCLTIEESLNSVYRQGRVCDKS  540

Query  492   IGPLEIRIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPP  313
             IGPLEI+IVE GTFDK+MDYAI+ G+SI+QYK PRCV  APIVELL+SR +S+YFSPK P
Sbjct  541   IGPLEIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRAVSSYFSPKCP  600

Query  312   EWAPGHKHWNTN  277
             +W PGHK W+ N
Sbjct  601   KWFPGHKQWSNN  612



>ref|XP_009763610.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Nicotiana 
sylvestris]
Length=609

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/601 (69%), Positives = 490/601 (82%), Gaps = 11/601 (2%)
 Frame = -1

Query  2055  SSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETF  1876
             S++   + E+N ++LQFIE+VTTNA +VQ+RVL  ILS NA VEYL RH LNG TDR+TF
Sbjct  7     SAEYSVVAENNKKVLQFIEEVTTNADEVQKRVLAEILSQNAHVEYLHRHDLNGHTDRDTF  66

Query  1875  KKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERK  1696
             KK +PV+TYED++  I R+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEELER+
Sbjct  67    KKTMPVITYEDIQSVITRIANGDKSPILCSQPISEFLTSSGTSGGERKLMPTIEEELERR  126

Query  1695  SLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYT  1516
             S   SLLMPV++QFVPDL KGK MYFLF++ EAKTPGGL ARPVLTS  K  +FK R   
Sbjct  127   SKLYSLLMPVMSQFVPDLEKGKGMYFLFIKSEAKTPGGLPARPVLTSYYKSPHFKNRR-P  185

Query  1515  NPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRL  1336
             +PYT+ TSP ETILC+DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW L
Sbjct  186   DPYTNYTSPNETILCSDSYQSMYSQMLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWPL  245

Query  1335  LCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYI  1156
             LCHDIRTGT+N +ITDPSVREAV +I+KP+  LA+FIE EC+K SW+GII R+W NTKYI
Sbjct  246   LCHDIRTGTINSQITDPSVREAVMKILKPDNKLADFIEVECSKNSWQGIITRLWPNTKYI  305

Query  1155  DVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYF  976
             DV+VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+EVAYT+IPTM YF
Sbjct  306   DVIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVAYTLIPTMGYF  365

Query  975   EFLPVSREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDIL  826
             EFLPV R  GV           E    E++DLVDVK+GQEYE+VVTTYAGLYRYRVGD+L
Sbjct  366   EFLPVHRNNGVTNSISMPKSLNEKEQQELVDLVDVKIGQEYELVVTTYAGLYRYRVGDVL  425

Query  825   RVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHAN  646
             RVAGFKNN PQFNF+CRKNV LSID+DKTDEVEL NAVKNA + L+PFDA + EYTS+A+
Sbjct  426   RVAGFKNNAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVSHLMPFDAHVTEYTSYAD  485

Query  645   TSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIV  466
             T+TIPGHYVL+WE+  +   P+P  +FEDCC  +EESLNSVYR+ R SDKSIGPLEI+IV
Sbjct  486   TTTIPGHYVLFWELNVNGSTPVPPSVFEDCCLTIEESLNSVYRQGRASDKSIGPLEIKIV  545

Query  465   ENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             E+GTFDK+MDYAI+ G+SI+QYK PRCV  APIVELL+SRV+S+YFSPK P+W PG K W
Sbjct  546   ESGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYFSPKCPKWVPGLKQW  605

Query  285   N  283
             N
Sbjct  606   N  606



>emb|CDY43824.1| BnaC03g14570D [Brassica napus]
Length=612

 Score =   861 bits (2224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/604 (68%), Positives = 488/604 (81%), Gaps = 11/604 (2%)
 Frame = -1

Query  2058  SSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRET  1879
             S   +++L E N   LQFIE+VT+NA  VQ RVL+ ILS NA VEYL RHGL G TDRE+
Sbjct  10    SELSDQSLAEKNKNKLQFIEEVTSNADDVQRRVLEEILSRNADVEYLKRHGLQGRTDRES  69

Query  1878  FKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELER  1699
             FK ++PVVTYED++PDINR++NG+ S I+CS+PISEF TSSGTS GE KL+PT EEEL+R
Sbjct  70    FKHVMPVVTYEDIQPDINRISNGDKSQILCSSPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1698  KSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTY  1519
             +SL  SLLMPV++QFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FK R Y
Sbjct  130   RSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKNRPY  189

Query  1518  TNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWR  1339
              +PYT+ TSP +TILC DS+QSMYSQMLCGL   ++VLRVG +FAS FIRAI FLEKHW 
Sbjct  190   -DPYTNYTSPNQTILCPDSYQSMYSQMLCGLCQHNEVLRVGAVFASGFIRAIKFLEKHWP  248

Query  1338  LLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKY  1159
              L HDIRTGTLN  ITD SVREAV  I+KP+P LA+F+E EC K SW+GII R+W NTKY
Sbjct  249   ELVHDIRTGTLNSEITDLSVREAVEEILKPDPKLADFVETECRKTSWQGIITRLWPNTKY  308

Query  1158  IDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAY  979
             +DV+VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IPTMAY
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMAY  368

Query  978   FEFLPVSREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDI  829
             FEFLPV R  GV           E    E++DLVDVKLGQEYE+VVTTYAGLYRYRVGD+
Sbjct  369   FEFLPVHRNSGVTSSISLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLYRYRVGDV  428

Query  828   LRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHA  649
             LRVAGFKNN PQFNF+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDASL EYTS+A
Sbjct  429   LRVAGFKNNAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEYTSYA  488

Query  648   NTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRI  469
             +TS+IPGHYVL+WE+  +   P+P  + EDCC  +EESLNSVYR+ RVSDKSIGPLEI++
Sbjct  489   DTSSIPGHYVLFWELCLNGGTPVPPSVLEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKV  548

Query  468   VENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             VE+GTFDK+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+  YFSPK P+W PGHK 
Sbjct  549   VESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVKTYFSPKCPKWIPGHKQ  608

Query  288   WNTN  277
             W +N
Sbjct  609   WGSN  612



>ref|XP_009355553.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Pyrus 
x bretschneideri]
Length=614

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/601 (68%), Positives = 485/601 (81%), Gaps = 14/601 (2%)
 Frame = -1

Query  2052  SDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFK  1873
             +++ NL++ NN+IL FIE+VT N  +VQ+RVL  IL+ NA VEYL RHGLNG TDR+TFK
Sbjct  12    TEDYNLQDKNNKILHFIEEVTKNPDEVQKRVLAEILTRNAHVEYLQRHGLNGHTDRDTFK  71

Query  1872  KLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKS  1693
             K++PV+ YED++ DINR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL+R+S
Sbjct  72    KMMPVIKYEDIQSDINRIANGDTSQILCSKPISEFLTSSGTSGGERKLMPTIEEELDRRS  131

Query  1692  LYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTN  1513
             L  SLLMPV++Q+VP L KGK MYFLF++ EAKTPGGL+ARPVLTS  K S+FK+R Y +
Sbjct  132   LLYSLLMPVMSQYVPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKQRPY-D  190

Query  1512  PYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLL  1333
             PYT+ TSP ETILC DS+QSMYSQ+LCGL    +VLRVG +FAS FIRAI FLEKHW LL
Sbjct  191   PYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWTLL  250

Query  1332  CHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYID  1153
             C DI +GTLNP+ITDPSV EAV +I+KP+P LA FIE EC K SW GII R+W NTKY+D
Sbjct  251   CKDIASGTLNPQITDPSVHEAVMKILKPDPKLASFIEAECGKASWHGIITRLWPNTKYVD  310

Query  1152  VVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFE  973
             V+VTG MSQYIPTL Y+ N LP V T Y SSEC F +NLNPL KP+EV+YT+IPTM YFE
Sbjct  311   VIVTGTMSQYIPTLEYYSNGLPQVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMGYFE  370

Query  972   FLPVSREIGVPEPNPVEV------------LDLVDVKLGQEYEVVVTTYAGLYRYRVGDI  829
             FLPV R  G+   NP+ V            LDL D KLGQEYE+VVTTYAGLYRYRVGD+
Sbjct  371   FLPVQRNNGI-NSNPLSVPKSLNEKEQQQLLDLADAKLGQEYELVVTTYAGLYRYRVGDV  429

Query  828   LRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHA  649
             LRVA FKN  PQFNF+CRKNV LSID+DKTDEVEL NAVKNA N L+PFDA++ EYTS A
Sbjct  430   LRVASFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFDATVTEYTSFA  489

Query  648   NTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRI  469
             +T+TIPGHYVL+WE++ +   PIP  +FEDCCF  EESLNSVYR+ R SDKSIGPLEI+I
Sbjct  490   DTTTIPGHYVLFWELSLNGTTPIPPSVFEDCCFTAEESLNSVYRQGRASDKSIGPLEIKI  549

Query  468   VENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             VE GTFDK+MDYAI+ G+SI+QYK PRCV  APIVELL +RV+S+YFSPK P+W PGHK 
Sbjct  550   VEAGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLSTRVVSSYFSPKCPKWVPGHKQ  609

Query  288   W  286
             W
Sbjct  610   W  610



>ref|XP_007021139.1| Auxin-responsive GH3 family protein [Theobroma cacao]
 gb|EOY12664.1| Auxin-responsive GH3 family protein [Theobroma cacao]
Length=611

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/598 (69%), Positives = 488/598 (82%), Gaps = 11/598 (2%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             +LE  N + LQFIEDVT+NA  VQ++VL+ ILS NA VEYL RHGLNG TDRETFKK++P
Sbjct  15    SLELKNKKTLQFIEDVTSNADGVQKKVLEEILSRNAHVEYLQRHGLNGHTDRETFKKVMP  74

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             V+TYED++P I+R+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL R+SL  S
Sbjct  75    VITYEDIQPHIDRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELGRRSLLYS  134

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV++QFVP L KGK MYFLF++ EAKTP GL+ARPVLTS  K S+FK R Y +PYT+
Sbjct  135   LLMPVMSQFVPGLDKGKGMYFLFIKSEAKTPSGLVARPVLTSYYKSSHFKDRPY-DPYTN  193

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW LLC DI
Sbjct  194   YTSPNETILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIRFLEKHWPLLCKDI  253

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             R GT++ +ITD  VREAV +I+KP+P LA+FIE EC+K+SW+GII R+W NTKY+DV+VT
Sbjct  254   RAGTVDAQITDQPVREAVMKILKPDPKLADFIEAECSKDSWQGIITRLWPNTKYVDVIVT  313

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IPTMAYFEFLPV
Sbjct  314   GTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLKPLCKPSEVSYTLIPTMAYFEFLPV  373

Query  960   SREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGF  811
              R  GV           E    +++DLVDVKLGQEYE+VVTTYAGLYRYRVGD+LRVAGF
Sbjct  374   HRNNGVTNSISVPKSLNEKEQQQLVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLRVAGF  433

Query  810   KNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIP  631
             KN  PQFNF+CRKNV LSID+DKTDEVEL +AVKNA N LLPFDA+L EYTS+A+T+TIP
Sbjct  434   KNKAPQFNFICRKNVVLSIDSDKTDEVELQHAVKNAVNHLLPFDATLAEYTSYADTTTIP  493

Query  630   GHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTF  451
             GHYVLYWE++ +   PIP  +FEDCC  +EESLNSVYR+ RV DKSIGPLEI+IVE GTF
Sbjct  494   GHYVLYWELSLNGTTPIPPSVFEDCCLTIEESLNSVYRQGRVCDKSIGPLEIKIVEPGTF  553

Query  450   DKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             DK+MDYAI+ G+SI+QYK PRCV  APIVELL+SR +S+YFSPK P+W PG K WN N
Sbjct  554   DKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRAVSSYFSPKCPKWLPGRKQWNMN  611



>ref|XP_002866046.1| hypothetical protein ARALYDRAFT_918581 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42305.1| hypothetical protein ARALYDRAFT_918581 [Arabidopsis lyrata subsp. 
lyrata]
Length=612

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/607 (69%), Positives = 489/607 (81%), Gaps = 13/607 (2%)
 Frame = -1

Query  2067  ALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTD  1888
             ALE S  + +L E N   LQFIEDVTTNA  VQ RVL+ ILS NA VEYL RHGL+G TD
Sbjct  9     ALEVS--DESLAEKNKNKLQFIEDVTTNADDVQRRVLEEILSRNADVEYLKRHGLDGRTD  66

Query  1887  RETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEE  1708
             RETFK ++PVVTYED++P+INR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEE
Sbjct  67    RETFKHVMPVVTYEDIQPEINRIANGDKSQILCSNPISEFLTSSGTSGGERKLMPTIEEE  126

Query  1707  LERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKK  1528
             L+R+SL  SLLMPV+NQFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FK 
Sbjct  127   LDRRSLLYSLLMPVMNQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKN  186

Query  1527  RTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEK  1348
             R + +PY + TSP +TILC+DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEK
Sbjct  187   RPF-DPYNNYTSPNQTILCSDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEK  245

Query  1347  HWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRN  1168
             HW  L  DIRTGTL+  ITD SVREAV  I+KP+P LA+F+E EC K SW+GII R+W N
Sbjct  246   HWSELARDIRTGTLSSEITDLSVREAVGEILKPDPKLADFVESECRKTSWQGIITRLWPN  305

Query  1167  TKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPT  988
             TKY+DV+VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IP 
Sbjct  306   TKYVDVIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPN  365

Query  987   MAYFEFLPVSREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRV  838
             MAYFEFLPV R  GV           E    E++DLVDVKLGQEYE+VVTTYAGLYRYRV
Sbjct  366   MAYFEFLPVHRNSGVTSSISLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLYRYRV  425

Query  837   GDILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYT  658
             GD+L VAGFKNN PQF+F+CRKNVALSID+DKTDEVEL NAVKNA   L+PFDASL EYT
Sbjct  426   GDVLSVAGFKNNAPQFSFICRKNVALSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEYT  485

Query  657   SHANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLE  478
             S+A TS+IPGHYVL+WE+  +   PIP  +FEDCC  +EESLNSVYR+ RVSDKSIGPLE
Sbjct  486   SYAETSSIPGHYVLFWELCLNGNTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPLE  545

Query  477   IRIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPG  298
             I++VE+GTFDK+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+ +YFSPK P+WAPG
Sbjct  546   IKMVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDSYFSPKCPKWAPG  605

Query  297   HKHWNTN  277
             HK W +N
Sbjct  606   HKQWGSN  612



>ref|XP_002276241.2| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Vitis 
vinifera]
Length=614

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/595 (70%), Positives = 486/595 (82%), Gaps = 10/595 (2%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             L++ N R L+FIEDVT NA +VQ +VL  I++ N+ VEYL RHGLNG  D +TFKK++PV
Sbjct  21    LDDKNIRALEFIEDVTMNAKEVQMQVLSEIITRNSNVEYLQRHGLNGRVDADTFKKIVPV  80

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             VTYED+ PDI R+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL R+SL  SL
Sbjct  81    VTYEDMLPDIERIANGDMSPILCSKPISEFLTSSGTSGGERKLMPTIEEELGRRSLLYSL  140

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV+NQ VP L +GK MYFLFV+ EAKTPGGL+ARPVLTS  K SYF+ R Y +PYT+ 
Sbjct  141   LMPVMNQSVPGLDEGKGMYFLFVKSEAKTPGGLMARPVLTSYYKSSYFRDRPY-DPYTNY  199

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP ETILC DS+QSMYSQ+LCGL    +VLRVG +FAS FIRAI FLEKHW LLC DIR
Sbjct  200   TSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWVLLCKDIR  259

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
              GTL+ +I DPSVREAV RI+KPNP+LA+FIE EC +ESW+GII R+W NTKYIDV+VTG
Sbjct  260   AGTLDSQINDPSVREAVKRILKPNPELADFIEAECRRESWEGIITRLWPNTKYIDVIVTG  319

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
              MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+EV+YT+IPTMAYFEFLPV+
Sbjct  320   TMSQYIPTLDYYSNGLPLVCTMYASSECYFGLNLNPLCKPSEVSYTLIPTMAYFEFLPVN  379

Query  957   REIG---VPEPNPV------EVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKN  805
             R+ G   V E  P+      E++DLVDVKLGQEYE+VVTTYAGLYRYRVGDIL VAGFKN
Sbjct  380   RKNGFTNVSESAPLNEKEHQELVDLVDVKLGQEYELVVTTYAGLYRYRVGDILCVAGFKN  439

Query  804   NTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGH  625
               PQF F+CRKNVALSID+DKTDE EL NAVKNA++ LL FDAS+ EYTS+A+TSTIPGH
Sbjct  440   KAPQFKFICRKNVALSIDSDKTDEFELQNAVKNAADHLLQFDASVTEYTSYADTSTIPGH  499

Query  624   YVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDK  445
             YVLYWEI  S   PIP  +FEDCC  +EESLNSVYR+ R SDKSIGPLEIRIVE GTFDK
Sbjct  500   YVLYWEIGLSGATPIPPSVFEDCCLIMEESLNSVYRQGRASDKSIGPLEIRIVEGGTFDK  559

Query  444   MMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNT  280
             +MDYA++ G+SI+QYK PRCV  API+ELL+SRV+SNYFSPK P+W  GHK W T
Sbjct  560   LMDYALSQGASINQYKTPRCVKYAPIIELLNSRVVSNYFSPKCPKWVAGHKQWCT  614



>ref|XP_009132438.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Brassica 
rapa]
Length=608

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/608 (68%), Positives = 490/608 (81%), Gaps = 11/608 (2%)
 Frame = -1

Query  2076  MTDALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNG  1897
             M +A E +  ++ LEE N   LQFIE+VT+NA +VQ +VL+ ILS NA VEYL RHGL G
Sbjct  1     MPEAPELAVSDQILEEKNKNKLQFIEEVTSNADEVQRQVLEEILSRNADVEYLKRHGLQG  60

Query  1896  STDRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTT  1717
              TDRETFK ++PVVTYED++PDINR+ANG+ S I+CS+PISEF TSSGTS GE KL+PT 
Sbjct  61    RTDRETFKHVMPVVTYEDIQPDINRIANGDKSQILCSSPISEFLTSSGTSGGERKLMPTI  120

Query  1716  EEELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSY  1537
             EEEL+R+SL  SLLMPV++QFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+
Sbjct  121   EEELDRRSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSH  180

Query  1536  FKKRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHF  1357
             FK R Y +PYT+ TSP +TILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI F
Sbjct  181   FKNRPY-DPYTNYTSPNQTILCPDSYQSMYSQMLCGLCQHSEVLRVGAVFASGFIRAIKF  239

Query  1356  LEKHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRI  1177
             LEKHW  L HDIRTGTLN  ITD SVREAV  I+KP+P LA+FIE EC K SW+GII R+
Sbjct  240   LEKHWPQLVHDIRTGTLNSEITDLSVREAVEEILKPDPRLADFIETECRKTSWQGIITRL  299

Query  1176  WRNTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTI  997
             W NTKY+DV+VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NL P+ KP+EV+YT+
Sbjct  300   WPNTKYVDVIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPVCKPSEVSYTL  359

Query  996   IPTMAYFEFLPVSREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYR  847
             IPTMAYFEFLPV R  GV           E    E++DLVDVKLGQEYE+VVTTYAGLYR
Sbjct  360   IPTMAYFEFLPVHRNSGVTSSISLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLYR  419

Query  846   YRVGDILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLI  667
             YRVGD+LRVAGFKNN PQF+F+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDASL 
Sbjct  420   YRVGDVLRVAGFKNNAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLS  479

Query  666   EYTSHANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIG  487
             EYTS+A+TS+IPGHYVL+WE+  +   P+P  + EDCC  +EESLNSVYR+ RVSDKSIG
Sbjct  480   EYTSYADTSSIPGHYVLFWELCLNGGTPVPPSVLEDCCLTIEESLNSVYRQGRVSDKSIG  539

Query  486   PLEIRIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEW  307
             PLEI++VE+GTFDK+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+  YFSPK P+W
Sbjct  540   PLEIKVVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVKTYFSPKCPKW  599

Query  306   APGHKHWN  283
              PGHK W 
Sbjct  600   IPGHKQWG  607



>emb|CDY43037.1| BnaA03g11840D [Brassica napus]
Length=603

 Score =   859 bits (2219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/595 (69%), Positives = 489/595 (82%), Gaps = 2/595 (0%)
 Frame = -1

Query  2058  SSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRET  1879
             S   ++ LEE N   LQFIE+VT+NA +VQ +VL+ ILS NA VEYL RHGL G TDRET
Sbjct  10    SEVSDQILEEKNKNKLQFIEEVTSNADEVQRQVLEEILSRNADVEYLKRHGLQGRTDRET  69

Query  1878  FKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELER  1699
             FK ++PVVTYED++PDINR+ANG+ S I+CS+PISEF TSSGTS GE KL+PT EEEL+R
Sbjct  70    FKHVMPVVTYEDIQPDINRIANGDKSQILCSSPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1698  KSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTY  1519
             +SL  SLLMPV++QFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FK R Y
Sbjct  130   RSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKNRPY  189

Query  1518  TNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWR  1339
              +PYT+ TSP +TILC DS+QSMYSQMLCGL   ++VLRVG +FAS FIRAI FLEKHW 
Sbjct  190   -DPYTNYTSPNQTILCPDSYQSMYSQMLCGLCQHNEVLRVGAVFASGFIRAIKFLEKHWP  248

Query  1338  LLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKY  1159
              L HDIRTGTLN  ITD SVREAV  I+KP+P LA+FIE EC K SW+GII R+W NTKY
Sbjct  249   QLVHDIRTGTLNSEITDLSVREAVEEILKPDPKLADFIETECRKTSWQGIITRLWPNTKY  308

Query  1158  IDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAY  979
             +DV+VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NL P+ KP+EV+YT+IPTMAY
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPVCKPSEVSYTLIPTMAY  368

Query  978   FEFLPVSREIG-VPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNN  802
             FEFLPV R  G + E    +++DLVDVKLGQEYE+VVTTYAGLYRYRVGD+LRVA FKNN
Sbjct  369   FEFLPVHRNSGALTEKEQQDLVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLRVADFKNN  428

Query  801   TPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHY  622
              PQF+F+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDASL EYTS+A+TS+IPGHY
Sbjct  429   APQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVAHLVPFDASLSEYTSYADTSSIPGHY  488

Query  621   VLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKM  442
             VL+WE+  + + P+P  + EDCC  +EESLNSVYR+ RVSDKSIGPLEI++VE+GTFDK+
Sbjct  489   VLFWELCLNGDTPVPPSVLEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKVVESGTFDKL  548

Query  441   MDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+  YFSPK P+W PGHK W +N
Sbjct  549   MDYAISLGASINQYKTPRCVKFAPIIELLNSRVVKTYFSPKCPKWIPGHKQWGSN  603



>ref|XP_006280192.1| hypothetical protein CARUB_v10026098mg [Capsella rubella]
 gb|EOA13090.1| hypothetical protein CARUB_v10026098mg [Capsella rubella]
Length=613

 Score =   859 bits (2219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/606 (69%), Positives = 489/606 (81%), Gaps = 13/606 (2%)
 Frame = -1

Query  2058  SSSD--ERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDR  1885
             +SSD  + +L E N   LQFIEDVTTNA  VQ RVL+ ILS NA VEYL RHGL G TDR
Sbjct  9     ASSDVSDESLAEKNKNKLQFIEDVTTNADDVQRRVLEEILSRNADVEYLKRHGLQGRTDR  68

Query  1884  ETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEEL  1705
             ETFK ++PVVTYED++P+INR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL
Sbjct  69    ETFKHVVPVVTYEDIQPEINRIANGDKSQILCSNPISEFLTSSGTSGGERKLMPTIEEEL  128

Query  1704  ERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKR  1525
             +R+SL  SLLMPV+NQFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FK R
Sbjct  129   DRRSLLYSLLMPVMNQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKNR  188

Query  1524  TYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKH  1345
              + +PYT+ TSP +TILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKH
Sbjct  189   PF-DPYTNYTSPNQTILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKH  247

Query  1344  WRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNT  1165
             W  L  DIRTGTL+  ITD SVREAV  I+KP+P LA+F+E EC K SW+GII RIW NT
Sbjct  248   WPELARDIRTGTLSSEITDLSVREAVGEILKPDPKLADFVESECRKTSWQGIITRIWPNT  307

Query  1164  KYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTM  985
             KY+DV+VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IP M
Sbjct  308   KYVDVIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPNM  367

Query  984   AYFEFLPVSREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVG  835
             AYFEFLPV R  GV           E    E++DLVDVKLGQEYE+VVTTYAGLYRYRVG
Sbjct  368   AYFEFLPVHRNSGVTSSISLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLYRYRVG  427

Query  834   DILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTS  655
             D+L VAGFKNN+PQF+F+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDASL EYTS
Sbjct  428   DVLSVAGFKNNSPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEYTS  487

Query  654   HANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEI  475
             +A+TS+IPGHYVL+WE+  +   PIP  +FEDCC  +EESLNSVYR+ RVSDKSIGPLEI
Sbjct  488   YADTSSIPGHYVLFWELCLNGNTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPLEI  547

Query  474   RIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGH  295
             +IVE+GTFDK+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+++YFSPK P+W PGH
Sbjct  548   KIVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVNSYFSPKCPKWVPGH  607

Query  294   KHWNTN  277
             K W +N
Sbjct  608   KQWGSN  613



>ref|NP_200262.1| indole-3-acetic acid-amido synthetase GH3.6 [Arabidopsis thaliana]
 sp|Q9LSQ4.1|GH36_ARATH RecName: Full=Indole-3-acetic acid-amido synthetase GH3.6; AltName: 
Full=Auxin-responsive GH3-like protein 6; Short=AtGH3-6; 
AltName: Full=Protein DWARF IN LIGHT 1; Short=DFL-1 [Arabidopsis 
thaliana]
 dbj|BAA97524.1| auxin-responsive-like protein [Arabidopsis thaliana]
 dbj|BAB17304.1| auxin-responsive GH3 homologue [Arabidopsis thaliana]
 gb|AAX12878.1| At5g54510 [Arabidopsis thaliana]
 gb|ACI46505.1| At5g54510 [Arabidopsis thaliana]
 gb|AED96504.1| indole-3-acetic acid-amido synthetase GH3.6 [Arabidopsis thaliana]
Length=612

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/607 (68%), Positives = 489/607 (81%), Gaps = 13/607 (2%)
 Frame = -1

Query  2067  ALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTD  1888
             ALE S  + +L E N   LQFIEDVTTNA  VQ RVL+ ILS NA VEYL RHGL G TD
Sbjct  9     ALEVS--DESLAEKNKNKLQFIEDVTTNADDVQRRVLEEILSRNADVEYLKRHGLEGRTD  66

Query  1887  RETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEE  1708
             RETFK ++PVVTYED++P+INR+ANG+ S ++CS PISEF TSSGTS GE KL+PT EEE
Sbjct  67    RETFKHIMPVVTYEDIQPEINRIANGDKSQVLCSNPISEFLTSSGTSGGERKLMPTIEEE  126

Query  1707  LERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKK  1528
             L+R+SL  SLLMPV++QFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FK 
Sbjct  127   LDRRSLLYSLLMPVMDQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKN  186

Query  1527  RTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEK  1348
             R Y +PYT+ TSP +TILC+DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEK
Sbjct  187   RPY-DPYTNYTSPNQTILCSDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEK  245

Query  1347  HWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRN  1168
             HW  L  DIRTGTL+  ITD SVREAV  I+KP+P LA+F+E EC K SW+GII R+W N
Sbjct  246   HWPELARDIRTGTLSSEITDSSVREAVGEILKPDPKLADFVESECRKTSWQGIITRLWPN  305

Query  1167  TKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPT  988
             TKY+DV+VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IP 
Sbjct  306   TKYVDVIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPN  365

Query  987   MAYFEFLPVSREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRV  838
             MAYFEFLPV R  GV           E    E++DLVDVKLGQEYE+VVTTYAGLYRYRV
Sbjct  366   MAYFEFLPVHRNSGVTSSISLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLYRYRV  425

Query  837   GDILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYT  658
             GD+L VAGFKNN PQF+F+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDASL EYT
Sbjct  426   GDVLSVAGFKNNAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEYT  485

Query  657   SHANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLE  478
             S+A+TS+IPGHYVL+WE+  +   PIP  +FEDCC  +EESLNSVYR+ RVSDKSIGPLE
Sbjct  486   SYADTSSIPGHYVLFWELCLNGNTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPLE  545

Query  477   IRIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPG  298
             I++VE+GTFDK+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+ +YFSPK P+W+PG
Sbjct  546   IKMVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDSYFSPKCPKWSPG  605

Query  297   HKHWNTN  277
             HK W +N
Sbjct  606   HKQWGSN  612



>ref|XP_008365943.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Malus 
domestica]
 ref|XP_008345064.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Malus 
domestica]
Length=614

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/601 (68%), Positives = 489/601 (81%), Gaps = 14/601 (2%)
 Frame = -1

Query  2052  SDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFK  1873
             +++ NL++ NN+IL FIE+VT    +VQ+RVL  IL+ NA VEYL RHGLNG TDR+TFK
Sbjct  12    TEDYNLQDKNNKILHFIEEVTKTPHEVQKRVLAEILTRNAHVEYLQRHGLNGHTDRDTFK  71

Query  1872  KLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKS  1693
             K++PV+ YED++ DINR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEELER+S
Sbjct  72    KIMPVIKYEDIQSDINRIANGDTSHILCSKPISEFLTSSGTSGGERKLMPTIEEELERRS  131

Query  1692  LYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTN  1513
             L  SLLMPV++Q+VP L KGK MYFLF++ EAKTPGGL+ARPVLTS  K S+FK+R Y +
Sbjct  132   LLYSLLMPVMSQYVPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKQRPY-D  190

Query  1512  PYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLL  1333
             PYT+ TSP ETILC DS+QSMYSQ+LCGL    +VLRVG +FAS FIRAI FLEKHW +L
Sbjct  191   PYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWTIL  250

Query  1332  CHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYID  1153
             C DI +GTLNP+ITDPSVREAV +I+KP+P LA FIE EC ++SW GII R+W NTKY+D
Sbjct  251   CKDIASGTLNPQITDPSVREAVMKILKPDPKLASFIEGECRRDSWHGIITRLWPNTKYVD  310

Query  1152  VVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFE  973
             V+VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+EV+YT+IPTM YFE
Sbjct  311   VIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMGYFE  370

Query  972   FLPVSREIGVPEPNPV------------EVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDI  829
             FLPV R  G+   NPV            E++DL DVKLGQEYE+VVTTYAGLYRYRVGD+
Sbjct  371   FLPVQRNNGI-NTNPVSVRKSLNEKEHQELVDLADVKLGQEYELVVTTYAGLYRYRVGDV  429

Query  828   LRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHA  649
             LRV  FKN  PQFNF+CRKNV LSID+DKTDEVEL NAVKNA N L+PF+A++ EYTS+A
Sbjct  430   LRVTSFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFEATVTEYTSYA  489

Query  648   NTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRI  469
             +T+TIPGHYVL+WE++ +   P+P  +FEDCC  VEESLNSVYR+ R SDKSIGPLEI+I
Sbjct  490   DTTTIPGHYVLFWELSFNGTTPVPPSVFEDCCLTVEESLNSVYRQGRASDKSIGPLEIKI  549

Query  468   VENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             VE GTFDK+MDYAI+ G+SI+QYK PRCV  APIVELL +RV+SNY SPK P+W PGHK 
Sbjct  550   VETGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLTTRVVSNYHSPKCPKWVPGHKQ  609

Query  288   W  286
             W
Sbjct  610   W  610



>ref|XP_003526154.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Glycine 
max]
Length=609

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/596 (69%), Positives = 483/596 (81%), Gaps = 12/596 (2%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             NL E N + L+FIEDVT NA QVQ+RVL  ILS NA  EYL RHGL+G TDRETFKKL+P
Sbjct  9     NLLEQNKKTLEFIEDVTANADQVQKRVLSEILSNNANAEYLKRHGLHGQTDRETFKKLLP  68

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             V+TYED++PDINR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL R+SL  S
Sbjct  69    VITYEDIQPDINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELGRRSLLYS  128

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV++QFVP L KGK MY +F++ EAKTPGG++ARPVLTS  K SYFK R Y +PYT+
Sbjct  129   LLMPVMSQFVPGLEKGKGMYLMFIKSEAKTPGGIVARPVLTSYYKSSYFKDRPY-DPYTN  187

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ET+LC DS+QSMYSQ+LCGL    +VLRVG +FAS FIRAI FLEKHW LLCHDI
Sbjct  188   YTSPNETVLCLDSYQSMYSQLLCGLCQHKEVLRVGAVFASGFIRAIRFLEKHWPLLCHDI  247

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             RTGT++  +TD SVR+AV +I+KP+  LA+ I+ EC K SW+GII R+W NTKY+DV+VT
Sbjct  248   RTGTIDNTVTDLSVRDAVMKILKPDARLADLIQCECGKSSWQGIITRLWPNTKYVDVIVT  307

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+EV+YT+IPTM YFEFLPV
Sbjct  308   GTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMCYFEFLPV  367

Query  960   SREIGVPEPN-----------PVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAG  814
             +R  GV   N             E+++LVDVKLGQEYE+VVTTYAGLYRYRVGD+LRVAG
Sbjct  368   NRSNGVSHDNLHTPRSLNEKEQKELVELVDVKLGQEYELVVTTYAGLYRYRVGDVLRVAG  427

Query  813   FKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTI  634
             FKN  PQFNFVCRKNV LSID+DKTDEVEL NA+KNA   L+PFDAS+ EYTS+A+T+TI
Sbjct  428   FKNKAPQFNFVCRKNVVLSIDSDKTDEVELQNAMKNAVTHLVPFDASVSEYTSYADTTTI  487

Query  633   PGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGT  454
             PGHYVLYWE++     PIP  +FEDCC  +EESLNSVYR+ RVSDKSIGPLEI+IVE GT
Sbjct  488   PGHYVLYWELSLKGSTPIPPCVFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKIVEQGT  547

Query  453   FDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             FDK+MDYAI+ G+SI+QYK PRCV  AP++ELL+SRV+  YFSPK P+W PGHK W
Sbjct  548   FDKLMDYAISLGASINQYKTPRCVKFAPVLELLNSRVVEKYFSPKCPKWVPGHKQW  603



>ref|XP_008359298.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like isoform 
X1 [Malus domestica]
Length=618

 Score =   857 bits (2214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/607 (68%), Positives = 489/607 (81%), Gaps = 18/607 (3%)
 Frame = -1

Query  2058  SSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRET  1879
             +S+++ NL++ NN+IL FIE+VT N  +VQ+RVL  IL+ NA VEYL RHGLNG TDR+T
Sbjct  10    NSTEDYNLQDKNNKILHFIEEVTKNPDEVQKRVLAEILTRNAHVEYLQRHGLNGHTDRDT  69

Query  1878  FKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTS----SGTSKGENKLIPTTEE  1711
             FKK++PV+ YED++ DINR+ANG+ S I+CS PISEF TS    SGTS GE KL+PT EE
Sbjct  70    FKKMMPVIKYEDIQSDINRIANGDTSQILCSKPISEFLTSFCCSSGTSGGERKLMPTIEE  129

Query  1710  ELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFK  1531
             EL+R+SL  SLLMPV++Q+VP L KGK MYFLF++ EAKTPGGL+ARPVLTS  K S+FK
Sbjct  130   ELDRRSLLYSLLMPVMSQYVPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFK  189

Query  1530  KRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLE  1351
             +R Y +PYT+ TSP ETILC DS+QSMYSQ+LC L    +VLRVG +FAS FIRAI FLE
Sbjct  190   QRPY-DPYTNYTSPXETILCPDSYQSMYSQLLCSLCQNKEVLRVGAVFASGFIRAIRFLE  248

Query  1350  KHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWR  1171
             KHW LLC DI +GTLNP+ITDPSVR+AV +I+KP+P LA FIE EC K SW GII R+W 
Sbjct  249   KHWTLLCKDIASGTLNPQITDPSVRQAVMKILKPDPKLASFIEAECGKASWHGIITRLWP  308

Query  1170  NTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIP  991
             NTKY+DV+VTG MSQYIPTL Y+ N LP V T Y SSEC F +NLNPL KP+EV+YT+IP
Sbjct  309   NTKYVDVIVTGTMSQYIPTLEYYSNGLPQVCTMYASSECYFGVNLNPLCKPSEVSYTLIP  368

Query  990   TMAYFEFLPVSREIGVPEPNPVEV------------LDLVDVKLGQEYEVVVTTYAGLYR  847
             TM YFEFLPV R  G+   NP+ V            +DL DVKLGQEYE+VVTTYAGLYR
Sbjct  369   TMGYFEFLPVQRNNGI-NSNPLSVPKSLNEKEQQQLVDLADVKLGQEYELVVTTYAGLYR  427

Query  846   YRVGDILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLI  667
             YRVGD+LRVA FKNN PQFNF+CRKNV LSID+DKTDEVEL NAVKNA N L+PFDA++ 
Sbjct  428   YRVGDVLRVASFKNNAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFDATVT  487

Query  666   EYTSHANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIG  487
             EYTS A+T+TIPGHYVL+WE++ +   PIP  +FEDCCF  EESLNSVYR+ R SDKSIG
Sbjct  488   EYTSFADTTTIPGHYVLFWELSLNGTTPIPPSVFEDCCFTAEESLNSVYRQGRASDKSIG  547

Query  486   PLEIRIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEW  307
             PLEI+IVE GTFDK+MDYAI+ G+SI+QYK PRCV  APIVELL +RV+S+YFSPK P+W
Sbjct  548   PLEIKIVEAGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLSTRVVSSYFSPKCPKW  607

Query  306   APGHKHW  286
              PGHK W
Sbjct  608   VPGHKQW  614



>ref|XP_008226758.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Prunus 
mume]
Length=614

 Score =   857 bits (2214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/595 (69%), Positives = 486/595 (82%), Gaps = 12/595 (2%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             L++ N + LQFIE+VT NA +VQ+RVL  IL+ NA VEYL RHGLNG TDR+TFKK+IPV
Sbjct  17    LQDKNEKALQFIEEVTENADEVQKRVLAEILARNAHVEYLQRHGLNGHTDRDTFKKIIPV  76

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             + YED++ DINR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEELER+SL  SL
Sbjct  77    IKYEDIEADINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELERRSLLYSL  136

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV++Q VP+L KGK MYFLF++ EAKTPGGL+ARPVLTS  K S+FK+R Y +PYT+ 
Sbjct  137   LMPVMSQSVPELDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKRRPY-DPYTNY  195

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP ETILC DS+QSMYSQ+LCGL    +V+RVG +FAS FIRAI FLEKHW  LC DI 
Sbjct  196   TSPNETILCPDSYQSMYSQLLCGLCQNKEVIRVGAVFASGFIRAIRFLEKHWPSLCRDIA  255

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             +GTLNP+ITDPSVREAV + +KP+P LA  IE EC K+SW+GII R+W NTKY+DV+VTG
Sbjct  256   SGTLNPQITDPSVREAVMKTLKPDPKLANCIETECGKKSWQGIITRLWPNTKYVDVIVTG  315

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
              MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+EV+YT++P+M YFEFLPV 
Sbjct  316   TMSQYIPTLDYYSNGLPLVCTMYASSECYFGLNLNPLCKPSEVSYTLVPSMGYFEFLPVQ  375

Query  957   REIGVP-----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGF  811
             R  G+            E    E++DLVDVKLGQEYE+VVTTYAGLYRYRVGD+LRVAGF
Sbjct  376   RNNGINSNSLSVPKSLNEKEQQELVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLRVAGF  435

Query  810   KNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIP  631
             KN  PQFNFVCRKNV LSID+DKTDEVEL  AVKNA + L+PFDA++ EYTS A+TSTIP
Sbjct  436   KNKAPQFNFVCRKNVVLSIDSDKTDEVELQTAVKNAVSHLVPFDATVSEYTSFADTSTIP  495

Query  630   GHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTF  451
             GHYVL+WE+  +   PIP  ++EDCC AVEESLNSVYR+ RVSDKSIGPLEI+IVE GTF
Sbjct  496   GHYVLFWELCLNGSTPIPPSVYEDCCLAVEESLNSVYRQGRVSDKSIGPLEIKIVEAGTF  555

Query  450   DKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             DK+MDYAI+ G+SI+QYK PRCV  APIVELL+SRV+SNYFSPK P+W PGHK W
Sbjct  556   DKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSNYFSPKCPKWVPGHKQW  610



>ref|XP_011095287.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Sesamum 
indicum]
Length=612

 Score =   856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/601 (69%), Positives = 490/601 (82%), Gaps = 13/601 (2%)
 Frame = -1

Query  2052  SDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFK  1873
             S E ++ E+N + L+FIEDVT NA +VQ+RVL  ILS NA VEYL RHGLNG TDRETFK
Sbjct  11    SAEYSVAENNRKKLEFIEDVTKNADEVQKRVLAEILSRNADVEYLKRHGLNGHTDRETFK  70

Query  1872  KLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKS  1693
             K++PV+TYED+ PDINR+ANG+ S I+CS PISEF TSSGTS GE K++PT EEELER+S
Sbjct  71    KIMPVITYEDILPDINRIANGDTSPILCSEPISEFLTSSGTSAGERKVMPTIEEELERRS  130

Query  1692  LYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTN  1513
             L  SLLMPV++QFVP L +GK MYFLF++ E KTPGGLLARPVLTS  K S+FK R + +
Sbjct  131   LLYSLLMPVMSQFVPGLDQGKAMYFLFIKCETKTPGGLLARPVLTSYYKSSHFKDRPF-D  189

Query  1512  PYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLL  1333
             PYT+ TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW LL
Sbjct  190   PYTNYTSPNETILCADSYQSMYSQMLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWTLL  249

Query  1332  CHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYID  1153
             CHDIRTGT+N  ITDPSVREAV RI+KP+P LA+FIE EC+KESW+GII ++W NTKYID
Sbjct  250   CHDIRTGTVNSLITDPSVREAVMRILKPDPKLADFIESECSKESWQGIITKLWPNTKYID  309

Query  1152  VVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFE  973
             V+VTG MSQYIPTL+Y+ + LPLV T Y SSEC F +NLNPL KP+EV+YT+IPTM Y+E
Sbjct  310   VIVTGTMSQYIPTLDYYSDGLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMCYYE  369

Query  972   FLPVSREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILR  823
             FLPV R  G+           E    E++DLVDVKLGQEYE+VVTTYAGLYRYRVGD+LR
Sbjct  370   FLPVHRNNGLTNSISMPKSLNEKEQQELVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLR  429

Query  822   VAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANT  643
             VAGFKNN PQFNFVCRKNV LSID DKTDEVEL NAV+NA + L+PF A L EYTS+A+T
Sbjct  430   VAGFKNNAPQFNFVCRKNVVLSIDTDKTDEVELQNAVRNAVSHLMPFGARLTEYTSYADT  489

Query  642   STIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVE  463
             +TIPGHYVLYWE++Q    PIP  +FEDCC  +EESL++VYR+ RV + +IGPLEI+IVE
Sbjct  490   TTIPGHYVLYWELSQMGSTPIPPSVFEDCCLTIEESLDNVYRQNRVFE-AIGPLEIKIVE  548

Query  462   NGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEW-APGHKHW  286
              GTFDK+MDYAI+ G+SI+QYK PRCV  APIVELL+SRV+S YFSPK P+W  PG K W
Sbjct  549   TGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSKYFSPKCPKWTTPGLKQW  608

Query  285   N  283
             +
Sbjct  609   S  609



>ref|XP_006475255.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Citrus 
sinensis]
Length=628

 Score =   856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/601 (68%), Positives = 493/601 (82%), Gaps = 11/601 (2%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             +L+E N + L+FIE+VT+N  +VQ++VL  IL  NA VEYL R+GLNG TDRE+FKK +P
Sbjct  14    SLDEMNKKKLEFIENVTSNPDEVQKKVLSEILLRNAHVEYLQRNGLNGHTDRESFKKTMP  73

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             V+TYED++ DINR+ANG+ SSI+CS PISEF TSSGTS GE KL+PT EEELER+SL  S
Sbjct  74    VITYEDIQADINRIANGDTSSILCSKPISEFLTSSGTSGGERKLMPTIEEELERRSLLYS  133

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV++QF+P L KGK MYFLF++ EAKTPGGL+ARPVLTS  K  +FK+R Y +PYT+
Sbjct  134   LLMPVMSQFIPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSCHFKERPY-DPYTN  192

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ETILC DS+QSMYSQ+LCGL    +VLRVG +FAS FIRAI FLEKHW L+  DI
Sbjct  193   YTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWPLVVKDI  252

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             RTGT++ +ITDPSVR+AV +I+KPNP LA+FIE EC K+ W+GII R+W NTKY+DV+VT
Sbjct  253   RTGTIDSQITDPSVRDAVMKILKPNPKLADFIENECRKDCWQGIITRLWPNTKYVDVIVT  312

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIP L+Y+ N LPLV T Y SSEC F +NLNPL KP+EV+YT++PTMAYFEFLPV
Sbjct  313   GTMSQYIPILDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLVPTMAYFEFLPV  372

Query  960   SREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGF  811
              R  GV           E    E++DLVDVKLGQEYE+VVTTYAGLYRYRVGD+LRVAGF
Sbjct  373   HRNNGVANSISMPKSLNEKERQELVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLRVAGF  432

Query  810   KNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIP  631
             KN  PQFNF+CRKNV LSID+DKTDEVEL NAVKNA N L+PFDA++ EYTS+A+T+T+P
Sbjct  433   KNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFDAAVSEYTSYADTTTVP  492

Query  630   GHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTF  451
             GHYVLYWE++ +   PIP  +FEDCC  +EESLNSVYR+ RV DKSIGPLEI+IVE GTF
Sbjct  493   GHYVLYWELSLNGTTPIPPSVFEDCCLTIEESLNSVYRQGRVCDKSIGPLEIKIVEPGTF  552

Query  450   DKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN*N  271
             DK+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+SNYFSPK P+W  GHK W++N N
Sbjct  553   DKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPKWVAGHKQWSSNNN  612

Query  270   Q  268
             +
Sbjct  613   K  613



>ref|XP_007133123.1| hypothetical protein PHAVU_011G153400g [Phaseolus vulgaris]
 gb|ESW05117.1| hypothetical protein PHAVU_011G153400g [Phaseolus vulgaris]
Length=606

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/595 (68%), Positives = 483/595 (81%), Gaps = 11/595 (2%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             NL E N +IL+FIEDVT NA +VQ+RVL  ILS NA VEYL RHGL+G TDRETFKKL+P
Sbjct  9     NLVEQNEKILEFIEDVTANADKVQKRVLSEILSNNANVEYLKRHGLHGQTDRETFKKLLP  68

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             V+TYED++PDINR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EE+L R+     
Sbjct  69    VITYEDIQPDINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEDLGRRRSLYG  128

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV++ FVP L KGK MY +F++ EAKTPGG++ARPVLTS  K SYFK R Y +PYT+
Sbjct  129   LLMPVMSLFVPGLEKGKGMYLMFIKSEAKTPGGIVARPVLTSYYKSSYFKDRPY-DPYTN  187

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ET+LC DS+QSMYSQ+LCGL    +V RVG +FAS FIRAI FLEKHW LLC+DI
Sbjct  188   YTSPNETVLCPDSYQSMYSQLLCGLCQNKEVFRVGAVFASGFIRAIRFLEKHWSLLCNDI  247

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             RTGT+NP+ITD SVREAV +I+KP+P LA+ I+ EC+K SW+GII R+W NT+Y+DV+VT
Sbjct  248   RTGTVNPQITDTSVREAVMKILKPDPKLADLIQTECSKNSWQGIITRLWPNTRYVDVIVT  307

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+EV+YT+IPTM YFEFLPV
Sbjct  308   GTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMCYFEFLPV  367

Query  960   SREIGVPEP----------NPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGF  811
             +R  GV +P             E+++LVDVKLGQEYE+VVTTYAGLYRYRVGD+LRVAGF
Sbjct  368   NRSNGVNDPLHTSRSLNEKEQQELVELVDVKLGQEYELVVTTYAGLYRYRVGDVLRVAGF  427

Query  810   KNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIP  631
             KN  PQFNFVCRKNV LSID+DKTDEVEL NA+KNA   L+PFDAS+ +YTS+A+T+TIP
Sbjct  428   KNKAPQFNFVCRKNVVLSIDSDKTDEVELQNAMKNAVTHLVPFDASVSDYTSYADTTTIP  487

Query  630   GHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTF  451
             GHYVLYWE+      PIP  +FEDCC  +EESLNSVYR+ RVSDKSIGPLEI+IVE GTF
Sbjct  488   GHYVLYWELALKGSTPIPPCVFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKIVEQGTF  547

Query  450   DKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             DK+MDYAI+ G+SI+QYK PRCV  AP+VELL+SRV+  YFSPK P+W  GHK W
Sbjct  548   DKLMDYAISLGASINQYKTPRCVKFAPVVELLNSRVVEKYFSPKCPKWVSGHKQW  602



>ref|XP_009346484.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Pyrus 
x bretschneideri]
Length=614

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/601 (68%), Positives = 484/601 (81%), Gaps = 14/601 (2%)
 Frame = -1

Query  2052  SDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFK  1873
             +++ NL++ NN+IL FIE+VT N  +VQ+RVL  IL+ NA VEYL RHGLNG TDR+TFK
Sbjct  12    TEDYNLQDKNNKILHFIEEVTKNPDEVQKRVLAEILTRNAHVEYLQRHGLNGHTDRDTFK  71

Query  1872  KLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKS  1693
             K++PV+ YED++ DINR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL+R+S
Sbjct  72    KMMPVIKYEDIQSDINRIANGDTSQILCSKPISEFLTSSGTSGGERKLMPTIEEELDRRS  131

Query  1692  LYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTN  1513
             L  SLLMPV++Q+VP L KGK MYFLF++ EAKTPGGL+ARPVLTS  K S+FK+R Y +
Sbjct  132   LLYSLLMPVMSQYVPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKQRPY-D  190

Query  1512  PYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLL  1333
             PYT+ TSP ETILC DS+QSMYSQ+LCGL    +VLRVG +FAS FIRAI FLEKHW LL
Sbjct  191   PYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWTLL  250

Query  1332  CHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYID  1153
             C DI +GTLN +ITDPSVREAV +I+KP+P LA FIE EC K SW GII R+W NTKY+D
Sbjct  251   CKDIASGTLNRQITDPSVREAVMKILKPDPKLASFIEAECGKASWHGIITRLWPNTKYVD  310

Query  1152  VVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFE  973
             V+VTG MSQYIPTL Y+ N LP V T Y SSEC F +NLNPL KP+EV+YT+IPTM YFE
Sbjct  311   VIVTGTMSQYIPTLEYYSNGLPQVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMGYFE  370

Query  972   FLPVSREIGVPEPNPVEV------------LDLVDVKLGQEYEVVVTTYAGLYRYRVGDI  829
              LPV R  G+   NP+ V            +DL D KLGQEYE+VVTTYAGLYRYRVGD+
Sbjct  371   LLPVQRNNGI-NSNPLSVPKSLNEKEQQQLVDLADAKLGQEYELVVTTYAGLYRYRVGDV  429

Query  828   LRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHA  649
             LRVA FKN  PQFNF+CRKNV LSID+DKTDEVEL NAVKNA N L+PFDA++ EYTS A
Sbjct  430   LRVASFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFDATVTEYTSFA  489

Query  648   NTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRI  469
             +T+TIPGHYVL+WE++ +   PIP  +FEDCCF  EESLNSVYR+ R SDKSIGPLEI+I
Sbjct  490   DTTTIPGHYVLFWELSLNGTTPIPPSVFEDCCFTAEESLNSVYRQGRASDKSIGPLEIKI  549

Query  468   VENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             VE GTFDK+MDYAI+ G+SI+QYK PRCV  APIVELL +RV+S+YFSPK P+W PGHK 
Sbjct  550   VEAGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLSTRVVSSYFSPKCPKWVPGHKQ  609

Query  288   W  286
             W
Sbjct  610   W  610



>ref|XP_011030915.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Populus 
euphratica]
Length=611

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/598 (68%), Positives = 488/598 (82%), Gaps = 11/598 (2%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             NL E N   LQFIEDVT+NA +VQ++VL+ ILS NA VEYL RHGLNG T+RETFKK++P
Sbjct  15    NLAEKNKESLQFIEDVTSNADEVQKKVLEEILSRNAHVEYLQRHGLNGQTNRETFKKVMP  74

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             V+ YED++PDINR+A+G+ S I+CS PISEF TSSGTS GE KL+PT  EEL R+SL  S
Sbjct  75    VINYEDIQPDINRIASGDASPILCSKPISEFLTSSGTSGGERKLMPTIVEELGRRSLLYS  134

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV+NQFVP L KGK MYFLF++ EAKTP GL+ARPVLTS  K ++FK R Y +PYT+
Sbjct  135   LLMPVMNQFVPGLEKGKGMYFLFIKSEAKTPSGLVARPVLTSYYKSTHFKDRPY-DPYTN  193

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEK+W+ L +DI
Sbjct  194   YTSPNETILCPDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIRFLEKYWKFLANDI  253

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             RTG ++P+ITDPS+REAV +I+KP+  LA+FIE EC+KESW+GII R+W NTKY+DV+VT
Sbjct  254   RTGIIDPQITDPSIREAVMKILKPDAKLADFIEAECSKESWQGIITRLWPNTKYVDVIVT  313

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNP+ KP+EV+YT+IPTMAYFEFLPV
Sbjct  314   GTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPICKPSEVSYTLIPTMAYFEFLPV  373

Query  960   SREIGV----------PEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGF  811
             +R  GV           E    E++DLVDVKL  EYE+VVTTYAGLYRYRVGD+LRV GF
Sbjct  374   NRNNGVINSVSRPKSLKEKEQQELVDLVDVKLDHEYELVVTTYAGLYRYRVGDVLRVVGF  433

Query  810   KNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIP  631
             KN  PQF+F+CRKNV LSID+DKTDEVEL +AVK A N L+PFDA+L EYTS+A+T+TIP
Sbjct  434   KNKAPQFSFICRKNVVLSIDSDKTDEVELQSAVKKAVNHLIPFDATLAEYTSYADTTTIP  493

Query  630   GHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTF  451
             GHYVL+WE++ +   PIP  +FEDCC  +EESLNSVYR+ RVSDKSIGPLEI+IVE GTF
Sbjct  494   GHYVLFWELSLNGSTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKIVEPGTF  553

Query  450   DKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             DK+MDYAI+ G+SI+QYK PRCV  APIVELL+SR +S YFSPK P+W PGHK WN N
Sbjct  554   DKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRAVSCYFSPKCPKWVPGHKQWNKN  611



>gb|AAL47444.1| AT5g54510/F24B18_13 [Arabidopsis thaliana]
Length=612

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/607 (68%), Positives = 488/607 (80%), Gaps = 13/607 (2%)
 Frame = -1

Query  2067  ALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTD  1888
             ALE S  + +L E N   LQFIEDVTTNA  VQ RVL+ ILS NA VEYL RHGL G TD
Sbjct  9     ALEVS--DESLAEKNKNKLQFIEDVTTNADDVQRRVLEEILSRNADVEYLKRHGLEGRTD  66

Query  1887  RETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEE  1708
             RETFK ++PVVTYED++P+INR+ANG+ S ++CS PISEF TSSGTS GE KL+PT EEE
Sbjct  67    RETFKHIMPVVTYEDIQPEINRIANGDKSQVLCSNPISEFLTSSGTSGGERKLMPTIEEE  126

Query  1707  LERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKK  1528
             L+R+SL  SLLMPV++QFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FK 
Sbjct  127   LDRRSLLYSLLMPVMDQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKN  186

Query  1527  RTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEK  1348
             R Y +PYT+ TSP +TILC+DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEK
Sbjct  187   RPY-DPYTNYTSPNQTILCSDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEK  245

Query  1347  HWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRN  1168
             HW  L  DIRTGTL+  ITD SVREAV  I+KP+P LA+F+E EC K SW+GII R+W N
Sbjct  246   HWPELARDIRTGTLSSEITDSSVREAVGEILKPDPKLADFVESECRKTSWQGIITRLWPN  305

Query  1167  TKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPT  988
             TKY+DV+VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IP 
Sbjct  306   TKYVDVIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPN  365

Query  987   MAYFEFLPVSREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRV  838
             MAYFEFLPV R  GV           E    E++DLVDVKLGQEYE+VVTTYAGLYRYRV
Sbjct  366   MAYFEFLPVHRNSGVTSSISLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLYRYRV  425

Query  837   GDILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYT  658
             GD+L VAGFKNN PQF+F+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDASL EYT
Sbjct  426   GDVLSVAGFKNNAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEYT  485

Query  657   SHANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLE  478
             S+A+TS+IPGHYVL+WE+  +   PIP  +FEDCC  +EESLNSVYR+ RVSDKSIGPLE
Sbjct  486   SYADTSSIPGHYVLFWELCLNGNTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPLE  545

Query  477   IRIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPG  298
             I++VE+GTFDK+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+ +YFSPK P+W+ G
Sbjct  546   IKMVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDSYFSPKCPKWSHG  605

Query  297   HKHWNTN  277
             HK W +N
Sbjct  606   HKQWGSN  612



>gb|KHG17209.1| Indole-3-acetic acid-amido synthetase GH3.6 -like protein [Gossypium 
arboreum]
Length=615

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/595 (68%), Positives = 484/595 (81%), Gaps = 11/595 (2%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E+NN++L+FIEDVT +A +VQ RVL  ILS +A VEYL R+GLNG TDRETFKK+IPVVT
Sbjct  21    ENNNKVLKFIEDVTADADEVQRRVLSEILSRSANVEYLQRYGLNGCTDRETFKKVIPVVT  80

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED+KPDI R+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL R+SL  SLLM
Sbjct  81    YEDLKPDIERIANGDTSPILCSQPISEFLTSSGTSAGERKLMPTIEEELGRRSLLYSLLM  140

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV++QF+P L KGK MYFLFV+ EAKTPGGL+ARPVLTS  K S+FK R   +PYT+ TS
Sbjct  141   PVMSQFLPGLDKGKGMYFLFVKSEAKTPGGLVARPVLTSYYKSSHFKNRP-NDPYTNYTS  199

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P+ETILC DS+QSMYSQ+LCGL+  + V+RVG +FAS FIRAI FLEKHW LLC DIRTG
Sbjct  200   PKETILCLDSYQSMYSQLLCGLFQNEDVVRVGAVFASGFIRAIQFLEKHWSLLCKDIRTG  259

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             T++ +ITDPSVREAV +I+KPNP LA+F+E EC+K SWKGII R+W  TKYIDV+VTG M
Sbjct  260   TIDSKITDPSVREAVMKILKPNPKLADFVEAECSKGSWKGIITRLWPETKYIDVIVTGTM  319

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             SQYIP L+Y+ N LPLV T Y SSEC F INLNPL  P+EV+YT+IP MAYFEFLPV+R+
Sbjct  320   SQYIPALDYYSNALPLVCTMYASSECYFGINLNPLCSPSEVSYTLIPNMAYFEFLPVTRK  379

Query  951   ----------IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNN  802
                         + +    +++DLV VKLGQ+YE+VVTTYAGLYRYRVGDILRV+GFKN 
Sbjct  380   DELTGSISGPTALNDKEKQQLVDLVHVKLGQDYELVVTTYAGLYRYRVGDILRVSGFKNK  439

Query  801   TPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHY  622
              PQFNF+CRKNVALSID+DKTDEVEL NAVK A+N LL ++ASL+EYTS+A+TS IPGHY
Sbjct  440   APQFNFICRKNVALSIDSDKTDEVELQNAVKTAANQLLQYEASLVEYTSYADTSAIPGHY  499

Query  621   VLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKM  442
             VL+WE++      I   +FEDCCF VEESLNSVYR+ RV DKSIGPLEIR+VENGTFD +
Sbjct  500   VLFWELSVKDSTLIAPSVFEDCCFTVEESLNSVYRQGRVCDKSIGPLEIRVVENGTFDML  559

Query  441   MDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             MD+A++ GSSI+QYK PRCV  API+ELL SRV+S+YFSPK P W  GHK W T 
Sbjct  560   MDFALSQGSSINQYKTPRCVKYAPIIELLSSRVISSYFSPKCPRWTAGHKQWCTQ  614



>ref|XP_009127083.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Brassica 
rapa]
Length=612

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/608 (68%), Positives = 490/608 (81%), Gaps = 13/608 (2%)
 Frame = -1

Query  2070  DALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGST  1891
             +ALE S  ++ L E N   LQFIE+VT+NA  VQ RVL+ ILS NA VEYL RHGL G T
Sbjct  8     EALEVS--DQTLAEKNKNRLQFIEEVTSNADDVQRRVLEEILSRNADVEYLKRHGLQGRT  65

Query  1890  DRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEE  1711
             DRETFK ++PVVTYED++P+INR+ANG+ S I+CS+PISEF TSSGTS GE KL+PT EE
Sbjct  66    DRETFKHVMPVVTYEDIQPEINRIANGDTSQILCSSPISEFLTSSGTSGGERKLMPTIEE  125

Query  1710  ELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFK  1531
             EL+R+SL  SLLMPV++QFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FK
Sbjct  126   ELDRRSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFK  185

Query  1530  KRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLE  1351
              R Y +PYT+ TSP +TILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLE
Sbjct  186   NRPY-DPYTNYTSPNQTILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLE  244

Query  1350  KHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWR  1171
             KHW  L  DIRTGTL+  ITD SVREAV  I+KP+P LA+FIE EC K SW+GII R+W 
Sbjct  245   KHWPELTRDIRTGTLSSEITDLSVREAVGEILKPDPKLADFIESECMKNSWQGIITRLWP  304

Query  1170  NTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIP  991
             NTKY+DV+VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IP
Sbjct  305   NTKYVDVIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIP  364

Query  990   TMAYFEFLPVSREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYR  841
             TMAYFEFLPV R  GV           E    E++DLVDVKLGQEYE+VVTTYAGLYRYR
Sbjct  365   TMAYFEFLPVHRNNGVTSSISLPKALTEKEQKELVDLVDVKLGQEYELVVTTYAGLYRYR  424

Query  840   VGDILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEY  661
             VGD+LRVAGFKNN PQF+F+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDASL EY
Sbjct  425   VGDVLRVAGFKNNAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEY  484

Query  660   TSHANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPL  481
             TS+A+TS+IPGHYVL+WE+  +   P+P  ++EDCC  +EES NSVYR+ RVSDKSIGPL
Sbjct  485   TSYADTSSIPGHYVLFWELCLNGNTPVPPSVYEDCCLTIEESFNSVYRQGRVSDKSIGPL  544

Query  480   EIRIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAP  301
             EI++VE+GTFDK+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+ +YFSPK P+W P
Sbjct  545   EIKVVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVKSYFSPKCPKWTP  604

Query  300   GHKHWNTN  277
             GHK W +N
Sbjct  605   GHKQWGSN  612



>ref|XP_011097950.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Sesamum 
indicum]
Length=613

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/597 (70%), Positives = 488/597 (82%), Gaps = 13/597 (2%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             ++ E+N R L+FIEDVT NA +VQ+RVL  ILS NA VEYL RHGL G  DR TFKK++P
Sbjct  15    SVAENNKRKLEFIEDVTRNADEVQKRVLAEILSRNADVEYLKRHGLTGQVDRHTFKKIMP  74

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             VVTYED+ PDINR+ANG+ S I+CS PISEF TSSGTS GE K++PT EEEL R+SL  S
Sbjct  75    VVTYEDILPDINRIANGDMSPILCSRPISEFLTSSGTSGGERKMMPTIEEELGRRSLLYS  134

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV++QFVP L KGK MYFLF++ E KTPGGLLARPVLTS  K S+FK R + +PYT+
Sbjct  135   LLMPVMSQFVPGLDKGKGMYFLFIKCETKTPGGLLARPVLTSYYKSSHFKDRPF-DPYTN  193

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW LLCHDI
Sbjct  194   YTSPNETILCPDSYQSMYSQMLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWTLLCHDI  253

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             RTGTLN  ITDPSVR+AV+RI+KP P LA+F+E EC+KESW+GII R+W NTKYIDV+VT
Sbjct  254   RTGTLNSLITDPSVRDAVSRILKPEPKLADFVESECSKESWQGIITRLWPNTKYIDVIVT  313

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP++VAYT+IPTMAYFEFLPV
Sbjct  314   GTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLRKPSDVAYTLIPTMAYFEFLPV  373

Query  960   SR------EIGVP----EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGF  811
              R       I +P    E    E++DLVDVKLGQEYE+VVTTYAGLYRYRVGD+LRVAGF
Sbjct  374   YRNNSITHSIAIPRSLNEKEQQELVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLRVAGF  433

Query  810   KNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIP  631
             KNN PQFNFVCRKNV LSID DKTDEV+L NAVKNA + L+PFDA L EYTS+A+T+TIP
Sbjct  434   KNNAPQFNFVCRKNVVLSIDTDKTDEVQLQNAVKNAVSHLMPFDARLTEYTSYADTTTIP  493

Query  630   GHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTF  451
             GHYVLYWE+ QS   PIP  +FEDCC  +EESL++VYR+ RV + +IGPLEI+IVE GTF
Sbjct  494   GHYVLYWELIQSGTIPIPPSVFEDCCLTIEESLDTVYRQNRVFE-AIGPLEIKIVEAGTF  552

Query  450   DKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEW-APGHKHWN  283
             DK+MDYAI+ G+SI+QYK PRCV  APIVELL+SRV+S++FSPK P+W  PG K WN
Sbjct  553   DKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSFFSPKCPKWTTPGLKQWN  609



>emb|CDY62097.1| BnaCnng39150D [Brassica napus]
Length=612

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/608 (68%), Positives = 489/608 (80%), Gaps = 13/608 (2%)
 Frame = -1

Query  2070  DALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGST  1891
             +ALE S  ++ L E N   LQ IE+VT+NA  VQ RVL+ ILS NA VEYL RHGL G T
Sbjct  8     EALEVS--DQTLAEKNKNRLQLIEEVTSNADDVQRRVLEEILSRNADVEYLKRHGLQGRT  65

Query  1890  DRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEE  1711
             DRETFK ++PVVTYED++P+INR+ANG+ S I+CSTPISEF TSSGTS GE KL+PT EE
Sbjct  66    DRETFKHVMPVVTYEDIQPEINRIANGDKSQILCSTPISEFLTSSGTSGGERKLMPTIEE  125

Query  1710  ELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFK  1531
             EL+R+SL  SLLMPV++QFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FK
Sbjct  126   ELDRRSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFK  185

Query  1530  KRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLE  1351
              R Y +PYT+ TSP +TILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLE
Sbjct  186   NRPY-DPYTNYTSPNQTILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLE  244

Query  1350  KHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWR  1171
             KHW  L  DIRTGTL+  ITD SVREAV  I+KP+P LA+FIE EC K SW+GII R+W 
Sbjct  245   KHWPELTRDIRTGTLSSEITDLSVREAVGEILKPDPKLADFIESECKKNSWQGIITRLWP  304

Query  1170  NTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIP  991
             NTKY+DV+VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IP
Sbjct  305   NTKYVDVIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIP  364

Query  990   TMAYFEFLPVSREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYR  841
             TMAYFEFLPV R  GV           E    E++DLVDVKLGQEYE+VVTTYAGLYRYR
Sbjct  365   TMAYFEFLPVHRNNGVTSSISLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLYRYR  424

Query  840   VGDILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEY  661
             VGD+LRVAGFKNN PQF+F+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDASL EY
Sbjct  425   VGDVLRVAGFKNNAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEY  484

Query  660   TSHANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPL  481
             TS+A+TS+IPGHYVL+WE+  +   P+P  ++EDCC  +EES NSVYR+ RVSDKSIGPL
Sbjct  485   TSYADTSSIPGHYVLFWELYLNGNTPVPPSVYEDCCLTIEESFNSVYRQGRVSDKSIGPL  544

Query  480   EIRIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAP  301
             EI++VE+GTFDK+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+ +YFSPK P+W P
Sbjct  545   EIKVVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVKSYFSPKCPKWTP  604

Query  300   GHKHWNTN  277
             GHK W +N
Sbjct  605   GHKQWGSN  612



>ref|XP_006452114.1| hypothetical protein CICLE_v10007746mg [Citrus clementina]
 gb|ESR65354.1| hypothetical protein CICLE_v10007746mg [Citrus clementina]
 gb|KDO74387.1| hypothetical protein CISIN_1g006862mg [Citrus sinensis]
Length=628

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/601 (68%), Positives = 492/601 (82%), Gaps = 11/601 (2%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             +L+E N + L+FIE+VT+N  +VQ++VL  IL  NA VEYL R+GLNG TDRE+FKK +P
Sbjct  14    SLDEMNKKKLEFIENVTSNPDEVQKKVLSEILLRNAHVEYLQRNGLNGHTDRESFKKTMP  73

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             V+TYED++ DINR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEELER+SL  S
Sbjct  74    VITYEDIQADINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELERRSLLYS  133

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV++QF+P L KGK MYFLF++ EAKTPGGL+ARPVLTS  K  +FK+R Y +PYT+
Sbjct  134   LLMPVMSQFIPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSCHFKERPY-DPYTN  192

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ETILC DS+QSMYSQ+LCGL    +VLRVG +FAS FIRAI FLEKHW L+  DI
Sbjct  193   YTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWPLVVKDI  252

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             RTGT++ +ITDPSVR+AV +I+KPNP LA+FIE EC K+ W+GII R+W NTKY+DV+VT
Sbjct  253   RTGTIDSQITDPSVRDAVMKILKPNPKLADFIENECRKDCWQGIITRLWPNTKYVDVIVT  312

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIP L+Y+ N LPLV T Y SSEC F +NLNPL KP+EV+YT++PTMAYFEFLPV
Sbjct  313   GTMSQYIPILDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLVPTMAYFEFLPV  372

Query  960   SREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGF  811
              R  GV           E    E++DLVDVKLGQEYE+VVTTYAGLYRYRVGD+LRVAGF
Sbjct  373   HRNNGVANSISMPKSLNEKERQELVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLRVAGF  432

Query  810   KNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIP  631
             KN  PQFNF+CRKNV LSID+DKTDEVEL NAVKNA N L+PFDA++ EYTS+A+T+T+P
Sbjct  433   KNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFDAAVSEYTSYADTTTVP  492

Query  630   GHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTF  451
             GHYVLYWE++ +   PIP  +FEDCC  +EESLNSVYR+ RV DKSIGPLEI+IVE GTF
Sbjct  493   GHYVLYWELSLNGTTPIPPSVFEDCCLTIEESLNSVYRQGRVCDKSIGPLEIKIVEPGTF  552

Query  450   DKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN*N  271
             DK+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+SNYFSPK P+W  GHK W++N N
Sbjct  553   DKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPKWVAGHKQWSSNNN  612

Query  270   Q  268
             +
Sbjct  613   K  613



>gb|KHG06705.1| Indole-3-acetic acid-amido synthetase GH3.6 -like protein [Gossypium 
arboreum]
Length=604

 Score =   854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/595 (69%), Positives = 486/595 (82%), Gaps = 11/595 (2%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             NLE  N + LQFIEDVT+NA +VQ++VL+ ILS NA VEYL   GLNG TDRETFKK +P
Sbjct  7     NLELKNKKTLQFIEDVTSNADEVQKKVLEEILSRNAHVEYLQTRGLNGHTDRETFKKTMP  66

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             V+TYED++P I+R+ANG+ S I+ S  ISEF TSSGTS GE K++PT EEEL R+SL  S
Sbjct  67    VITYEDIQPHIDRIANGDTSPILSSNAISEFLTSSGTSGGERKMMPTIEEELGRRSLLYS  126

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV++QFVP L KGK MYFLF++ EAKTP GL+ARPVLTS  K ++FK R Y +PYT+
Sbjct  127   LLMPVMSQFVPGLDKGKGMYFLFIKSEAKTPSGLVARPVLTSYYKSTHFKDRPY-DPYTN  185

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHWR LC+DI
Sbjct  186   YTSPNETILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKHWRFLCNDI  245

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             RTGT++ +I D SVREAV +I+KP+P LA+FIE EC+K+SW+GII R+W NTKY+DV+VT
Sbjct  246   RTGTIDSQINDQSVREAVTKILKPDPKLADFIEAECSKDSWQGIITRLWPNTKYVDVIVT  305

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+EV+YT+IPTMAYFEFLPV
Sbjct  306   GTMSQYIPTLDYYTNGLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMAYFEFLPV  365

Query  960   SREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGF  811
              R  GV           E    E++DLVDVKLGQEYE+VVTTY+GLYRYRVGD+LRVAGF
Sbjct  366   QRNNGVNSSISVPKTLNEKEQQELVDLVDVKLGQEYELVVTTYSGLYRYRVGDVLRVAGF  425

Query  810   KNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIP  631
             KNN PQFNF+CRKNV L ID+DKTDEVEL NAVKNA N LLPFDA+L EYTS+A+T+TIP
Sbjct  426   KNNAPQFNFICRKNVVLCIDSDKTDEVELQNAVKNAVNHLLPFDATLAEYTSYADTTTIP  485

Query  630   GHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTF  451
             GHYVLYWE++ +   PIP  +FEDCC  +EESLNSVYR+ RV DKSIGPLEI+IVE GTF
Sbjct  486   GHYVLYWELSLNGTTPIPPSVFEDCCLTIEESLNSVYRQGRVCDKSIGPLEIKIVEPGTF  545

Query  450   DKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             DK+MDYAI+ G+SI+QYK PRCV  APIVELL+SR +S++FSPK P+W PGHK W
Sbjct  546   DKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRAVSSFFSPKCPKWFPGHKQW  600



>emb|CDY67943.1| BnaAnng25610D [Brassica napus]
Length=612

 Score =   854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/608 (68%), Positives = 489/608 (80%), Gaps = 13/608 (2%)
 Frame = -1

Query  2070  DALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGST  1891
             +A E S  ++ L E N   LQFIE+VT+NA  VQ RVL+ ILS NA VEYL RHGL G T
Sbjct  8     EAFEVS--DQTLAEKNKNRLQFIEEVTSNADDVQRRVLEEILSRNADVEYLKRHGLQGRT  65

Query  1890  DRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEE  1711
             DRETFK ++PVVTYED++P+INR+ANG+ S I+CS+PISEF TSSGTS GE KL+PT EE
Sbjct  66    DRETFKHVMPVVTYEDIQPEINRIANGDTSQILCSSPISEFLTSSGTSGGERKLMPTIEE  125

Query  1710  ELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFK  1531
             EL+R+SL  SLLMPV++QFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FK
Sbjct  126   ELDRRSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFK  185

Query  1530  KRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLE  1351
              R Y +PYT+ TSP +TILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLE
Sbjct  186   NRPY-DPYTNYTSPNQTILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLE  244

Query  1350  KHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWR  1171
             KHW  L  DIRTGTL+  ITD SVREAV  I+KP+P LA+FIE EC K SW+GII R+W 
Sbjct  245   KHWPELTRDIRTGTLSSEITDLSVREAVGEILKPDPKLADFIESECKKNSWQGIITRLWP  304

Query  1170  NTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIP  991
             NTKY+DV+VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IP
Sbjct  305   NTKYVDVIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIP  364

Query  990   TMAYFEFLPVSREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYR  841
             TMAYFEFLPV R  GV           E    E++DLVDVKLGQEYE+VVTTYAGLYRYR
Sbjct  365   TMAYFEFLPVHRNNGVTSSISLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLYRYR  424

Query  840   VGDILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEY  661
             VGD+LRVAGFKNN PQF+F+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDASL EY
Sbjct  425   VGDVLRVAGFKNNAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEY  484

Query  660   TSHANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPL  481
             TS+A+TS+IPGHYVL+WE+  +   P+P  ++EDCC  +EES NSVYR+ RVSDKSIGPL
Sbjct  485   TSYADTSSIPGHYVLFWELCLNGNTPVPPSVYEDCCLTIEESFNSVYRQGRVSDKSIGPL  544

Query  480   EIRIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAP  301
             EI++VE+GTFDK+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+ +YFSPK P+W P
Sbjct  545   EIKVVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVKSYFSPKCPKWTP  604

Query  300   GHKHWNTN  277
             GHK W +N
Sbjct  605   GHKQWGSN  612



>ref|XP_006360114.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Solanum 
tuberosum]
Length=607

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/594 (68%), Positives = 483/594 (81%), Gaps = 12/594 (2%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E+N ++L FIE+VTTNA ++Q++VL  IL+ NA VEYL RHGLNG  DRE FKK++P +T
Sbjct  12    ENNKQVLHFIEEVTTNADEIQKKVLAEILTKNAYVEYLQRHGLNGHIDRENFKKIMPAIT  71

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++ DI R+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL R+S   SLLM
Sbjct  72    YEDIQSDITRIANGDKSQILCSQPISEFLTSSGTSGGERKLMPTIEEELARRSQLYSLLM  131

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV++QFVPDL KGK MYFLF++ EAKTPGGL ARPVLTS  K  +FK R   +PYT+ TS
Sbjct  132   PVMSQFVPDLEKGKGMYFLFIKSEAKTPGGLPARPVLTSYYKSPHFKNRR-PDPYTNYTS  190

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P +TILC+DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW LLCHDIR G
Sbjct  191   PNDTILCSDSYQSMYSQMLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWPLLCHDIRAG  250

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             T+N +ITD SVREAV +I+KP+ +LA+F+E EC+K+SW+GII R+W NTKYIDV+VTG M
Sbjct  251   TINSQITDLSVREAVMKILKPDKNLADFVEAECSKDSWQGIITRLWPNTKYIDVIVTGTM  310

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             SQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+EVAYT+IPTM YFEFLPV R 
Sbjct  311   SQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVAYTLIPTMGYFEFLPVHRN  370

Query  951   IGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNN  802
              GV           E    E++DLVDVK+GQEYE++VTTYAGLYRYRVGD+LRVAGFKNN
Sbjct  371   NGVTNSISMPKSLNEKEQQELVDLVDVKIGQEYELIVTTYAGLYRYRVGDVLRVAGFKNN  430

Query  801   TPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHAN-TSTIPGH  625
              PQFNF+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDA + EYTS+A+ T+TIPGH
Sbjct  431   APQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLMPFDAHVTEYTSYADTTTTIPGH  490

Query  624   YVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDK  445
             YVLYWE+  +   P+P  +FEDCC  +EESLNSVYR+ R SDKSIGPLEI+IVE+GTFDK
Sbjct  491   YVLYWELNVNGSTPVPPSVFEDCCLTIEESLNSVYRQGRASDKSIGPLEIKIVESGTFDK  550

Query  444   MMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
             +MDYAI+ G+SI+QYK PRCV   PIVELL+S+V+SNYFSPK P+W PGHK WN
Sbjct  551   LMDYAISLGASINQYKTPRCVKFEPIVELLNSKVVSNYFSPKCPKWVPGHKQWN  604



>ref|XP_007214798.1| hypothetical protein PRUPE_ppa002986mg [Prunus persica]
 gb|EMJ15997.1| hypothetical protein PRUPE_ppa002986mg [Prunus persica]
Length=614

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/595 (68%), Positives = 485/595 (82%), Gaps = 12/595 (2%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             L++ N + LQFIE+VT NA +VQ+RVL  IL+ NA VEYL RHGLNG TDR+TFKK+IPV
Sbjct  17    LQDKNEKALQFIEEVTENADEVQKRVLAEILARNAHVEYLQRHGLNGHTDRDTFKKIIPV  76

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             + YED++ DINR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEELER+SL  SL
Sbjct  77    IKYEDIEADINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELERRSLLYSL  136

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV++Q VP+L KGK MYFLF++ EAKTPGGL+ARPVLTS  K S+FK+R Y +PYT+ 
Sbjct  137   LMPVMSQSVPELDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKRRPY-DPYTNY  195

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP ETILC DS+QSMYSQ+LCGL    +V+RVG +FAS FIRAI FLEKHW  LC DI 
Sbjct  196   TSPNETILCPDSYQSMYSQLLCGLCQNKEVIRVGAVFASGFIRAIRFLEKHWPSLCKDIA  255

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             +GTLNP+ITD SVREAV + +KP+P LA +IE EC ++SW+GII R+W NTKY+DV+VTG
Sbjct  256   SGTLNPQITDSSVREAVMKTLKPDPKLANYIETECGEKSWQGIITRLWPNTKYVDVIVTG  315

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
              MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+EV+YT++P+M YFEFLPV 
Sbjct  316   TMSQYIPTLDYYSNGLPLVCTMYASSECYFGLNLNPLCKPSEVSYTLVPSMGYFEFLPVQ  375

Query  957   REIGVP-----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGF  811
             R  G+            E    E++DLVDVKLGQEYE+VVTTYAGLYRYRVGD+LRVAGF
Sbjct  376   RNNGINSNSLSVPKALNEKEQQELVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLRVAGF  435

Query  810   KNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIP  631
             KN  PQFNF+CRKNV LSID+DKTDEVEL  AVKNA + L+PFDA++ EYTS A+TSTIP
Sbjct  436   KNKAPQFNFICRKNVVLSIDSDKTDEVELQTAVKNAVSHLVPFDATVSEYTSFADTSTIP  495

Query  630   GHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTF  451
             GHYVL+WE+  +   PIP  ++EDCC AVEESLNSVYR+ R SDKSIGPLEI+IVE GTF
Sbjct  496   GHYVLFWELCLNGSTPIPPSVYEDCCLAVEESLNSVYRQGRASDKSIGPLEIKIVEAGTF  555

Query  450   DKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             DK+MDYAI+ G+SI+QYK PRCV  APIVELL+SRV+SNYFSPK P+W PGHK W
Sbjct  556   DKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSNYFSPKCPKWVPGHKQW  610



>ref|XP_004244168.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Solanum 
lycopersicum]
Length=607

 Score =   852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/594 (69%), Positives = 478/594 (80%), Gaps = 12/594 (2%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E N +IL FIE+ TTN  ++Q++VL  IL  NA VEYL RHGLNG  DRE FKK++PV+T
Sbjct  12    EKNKQILDFIEEATTNVDEIQKQVLAEILRENAHVEYLQRHGLNGHVDRENFKKIMPVIT  71

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++ DI R+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL R+S   SLLM
Sbjct  72    YEDIQSDITRIANGDKSQILCSQPISEFLTSSGTSGGERKLMPTIEEELARRSQLYSLLM  131

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV++QFVPDL KGK MYFLF++ EAKTPGGL ARPVLTS  K  +FK R   +PYT+ TS
Sbjct  132   PVMSQFVPDLEKGKGMYFLFIKSEAKTPGGLPARPVLTSYYKSPHFKNRQ-PDPYTNYTS  190

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P ETILC+DS+QSMYSQMLCGL    QVLRVG +FAS FIRAI FLEKHW LLCHDIR G
Sbjct  191   PNETILCSDSYQSMYSQMLCGLCQNKQVLRVGAVFASGFIRAIRFLEKHWPLLCHDIRVG  250

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             T+N +ITD S+REAV  I+KP+ +LA+F+E EC+K SW+GII R+W NTKYIDV+VTG M
Sbjct  251   TINSQITDLSIREAVMNILKPDTNLADFVEAECSKNSWQGIITRLWPNTKYIDVIVTGTM  310

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             SQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+EVAYT+IPTM YFEFLPV R 
Sbjct  311   SQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVAYTLIPTMGYFEFLPVHRN  370

Query  951   IGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNN  802
              GV           E    E++DLVDVK+GQEYE++VTTYAGLYRYRVGD+LRVAGFKNN
Sbjct  371   NGVSNSIAMPKSLNEKEQQELVDLVDVKIGQEYELIVTTYAGLYRYRVGDVLRVAGFKNN  430

Query  801   TPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHAN-TSTIPGH  625
              PQFNF+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDA + EYTS+A+ T+TIPGH
Sbjct  431   APQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLMPFDAHVTEYTSYADTTTTIPGH  490

Query  624   YVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDK  445
             YVLYWE+  +   P+P  +FEDCC  +EESLNSVYR+ R SDKSIGPLEI+IVE+GTFDK
Sbjct  491   YVLYWELNVNGSTPVPPSVFEDCCLTIEESLNSVYRQGRASDKSIGPLEIKIVESGTFDK  550

Query  444   MMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
             +MDYAI+ G+SI+QYK PRCV   PIVELL+SRV+SNYFSPK P+W PGHK WN
Sbjct  551   LMDYAISLGASINQYKTPRCVKFEPIVELLNSRVVSNYFSPKCPKWVPGHKQWN  604



>gb|KEH19704.1| indole-3-acetic acid-amido synthetase [Medicago truncatula]
Length=606

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/595 (68%), Positives = 488/595 (82%), Gaps = 11/595 (2%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             NL E N +IL FIEDVT+NA QVQ++VL  ILS NA VEYL R+ LNG TDR+TFKKL+P
Sbjct  9     NLVEQNKKILDFIEDVTSNADQVQQKVLSEILSRNANVEYLKRYDLNGHTDRDTFKKLLP  68

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             V++YED++PDI+R++NG+ S I+CS PISEF TSSGTS GE KL+PT EEEL R+SL  S
Sbjct  69    VISYEDIQPDIDRISNGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELGRRSLLYS  128

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV++QFVP L KGK MY +F++ EAKTPGG++ARPVLTS  K SYF+ R Y +PYT+
Sbjct  129   LLMPVMSQFVPGLEKGKGMYLMFIKSEAKTPGGIVARPVLTSYYKSSYFRDRPY-DPYTN  187

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ET+LC DS+QSMYSQ+LCGL    +VLRVG +FAS FIRAI FLEKHW LLC+DI
Sbjct  188   YTSPNETVLCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWTLLCNDI  247

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             RTGT+NP ITD +VR++V +I+KP+P LA+FI+ EC+K SW+GII R+W NTKY+DV+VT
Sbjct  248   RTGTVNPLITDSTVRDSVMKILKPDPKLADFIQTECSKNSWQGIITRLWPNTKYVDVIVT  307

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIP L+++ N LPLV T Y SSEC F +NLNPL +P+EV+YT+IPTM YFEFLPV
Sbjct  308   GTMSQYIPILDHYSNGLPLVCTMYASSECYFGVNLNPLCQPSEVSYTLIPTMCYFEFLPV  367

Query  960   SREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGF  811
             +R  GV           E    E+++LVDVKLGQEYE+VVTTYAGLYRYRVGD+L+VAGF
Sbjct  368   NRSNGVTDSLHTPRSLNEKEQKELVELVDVKLGQEYELVVTTYAGLYRYRVGDVLKVAGF  427

Query  810   KNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIP  631
             KN  PQFNFVCRKNV LSID+DKTDEVEL NA+ NA   L+PFDA++ EYTS+A+T+TIP
Sbjct  428   KNKAPQFNFVCRKNVVLSIDSDKTDEVELQNAMANAITHLVPFDATVSEYTSYADTTTIP  487

Query  630   GHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTF  451
             GHYVLYWE+T +    IP  +FEDCC  +EESLNSVYR+ RVSDKSIGPLEI+IVE GTF
Sbjct  488   GHYVLYWELTLNKSTQIPPCVFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKIVEQGTF  547

Query  450   DKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             DK+MDYAI+ G+SI+QYK PRCV  AP+VELL+SRVMS+YFSPK P+W PGHK W
Sbjct  548   DKLMDYAISLGASINQYKTPRCVKFAPVVELLNSRVMSSYFSPKCPKWVPGHKQW  602



>ref|XP_004510013.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Cicer 
arietinum]
Length=606

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/595 (68%), Positives = 488/595 (82%), Gaps = 11/595 (2%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             NL E N +IL+FIEDVT NA QVQ++VL  ILS NA VEYL R+GLNG TDR+TFKK++P
Sbjct  9     NLVEQNKKILEFIEDVTLNADQVQQKVLSEILSRNANVEYLKRYGLNGHTDRDTFKKILP  68

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             V++YED++ DINR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL R+SL  S
Sbjct  69    VISYEDIQTDINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELARRSLLYS  128

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV++QFVP L KGK MY +F++ EAKTPGG++ARPVLTS  K S+F+ R Y +PYT+
Sbjct  129   LLMPVMSQFVPGLEKGKGMYLMFIKSEAKTPGGIVARPVLTSYYKSSHFRDRPY-DPYTN  187

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ET+LC DS+QSMYSQ+LCGL    +VLRVG +FAS FIRAI FLEKHW LL +DI
Sbjct  188   YTSPNETVLCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWTLLVNDI  247

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             RTGT+NP ITD SVR++V +I+KP+P LA+FI+ EC++ SW+GII R+W NTKY+DV+VT
Sbjct  248   RTGTVNPLITDSSVRDSVMKILKPDPKLADFIQTECSESSWQGIITRLWPNTKYVDVIVT  307

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIP L+++ N LPLV T Y SSEC F +NLNPL +P+EV+YT+IPTM YFEFLPV
Sbjct  308   GTMSQYIPILDHYSNGLPLVCTMYASSECYFGVNLNPLCQPSEVSYTLIPTMCYFEFLPV  367

Query  960   SREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGF  811
             +R  GV           E    E+++LVDVKLGQEYE+VVTTYAGLYRYRVGD+L+VAGF
Sbjct  368   NRSNGVTDSLHTPRSLNEKEQQELVELVDVKLGQEYELVVTTYAGLYRYRVGDVLKVAGF  427

Query  810   KNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIP  631
             KN  PQFNFVCRKNV LSID+DKTDEVEL NA+ NA   L+PFDA++ EYTS+A+T+TIP
Sbjct  428   KNKAPQFNFVCRKNVVLSIDSDKTDEVELQNAMSNAMTHLVPFDATVSEYTSYADTTTIP  487

Query  630   GHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTF  451
             GHYVLYWE+T +   PIP  +FEDCC  +EESLNSVYR+ RVSDKSIGPLEI+IVE GTF
Sbjct  488   GHYVLYWELTLNGSTPIPPCVFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKIVEQGTF  547

Query  450   DKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             DK+MDYAI+ G+SI+QYK PRCV  AP+VELL+SRVMS+YFSPK P+W PGHK W
Sbjct  548   DKLMDYAISLGASINQYKTPRCVKFAPVVELLNSRVMSSYFSPKCPKWVPGHKQW  602



>ref|XP_004243428.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Solanum 
lycopersicum]
Length=606

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/599 (70%), Positives = 498/599 (83%), Gaps = 10/599 (2%)
 Frame = -1

Query  2046  ERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGL--NGSTDR-ETF  1876
             + N +E+N ++LQF ED+T+N   VQ+ VL  ILS N+GVEY  RHGL  NG+ D  E F
Sbjct  9     DGNFDENNKKLLQFFEDITSNPNDVQKTVLHEILSRNSGVEYFQRHGLIINGNNDDYENF  68

Query  1875  KKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERK  1696
             KK++P+VTYED+KPDINR+ANG+ SSI+CS PISEF TSSGTS GE KL+PT EEEL R+
Sbjct  69    KKIMPIVTYEDLKPDINRIANGDRSSILCSLPISEFLTSSGTSGGERKLMPTIEEELGRR  128

Query  1695  SLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYT  1516
             SL  SLLMPV+N+FVPDL KGK MYFLF++ EAKTPGGLLARPVLTS  K SYFKKR Y 
Sbjct  129   SLLYSLLMPVMNKFVPDLQKGKGMYFLFIKSEAKTPGGLLARPVLTSYYKSSYFKKRPY-  187

Query  1515  NPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRL  1336
             +PYT+ TSP ETILC DS+QSMYSQMLCGL    QVLRVG +FAS FIRAI FLEKHW +
Sbjct  188   DPYTNYTSPNETILCLDSYQSMYSQMLCGLCQNTQVLRVGAVFASGFIRAIRFLEKHWPI  247

Query  1335  LCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYI  1156
             LC DI+TGTLNP+I DP VRE+V +I+KP+P LA+FIE EC+KESWKGIIPR+W NTKY+
Sbjct  248   LCRDIKTGTLNPQINDPMVRESVMKILKPDPYLADFIEMECSKESWKGIIPRLWPNTKYV  307

Query  1155  DVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYF  976
             DV+VTG MSQYIPTL Y+GNDLPLV T Y SSEC F INL+PL +P+EVAYT+IPTM +F
Sbjct  308   DVIVTGTMSQYIPTLKYYGNDLPLVCTMYASSECYFGINLDPLCEPSEVAYTLIPTMGFF  367

Query  975   EFLPVSREIGVPEPN----PVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFK  808
             EFLPV+R+   PE +      +++DLVDVKLG EYE+VVTTYAGLYRYRVGDIL+VAGFK
Sbjct  368   EFLPVARDDQGPENSNKYDRDDLVDLVDVKLGHEYELVVTTYAGLYRYRVGDILKVAGFK  427

Query  807   NNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPG  628
             N  PQF+FVCRKNVALSID+DKT EVELH+AV  AS  L+P+  SL EYTS+A+TST PG
Sbjct  428   NKAPQFHFVCRKNVALSIDSDKTYEVELHDAVLKASTHLVPYGTSLTEYTSYADTSTNPG  487

Query  627   HYVLYWEIT--QSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGT  454
             HYVLYWEI   +S E  IP  +FEDCC  +EESLNSVYR+CRVSDKSIGPLEI++VENGT
Sbjct  488   HYVLYWEINNDESDETLIPTSVFEDCCLTIEESLNSVYRQCRVSDKSIGPLEIKVVENGT  547

Query  453   FDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             FDK+MDYAI++G+SI+QYK PRCV  API+ELL+SRV+S+YFSPK P+W PGHK W+++
Sbjct  548   FDKLMDYAISNGASINQYKAPRCVNYAPIIELLNSRVVSSYFSPKCPKWVPGHKQWSSS  606



>ref|XP_007149669.1| hypothetical protein PHAVU_005G089200g [Phaseolus vulgaris]
 gb|ESW21663.1| hypothetical protein PHAVU_005G089200g [Phaseolus vulgaris]
Length=611

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/608 (68%), Positives = 490/608 (81%), Gaps = 12/608 (2%)
 Frame = -1

Query  2076  MTDALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNG  1897
             M +A   S+ E +L E N  IL FIEDVT NA +VQ+RVL  ILS NA VEYL RHGLNG
Sbjct  1     MPEAPRDSNIEHDLAEKNREILNFIEDVTANADEVQKRVLSEILSRNANVEYLRRHGLNG  60

Query  1896  STDRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTT  1717
              TDR TFKKL+PV+TYEDV+PDINR+ANG+ S I+ S PI+EF TSSGTS GE KL+PT 
Sbjct  61    QTDRHTFKKLLPVITYEDVQPDINRIANGDTSPILTSKPITEFLTSSGTSGGERKLMPTI  120

Query  1716  EEELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSY  1537
             EEEL R+ +  SLLMP+++QFV DL KGK MY +FV+ E+KTPGG++ARPVLTS  K  Y
Sbjct  121   EEELGRRCVLYSLLMPIMSQFVADLEKGKGMYLMFVKCESKTPGGIVARPVLTSYYKSPY  180

Query  1536  FKKRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHF  1357
             F+ R Y +PYT+ TSP +T+LC DS+QSMYSQ+LCGL    +VLRVG +FAS FIRAI F
Sbjct  181   FRDRPY-DPYTNYTSPNQTVLCPDSYQSMYSQLLCGLSQNKEVLRVGAIFASGFIRAIRF  239

Query  1356  LEKHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRI  1177
             LEKHW LL +DIRTGTLNP ITD SVREAV RI+KP+P LA+ I KEC+K SW+GII R+
Sbjct  240   LEKHWTLLSNDIRTGTLNPLITDTSVREAVMRILKPDPKLADMIHKECSKGSWQGIITRL  299

Query  1176  WRNTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTI  997
             W NTKY+DV+VTG M+QYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KPT+V+YT+
Sbjct  300   WPNTKYVDVIVTGTMAQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLCKPTQVSYTL  359

Query  996   IPTMAYFEFLPVSR--EIGVP-EPNPV--------EVLDLVDVKLGQEYEVVVTTYAGLY  850
             IPTM Y+EFLPV+R  ++ +P  P P         ++L+LVDVKLGQEYE+VVTT+AGLY
Sbjct  360   IPTMCYYEFLPVNRTTDLTLPSRPTPTSLNHTQHQQLLELVDVKLGQEYELVVTTHAGLY  419

Query  849   RYRVGDILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASL  670
             RYRVGDILRV GFKN  PQF+FVCRKNVALSID+DKTDEVEL NA+KNA   L+PFDA +
Sbjct  420   RYRVGDILRVTGFKNKAPQFSFVCRKNVALSIDSDKTDEVELQNAMKNAVTHLVPFDALV  479

Query  669   IEYTSHANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSI  490
              EYTS+A+T+TIPGHYVLYWE++     PIP  ++EDCC  +EESLNSVYR+ RVSDKSI
Sbjct  480   SEYTSYADTTTIPGHYVLYWELSLKGSTPIPPCVYEDCCLTMEESLNSVYRQGRVSDKSI  539

Query  489   GPLEIRIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPE  310
             GPLEI+IVE GTFDK+MDYAI+ G+SI+QYK PRCV  APIVELL+SRV SNYFSPK P+
Sbjct  540   GPLEIKIVEQGTFDKLMDYAISLGASINQYKAPRCVKFAPIVELLNSRVTSNYFSPKCPK  599

Query  309   WAPGHKHW  286
             W PGHK W
Sbjct  600   WVPGHKQW  607



>ref|XP_010448236.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Camelina 
sativa]
Length=613

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/600 (68%), Positives = 481/600 (80%), Gaps = 11/600 (2%)
 Frame = -1

Query  2046  ERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKL  1867
             +++L E N   LQFIEDVTTNA  VQ RVL+ ILS NA VEYL RHGL G TDRETFK +
Sbjct  15    DQSLAEKNKNKLQFIEDVTTNADDVQRRVLEEILSRNADVEYLKRHGLGGRTDRETFKHV  74

Query  1866  IPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLY  1687
             +PVVTYED++P+INR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL+R+SL 
Sbjct  75    MPVVTYEDIQPEINRIANGDKSQILCSNPISEFLTSSGTSGGERKLMPTIEEELDRRSLL  134

Query  1686  SSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPY  1507
              SLLMPV+NQFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FKKR + +PY
Sbjct  135   YSLLMPVMNQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKKRPF-DPY  193

Query  1506  TDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCH  1327
             T+ TSP +TILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW  L  
Sbjct  194   TNYTSPNQTILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKHWPELAR  253

Query  1326  DIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVV  1147
             DIRTGTL+  ITD SVREAV  I+KP+P LA+F+E EC K SW+GII RIW NTKY+DV+
Sbjct  254   DIRTGTLSSEITDLSVREAVGEILKPDPKLADFVESECRKTSWQGIITRIWPNTKYVDVI  313

Query  1146  VTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL  967
             VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IP MAYFEFL
Sbjct  314   VTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPNMAYFEFL  373

Query  966   PVSREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVA  817
             PV R  GV           E    E++DLVDVKLGQ  +  VTTYAGLYRYRVGD++ V 
Sbjct  374   PVHRNSGVTSSISLPKALTEKEQQELVDLVDVKLGQGTQKXVTTYAGLYRYRVGDVISVT  433

Query  816   GFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTST  637
             GFKNN PQF+F+CRKNVALSIDADKTDEVEL NAVKNA   L+PF+ASL EYTS+A+TS+
Sbjct  434   GFKNNAPQFSFICRKNVALSIDADKTDEVELQNAVKNAVTHLVPFEASLSEYTSYADTSS  493

Query  636   IPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENG  457
             IPGHYVL+WE+  +   PIP  +FEDCC  +EESLNSVYR+ RVSDKSIGPLEI+IVE+G
Sbjct  494   IPGHYVLFWELCLNGNTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKIVESG  553

Query  456   TFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             TFDK+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+ +YFSPK P+W PGHK W +N
Sbjct  554   TFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDSYFSPKCPKWVPGHKQWGSN  613



>ref|XP_009137648.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.5 isoform 
X1 [Brassica rapa]
Length=612

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/597 (69%), Positives = 482/597 (81%), Gaps = 11/597 (2%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             L+E N R LQ IE++T+NA QVQ+RVL+ IL  NA VEYL RH LNG TDRETFK ++PV
Sbjct  17    LDEKNKRKLQLIEELTSNADQVQKRVLEEILIRNADVEYLRRHDLNGRTDRETFKNVMPV  76

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             +TYED++P+INR+ANG+ S I+ S PISEF TSSGTS GE KL+PT EEEL+R+SL  S 
Sbjct  77    ITYEDIQPEINRIANGDKSPILSSKPISEFLTSSGTSGGERKLMPTIEEELDRRSLLYSF  136

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV++QFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FK+R + +PYTD 
Sbjct  137   LMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPF-DPYTDY  195

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW  L  DIR
Sbjct  196   TSPNETILCPDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIKFLEKHWTELVRDIR  255

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             TGTL+  ITDPSVREAVA+I+KP+P LA+F+E EC K+SW GII R+W NTKY+DV+VTG
Sbjct  256   TGTLSSLITDPSVREAVAKILKPSPKLADFVEFECKKKSWHGIITRLWPNTKYVDVIVTG  315

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
              MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IPTMAYFEFLPV 
Sbjct  316   TMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMAYFEFLPVH  375

Query  957   REIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFK  808
             R  GV           E    E++DLVDVKLGQEYE+VVTTYAGL RYRVGD+LRV GFK
Sbjct  376   RNTGVTNSINLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLCRYRVGDLLRVTGFK  435

Query  807   NNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPG  628
             N  PQF+F+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDASL EYTS+A+TS+IPG
Sbjct  436   NKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAMTHLVPFDASLSEYTSYADTSSIPG  495

Query  627   HYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
             HYVL+WE+      PIP  +FEDCC AVEES NSVYR+ RVSDKSIGPLEI+IVE GTFD
Sbjct  496   HYVLFWELCLDGNTPIPPSVFEDCCLAVEESFNSVYRQGRVSDKSIGPLEIKIVEPGTFD  555

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             K+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+ +YFSPK P+W PGHK W +N
Sbjct  556   KLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDSYFSPKCPKWVPGHKQWGSN  612



>emb|CDX92823.1| BnaC07g40810D [Brassica napus]
Length=612

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/597 (69%), Positives = 482/597 (81%), Gaps = 11/597 (2%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             L+E N R LQ IE++T+NA QVQ RVL+ IL+ NA VEYL RH LNG TDRETFK ++PV
Sbjct  17    LDEKNKRKLQLIEELTSNADQVQRRVLEEILTRNADVEYLRRHDLNGRTDRETFKNVMPV  76

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             +TYED++P+INR+ANG+ S I+ S PISEF TSSGTS GE KL+PT EEEL+R+SL  S 
Sbjct  77    ITYEDIQPEINRIANGDKSPILSSKPISEFLTSSGTSGGERKLMPTIEEELDRRSLLYSF  136

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV++QFVP L KGK MYFLFV+ E+KTPGGL ARPVLTS  K  +FK+R + +PYTD 
Sbjct  137   LMPVMSQFVPGLDKGKGMYFLFVKSESKTPGGLPARPVLTSYYKSPHFKERPF-DPYTDY  195

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW  L  DIR
Sbjct  196   TSPNETILCPDSYQSMYSQMLCGLCQYQEVLRVGAVFASGFIRAIKFLEKHWTELVRDIR  255

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             TGTL+  ITDPSVREAVA+I+KP+P LA+F+E EC K+SW+G+I R+W NTKY+DV+VTG
Sbjct  256   TGTLSSLITDPSVREAVAKILKPSPKLADFVESECQKKSWQGVITRLWPNTKYVDVIVTG  315

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
              MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IPTMAYFEFLPV 
Sbjct  316   TMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMAYFEFLPVY  375

Query  957   REIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFK  808
             R  GV           E    E++DLVDVKLGQEYE+VVTTYAGL RYRVGD+LRV GFK
Sbjct  376   RNTGVTNSINLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLCRYRVGDLLRVTGFK  435

Query  807   NNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPG  628
             N  PQF+F+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDASL EYTS+A+TS+IPG
Sbjct  436   NKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAMTHLVPFDASLSEYTSYADTSSIPG  495

Query  627   HYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
             HYVL+WE+      PIP  +FEDCC AVEES NSVYR+ RVSDKSIGPLEI+IVE GTFD
Sbjct  496   HYVLFWELCLDGNTPIPPSVFEDCCLAVEESFNSVYRQGRVSDKSIGPLEIKIVEPGTFD  555

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             K+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+ +YFSPK P+W PGHK W +N
Sbjct  556   KLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDSYFSPKCPKWVPGHKQWGSN  612



>emb|CDY46653.1| BnaA03g48550D [Brassica napus]
Length=612

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/597 (69%), Positives = 483/597 (81%), Gaps = 11/597 (2%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             L+E N R LQ IE++T+NA QVQ+RVL+ IL  NA VEYL RH LNG TDRETFK ++PV
Sbjct  17    LDEKNKRKLQLIEELTSNADQVQKRVLEEILIRNADVEYLRRHDLNGRTDRETFKNVMPV  76

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             +TYED++P+INR+ANG+ S I+ S PISEF TSSGTS G+ KL+PT EEEL+R+SL  S 
Sbjct  77    ITYEDIQPEINRIANGDKSPILSSKPISEFLTSSGTSGGQRKLMPTIEEELDRRSLLYSF  136

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV++QFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FK+R + +PYTD 
Sbjct  137   LMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPF-DPYTDY  195

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW  L  DIR
Sbjct  196   TSPNETILCPDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIKFLEKHWIELVRDIR  255

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             TGTL+  ITDPSVREAVA+I+KP+P LA+F+E EC K+SW+GII R+W NTKY+DV+VTG
Sbjct  256   TGTLSSLITDPSVREAVAKILKPSPKLADFVEFECKKKSWQGIITRLWPNTKYVDVIVTG  315

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
              MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IPTMAYFEFLPV 
Sbjct  316   TMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMAYFEFLPVH  375

Query  957   REIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFK  808
             R  GV           E    E++DLVDVKLGQEYE+VVTTYAGL RYRVGD+LRV GFK
Sbjct  376   RNTGVTNSINLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLCRYRVGDLLRVTGFK  435

Query  807   NNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPG  628
             N  PQF+F+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDASL EYTS+A+TS+IPG
Sbjct  436   NKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAMTHLVPFDASLSEYTSYADTSSIPG  495

Query  627   HYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
             HYVL+WE+      PIP  +FEDCC AVEES NSVYR+ RVSDKSIGPLEI+IVE GTFD
Sbjct  496   HYVLFWELCLDGNTPIPPSVFEDCCLAVEESFNSVYRQGRVSDKSIGPLEIKIVEPGTFD  555

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             K+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+ +YFSPK P+W PGHK W +N
Sbjct  556   KLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDSYFSPKCPKWVPGHKQWGSN  612



>ref|XP_010438643.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.5-like [Camelina 
sativa]
Length=613

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/601 (68%), Positives = 483/601 (80%), Gaps = 11/601 (2%)
 Frame = -1

Query  2049  DERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKK  1870
             D   L++ N + LQ IED+T+NA QVQ RVL+ IL+ NA VEYL RH LNG TDRETFK 
Sbjct  14    DLMTLDQKNKQKLQLIEDLTSNADQVQRRVLEEILTRNADVEYLRRHDLNGRTDRETFKN  73

Query  1869  LIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSL  1690
             ++PV+TYED++P+INR+ANG+ S I+ S PISEF TSSGTS GE KL+PT EEEL+R+SL
Sbjct  74    VMPVITYEDIQPEINRIANGDKSLILSSKPISEFLTSSGTSGGERKLMPTIEEELDRRSL  133

Query  1689  YSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNP  1510
               SLLMPV++QFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FK+R Y +P
Sbjct  134   LYSLLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPY-DP  192

Query  1509  YTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLC  1330
             YT+ TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW  L 
Sbjct  193   YTNYTSPNETILCPDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIKFLEKHWTELV  252

Query  1329  HDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDV  1150
              DIRTGTLN  ITDPSVREAVA+I+KP+P LA+F+E EC K SW+GII R+W NTKY+DV
Sbjct  253   RDIRTGTLNALITDPSVREAVAKILKPSPKLADFVEFECKKSSWQGIITRLWPNTKYVDV  312

Query  1149  VVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEF  970
             +VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IPTMAYFEF
Sbjct  313   IVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMAYFEF  372

Query  969   LPVSREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRV  820
             LPV R  GV           E    E++DLVDVKLGQEYE+VVTTYAGL RYRVGD+LRV
Sbjct  373   LPVHRNNGVTNSINLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLCRYRVGDLLRV  432

Query  819   AGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTS  640
              GFKN  PQF+F+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDASL EYTS+A+TS
Sbjct  433   TGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEYTSYADTS  492

Query  639   TIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVEN  460
             +IPGHYVL+WE+      PIP  +FEDCC  VEESLN+VYR+ RVSDKSIGPLEI+IVE 
Sbjct  493   SIPGHYVLFWELCLDGNTPIPPSVFEDCCLTVEESLNTVYRQGRVSDKSIGPLEIKIVEP  552

Query  459   GTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNT  280
             GTFDK+MDYAI+ G+SI+QYK PRCV  API++LL+SRV+ +Y SPK P+W PGHK W +
Sbjct  553   GTFDKLMDYAISLGASINQYKTPRCVKFAPIIKLLNSRVVDSYLSPKCPKWVPGHKQWGS  612

Query  279   N  277
             N
Sbjct  613   N  613



>ref|XP_010694299.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Beta 
vulgaris subsp. vulgaris]
Length=622

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/596 (67%), Positives = 484/596 (81%), Gaps = 12/596 (2%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             N+ E N + L+FIE+VT NA  VQ+RVL  IL+ N+ VEYL RHGLNG+TDR+TFKKLIP
Sbjct  21    NMYEKNKKSLEFIEEVTENADHVQKRVLFEILTRNSNVEYLQRHGLNGATDRDTFKKLIP  80

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             V+ YED++ DI R+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL+R+ +  S
Sbjct  81    VIKYEDIQSDITRIANGDKSPILCSHPISEFLTSSGTSGGERKLMPTIEEELDRRCMLYS  140

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV++QFVP L KGK MYFLFV+ EAKTPGGL ARPVLTS  K S+F+ R + + YT+
Sbjct  141   LLMPVMSQFVPGLDKGKGMYFLFVKSEAKTPGGLFARPVLTSYYKSSHFQNRPF-DSYTN  199

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ETILC+DS+QSMYSQMLCGL   ++VLRVG +FAS FIRAI FLEKHW LL HDI
Sbjct  200   YTSPNETILCSDSYQSMYSQMLCGLCQNNEVLRVGAVFASGFIRAIKFLEKHWTLLAHDI  259

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             R G+LNP ITDP VR+AV +I+KP+P LA+FIE EC+KESW+GII R+W NTKY+DV+VT
Sbjct  260   RVGSLNPEITDPIVRDAVMQILKPDPKLADFIELECSKESWQGIITRLWPNTKYVDVIVT  319

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G M+QYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+EV+YT+IP+M YFEFLPV
Sbjct  320   GTMAQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPSMGYFEFLPV  379

Query  960   SREI-----------GVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAG  814
              R +            + E    ++++L DVKLG EYE+V+TTYAGLYRYRVGD+LRVAG
Sbjct  380   QRNVNGVTNSISMPKSLTEKEQQQLVELTDVKLGHEYELVITTYAGLYRYRVGDVLRVAG  439

Query  813   FKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTI  634
             FKN  PQFNFVCRKNV LSID+DKTDEVEL NAVKNA   L PFDA+L+EYTS+A+ STI
Sbjct  440   FKNKAPQFNFVCRKNVVLSIDSDKTDEVELQNAVKNAVTHLQPFDATLLEYTSYADLSTI  499

Query  633   PGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGT  454
             PGHYVL+WE++++    +P  +FEDCC A+EESLNSVYR+ RVSDKSIGPLEI++VE+GT
Sbjct  500   PGHYVLFWELSRNGCTTVPPSVFEDCCLAIEESLNSVYRQGRVSDKSIGPLEIKVVESGT  559

Query  453   FDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             FDK+MDYAI+ G+SI+QYK PRCV  APIVELL+SRV+S Y SPK P+W PGHK W
Sbjct  560   FDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSTYLSPKCPKWVPGHKQW  615



>ref|XP_010520883.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Tarenaya 
hassleriana]
Length=612

 Score =   845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/596 (68%), Positives = 483/596 (81%), Gaps = 12/596 (2%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             L E N + LQFIEDVT NA  VQ RVL+ IL+ NA VEYL RHGL G TDR +FK+L+PV
Sbjct  17    LAEKNKKKLQFIEDVTANADAVQRRVLEEILTRNADVEYLKRHGLGGRTDRGSFKRLMPV  76

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             +TYED++ DINR+ANG+ S I+ S P+SEF TSSGTS GE KL+PT EEEL+R+SL  SL
Sbjct  77    ITYEDIQTDINRIANGDTSPILSSKPVSEFLTSSGTSGGERKLMPTIEEELDRRSLLYSL  136

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV++QFVP L +GK MYFLF++ E+KTP GLLARPVLTS  K S+FK+R + +PYT+ 
Sbjct  137   LMPVMSQFVPGLDEGKGMYFLFIKSESKTPSGLLARPVLTSYYKSSHFKERPF-DPYTNY  195

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP ETILC DS+QSMYSQMLCGL   ++VLRVG +FAS FIRAI FLEKHW  L  DIR
Sbjct  196   TSPNETILCPDSYQSMYSQMLCGLCQHNEVLRVGAVFASGFIRAIKFLEKHWPELARDIR  255

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             TGT++ +ITDPSVREAV +I+KPNP LA+F+E EC KESW+GII R+W NTKY+DV+VTG
Sbjct  256   TGTVSAQITDPSVREAVGKILKPNPKLADFVEDECGKESWQGIITRLWPNTKYVDVIVTG  315

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
              MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IPTMAYFEFLPV 
Sbjct  316   TMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMAYFEFLPVH  375

Query  957   REIGV----------PEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFK  808
             +  GV           E    E+ DLVDVKLG EYE+VVTTYAGLYRYRVGD+LRV GFK
Sbjct  376   KNNGVTNSINVPKSLTEKEQKELADLVDVKLGHEYELVVTTYAGLYRYRVGDVLRVTGFK  435

Query  807   NNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTST-IP  631
             NN PQF+F+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDA+L EYTS+A+T+T +P
Sbjct  436   NNAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDATLSEYTSYADTTTSVP  495

Query  630   GHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTF  451
             GHYVL+WE+T   + PIP  +FEDCC  +EESLNSVYR+ RVSD+SIGPLEI+IVE GTF
Sbjct  496   GHYVLFWELTLKGKTPIPPSVFEDCCLTIEESLNSVYRQGRVSDRSIGPLEIKIVEQGTF  555

Query  450   DKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
             DK+MDYAI+ G+SI+QYK PRCV  APIVELL+SRV+S YFSPK P+WAPG+K W 
Sbjct  556   DKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSCYFSPKSPKWAPGYKQWG  611



>ref|XP_006283319.1| hypothetical protein CARUB_v10004357mg, partial [Capsella rubella]
 gb|EOA16217.1| hypothetical protein CARUB_v10004357mg, partial [Capsella rubella]
Length=634

 Score =   845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/597 (69%), Positives = 484/597 (81%), Gaps = 11/597 (2%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             L++ N + LQ IE++T+NA QVQ RVL+ IL+ NA VEYL RH LNG TDRETFK ++PV
Sbjct  39    LDQKNKQKLQLIEELTSNADQVQRRVLEEILTRNADVEYLRRHDLNGRTDRETFKNVMPV  98

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             +TYED++P+INR+ANG+ S I+ S PISEF TSSGTS GE KL+PT EEEL+R+SL  SL
Sbjct  99    ITYEDIQPEINRIANGDKSLILSSKPISEFLTSSGTSGGERKLMPTIEEELDRRSLLYSL  158

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV++QFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FK+R Y +PYT+ 
Sbjct  159   LMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPY-DPYTNY  217

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW  L  DIR
Sbjct  218   TSPNETILCPDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIKFLEKHWTELVRDIR  277

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             TGTL+  ITDPSVREAVA+I+KP+P LA+F+E EC K SW+GII R+W NTKY+DV+VTG
Sbjct  278   TGTLSALITDPSVREAVAKILKPSPKLADFVEFECKKSSWQGIITRLWPNTKYVDVIVTG  337

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
              MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IPTMAYFEFLPV 
Sbjct  338   TMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMAYFEFLPVH  397

Query  957   R------EIGVP----EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFK  808
             R       I +P    E    E++DLVDVKLGQEYE+VVTTYAGL RYRVGD+LRV GFK
Sbjct  398   RNNAVTNSISLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLCRYRVGDLLRVTGFK  457

Query  807   NNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPG  628
             N  PQF+F+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDASL EYTS+A+TS+IPG
Sbjct  458   NKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEYTSYADTSSIPG  517

Query  627   HYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
             HYVL+WE+      PIP  +FEDCC AVEESLN+VYR+ RVSDKSIGPLEI+IVE GTFD
Sbjct  518   HYVLFWELCLDGNTPIPPSVFEDCCLAVEESLNTVYRQGRVSDKSIGPLEIKIVEPGTFD  577

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             K+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+  YFSPK P+W PGHK W +N
Sbjct  578   KLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDTYFSPKCPKWVPGHKQWGSN  634



>ref|XP_010448162.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.5 [Camelina 
sativa]
Length=613

 Score =   843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/601 (68%), Positives = 482/601 (80%), Gaps = 11/601 (2%)
 Frame = -1

Query  2049  DERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKK  1870
             D   L++ N + LQ IED+T+NA QVQ RVL+ IL+ NA VEYL RH LNG TDRETFK 
Sbjct  14    DLMTLDQKNKQKLQLIEDLTSNADQVQRRVLEEILTRNADVEYLRRHDLNGRTDRETFKN  73

Query  1869  LIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSL  1690
             ++PV+TYED++P+INR+ANG+ S I+ S PISEF TSSGTS GE KL+PT EEEL+R+SL
Sbjct  74    VMPVITYEDIQPEINRIANGDKSLILSSKPISEFLTSSGTSGGERKLMPTIEEELDRRSL  133

Query  1689  YSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNP  1510
               SLLMPV++QFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FK+R Y +P
Sbjct  134   LYSLLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPY-DP  192

Query  1509  YTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLC  1330
             YT+ TSP E ILC+DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW  L 
Sbjct  193   YTNYTSPNEAILCSDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIKFLEKHWTELV  252

Query  1329  HDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDV  1150
              DIRTGTL+  ITDPSVREAVA+I+KP+  LA F+E EC K SW+GII R+W NTKY+DV
Sbjct  253   RDIRTGTLSALITDPSVREAVAKILKPSSKLANFVEFECKKSSWQGIITRLWPNTKYVDV  312

Query  1149  VVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEF  970
             +VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IPTMAYFEF
Sbjct  313   IVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMAYFEF  372

Query  969   LPVSREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRV  820
             LPV R  GV           E    E++DLVDVKLGQEYE+VVTTYAGL RYRVGD+LRV
Sbjct  373   LPVHRNNGVTNSINLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLCRYRVGDLLRV  432

Query  819   AGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTS  640
              GFKN  PQF+F+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDASL EYTS+A+TS
Sbjct  433   TGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEYTSYADTS  492

Query  639   TIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVEN  460
             +IPGHYVL+WE+      PIP  +FEDCC  VEESLN+VYR+ RVSDKSIGPLEI+IVE 
Sbjct  493   SIPGHYVLFWELCLDGNTPIPPSVFEDCCLTVEESLNTVYRQGRVSDKSIGPLEIKIVEP  552

Query  459   GTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNT  280
             GTFDK+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+ +YFSPK P+W PGHK W +
Sbjct  553   GTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDSYFSPKCPKWVPGHKQWGS  612

Query  279   N  277
             N
Sbjct  613   N  613



>emb|CDY29291.1| BnaC01g19430D [Brassica napus]
Length=612

 Score =   843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/597 (68%), Positives = 483/597 (81%), Gaps = 11/597 (2%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             L+E N R LQ IE++T+NA QVQ RVL+ IL+ NA VEYL RH L+G TDR+TFK ++PV
Sbjct  17    LDEKNKRRLQLIEELTSNADQVQRRVLEEILTRNADVEYLKRHDLDGRTDRDTFKNVMPV  76

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             +TYED++P+INR+ANG+ S I+ S PISEF TSSGTS GE KL+PT EEEL+R+S   S 
Sbjct  77    ITYEDIQPEINRIANGDKSPILSSKPISEFLTSSGTSGGERKLMPTIEEELDRRSFLYSF  136

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV++QFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FK+R + +PYT+ 
Sbjct  137   LMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPF-DPYTNY  195

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP ETILC+DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW  L  DIR
Sbjct  196   TSPNETILCSDSYQSMYSQMLCGLCQHHEVLRVGAVFASGFIRAIKFLEKHWTELVRDIR  255

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             TGTL+  ITDPSVREAVA+I+KP+P LAEF+E EC K+SW+GII R+W NTKY+DV+VTG
Sbjct  256   TGTLSSSITDPSVREAVAKILKPSPKLAEFVESECKKKSWQGIITRLWPNTKYVDVIVTG  315

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
              MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IPTMAYFEFLPV 
Sbjct  316   TMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMAYFEFLPVH  375

Query  957   REIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFK  808
             R  GV           E    E++DLVDVKLGQEYE+VVTTYAGL RYRVGD+L+V GFK
Sbjct  376   RNTGVTNSINLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLCRYRVGDLLKVTGFK  435

Query  807   NNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPG  628
             N  PQF+F+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDAS+ EYTS+A+TS+IPG
Sbjct  436   NKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASVSEYTSYADTSSIPG  495

Query  627   HYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
             HYVL+WE+      PIP  +FEDCC A+EESLN+VYR+ RVSDKSIGPLEI+IVE GTFD
Sbjct  496   HYVLFWELCLDGNTPIPPSVFEDCCLALEESLNTVYRQGRVSDKSIGPLEIKIVEAGTFD  555

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             K+MDYAI  G+SI+QYK PRCV  API+ELL+SRV+ +YFSPK P+W PGHK W +N
Sbjct  556   KLMDYAICLGASINQYKTPRCVKFAPIIELLNSRVVDSYFSPKCPKWVPGHKQWGSN  612



>ref|XP_007132598.1| hypothetical protein PHAVU_011G108500g [Phaseolus vulgaris]
 gb|ESW04592.1| hypothetical protein PHAVU_011G108500g [Phaseolus vulgaris]
Length=615

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/589 (69%), Positives = 486/589 (83%), Gaps = 8/589 (1%)
 Frame = -1

Query  2034  EESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVV  1855
             + +NN+ L++IEDVT+NA ++Q RVL  ILS +A  EYL RHGL+G T+RE+FKK++PVV
Sbjct  25    KNNNNKALEYIEDVTSNADEIQTRVLAEILSSSAHAEYLQRHGLDGRTERESFKKIMPVV  84

Query  1854  TYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLL  1675
             TYED+KPDI+R+ANG+ S I+CS PISEF TSSGTS GE KL+PT E+EL+RKSL  SLL
Sbjct  85    TYEDLKPDIDRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEDELQRKSLLYSLL  144

Query  1674  MPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFK--KRTYTNPYTD  1501
             MPV++QFVP L KGK MYFLFV+ EAKTPGGLLARPVLTS  K S+FK  K+ Y +PYT+
Sbjct  145   MPVMDQFVPGLEKGKGMYFLFVKSEAKTPGGLLARPVLTSYYKSSHFKNPKQRY-DPYTN  203

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP E+ILC DS+QSMYSQMLCGL   +QVLRVG +F+S FIRAI FLEKHW  LCHDI
Sbjct  204   YTSPIESILCLDSYQSMYSQMLCGLSQNEQVLRVGAVFSSGFIRAIKFLEKHWVSLCHDI  263

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             R GT++P I+D SVREA+ + +KPNP LA+FIE EC KESWKGII R+W NTKY+DV+VT
Sbjct  264   RYGTIDPEISDSSVREAIMKTLKPNPKLADFIEGECKKESWKGIITRVWPNTKYVDVIVT  323

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIP L+Y+ N LPLV T Y SSEC F +NLNPL +P+EV+YT+IPTMAYFEFLP+
Sbjct  324   GTMSQYIPILDYYSNGLPLVCTMYASSECYFGLNLNPLCEPSEVSYTLIPTMAYFEFLPL  383

Query  960   SREIG----VPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQ  793
             ++  G    +  P    ++DLVDV+LG+EYE+VVTTYAGLYRYRVGDILRVAGFKN  PQ
Sbjct  384   NKTKGHANSISHPEHEHLVDLVDVELGKEYELVVTTYAGLYRYRVGDILRVAGFKNKAPQ  443

Query  792   FNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLY  613
             FNFVCRKNV LSID+DKTDEVEL NAVKN +N L  FDASL EYTS A+TSTIPGHYVLY
Sbjct  444   FNFVCRKNVVLSIDSDKTDEVELQNAVKNGANRLAEFDASLTEYTSCADTSTIPGHYVLY  503

Query  612   WEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDY  433
             WEI+ + E PIP  +FE+CCFAVE  LNSVYR+ RV++ SIG LEI+IVENGTFDK+MD+
Sbjct  504   WEISTNDETPIPGSVFEECCFAVEGCLNSVYRQGRVAE-SIGALEIKIVENGTFDKLMDF  562

Query  432   AIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             A++ G+SI+QYK PRCV  API+ELLDS+ +S+YFS K P+W PGHK W
Sbjct  563   ALSQGASINQYKTPRCVNYAPIIELLDSKTVSSYFSTKCPQWVPGHKKW  611



>ref|XP_010539260.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Tarenaya 
hassleriana]
Length=611

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/598 (68%), Positives = 483/598 (81%), Gaps = 11/598 (2%)
 Frame = -1

Query  2046  ERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKL  1867
             ++ L E N + LQFIEDVT  A +VQ RVL+ IL  NA VEYL RHGL+G +DRE+FK++
Sbjct  14    DQGLAEKNKKKLQFIEDVTMKAEEVQRRVLEEILKRNAKVEYLKRHGLDGRSDRESFKRV  73

Query  1866  IPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLY  1687
             +PV+TYED++PDINR+ANG+   I+CS PISEF TSSGTS GE KL+PT EEEL+R+SL 
Sbjct  74    MPVITYEDIQPDINRIANGDNFPILCSKPISEFLTSSGTSGGERKLMPTIEEELDRRSLL  133

Query  1686  SSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPY  1507
              SLLMPV++QFVP L KGK MYFLF++ EAKTP GLLARPVLTS  K S+FK+R + +PY
Sbjct  134   YSLLMPVMSQFVPGLDKGKGMYFLFIKSEAKTPSGLLARPVLTSYYKSSHFKERPF-DPY  192

Query  1506  TDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCH  1327
             T+ TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW  L  
Sbjct  193   TNYTSPNETILCPDSYQSMYSQMLCGLCQRMEVLRVGAVFASGFIRAIKFLEKHWPELAC  252

Query  1326  DIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVV  1147
             DIRTG L+ +ITDPSVR AV +I+KP+P LA+FIE EC KESW+GII R+W NTKY+DV+
Sbjct  253   DIRTGILSAQITDPSVRGAVDKILKPDPKLADFIENECGKESWQGIITRLWPNTKYVDVI  312

Query  1146  VTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL  967
             VTG MSQYI TL+Y+ N LPLV T Y SSEC F +NL P+ KP+EV+YT+IPTMAYFEFL
Sbjct  313   VTGTMSQYIQTLDYYSNGLPLVCTMYASSECYFGVNLRPICKPSEVSYTLIPTMAYFEFL  372

Query  966   PVSREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVA  817
             PV R  GV           E    E++DLVDVKLGQEYE+VVTTYAGLYRYRVGD+LRV 
Sbjct  373   PVHRNNGVTNSINLPKSLTEREQKELVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLRVT  432

Query  816   GFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTST  637
             GFKN  PQF+F+CRKNV LSID+DKTDEVEL NAVK A   L+PF+A+L EYTS+A+T+T
Sbjct  433   GFKNKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKKAVTHLVPFEATLSEYTSYADTTT  492

Query  636   IPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENG  457
             +PGHYVL+WE+T   + PIP  IFEDCC  +EESLNSVYR+ RVSDKSIGPLEI+IVE G
Sbjct  493   VPGHYVLFWELTLKGQTPIPPSIFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKIVEAG  552

Query  456   TFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
             TFDK+MDYAI+ G+SI+QYK PRCV  APIVELL+SRV+S+YFSPK P+W PGHK W 
Sbjct  553   TFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYFSPKCPKWVPGHKQWG  610



>emb|CDX89263.1| BnaA01g16300D [Brassica napus]
Length=602

 Score =   842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/587 (68%), Positives = 480/587 (82%), Gaps = 1/587 (0%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             L+E N R LQ IE++T+NA QVQ RVL+ IL+ NA VEYL RH L+G TDRETFK ++PV
Sbjct  17    LDEKNKRRLQLIEELTSNADQVQRRVLEEILTRNADVEYLRRHDLDGRTDRETFKNVMPV  76

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             +TYED++P+INR+ANG+ S I+ S PISEF TSSGTS GE KL+PT EEEL+R+S   S 
Sbjct  77    ITYEDIQPEINRIANGDKSPILSSKPISEFLTSSGTSGGERKLMPTIEEELDRRSFLYSF  136

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV++QFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FK+R + +PYT+ 
Sbjct  137   LMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPF-DPYTNY  195

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEK W  L  DIR
Sbjct  196   TSPNETILCPDSYQSMYSQMLCGLCQHHEVLRVGAVFASGFIRAIKFLEKRWTELVRDIR  255

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             TGTL+  ITDPSVREAVA+I+K +P LAEF+E EC K+SW+GII R+W NTKY+DV+VTG
Sbjct  256   TGTLSSSITDPSVREAVAKILKQSPKLAEFVESECKKKSWQGIITRLWPNTKYVDVIVTG  315

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
              MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IPTMAYFEFLPV 
Sbjct  316   TMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMAYFEFLPVH  375

Query  957   REIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVC  778
             R   + E    E++DLVDVKLGQEYE+VVTTYAGL RYRVGD+L+V GFKN  PQF+F+C
Sbjct  376   RNTALTEKEQQELVDLVDVKLGQEYELVVTTYAGLCRYRVGDLLKVTGFKNKAPQFSFIC  435

Query  777   RKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQ  598
             RKNV LSID+DKTDEVEL NAVKNA   L+PFDAS+ EYTS+A+TS+IPGHYVL+WE+  
Sbjct  436   RKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASVSEYTSYADTSSIPGHYVLFWELCL  495

Query  597   SSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASG  418
                 PIP  +FEDCC A+EESLN+VYR+ RVSDKSIGPLEI+IVE GTFDK+MDYAI+ G
Sbjct  496   DGNTPIPPSVFEDCCLALEESLNTVYRQGRVSDKSIGPLEIKIVEPGTFDKLMDYAISLG  555

Query  417   SSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             +SI+QYK PRCV  API+ELL+SRV+ +YFSPK P+W PGHK W +N
Sbjct  556   ASINQYKTPRCVKFAPIIELLNSRVVDSYFSPKCPKWVPGHKQWGSN  602



>ref|XP_006413097.1| hypothetical protein EUTSA_v10024696mg [Eutrema salsugineum]
 dbj|BAJ34606.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ54550.1| hypothetical protein EUTSA_v10024696mg [Eutrema salsugineum]
Length=612

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/597 (68%), Positives = 482/597 (81%), Gaps = 11/597 (2%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             L+E N R LQ IE++T+NA QVQ RVL+ IL+ NA VEYL RH L+G TDRETFK ++PV
Sbjct  17    LDEKNKRKLQLIEELTSNADQVQRRVLEEILTRNADVEYLRRHDLDGRTDRETFKNVMPV  76

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             +TYED++P+INR+ANG+ S I+   PISEF TSSGTS GE KL+PT EEEL+R+SL  SL
Sbjct  77    ITYEDIQPEINRIANGDKSHILSIKPISEFLTSSGTSGGERKLMPTIEEELDRRSLLYSL  136

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV++QFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FK+R + +PYT+ 
Sbjct  137   LMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPF-DPYTNY  195

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW  L  DIR
Sbjct  196   TSPNETILCPDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIKFLEKHWTELVCDIR  255

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             TG L+  ITDPSVREAVA+I+KPNP LA+F+E EC K+SW+GII R+W NTKY+DV+VTG
Sbjct  256   TGVLSSLITDPSVREAVAKILKPNPKLADFVESECKKKSWQGIITRLWPNTKYVDVIVTG  315

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
              MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IPTMAYFEFLPV 
Sbjct  316   TMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLKPLCKPSEVSYTLIPTMAYFEFLPVH  375

Query  957   REIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFK  808
             R  GV           E    E++DLVDVKLGQEYE+VVTTYAGL RYRVGD+LRV GFK
Sbjct  376   RNTGVTNSINLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLCRYRVGDLLRVTGFK  435

Query  807   NNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPG  628
             N  PQF+F+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDASL EYTS+A+TS+IPG
Sbjct  436   NKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEYTSYADTSSIPG  495

Query  627   HYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
             HYVL+WE+      PIP  +FEDCC AVEESLN+VYR+ RVSDKSIGPLEI+IVE  TFD
Sbjct  496   HYVLFWELCLDGNTPIPPSVFEDCCLAVEESLNTVYRQGRVSDKSIGPLEIKIVEPNTFD  555

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             K+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+ +YFSPK P+W PGH+ W +N
Sbjct  556   KLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDSYFSPKCPKWVPGHRQWGSN  612



>gb|KHN27995.1| Indole-3-acetic acid-amido synthetase GH3.6 [Glycine soja]
Length=612

 Score =   842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/609 (66%), Positives = 488/609 (80%), Gaps = 13/609 (2%)
 Frame = -1

Query  2076  MTDALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNG  1897
             M +A   S+ +  LEE N +IL FIEDVT NA +VQ +VL  ILS NA VEYL RHG+NG
Sbjct  1     MPEAPRDSTKDYVLEEKNKKILDFIEDVTNNADEVQNKVLSEILSRNANVEYLRRHGVNG  60

Query  1896  ST-DRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPT  1720
              T DR+TFK+L+PV+TYED++PDINR+ANG+ S I+ + PI+EF TSSGTS GE KL+PT
Sbjct  61    QTVDRDTFKRLLPVITYEDIQPDINRIANGDKSPILTTKPITEFLTSSGTSGGERKLMPT  120

Query  1719  TEEELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRS  1540
              EEEL R+ +  SLLMP+++QFVPDL KGK MY +F++ E+KTPGG++ARPVLTS  K  
Sbjct  121   IEEELGRRCILYSLLMPIMSQFVPDLEKGKGMYLMFIKCESKTPGGIVARPVLTSYYKSP  180

Query  1539  YFKKRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIH  1360
             YF+ R Y +PYT  TSP ET+LC DS+QSMYSQ+LCGL    +VLRVG +FAS FIRAI 
Sbjct  181   YFRDRPY-DPYTKYTSPNETVLCPDSYQSMYSQLLCGLCQHKEVLRVGAIFASGFIRAIR  239

Query  1359  FLEKHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPR  1180
             FLEKHW LLC+DI+TGT+N  ITD SVREAV RI+K +P LA+FI  EC+K SW+GII R
Sbjct  240   FLEKHWTLLCNDIKTGTINNSITDSSVREAVMRILKADPKLADFIHNECSKGSWQGIITR  299

Query  1179  IWRNTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYT  1000
             +W NTKY+DV+VTG M+QYIPTL+Y+ NDLPLV T Y SSEC F +NLNPL KP++V+YT
Sbjct  300   LWPNTKYVDVIVTGTMAQYIPTLDYYSNDLPLVCTMYASSECYFGVNLNPLCKPSQVSYT  359

Query  999   IIPTMAYFEFLPVSR---EIGVPEPNPV--------EVLDLVDVKLGQEYEVVVTTYAGL  853
             +IPTM Y+EFLPV+R   E+    P+P         E+++LVDVKLGQEYE+VVTT+AGL
Sbjct  360   LIPTMCYYEFLPVNRSNNELAASRPSPTSLNQAQQEELVELVDVKLGQEYELVVTTHAGL  419

Query  852   YRYRVGDILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDAS  673
             YRYRVGDILRV+GFKN  PQF+FVCRKNVALSID+DKTDEVEL NA+KNA   L PFDA 
Sbjct  420   YRYRVGDILRVSGFKNKAPQFSFVCRKNVALSIDSDKTDEVELQNAMKNAVTHLEPFDAH  479

Query  672   LIEYTSHANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKS  493
             + EYTS+A+T+TIPGHYVLYWE+      PIP  ++EDCC  VEESLNSVYR+ RVSDKS
Sbjct  480   VSEYTSYADTTTIPGHYVLYWELNLKGSTPIPPCVYEDCCLTVEESLNSVYRQGRVSDKS  539

Query  492   IGPLEIRIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPP  313
             IG LEI+IVE GTFDK+MDYAI+ G+SI+QYK PRCV  APIVELL+SRV SNYFSPK P
Sbjct  540   IGALEIKIVEQGTFDKLMDYAISLGASINQYKAPRCVKFAPIVELLNSRVTSNYFSPKCP  599

Query  312   EWAPGHKHW  286
             +W PGHK W
Sbjct  600   KWVPGHKQW  608



>ref|XP_003540863.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Glycine 
max]
Length=629

 Score =   842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/598 (68%), Positives = 484/598 (81%), Gaps = 17/598 (3%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             +E +N + L++IEDVT+NA ++Q+RVL  ILS +A  EYL RHGL+G TDRETFKK++PV
Sbjct  27    IEHNNKKALKYIEDVTSNADEIQKRVLAEILSSSAHAEYLQRHGLDGRTDRETFKKIMPV  86

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             VTYED+KPDI+R+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEELER+SL  SL
Sbjct  87    VTYEDLKPDIDRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELERRSLLYSL  146

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYT-NPYTD  1501
             LMPV+ QFVP L KGK MYFLF++ EAKTPGGLLARPVLTS  + S+FK +T+  +PYT+
Sbjct  147   LMPVMEQFVPGLDKGKGMYFLFIKSEAKTPGGLLARPVLTSYYRSSHFKNKTHCFDPYTN  206

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ETILC DS+QSMYSQMLCGL   + VLRVG +FAS FIRA+ FLEKHW  LC DI
Sbjct  207   YTSPIETILCLDSYQSMYSQMLCGLSQNEHVLRVGAVFASGFIRALKFLEKHWVCLCRDI  266

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             R GT+ P ITD SVREA+ R++KPNP LA+FIE EC K  WKGII R+W NTKY+DV+VT
Sbjct  267   RNGTIGPEITDSSVREAIMRVLKPNPKLADFIEGECKKGLWKGIITRLWPNTKYVDVIVT  326

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G M+QYIP L+Y+ N LPLV T Y SSEC F +NLNPL  P+EV+YT++PTMAYFEFLP+
Sbjct  327   GTMAQYIPMLDYYSNGLPLVCTMYASSECYFGLNLNPLCDPSEVSYTLVPTMAYFEFLPL  386

Query  960   SREIGVPEPNPVE------VLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNT  799
             ++       N +       ++DLVDV+LGQEYE+VVTTYAGLYRYRVGDILRVAGFKNN 
Sbjct  387   NKT--KEHANSISYTEQELLVDLVDVELGQEYELVVTTYAGLYRYRVGDILRVAGFKNNA  444

Query  798   PQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYV  619
             PQFNFVCRKNV LSID+DKTDEVEL NAVKN +N L  F ASL EYTS A+TSTIPGHYV
Sbjct  445   PQFNFVCRKNVVLSIDSDKTDEVELQNAVKNGANHLTLFGASLTEYTSFADTSTIPGHYV  504

Query  618   LYWEITQS-------SENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVEN  460
             LYWEI+ +       ++NPIP  +FE+CCFAVE SLNSVYR+ RVS+ SIGPLEI+IVEN
Sbjct  505   LYWEISMNKNNNIDQNQNPIPSSVFEECCFAVEGSLNSVYRQGRVSE-SIGPLEIKIVEN  563

Query  459   GTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             GTFDK+MD+A++ G+SI+QYK PRCV  APIVELLDS+ +SNYFSPK P W PGHK W
Sbjct  564   GTFDKLMDFALSQGASINQYKTPRCVKYAPIVELLDSKTVSNYFSPKCPLWVPGHKKW  621



>ref|NP_194456.1| indole-3-acetic acid-amido synthetase GH3.5 [Arabidopsis thaliana]
 sp|O81829.1|GH35_ARATH RecName: Full=Indole-3-acetic acid-amido synthetase GH3.5; AltName: 
Full=Auxin-responsive GH3-like protein 5; Short=AtGH3-5 
[Arabidopsis thaliana]
 emb|CAA19720.1| GH3 like protein [Arabidopsis thaliana]
 emb|CAB79581.1| GH3 like protein [Arabidopsis thaliana]
 gb|AAL49795.1| putative GH3 protein [Arabidopsis thaliana]
 gb|AAM20166.1| putative GH3 protein [Arabidopsis thaliana]
 gb|ABF58888.1| auxin-responsive GH3-like [Arabidopsis thaliana]
 gb|AEE85318.1| indole-3-acetic acid-amido synthetase GH3.5 [Arabidopsis thaliana]
Length=612

 Score =   841 bits (2172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/597 (68%), Positives = 483/597 (81%), Gaps = 11/597 (2%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             L++ N + LQ IE++T+NA QVQ +VL+ IL+ NA VEYL RH LNG TDRETFK ++PV
Sbjct  17    LDQKNKQKLQLIEELTSNADQVQRQVLEEILTRNADVEYLRRHDLNGRTDRETFKNIMPV  76

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             +TYED++P+INR+ANG+ S I+ S PISEF TSSGTS GE KL+PT EEEL+R+SL  SL
Sbjct  77    ITYEDIEPEINRIANGDKSPILSSKPISEFLTSSGTSGGERKLMPTIEEELDRRSLLYSL  136

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV++QFVP L  GK MYFLF++ E+KTPGGL ARPVLTS  K S+FK+R Y +PYT+ 
Sbjct  137   LMPVMSQFVPGLENGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPY-DPYTNY  195

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP ETILC+DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW  L  DIR
Sbjct  196   TSPNETILCSDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIKFLEKHWIELVRDIR  255

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             TGTL+  ITDPSVREAVA+I+KP+P LA+F+E EC K SW+GII R+W NTKY+DV+VTG
Sbjct  256   TGTLSSLITDPSVREAVAKILKPSPKLADFVEFECKKSSWQGIITRLWPNTKYVDVIVTG  315

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
              MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IP+MAYFEFLPV 
Sbjct  316   TMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPSMAYFEFLPVH  375

Query  957   REIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFK  808
             R  GV           E    E++DLVDVKLGQEYE+VVTTYAGL RYRVGD+LRV GFK
Sbjct  376   RNNGVTNSINLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLCRYRVGDLLRVTGFK  435

Query  807   NNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPG  628
             N  PQF+F+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDASL EYTS+A+TS+IPG
Sbjct  436   NKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEYTSYADTSSIPG  495

Query  627   HYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
             HYVL+WE+      PIP  +FEDCC AVEES N+VYR+ RVSDKSIGPLEI+IVE GTFD
Sbjct  496   HYVLFWELCLDGNTPIPPSVFEDCCLAVEESFNTVYRQGRVSDKSIGPLEIKIVEPGTFD  555

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             K+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+ +YFSPK P+W PGHK W +N
Sbjct  556   KLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDSYFSPKCPKWVPGHKQWGSN  612



>ref|XP_003543279.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Glycine 
max]
 gb|KHN36753.1| Indole-3-acetic acid-amido synthetase GH3.6 [Glycine soja]
Length=611

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/608 (66%), Positives = 489/608 (80%), Gaps = 12/608 (2%)
 Frame = -1

Query  2076  MTDALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNG  1897
             M +A   S+ +  LEE N +IL FIEDVT NA +VQ++VL  ILS NA VEYL RHG+NG
Sbjct  1     MPEAPGDSTKDYVLEEKNKKILDFIEDVTNNADEVQKKVLSEILSRNANVEYLRRHGVNG  60

Query  1896  ST-DRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPT  1720
              T D +TFK+L+PV+TYED++PDINR+ANG+ S I+ S P++EF TSSGTS GE KL+PT
Sbjct  61    QTVDPDTFKRLLPVITYEDIQPDINRIANGDKSPILTSKPVTEFLTSSGTSGGERKLMPT  120

Query  1719  TEEELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRS  1540
              EEEL R+ +  SLLMP++NQFVPDL KGK MY +F++ E+KTPGG++ARPVLTS  K  
Sbjct  121   IEEELGRRCMLYSLLMPIMNQFVPDLEKGKGMYLMFIKCESKTPGGIVARPVLTSYYKSP  180

Query  1539  YFKKRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIH  1360
             YF+ R+Y +PYT+ TSP ET+LC DS+QSMYSQ+LCGL    +VLRVG +FAS FIRAI 
Sbjct  181   YFRDRSY-DPYTNYTSPNETVLCLDSYQSMYSQLLCGLCQHKEVLRVGAIFASGFIRAIR  239

Query  1359  FLEKHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPR  1180
             FLEKHW LLC+DI+TGT+N  ITD SVREAV RI+K +P LA+FI  EC+K SW+GII R
Sbjct  240   FLEKHWALLCNDIKTGTINNSITDSSVREAVMRILKADPKLADFIHNECSKGSWQGIITR  299

Query  1179  IWRNTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYT  1000
             +W NTKY+DV+VTG M+QYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+ V+YT
Sbjct  300   LWPNTKYVDVIVTGTMAQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSHVSYT  359

Query  999   IIPTMAYFEFLPVSR--EIGVPEPNPV--------EVLDLVDVKLGQEYEVVVTTYAGLY  850
             +IPTM Y+EFLPV+R  E+    P+P         E+++LVDVKLGQEYE+VVTT+AGLY
Sbjct  360   LIPTMCYYEFLPVNRSNELAASRPSPTSLNQAQQQELVELVDVKLGQEYELVVTTHAGLY  419

Query  849   RYRVGDILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASL  670
             RYRVGDIL+V+GFKN  PQF+FVCRKNVALSID+DKTDEVEL NA+KNA   L PFDA +
Sbjct  420   RYRVGDILKVSGFKNKAPQFSFVCRKNVALSIDSDKTDEVELQNAMKNAVTHLEPFDAHV  479

Query  669   IEYTSHANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSI  490
              EYTS+A+T+TIPGHYVLYWE+      PIP  ++EDCC  +EESLNSVYR+ RVSDKSI
Sbjct  480   SEYTSYADTTTIPGHYVLYWELNLKGSTPIPPCVYEDCCLTIEESLNSVYRQGRVSDKSI  539

Query  489   GPLEIRIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPE  310
             GPLEI+IVE GTFDK+MDYAI+ G+SI+QYK PRCV  APIVELL+SRV SNYFSPK P+
Sbjct  540   GPLEIKIVEQGTFDKLMDYAISLGASINQYKAPRCVKFAPIVELLNSRVTSNYFSPKCPK  599

Query  309   WAPGHKHW  286
             W PGHK W
Sbjct  600   WVPGHKQW  607



>gb|EYU19184.1| hypothetical protein MIMGU_mgv1a003042mg [Erythranthe guttata]
Length=612

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/589 (69%), Positives = 485/589 (82%), Gaps = 10/589 (2%)
 Frame = -1

Query  2025  NNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGL-NGSTDRETFKKLIPVVTY  1849
             NN+ L+FIE+VTTNA +VQ+RVL  ILS NAGVEYL RHG   G+TDR+TFKK++PV+TY
Sbjct  23    NNKKLEFIEEVTTNADEVQKRVLSEILSRNAGVEYLKRHGFEGGNTDRDTFKKIMPVITY  82

Query  1848  EDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLMP  1669
             ED+ PDINR+ANG+ S I+CS PISEF TSSGTS GE K++PT EEEL R+SL  SLLMP
Sbjct  83    EDILPDINRIANGDKSPILCSDPISEFLTSSGTSAGERKVMPTIEEELGRRSLLYSLLMP  142

Query  1668  VINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTSP  1489
             V++QFVP L KGK MYFLFV+ E KTPGGL ARPVLTS  K S+FK R + +PYT+ TSP
Sbjct  143   VMSQFVPGLDKGKGMYFLFVKCETKTPGGLPARPVLTSYYKSSHFKDRPF-DPYTNYTSP  201

Query  1488  RETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTGT  1309
              ETILC DS+QSMYSQMLCGL+  +QVLRVG +FAS FIRAI FLEK+W LL HDIRTGT
Sbjct  202   NETILCPDSYQSMYSQMLCGLFQNNQVLRVGAVFASGFIRAIRFLEKNWALLAHDIRTGT  261

Query  1308  LNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAMS  1129
             +N  ITDPSVR+AV RI+KP+P LA+FIE EC KESW+GII +IW NTKYIDV+VTG MS
Sbjct  262   VNSLITDPSVRDAVTRILKPDPKLADFIEAECGKESWQGIITKIWPNTKYIDVIVTGTMS  321

Query  1128  QYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSREI  949
             QYIPTL+Y+ + LPLV T Y SSEC F +NLNPL KP++VAYT+IPTM Y+EFLPVSR  
Sbjct  322   QYIPTLDYYSDGLPLVCTMYASSECYFGVNLNPLCKPSDVAYTLIPTMCYYEFLPVSRNN  381

Query  948   GVPEPNPV------EVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFN  787
             G+P P  +      E++DLVDV+LG EYE+VVTTYAGLYRYRVGD+LRVAGFKNN PQFN
Sbjct  382   GMPLPKSLNEKEQQELVDLVDVELGHEYELVVTTYAGLYRYRVGDVLRVAGFKNNAPQFN  441

Query  786   FVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE  607
             FVCRKNV LSID DKTDEVEL NAVKNA   L+PFD+ L EYTS+A+T+TIPGHYVLYWE
Sbjct  442   FVCRKNVVLSIDTDKTDEVELQNAVKNAVTHLIPFDSRLTEYTSYADTATIPGHYVLYWE  501

Query  606   ITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAI  427
             ++Q     IP  ++EDCC  +EESL+SVYR+ R  D +IGPLEI+IVE+GTFDK+MDYAI
Sbjct  502   LSQIGSTQIPASVYEDCCLTIEESLDSVYRQNRHFD-AIGPLEIKIVESGTFDKLMDYAI  560

Query  426   ASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEW-APGHKHWN  283
             + G+SI+QYK PRCV  APIVELL+SRV++ YFSPK P+W  PG K W+
Sbjct  561   SLGASINQYKTPRCVKFAPIVELLNSRVVACYFSPKCPKWTTPGLKQWS  609



>ref|XP_002869571.1| GH3.5/WES1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45830.1| GH3.5/WES1 [Arabidopsis lyrata subsp. lyrata]
Length=612

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/597 (68%), Positives = 480/597 (80%), Gaps = 11/597 (2%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             L++ N + LQ IE++T+NA Q Q RVL+ ILS NA VEYL RH LNG TDRETFK ++PV
Sbjct  17    LDQKNKQKLQLIEELTSNADQFQRRVLEEILSRNADVEYLRRHYLNGRTDRETFKNVMPV  76

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             +TYED++P+INR+ANG+ S I+ S PISEF TSSGTS GE KL+PT EEEL+R+SL  SL
Sbjct  77    ITYEDIQPEINRIANGDKSPILSSKPISEFLTSSGTSGGERKLMPTIEEELDRRSLLYSL  136

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV++QFVP L  GK MYFLF++ E+KTPGGL ARPVLTS  K S+FK+R Y +PYT+ 
Sbjct  137   LMPVMSQFVPGLENGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPY-DPYTNY  195

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP ETILC+DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW  L  DIR
Sbjct  196   TSPNETILCSDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIKFLEKHWTELVRDIR  255

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             TGTL+  ITDPSVREAV++I+KPN  LAEF+E EC K SW+GII R+W NTKY+DV+VTG
Sbjct  256   TGTLSSLITDPSVREAVSKILKPNSKLAEFVEFECKKSSWQGIITRLWPNTKYVDVIVTG  315

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
              MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IP+MAYFEFLPV 
Sbjct  316   TMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPSMAYFEFLPVH  375

Query  957   REIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFK  808
             R  GV           E    E++DLVDVKLGQEYE+VVTTYAGL RYRVGD+LRV GFK
Sbjct  376   RNNGVTNSINLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLCRYRVGDLLRVTGFK  435

Query  807   NNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPG  628
             N  PQF+F+CRKNV LSIDADKTDEVEL NAVKNA   L+PFDASL EYTS+A+TS+IPG
Sbjct  436   NKAPQFSFICRKNVVLSIDADKTDEVELQNAVKNAVTYLVPFDASLSEYTSYADTSSIPG  495

Query  627   HYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
             HYVL+WE+      PIP  +FEDCC  VEES N+VYR+ RVSDKSIGPLEI+IVE GTFD
Sbjct  496   HYVLFWELCLDGNTPIPPSVFEDCCLTVEESFNTVYRQGRVSDKSIGPLEIKIVEPGTFD  555

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             K+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+++Y SPK P+W PGHK W +N
Sbjct  556   KLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVNSYLSPKCPKWVPGHKQWGSN  612



>ref|XP_009143243.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.5 [Brassica 
rapa]
Length=612

 Score =   837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/597 (68%), Positives = 481/597 (81%), Gaps = 11/597 (2%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             L+E N R LQ IE++T+NA QVQ RVL+ IL+ NA VEYL RH L+G TDRETFK ++PV
Sbjct  17    LDEKNKRRLQLIEELTSNADQVQRRVLEEILTRNADVEYLRRHDLDGRTDRETFKNVMPV  76

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             +TYED++P+INR+ANG+ S I+ S PISEF TSSGTS GE KL+PT EEEL+R+S   S 
Sbjct  77    ITYEDIQPEINRIANGDKSPILSSKPISEFLTSSGTSGGERKLMPTIEEELDRRSFLYSF  136

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV++QFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FK+R + +PYT+ 
Sbjct  137   LMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPF-DPYTNY  195

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEK W  L  DIR
Sbjct  196   TSPNETILCPDSYQSMYSQMLCGLCQHHEVLRVGAVFASGFIRAIKFLEKRWTELVRDIR  255

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             TGTL+  ITDPSVREAVA+I+K +P LAEF+E EC K+SW+GII R+W NTKY+DV+VTG
Sbjct  256   TGTLSSSITDPSVREAVAKILKQSPKLAEFVESECKKKSWQGIITRLWPNTKYVDVIVTG  315

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
              MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IPTMAYFEFLPV 
Sbjct  316   TMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMAYFEFLPVH  375

Query  957   REIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFK  808
             R  GV           E    E++DLVDVKLGQEYE+VVTTYAGL RYRVGD+L+V GFK
Sbjct  376   RNTGVTNSINLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLCRYRVGDLLKVTGFK  435

Query  807   NNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPG  628
             N  PQF+F+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDAS+ EYTS+A+TS+IPG
Sbjct  436   NKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASVSEYTSYADTSSIPG  495

Query  627   HYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
             HYVL+WE+      PIP  +FEDCC A+EESLN+VYR+ RVSDKSIGPLEI+IVE GTFD
Sbjct  496   HYVLFWELCLDGNTPIPPSVFEDCCLALEESLNTVYRQGRVSDKSIGPLEIKIVEPGTFD  555

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             K+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+ +YFSPK P+W PGHK W +N
Sbjct  556   KLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDSYFSPKCPKWVPGHKQWGSN  612



>ref|XP_003527474.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Glycine 
max]
Length=624

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/593 (68%), Positives = 483/593 (81%), Gaps = 10/593 (2%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             +E +N + L++IEDVT+NA ++Q+RVL  ILS +A VEYL RHGL G TDRETFKK++PV
Sbjct  29    IEHNNKKALKYIEDVTSNADEIQKRVLAEILSCSAHVEYLQRHGLEGRTDRETFKKIMPV  88

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             VTYED+KPDI+R+ANG+ S I+CS PISEF TSSGTS GE KL+PT E+ELER+SL  SL
Sbjct  89    VTYEDLKPDIDRIANGDASPILCSKPISEFLTSSGTSGGERKLMPTIEDELERRSLLYSL  148

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYT---NPY  1507
             LMPV++QFVP L KGK MYFLF++ E+KTPGGLLARPVLTS  K S+FK +T+    +PY
Sbjct  149   LMPVMDQFVPGLDKGKGMYFLFIKSESKTPGGLLARPVLTSYYKSSHFKNKTHGLNFDPY  208

Query  1506  TDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCH  1327
             T+ TSP ETILC DS+QSMYSQMLCGL   + VLRVG++FAS FIRA+ FLEKHW  LCH
Sbjct  209   TNYTSPIETILCQDSYQSMYSQMLCGLSQNEHVLRVGSVFASGFIRALKFLEKHWESLCH  268

Query  1326  DIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVV  1147
             DIR GT++  ITD +VREA+ +I+KPNP LA+FIE EC K  WKGII R+W NTKY+DV+
Sbjct  269   DIRNGTIDHEITDSTVREAIMKILKPNPKLADFIEGECKKGLWKGIITRLWPNTKYVDVI  328

Query  1146  VTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL  967
             VTG M+QYIP L+Y+ N LPLV T Y SSEC F +NLNPL  P+EV+YT++PTMAYFEFL
Sbjct  329   VTGTMAQYIPMLDYYSNGLPLVCTMYASSECYFGLNLNPLCDPSEVSYTLVPTMAYFEFL  388

Query  966   PVSREIG----VPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNT  799
             P+++  G    +       ++DLVDV+L QEYE+VVTTYAGLYRYRVGDILRVAGFKNN 
Sbjct  389   PLNKMKGHANSISHTEQELLVDLVDVELDQEYELVVTTYAGLYRYRVGDILRVAGFKNNA  448

Query  798   PQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYV  619
             PQFNFVCRKNV LSID+DKTDEVEL NAVKN +  L    ASL EYTS A+TSTIPGHYV
Sbjct  449   PQFNFVCRKNVVLSIDSDKTDEVELQNAVKNGAKHLATLGASLTEYTSCADTSTIPGHYV  508

Query  618   LYWEITQSS--ENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDK  445
             LYWEI  ++  + PIP  +FE+CCFAVE SLNSVYR+ RVS+ SIGPLEI+IVENGTFDK
Sbjct  509   LYWEINMNNNDQTPIPSSVFEECCFAVEGSLNSVYRQGRVSE-SIGPLEIKIVENGTFDK  567

Query  444   MMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             +MD+A++ G+SI+QYK PRCV  APIVELLDS+ +SNYFSPK P+W PGHK W
Sbjct  568   LMDFALSQGASINQYKTPRCVKYAPIVELLDSKTVSNYFSPKCPQWVPGHKKW  620



>gb|KHN41185.1| Indole-3-acetic acid-amido synthetase GH3.6 [Glycine soja]
Length=624

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/593 (68%), Positives = 483/593 (81%), Gaps = 10/593 (2%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             +E +N + L++IEDVT+NA ++Q+RVL  ILS +A VEYL RHGL G TDRETFKK++PV
Sbjct  29    IEHNNKKALKYIEDVTSNADEIQKRVLAEILSCSAHVEYLQRHGLEGRTDRETFKKIMPV  88

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             VTYED+KPDI+R+ANG+ S I+CS PISEF TSSGTS GE KL+PT E+ELER+SL  SL
Sbjct  89    VTYEDLKPDIDRIANGDASPILCSKPISEFLTSSGTSGGERKLMPTIEDELERRSLLYSL  148

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYT---NPY  1507
             LMPV++QFVP L KGK MYFLF++ E+KTPGGLLARPVLTS  K S+FK +T+    +PY
Sbjct  149   LMPVMDQFVPGLDKGKGMYFLFIKSESKTPGGLLARPVLTSYYKSSHFKNKTHGLNFDPY  208

Query  1506  TDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCH  1327
             T+ TSP ETILC DS+QSMYSQMLCGL   + VLRVG++FAS FIRA+ FLEKHW  LCH
Sbjct  209   TNYTSPIETILCQDSYQSMYSQMLCGLSQNEHVLRVGSVFASGFIRALKFLEKHWESLCH  268

Query  1326  DIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVV  1147
             DIR GT++  ITD +VREA+ +I+KPNP LA+FIE EC K  WKGII R+W NTKY+DV+
Sbjct  269   DIRNGTIDHEITDSTVREAIMKILKPNPKLADFIEGECKKGLWKGIITRLWPNTKYVDVI  328

Query  1146  VTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL  967
             VTG M+QYIP L+Y+ N LPLV T Y SSEC F +NLNPL  P+EV+YT++PTMAYFEFL
Sbjct  329   VTGTMAQYIPMLDYYSNGLPLVCTMYASSECYFGLNLNPLCDPSEVSYTLVPTMAYFEFL  388

Query  966   PVSREIG----VPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNT  799
             P+++  G    +       ++DLVDV+L QEYE+VVTTYAGLYRYRVGDILRVAGFKNN 
Sbjct  389   PLNKMKGHANSISHTEQELLVDLVDVELDQEYELVVTTYAGLYRYRVGDILRVAGFKNNA  448

Query  798   PQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYV  619
             PQFNFVCRKNV LSID+DKTDEVEL NAVKN +  L    ASL EYTS A+TSTIPGHYV
Sbjct  449   PQFNFVCRKNVVLSIDSDKTDEVELQNAVKNGAKHLATLGASLTEYTSCADTSTIPGHYV  508

Query  618   LYWEITQSS--ENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDK  445
             LYWEI  ++  + PIP  +FE+CCFAVE SLNSVYR+ RVS+ SIGPLEI+IVENGTFDK
Sbjct  509   LYWEINMNNNDQTPIPSSVFEECCFAVEGSLNSVYRQGRVSE-SIGPLEIKIVENGTFDK  567

Query  444   MMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             +MD+A++ G+SI+QYK PRCV  APIVELLDS+ +SNYFSPK P+W PGHK W
Sbjct  568   LMDFALSQGASINQYKTPRCVKYAPIVELLDSKTVSNYFSPKCPQWVPGHKKW  620



>ref|XP_006363511.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Solanum 
tuberosum]
Length=614

 Score =   836 bits (2160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/612 (67%), Positives = 485/612 (79%), Gaps = 15/612 (2%)
 Frame = -1

Query  2076  MTDALESSSDERN--LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHG-  1906
             M +A ++S    N  + E N + L FIE+VTT A +VQ+RVL  ILS N+ VEYL R+G 
Sbjct  1     MPEAPKNSPKANNFIVAEENKKTLHFIEEVTTKADEVQKRVLAEILSRNSNVEYLKRYGN  60

Query  1905  LNGSTDRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLI  1726
             LN +TDRETFKK++PV+TYED++ DINR+A+G+ S I CS P+SEF TSSGTS GE KL+
Sbjct  61    LNDNTDRETFKKVMPVITYEDIQHDINRIASGDKSPIFCSQPVSEFLTSSGTSGGERKLM  120

Query  1725  PTTEEELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQK  1546
             PTTEEEL R+SL  SLLMPV++ FVPDL  GK MYFLFV+ E+KTPGGLLARPVLTS  K
Sbjct  121   PTTEEELGRRSLLYSLLMPVMSHFVPDLETGKGMYFLFVKSESKTPGGLLARPVLTSYYK  180

Query  1545  RSYFKKRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRA  1366
               +FK R   +PYT+ TSP E ILC DS+QSMYSQMLCGL    QVLRVG +FAS FIRA
Sbjct  181   SPHFKNRR-PDPYTNYTSPNEAILCPDSYQSMYSQMLCGLSQNAQVLRVGAVFASGFIRA  239

Query  1365  IHFLEKHWRLLCHDIRTGTLNPR-ITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGI  1189
             I FLEKHW LLC DIR+G +N   ITD SVREAV +I+KP+PDLA+FIE EC+K+SW+GI
Sbjct  240   IRFLEKHWSLLCSDIRSGIMNTELITDSSVREAVMKILKPDPDLADFIEAECSKKSWQGI  299

Query  1188  IPRIWRNTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEV  1009
             I R+W NTKY+DV+VTG MSQYIPTL+Y+ N L LV T Y SSEC F +NLNPL KP +V
Sbjct  300   ITRLWPNTKYVDVIVTGTMSQYIPTLDYYSNGLSLVCTMYASSECYFGVNLNPLCKPEDV  359

Query  1008  AYTIIPTMAYFEFLPVSREIGV----------PEPNPVEVLDLVDVKLGQEYEVVVTTYA  859
             AYT+IPTM YFEFLP+ R  GV           E     ++DLVDVK+GQEYE+VVTTYA
Sbjct  360   AYTLIPTMCYFEFLPIYRNNGVMDSISAPKSLNEKEKQTLVDLVDVKIGQEYELVVTTYA  419

Query  858   GLYRYRVGDILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFD  679
             GLYRYRVGD+LRVAGFKNN PQFNF+CRKNV LSID+DKTDEVEL NA+KNA + L+PFD
Sbjct  420   GLYRYRVGDVLRVAGFKNNAPQFNFICRKNVVLSIDSDKTDEVELQNAMKNAVSHLMPFD  479

Query  678   ASLIEYTSHANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSD  499
             A + EYTS+A+T+TIPGHYVL+WEI  +   P+   +FEDCC  +EESLNSVYR+ R SD
Sbjct  480   AHVTEYTSYADTTTIPGHYVLFWEINVNGSTPVHPSVFEDCCLTIEESLNSVYRQGRASD  539

Query  498   KSIGPLEIRIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPK  319
             KSIGPLEIRIVE GTFDK+MDYAI+ G+SI+QYK PRCV  API+ELL+SRVMS YFSPK
Sbjct  540   KSIGPLEIRIVEIGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVMSKYFSPK  599

Query  318   PPEWAPGHKHWN  283
              P+W PGHK WN
Sbjct  600   CPKWTPGHKQWN  611



>ref|XP_009137649.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.5 isoform 
X2 [Brassica rapa]
Length=608

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/597 (68%), Positives = 478/597 (80%), Gaps = 15/597 (3%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             L+E N R LQ IE++T+NA QVQ+RVL+ IL  NA VEYL RH LNG TDRETFK ++PV
Sbjct  17    LDEKNKRKLQLIEELTSNADQVQKRVLEEILIRNADVEYLRRHDLNGRTDRETFKNVMPV  76

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             +TYED++P+INR+ANG+ S I+ S PISEF TSSGTS GE KL+PT EEEL+R+SL  S 
Sbjct  77    ITYEDIQPEINRIANGDKSPILSSKPISEFLTSSGTSGGERKLMPTIEEELDRRSLLYSF  136

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV++QFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FK+R + +PYTD 
Sbjct  137   LMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPF-DPYTDY  195

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW  L  DIR
Sbjct  196   TSPNETILCPDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIKFLEKHWTELVRDIR  255

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             TGTL+  ITDPSVREAVA+I+KP+P LA+F+E EC K+SW GII R+W NTKY+DV+VTG
Sbjct  256   TGTLSSLITDPSVREAVAKILKPSPKLADFVEFECKKKSWHGIITRLWPNTKYVDVIVTG  315

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
              MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IPTMAYFEFLPV 
Sbjct  316   TMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMAYFEFLPVH  375

Query  957   REIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFK  808
             R  GV           E    E++DLVDVKLGQEYE+VVTTYAG     VGD+LRV GFK
Sbjct  376   RNTGVTNSINLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAG----GVGDLLRVTGFK  431

Query  807   NNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPG  628
             N  PQF+F+CRKNV LSID+DKTDEVEL NAVKNA   L+PFDASL EYTS+A+TS+IPG
Sbjct  432   NKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAMTHLVPFDASLSEYTSYADTSSIPG  491

Query  627   HYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
             HYVL+WE+      PIP  +FEDCC AVEES NSVYR+ RVSDKSIGPLEI+IVE GTFD
Sbjct  492   HYVLFWELCLDGNTPIPPSVFEDCCLAVEESFNSVYRQGRVSDKSIGPLEIKIVEPGTFD  551

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             K+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+ +YFSPK P+W PGHK W +N
Sbjct  552   KLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDSYFSPKCPKWVPGHKQWGSN  608



>ref|XP_004251485.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Solanum 
lycopersicum]
Length=609

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/597 (67%), Positives = 477/597 (80%), Gaps = 13/597 (2%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHG-LNGSTDRETFKKLIP  1861
             + E N + L FIEDVTT A ++Q+RVL  IL  NA VEYL R+  LNG+TDRETFKK++P
Sbjct  11    VAEENKKTLHFIEDVTTKADEIQKRVLAEILCRNANVEYLKRYADLNGNTDRETFKKVMP  70

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             V++YED++ DINR+A+G+ S I+CS P+SEF TSSGTS GE KL+PTTEEEL R+SL  S
Sbjct  71    VISYEDIQHDINRIASGDTSPILCSQPVSEFLTSSGTSGGERKLMPTTEEELGRRSLLYS  130

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV++ FVPDL  GK MYFLFV+ E+KTPGGLLARPVLTS     +FK R   +PYT+
Sbjct  131   LLMPVMSHFVPDLETGKGMYFLFVKSESKTPGGLLARPVLTSYYNSPHFKNRR-PDPYTN  189

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ETILC DS+QSMYSQMLCGL    QVLRVG +FAS FIRAI FLEKHW LLC DI
Sbjct  190   YTSPNETILCPDSYQSMYSQMLCGLSQNAQVLRVGAVFASGFIRAIRFLEKHWSLLCTDI  249

Query  1320  RTGTLNPR-ITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVV  1144
             R+G +N   ITD SVREAV +I+KP+PDLA+FIE EC+K+SW+GII R+W NTKY+DV+V
Sbjct  250   RSGIMNTELITDSSVREAVMKILKPDPDLADFIEAECSKKSWQGIITRLWPNTKYVDVIV  309

Query  1143  TGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLP  964
             TG MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP +VAYT+IPTM YFEFLP
Sbjct  310   TGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLCKPEDVAYTLIPTMCYFEFLP  369

Query  963   VSREIGV----------PEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAG  814
             + R  GV           E     ++DLVDVK+GQEYE+VVTTYAGLYRYRVGD+LRVAG
Sbjct  370   IHRNNGVMDSIAAPKSLNENEQQTLVDLVDVKIGQEYELVVTTYAGLYRYRVGDVLRVAG  429

Query  813   FKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTI  634
             FKN  PQFNF+CRKNV LSID+DKTDEVEL NA+KNA + L+PFDA + EYTS+A+T+ I
Sbjct  430   FKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAMKNAVSHLMPFDAHVTEYTSYADTTII  489

Query  633   PGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGT  454
             PGHYVL+WE+  +   P+   +FEDCC  +EESLNSVYR+ R SDKSIGPLEIRIVE GT
Sbjct  490   PGHYVLFWEVNVNGSTPVHPSVFEDCCLTIEESLNSVYRQGRASDKSIGPLEIRIVEVGT  549

Query  453   FDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
             FDK+MDYAI+ G+SI+QYK PRCV  API+ELL+SRVMS YFSPK P+W PGHK WN
Sbjct  550   FDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVMSKYFSPKCPKWTPGHKQWN  606



>ref|XP_006851205.1| hypothetical protein AMTR_s00043p00208540 [Amborella trichopoda]
 gb|ERN12786.1| hypothetical protein AMTR_s00043p00208540 [Amborella trichopoda]
Length=600

 Score =   829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/609 (65%), Positives = 486/609 (80%), Gaps = 19/609 (3%)
 Frame = -1

Query  2076  MTDALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNG  1897
             M +A ++S+DE+ L        + IEDVT+ A +VQ+RVL  IL  NA  EYL R GL G
Sbjct  1     MPEAKKNSNDEKGL--------KLIEDVTSKAEEVQDRVLADILKRNANTEYLRRRGLEG  52

Query  1896  STDRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTT  1717
              TDRE+FK+++PV+TYED++PDI+R+ANG+ S I+CS  +SEF TSSGTS GE KL+PT 
Sbjct  53    RTDRESFKRMLPVITYEDIQPDIHRIANGDKSPILCSHAVSEFLTSSGTSGGERKLMPTI  112

Query  1716  EEELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSY  1537
             EE+++R++L+ SLL+P++NQ VP L KGK MYFLFV+ EAKTP GLLARPVLTS  K  +
Sbjct  113   EEDMDRRALFYSLLIPIMNQHVPGLDKGKGMYFLFVKSEAKTPSGLLARPVLTSYYKSKH  172

Query  1536  FKKRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHF  1357
             F +R Y +P+   TSP E ILC DS+QSMYSQ+LCGL    +VLRVG +FAS FIRAIHF
Sbjct  173   FTERPY-DPFNVYTSPNEAILCPDSYQSMYSQLLCGLAQNQEVLRVGAVFASGFIRAIHF  231

Query  1356  LEKHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRI  1177
             LE+HWRLLC D+R+G++NP ITDP VREAV +I+KP P LA+FIE EC+K SWK II R+
Sbjct  232   LEQHWRLLCEDLRSGSVNPHITDPGVREAVMKILKPKPKLADFIEMECSKGSWKSIITRL  291

Query  1176  WRNTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTI  997
             W NTKYIDV+VTG MSQYI TL+++ N LPLV T Y SSEC F +NL PL KP+EVAYT+
Sbjct  292   WPNTKYIDVIVTGTMSQYIATLDFYSNGLPLVCTMYGSSECYFGLNLKPLCKPSEVAYTL  351

Query  996   IPTMAYFEFLPVSR-----EIGVP----EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRY  844
             +PTMAYFEFLPV++     EI VP    E     ++DLVDV++GQEYE+VVTTYAGLYRY
Sbjct  352   LPTMAYFEFLPVNKSNGVCEISVPKDLNEKEKKGLVDLVDVEVGQEYELVVTTYAGLYRY  411

Query  843   RVGDILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIE  664
             RVGD+LRVAGFKN  PQFNFVCRKNVALSI++DKTDEVELHNAV  AS  L PFDASL+E
Sbjct  412   RVGDVLRVAGFKNKAPQFNFVCRKNVALSIESDKTDEVELHNAVIRASIHLEPFDASLVE  471

Query  663   YTSHANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGP  484
             YTSHA+T+TIPGHYVLYWE+ +  +  +P ++FEDCC  +EESLNSVYR+ R SDKSIGP
Sbjct  472   YTSHADTTTIPGHYVLYWEL-RDGQTHVPPFVFEDCCLTIEESLNSVYRQSRASDKSIGP  530

Query  483   LEIRIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWA  304
             LEIR+VE+GTFDK+MDYA++ G+SI+QYK PRCV   PIVELLDSRV+  YFSPK P+W 
Sbjct  531   LEIRVVESGTFDKLMDYALSRGASINQYKAPRCVKFKPIVELLDSRVVGKYFSPKCPKWV  590

Query  303   PGHKHWNTN  277
             PGHK W+ N
Sbjct  591   PGHKKWSNN  599



>ref|XP_003541929.2| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Glycine 
max]
Length=630

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/585 (68%), Positives = 477/585 (82%), Gaps = 7/585 (1%)
 Frame = -1

Query  2019  RILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVTYEDV  1840
             R L++IE+VTTNA ++QE+VL  ILS +A  EYL RHGL G TDR TFK ++PVVTYED+
Sbjct  46    RALEYIEEVTTNADEIQEKVLAQILSRSANAEYLQRHGLEGRTDRNTFKNIMPVVTYEDL  105

Query  1839  KPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLMPVIN  1660
             KPDI+R+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEELER+S+  SLLMPV++
Sbjct  106   KPDIDRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELERRSMLYSLLMPVMD  165

Query  1659  QFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTSPRET  1480
             QFVPDL KGK MYFLF + EAKTPGGLLARPVLTS  K S+FK R + +PYT+ TSP ET
Sbjct  166   QFVPDLDKGKGMYFLFTKSEAKTPGGLLARPVLTSYYKSSHFKHRKH-DPYTNYTSPNET  224

Query  1479  ILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTGTLNP  1300
             ILC DS+QSMYSQ+LCGL+  ++VLRVG +FAS FIRA+ FLEKH+  LC+DIRTGTL+ 
Sbjct  225   ILCHDSYQSMYSQLLCGLYQNEEVLRVGAVFASGFIRALKFLEKHFVCLCNDIRTGTLDA  284

Query  1299  RITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAMSQYI  1120
             +ITDPSVREAV +++KPNP LA+F+E EC K SWKGII RIW NTKY+DV+VTG MSQYI
Sbjct  285   KITDPSVREAVMKVLKPNPTLADFVETECMKGSWKGIITRIWPNTKYVDVIVTGTMSQYI  344

Query  1119  PTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSREIG--  946
             P L+Y+ N LPLV T Y SSEC F +NLNP   P+EVAYT+IPTMAYFEFLP+    G  
Sbjct  345   PILDYYSNGLPLVCTMYASSECYFGLNLNPSCDPSEVAYTLIPTMAYFEFLPLDEINGHT  404

Query  945   --VPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
               + +     ++DL DVKLGQEYE+VVTTYAGLYRYRVGDILRVAGFKN  PQFNFVCRK
Sbjct  405   NSISQLEQEHLVDLADVKLGQEYELVVTTYAGLYRYRVGDILRVAGFKNKAPQFNFVCRK  464

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQSS  592
             NV LSID+DKTDEVELHNAVK+ +  L  F+ASL EYTS  +TSTIPGHYVLYWEI+ + 
Sbjct  465   NVVLSIDSDKTDEVELHNAVKSGAEQLAEFNASLTEYTSCVDTSTIPGHYVLYWEISTND  524

Query  591   ENP-IPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
               P IP  +F  CC ++EESLNSVYR+ RVS+ SIGPLEI++VENGTFDK+MD+A++ G+
Sbjct  525   HTPTIPSSVFGHCCLSIEESLNSVYRQGRVSE-SIGPLEIKVVENGTFDKLMDFALSQGA  583

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNT  280
             SI+QYK PRCVT API++LL+S+V+S+Y SPK P W PGHK W T
Sbjct  584   SINQYKTPRCVTYAPILDLLNSKVLSSYISPKCPNWVPGHKDWCT  628



>ref|XP_004149186.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Cucumis 
sativus]
 ref|XP_004171300.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Cucumis 
sativus]
 gb|KGN58009.1| hypothetical protein Csa_3G431430 [Cucumis sativus]
Length=602

 Score =   826 bits (2134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/594 (67%), Positives = 478/594 (80%), Gaps = 8/594 (1%)
 Frame = -1

Query  2058  SSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRET  1879
             S+++   L E N + LQFIEDVT NA QVQ RVL  ILS NAGVEYL RHGL G+TD +T
Sbjct  13    STTEYYKLLEKNKKTLQFIEDVTANADQVQRRVLTEILSRNAGVEYLRRHGLGGATDCKT  72

Query  1878  FKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELER  1699
             FK  +P+++YED++PDINR+ANG+ SSI+CS+PISEF TSSGTS GE KL+PT EEELER
Sbjct  73    FKNTLPLISYEDIQPDINRIANGDSSSILCSSPISEFLTSSGTSGGERKLMPTIEEELER  132

Query  1698  KSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTY  1519
             +S   SLLMPV++QF+  L KGK MYFLF++ E+KTP GLLARPVLTS  K  +FK R +
Sbjct  133   RSSLYSLLMPVMSQFIEGLEKGKGMYFLFIKSESKTPSGLLARPVLTSYYKSPHFKNRPF  192

Query  1518  TNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWR  1339
              +PYT+ TSP E ILC+DS+QSMY+Q+LCGL +   VLRVG +FAS FIRAI FLEKH+ 
Sbjct  193   -DPYTNYTSPNEAILCSDSYQSMYAQLLCGLLHRTDVLRVGAVFASGFIRAIRFLEKHYT  251

Query  1338  LLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKY  1159
             LLCHDIRTGTLN  ITD  +RE+V +I+K +  LA+F+E EC K+ W GII RIW NTKY
Sbjct  252   LLCHDIRTGTLNSEITDQGIRESVRKILKADGKLADFVEGECGKKCWGGIISRIWPNTKY  311

Query  1158  IDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAY  979
             +DV+VTG MSQYI TL+Y+ N LP+V T Y SSEC F +NL P+ KP EVAYT+IPTMAY
Sbjct  312   VDVIVTGTMSQYIGTLDYYSNGLPIVCTMYASSECYFGVNLKPMCKPGEVAYTLIPTMAY  371

Query  978   FEFLPVSREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNT  799
             FEFLPV+R     +    E++DLVDVKLG EYE+VVTTY+GLYRYRVGDILRVAGFKNN 
Sbjct  372   FEFLPVNR--SKEKELEKELVDLVDVKLGHEYELVVTTYSGLYRYRVGDILRVAGFKNNA  429

Query  798   PQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYV  619
             PQFNF+CRKNVALSID+DKTDEVEL NAVKNA   L+PFD +L EYTS  +TS IPGHYV
Sbjct  430   PQFNFICRKNVALSIDSDKTDEVELQNAVKNALTHLIPFDVTLSEYTSCVDTSNIPGHYV  489

Query  618   LYWEITQSSE---NPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
             LYWE+T ++E    PIP  +FEDCCFA+EESLN+VYR+ RVSDKSIGPLEI+IVE GTFD
Sbjct  490   LYWELTLNNEIKSTPIPPSVFEDCCFAIEESLNAVYRQGRVSDKSIGPLEIKIVETGTFD  549

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             K+MD+AI+ G+SI+QYK PRCV   PI++LL SRV+SNYFSPK P+W P  K W
Sbjct  550   KLMDFAISLGASINQYKTPRCVKYEPIIQLLSSRVVSNYFSPKCPKWVP--KQW  601



>ref|XP_010485124.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Camelina 
sativa]
Length=596

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/600 (67%), Positives = 472/600 (79%), Gaps = 28/600 (5%)
 Frame = -1

Query  2046  ERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKL  1867
             +++L E N   LQFIEDVTTNA  VQ RVL+ ILS NA VEYL RHGL G TDRETFK +
Sbjct  15    DQSLAEKNKNKLQFIEDVTTNADDVQRRVLEEILSRNADVEYLKRHGLGGRTDRETFKHV  74

Query  1866  IPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLY  1687
             +PVVTYED++P+INR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL+R+SL 
Sbjct  75    MPVVTYEDIQPEINRIANGDKSQILCSNPISEFLTSSGTSGGERKLMPTIEEELDRRSLL  134

Query  1686  SSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPY  1507
              SLLMPV+NQFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FKKR + +PY
Sbjct  135   YSLLMPVMNQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKKRPF-DPY  193

Query  1506  TDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCH  1327
             T+ TSP +TILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW  L  
Sbjct  194   TNYTSPNQTILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKHWPELAR  253

Query  1326  DIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVV  1147
             DIRTGTL+  ITD SVREAV  I+KP+P LA+F+E EC K SW+GII RIW NTKY+DV+
Sbjct  254   DIRTGTLSSVITDLSVREAVGEILKPDPKLADFVESECRKTSWQGIITRIWPNTKYVDVI  313

Query  1146  VTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL  967
             VTG MSQYIPTL+Y+                   +NL PL KP+EV+YT+IP MAYFEFL
Sbjct  314   VTGTMSQYIPTLDYY-----------------IGVNLRPLCKPSEVSYTLIPNMAYFEFL  356

Query  966   PVSREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVA  817
             PV R  GV           E    E++DLVDVKLGQEYE+VVTTYAGLYRYRVGD++ V 
Sbjct  357   PVHRNSGVTSSISLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLYRYRVGDVISVT  416

Query  816   GFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTST  637
             GFKNN PQF+F+CRKNV LSIDADKTDEVEL NAVKNA   L+PF+ASL EYTS+A+TS+
Sbjct  417   GFKNNAPQFSFICRKNVVLSIDADKTDEVELQNAVKNAVTHLVPFEASLSEYTSYADTSS  476

Query  636   IPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENG  457
             IPGHYVL+WE+  +   PIP  +FEDCC  +EESLNSVYR+ RVSDKSIGPLEI+IVE+G
Sbjct  477   IPGHYVLFWELCLNGNTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKIVESG  536

Query  456   TFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             TFDK+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+ NYFSPK P+W PGHK W +N
Sbjct  537   TFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDNYFSPKCPKWVPGHKQWGSN  596



>ref|XP_008454612.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Cucumis 
melo]
Length=602

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/594 (67%), Positives = 478/594 (80%), Gaps = 8/594 (1%)
 Frame = -1

Query  2058  SSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRET  1879
             S+++   L E N + LQFIEDVTTNA QVQ RVL  ILS NAGVEYL RHGL G+TD +T
Sbjct  13    STTEYYKLLEKNKKTLQFIEDVTTNADQVQRRVLTEILSRNAGVEYLRRHGLGGATDCKT  72

Query  1878  FKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELER  1699
             FK  +P+++YED++PDINR+ANG+ S I+CS+PISEF TSSGTS GE KL+PT EEELER
Sbjct  73    FKNTLPLISYEDIQPDINRIANGDTSPILCSSPISEFLTSSGTSGGERKLMPTIEEELER  132

Query  1698  KSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTY  1519
             +S   SLLMPV++QF+  L KGK MYFLF++ E+KTP GLLARPVLTS  K  +FK R +
Sbjct  133   RSSLYSLLMPVMSQFIEGLEKGKGMYFLFIKSESKTPSGLLARPVLTSYYKSPHFKNRPF  192

Query  1518  TNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWR  1339
              +PYT+ TSP E ILC+DS+QSMY+Q+LCGL +   VLRVG +FAS FIRAI FLEKH+ 
Sbjct  193   -DPYTNYTSPNEAILCSDSYQSMYAQLLCGLLHRTDVLRVGAVFASGFIRAIRFLEKHYT  251

Query  1338  LLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKY  1159
             LLCHDIRTGTLN  ITD  +RE+V +I+K +  LA+F+E EC K+ W GII RIW NTKY
Sbjct  252   LLCHDIRTGTLNSEITDQGIRESVRKILKADGKLADFVEGECGKKCWGGIISRIWPNTKY  311

Query  1158  IDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAY  979
             +DV+VTG MSQYI TL+Y+ N LP+V T Y SSEC F +NL P+ KP EVAYT+IPTMAY
Sbjct  312   VDVIVTGTMSQYIGTLDYYSNGLPIVCTMYASSECYFGVNLKPMCKPGEVAYTLIPTMAY  371

Query  978   FEFLPVSREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNT  799
             FEFLPV+R     +    E++DLVDVKLG EYE+VVTTY+GLYRYRVGDILRVAGFKNN 
Sbjct  372   FEFLPVNR--SKEKELEKELVDLVDVKLGHEYELVVTTYSGLYRYRVGDILRVAGFKNNA  429

Query  798   PQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYV  619
             PQFNF+CRKNVALSID+DKTDEVEL NAVKNA   L+PFD +L EYTS  +TS IPGHYV
Sbjct  430   PQFNFICRKNVALSIDSDKTDEVELQNAVKNALTHLIPFDVTLSEYTSCVDTSKIPGHYV  489

Query  618   LYWEITQSSE---NPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
             LYWE+T ++E    PIP  +FEDCCFA+EESLN+VYR+ RVSDKSIGPLEI+IVE GTFD
Sbjct  490   LYWELTPNNEIKSTPIPPSVFEDCCFAIEESLNAVYRQGRVSDKSIGPLEIKIVETGTFD  549

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             K+MDYAI+ G+SI+QYK PRCV   PI++LL+SR +SNYFSPK P+W P  K W
Sbjct  550   KLMDYAISLGASINQYKTPRCVKYEPIIQLLNSRTVSNYFSPKCPKWVP--KQW  601



>gb|KHN06043.1| Indole-3-acetic acid-amido synthetase GH3.6 [Glycine soja]
Length=589

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/596 (67%), Positives = 469/596 (79%), Gaps = 32/596 (5%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             NL E N + L+FIEDVT NA QVQ+RVL  ILS NA VEYL RH L+G TDRETFKKL+P
Sbjct  9     NLLEQNKKTLEFIEDVTANADQVQKRVLSEILSNNANVEYLKRHDLHGQTDRETFKKLLP  68

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             V+TYED++PDINR+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEEL R+SL  S
Sbjct  69    VITYEDIQPDINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELGRRSLLYS  128

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV++QFVP L KGK MY +F++ EAKTPGG++ARPVLTS  K SYFK R Y +PYT+
Sbjct  129   LLMPVMSQFVPGLEKGKGMYLMFIKSEAKTPGGIVARPVLTSYYKSSYFKDRPY-DPYTN  187

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ET+LC DS+QSMYSQ+LCGL    +VLRVG +FAS FIRAI FLEKHW LLCHDI
Sbjct  188   YTSPNETVLCPDSYQSMYSQLLCGLCQHKEVLRVGAVFASGFIRAIRFLEKHWPLLCHDI  247

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             RTGT+N  ITD SVR+AV +I+                    GII R+W NTKY+DV+VT
Sbjct  248   RTGTINNTITDLSVRDAVMKIL--------------------GIITRLWPNTKYVDVIVT  287

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+EV+YT+IPTM YFEFLPV
Sbjct  288   GTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMCYFEFLPV  347

Query  960   SREIGVPEPN-----------PVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAG  814
             +R  GV   N             E+++LVDVKLGQEYE+VVTTYAGLYRYRVGD+LRVAG
Sbjct  348   NRSNGVSHDNLHTPRSLNEKEQKELVELVDVKLGQEYELVVTTYAGLYRYRVGDVLRVAG  407

Query  813   FKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTI  634
             FKN  PQFNFVCRKNV LSID+DKTDEVEL NA+KNA   L+PFDAS+ EYTS+A+T+TI
Sbjct  408   FKNKAPQFNFVCRKNVVLSIDSDKTDEVELQNAMKNAVTHLVPFDASVSEYTSYADTTTI  467

Query  633   PGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGT  454
             PGHYVLYWE++     PIP  +FEDCC  +EESLNSVYR+ RVSDKSIGPLEI+IVE GT
Sbjct  468   PGHYVLYWELSLKGSTPIPPCVFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKIVEQGT  527

Query  453   FDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             FDK+MDYAI+ G+SI+QYK PRCV  AP++ELL+SRV+  YFSPK P+W PGHK W
Sbjct  528   FDKLMDYAISLGASINQYKTPRCVKFAPVLELLNSRVVEKYFSPKCPKWVPGHKQW  583



>ref|XP_009631635.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Nicotiana 
tomentosiformis]
Length=616

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/598 (66%), Positives = 474/598 (79%), Gaps = 11/598 (2%)
 Frame = -1

Query  2046  ERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKL  1867
             E ++ E N + LQFIE+VTTN G VQ RVL  ILS NA VEYL RH LNG TDRETFKK+
Sbjct  17    ECSIAEDNKKNLQFIEEVTTNVGDVQRRVLAEILSRNANVEYLQRHNLNGHTDRETFKKV  76

Query  1866  IPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLY  1687
             IP +TYED++ DINR+A+G+ S I CS PISEF TSSGTS GE KL+PT +EEL R+   
Sbjct  77    IPAITYEDIQQDINRIAHGDKSPIFCSQPISEFLTSSGTSGGERKLMPTIQEELGRRLQL  136

Query  1686  SSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPY  1507
               L+M VI+QFVPDL KGK MYFL ++ EAKTPGGL ARPVLTS+ K  YF  R  + PY
Sbjct  137   HGLMMSVISQFVPDLEKGKGMYFLSIKSEAKTPGGLPARPVLTSIYKSPYFSNRRLS-PY  195

Query  1506  TDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCH  1327
              + TSP ETILC DS+Q+MYSQMLCGL    +VLR+G+ FAS FIRAI FLEKHW LLC+
Sbjct  196   ANYTSPAETILCPDSYQNMYSQMLCGLCQNKEVLRLGSYFASGFIRAIRFLEKHWSLLCN  255

Query  1326  DIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVV  1147
             DIR GT+N +ITD SVREAV +I+KP+P+LA+FIE EC+K+SWKGII R+W NTKY+DV+
Sbjct  256   DIRMGTINTQITDLSVREAVMKILKPDPELADFIEAECSKDSWKGIITRLWPNTKYVDVI  315

Query  1146  VTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL  967
             VTG+MSQYIPTL+Y+ N LPLVST Y SSEC F INLNP  KP+EV+YT+IPTM YFEF 
Sbjct  316   VTGSMSQYIPTLDYYSNGLPLVSTMYASSECPFGINLNPFCKPSEVSYTLIPTMGYFEFS  375

Query  966   PVSREIGVP-------EPNPVE---VLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVA  817
             P+ R   VP        PN  E   ++DLVDVK+GQEYE+VV+TY+GLYRYRVGD+LRVA
Sbjct  376   PIHRTNEVPNSISMSESPNEKEQQQLVDLVDVKIGQEYELVVSTYSGLYRYRVGDVLRVA  435

Query  816   GFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTST  637
             G+KNNTPQF FVCR+NV LSID+DKTDEVEL NAV+NA   L+PFDA + EYTS+A+T+T
Sbjct  436   GYKNNTPQFTFVCRENVILSIDSDKTDEVELQNAVENAVRDLMPFDAHVTEYTSYADTAT  495

Query  636   IPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENG  457
             IPGHYVL+WE++ +    IP  +FEDCC  +EESL+SVYR+ R SDKSIGPLEIRIVE G
Sbjct  496   IPGHYVLFWELSINVSTSIPPSVFEDCCLTIEESLDSVYRQGRASDKSIGPLEIRIVEIG  555

Query  456   TFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
             TFDK+MDY ++ G+SI QYK PRCV  AP VELL+SRVMS++FS   P W PGH+ WN
Sbjct  556   TFDKLMDYCVSLGASIDQYKTPRCVKFAPHVELLNSRVMSSHFSQTCPNWVPGHRQWN  613



>ref|XP_004487633.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Cicer 
arietinum]
Length=614

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/597 (65%), Positives = 471/597 (79%), Gaps = 13/597 (2%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             +L + N +IL FIEDV+  A ++Q++VL  ILS NA VEYL RHGLNG TD ETFKKLIP
Sbjct  12    DLSQQNKKILDFIEDVSAKADEIQKKVLAEILSRNANVEYLQRHGLNGQTDSETFKKLIP  71

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             ++TYED++ DINR+ANG+ SSI+ S PIS F TSSGTS GE KL+P TEEE ER+ +  S
Sbjct  72    IITYEDIQHDINRIANGDTSSILTSNPISNFLTSSGTSGGERKLMPATEEEFERRYMLYS  131

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMP+++QFVPDL KGK MY +F++ E+KTP G++A PVLT+  K S+F  R Y +PYT+
Sbjct  132   LLMPIMSQFVPDLEKGKGMYLMFIKNESKTPSGIMASPVLTNYYKSSHFCNRLY-DPYTN  190

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ET+LC DS+QSMYSQ+LCGL    +V RVG +FAS  IRAI FLEKHW LLC+DI
Sbjct  191   FTSPNETVLCLDSYQSMYSQLLCGLCQNYEVFRVGAVFASGLIRAIRFLEKHWSLLCNDI  250

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             R GT+N  +T+ SVREAV +I+KPN +LA+FI+ EC+K  W+GII R+W NTKY+DV+VT
Sbjct  251   RMGTINALVTESSVREAVMKILKPNKNLADFIQGECSKNCWQGIITRLWPNTKYVDVIVT  310

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPL KP+ VAYT+IPTM Y+EFLPV
Sbjct  311   GTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSHVAYTLIPTMCYYEFLPV  370

Query  960   SRE------IGVP------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVA  817
             +R       I  P      E +  E++DLVDVKLGQEYE+VVTTYAGLYRY+VGD+L+V 
Sbjct  371   NRSNEVTGSISTPTTKFLNEKDHQELVDLVDVKLGQEYELVVTTYAGLYRYKVGDVLKVT  430

Query  816   GFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTST  637
             GFKN  PQF+FVCRKNV LSID+DKTDEVEL NA+KNA   L+PFDA + EYTS A+T+T
Sbjct  431   GFKNKAPQFSFVCRKNVVLSIDSDKTDEVELQNAMKNAITHLVPFDADVAEYTSFADTTT  490

Query  636   IPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENG  457
             IPGHYVLYWE+       IP  ++EDCC  +EESLNSVYR+ RVSDKSIGPLEI+IVE G
Sbjct  491   IPGHYVLYWELNLKGSTIIPHCVYEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKIVEQG  550

Query  456   TFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             TFDK+MDYAI  G+SI+QYK PRCV  AP+VELL+SRV SNYFSPK P+W PGHK W
Sbjct  551   TFDKLMDYAIGLGASINQYKTPRCVKFAPVVELLNSRVTSNYFSPKCPKWIPGHKEW  607



>ref|XP_009790943.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Nicotiana 
sylvestris]
Length=610

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/601 (65%), Positives = 479/601 (80%), Gaps = 18/601 (3%)
 Frame = -1

Query  2052  SDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFK  1873
             S + ++ E N  +LQFIE+VTTN  +VQ+RVL  ILS NA VEYL RH LNG TDRETFK
Sbjct  14    STDCSIAEDNKAVLQFIEEVTTNVDEVQKRVLAEILSRNANVEYLQRHNLNGHTDRETFK  73

Query  1872  KLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKS  1693
             K+IPV+TYED++PDINR+ANG+ S I+CS PISEFFTSSGTS GE KL+P  EE+  R+S
Sbjct  74    KVIPVITYEDIQPDINRIANGDKSPILCSQPISEFFTSSGTSGGERKLMPIIEEDFGRRS  133

Query  1692  LYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTN  1513
                +L++ V++Q  PDL KGK MYF+FV+ EAKTPGGLLARP LTS+ KR +F    +T 
Sbjct  134   QLYNLMISVVSQSFPDLEKGKGMYFMFVKSEAKTPGGLLARPALTSIFKRPHFLNLNHT-  192

Query  1512  PYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLL  1333
                   SP ETILC DS+QSMYSQMLCGL    +VL VG +FASAFIRA+ FLEKHW LL
Sbjct  193   ------SPIETILCLDSYQSMYSQMLCGLCQNKEVLHVGAVFASAFIRAMRFLEKHWSLL  246

Query  1332  CHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYID  1153
             C+DIRTGT+N +ITDP+VREAV +I+KP+P+LA+FIE EC+K SW+GI+ R+W NTKY+D
Sbjct  247   CNDIRTGTINAQITDPAVREAVMKILKPDPELADFIEAECSKSSWQGIVTRLWPNTKYVD  306

Query  1152  VVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFE  973
             VVVTG MSQYI TL Y+ + LPLVST+Y SSEC F INLNPL KP+EV+YT+IPTM YFE
Sbjct  307   VVVTGTMSQYISTLEYYSSSLPLVSTTYASSECSFGINLNPLCKPSEVSYTLIPTMGYFE  366

Query  972   FLPVSR-------EIGVPEPN----PVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDIL  826
             FLP+ R        I + E        +++DLVDVK+GQEYE+VVTTY+GLYRYRVGD+L
Sbjct  367   FLPIHRINNEVKDSISMSESQNEKEQQQLVDLVDVKIGQEYELVVTTYSGLYRYRVGDVL  426

Query  825   RVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHAN  646
             RVAG+KNN PQF F+CR+NV LSID+DKTDEVEL NAVKNA+++L+PFDA + +YTS+A+
Sbjct  427   RVAGYKNNAPQFTFICRENVILSIDSDKTDEVELQNAVKNAASVLIPFDAHVTDYTSYAD  486

Query  645   TSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIV  466
             TSTIPGHYV++ E+  +S  PI   +FE+CC ++EESLNSVYR+ R SDKSIGPLEIRIV
Sbjct  487   TSTIPGHYVVFLELRVNSSTPISPSVFENCCLSIEESLNSVYRQGRASDKSIGPLEIRIV  546

Query  465   ENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             E GTFDK+MDY I+ G+SI+QYK PRCV   P++ELL+SRV+S++FS   P W PGHK W
Sbjct  547   EIGTFDKLMDYCISLGASINQYKTPRCVKLTPLIELLNSRVVSSHFSQTCPNWIPGHKQW  606

Query  285   N  283
             N
Sbjct  607   N  607



>ref|XP_003596546.1| Indole-3-acetic acid-amido synthetase GH3.6 [Medicago truncatula]
 gb|ABN09059.1| GH3 auxin-responsive promoter [Medicago truncatula]
 gb|AES66797.1| indole-3-acetic acid-amido synthetase [Medicago truncatula]
Length=607

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/604 (64%), Positives = 475/604 (79%), Gaps = 14/604 (2%)
 Frame = -1

Query  2055  SSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETF  1876
             +S + +L + N + L FIED+TT+A ++Q++VL  IL+ NA VEYL RHGLNG TD ETF
Sbjct  3     TSLDYDLSQKNKKTLDFIEDITTHADEIQKKVLAEILNRNANVEYLQRHGLNGHTDSETF  62

Query  1875  KKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERK  1696
             KKL+P++TYED++ DIN +ANG+ S I+ S PIS F TSSGTS GE KL+P TEEE  R+
Sbjct  63    KKLLPIITYEDIQNDINLIANGDTSPILTSNPISNFLTSSGTSGGERKLMPATEEEFGRR  122

Query  1695  SLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYT  1516
              L  S LMP+++QF+PDL KGK MY +F++ E+KTPGG+ A PVLT+  K S+F  R Y 
Sbjct  123   YLLYSYLMPIMSQFIPDLEKGKGMYLMFIKNESKTPGGIKASPVLTNYYKSSHFLNRPY-  181

Query  1515  NPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRL  1336
             +PYT+ TSP ET+LC DS+QSMYSQ+LCGL   ++VLRVG +FAS  IRAI FLEK+WRL
Sbjct  182   DPYTNFTSPNETVLCLDSYQSMYSQLLCGLIQNNEVLRVGAVFASGLIRAIRFLEKNWRL  241

Query  1335  LCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYI  1156
             LC+DIRTGTL+  ITD SVREAV +I+KPN +LA+F+E ECNK SW+GII R+W NTKY+
Sbjct  242   LCNDIRTGTLDLLITDDSVREAVMKILKPNKNLADFVEGECNKGSWQGIITRLWPNTKYV  301

Query  1155  DVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYF  976
             DV+VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NLNPLSKP  V+YT+IPTM Y+
Sbjct  302   DVIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLSKPCHVSYTLIPTMCYY  361

Query  975   EFLPVSRE-------------IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVG  835
             EFLPV+R                + E    EV+DLVDVKLGQEYE+VVTTYAGLYRY+VG
Sbjct  362   EFLPVNRSNCEVNGSIPPSTTKSLGEKKYQEVVDLVDVKLGQEYELVVTTYAGLYRYKVG  421

Query  834   DILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTS  655
             D+L+V GFKN  PQF+FVCRKNV LSI++DKTDEVEL NA+KNA   L PF+A + EYTS
Sbjct  422   DVLKVTGFKNKAPQFSFVCRKNVVLSIESDKTDEVELQNAMKNAVTHLAPFEADVAEYTS  481

Query  654   HANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEI  475
             +A+T+TIPGHYVLYWE+       IP  ++EDCC  +EESLNSVYR+ RVSDKSIGPLEI
Sbjct  482   YADTTTIPGHYVLYWELNLKGSTKIPHSVYEDCCLTIEESLNSVYRQGRVSDKSIGPLEI  541

Query  474   RIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGH  295
             +IVE GTFDK+MDYAI  G+SI+QYK PRCV  AP+VELL+SRVM+ YFSPK P+W PGH
Sbjct  542   KIVEQGTFDKLMDYAINLGASINQYKTPRCVKFAPMVELLESRVMAKYFSPKCPKWVPGH  601

Query  294   KHWN  283
             K WN
Sbjct  602   KKWN  605



>gb|KHN25755.1| Indole-3-acetic acid-amido synthetase GH3.6 [Glycine soja]
Length=615

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/590 (67%), Positives = 473/590 (80%), Gaps = 7/590 (1%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             N   +N   L++IE+VT+NA  +QE+VL  ILS +A  EYL RHGL+G TDR TFKK++P
Sbjct  24    NTSNNNKSALEYIEEVTSNADVIQEKVLAQILSRSAHAEYLQRHGLDGRTDRNTFKKIMP  83

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             VVTYED+KP I+R+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEELER+S+  S
Sbjct  84    VVTYEDLKPYIDRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELERRSMLYS  143

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV++QFVP L KGK MYFLF + EAKTPGGLLARPVLTS  K S+FK R + +PYT+
Sbjct  144   LLMPVMDQFVPALDKGKGMYFLFTKSEAKTPGGLLARPVLTSYYKSSHFKHRKH-DPYTN  202

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ETILC DS+QSMYSQ+LCGL   ++VLRVG +FAS FIRA+ FLEKH+  LC+DI
Sbjct  203   YTSPNETILCPDSYQSMYSQLLCGLCQNEEVLRVGAVFASGFIRALKFLEKHFVSLCNDI  262

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             R GTL+ +I DP VREAV +++KPNP LA+F+E EC K SWKGI+ RIW NTKY+DV+VT
Sbjct  263   RKGTLDAKINDPLVREAVMKVLKPNPTLADFVEAECMKGSWKGIVTRIWPNTKYVDVIVT  322

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIP L+Y+ N LPLV T Y SSEC F +NLNPL  P+EVAYT+IPTMAYFEFLP+
Sbjct  323   GTMSQYIPILDYYSNGLPLVCTMYASSECYFGLNLNPLCDPSEVAYTLIPTMAYFEFLPL  382

Query  960   SREIG----VPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQ  793
                 G    V      ++LDL DVKLGQEYE+VVTTYAGLYRY+VGDILRVAGFKN  PQ
Sbjct  383   DEINGHTNSVSHLVQEQLLDLADVKLGQEYELVVTTYAGLYRYQVGDILRVAGFKNKAPQ  442

Query  792   FNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLY  613
             FNFVCRKNV LSID+DKTDEVEL NAVK+ ++ L  F ASL EYTS  +TSTIPGHYVLY
Sbjct  443   FNFVCRKNVVLSIDSDKTDEVELQNAVKSGADHLAQFGASLTEYTSCVDTSTIPGHYVLY  502

Query  612   WEITQSSENP-IPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMD  436
             WEI+ +   P IP  +F  CC A+EESLNSVYR+ RVS+ SIGPLEI+IVENGTFDK+MD
Sbjct  503   WEISTNGHTPTIPSSVFGHCCLAIEESLNSVYRQGRVSE-SIGPLEIKIVENGTFDKLMD  561

Query  435   YAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             +A++ G+SI+QYK PRCVT API++LL+S V+S+YFSPK P W PGHK W
Sbjct  562   FALSQGASINQYKTPRCVTYAPILDLLNSNVVSSYFSPKCPNWVPGHKDW  611



>ref|XP_009790940.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Nicotiana 
sylvestris]
Length=616

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/596 (66%), Positives = 471/596 (79%), Gaps = 11/596 (2%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             ++ E N + LQFIE+VTTN  +VQ+RVL  ILS NA VEYL RH  NG TDRETFKK+IP
Sbjct  19    SIAEDNKKALQFIEEVTTNVDEVQKRVLAEILSRNANVEYLQRHNFNGQTDRETFKKVIP  78

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             V+TYED++PDINR+ANG+ S I  S PISEF TSSGTS GE KL+PT +EEL R+     
Sbjct  79    VITYEDIQPDINRIANGDKSPIFSSQPISEFLTSSGTSGGERKLMPTIQEELGRRLQLHG  138

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             L+M VI+Q VPDL KGK MYFL ++ EAKTPGGL ARPVLTS+ K  YF  R  + PY +
Sbjct  139   LMMSVISQSVPDLEKGKGMYFLSIKSEAKTPGGLPARPVLTSIYKSPYFSNRRLS-PYAN  197

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ETILC D++QSMYSQMLCGL    +VLR+G+ FAS FIRAI FLEKHW LLC+DI
Sbjct  198   YTSPAETILCPDTYQSMYSQMLCGLCQNKEVLRLGSYFASGFIRAIRFLEKHWSLLCNDI  257

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             R GT+NP+ITD SVREAV +I+K +P+LA+FIE EC+K+SWKGII R+W NTKY+DV+VT
Sbjct  258   RMGTINPQITDLSVREAVMKILKTDPELADFIEAECSKDSWKGIITRLWPNTKYVDVIVT  317

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G+MSQYIPTL+Y+ N LPLVST Y SSEC F INLNP  K +EV+YT+IPTM YFEF  +
Sbjct  318   GSMSQYIPTLDYYSNGLPLVSTMYASSECPFGINLNPFCKSSEVSYTLIPTMGYFEFSQI  377

Query  960   SREIGVP-------EPNPVE---VLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGF  811
              R   VP        PN  E   ++DLVDVK+GQEYE+VVTTY+GLYRYRVGD+LRVAG+
Sbjct  378   HRSNDVPNSISMSESPNEKEQQQLVDLVDVKIGQEYELVVTTYSGLYRYRVGDVLRVAGY  437

Query  810   KNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIP  631
             KNNTPQF FVCR+NV LSID+DKTDEVEL NAV+NA   L+PFDA + EYTS+A+T+ IP
Sbjct  438   KNNTPQFTFVCRENVILSIDSDKTDEVELQNAVENAVRNLMPFDAHVTEYTSYADTANIP  497

Query  630   GHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTF  451
             GHYVL+WE++ +   PIP  + EDCC  +EESL+SVYR+ R SDKSIGPLEIRIVE GTF
Sbjct  498   GHYVLFWELSINISTPIPPSVVEDCCLTIEESLDSVYRQGRASDKSIGPLEIRIVEIGTF  557

Query  450   DKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
             DK+MDY ++ G+SI QYK PRCV  AP+VELL+SRV+S++FS   P W PGH+ WN
Sbjct  558   DKLMDYCVSLGASIDQYKTPRCVRFAPLVELLNSRVVSSHFSQTCPNWVPGHRQWN  613



>ref|XP_006362917.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006362918.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006362919.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like isoform 
X3 [Solanum tuberosum]
Length=602

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/601 (65%), Positives = 483/601 (80%), Gaps = 16/601 (3%)
 Frame = -1

Query  2046  ERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKL  1867
             E ++ E N + L+FIE+VT+N  +VQ+RVL  IL+ NA VEYL R  LNG TDRETFKK+
Sbjct  2     EGSMTEENKKNLEFIEEVTSNVDEVQKRVLHEILTRNANVEYLQRLNLNGHTDRETFKKV  61

Query  1866  IPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLY  1687
             +P++TYED++ DINR+ANG+ S I+CS PISEFFTSSGTS GE KLIPTTEEE  R+   
Sbjct  62    VPIITYEDIQSDINRIANGDRSPILCSQPISEFFTSSGTSGGERKLIPTTEEENRRRHQL  121

Query  1686  SSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKK-RTYTNP  1510
               L+M V++QF PDL  GK MYF+F++ EAKTPGGLLARP+LTS+ K S FK   +  +P
Sbjct  122   YGLMMSVVSQFFPDLGNGKGMYFMFIKSEAKTPGGLLARPILTSVYKSSLFKNSNSRVSP  181

Query  1509  YTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLC  1330
             YT   SP E ILC DS+QSMYSQMLCGL+   +V+RVG++FA AFIRA+ FLE HW LLC
Sbjct  182   YT---SPIEAILCLDSYQSMYSQMLCGLFQNREVVRVGSIFAYAFIRAMRFLEDHWSLLC  238

Query  1329  HDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDV  1150
             +DIRTGT+N +ITDPSVREAV +I+KP+ +LA+FIE EC+K+SW+GI+ R+W NT Y+DV
Sbjct  239   NDIRTGTINNKITDPSVREAVMKILKPDSELADFIEAECSKDSWEGIVTRLWPNTTYVDV  298

Query  1149  VVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEF  970
             VVTGAMSQYIP L+Y+ N LPLVST+Y SSEC F INLNPL KP+EV+YT+IP +AYFEF
Sbjct  299   VVTGAMSQYIPMLDYYCNSLPLVSTAYASSECFFGINLNPLCKPSEVSYTLIPIVAYFEF  358

Query  969   LPVSR------EIGVPEP----NPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRV  820
             LP+ R       I +P P    +  +++DLVDVK+GQEYE+VVTTY+GLYRYRVGD+LRV
Sbjct  359   LPIHRSNEVIDSISIPTPFNEKDEQQLVDLVDVKIGQEYELVVTTYSGLYRYRVGDVLRV  418

Query  819   AGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTS  640
             AG+KNN PQFNF+ R+NV LSID+DKT+E+EL NAVKNA N L+PFDAS+I+YTS+ +T+
Sbjct  419   AGYKNNAPQFNFIRRENVILSIDSDKTNEIELQNAVKNAENNLMPFDASVIDYTSYVDTA  478

Query  639   TIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVEN  460
             TIPGHYVL+WE+  ++ +PIP  + E+CC  +EESLNSVYR+ R SDKSIGPLEIRIVE 
Sbjct  479   TIPGHYVLFWELNVNASSPIPPSVLEECCLTIEESLNSVYRQGRTSDKSIGPLEIRIVET  538

Query  459   GTFDKMMDYAIAS--GSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             GTFDK+MDY   S  G+SI+QYK PRCV  AP VELL+SRV+S+YFSP  P+W PG K W
Sbjct  539   GTFDKLMDYCCTSLLGASINQYKTPRCVKFAPHVELLNSRVVSSYFSPVCPKWVPGSKQW  598

Query  285   N  283
             N
Sbjct  599   N  599



>ref|XP_009586735.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Nicotiana 
tomentosiformis]
Length=607

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/598 (65%), Positives = 472/598 (79%), Gaps = 15/598 (3%)
 Frame = -1

Query  2052  SDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFK  1873
             S + ++ E N   LQFIE+VTTN  +VQ+RV+  ILS NA VEYL RH LNG TDRETFK
Sbjct  14    STDCSIAEDNKSALQFIEEVTTNVDEVQKRVVAEILSRNANVEYLQRHNLNGHTDRETFK  73

Query  1872  KLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKS  1693
             K+IPV+TYED++PDINR+A+G+ S I+CS PISEF TSSGTS GE KL+P  EE+  R+S
Sbjct  74    KVIPVITYEDIQPDINRIADGDKSPILCSQPISEFLTSSGTSGGERKLMPIIEEDFGRRS  133

Query  1692  LYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTN  1513
                SL++ V++Q V DL KGK MYF+FV+ E KTPGGLLARPVLTS+ KR +F    YT 
Sbjct  134   QLYSLMISVVSQSVGDLEKGKGMYFMFVKSETKTPGGLLARPVLTSIFKRPHFHNSNYT-  192

Query  1512  PYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLL  1333
                   SP ETILC DS+QSMYSQMLCGL    QVLRVG +FASAFIRA+ FLEKHW LL
Sbjct  193   ------SPIETILCLDSYQSMYSQMLCGLCQNKQVLRVGAVFASAFIRAMRFLEKHWSLL  246

Query  1332  CHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYID  1153
             C+DIRTGT+N +IT  SVRE+V +I+KPNP+LA+FI+ EC K SW+GI+ R+W NTKY+D
Sbjct  247   CNDIRTGTINAQITHLSVRESVMKILKPNPELADFIDAECRKSSWQGIVTRLWPNTKYVD  306

Query  1152  VVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFE  973
             VVVTG MSQYIPTL Y+ ++LPLVST+Y SSEC F INLNPL KP+EV+YT+IPTM YFE
Sbjct  307   VVVTGTMSQYIPTLEYYSSNLPLVSTTYASSECSFGINLNPLCKPSEVSYTLIPTMGYFE  366

Query  972   FLPVSR-------EIGVPE-PNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVA  817
             FLP+ R        I + E     +++DLVDVK+GQEYE+VVTTY+GLYRYRVGD+LRVA
Sbjct  367   FLPIHRINNEVKNSISMSELQEQQQLVDLVDVKIGQEYELVVTTYSGLYRYRVGDVLRVA  426

Query  816   GFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTST  637
             G+KNN PQF FVCR+NV LSID+DKTDE EL NAVKNA + L+PFDA + EYTS+A+ +T
Sbjct  427   GYKNNAPQFTFVCRENVILSIDSDKTDEAELQNAVKNAVSDLMPFDAHVTEYTSYADITT  486

Query  636   IPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENG  457
             IPGHYVL+ E+  +S  PIP  +FE+CC  +EESLNSVYR+ R SDKSIGPLEIRIVE G
Sbjct  487   IPGHYVLFLELRVNSSTPIPPSVFENCCLNIEESLNSVYRQGRASDKSIGPLEIRIVETG  546

Query  456   TFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
             TFDK+MDY I+ G+SI+QYK PRCV   P+VELL+SRV+S++FS   P W PG K WN
Sbjct  547   TFDKLMDYCISLGASINQYKTPRCVKLTPLVELLNSRVVSSHFSQTCPNWIPGDKQWN  604



>ref|XP_008452341.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Cucumis 
melo]
Length=604

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/598 (66%), Positives = 478/598 (80%), Gaps = 10/598 (2%)
 Frame = -1

Query  2058  SSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRET  1879
             S+ +   L + N  ILQFIEDVTTNA  VQ +VL  ILS N+  EYL    L G    +T
Sbjct  8     STPNYNQLVQKNKAILQFIEDVTTNAALVQRQVLSQILSQNSNSEYLT---LYGRPSPDT  64

Query  1878  FKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELER  1699
             FK  IP+V+Y+ ++P ++R+ANG+ S I+CS+PISEF TSSGTS GE KL+PT EEELER
Sbjct  65    FKTSIPLVSYDQIQPFVSRIANGDFSPILCSSPISEFLTSSGTSGGERKLMPTIEEELER  124

Query  1698  KSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTY  1519
             +SL  SLLMPV++QFVP L KGK MYFLF++ EAKTPGGLLARPVLTS  K S+FK+R Y
Sbjct  125   RSLLYSLLMPVMSQFVPGLEKGKGMYFLFIKAEAKTPGGLLARPVLTSYYKSSHFKERPY  184

Query  1518  TNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWR  1339
              +PYT+ TSP E ILC DS+QSMY+Q+LCGL +   VLRVG +FAS FIRAI FLEKHW+
Sbjct  185   -DPYTNYTSPNEAILCPDSYQSMYAQLLCGLCHRLDVLRVGAVFASGFIRAIRFLEKHWQ  243

Query  1338  LLCHDIRTGTLNPRITDPSVREAVARIV--KPNPDLAEFIEKECNKESWKGIIPRIWRNT  1165
             LLCHDIRTGTLN +ITD +VR+AV   V  +P+P+LA++I  EC K SW+GII R+W NT
Sbjct  244   LLCHDIRTGTLNSQITDQAVRDAVMLSVLRRPDPELADYIHGECCKGSWQGIITRLWPNT  303

Query  1164  KYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTM  985
             KY+DV+VTG MSQYI TL+Y+ N LPLV T Y SSEC F +NLNPL KP+EVAYT+IP+M
Sbjct  304   KYVDVIVTGTMSQYIATLDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVAYTLIPSM  363

Query  984   AYFEFLPVSREIGVPEP--NPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGF  811
             AYFEFLP+ R     +   +  +++DL DV+LG+EYE+VVTTYAGLYRYRVGDILRVAGF
Sbjct  364   AYFEFLPIERSHNNDDNSLDEQQLVDLTDVELGKEYELVVTTYAGLYRYRVGDILRVAGF  423

Query  810   KNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIP  631
             KN  PQFNF+CRKNV LSID+DKTDEVEL NAVKN+ N L+PF+A+L EYTS+ANTSTIP
Sbjct  424   KNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNSMNHLVPFEATLAEYTSYANTSTIP  483

Query  630   GHYVLYWEITQ--SSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENG  457
             GHYVLYWE+ Q   +  P+P  + EDCC  +EESLNSVYR+ RVSDKSIGPLEI++VENG
Sbjct  484   GHYVLYWEVNQKEGAATPVPPSVLEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKVVENG  543

Query  456   TFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
             TFDK+MDYAI+ G+SI+QYK PRCV   PIVELL+SRV+ +YFSPK P+W PGHK W+
Sbjct  544   TFDKLMDYAISMGASINQYKTPRCVKFQPIVELLNSRVVGSYFSPKCPKWVPGHKQWS  601



>ref|XP_004149936.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Cucumis 
sativus]
 ref|XP_004165416.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Cucumis 
sativus]
 gb|KGN56171.1| hypothetical protein Csa_3G088930 [Cucumis sativus]
Length=604

 Score =   806 bits (2083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/599 (66%), Positives = 478/599 (80%), Gaps = 12/599 (2%)
 Frame = -1

Query  2058  SSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRET  1879
             S+ +   L + N  ILQFIEDVTTNA  VQ +VL  ILS N+  EYL  +G   S   +T
Sbjct  8     STQNYNQLLQKNKAILQFIEDVTTNAALVQRQVLSQILSQNSNSEYLTLYGRPSS---DT  64

Query  1878  FKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELER  1699
             FK  IP+V+Y+ ++P ++R+ANG+ S I+CS+PISEF TSSGTS GE KL+PT EEEL+R
Sbjct  65    FKTSIPLVSYDQIQPFVSRIANGDFSPILCSSPISEFLTSSGTSGGERKLMPTIEEELDR  124

Query  1698  KSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTY  1519
             +SL  SLLMPV+ QFVP L KGK MYFLF++ EAKTPGGLLARPVLTS  K S+FK+R Y
Sbjct  125   RSLLYSLLMPVMTQFVPGLEKGKGMYFLFIKAEAKTPGGLLARPVLTSYYKSSHFKERPY  184

Query  1518  TNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWR  1339
              +PYT+ TSP E ILC DS+QSMY+Q+LCGL +   VLRVG +FAS FIRAI FLEKHW+
Sbjct  185   -DPYTNYTSPNEAILCPDSYQSMYAQLLCGLCHRLDVLRVGAVFASGFIRAIRFLEKHWQ  243

Query  1338  LLCHDIRTGTLNPRITDPSVREAVARIV--KPNPDLAEFIEKECNKESWKGIIPRIWRNT  1165
             LLCHDIRTGTLN +ITD +VR+AV   V   P+P+LA+++  EC K  W+GII R+W NT
Sbjct  244   LLCHDIRTGTLNSQITDQAVRDAVMSSVLRGPDPELADYVHGECCKGWWQGIITRLWPNT  303

Query  1164  KYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTM  985
             KY+DV+VTG MSQYI TL+Y+ N LPLV T Y SSEC F +NLNPL KP+EVAYT+IP+M
Sbjct  304   KYVDVIVTGTMSQYITTLDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVAYTLIPSM  363

Query  984   AYFEFLPVSREIGVPEPNPV---EVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAG  814
             AYFEFLPV R   + + N +   +++DL DV+LG+EYE+VVTTYAGLYRYRVGDILRVAG
Sbjct  364   AYFEFLPVERS-HINDDNSLNEQQLVDLTDVELGKEYELVVTTYAGLYRYRVGDILRVAG  422

Query  813   FKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTI  634
             FKN  PQFNF+CRKNV LSID+DKTDEVEL NAVKN+ N L+PF+A+L EYTS+ANTSTI
Sbjct  423   FKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNSVNNLMPFEATLAEYTSYANTSTI  482

Query  633   PGHYVLYWEITQ--SSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVEN  460
             PGHYVLYWE+ Q   +  P+P  + EDCC  +EESLNSVYR+ RVSDKSIGPLEI++VEN
Sbjct  483   PGHYVLYWELNQKEGAATPVPPSVLEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKVVEN  542

Query  459   GTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
             GTFDK+MDYAI+ G+SI+QYK PRCV   PIVELL+SRV+ +YFSPK P+W PGHK W+
Sbjct  543   GTFDKLMDYAISMGASINQYKTPRCVKFQPIVELLNSRVVGSYFSPKCPKWVPGHKQWS  601



>ref|XP_007149929.1| hypothetical protein PHAVU_005G111000g [Phaseolus vulgaris]
 gb|ESW21923.1| hypothetical protein PHAVU_005G111000g [Phaseolus vulgaris]
Length=635

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/589 (67%), Positives = 473/589 (80%), Gaps = 7/589 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             + N R L++IE+VT NA ++QE+VL  ILS +A  EYL RHGL+G TDR TFKKL+PVV 
Sbjct  47    QENKRALEYIEEVTRNADEIQEKVLAEILSCSAQAEYLQRHGLDGRTDRITFKKLVPVVN  106

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED+KPDI+R+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEE ER++L  SLLM
Sbjct  107   YEDLKPDIDRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEEQERRTLLYSLLM  166

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV++QFVP L +GK MYFLF + EAKTP GLLARPVLTS  K S+FK + + + YT+ TS
Sbjct  167   PVMDQFVPGLDEGKGMYFLFTKLEAKTPSGLLARPVLTSYYKSSHFKPQKH-DLYTNYTS  225

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P ETILC  S+QSMYSQ+LCGL    +VLRVG +FAS FIRA+ FLEKH+  LC+DIRTG
Sbjct  226   PNETILCPHSYQSMYSQLLCGLCQNREVLRVGAVFASGFIRALKFLEKHFVCLCNDIRTG  285

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TL+ +ITDPSVREAV +++KPNP+LA+FIE EC K SWKGII RIW NTKY+DV+VTG M
Sbjct  286   TLDTKITDPSVREAVMKVLKPNPELADFIEAECVKGSWKGIITRIWPNTKYVDVIVTGTM  345

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             SQYIP L+Y+ N LPLV T Y SSEC F +NLNPL  P+EV+YT+IPTMAYFEFLPV + 
Sbjct  346   SQYIPILDYYSNGLPLVCTMYASSECYFGLNLNPLCNPSEVSYTLIPTMAYFEFLPVDQI  405

Query  951   IG----VPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNF  784
              G    +       ++DLVDVK+ QEYE+VVTTYAGLYRYRVGDILRVAGFKN  PQFNF
Sbjct  406   NGHTDSISNLEHEHLVDLVDVKMNQEYELVVTTYAGLYRYRVGDILRVAGFKNKAPQFNF  465

Query  783   VCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEI  604
             VCRKNV LSID+DKTDEVELHNAVK  ++ L  F ASL EYTS  +TSTIPGHYVLYWEI
Sbjct  466   VCRKNVVLSIDSDKTDEVELHNAVKTGADHLPQFGASLTEYTSCVDTSTIPGHYVLYWEI  525

Query  603   TQSSEN-PIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAI  427
              ++ +   IP  +F DCC A+EESLNSVYR+ RVS+  IG LEIR+VE+GTFDK+MD+A+
Sbjct  526   NKNGQTIEIPSSVFGDCCLAIEESLNSVYRQGRVSE-CIGALEIRVVEDGTFDKLMDFAL  584

Query  426   ASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNT  280
             + G+SI+QYK PRCVT  PI++LL+S+V+SNYFSPK P W PGHK+W T
Sbjct  585   SQGASINQYKTPRCVTYVPILDLLNSKVVSNYFSPKCPNWVPGHKNWCT  633



>ref|XP_010327157.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Solanum 
lycopersicum]
 ref|XP_010327158.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Solanum 
lycopersicum]
Length=616

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/597 (64%), Positives = 471/597 (79%), Gaps = 11/597 (2%)
 Frame = -1

Query  2046  ERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKL  1867
             E ++ E N + L FIE+VTTN  +VQ+RVL  ILS NA VEYL RH LNG TDRETFKK+
Sbjct  17    EGSIVEENKKALHFIEEVTTNVDEVQKRVLAEILSQNANVEYLQRHDLNGHTDRETFKKV  76

Query  1866  IPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLY  1687
             +PV+TYED++PDINR+ANG+ S I C    SEF TSSGTS GE KL+PT +EE+ ++   
Sbjct  77    MPVITYEDIQPDINRIANGDKSPIFCFQSTSEFLTSSGTSGGERKLMPTIQEEIGKRFHL  136

Query  1686  SSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPY  1507
               L M VI+QFVPDL KGK MYF  ++ EAKTPGGL ARPVLTS+ K  YF    ++ PY
Sbjct  137   RGLGMSVISQFVPDLEKGKGMYFWSIKSEAKTPGGLPARPVLTSMFKSPYFNNNRFS-PY  195

Query  1506  TDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCH  1327
              + TSP ETILC DS+Q+MYSQMLCGL+   +VLRVG+ FAS FIRAI FLEKHW LLC+
Sbjct  196   ANYTSPTETILCQDSYQNMYSQMLCGLYQRKEVLRVGSPFASGFIRAIRFLEKHWSLLCN  255

Query  1326  DIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVV  1147
             DIRTGT+N +IT+ SVRE+V +I+KP+P+LA+FIE EC+K+SW+GII R+W NTKY+DV+
Sbjct  256   DIRTGTVNAQITNLSVRESVMKILKPDPELADFIEAECSKDSWQGIIARLWPNTKYVDVI  315

Query  1146  VTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL  967
             VTG+MSQYIPTL+Y+ N LPLVS+ Y SSEC F +NLNP  KP+EV YT+IPTM YFEF 
Sbjct  316   VTGSMSQYIPTLDYYSNGLPLVSSIYASSECHFGVNLNPFCKPSEVCYTLIPTMCYFEFA  375

Query  966   PVSREIGV----------PEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVA  817
             P+ R+ G+           E    +++DLVDVK+GQEYE+VVTTY+GLYRYRVGD+LRVA
Sbjct  376   PIHRDNGLINSISKSKSLNEKEQNQLVDLVDVKIGQEYELVVTTYSGLYRYRVGDVLRVA  435

Query  816   GFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTST  637
             G+KNN PQF FVCR+NV LSID+DKTDE EL NAVKNA + L+PFDA+++EYTS+A+T+ 
Sbjct  436   GYKNNAPQFCFVCRENVILSIDSDKTDEAELQNAVKNAVHNLIPFDANVVEYTSYADTTA  495

Query  636   IPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENG  457
             IPGHYVLYWE++ +    IP  +FEDCC  +EESLNSVYR+ R SDKSIGPLEIRIVE G
Sbjct  496   IPGHYVLYWELSLNGSTHIPPSVFEDCCLTIEESLNSVYRQGRASDKSIGPLEIRIVEIG  555

Query  456   TFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             TFDK+MDY ++ G+S  QYK PRC+  AP+VELL+SRVMS +FSP  P W PGHK W
Sbjct  556   TFDKLMDYFVSLGASPDQYKTPRCLKSAPLVELLNSRVMSRHFSPTCPNWVPGHKQW  612



>ref|XP_010095194.1| hypothetical protein L484_008731 [Morus notabilis]
 gb|EXB58578.1| hypothetical protein L484_008731 [Morus notabilis]
Length=607

 Score =   804 bits (2077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/598 (66%), Positives = 480/598 (80%), Gaps = 20/598 (3%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             +++ N + LQ+IEDVT+NA +VQ RVL  ILS +A VEYL RHG NG TDRETFKK++P+
Sbjct  13    MDDKNKKSLQYIEDVTSNADEVQTRVLAEILSRSASVEYLQRHGHNGHTDRETFKKVMPI  72

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             V YED+KPDI+R+ANG+ S I+CS PISEF TSSGTS+GE KL+PT EEEL+R+SL  SL
Sbjct  73    VKYEDLKPDIDRIANGDTSPILCSVPISEFLTSSGTSQGERKLMPTIEEELDRRSLLYSL  132

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             L+PV+NQF+P L KGK MYFLF + EAKTP GL+ARPVL+S  K S+F+ R   +PYT+ 
Sbjct  133   LIPVMNQFIPGLDKGKGMYFLFTKSEAKTPSGLVARPVLSSYYKSSHFRNRV-GDPYTNY  191

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP ETILC DS+QSMYSQ+LCGL    +VLRVG +FAS FIRAI FLEK+W  L +DIR
Sbjct  192   TSPNETILCPDSYQSMYSQLLCGLCQNREVLRVGAVFASGFIRAIKFLEKNWVSLANDIR  251

Query  1317  TGTLN-PRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             TG LN  +I D SVR++V +I+KP+ +LA F+E EC KE+      R+W NTKYIDV+VT
Sbjct  252   TGKLNSSKINDSSVRDSVMKILKPDKELANFVEAECGKET------RLWPNTKYIDVIVT  305

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIPTL+++ N LP+V T Y SSEC F INLNPL KP+EV+YT+IPTMAYFEFLPV
Sbjct  306   GTMSQYIPTLDFYSNGLPIVCTMYASSECYFGINLNPLCKPSEVSYTLIPTMAYFEFLPV  365

Query  960   SREIG----VPEPNPV------EVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGF  811
              R+ G    + +P  +      E+LDLVDVK+G+EYE+VVTTY+GLYRYRVGDILRVA F
Sbjct  366   HRKNGRVNSISDPVSLGKDKNHELLDLVDVKVGEEYELVVTTYSGLYRYRVGDILRVASF  425

Query  810   KNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNI-LLPFDASLIEYTSHANTSTI  634
             KN  PQFNFVCRKNV LSID+DKT+EVEL NAVKNA+N  L  F A+LIEYTS A+TSTI
Sbjct  426   KNKAPQFNFVCRKNVVLSIDSDKTNEVELQNAVKNATNKHLHAFGATLIEYTSFADTSTI  485

Query  633   PGHYVLYWEITQSSENP-IPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENG  457
             PGHYVLYWEI ++S    IP  +FE+CC  VEESLNSVYR+ RV DKSIGPLEI+IVENG
Sbjct  486   PGHYVLYWEIIENSTTTIIPASVFEECCLTVEESLNSVYRQGRVCDKSIGPLEIKIVENG  545

Query  456   TFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
             TFDK+MDYA+  G+SI+QYK PRCV +A I++LL+SRV+SNYFSPK P WAPGHK W+
Sbjct  546   TFDKLMDYALGQGASINQYKAPRCVKQASILQLLNSRVVSNYFSPKCPNWAPGHKLWS  603



>gb|KEH29592.1| indole-3-acetic acid-amido synthetase [Medicago truncatula]
Length=611

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/587 (65%), Positives = 472/587 (80%), Gaps = 11/587 (2%)
 Frame = -1

Query  2028  SNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVTY  1849
             +N + L++IEDVT NA ++QERVL  ILS +A VEYL RHGLNG  DR+TFKK++PVVTY
Sbjct  28    NNKKALKYIEDVTMNANEIQERVLAEILSSSALVEYLQRHGLNGRRDRKTFKKVVPVVTY  87

Query  1848  EDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLMP  1669
             ED+K DI+R+ANG+ S I+CS PISEF TSSGTS GE KL+PT EE+LER+SL  SLLMP
Sbjct  88    EDLKVDIDRIANGDASPILCSKPISEFLTSSGTSGGERKLMPTIEEDLERRSLLYSLLMP  147

Query  1668  VINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTSP  1489
             V++Q+VP+L KGK MYFLF + EAKTP GLLARPVLTS  K S+F K    N   + TSP
Sbjct  148   VMDQYVPNLDKGKGMYFLFTKSEAKTPAGLLARPVLTSYYKSSHFIK----NKTHEITSP  203

Query  1488  RETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTGT  1309
              ETILC D +QSMYSQ+LCGL+  +QVLRVG +FAS FIRAI FLEKHW  LC+DI+TGT
Sbjct  204   IETILCLDFYQSMYSQILCGLYQNEQVLRVGAVFASGFIRAIKFLEKHWVGLCNDIKTGT  263

Query  1308  LNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAMS  1129
             +N  ITD  VRE+V +I+KPNP LA+F+E EC K+SWKGII R+W N+KY+DV+VTG MS
Sbjct  264   MNDEITDQGVRESVMKILKPNPKLADFVELECKKKSWKGIITRLWPNSKYVDVIVTGTMS  323

Query  1128  QYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSR--  955
             QYIP L+Y+ N LPLV T Y SSEC F +NLNPL +P+EV+YT++PTMAYFEFLP+++  
Sbjct  324   QYIPILDYYSNGLPLVCTMYASSECYFGLNLNPLCEPSEVSYTLVPTMAYFEFLPLNKID  383

Query  954   --EIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFV  781
                  +       +++LVDV+LGQEYE+VVTTYAGLYRYRVGDILRVAGFKN  PQFNF+
Sbjct  384   ANADSISATEQEHLVELVDVELGQEYELVVTTYAGLYRYRVGDILRVAGFKNKAPQFNFI  443

Query  780   CRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEIT  601
             CRKNV LSID+DKTDEVEL  AVKN SN L  ++ SL +YTS A+ STIPGHY+LYWEI 
Sbjct  444   CRKNVVLSIDSDKTDEVELQTAVKNGSNHLSHYNVSLTDYTSCADASTIPGHYILYWEII  503

Query  600   QSSEN--PIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAI  427
                +N  PIP  +FE+CCFAVE+SLNSVYR+ RV++ SIGPLEI++VENGTFDK+MD+A+
Sbjct  504   FDEQNPIPIPDSVFEECCFAVEDSLNSVYRQGRVTE-SIGPLEIKVVENGTFDKVMDFAL  562

Query  426   ASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             + G+SI+QYK PRCV  API+ELL+S+ +S++FS K P W PGHK W
Sbjct  563   SQGASINQYKTPRCVKYAPIIELLNSKTVSSFFSTKCPHWVPGHKKW  609



>ref|XP_003539512.2| PREDICTED: indole-3-acetic acid-amido synthetase GH3.5-like [Glycine 
max]
Length=630

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/590 (66%), Positives = 468/590 (79%), Gaps = 8/590 (1%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             N   +N   L++IE+VT+NA  +QE+VL  ILS +A  EYL RHGL+G TDR TFKK++P
Sbjct  40    NTSNNNKSALEYIEEVTSNADVIQEKVLAQILSRSAHAEYLQRHGLDGRTDRNTFKKIMP  99

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             VVTYED+KP I+R+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEELER+S+  S
Sbjct  100   VVTYEDLKPYIDRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELERRSMLYS  159

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV++QFVP L KGK MYFLF + EAKTPGGLLARPVLTS  K S+FK R + +PYT+
Sbjct  160   LLMPVMDQFVPALDKGKGMYFLFTKSEAKTPGGLLARPVLTSYYKSSHFKHRKH-DPYTN  218

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ETILC DS+QSMYSQ+LCGL   ++VLRVG +FAS FIRA+ FLEKH+  LC+DI
Sbjct  219   YTSPNETILCPDSYQSMYSQLLCGLCQNEEVLRVGAVFASGFIRALKFLEKHFVSLCNDI  278

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             R GTL+ +I DP VREAV +++KPNP LA+F+E EC K SWKGI+ RIW NTKY+DV+VT
Sbjct  279   RKGTLDAKINDPLVREAVMKVLKPNPTLADFVEAECMKGSWKGIVTRIWPNTKYVDVIVT  338

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIP L+Y+ N LPLV T Y SSEC F +NLNPL  P+EVAYT+IPTMAYFEFLP+
Sbjct  339   GTMSQYIPILDYYSNGLPLVCTMYASSECYFGLNLNPLCDPSEVAYTLIPTMAYFEFLPL  398

Query  960   SREIG----VPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQ  793
                 G    V      ++LDL DVKLGQEYE+VVTTYAG     +GDILRVAGFKN  PQ
Sbjct  399   DEINGHTNSVSHLVQEQLLDLADVKLGQEYELVVTTYAGTATV-IGDILRVAGFKNKAPQ  457

Query  792   FNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLY  613
             FNFVCRKNV LSID+DKTDEVEL NAVK+ ++ L  F ASL EYTS  +TSTIPGHYVLY
Sbjct  458   FNFVCRKNVVLSIDSDKTDEVELQNAVKSGADHLAQFGASLTEYTSCVDTSTIPGHYVLY  517

Query  612   WEITQSSENP-IPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMD  436
             WEI+ +   P IP  +F  CC A+EESLNSVYR+ RVS+ SIGPLEI+IVENGTFDK+MD
Sbjct  518   WEISTNGHTPTIPSSVFGHCCLAIEESLNSVYRQGRVSE-SIGPLEIKIVENGTFDKLMD  576

Query  435   YAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             +A++ G+SI+QYK PRCVT API++LL+S V+S+YFSPK P W PGHK W
Sbjct  577   FALSQGASINQYKTPRCVTYAPILDLLNSNVVSSYFSPKCPNWVPGHKDW  626



>ref|XP_006362911.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Solanum 
tuberosum]
Length=616

 Score =   798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/598 (64%), Positives = 469/598 (78%), Gaps = 11/598 (2%)
 Frame = -1

Query  2046  ERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKL  1867
             E ++ E N + LQFIE+VT N  +VQ+RVL  ILS NA VEYL RH LNG TDRETFKK+
Sbjct  17    EGSIVEENKKTLQFIEEVTINVDEVQKRVLAEILSRNANVEYLQRHDLNGHTDRETFKKV  76

Query  1866  IPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLY  1687
             +PV+TY+D++ DINR+ANG+ S I CS PISEF TSSGTS GE KL+PT  EE+ ++   
Sbjct  77    MPVITYKDIQHDINRIANGDKSPIFCSQPISEFLTSSGTSGGERKLMPTIPEEIGKRFQL  136

Query  1686  SSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPY  1507
               L M VI+QFVPDL KGK MYF  ++ EAKTPGGL ARPVLTS+ K  YF    ++ PY
Sbjct  137   RGLGMSVISQFVPDLEKGKGMYFWSIKSEAKTPGGLTARPVLTSMCKSPYFNNNRFS-PY  195

Query  1506  TDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCH  1327
              + TSP ET LC DS+Q+MYSQMLCGL+   +V+ VG+ FAS+FIRAI FLEKHW LLC+
Sbjct  196   ANYTSPAETTLCPDSYQNMYSQMLCGLYQCKEVISVGSPFASSFIRAIRFLEKHWSLLCN  255

Query  1326  DIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVV  1147
             DIR GTLN +ITD SVRE+V +I+KP+P+LA+FIE EC+++SW+GII R+W NTKY+ VV
Sbjct  256   DIRMGTLNTQITDQSVRESVMKILKPDPELADFIEAECSRDSWQGIIARLWPNTKYVAVV  315

Query  1146  VTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL  967
             VTG+MSQYIPTL+Y+ N LPLVST Y SSEC F INLNP  KP+EV+YT+IPTM YFEF 
Sbjct  316   VTGSMSQYIPTLDYYSNGLPLVSTMYGSSECYFGINLNPFCKPSEVSYTLIPTMCYFEFA  375

Query  966   PVSREIGV----------PEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVA  817
             P+ R+ GV           E    +++DL+DV++GQEYE+VVTTY+GLYRYRVGD+LRVA
Sbjct  376   PIHRDNGVINSISKSKLLNEKEQNQLVDLIDVQIGQEYELVVTTYSGLYRYRVGDVLRVA  435

Query  816   GFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTST  637
             G+KNN PQF FVCR+NV LSID+DKTDE EL NAVK A + L+PFD ++ EYTS+A+++T
Sbjct  436   GYKNNAPQFYFVCRENVILSIDSDKTDEAELQNAVKTAGHNLIPFDTNVTEYTSYADSAT  495

Query  636   IPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENG  457
             IPGHYVL+WE+  +    IP  +FEDCC  +EESLNSVYR+ R SDKSIGPLEIRIVE G
Sbjct  496   IPGHYVLFWELNVNGSTQIPPSVFEDCCLTIEESLNSVYRQGRASDKSIGPLEIRIVEIG  555

Query  456   TFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
             TFDK+MDY ++ G+S+ QYK PRCV  AP+VELL+SRVMS +FSP  P W PG+K WN
Sbjct  556   TFDKLMDYCVSLGASLDQYKTPRCVKFAPLVELLNSRVMSRHFSPTCPNWVPGNKQWN  613



>gb|EYU33579.1| hypothetical protein MIMGU_mgv1a002987mg [Erythranthe guttata]
Length=618

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/596 (67%), Positives = 470/596 (79%), Gaps = 15/596 (3%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGL-NGSTDRETFKKLIP  1861
             L ++    L FIE+VT NAG+VQ+RVL  ILS NAG EYL RH L  G TD +TFKK IP
Sbjct  24    LADNKKTKLDFIEEVTRNAGEVQKRVLAEILSRNAGAEYLKRHNLRGGQTDGDTFKKTIP  83

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             VV YEDV P INR+A G+ S I+CS PISEF TSSGTS GE K++PT EEEL R+SL  S
Sbjct  84    VVAYEDVLPYINRIAAGDSSPILCSDPISEFLTSSGTSGGERKMMPTIEEELSRRSLLYS  143

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV++QFV  L KGK MYFLFV+ E KTPGGLLARPVLTS  K S+FK+R Y +PYT+
Sbjct  144   LLMPVMSQFVHGLDKGKGMYFLFVKSETKTPGGLLARPVLTSYYKSSHFKERPY-DPYTN  202

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP ETILC DS+QSMYSQMLCGL    QVLRVG +FAS FIRAI FLEKHW LLC DI
Sbjct  203   YTSPNETILCPDSYQSMYSQMLCGLCEHAQVLRVGAVFASGFIRAIRFLEKHWTLLCQDI  262

Query  1320  RTGTLNPRITDPSVREAVARIV-KPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVV  1144
             RTG++N  ITDPSVR+AVARI+ KP+P+LA+F+  EC K SW+GII R+W NTKY+DV+V
Sbjct  263   RTGSVNQLITDPSVRDAVARILKKPDPELADFVATECGKGSWQGIITRLWPNTKYVDVIV  322

Query  1143  TGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLP  964
             TG MSQYIP L+Y+ N LPLV T Y SSEC F +NLNPL KP+EV+YTIIP MAYFEFLP
Sbjct  323   TGTMSQYIPILDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVSYTIIPNMAYFEFLP  382

Query  963   VSREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNF  784
             V +     +    E++DLVDVK+G EYE+VVTTYAGLYRYRVGDILRVAGFKN  PQFNF
Sbjct  383   VQK--ADEKEEEKELVDLVDVKIGHEYELVVTTYAGLYRYRVGDILRVAGFKNKAPQFNF  440

Query  783   VCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANT-STIPGHYVLYWE  607
             VCRKNV LSID DKTDEVEL NAVKNA+N L+PF A L EYTS+A+T +TIPGHYVLYWE
Sbjct  441   VCRKNVVLSIDTDKTDEVELQNAVKNATNHLVPFGACLAEYTSYADTITTIPGHYVLYWE  500

Query  606   ITQSS-------ENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
             +   S          +P  + EDCC  VEESL++VYR+ RV + +IGPLEI+IVE GTFD
Sbjct  501   LILGSNKNNNNNIKIVPPSVIEDCCLTVEESLDTVYRQNRVFE-AIGPLEIKIVETGTFD  559

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEW-APGHKHWN  283
             K+MDYAI+ G+SI+QYK PRCVT APIVELL+S+V+S++FSPK P+W  PG K W+
Sbjct  560   KLMDYAISLGASINQYKTPRCVTFAPIVELLNSKVVSSFFSPKCPKWTTPGLKQWS  615



>ref|XP_010924006.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Elaeis guineensis]
Length=607

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/591 (64%), Positives = 466/591 (79%), Gaps = 5/591 (1%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNG--STDRETFKKL  1867
             ++ E + ++L +IEDVT NA QVQ RVL  IL+ NA  EYL RHGL+G  + D + FK+L
Sbjct  15    SVPEEHRKVLDYIEDVTVNADQVQRRVLSEILTQNAPAEYLHRHGLSGHATADLDAFKRL  74

Query  1866  IPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLY  1687
             IPV+TYED++PDI R+A+G+PS I+   PISEF TSSGTS GE KL+PT  +EL R+SL+
Sbjct  75    IPVITYEDLQPDILRIAHGDPSPILSGRPISEFLTSSGTSGGERKLMPTIHDELVRRSLF  134

Query  1686  SSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPY  1507
              SL+ PV++QFVP L KGK MY  FV+ E++TPGGL+ARPVLTS  K  +F  R + +PY
Sbjct  135   YSLMTPVMSQFVPGLDKGKAMYLYFVKSESRTPGGLVARPVLTSYYKSRHFLDRPF-DPY  193

Query  1506  TDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCH  1327
                TSP E ILC+DS+QSMY+Q+LCGL     V+RVG +FAS F+RA  FLEKHW  LC 
Sbjct  194   NILTSPNEAILCSDSYQSMYAQLLCGLVQSADVVRVGAVFASGFLRATKFLEKHWPRLCC  253

Query  1326  DIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVV  1147
             DIRTG L+P+ITD +VREAV R+++P+P LA  IE EC+K SW+GII RIW NTKYID++
Sbjct  254   DIRTGMLDPQITDRTVREAVERVLRPDPGLAGHIEFECSKASWQGIIRRIWPNTKYIDII  313

Query  1146  VTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL  967
             VTGAM+QYIPTL ++G  LPL  T Y SSEC F INLNP+ KP+EVAYT+IPTMAYFEFL
Sbjct  314   VTGAMAQYIPTLEFYGGGLPLACTMYGSSECYFGINLNPMCKPSEVAYTLIPTMAYFEFL  373

Query  966   PVSR-EIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQF  790
             PV     G  + +  +++DLVDVKLGQEYE+VVTTY+GLYRYRVGD+LRVAGFKN  PQF
Sbjct  374   PVHHINKGAKDDDQRDLVDLVDVKLGQEYELVVTTYSGLYRYRVGDVLRVAGFKNKAPQF  433

Query  789   NFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYW  610
             NFV RKNVALSID+DKTDEVELH AV+NA N L PF ASL+EYTS+A+TS+IPGHYVL+W
Sbjct  434   NFVRRKNVALSIDSDKTDEVELHAAVRNAVNHLEPFGASLVEYTSYADTSSIPGHYVLFW  493

Query  609   EITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYA  430
             E+ ++    +P  +FEDCC A EESLNSVYR+ RV DKSIGPLEIR+VE GTFDK+MD A
Sbjct  494   EL-KAGGTAVPPSVFEDCCLAAEESLNSVYRQGRVCDKSIGPLEIRVVEEGTFDKLMDCA  552

Query  429   IASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             ++ G+SI+QYK PRCV   P+VELLD RV S +FSPK P+W PGHK W+ +
Sbjct  553   LSQGASINQYKAPRCVRSGPVVELLDGRVQSRFFSPKCPKWVPGHKQWSID  603



>ref|XP_010928643.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Elaeis guineensis]
Length=607

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/586 (64%), Positives = 465/586 (79%), Gaps = 5/586 (1%)
 Frame = -1

Query  2025  NNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNG--STDRETFKKLIPVVT  1852
             + ++L +IEDVT NA QVQ RVL  IL+ NA  EYL RHGL+G  + D   FK+LIPV+T
Sbjct  20    HQKVLDYIEDVTINADQVQRRVLSEILAQNAPAEYLHRHGLSGHATADPGAFKRLIPVIT  79

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             Y+D++PDI R+A+G+ S I+   PISEF TSSGTS GE KL+PT ++EL+R+SL+ SL+ 
Sbjct  80    YDDLQPDILRIAHGDTSPILSGRPISEFLTSSGTSGGERKLMPTIDDELDRRSLFYSLMT  139

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV++QFVP L +GK MY  FV+ E++TPGGL+ARPVLTS  K  +F  R + +PY   TS
Sbjct  140   PVMSQFVPGLDRGKAMYLYFVKSESRTPGGLVARPVLTSYYKSRHFLDRPF-DPYNILTS  198

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DS+QSMY+Q+LCGL    +V+RVG +FAS FIRAI FLEKHW  LC DIRTG
Sbjct  199   PNEAILCQDSYQSMYAQLLCGLVQRAEVVRVGAIFASGFIRAIKFLEKHWPRLCRDIRTG  258

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
              L+P ITD +VREA+ R+++P+P LA  IE EC+K S +GII RIW NT+YIDV+VTGAM
Sbjct  259   ILDPEITDGAVREAIERVLRPDPGLAGQIEAECSKPSCEGIIRRIWPNTRYIDVIVTGAM  318

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSR-  955
             +QYIPTL+++G  LPL  T Y SSEC   INLNP+ KP+EVAYT+IPTMAYFEF+PV   
Sbjct  319   AQYIPTLDFYGGGLPLACTMYGSSECYLGINLNPMCKPSEVAYTLIPTMAYFEFMPVHHV  378

Query  954   EIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCR  775
               G  + +  +++DLVDVKLGQEYE+VVTTY+GLYRYRVGD+LRVAGFKN  PQFNFV R
Sbjct  379   SNGAKDYDQRDLVDLVDVKLGQEYELVVTTYSGLYRYRVGDVLRVAGFKNKAPQFNFVRR  438

Query  774   KNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQS  595
             KNVALSID+DKTDEVELH AV+NA + L PF ASL+EYTS+A+TS+IPGHYVL+WE+ ++
Sbjct  439   KNVALSIDSDKTDEVELHAAVRNAVSHLEPFGASLVEYTSYADTSSIPGHYVLFWEL-KA  497

Query  594   SENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
                 +P  +FEDCC AVEESLN+VYR+ RV DKSIGPLEIR+VE GTFDKMMDYA++ G+
Sbjct  498   GGTAVPPSVFEDCCLAVEESLNTVYRQGRVCDKSIGPLEIRVVEEGTFDKMMDYALSQGA  557

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             SI+QYK PRCV   P+VELLD RV S +FSPK P+W PGHK W+T+
Sbjct  558   SINQYKAPRCVRSGPVVELLDGRVQSRFFSPKCPKWVPGHKQWSTD  603



>emb|CBI20465.3| unnamed protein product [Vitis vinifera]
Length=569

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/608 (64%), Positives = 460/608 (76%), Gaps = 54/608 (9%)
 Frame = -1

Query  2082  DAMTDALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGL  1903
             +A   + +++  +  L E N + LQFIEDVTTNA QVQ+RVL  IL+ NA VEYL RHGL
Sbjct  3     EAPKKSFKATGHDYCLAEKNKKALQFIEDVTTNADQVQKRVLAEILTRNAHVEYLHRHGL  62

Query  1902  NGSTDRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIP  1723
              G TDR+TFKKL+PV+TYED++PDI R+ANG+ S I+CS PISEF TSSGTS GE KL+P
Sbjct  63    GGHTDRDTFKKLMPVITYEDLQPDITRIANGDTSLILCSNPISEFLTSSGTSGGERKLMP  122

Query  1722  TTEEELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKR  1543
             T EEELER+SL  SLLMPV++Q V  L KGK MYFLF++ EAKTPGGL+ARPVLTS  K 
Sbjct  123   TIEEELERRSLLYSLLMPVMSQSVQGLEKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKS  182

Query  1542  SYFKKRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAI  1363
             S+F++R Y +PYT+ TSP ETILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI
Sbjct  183   SHFRERPY-DPYTNYTSPNETILCPDSYQSMYSQMLCGLVQNKEVLRVGAVFASGFIRAI  241

Query  1362  HFLEKHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIP  1183
              FLEKHW LLC DIRTGT++ +ITDPSVREAV R++KP+P LA+F+E E           
Sbjct  242   RFLEKHWTLLCRDIRTGTIDQQITDPSVREAVMRVLKPDPKLADFVEGE-----------  290

Query  1182  RIWRNTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAY  1003
                                              + T Y SSEC F +NLNPL KP+EV+Y
Sbjct  291   ---------------------------------LCTMYASSECYFGVNLNPLCKPSEVSY  317

Query  1002  TIIPTMAYFEFLPVSR-----EIGVP----EPNPVEVLDLVDVKLGQEYEVVVTTYAGLY  850
             T+IPTMAYFEFLPV R      I VP    +    +++DLVDVKLGQEYE+VVTTYAGLY
Sbjct  318   TLIPTMAYFEFLPVHRNNGTNSISVPKSLNDKEQQDLVDLVDVKLGQEYELVVTTYAGLY  377

Query  849   RYRVGDILRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASL  670
             RYRVGD+LRVAGFKN  PQFNFVCRKNV LSID+DKTDEVEL  AVKNA N L+PFDA+L
Sbjct  378   RYRVGDVLRVAGFKNKAPQFNFVCRKNVVLSIDSDKTDEVELQAAVKNAVNHLMPFDATL  437

Query  669   IEYTSHANTSTIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSI  490
              EYTS+A+T+TIPGHYVLYWE++     PIP  +FEDCC  VEESLNSVYR+ RVSDKSI
Sbjct  438   TEYTSYADTTTIPGHYVLYWELSLRGSTPIPPSVFEDCCLTVEESLNSVYRQGRVSDKSI  497

Query  489   GPLEIRIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPE  310
             GPLE++IVE+GTFDK+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+SNYFSPK P+
Sbjct  498   GPLEMKIVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPK  557

Query  309   WAPGHKHW  286
             W PGHK W
Sbjct  558   WIPGHKQW  565



>ref|XP_008789772.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Phoenix dactylifera]
Length=607

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/586 (64%), Positives = 462/586 (79%), Gaps = 5/586 (1%)
 Frame = -1

Query  2025  NNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNG--STDRETFKKLIPVVT  1852
             + ++L +IEDVT NA QVQ RVL  IL+ NA  EYL RHGL+G  + D   FK LIPV+T
Sbjct  20    HRKVLDYIEDVTVNADQVQRRVLSEILAQNAPAEYLRRHGLSGRATADPSAFKLLIPVIT  79

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++PDI R+A+G+ S II   PISEF TSSGTS GE KL+PT ++EL+R+SL+ SL+ 
Sbjct  80    YEDLQPDILRIAHGDTSPIISGRPISEFLTSSGTSGGERKLMPTIDDELDRRSLFYSLMT  139

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV++QFVP L +GK MY  FV+ E++TPGGL+ARPVLTS  K  +F +R + +PY   TS
Sbjct  140   PVMSQFVPGLDRGKAMYLYFVKSESRTPGGLVARPVLTSYYKSRHFLERPF-DPYNTLTS  198

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DS+QSMY+Q+LCGL    +V+RVG +FAS FIRAI FLEKHW  LC DIRTG
Sbjct  199   PNEAILCLDSYQSMYAQLLCGLVQRAEVVRVGAIFASGFIRAIKFLEKHWPRLCRDIRTG  258

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
              L+P I D +VREAV R+++P+P LA  IE EC+K SW+ II RIW NTKYIDV+VTGAM
Sbjct  259   MLDPEIADRAVREAVERVLRPDPGLAGQIEAECSKPSWEAIIRRIWPNTKYIDVIVTGAM  318

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+++G  LPL  T Y SSEC F INLNP+ KP+EVAYT+IPTMAYFEFLPV   
Sbjct  319   AQYIPTLDFYGGGLPLACTMYGSSECYFGINLNPMCKPSEVAYTLIPTMAYFEFLPVRHA  378

Query  951   I-GVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCR  775
               G  + +  +++DLVDVKLGQEYE+VVTTY+GLYRYRVGD+LRVAGFKN  PQFNFV R
Sbjct  379   GNGAKDYDQRDLVDLVDVKLGQEYELVVTTYSGLYRYRVGDVLRVAGFKNKAPQFNFVRR  438

Query  774   KNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQS  595
              NVALS+D++KT+EVELH AV++A+N L PF ASL+EYTS+A T +IPGHYVL+WE+ ++
Sbjct  439   NNVALSVDSEKTNEVELHAAVRSAANHLEPFGASLVEYTSYAETWSIPGHYVLFWEL-KA  497

Query  594   SENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
                 +P  +FEDCC AVEESLNSVYR+ RV D SIGPLEIR+VE GTFDK+MDYA++ G+
Sbjct  498   GGTAVPPSVFEDCCLAVEESLNSVYRQGRVCDSSIGPLEIRVVEEGTFDKLMDYALSQGA  557

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             SI+QYK PRCV   P+VELLD RV S +FSPK P+W PGHK W+T+
Sbjct  558   SINQYKAPRCVRSGPVVELLDGRVQSRFFSPKSPKWVPGHKQWSTD  603



>ref|XP_010443025.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Camelina 
sativa]
Length=539

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/540 (69%), Positives = 438/540 (81%), Gaps = 11/540 (2%)
 Frame = -1

Query  1866  IPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLY  1687
             +PVVTYED++P+INR+ANG+ S I+CS  ISEF TSSGTS GE KL+PT EEEL+R+SL 
Sbjct  1     MPVVTYEDIQPEINRIANGDKSQILCSNHISEFLTSSGTSGGERKLMPTIEEELDRRSLL  60

Query  1686  SSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPY  1507
              SLLMPV+NQFVP L KGK MYFLF++ E+KTPGGL ARPVLTS  K S+FKKR + +PY
Sbjct  61    YSLLMPVMNQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKKRPF-DPY  119

Query  1506  TDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCH  1327
             T+ TSP +TILC DS+QSMYSQMLCGL    +VLRVG +FAS FIRAI FLEKHW  L  
Sbjct  120   TNYTSPNQTILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKHWPELAR  179

Query  1326  DIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVV  1147
             DIRTGTL+  ITD SVREAV  I+KP+P LA+F+E EC K SW+GII RIW NTKY+DV+
Sbjct  180   DIRTGTLSSEITDLSVREAVGEILKPDPKLADFVESECRKTSWQGIITRIWPNTKYVDVI  239

Query  1146  VTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL  967
             VTG MSQYIPTL+Y+ N LPLV T Y SSEC F +NL PL KP+EV+YT+IP MAYFEFL
Sbjct  240   VTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPNMAYFEFL  299

Query  966   PVSREIGVP----------EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVA  817
             PV R  GV           E    E++DLVDVKLGQEYE+VVTTYAGLYRYRVGD++ V 
Sbjct  300   PVHRNSGVTSSISLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLYRYRVGDVISVT  359

Query  816   GFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTST  637
             GFKNN PQF+F+CRKNV LSIDADKTDEVEL NAVKNA   L+PF+ASL EYTS+A+TS+
Sbjct  360   GFKNNAPQFSFICRKNVVLSIDADKTDEVELQNAVKNAVTHLVPFEASLSEYTSYADTSS  419

Query  636   IPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENG  457
             IPGHYVL+WE+  +   PIP  +FEDCC  +EESLNSVYR+ RVSDKSIGPLEI+IVE+G
Sbjct  420   IPGHYVLFWELCLNGNTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKIVESG  479

Query  456   TFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             TFDK+MDYAI+ G+SI+QYK PRCV  API+ELL+SRV+ NYFSPK P+W PGHK W +N
Sbjct  480   TFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDNYFSPKCPKWVPGHKQWGSN  539



>ref|XP_009408668.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Musa acuminata subsp. malaccensis]
Length=606

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/589 (64%), Positives = 464/589 (79%), Gaps = 6/589 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGST--DRETFKKLIPV  1858
             E + + L FIEDVT NA  VQ RVL  ILS NA  +YL RHGL+G    D + FK+L+PV
Sbjct  16    EEHRQALHFIEDVTANADLVQRRVLVEILSQNAAADYLHRHGLSGRAVPDPDAFKRLVPV  75

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             VTYED++PDI R+A+G+ S I+   PISEF TSSGTS GE KL+PT ++EL+R+SL  SL
Sbjct  76    VTYEDLQPDILRIAHGDTSPILSGRPISEFLTSSGTSGGERKLMPTIDDELDRRSLLYSL  135

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV++QFVP L KGK MY LFV+ EA+TPGGL+ARPVLTS  K  +F  R + +PY   
Sbjct  136   LMPVMSQFVPGLDKGKGMYLLFVKSEARTPGGLVARPVLTSYYKSRHFLSRPF-DPYNVY  194

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP E ILC+DS+QSMYSQ+LCGL    QV+RVG +FAS FIRAI FLEKHW  LC DIR
Sbjct  195   TSPNEAILCSDSYQSMYSQLLCGLIQRTQVVRVGAVFASGFIRAIRFLEKHWPSLCRDIR  254

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             TG L+P ITD +VREAVA +++P+P+LA  IE EC K SW+GII R+W NTKY+DV+VTG
Sbjct  255   TGELDPDITDRAVREAVACVLRPDPELALQIETECRKGSWQGIISRLWPNTKYVDVIVTG  314

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
             AM+QYIPTL+++ + LPL  T Y SSEC F +NL+P   P++V+YT+IPTMAYFEFLP+ 
Sbjct  315   AMAQYIPTLDFYSDCLPLTCTMYASSECYFGLNLDPTCTPSDVSYTLIPTMAYFEFLPIQ  374

Query  957   R--EIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNF  784
             +  + G  E +  +++DLVDVKLGQEYE+VVTTYAGLYRYR+GD+LRVAGFKN  PQFNF
Sbjct  375   KCSDNGGVELDHHDLVDLVDVKLGQEYELVVTTYAGLYRYRIGDVLRVAGFKNKAPQFNF  434

Query  783   VCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEI  604
             + RKNVALSID+DKTDEVELH+AV NA N L PF  SL+EYTS+A+TS+IPGHYVL+WE+
Sbjct  435   IRRKNVALSIDSDKTDEVELHDAVGNAVNNLEPFGTSLVEYTSYADTSSIPGHYVLFWEL  494

Query  603   TQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIA  424
              ++   P+P  +FEDC   VEESLNSVYR+ RV DKSIGPLEIR+V  GTFDK+MDYA++
Sbjct  495   -RAGGTPVPPSVFEDCGLTVEESLNSVYRQGRVCDKSIGPLEIRVVAEGTFDKLMDYALS  553

Query  423   SGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
              G+SI+QYK PRCV   P+V+LLD RV S +FSPK P+W PGHK WN +
Sbjct  554   QGASINQYKAPRCVRAGPVVDLLDGRVKSRFFSPKCPKWRPGHKQWNMD  602



>ref|XP_008797411.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Phoenix dactylifera]
Length=607

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/585 (64%), Positives = 459/585 (78%), Gaps = 5/585 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNG--STDRETFKKLIPV  1858
             E + ++L ++EDVT NA +VQ RVL  IL+ NA  EYL RHGL+G  + D + FK+LIPV
Sbjct  18    EEHRKVLDYVEDVTVNADEVQRRVLSEILTQNAPAEYLHRHGLSGHATADPDAFKRLIPV  77

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             +TYED++PD+ R+A+G+ S I+   PISEF TSSGTS GE KL+PT  +EL+R+SL+ SL
Sbjct  78    ITYEDLQPDVLRIAHGDTSPILSGRPISEFLTSSGTSGGERKLMPTIHDELDRRSLFYSL  137

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             + PV++QFVP L KGK MY  FV+ E++TPGGL+ARPVLTS  K  +F +R + +PY   
Sbjct  138   MTPVMSQFVPGLDKGKAMYLYFVKSESRTPGGLVARPVLTSYYKSRHFLERPF-DPYNIL  196

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP E ILC DS+QSMY+Q+LCGL     V+RVG +FAS F+RAI FLEKHW  LC DIR
Sbjct  197   TSPNEAILCPDSYQSMYAQLLCGLVQRADVVRVGAVFASGFLRAIKFLEKHWPRLCCDIR  256

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             TG L+  ITD +VREAV R+++P+P LA  IE EC+K SW+GII RIW NTKYID++VTG
Sbjct  257   TGMLDTEITDRAVREAVERVLRPDPGLAGEIETECSKASWQGIIRRIWPNTKYIDIIVTG  316

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
             AM+QYIPTL ++G  LPL  T Y SSEC F INLNP+ KP+EVAYT+IPTMAYFEFLPV 
Sbjct  317   AMAQYIPTLEFYGGGLPLACTMYGSSECYFGINLNPMCKPSEVAYTLIPTMAYFEFLPVH  376

Query  957   R-EIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFV  781
                 G  + +  +++DLVDVKLGQEYE+VVTTY+GLYRYRVGD+LRVAGFK+  PQFNFV
Sbjct  377   HINHGAKDYDQRDLVDLVDVKLGQEYELVVTTYSGLYRYRVGDVLRVAGFKDKAPQFNFV  436

Query  780   CRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEIT  601
              RKNVALSID+DKTDEVELH AV+NA N L PF ASL+EYTS+A+TS+IPGHYVL+WE+ 
Sbjct  437   RRKNVALSIDSDKTDEVELHAAVRNAVNHLEPFGASLVEYTSYADTSSIPGHYVLFWEL-  495

Query  600   QSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIAS  421
             ++    +P  +FEDCC A EESLNSVYR+ R  DKSIGPLEIR+VE GTFDK+MDYA++ 
Sbjct  496   KAGGTAVPPSVFEDCCLAAEESLNSVYRQGRACDKSIGPLEIRVVEEGTFDKLMDYALSQ  555

Query  420   GSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHW  286
             G+SI+QYK PRCV   P VELLD RV S +FSPK P+W  GHK W
Sbjct  556   GASINQYKAPRCVRSGPAVELLDGRVQSRFFSPKCPKWVAGHKQW  600



>gb|EPS63059.1| hypothetical protein M569_11729, partial [Genlisea aurea]
Length=592

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/587 (65%), Positives = 453/587 (77%), Gaps = 7/587 (1%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             NL E N   L FI+DVT  A QVQE VL  ILS NAGVEYL R+GL+G TDR++FK  +P
Sbjct  9     NLAEINKAKLNFIDDVTARADQVQELVLSEILSRNAGVEYLNRYGLDGRTDRQSFKTTLP  68

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             VV YED+ PDINR+A G+ S I+CS PISEF TSSGTS GE K++PT  EELER+SL  S
Sbjct  69    VVNYEDILPDINRIAAGDTSPILCSAPISEFLTSSGTSAGERKMMPTIAEELERRSLLYS  128

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV++QFV  L KGK MYFLFV+ E +TPGGLLARPVLTS  K  +FK R Y +PYTD
Sbjct  129   LLMPVMSQFVEGLEKGKAMYFLFVKSETRTPGGLLARPVLTSYYKSPHFKDRPY-DPYTD  187

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP E ILC+DS+QSMYSQMLCGL+    VLRVG +FAS FIRA+HFL  HW LL  DI
Sbjct  188   YTSPNEAILCSDSYQSMYSQMLCGLFLSRHVLRVGAVFASGFIRALHFLRNHWALLARDI  247

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             RTGTLNP + D +VREAV  I+KP+P LA+F+E EC KESWKGII R+W NT+YI+V+VT
Sbjct  248   RTGTLNPLVADSAVREAVMGILKPDPRLADFVEGECGKESWKGIIARLWPNTRYIEVIVT  307

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             G MSQYIPTL+Y+G+ LPLV T Y SSEC F +NL+PL +P EVAYT+IPTM Y+EF+P+
Sbjct  308   GTMSQYIPTLDYYGDGLPLVCTMYASSECYFGVNLSPLCEPGEVAYTLIPTMCYYEFIPM  367

Query  960   SREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFV  781
               +    E    +++DLVDVKLG+EYE+VVTTY+GLYRYRVGD+LRVAGFKN  PQFNFV
Sbjct  368   DDD---EEEGQEQLVDLVDVKLGKEYELVVTTYSGLYRYRVGDVLRVAGFKNKAPQFNFV  424

Query  780   CRKNVALSIDADKTDEVELHNAVKNA-SNILLPFDASLIEYTSHANTSTIPGHYVLYWEI  604
             CRKNV LSID+DKT+EVELH+AV +A    L PF A + EYTS A T  +PGHYVLYWE+
Sbjct  425   CRKNVVLSIDSDKTNEVELHDAVNHAVRQHLSPFGARVSEYTSCAETGAVPGHYVLYWEL  484

Query  603   TQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIA  424
                     P   F+DCC AVEE L++VYR  RV   +IGPLEIRIVE GTFDK+MDYAI+
Sbjct  485   EGGGGGAAPPSAFQDCCLAVEERLDNVYRHNRVLG-AIGPLEIRIVEGGTFDKLMDYAIS  543

Query  423   SGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAP-GHKHW  286
              G+SI+QYK PRCV   PIVELL+SRV+S +FSPK P+W   G K W
Sbjct  544   LGASINQYKTPRCVKFPPIVELLNSRVVSRHFSPKCPKWTSLGLKQW  590



>gb|KHN22868.1| Indole-3-acetic acid-amido synthetase GH3.6 [Glycine soja]
Length=546

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/541 (69%), Positives = 438/541 (81%), Gaps = 17/541 (3%)
 Frame = -1

Query  1866  IPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLY  1687
             +PVVTYED+KPDI+R+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEELER+SL 
Sbjct  1     MPVVTYEDLKPDIDRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELERRSLL  60

Query  1686  SSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYT-NP  1510
              SLLMPV+ QFVP L KGK MYFLF++ EAKTPGGLLARPVLTS  + S+FK +T+  +P
Sbjct  61    YSLLMPVMEQFVPGLDKGKGMYFLFIKSEAKTPGGLLARPVLTSYYRSSHFKNKTHCFDP  120

Query  1509  YTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLC  1330
             YT+ TSP ETILC DS+QSMYSQMLCGL   + VLRVG +FAS FIRA+ FLEKHW  LC
Sbjct  121   YTNYTSPIETILCLDSYQSMYSQMLCGLSQNEHVLRVGAVFASGFIRALKFLEKHWVCLC  180

Query  1329  HDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDV  1150
              DIR GT+ P ITD SVREA+ R++KPNP LA+FIE EC K  WKGII R+W NTKY+DV
Sbjct  181   RDIRNGTIGPEITDSSVREAIMRVLKPNPKLADFIEGECKKGLWKGIITRLWPNTKYVDV  240

Query  1149  VVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEF  970
             +VTG M+QYIP L+Y+ N LPLV T Y SSEC F +NLNPL  P+EV+YT++PTMAYFEF
Sbjct  241   IVTGTMAQYIPMLDYYSNGLPLVCTMYASSECYFGLNLNPLCDPSEVSYTLVPTMAYFEF  300

Query  969   LPVSREIGVPEPNPVE------VLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFK  808
             LP+++       N +       ++DLVDV+LGQEYE+VVTTYAGLYRYRVGDILRVAGFK
Sbjct  301   LPLNKT--KEHANSISYTEQELLVDLVDVELGQEYELVVTTYAGLYRYRVGDILRVAGFK  358

Query  807   NNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPG  628
             NN PQFNFVCRKNV LSID+DKTDEVEL NAVKN +N L  F ASL EYTS A+TSTIPG
Sbjct  359   NNAPQFNFVCRKNVVLSIDSDKTDEVELQNAVKNGANHLTLFGASLTEYTSFADTSTIPG  418

Query  627   HYVLYWEITQS-------SENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRI  469
             HYVLYWEI+ +       ++NPIP  +FE+CCFAVE SLNSVYR+ RVS+ SIGPLEI+I
Sbjct  419   HYVLYWEISMNKNNNIDQNQNPIPSSVFEECCFAVEGSLNSVYRQGRVSE-SIGPLEIKI  477

Query  468   VENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             VENGTFDK+MD+A++ G+SI+QYK PRCV  APIVELLDS+ +SNYFSPK P W PGHK 
Sbjct  478   VENGTFDKLMDFALSQGASINQYKTPRCVKYAPIVELLDSKTVSNYFSPKCPLWVPGHKK  537

Query  288   W  286
             W
Sbjct  538   W  538



>gb|KHN36576.1| Indole-3-acetic acid-amido synthetase GH3.5 [Glycine soja]
Length=534

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/534 (69%), Positives = 438/534 (82%), Gaps = 7/534 (1%)
 Frame = -1

Query  1866  IPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLY  1687
             +PVVTYED+KPDI+R+ANG+ S I+CS PISEF TSSGTS GE KL+PT EEELER+S+ 
Sbjct  1     MPVVTYEDLKPDIDRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELERRSML  60

Query  1686  SSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPY  1507
              SLLMPV++QFVPDL KGK MYFLF + EAKTPGGLLARPVLTS  K S+FK R + +PY
Sbjct  61    YSLLMPVMDQFVPDLDKGKGMYFLFTKSEAKTPGGLLARPVLTSYYKSSHFKHRKH-DPY  119

Query  1506  TDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCH  1327
             T+ TSP ETILC DS+QSMYSQ+LCGL+  ++VLRVG +FAS FIRA+ FLEKH+  LC+
Sbjct  120   TNYTSPNETILCHDSYQSMYSQLLCGLYQNEEVLRVGAVFASGFIRALKFLEKHFVCLCN  179

Query  1326  DIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVV  1147
             DIRTGTL+ +ITDPSVREAV +++KPNP LA+F+E EC K SWKGII RIW NTKY+DV+
Sbjct  180   DIRTGTLDAKITDPSVREAVMKVLKPNPTLADFVETECMKGSWKGIITRIWPNTKYVDVI  239

Query  1146  VTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL  967
             VTG MSQYIP L+Y+ N LPLV T Y SSEC F +NLNP   P+EVAYT+IPTMAYFEFL
Sbjct  240   VTGTMSQYIPILDYYSNGLPLVCTMYASSECYFGLNLNPSCDPSEVAYTLIPTMAYFEFL  299

Query  966   PVSREIG----VPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNT  799
             P+    G    + +     ++DL DVKLGQEYE+VVTTYAGLYRYRVGDILRVAGFKN  
Sbjct  300   PLDEINGHTNSISQLEQEHLVDLADVKLGQEYELVVTTYAGLYRYRVGDILRVAGFKNKA  359

Query  798   PQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYV  619
             PQFNFVCRKNV LSID+DKTDEVELHNAVK+ +  L  F+ASL EYTS  +TSTIPGHYV
Sbjct  360   PQFNFVCRKNVVLSIDSDKTDEVELHNAVKSGAEHLAEFNASLTEYTSCVDTSTIPGHYV  419

Query  618   LYWEITQSSENP-IPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKM  442
             LYWEI+ +   P IP  +F  CC ++EESLNSVYR+ RVS+ SIGPLEI++VENGTFDK+
Sbjct  420   LYWEISTNDHTPTIPSSVFGHCCLSIEESLNSVYRQGRVSE-SIGPLEIKVVENGTFDKL  478

Query  441   MDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNT  280
             MD+A++ G+SI+QYK PRCVT API++LL+S+V+S+Y SPK P W PGHK W T
Sbjct  479   MDFALSQGASINQYKTPRCVTYAPILDLLNSKVLSSYISPKSPNWVPGHKDWCT  532



>ref|XP_009402880.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Musa acuminata subsp. malaccensis]
Length=605

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/591 (63%), Positives = 461/591 (78%), Gaps = 5/591 (1%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGST--DRETFKKL  1867
             ++ + + + L+FIEDVT NA QVQ RVL  IL+ NA  EYL RHGL   T  D + FK+L
Sbjct  13    SVPDEHRKALEFIEDVTANADQVQRRVLAEILAQNAPAEYLHRHGLPSRTAPDPDAFKRL  72

Query  1866  IPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLY  1687
             IPVVTYED++ DI R+A+G+ S I+   PISEF TSSGTS GE KL+P  E+EL+R+S+ 
Sbjct  73    IPVVTYEDIRLDILRIAHGDTSPILSGRPISEFLTSSGTSGGERKLMPMIEDELDRRSVL  132

Query  1686  SSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPY  1507
              SLLMPV++QFVP L +GK MY LFV+ EA+TPGGL+ARPVLTS  K  +F  + + +PY
Sbjct  133   YSLLMPVMSQFVPGLDEGKGMYLLFVKSEARTPGGLIARPVLTSYYKSRHFLSQPF-DPY  191

Query  1506  TDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCH  1327
                TSP E ILC DS+QSMY+Q+LCGL +  +V+RVG +FAS FIRAI FLEK+W  LC 
Sbjct  192   NVLTSPNEAILCLDSYQSMYAQLLCGLIHRAEVVRVGAVFASGFIRAIRFLEKYWPRLCR  251

Query  1326  DIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVV  1147
             DIR+G L+  ITD +VREAV R+++P+P+LA  IE E  + S +GIIPR+W NTKY+DV+
Sbjct  252   DIRSGELDAEITDRAVREAVVRVLRPDPELARLIEAEFARGSLQGIIPRLWPNTKYVDVI  311

Query  1146  VTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL  967
             VTGAM+QYIPTL+++   LPL  T Y SSEC F +NLNP+ KP+EV+YT IPT AYFEFL
Sbjct  312   VTGAMAQYIPTLDFYSGGLPLTCTMYGSSECYFGLNLNPMCKPSEVSYTFIPTFAYFEFL  371

Query  966   PV-SREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQF  790
             P+     G  E +  E++DLVDVKLGQEYE+VVTTYAGLYRYRVGD+LRVAGFKN TPQF
Sbjct  372   PIHCSGNGRTEFDHRELVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLRVAGFKNKTPQF  431

Query  789   NFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYW  610
             NF+ RK+V LSID+DKTDEVEL  AV NA N L PF ASL+EYTS A+T +IPGHYVLYW
Sbjct  432   NFIRRKSVVLSIDSDKTDEVELQAAVSNAVNHLKPFGASLVEYTSCADTVSIPGHYVLYW  491

Query  609   EITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYA  430
             E+ ++ +  +P  +FEDCC AVEESLNSVYR+ RV DKSIGPLEIR+VE GTFDKMMDYA
Sbjct  492   EL-RAGDTTVPASVFEDCCLAVEESLNSVYRQGRVCDKSIGPLEIRVVEEGTFDKMMDYA  550

Query  429   IASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             ++ G+SI+QYK PRCV   P+VELLD RV S +FSPK P+WAPG+K W+ +
Sbjct  551   LSQGASINQYKAPRCVRHGPVVELLDGRVQSTFFSPKCPKWAPGNKQWDKD  601



>ref|XP_004970208.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like 
[Setaria italica]
Length=616

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/585 (62%), Positives = 451/585 (77%), Gaps = 5/585 (1%)
 Frame = -1

Query  2028  SNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDR---ETFKKLIPV  1858
             ++   L+FIE VT NAGQVQ RVL  IL+ NA  EYL RHG++G+ D    E F++L+P+
Sbjct  21    AHREALEFIEHVTANAGQVQRRVLAEILAQNAPAEYLRRHGVSGAADDDAVEAFRRLVPL  80

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             VTYE ++PDI R+ANG+ S I+ S PISEF TSSGTS GE KL+PT  +EL+R+SL  SL
Sbjct  81    VTYEGLQPDILRIANGDTSPILSSKPISEFLTSSGTSGGERKLMPTIADELDRRSLLYSL  140

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
              MPV++Q VP L KGK MY LFV+ E++TPGGL+ARPVLTS  +   F +R + +PYTD 
Sbjct  141   QMPVMSQSVPGLDKGKAMYLLFVKAESRTPGGLVARPVLTSYYRSRQFLERPH-DPYTDY  199

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP E ILC DS+QSMY+Q+LCGL +   VLRVG +FAS F+RAI FLEKHW  LC DIR
Sbjct  200   TSPNEAILCVDSYQSMYAQLLCGLVHRADVLRVGAVFASGFLRAIRFLEKHWPRLCRDIR  259

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             TG L+P ITD +VR+AV R+++ +P LA  IE EC + SW+GII R+W  TKYIDV+VTG
Sbjct  260   TGALDPEITDRAVRDAVGRVLRADPALAGEIEAECGRASWEGIIRRLWPRTKYIDVIVTG  319

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
             AMSQYIPTL ++G  LPL  T Y SSEC F +NL P+ KP++VAYT+IPTM YFEFLP+ 
Sbjct  320   AMSQYIPTLEFYGGGLPLACTMYASSECYFGLNLKPMCKPSDVAYTLIPTMCYFEFLPLR  379

Query  957   REIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVC  778
                   EP+  +++DLVDVKLG EYE+VVTTY+GL RYRVGD+LRVAGFKN  P F+FV 
Sbjct  380   CSNAKAEPSHRDLVDLVDVKLGHEYELVVTTYSGLCRYRVGDVLRVAGFKNEAPMFSFVR  439

Query  777   RKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQ  598
             R+NVALSID+DKTDE ELH AV  A   L PF ASL+EYTS+A+ + IPGHYVL+WE+ +
Sbjct  440   RQNVALSIDSDKTDETELHAAVSGAVQHLAPFGASLVEYTSYADAAAIPGHYVLFWEL-R  498

Query  597   SSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASG  418
             +    +P  +FEDCC +VEE+LNSVYR+CR  D+SIGPLEIR+V  GTFDK+MDYAI+ G
Sbjct  499   AGTTAVPASVFEDCCLSVEEALNSVYRQCRACDRSIGPLEIRVVSEGTFDKLMDYAISRG  558

Query  417   SSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
             +SI+QYK PRCV   P+VELLD+RV   YFSPK P+W+PG+K WN
Sbjct  559   ASINQYKAPRCVRPGPVVELLDARVQGRYFSPKCPKWSPGNKQWN  603



>ref|XP_006362920.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Solanum 
tuberosum]
Length=595

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/598 (62%), Positives = 469/598 (78%), Gaps = 19/598 (3%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             + E N +  +FIE+VTTN  +VQ+RVL  IL+ NA VEYL R      TDRETFKK +PV
Sbjct  1     MAEENKKNFEFIEEVTTNVDEVQKRVLHEILTRNANVEYLQRLS---HTDRETFKKFVPV  57

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             +TYED++P+INR+ANG+ S I+CS P+SEF +S+GTS GENKLIPTTEE   R+     L
Sbjct  58    ITYEDIQPEINRIANGDTSPILCSQPVSEFISSTGTSGGENKLIPTTEEGHGRRLQLYGL  117

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKR-TYTNPYTD  1501
             ++ V++QF PDL KGK MYFLF++ EAKTPGGLLAR  LTSL K S+ +   +Y  PYT 
Sbjct  118   VLSVMSQFFPDLEKGKGMYFLFIKSEAKTPGGLLARTFLTSLYKSSHIRNNNSYVLPYT-  176

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
               SP E ILC DS+QSMYSQMLCGL    +V+RVG++ ASAFIRA+ FLE HW  LC+DI
Sbjct  177   --SPIEAILCLDSYQSMYSQMLCGLCQNREVVRVGSVLASAFIRAMRFLEDHWSQLCNDI  234

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             RTGT+  +ITDPSVREAV +I+KP+ +LA+FIE EC+K+SW+GI+ R+W NTKY+D++VT
Sbjct  235   RTGTITNKITDPSVREAVMKILKPDSELADFIEAECSKDSWEGIVTRLWPNTKYMDLIVT  294

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLP-  964
             G MSQYIP L+Y+ N LPLVST Y SSEC F INLNPL KP+EV+YT+IPTM YFEFLP 
Sbjct  295   GTMSQYIPMLDYYCNSLPLVSTMYASSECFFGINLNPLCKPSEVSYTLIPTMGYFEFLPI  354

Query  963   ---------VSREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGF  811
                      +S    + E +  +++DLVDVK+GQEYE++VTTY+GLYRYRVGD+LRVAG+
Sbjct  355   HSSNEFIDSISISTQLNEKDEQQLVDLVDVKIGQEYELIVTTYSGLYRYRVGDVLRVAGY  414

Query  810   KNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIP  631
             KNN+PQFNF+ R+NV LSID DKT+E +L NAV NA+N L+PFDA +++YTS+A+T+TIP
Sbjct  415   KNNSPQFNFIRRENVILSIDFDKTNEFDLQNAVNNAANNLMPFDARVVDYTSYADTATIP  474

Query  630   GHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTF  451
             GHYVL+WE++ ++  PI   + EDCC  +EESL+SVYR+ R SDKSIGPLEIRIVE GTF
Sbjct  475   GHYVLFWELSANASTPITPSVLEDCCLTIEESLDSVYRQGRTSDKSIGPLEIRIVETGTF  534

Query  450   DKMMDYAIAS--GSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
             DK+MDY   S  G+SI+QYK PRCV  AP+VELL+SRV+S+YFSP  P+WAPG K WN
Sbjct  535   DKLMDYCCTSLLGASINQYKTPRCVKFAPLVELLNSRVVSSYFSPVCPKWAPGSKQWN  592



>gb|KDP32021.1| hypothetical protein JCGZ_12482 [Jatropha curcas]
Length=597

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/582 (61%), Positives = 451/582 (77%), Gaps = 2/582 (0%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + ++LQFIED+T N   VQER+L  ILS N+  EYL R  L G+TDR+TFK  IPVVT
Sbjct  17    EKDAKVLQFIEDMTKNVDSVQERLLAEILSRNSETEYLSRFSLQGATDRDTFKSKIPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++PDI R+ANG+ S I  + P+SEF TSSGTS GE KL+PT +EE++R+ L  SLLM
Sbjct  77    YEDLQPDIQRIANGDRSPIFSAHPVSEFLTSSGTSAGERKLMPTIQEEMDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E KTP GL+ARPVLTS  K  +FK R Y +PY + TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKAETKTPSGLVARPVLTSYYKSEHFKNRPY-DPYNNYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E +LC DSFQSMYSQMLCGL   ++VLRVG +FAS  +RAI+FL+ HW+ L  DI +G
Sbjct  196   PNEAVLCADSFQSMYSQMLCGLLVREEVLRVGAIFASGLLRAINFLQVHWKQLAEDISSG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNPRIT+ SVRE + +I+KPNP+LAEFI KEC+KE+W+GII RIW NTKY+DV+VTGAM
Sbjct  256   TLNPRITEVSVRECIGKILKPNPELAEFIAKECSKENWEGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL Y+   LP+  T Y SSEC F +NL P+ KP+EV+YTI+P MAYFEFLP    
Sbjct  316   AQYIPTLEYYSGGLPMACTMYASSECYFGLNLKPMCKPSEVSYTIMPNMAYFEFLPHQPS  375

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
                   +P  ++DL DV++G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF F+ RK
Sbjct  376   GAFSRDSPPRLVDLADVEVGKEYELVITTYAGLYRYRVGDILRVTGFYNSAPQFRFIRRK  435

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEI-TQS  595
             NV LSID+DKTDE EL  A++NAS +L  F+ S++EYTS+A+T+TIPGHYV+YWE+  + 
Sbjct  436   NVLLSIDSDKTDEAELQKAIENASFLLKEFNTSVVEYTSYADTNTIPGHYVIYWELMVKD  495

Query  594   SENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
             + N     +   CC A+EESLNSVYR+ RV+D SIGPLEIR+V+NGTF+++MDYAI+ G+
Sbjct  496   TANSPTEEVLNQCCLAMEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAISRGA  555

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             SI+QYK PRCV+  PI+ELLDSRV+S +FSP  P W P  +H
Sbjct  556   SINQYKVPRCVSFTPIMELLDSRVVSKHFSPSLPHWTPERRH  597



>ref|NP_001044467.1| Os01g0785400 [Oryza sativa Japonica Group]
 sp|Q8LQM5.1|GH31_ORYSJ RecName: Full=Probable indole-3-acetic acid-amido synthetase 
GH3.1; AltName: Full=Auxin-responsive GH3-like protein 1; Short=OsGH3-1 
[Oryza sativa Japonica Group]
 dbj|BAB92590.1| putative auxin-regulated protein GH3 [Oryza sativa Japonica Group]
 dbj|BAF06381.1| Os01g0785400 [Oryza sativa Japonica Group]
 gb|EAZ13782.1| hypothetical protein OsJ_03707 [Oryza sativa Japonica Group]
 dbj|BAG88666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=610

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/585 (61%), Positives = 447/585 (76%), Gaps = 3/585 (1%)
 Frame = -1

Query  2028  SNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDR-ETFKKLIPVVT  1852
             ++   L+FIE VT NAGQVQ RVL  IL+ NA  EYL R+G+ GS D  + F++L+P+VT
Sbjct  19    AHAEALEFIEHVTANAGQVQRRVLGEILAQNAPAEYLRRYGIPGSPDVVDAFRRLVPLVT  78

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YE ++PDI R+ANG+ S I    PISEF TSSGTS GE KL+PT  +E+ R+SL  SLLM
Sbjct  79    YEGLQPDILRIANGDTSPIFSGKPISEFLTSSGTSGGERKLMPTIADEMNRRSLLYSLLM  138

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV++Q V  L KGK MY LFV+ E++TPGGL ARPVLTS  +   F  R   +PYT  TS
Sbjct  139   PVMSQSVSGLDKGKAMYLLFVKAESRTPGGLAARPVLTSYYRSRQFLDRP-RDPYTSYTS  197

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DS+QSMY+Q+LCGL +   VLRVG +FAS F+RAIHFLEKHW  LCHDIRTG
Sbjct  198   PDEAILCVDSYQSMYAQLLCGLVHRADVLRVGAVFASGFLRAIHFLEKHWARLCHDIRTG  257

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
              L+P ITD  VR+AV R+++ +P LA+ IE EC + SW+GII R+W  TKYIDV+VTG M
Sbjct  258   ELDPEITDRVVRDAVGRVLRADPALADAIEDECARASWEGIIRRLWPRTKYIDVIVTGTM  317

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             SQYIPTL ++G  LPL  T Y SSEC F +NLNP+ KP++VAYT+IPTM Y+EFLPV+  
Sbjct  318   SQYIPTLEFYGGGLPLTCTMYASSECYFGLNLNPMCKPSDVAYTLIPTMCYYEFLPVNCN  377

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
                 E +  +++DLVDVKLG EYE+VVTTY+GLYRYRVGD+LRVAGFKN  P F+FV R+
Sbjct  378   NATAEASHRDLVDLVDVKLGHEYELVVTTYSGLYRYRVGDVLRVAGFKNKAPMFSFVRRQ  437

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQSS  592
             NVALS+D+DKTDE ELH AV  A   L PF ASL+EYTS+A+ +TIPGHYVL+WE+ ++ 
Sbjct  438   NVALSVDSDKTDETELHAAVSGAVQHLAPFGASLVEYTSYADAATIPGHYVLFWEL-RAG  496

Query  591   ENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGSS  412
                +P  +FE+CC +VEE+LNSVYR+ R  D+SIGPLEIR+V  GTFDK+MDYAI+ G+S
Sbjct  497   STAVPASVFEECCLSVEEALNSVYRQGRACDRSIGPLEIRVVAEGTFDKLMDYAISRGAS  556

Query  411   ISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             I+QYK PRCV   P+VELLD+RV   YFSPK P+W+PG+K WN +
Sbjct  557   INQYKAPRCVRPGPVVELLDARVQGKYFSPKCPKWSPGNKQWNKS  601



>ref|XP_008674951.1| PREDICTED: LOW QUALITY PROTEIN: probable indole-3-acetic acid-amido 
synthetase GH3.1 [Zea mays]
Length=608

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/587 (61%), Positives = 450/587 (77%), Gaps = 5/587 (1%)
 Frame = -1

Query  2028  SNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGL-NGSTDR-ETFKKLIPVV  1855
             ++   L+FIE VT NAG+VQ RVL  ILS NA  EYL R+G+  GS D  E F++++P+V
Sbjct  20    AHREALEFIEHVTANAGKVQRRVLAEILSQNAPAEYLRRYGVPGGSADAVEAFRRVVPLV  79

Query  1854  TYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLL  1675
             TYE ++PDI R+ANG+ S I+   PISEF TSSGTS GE KL+PT  +EL+R+SL  SL 
Sbjct  80    TYEGLQPDILRIANGDASPILSGKPISEFLTSSGTSGGERKLMPTIADELDRRSLLYSLQ  139

Query  1674  MPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCT  1495
             MPV++Q VP L KGK MY LFV+ E++TPGGL+ARPVLTS  +   F +R + +PYT+ T
Sbjct  140   MPVMSQSVPGLDKGKAMYLLFVKAESRTPGGLVARPVLTSYYRSRQFLERPH-DPYTEYT  198

Query  1494  SPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRT  1315
             SP E ILC DS+QSMY+Q+LCGL +   VLRVG +FAS F+RAI FLEKHW  LC DIRT
Sbjct  199   SPNEAILCVDSYQSMYAQLLCGLVHRADVLRVGAVFASGFLRAIRFLEKHWPRLCRDIRT  258

Query  1314  GTLNPRITDPSVREAVARIVK-PNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             GTL+P ITD +VR+AVAR+++  +P LA+ IE  C   SW+ II R+W  T+Y+DV+VTG
Sbjct  259   GTLDPEITDRAVRDAVARVLRGADPALADEIEAVCGGSSWESIIRRLWPRTRYVDVIVTG  318

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
             AMSQYIPTL ++G  LPL  T Y SSEC F +NLNP+ KP +VAYT+IPTM YFEFLP+ 
Sbjct  319   AMSQYIPTLEFYGGGLPLACTMYASSECYFGLNLNPMCKPGDVAYTLIPTMCYFEFLPLQ  378

Query  957   REIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVC  778
                G  EP+  +++ LVDVKLG EYE+VVTTY+GLYRYRVGD+LRVAGFKN  P F FV 
Sbjct  379   CSNGKAEPSHRDLVGLVDVKLGHEYELVVTTYSGLYRYRVGDVLRVAGFKNEAPMFKFVR  438

Query  777   RKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQ  598
             R+NVALS+D+DKTDE ELH AV  A   L PF ASL+EYTS+A+ +TIPGHYVL+WE+  
Sbjct  439   RQNVALSVDSDKTDETELHAAVSGAVQHLAPFGASLVEYTSYADAATIPGHYVLFWELRA  498

Query  597   SSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASG  418
              S   +P  +FEDCC +VEE LNSVYR+CR  DKSIGPLEIR+V  GTFDK+MDYAI+ G
Sbjct  499   GS-TAVPASVFEDCCLSVEEELNSVYRQCRACDKSIGPLEIRVVSEGTFDKLMDYAISRG  557

Query  417   SSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             +SI+QYK PRCV   P+VELLD+RV + YFSPK P+W+PG+K WN +
Sbjct  558   ASINQYKAPRCVRPGPVVELLDARVQAKYFSPKCPKWSPGNKQWNAS  604



>ref|XP_009611719.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Nicotiana 
tomentosiformis]
Length=617

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/597 (61%), Positives = 451/597 (76%), Gaps = 11/597 (2%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
              + E   + L+FIE+VT+N  +VQ RVL  ILS NA VEYL RH LNGSTDRETFKK++P
Sbjct  18    GMAEEIKKNLEFIEEVTSNVDEVQCRVLAEILSQNAHVEYLQRHNLNGSTDRETFKKVLP  77

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLY-S  1684
             V+TYED++PDI R+A G+ S I+CS  ISE FTSSGTS GE+KLIPT E E ER+S+   
Sbjct  78    VITYEDIQPDIKRIAYGDKSPILCSKTISELFTSSGTSGGESKLIPTVEGEFERRSVQIQ  137

Query  1683  SLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYT  1504
             +LLM V++Q  PD  KGK MYF+F++ E KTPGGL A    TS+    +F      +P+ 
Sbjct  138   NLLMSVMSQVDPDFGKGKGMYFMFIKSEEKTPGGLPAVFGSTSIYTSPHFNYSRLHHPHF  197

Query  1503  DCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHD  1324
             + TSP  TILC+DS+QSMYSQMLCGL    +VLRVG++F S FI AI FLEKHW LLC+D
Sbjct  198   NYTSPTATILCSDSYQSMYSQMLCGLCQNQEVLRVGSLFPSGFISAIRFLEKHWSLLCND  257

Query  1323  IRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVV  1144
             IRTGTLN +IT+PSVREAV  I+KP+P LA FIE EC+K+SW+GII R+W NTKY++ +V
Sbjct  258   IRTGTLNTQITNPSVREAVMEILKPDPKLANFIEAECSKDSWQGIITRLWPNTKYVETIV  317

Query  1143  TGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLP  964
             TG MSQYIPTL+Y+ N LPLVST Y SSEC   INLNP  +PTEV+YT+IPTM YFEFLP
Sbjct  318   TGFMSQYIPTLDYYSNSLPLVSTMYASSECHLGINLNPFCQPTEVSYTLIPTMCYFEFLP  377

Query  963   VSREIGV----------PEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAG  814
                  GV           E    +++DL DVK+GQEYE+VVTTY+GLYRYRVGD+LRVAG
Sbjct  378   YHGNSGVIDSIVLPKSLNEKEQQQLVDLADVKIGQEYELVVTTYSGLYRYRVGDVLRVAG  437

Query  813   FKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTI  634
             +KNN PQFNF+CR+NV LSI AD T+EVEL NAV+NA   L+PFDA L EYTS+ + +TI
Sbjct  438   YKNNAPQFNFLCRENVILSIGADYTNEVELQNAVRNAVGNLMPFDAHLTEYTSYVDFTTI  497

Query  633   PGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGT  454
             P HYVL+WE++ +    IP  +FE CC  +EESLN  YRE R S+KSIGPLEIR+VE GT
Sbjct  498   PSHYVLFWELSLNGSISIPPSVFEVCCLTIEESLNYFYREGRSSEKSIGPLEIRVVETGT  557

Query  453   FDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
             FDK MDY I+ G+S++QYK P CV  AP +E+L+SRV+S+YFSP  P+W PG+K WN
Sbjct  558   FDKFMDYRISLGASMNQYKTPLCVKYAPFIEILNSRVVSSYFSPMCPKWVPGYKKWN  614



>ref|XP_002456458.1| hypothetical protein SORBIDRAFT_03g036680 [Sorghum bicolor]
 gb|EES01578.1| hypothetical protein SORBIDRAFT_03g036680 [Sorghum bicolor]
Length=610

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/592 (61%), Positives = 453/592 (77%), Gaps = 6/592 (1%)
 Frame = -1

Query  2028  SNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGL-NGSTDR-ETFKKLIPVV  1855
             ++   L+FIE VT NAG+VQ RVL  IL+ NA  EYL R+G+  GS D  E F++++P+V
Sbjct  20    AHREALEFIEHVTANAGKVQRRVLAEILTQNAPAEYLRRYGVPGGSADAVEAFRRVVPLV  79

Query  1854  TYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLL  1675
             TYE ++PDI R+A+G+ S I+   PISEF TSSGTS GE KL+PT  +EL+R+SL  SL 
Sbjct  80    TYEGLQPDILRIASGDTSPILSGKPISEFLTSSGTSGGERKLMPTIADELDRRSLLYSLQ  139

Query  1674  MPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCT  1495
             MPV++Q VP L KGK MY LFV+ E++TPGGL+ARPVLTS  +   F +R + +PYT+ T
Sbjct  140   MPVMSQSVPGLDKGKAMYLLFVKAESRTPGGLVARPVLTSYYRSRQFLERPH-DPYTEYT  198

Query  1494  SPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRT  1315
             SP E ILC DS+QSMY+Q+LCGL +   VLRVG +FAS F+RA+ FLEKHW  LC DIRT
Sbjct  199   SPNEAILCVDSYQSMYTQLLCGLVHRADVLRVGAVFASGFLRAVRFLEKHWPRLCRDIRT  258

Query  1314  GTLNPRITDPSVREAV-ARIVK-PNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             GTL+P ITD +VR+AV  R+++  NP LA+ IE EC   SW+GII R+W  TKYIDV+VT
Sbjct  259   GTLDPEITDRAVRDAVVGRVLRGANPALADEIEAECAGPSWEGIIRRLWPRTKYIDVIVT  318

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             GAMSQYIPTL ++G  LPL  T Y SSEC F +NL P+ KP +VAYT+IPTM YFEFLP+
Sbjct  319   GAMSQYIPTLEFYGGGLPLACTMYASSECYFGLNLKPMCKPGDVAYTLIPTMCYFEFLPL  378

Query  960   SREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFV  781
                 G  EP+  +++ LVDVKLG EYE+VVTTY+GLYRYRVGD+LRVAGFKN  P F F+
Sbjct  379   QCSDGKAEPSHRDLVGLVDVKLGHEYELVVTTYSGLYRYRVGDVLRVAGFKNEAPMFKFI  438

Query  780   CRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEIT  601
              R+NVALSID+DKTDE ELH AV  A   L PF ASL+EYTS+A+ +TIPGHYVL+WE+ 
Sbjct  439   RRQNVALSIDSDKTDETELHAAVSGAVQHLAPFGASLVEYTSYADAATIPGHYVLFWEL-  497

Query  600   QSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIAS  421
             ++    +P  +FEDCC +VEE+LNSVYR+CR  DKSIGPLEIR+V  GTFDK+MDYAI+ 
Sbjct  498   RAGSTAVPASVFEDCCLSVEEALNSVYRQCRACDKSIGPLEIRVVSEGTFDKLMDYAISR  557

Query  420   GSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN*NQN  265
             G+SI+QYK PRCV   P+VELLD+RV + YFSPK P+W+PG+K WN   N +
Sbjct  558   GASINQYKAPRCVRPGPVVELLDARVQAKYFSPKCPKWSPGNKQWNAASNGD  609



>ref|XP_004230721.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Solanum lycopersicum]
Length=597

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/582 (62%), Positives = 452/582 (78%), Gaps = 2/582 (0%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T NA  VQ+RVL  IL+ N+  EYL R  L+G TDRETFK +IPVVT
Sbjct  17    EKDAKALQFIEEMTRNADAVQQRVLDEILTRNSQTEYLKRFKLDGVTDRETFKSIIPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLF++ E KTPGGLLARPVLTS  K  +FK R + +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFIKSETKTPGGLLARPVLTSYYKSEHFKSRPH-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P ETILC+DSFQSMY+QMLCGL+  +QVLR+G +FAS  +RAI FL+ HW  L HDIRTG
Sbjct  196   PNETILCSDSFQSMYTQMLCGLYEREQVLRLGAVFASGLVRAIRFLQLHWEELAHDIRTG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNP+IT+PSV E + +I+KPNP+LA+F+  EC KE+W+GII RIW  TKY+DV+VTGAM
Sbjct  256   TLNPQITNPSVCERMGKIIKPNPELADFVANECCKENWEGIITRIWPKTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+Y+   LP   T Y +SEC F +NLNP+ KP+EV+YTI+P M YFEFLP    
Sbjct  316   AQYIPTLDYYSGGLPKACTMYAASECYFGLNLNPMCKPSEVSYTIMPNMGYFEFLPHDPT  375

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
                   +P  ++DLVDV++G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV RK
Sbjct  376   STTTTSSPTNLVDLVDVEVGKEYELVITTYAGLYRYRVGDILRVTGFHNSAPQFHFVRRK  435

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQSS  592
             NV LSID+DKTDE EL  AV+NAS +L  F+ S++EYTS+A+T TIPGHYV+YWE+    
Sbjct  436   NVLLSIDSDKTDEAELQGAVENASKLLREFNTSVVEYTSYADTKTIPGHYVIYWELLMKD  495

Query  591   ENPIPR-YIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
              N  P   +   CC A+EESLN+VYR+ RV+  SIGPLEIR+V+NGTF+++MDYAI+ G+
Sbjct  496   LNNSPSDEVLNQCCLAMEESLNTVYRQGRVACNSIGPLEIRVVKNGTFEELMDYAISRGA  555

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             SI+QYK PRCV  API+ELLDSRVMS +FSP  P+W P  + 
Sbjct  556   SINQYKVPRCVNFAPILELLDSRVMSRHFSPSLPQWTPERRR  597



>emb|CAJ14972.1| auxin-induced GH3 protein [Pinus pinaster]
Length=615

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/591 (60%), Positives = 450/591 (76%), Gaps = 10/591 (2%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E N + L FIE  T +A +VQ  VL  IL+ NA  EYL R+ L G TDR++FK+ +PV+T
Sbjct  23    ERNRKALDFIEHATIHAAEVQAEVLLEILTRNAYTEYLERYQLTGRTDRKSFKERLPVIT  82

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ + PISEF TSSGTS GE K++PT  EEL+R++L  SLLM
Sbjct  83    YEDLQPEILRIANGDMSPILSAHPISEFLTSSGTSAGERKIMPTIHEELKRRTLLYSLLM  142

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+NQ++  L KGK MYFLFV+ E +TPGGLLARPVLTS  K   F +R Y +PY   TS
Sbjct  143   PVMNQYMKGLDKGKGMYFLFVKSETRTPGGLLARPVLTSYYKSQDFIERPY-DPYNVYTS  201

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC+DS+QSMY Q+LCGL    +VLRVG +FAS  +RAI FLE+HW+ LC DIR+G
Sbjct  202   PMEAILCSDSYQSMYCQLLCGLAQNHEVLRVGAVFASGLLRAIRFLEEHWQSLCQDIRSG  261

Query  1311  TLN-PRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGA  1135
             T+N   +TDP +RE+V +I+ PN  LA+ I  EC+KESW+GII R+W N +Y+DV+VTGA
Sbjct  262   TVNDEEVTDPCLRESVMKILHPNTQLADLIRTECSKESWQGIITRLWPNARYLDVIVTGA  321

Query  1134  MSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSR  955
             M+QYI TL+++   LP V T Y SSEC F INL PL +P EV+YT++P MA+FEFLPV R
Sbjct  322   MAQYIKTLDFYSGGLPQVCTMYASSECYFGINLKPLCQPWEVSYTLMPNMAFFEFLPVYR  381

Query  954   E-------IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTP  796
                     +      P E++DLVDVK+GQEYE+V+TTY+GLYRYRVGD+LRV GF N  P
Sbjct  382   NKNEDAGPVTTATEQPAELVDLVDVKVGQEYELVITTYSGLYRYRVGDVLRVTGFHNAAP  441

Query  795   QFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVL  616
             QF FVCRKNV LSIDADKTDE ELHNAV NA   L P +A+L+EYTS+ +TSTIPGHYVL
Sbjct  442   QFQFVCRKNVMLSIDADKTDEAELHNAVMNAVKHLEPLEATLVEYTSYTDTSTIPGHYVL  501

Query  615   YWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMD  436
             YWE+ ++S  P+P  +FEDCC  VEESLNSVYR+CRV+DKSIGPLEI++VE GTFDK+MD
Sbjct  502   YWEL-RTSALPVPPSVFEDCCLTVEESLNSVYRQCRVADKSIGPLEIKVVEMGTFDKLMD  560

Query  435   YAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
             YAI+ GSSI+QYK  RCV  AP+V++L+SRV ++YFSP+ P+W  G   W 
Sbjct  561   YAISRGSSINQYKAARCVKFAPMVDILNSRVSASYFSPRCPKWTAGRTQWG  611



>emb|CDM84494.1| unnamed protein product [Triticum aestivum]
Length=613

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/588 (60%), Positives = 453/588 (77%), Gaps = 6/588 (1%)
 Frame = -1

Query  2028  SNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDR----ETFKKLIP  1861
             ++   L FIE VT NAG+VQ+RVL  IL+ NA  EYL R+G++ S+      + F++ +P
Sbjct  19    AHREALDFIEHVTANAGKVQQRVLAEILAQNATAEYLRRYGVSVSSSPLDAVDAFRRCVP  78

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             +VTYED++PDI R+ANG+ S I+   PISEF TSSGTS GE KL+PT  +EL+R+SL  S
Sbjct  79    LVTYEDLQPDILRIANGDTSPILSGKPISEFLTSSGTSGGERKLMPTIADELDRRSLLYS  138

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             LLMPV++Q +P L KGK MY LFV+ E++TPGGL ARPVLTS  +   F  R + +PYT 
Sbjct  139   LLMPVMSQSLPGLDKGKAMYLLFVKAESRTPGGLAARPVLTSYYRSRQFLDRPH-DPYTA  197

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP + ILC DS+QSMY+Q+LCGL +   VLRVG +FAS  +RAI FLEKHW  LCHDI
Sbjct  198   YTSPNKAILCVDSYQSMYAQLLCGLVHRTDVLRVGAVFASGLLRAIRFLEKHWPRLCHDI  257

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
             RTG L+P ITD +VR+AV R++  NP LA  IE EC+K SW+GII R+W  TKYIDV+VT
Sbjct  258   RTGELDPEITDHAVRDAVGRLLHANPALASEIEAECSKPSWEGIIRRLWPRTKYIDVIVT  317

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             GAMSQYI TL ++G  LPL+ T Y SSEC F +NLNP+ KP +VAYT+IPTM +FEFLPV
Sbjct  318   GAMSQYIQTLEFYGGGLPLICTMYASSECYFGLNLNPMCKPGDVAYTLIPTMCHFEFLPV  377

Query  960   SREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFV  781
                    EP+  +++DLVDVKLG +YE+VVTT++GL RYRVGD+LRVAGFKN  P F+FV
Sbjct  378   HCSNANAEPSHRDLVDLVDVKLGHDYELVVTTFSGLCRYRVGDVLRVAGFKNEAPMFSFV  437

Query  780   CRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEIT  601
              R+NVALSID+DKTDE ELH AV +A   L PF ASL+EYTS+A+T+ IPGHYVL+WE+ 
Sbjct  438   RRRNVALSIDSDKTDETELHTAVSSAVQHLAPFGASLVEYTSYADTAAIPGHYVLFWELR  497

Query  600   QSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIAS  421
             + S   +P  +FE+CC +VEE+LNSVYR+CR  D+SIGPLEIR+V  GTF+K+MDYA++ 
Sbjct  498   EGS-TAVPASVFEECCLSVEEALNSVYRQCRACDRSIGPLEIRVVSEGTFEKLMDYALSQ  556

Query  420   GSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             G+SI+QYK PRCV   P+VELLD+R+ ++YFSPK P+W+PG+K WNT+
Sbjct  557   GASINQYKAPRCVRPGPVVELLDARMQASYFSPKCPKWSPGNKQWNTS  604



>ref|XP_011088186.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Sesamum indicum]
Length=598

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/583 (61%), Positives = 452/583 (78%), Gaps = 3/583 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T NA  VQE VL  ILS NA  EYL R+ LNG+TDRETFK  IP+VT
Sbjct  17    EKDAKALQFIEEMTRNADSVQENVLSQILSRNAQTEYLQRYNLNGATDRETFKSKIPMVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P I R+ANG+ S I+ + P+SEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPLIQRIANGDRSPILSAHPVSEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +V  L KGK +YFLF++ E +TPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  137   PVMNLYVKGLDKGKGLYFLFIKSETQTPGGLLARPVLTSYYKSDHFKTRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL+   QVLRVG +FAS  +RAI FL+ +W+ L  DIRTG
Sbjct  196   PNEAILCPDSFQSMYTQMLCGLYERKQVLRVGAVFASGLLRAIRFLQLNWQQLAEDIRTG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             +LNP++TD S+RE + R+V+P+P+LA+FI KEC+K++W+ II RIW NTKY+DV+VTGAM
Sbjct  256   SLNPKVTDQSIRECMTRVVRPDPELADFIAKECSKDNWERIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS-R  955
             +QYIPTL+Y+   LP   T Y SSEC F +NLNP+ KP+EV+YTI+P MAYFEFLP    
Sbjct  316   AQYIPTLDYYSGGLPKACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMAYFEFLPHEPN  375

Query  954   EIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCR  775
               G    +P  ++DL DV++G+EYE+V+TTYAGL RYRVGDILRV GF N+ PQF FV R
Sbjct  376   STGSTRDSPPGLVDLADVEIGKEYELVITTYAGLCRYRVGDILRVTGFHNSAPQFQFVRR  435

Query  774   KNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-ITQ  598
             KNV LSID+DKTDE EL  AV+NAS +L  F+ S++EYTS+A+T TIPGHYV+YWE + +
Sbjct  436   KNVLLSIDSDKTDEAELQAAVENASRLLREFNTSVVEYTSYADTKTIPGHYVIYWELLGK  495

Query  597   SSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASG  418
              S N     + E CC A+EESLNSVYR+CRV+D SIGPLEIR+V NGTF+++MDYAI+ G
Sbjct  496   DSGNSPSDQVLEQCCLAMEESLNSVYRQCRVADNSIGPLEIRVVRNGTFEELMDYAISRG  555

Query  417   SSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             +SI+QYK PRCV+  PI+ELLDSRV+S++FSP  P+W P  + 
Sbjct  556   ASINQYKVPRCVSFTPIMELLDSRVVSSHFSPSLPQWTPERRR  598



>ref|XP_007208307.1| hypothetical protein PRUPE_ppa003126mg [Prunus persica]
 gb|EMJ09506.1| hypothetical protein PRUPE_ppa003126mg [Prunus persica]
Length=601

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/585 (61%), Positives = 449/585 (77%), Gaps = 8/585 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE+ T N   VQERVL  ILS NA  EYL R GL G+TDR+TFK  +PVVT
Sbjct  19    EKDAKALQFIEETTRNTDSVQERVLSEILSRNAETEYLKRFGLLGATDRDTFKSKVPVVT  78

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ S PISEF TSSGTS GE KL+PT  EEL+R++L  SLLM
Sbjct  79    YEDLQPEIQRIANGDRSLILSSHPISEFLTSSGTSAGERKLMPTIHEELDRRTLLYSLLM  138

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VPDL KGK +YFLFV+ E+KTPGGL+ARPVLTS  K  +FK R Y +PY D TS
Sbjct  139   PVMNLYVPDLDKGKGLYFLFVKAESKTPGGLVARPVLTSYYKSEHFKTRPY-DPYNDYTS  197

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QM+CGL    QVLRVG +FAS  +RAI FL+ +WR L HDI  G
Sbjct  198   PNEAILCADSFQSMYTQMVCGLVMRHQVLRVGAVFASGLLRAIRFLQLNWRQLAHDIHNG  257

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNP+ITDPS+RE+++  +KP+P+L+ FI KEC +E+W+GIIPRIW NTKY+DV+VTGAM
Sbjct  258   TLNPKITDPSLRESMSGTLKPDPELSSFITKECCEENWEGIIPRIWPNTKYLDVIVTGAM  317

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+Y+ N LPL  T Y SSEC F +NL P+ KP+EV+YTI+P MAYFEF+P   +
Sbjct  318   AQYIPTLDYYSNGLPLACTMYASSECYFGLNLKPMCKPSEVSYTIMPNMAYFEFIP--HD  375

Query  951   IGVP---EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFV  781
                P   + +P  ++DL DV++G+EYE+V+TTYAGL RYRVGDIL V GF N  PQF FV
Sbjct  376   PSAPPLSKLSPPHLVDLADVEVGKEYELVITTYAGLCRYRVGDILEVTGFHNAAPQFRFV  435

Query  780   CRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE--  607
              RKNV LSID+DKTDE EL  A+ NAS +L  F+ S++EYTS A+T TIPGHYV+YWE  
Sbjct  436   RRKNVLLSIDSDKTDEAELQKAIDNASVLLREFNTSVVEYTSFADTKTIPGHYVIYWELL  495

Query  606   ITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAI  427
             +   + N     + + CC A+EESLNSVYR+ RV+D SIGPLEIR+V+NGTF+++MDYAI
Sbjct  496   VKDPANNSPSHEVLDKCCLAMEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAI  555

Query  426   ASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             + G+SI+QYK PRCV  +PI+ELLDSRV S +FSP  P W P  +
Sbjct  556   SRGASINQYKAPRCVNFSPIMELLDSRVFSVHFSPSAPHWTPERR  600



>ref|XP_011001484.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Populus euphratica]
Length=596

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/582 (61%), Positives = 447/582 (77%), Gaps = 3/582 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQF+E++T NA  VQE VL  IL+ N+ VEYL R  L+G+ DR+TFK  IP++ 
Sbjct  17    EKDAKALQFLEEMTRNADSVQEDVLAKILTQNSEVEYLKRFNLDGAIDRDTFKSKIPMIR  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ SSI+ + PISEF TSSGTS GE KL+PT ++EL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSSILSAHPISEFLTSSGTSAGERKLMPTIKQELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E +TPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETRTPGGLLARPVLTSYYKSDHFKTRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL   +QVLRVG +FAS  +RAI FL+ HWR L  DI +G
Sbjct  196   PNEAILCADSFQSMYTQMLCGLLEREQVLRVGAVFASGLLRAIRFLQLHWRELSDDIESG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
              LN +ITDP+V++ +  I+KPNP LAEF+  EC KE+W+GII RIW NTKY+DV+VTGAM
Sbjct  256   MLNKKITDPTVKDCMVNILKPNPKLAEFVRMECGKENWEGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+Y+   LP   T Y SSEC F +NLNP+ KP+EV YTI+P MAYFEFLP    
Sbjct  316   AQYIPTLDYYSGGLPKACTMYASSECYFGLNLNPMCKPSEVCYTIMPNMAYFEFLP-HEP  374

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
              G+ + +   ++DL DV+LG+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV RK
Sbjct  375   AGISQDSTPTLVDLADVELGKEYELVITTYAGLYRYRVGDILRVTGFHNSAPQFHFVRRK  434

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-ITQS  595
             NV LSID+DKTDE EL  AV+NAS +L  F+ S++EYTSHA+T TIPGHYV+YWE + + 
Sbjct  435   NVLLSIDSDKTDEAELQKAVENASQLLREFNTSVVEYTSHADTKTIPGHYVIYWELLVKD  494

Query  594   SENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
             S N     +   CC A+EESLNSVYR+ RV+D SIGPLEIR+V+NGTF+++MDYAI+ G+
Sbjct  495   SANSPGDEVLNQCCLAMEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAISRGA  554

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             SI+QYK PRCV   PI+ELLDSRV+S +FSP  P WAP  + 
Sbjct  555   SINQYKVPRCVNFTPIMELLDSRVVSKHFSPALPRWAPERRR  596



>ref|XP_008238544.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Prunus mume]
Length=599

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/598 (60%), Positives = 455/598 (76%), Gaps = 8/598 (1%)
 Frame = -1

Query  2070  DALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGST  1891
             D++ SS       E + + LQFIE+ T N   +QERVL  ILS NA  EYL R GL G+T
Sbjct  4     DSVTSSPPAPPASEKDAKALQFIEETTRNTDSLQERVLSEILSRNAETEYLKRFGLRGAT  63

Query  1890  DRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEE  1711
             DR+TFK  +PVVTYED++P+I R+ANG+ S I+ S PISEF TSSGTS GE KL+PT  E
Sbjct  64    DRDTFKSKVPVVTYEDLQPEIQRIANGDRSLILSSHPISEFLTSSGTSAGERKLMPTIHE  123

Query  1710  ELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFK  1531
             EL+R++L  SLLMPV+N +VPDL KGK +YFLFV+ E++TPGGL+ARPVLTS  K  +FK
Sbjct  124   ELDRRTLLYSLLMPVMNLYVPDLDKGKGLYFLFVKAESRTPGGLVARPVLTSYYKSEHFK  183

Query  1530  KRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLE  1351
              R Y +PY D TSP E ILC DSFQSMY+QM+CGL    QVLRVG +FAS  +RAI FL+
Sbjct  184   TRPY-DPYNDYTSPNEAILCPDSFQSMYTQMVCGLVMRHQVLRVGAVFASGLLRAIRFLQ  242

Query  1350  KHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWR  1171
              +WR L HDI  GTLNP+ITDPS+RE+++  +KP+P+L+ FI KEC +E+W+GIIPRIW 
Sbjct  243   LNWRQLAHDIHNGTLNPKITDPSLRESLSGTLKPDPELSSFITKECCEENWEGIIPRIWP  302

Query  1170  NTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIP  991
             NTKY+DV+VTGAM+QYIPTL+Y+ N LPL  T Y SSEC F +NL P+ KP+EV+YTI+P
Sbjct  303   NTKYLDVIVTGAMAQYIPTLDYYSNGLPLACTMYASSECYFGLNLKPMCKPSEVSYTIMP  362

Query  990   TMAYFEFLPVSREIGVP---EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRV  820
              MAYFEF+P   +   P   + +P  ++DL DV++G+EYE+V+TTYAGL RYRVGDIL V
Sbjct  363   NMAYFEFIP--HDPSAPPLSKHSPPRLVDLADVEVGKEYELVITTYAGLCRYRVGDILEV  420

Query  819   AGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTS  640
              GF N  PQF FV RKNV LSID+DKTDE EL  A+ NAS +L  F+ S++EYTS A+T 
Sbjct  421   TGFHNAAPQFRFVRRKNVLLSIDSDKTDEAELQKAIDNASVLLREFNTSVVEYTSFADTK  480

Query  639   TIPGHYVLYWE--ITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIV  466
             TIPGHYV+YWE  +   + N     + + CC A+EESLNSVYR+ RV+D SIGPLEIR+V
Sbjct  481   TIPGHYVIYWELLVKDPANNSPSHEVLDKCCLAMEESLNSVYRQGRVADNSIGPLEIRVV  540

Query  465   ENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             +NGTF+++MDYAI+ G+SI+QYK PRCV  +PI+ELLDSRV+S +FSP  P W P  +
Sbjct  541   KNGTFEELMDYAISRGASINQYKAPRCVNFSPIMELLDSRVVSVHFSPSAPHWTPERR  598



>gb|AAD32141.1|AF123503_1 Nt-gh3 deduced protein [Nicotiana tabacum]
Length=595

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/582 (61%), Positives = 450/582 (77%), Gaps = 4/582 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T NA  VQERVL  IL+ N+  EYL R  L+G +DRETFK  IPVVT
Sbjct  17    EKDAKALQFIEEMTRNADAVQERVLNEILTRNSQTEYLKRFKLDGVSDRETFKNKIPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLF++ E KTPGGLLARPVLTS  K  +FK+R + +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFIKSETKTPGGLLARPVLTSYYKSEHFKRRPH-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL+  +QVLR+G +FAS  +RAI FL+ HW  L HDIRTG
Sbjct  196   PNEAILCADSFQSMYTQMLCGLYEREQVLRLGAVFASGLVRAIRFLQLHWPQLAHDIRTG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNP ITDPS+ E +  +++PNP LA+F+  EC+KE+W+GII RIW  TKY+DV+VTGAM
Sbjct  256   TLNPEITDPSICERMGLVMRPNPKLADFVTDECSKENWEGIITRIWPKTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+Y+   LP   T Y +SEC F +NLNP+ KP+EV+YTI+P M YFEFLP   +
Sbjct  316   AQYIPTLDYYSGGLPKACTMYAASECYFGLNLNPMCKPSEVSYTIMPNMGYFEFLP--HD  373

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
                   +   ++DLVDV++G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV RK
Sbjct  374   PNSSRDSTRNLVDLVDVEVGKEYELVITTYAGLYRYRVGDILRVTGFHNSAPQFHFVRRK  433

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQSS  592
             NV LSID+DKTDE EL  AV+NAS +L  F+ S++EYTS+A+T TIPGHYV+YWE+    
Sbjct  434   NVLLSIDSDKTDEAELQRAVENASKLLKEFNTSVVEYTSYADTKTIPGHYVIYWELLMKD  493

Query  591   ENPIPR-YIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
              N  P   +   CC A+EESLN+VYR+ RV+  SIGPLEIR+V+NGTF+++MDYAI+ G+
Sbjct  494   LNNSPSDEVLNKCCLAMEESLNTVYRQGRVACNSIGPLEIRVVKNGTFEELMDYAISRGA  553

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             SI+QYK PRCV+ API+ELLDSRVMS +FSP  P+W P  +H
Sbjct  554   SINQYKVPRCVSFAPILELLDSRVMSRHFSPSLPQWTPERRH  595



>ref|XP_006644816.1| PREDICTED: LOW QUALITY PROTEIN: probable indole-3-acetic acid-amido 
synthetase GH3.1-like [Oryza brachyantha]
Length=611

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/586 (60%), Positives = 446/586 (76%), Gaps = 4/586 (1%)
 Frame = -1

Query  2028  SNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDR-ETFKKLIPVVT  1852
             ++   L+FIE VT NAGQVQ RVL  IL+ NA  EYL RHG+    D  + F++L+P+VT
Sbjct  19    AHAEALEFIEHVTANAGQVQRRVLGEILAQNAPAEYLRRHGIPACPDAVDAFRRLVPLVT  78

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YE ++PDI R+ANG+ S I+   PISEF TSSGTS GE KL+PT  +E+ R+SL  SLLM
Sbjct  79    YEGLQPDILRIANGDTSPILSGKPISEFLTSSGTSGGERKLMPTIADEMNRRSLLYSLLM  138

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV++Q VP L KGK MY LFV+ E++TPGGL ARPVLTS  +   F  R   +PYT  TS
Sbjct  139   PVMSQSVPGLDKGKAMYLLFVKAESRTPGGLAARPVLTSYYRSRQFLDRP-RDPYTAYTS  197

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DS+QSMY+Q+LCGL +   VLRVG +FAS F+RAIHFLEKHW  LCHDIRTG
Sbjct  198   PDEAILCVDSYQSMYAQLLCGLVHRADVLRVGAVFASGFLRAIHFLEKHWARLCHDIRTG  257

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
              L+P ITD +VR+AV R+++ +P LA+ IE+EC + SW+GII R+W  TKYIDV+VTG M
Sbjct  258   ELDPEITDRAVRDAVGRVLRADPALADAIEEECARASWEGIIRRLWPRTKYIDVIVTGTM  317

Query  1131  SQYIPTLNYFGNDLPL-VSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSR  955
             SQYIPTL ++G   P    T Y SSEC F +NLNP+ KP +VAYT+IPTM Y+EFLPV+ 
Sbjct  318   SQYIPTLEFYGGGPPRRACTMYASSECYFGLNLNPMCKPRDVAYTLIPTMCYYEFLPVNC  377

Query  954   EIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCR  775
                  EP+  +++DLVDVK+G EYE+VVTTY+GLYRYRVGD+LRVAGFKN  P F+FV R
Sbjct  378   SNSNAEPSHRDLVDLVDVKVGHEYELVVTTYSGLYRYRVGDVLRVAGFKNKAPMFSFVRR  437

Query  774   KNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQS  595
             +NVALS+D+DKTDE ELH AV  +   L PF ASL+EYTS+A+ + IPGHYVL+WE+   
Sbjct  438   QNVALSVDSDKTDETELHAAVSGSVQHLAPFGASLVEYTSYADAAAIPGHYVLFWELRAG  497

Query  594   SENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
             S   +P  +FE+CC +VEE+LNSVYR+ R  D+SIGPLEIR+V  GTFDK+MDYA++ G+
Sbjct  498   S-TAVPASVFEECCLSVEEALNSVYRQGRACDRSIGPLEIRVVAEGTFDKLMDYALSRGA  556

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             SI+QYK PRCV   P+V+LLD RV +NYFSPK P+W+PG+K WN +
Sbjct  557   SINQYKAPRCVRPGPVVDLLDDRVQANYFSPKCPKWSPGNKQWNKS  602



>ref|XP_007042570.1| Auxin-responsive GH3 family protein [Theobroma cacao]
 gb|EOX98401.1| Auxin-responsive GH3 family protein [Theobroma cacao]
Length=598

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/583 (61%), Positives = 453/583 (78%), Gaps = 3/583 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQF+E++T +   VQERVL  ILS N+  EYL R  LNG+TDR+TFK  +PV+T
Sbjct  17    EKDAKALQFVEEMTRSPYAVQERVLAEILSRNSQTEYLRRFKLNGATDRDTFKSKLPVIT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E +TPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETRTPGGLLARPVLTSYYKSEHFKTRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL    QVLRVG +FAS  +RAI FL+ +W+ L  DI TG
Sbjct  196   PNEAILCADSFQSMYTQMLCGLQERQQVLRVGAVFASGLLRAIRFLQLNWQQLTQDIETG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             +L+P+ITDPS+RE +A+I+K NP+LAEF+ +EC+K+SW+GII RIW NTKY+DV+VTGAM
Sbjct  256   SLSPKITDPSLRECMAKILKTNPELAEFVRQECSKDSWEGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS-R  955
             +QYIPTL+Y+   +PL  T Y SSEC F +NLNP+ KP+EV+YTI+P MAYFEFLP    
Sbjct  316   AQYIPTLDYYSGGVPLACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMAYFEFLPHEPN  375

Query  954   EIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCR  775
               G    +P +++DLVDV++G+EYE+V+TTYAGL RYRVGDILRV GF N+ PQF+FV R
Sbjct  376   SAGFTRDSPPKLVDLVDVEVGKEYELVITTYAGLCRYRVGDILRVTGFHNSAPQFHFVRR  435

Query  774   KNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-ITQ  598
             KNV LSIDADKTDE EL  AV+NAS +L  F+ S++EYTS+A+T TIPGHYV+YWE + +
Sbjct  436   KNVLLSIDADKTDEAELQKAVENASQLLREFNTSVVEYTSYADTKTIPGHYVIYWELLVK  495

Query  597   SSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASG  418
                N     + + CC A+EESLNSVYR+ RV+D SIGPLEIR+V++GTF+++MDYAI+ G
Sbjct  496   DLANSPSDEVLKQCCLAMEESLNSVYRQGRVADNSIGPLEIRVVKSGTFEELMDYAISRG  555

Query  417   SSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             +SI+QYK PRCV   PI+ELLDSRV+S +FSP  P W P  + 
Sbjct  556   ASINQYKVPRCVNFTPIMELLDSRVVSAHFSPALPHWTPERRR  598



>pdb|4B2G|A Chain A, Crystal Structure Of An Indole-3-acetic Acid Amido Synthase 
From Vitis Vinifera Involved In Auxin Homeostasis
 pdb|4B2G|B Chain B, Crystal Structure Of An Indole-3-acetic Acid Amido Synthase 
From Vitis Vinifera Involved In Auxin Homeostasis
Length=609

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/582 (61%), Positives = 448/582 (77%), Gaps = 3/582 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T NA  VQERVL  ILS N   EYL R  L GST RETFK  IPV+ 
Sbjct  17    EKDAKALQFIEEMTRNADSVQERVLAEILSRNGETEYLKRFKLEGSTVRETFKSKIPVIK  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S+I+ + PISEF TSSGTS GE KL+PT +EEL+R+ +  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSAILSAHPISEFLTSSGTSAGERKLMPTIQEELDRRQMLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E +TPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETRTPGGLLARPVLTSYYKSEHFKTRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCG++   QVLR+G +FAS  +RAI FL+ +W  L HDIRTG
Sbjct  196   PNEAILCADSFQSMYTQMLCGIYERKQVLRLGAVFASGLLRAIRFLQLNWHQLTHDIRTG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TL+P+ITDPSVR  VA ++KP+P+LA+ +  EC+K++W+GII RIW NTKY+DV+VTGAM
Sbjct  256   TLSPKITDPSVRNCVAGVLKPDPELADLVAGECSKDNWEGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSR-  955
             +QYIPTL+Y+   LPL  T Y SSEC F +NLNP+SKP+EV+YTI+P MAYFEFLP    
Sbjct  316   AQYIPTLDYYSGGLPLACTMYASSECYFGLNLNPMSKPSEVSYTIMPNMAYFEFLPHEHS  375

Query  954   EIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCR  775
              I +   +P  ++DL  V++G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV R
Sbjct  376   SIPLSRDSPPRLVDLAHVEVGKEYELVITTYAGLYRYRVGDILRVTGFHNSAPQFHFVRR  435

Query  774   KNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-ITQ  598
             KNV LSID+DKTDE EL  AV NAS +L   + S++EYTS A+T TIPGHYV+YWE + +
Sbjct  436   KNVLLSIDSDKTDEAELQKAVDNASKLLREVNTSVVEYTSFADTKTIPGHYVIYWELLVK  495

Query  597   SSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASG  418
              S N     +   CC A+EESLNSVYR+ RV+D SIGPLEIR+V++GTF+++MDYAI+ G
Sbjct  496   DSANSPSDELLGQCCLAMEESLNSVYRQGRVADNSIGPLEIRVVKSGTFEELMDYAISRG  555

Query  417   SSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             +SI+QYK PRCV   PI+ELLDSRV+S++FSP  P W P  +
Sbjct  556   ASINQYKVPRCVNFTPIMELLDSRVVSSHFSPALPHWTPARR  597



>ref|XP_002271252.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Vitis vinifera]
Length=598

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/582 (61%), Positives = 448/582 (77%), Gaps = 3/582 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T NA  VQERVL  ILS N   EYL R  L GST RETFK  IPV+ 
Sbjct  17    EKDAKALQFIEEMTRNADSVQERVLAEILSRNGETEYLKRFKLEGSTVRETFKSKIPVIK  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S+I+ + PISEF TSSGTS GE KL+PT +EEL+R+ +  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSAILSAHPISEFLTSSGTSAGERKLMPTIQEELDRRQMLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E +TPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETRTPGGLLARPVLTSYYKSEHFKTRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCG++   QVLR+G +FAS  +RAI FL+ +W  L HDIRTG
Sbjct  196   PNEAILCADSFQSMYTQMLCGIYERKQVLRLGAVFASGLLRAIRFLQLNWHQLTHDIRTG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TL+P+ITDPSVR  VA ++KP+P+LA+ +  EC+K++W+GII RIW NTKY+DV+VTGAM
Sbjct  256   TLSPKITDPSVRNCVAGVLKPDPELADLVAGECSKDNWEGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSR-  955
             +QYIPTL+Y+   LPL  T Y SSEC F +NLNP+SKP+EV+YTI+P MAYFEFLP    
Sbjct  316   AQYIPTLDYYSGGLPLACTMYASSECYFGLNLNPMSKPSEVSYTIMPNMAYFEFLPHEHS  375

Query  954   EIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCR  775
              I +   +P  ++DL  V++G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV R
Sbjct  376   SIPLSRDSPPRLVDLAHVEVGKEYELVITTYAGLYRYRVGDILRVTGFHNSAPQFHFVRR  435

Query  774   KNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-ITQ  598
             KNV LSID+DKTDE EL  AV NAS +L   + S++EYTS A+T TIPGHYV+YWE + +
Sbjct  436   KNVLLSIDSDKTDEAELQKAVDNASKLLREVNTSVVEYTSFADTKTIPGHYVIYWELLVK  495

Query  597   SSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASG  418
              S N     +   CC A+EESLNSVYR+ RV+D SIGPLEIR+V++GTF+++MDYAI+ G
Sbjct  496   DSANSPSDELLGQCCLAMEESLNSVYRQGRVADNSIGPLEIRVVKSGTFEELMDYAISRG  555

Query  417   SSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             +SI+QYK PRCV   PI+ELLDSRV+S++FSP  P W P  +
Sbjct  556   ASINQYKVPRCVNFTPIMELLDSRVVSSHFSPALPHWTPARR  597



>ref|XP_009772040.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Nicotiana sylvestris]
Length=595

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/582 (61%), Positives = 449/582 (77%), Gaps = 4/582 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T NA  VQERVL  IL+ N+  EYL R  L+G +DRE FK  IPVVT
Sbjct  17    EKDAKALQFIEEMTRNADAVQERVLNEILTRNSQTEYLKRFKLDGVSDREIFKNKIPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLF++ E KTPGGLLARPVLTS  K  +FK+R + +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFIKSETKTPGGLLARPVLTSYYKSEHFKRRPH-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL+  +QVLR+G +FAS  +RAI FL+ HW  L HDIRTG
Sbjct  196   PNEAILCADSFQSMYTQMLCGLYEREQVLRLGAVFASGLVRAIRFLQLHWPQLAHDIRTG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNP ITDPS+ E +  +++PNP LA+F+  EC+KE+W+GII RIW  TKY+DV+VTGAM
Sbjct  256   TLNPEITDPSICERMGLVMRPNPKLADFVTDECSKENWEGIITRIWPKTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+Y+   LP   T Y +SEC F +NLNP+ KP+EV+YTI+P M YFEFLP   +
Sbjct  316   AQYIPTLDYYSGGLPKACTMYAASECYFGLNLNPMCKPSEVSYTIMPNMGYFEFLP--HD  373

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
                   +   ++DLVDV++G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV RK
Sbjct  374   PNSSRDSTRNLVDLVDVEVGKEYELVITTYAGLYRYRVGDILRVTGFHNSAPQFHFVRRK  433

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQSS  592
             NV LSID+DKTDE EL  AV+NAS +L  F+ S++EYTS+A+T TIPGHYV+YWE+    
Sbjct  434   NVLLSIDSDKTDEAELQRAVENASKLLKEFNTSVVEYTSYADTKTIPGHYVIYWELLMKD  493

Query  591   ENPIPR-YIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
              N  P   +   CC A+EESLN+VYR+ RV+  SIGPLEIR+V+NGTF+++MDYAI+ G+
Sbjct  494   LNNSPSDEVLNKCCLAMEESLNTVYRQGRVACNSIGPLEIRVVKNGTFEELMDYAISRGA  553

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             SI+QYK PRCV+ API+ELLDSRVMS +FSP  P+W P  +H
Sbjct  554   SINQYKVPRCVSFAPILELLDSRVMSRHFSPSLPQWTPERRH  595



>ref|XP_006486962.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like 
[Citrus sinensis]
Length=599

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/585 (61%), Positives = 449/585 (77%), Gaps = 6/585 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + L+FIE++T NA  VQE+VL  ILS NA VEYL R+ L G+TDRETFK  +P++ 
Sbjct  17    EKDAKALRFIEEMTRNAEAVQEKVLAEILSRNADVEYLKRYKLGGATDRETFKSKLPIIK  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S+I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSAILSAHPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E +TPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKALYFLFVKSETRTPGGLLARPVLTSYYKSEHFKTRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY QMLCGL   +QVLR+G +FAS  +RAI FL+ HW+ L  DI +G
Sbjct  196   PNEAILCADSFQSMYVQMLCGLLEREQVLRLGAVFASGLLRAIRFLQLHWQALASDIESG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLN +ITDPS+++ + + +KPN +LAEFI  EC+KE+W+GII RIW NTKY+DV+VTGAM
Sbjct  256   TLNQKITDPSIKDCLGKTLKPNTELAEFIRMECSKENWEGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYF-GNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV--  961
             +QYIPTL+Y+ G  LP+  T Y SSEC F +NLNP+ +P+EV+YTI+P MAYFEFLP   
Sbjct  316   AQYIPTLDYYSGGKLPMACTMYASSECYFGLNLNPICRPSEVSYTIMPNMAYFEFLPHEP  375

Query  960   SREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFV  781
             S   G+   +P  V DLVDV++G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV
Sbjct  376   SDSFGLTSSDPQPV-DLVDVEMGKEYELVITTYAGLYRYRVGDILRVIGFHNSAPQFHFV  434

Query  780   CRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-I  604
              RKNV LSIDADKTDE EL NA+ NAS +L  F+ S+ EYTS+ANT TIPGHYV+YWE +
Sbjct  435   RRKNVLLSIDADKTDEAELQNAIDNASRLLREFNTSVGEYTSYANTKTIPGHYVIYWELL  494

Query  603   TQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIA  424
              + S N     +   CC A+EE LNSVYR+ RV+D SIGPLEIR+V NGTF+++MDYAI+
Sbjct  495   IKDSANSPTNEVLNQCCLAMEECLNSVYRQGRVADNSIGPLEIRVVRNGTFEELMDYAIS  554

Query  423   SGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
              G+SI+QYK PRCV   PIVELLDSR +S +FSP  P W P  + 
Sbjct  555   RGASINQYKVPRCVNFTPIVELLDSRTVSAHFSPALPHWTPERRR  599



>ref|XP_006346338.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like 
[Solanum tuberosum]
Length=596

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/582 (61%), Positives = 450/582 (77%), Gaps = 3/582 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T NA  VQ+RVL  IL+ N+  EYL R  L+G TDRETFK +IPVVT
Sbjct  17    EKDAKALQFIEEMTRNADAVQQRVLDEILTRNSQTEYLKRFKLDGVTDRETFKSIIPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLF++ E KTPGGLLARPVLTS  K  +FK R + +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFIKSETKTPGGLLARPVLTSYYKSEHFKSRPH-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P ETILC+DSFQSMY+QMLCGL+  +QVLR+G +FAS  +RAI FL+ HW  L HDIRTG
Sbjct  196   PNETILCSDSFQSMYTQMLCGLYEREQVLRLGAVFASGLVRAIRFLQLHWEQLAHDIRTG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLN  IT+PSV E + +I+KPNP+LA+F+  EC KE+W+GII RIW  TKY+DV+VTGAM
Sbjct  256   TLNTLITNPSVCERMGKIMKPNPELADFVANECCKENWEGIITRIWPKTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+Y+   LP   T Y +SEC F +NLNP+ KP+EV+YTI+P M YFEFLP    
Sbjct  316   AQYIPTLDYYSGGLPKACTMYAASECYFGLNLNPMCKPSEVSYTIMPNMGYFEFLP-HDP  374

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
                   +P  ++DLVDV++G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV RK
Sbjct  375   TSTTTSSPTNLVDLVDVEVGKEYELVITTYAGLYRYRVGDILRVTGFHNSAPQFHFVRRK  434

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQSS  592
             NV LSID+DKTDE EL  AV+NAS +L  F+ S++EYTS+A+T TIPGHYV+YWE+    
Sbjct  435   NVLLSIDSDKTDEAELQRAVENASKLLREFNTSVVEYTSYADTKTIPGHYVIYWELLMKD  494

Query  591   ENPIPR-YIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
              N  P   +   CC A+EESLN+VYR+ RV+  SIGPLEIR+V+NGTF+++MDYAI+ G+
Sbjct  495   LNNSPSDEVLNQCCLAMEESLNTVYRQGRVACNSIGPLEIRVVKNGTFEELMDYAISRGA  554

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             SI+QYK PRCV  API+ELLDSRVMS +FSP  P+W P  + 
Sbjct  555   SINQYKVPRCVNFAPILELLDSRVMSRHFSPSLPQWTPERRR  596



>ref|XP_009611720.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Nicotiana 
tomentosiformis]
Length=612

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/597 (60%), Positives = 456/597 (76%), Gaps = 10/597 (2%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             + E   + L+FIE+VT+N  +VQ RVL  ILS NA VEYL RH LNGSTDRETFKK++PV
Sbjct  15    MAEDYKKDLEFIEEVTSNVDEVQMRVLAEILSQNAHVEYLQRHNLNGSTDRETFKKVVPV  74

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             +TYED++PDI R+A G+ S I+CS PISE  +SSGTS GE+KLIPTTE E+ R+     L
Sbjct  75    ITYEDIQPDIKRIAYGDKSPILCSQPISELLSSSGTSGGESKLIPTTEPEIGRRLQLHKL  134

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             +M V++Q  PD  KGK MYF+F+  E KTPGGL+AR + TS     YF      NP+ + 
Sbjct  135   VMSVLSQVAPDSGKGKGMYFMFISPEQKTPGGLIARFLTTSYYNSPYFNYSRLHNPHCNY  194

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP   ILC DS+QSMYSQMLCGL   +QVLRVG+ FA++F+RAI FLEKHW LLC+DIR
Sbjct  195   TSPTAAILCPDSYQSMYSQMLCGLCQNNQVLRVGSFFATSFVRAIRFLEKHWSLLCNDIR  254

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             +GT+N +ITDP VREAV  ++KP+P LA+FIE EC K+SW+GII R+W NTKY+D +VTG
Sbjct  255   SGTINTQITDPLVREAVMEVLKPDPTLADFIEVECTKDSWQGIITRLWPNTKYVDAIVTG  314

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
             +MSQYIP L+Y+ N+LPL+ST Y SSE  F INLNP  KP++V+YT+IPTM YFEFLP  
Sbjct  315   SMSQYIPILDYYSNNLPLISTLYASSESHFGINLNPFCKPSDVSYTLIPTMCYFEFLPYR  374

Query  957   REIGV----------PEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFK  808
                GV           E    +++DL DVK+GQEYE+VVTTY+GLYRYRVGD+L+VAG+K
Sbjct  375   GNSGVIDSISMPKSLNEKEQQQLVDLADVKIGQEYELVVTTYSGLYRYRVGDVLQVAGYK  434

Query  807   NNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPG  628
             NN P+FNF+CR+NV LSI AD T+EVEL NAVKNA   L+PFD+ + EYTS+ + +TIP 
Sbjct  435   NNAPRFNFLCRENVVLSIGADFTNEVELQNAVKNAVGNLVPFDSQVTEYTSYVDITTIPS  494

Query  627   HYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
             HYV++WE+  +   P+P  +FEDCC  +EESLN  YRE R S++SIGPLEIR++E GTFD
Sbjct  495   HYVIFWELNANDSTPVPPSVFEDCCLTIEESLNYFYREGRASNESIGPLEIRVLEIGTFD  554

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
             K+MDY ++ G+S++QYK PRC+  AP++ELL+SRV+S+YFSP  P+W PG+K W+ N
Sbjct  555   KLMDYCMSLGASMNQYKTPRCLKYAPLIELLNSRVVSSYFSPMCPKWVPGYKKWDGN  611



>ref|XP_002313887.2| hypothetical protein POPTR_0009s09590g [Populus trichocarpa]
 gb|EEE87842.2| hypothetical protein POPTR_0009s09590g [Populus trichocarpa]
Length=690

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/581 (61%), Positives = 447/581 (77%), Gaps = 3/581 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQF+E++T NA  VQE VL  IL+ N+ VEYL R  L+G+ DRETFK  IP++ 
Sbjct  111   EKDAKALQFLEEMTRNADSVQEDVLAKILTQNSEVEYLKRFNLDGAIDRETFKSKIPMIR  170

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ SSI+ + PISEF TSSGTS GE KL+PT ++EL+R+ L  SLLM
Sbjct  171   YEDLQPEIQRIANGDRSSILSAHPISEFLTSSGTSAGERKLMPTIKQELDRRQLLYSLLM  230

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E +TPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  231   PVMNLYVPGLDKGKGLYFLFVKSETRTPGGLLARPVLTSYYKSDHFKTRPY-DPYNVYTS  289

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL   +QVLRVG +FAS  +RAI FL+ HW  L  DI +G
Sbjct  290   PNEAILCADSFQSMYTQMLCGLLEREQVLRVGAVFASGLLRAIRFLQLHWLELSDDIESG  349

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
              LN +ITDP+V++ +  I+KPNP LAEF+  EC KE+W+GII RIW NTKY+DV+VTGAM
Sbjct  350   MLNKKITDPTVKDCMVNILKPNPKLAEFVRMECGKENWEGIITRIWPNTKYLDVIVTGAM  409

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+Y+   LP   T Y SSEC F +NLNP+ KP+EV YTI+P MAYFEFLP    
Sbjct  410   AQYIPTLDYYSGGLPKACTMYASSECYFGLNLNPMCKPSEVCYTIMPNMAYFEFLP-HEP  468

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
              G+ + +  +++DL DV+LG+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV RK
Sbjct  469   AGISQDSTPKLVDLADVELGKEYELVITTYAGLYRYRVGDILRVTGFHNSAPQFHFVRRK  528

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-ITQS  595
             NV LSID+DKTDE EL  AV+NAS +L  F+ S++EYTSHA+T TIPGHYV+YWE + + 
Sbjct  529   NVLLSIDSDKTDEAELQTAVENASQLLREFNTSVVEYTSHADTKTIPGHYVIYWELLVKD  588

Query  594   SENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
             S N     +   CC A+EESLNSVYR+ RV+D SIGPLEIR+V+NGTF+++MDYAI+ G+
Sbjct  589   SANSPGDEVLNQCCLAMEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAISRGA  648

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             SI+QYK PRCV   PI+ELLDSRV+S +FSP  P WAP  +
Sbjct  649   SINQYKVPRCVNFTPIMELLDSRVVSKHFSPALPRWAPERR  689



>ref|XP_003564364.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Brachypodium distachyon]
Length=615

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/589 (61%), Positives = 451/589 (77%), Gaps = 7/589 (1%)
 Frame = -1

Query  2028  SNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDR-ETFKKLIPVVT  1852
             ++   L+FIE VT NAG+VQ RVL  IL+ NA  EYL R+G++ S D  ++F++ +P+VT
Sbjct  19    AHREALEFIEHVTANAGKVQRRVLAEILAQNAPAEYLRRYGVSCSLDAVDSFRRCVPLVT  78

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++PDI R+ANG+ S I+   PISEF TSSGTS GE KL+PT  +EL+R+SL  SLLM
Sbjct  79    YEDLQPDILRIANGDTSPILSGKPISEFLTSSGTSGGERKLMPTIADELDRRSLLYSLLM  138

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV++Q VP L KGK MY LFV+ E++TPGGL ARPVLTS  +   F  R + +PYT  TS
Sbjct  139   PVMSQSVPGLDKGKAMYLLFVKAESRTPGGLAARPVLTSYYRSRQFLDRPH-DPYTAYTS  197

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DS+QSMY+Q+LCGL +   VLRVG +FAS  +RAI FLEKHW  LCHDIRTG
Sbjct  198   PNEAILCVDSYQSMYAQLLCGLVHRTDVLRVGAVFASGLLRAIRFLEKHWPRLCHDIRTG  257

Query  1311  TLNPRITDPSVREAVARIVKP---NPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
              L+P ITD  VR+AV RI++     P LA+ IE EC K SW+GI+ R+W  TKYIDV+VT
Sbjct  258   ELDPEITDRPVRDAVGRILRGAANRPALADEIEAECLKPSWEGIVRRLWPRTKYIDVIVT  317

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             GAMSQYIPTL ++G  LPL  T Y SSEC F +NLNP+ KP++VAYT+IPTM YFEFLPV
Sbjct  318   GAMSQYIPTLEFYGGGLPLTCTMYASSECYFGLNLNPMCKPSDVAYTLIPTMCYFEFLPV  377

Query  960   SREIGV-PEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNF  784
              R      +P+  +++DLVDVKLG  YE+VVTT++GL RYRVGD+LRVAGFKN  P F+F
Sbjct  378   HRGSNTNAKPSHQDLVDLVDVKLGHYYELVVTTFSGLCRYRVGDVLRVAGFKNEAPMFSF  437

Query  783   VCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEI  604
             V R+NVALSID+DKTDE ELH AV +A   L PF A+L+EYTS+A+T+ IPGHYVL+WE+
Sbjct  438   VRRQNVALSIDSDKTDETELHTAVSSAVQHLAPFGATLVEYTSYADTAAIPGHYVLFWEL  497

Query  603   TQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIA  424
              ++    +P  +FE+CC +VEE+LNSVYR+ R SD+SIGPLEIR+V  GTFDK+MDYA++
Sbjct  498   -RAGSTAVPASVFEECCLSVEEALNSVYRQGRASDRSIGPLEIRVVSEGTFDKLMDYALS  556

Query  423   SGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN  277
              G+SI+QYK PRCV   P+VELLD RV + YFSPK P+W+PG+K WN +
Sbjct  557   RGASINQYKAPRCVRPGPVVELLDDRVQAKYFSPKCPKWSPGNKQWNNS  605



>ref|XP_004961601.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.4-like 
[Setaria italica]
Length=626

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/592 (59%), Positives = 441/592 (74%), Gaps = 6/592 (1%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDR--ETFKKLI  1864
             L E++   L++IE VT  A QVQ RVL  IL+ NA  EYL R G+ G      E F +  
Sbjct  16    LPEAHREALEYIERVTAGAAQVQRRVLAEILAQNAPAEYLRRLGVEGDAPGAVEAFLRAA  75

Query  1863  PVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYS  1684
             P+VTYED+ PD+ R+ANG+ S I+   PI EF TSSGTS GE KL+P+  +E++R+SL  
Sbjct  76    PLVTYEDILPDVLRIANGDTSPILSGKPIREFLTSSGTSGGERKLMPSIADEMDRRSLMY  135

Query  1683  SLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYT  1504
             +LLMPV++Q VP L KGK MY  FV+ E++TP GL ARPVLTS  +  +F +R + +PYT
Sbjct  136   TLLMPVMSQAVPGLDKGKCMYLYFVKAESRTPAGLPARPVLTSFYRSRHFLERPH-DPYT  194

Query  1503  DCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHD  1324
               TSP E +LC DS+QSMY+ +LCG+ +   VLRVG +FAS F+RAI FLEKHW  LC D
Sbjct  195   VYTSPDEAVLCVDSYQSMYAHLLCGIVHRADVLRVGAVFASGFLRAIRFLEKHWPRLCRD  254

Query  1323  IRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVV  1144
             IR+GTL+  +TD SVR AV R+++ +P LA+ +E EC + SW+GII R+W NTKYIDV+V
Sbjct  255   IRSGTLDAEVTDRSVRAAVERVLRADPALADAVEAECARPSWEGIIRRVWPNTKYIDVIV  314

Query  1143  TGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLP  964
             TGAM+QYIPTL ++G  LPL  T Y SSEC F INLNP+ KP++VAYT+IPTM YFEFLP
Sbjct  315   TGAMAQYIPTLEFYGGGLPLTCTMYASSECYFGINLNPMCKPSDVAYTLIPTMGYFEFLP  374

Query  963   VSREIGVP--EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQF  790
             V    G P  EP P ++++LVDVKLG EYE+V+TTY+GLYRYRVGD+LRVAGFKN  P F
Sbjct  375   VPSSGGSPAAEPQPCDLVNLVDVKLGHEYELVLTTYSGLYRYRVGDVLRVAGFKNQAPMF  434

Query  789   NFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYW  610
             NFV R NV LSID+DKTDE ELH AV  A   L PF ASL+EYTS+A+ +TIPGHYVL+W
Sbjct  435   NFVRRNNVVLSIDSDKTDEAELHAAVAGAVQHLAPFGASLVEYTSYADAATIPGHYVLFW  494

Query  609   EITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYA  430
             E+      P+P  +FEDCC AVEE+LNSVYR+ R +D+SIGPLEIR+V  GTFDK+MDYA
Sbjct  495   ELRGGGATPVPASVFEDCCLAVEEALNSVYRQGRAADRSIGPLEIRVVSEGTFDKLMDYA  554

Query  429   IASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAP-GHKHWNTN  277
             +A G+SI+QYK PRCV   P+VELLD RV + Y SPK P+W+P G + W+ N
Sbjct  555   LAHGASINQYKAPRCVRPGPLVELLDGRVQARYLSPKCPKWSPGGGQQWSGN  606



>ref|XP_009598101.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Nicotiana tomentosiformis]
Length=603

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/584 (61%), Positives = 445/584 (76%), Gaps = 4/584 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T N   VQ++VL  ILS NA  EYL R  L G TDR+TFK  +PVVT
Sbjct  18    EKDAKALQFIEEMTRNVDSVQKKVLAEILSRNANTEYLQRFKLRGGTDRDTFKSKVPVVT  77

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YE+++PDI R+ANG+ S I  S PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  78    YEEIQPDIQRIANGDRSPIFSSHPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLM  137

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLF++ E KTPGGLLARPVLTS  K   FK R Y +PY   TS
Sbjct  138   PVMNLYVPGLDKGKGLYFLFIKAETKTPGGLLARPVLTSYYKSDQFKTRPY-DPYNVYTS  196

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL   +QVLRVG +FAS  +RAI FL+ +W+ L  DI  G
Sbjct  197   PNEAILCVDSFQSMYTQMLCGLLMREQVLRVGAVFASGLLRAIRFLQINWQTLVKDIAFG  256

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLN R++DPS++E +++I+KPNP+LAEFI KEC  ++W+GII RIW NTKY+DV+VTGAM
Sbjct  257   TLNTRVSDPSIKECMSKILKPNPELAEFIIKECEGQNWEGIITRIWPNTKYLDVIVTGAM  316

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS--  958
             +QYIPTL+Y+   LP   T Y SSEC F +NLNP+ KP+EV YTI+P M Y EF+P    
Sbjct  317   AQYIPTLDYYSGGLPKACTMYASSECYFGLNLNPMCKPSEVCYTIMPNMCYCEFIPHDPV  376

Query  957   REIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVC  778
                 +   +P  ++DL DV+LG+EYE+V+TTYAGL RYRVGDIL+V GF N+ PQF FV 
Sbjct  377   NPATISRDSPPRLVDLADVELGKEYELVITTYAGLCRYRVGDILQVTGFHNSAPQFKFVR  436

Query  777   RKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-IT  601
             RKNV LSID+DKTDE EL NAV+NA+ IL P+D S++EYTS+A+T+TIPGHYV+YWE +T
Sbjct  437   RKNVLLSIDSDKTDEAELQNAVENATQILRPYDTSVVEYTSYADTTTIPGHYVIYWELLT  496

Query  600   QSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIAS  421
             + S N   + +   CC A+EESLNSVYR+CRV+D SIGPLEIR+VE GTF+++MDYAI+ 
Sbjct  497   KDSNNSPSQEVLNKCCLAMEESLNSVYRQCRVADNSIGPLEIRVVEKGTFEELMDYAISR  556

Query  420   GSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             G+SI+QYK PRCV   PI+ELLDSRV+S +FSP  P W P  + 
Sbjct  557   GASINQYKTPRCVNFTPILELLDSRVISVHFSPTAPHWTPERRR  600



>ref|XP_010277152.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Nelumbo nucifera]
Length=599

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/598 (60%), Positives = 461/598 (77%), Gaps = 6/598 (1%)
 Frame = -1

Query  2073  TDALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGS  1894
             TD+  S   +  ++E + + LQFI D+T NA  VQ++VL  IL+ NA  EYL R+ L GS
Sbjct  3     TDSSISYHHDSAIDEKHAKALQFILDMTKNADSVQQKVLAEILAQNAETEYLRRYQLGGS  62

Query  1893  TDRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTE  1714
             TDR+TFK  +PVVTYED++P+I R+ANG+ S+I+ + PISEF TSSGTS GE KL+PT +
Sbjct  63    TDRDTFKSKVPVVTYEDLQPEIQRIANGDRSAILSAHPISEFLTSSGTSAGERKLMPTIQ  122

Query  1713  EELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYF  1534
             EEL+R+ +  SLL PV+N +VP L KGK +YF FV+ E KTPGGLLARPVLTS  K  +F
Sbjct  123   EELDRRQVLYSLLTPVMNLYVPGLDKGKALYFYFVKSETKTPGGLLARPVLTSYYKSDHF  182

Query  1533  KKRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFL  1354
             K R Y +PY   TSP E ILC DSFQSMY+QMLCGL+  ++VLRVG +FAS  +RAI FL
Sbjct  183   KTRPY-DPYNVYTSPNEAILCPDSFQSMYTQMLCGLYQREEVLRVGAVFASGLLRAIRFL  241

Query  1353  EKHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIW  1174
             + +WR L +DI TGTL+P+ITDPS+++ +  ++KPNP+LAEFI +EC++E W+GII RIW
Sbjct  242   QLNWRELVNDIATGTLSPKITDPSIQKCMVPLLKPNPELAEFITRECSQEKWEGIISRIW  301

Query  1173  RNTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTII  994
              NTKY+DV+VTGAM+QYIPTL Y+   LP+V T Y SSEC F +NL P+ KP+EV+YTI+
Sbjct  302   PNTKYLDVIVTGAMAQYIPTLEYYSGGLPMVCTMYASSECYFGLNLKPMCKPSEVSYTIM  361

Query  993   PTMAYFEFL---PVSREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILR  823
             P+MAYFEF+   P S  +    P P  ++DLVDV+LG+EYE+VVTTYAGLYRYRVGDILR
Sbjct  362   PSMAYFEFIPHEPSSASLTRDSPPP-RLVDLVDVELGKEYELVVTTYAGLYRYRVGDILR  420

Query  822   VAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANT  643
             V+GF N+ PQF+FV RKNV LSID+DKTDE EL NAV+NAS +L  F+ S++EYTS A++
Sbjct  421   VSGFHNSAPQFHFVRRKNVLLSIDSDKTDEAELQNAVENASMLLREFNTSVVEYTSFADS  480

Query  642   STIPGHYVLYWEITQSSENPIP-RYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIV  466
              +IPGHYV+YWE+     +  P   +  +CC A+EESLNSVYR+ RV+D SIGPLEIR+V
Sbjct  481   KSIPGHYVIYWELLVKDPSNWPTEQVLNNCCLAMEESLNSVYRQGRVADNSIGPLEIRVV  540

Query  465   ENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             ++GTF+ +MDYAI+ G+SI+QYK PRCV   PI+ELLDSRV+S +FSP  P W P  +
Sbjct  541   KSGTFEALMDYAISRGASINQYKVPRCVNFTPIMELLDSRVVSVHFSPARPHWTPERR  598



>ref|XP_011030377.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Populus euphratica]
Length=596

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/582 (61%), Positives = 445/582 (76%), Gaps = 3/582 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T N   VQE VL  IL+ NA VE+L R  L+G+TDRETFK  IP++ 
Sbjct  17    EKDAKALQFIEEMTKNTDSVQEDVLAKILTQNAEVEFLKRFNLDGATDRETFKSKIPMIR  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ SSI+ + PISEF TSSGTS GE KL+PT ++EL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSSILSTHPISEFLTSSGTSAGERKLMPTIKQELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E +TPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETRTPGGLLARPVLTSYYKSDHFKTRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL   +QVLRVG +FAS  +RAI FL+ HWR L  DI +G
Sbjct  196   PNEAILCADSFQSMYTQMLCGLLEREQVLRVGAVFASGLLRAIRFLQLHWRELADDIESG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
              LN  ITDPSV++ + +I+KPNP LAEF+  EC+ E+W+GII RIW NTKY+DV VTGAM
Sbjct  256   MLNKEITDPSVKDCMVKILKPNPKLAEFVRMECSTENWEGIITRIWPNTKYLDVTVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+Y+   LPL  T Y SSEC F +NLNP+ KP+EV YTI+P MAYFEFLP  R 
Sbjct  316   AQYIPTLDYYSGGLPLACTMYASSECYFGLNLNPMCKPSEVCYTIMPNMAYFEFLPHDRA  375

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
              G    +  +++DL DV+LG+EYE+V+TTYAGLYRY+VGDILRV GF N+ PQF+FV RK
Sbjct  376   -GFTHDSTPKLVDLADVELGKEYELVITTYAGLYRYQVGDILRVTGFHNSAPQFHFVRRK  434

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-ITQS  595
             NV LSID+DKTDE EL  AV+NAS +L  F+ S++EYTS+A+T TIPGHYV+YWE + + 
Sbjct  435   NVLLSIDSDKTDEAELQKAVENASQLLREFNTSVVEYTSYADTKTIPGHYVIYWELLVKD  494

Query  594   SENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
             S N     +   CC A+EE LNSVYR+ RV+D SIGPLEIR+V+NGTF+++MDYAI+ G+
Sbjct  495   SANSPSDEVLNQCCLAMEECLNSVYRQGRVADYSIGPLEIRVVKNGTFEELMDYAISRGA  554

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             SI+QYK PRCV   PI+ELLDSRV+S +FSP  P W P  + 
Sbjct  555   SINQYKVPRCVNFTPIMELLDSRVVSKHFSPALPYWTPERRR  596



>gb|KDP44447.1| hypothetical protein JCGZ_16280 [Jatropha curcas]
Length=599

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/583 (61%), Positives = 445/583 (76%), Gaps = 3/583 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T NA  VQE VL AILS N  VEYL R  L+G+TDRETFK  IP++T
Sbjct  17    EKDAKALQFIEEMTRNADLVQENVLAAILSRNKDVEYLKRFNLDGATDRETFKSKIPMIT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S+I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSAILSAHPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLF++ E +TPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFIKSETRTPGGLLARPVLTSYYKSEHFKNRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL   +QVLRVG +FAS  +RAI FL+ +W  L  DI +G
Sbjct  196   PNEAILCPDSFQSMYTQMLCGLLEREQVLRVGAVFASGLLRAIRFLQLNWEQLADDIESG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLN R+TDPS+R  +  I+KPN  LAEFI  +C+KE W+GII RIW NTKY++V+VTGAM
Sbjct  256   TLNERVTDPSIRACMKNILKPNSQLAEFIRFQCSKEKWEGIITRIWPNTKYLEVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS-R  955
             +QYIPTL+Y+   LP   T Y SSEC F +NLNP+SKP+EV+YTI+P M YFEFLP    
Sbjct  316   AQYIPTLDYYSGGLPKACTMYASSECYFGLNLNPMSKPSEVSYTIMPNMGYFEFLPHDPS  375

Query  954   EIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCR  775
               G    +  +++DLVDV++G+EYE V+TTY+GLYRYRVGDILRV GF N+ PQF FV R
Sbjct  376   STGSTRDSSPKLVDLVDVEVGKEYEFVITTYSGLYRYRVGDILRVTGFHNSAPQFQFVRR  435

Query  774   KNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-ITQ  598
             KNV LSID+DKTDE EL NAV+NAS +L  +  S++EYTS A+T TIPGHYV+YWE + +
Sbjct  436   KNVLLSIDSDKTDEAELQNAVENASQLLKEYKTSVVEYTSFADTKTIPGHYVIYWELLVK  495

Query  597   SSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASG  418
              S N   + +   CC A+EESLNSVYR+ RV+D SIGPLEIR+V+NGTF+++MDYAI+ G
Sbjct  496   DSANSPSKEVLNQCCLAMEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAISRG  555

Query  417   SSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             +SI+QYK PRCV   PI+ELLDSRV+S +FSP  P W P  + 
Sbjct  556   ASINQYKVPRCVNFTPIMELLDSRVVSTHFSPSLPNWTPERRR  598



>ref|XP_009611722.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Nicotiana 
tomentosiformis]
Length=609

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/600 (60%), Positives = 449/600 (75%), Gaps = 27/600 (5%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E   + L+FIE+VT+N  +VQ RVL  ILS NA VEYL R+ LNGSTDRETFKKL+PV+T
Sbjct  17    EDYKKNLEFIEEVTSNVDEVQCRVLAEILSQNAHVEYLQRYNLNGSTDRETFKKLVPVIT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++PDI R+A G+ S I+CS PISE  +SSGTS GE+KLIP+TE  L R+     LLM
Sbjct  77    YEDIQPDIKRIAYGDKSPILCSQPISELLSSSGTSGGESKLIPSTEAALGRRLQLLKLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC--  1498
              V++Q  PD  KGK MYF+F+  E KTPGGLLAR          +F    Y +PY +C  
Sbjct  137   SVMSQVAPDFGKGKGMYFMFISSEQKTPGGLLAR----------FFTTSFYKSPYINCGY  186

Query  1497  -----TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLL  1333
                  TSP  TILC DS+QSMYSQMLCGL    +VLRVG++FA+ FIR I FLEKHW LL
Sbjct  187   PCRKFTSPTATILCQDSYQSMYSQMLCGLCQNQEVLRVGSLFATGFIRGIRFLEKHWSLL  246

Query  1332  CHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYID  1153
             C+DIR GT+N +ITDPSVREAV  I+KP+P LA+FIE EC+K+SW+GII R+W NTKY+D
Sbjct  247   CNDIRNGTINTQITDPSVREAVMEILKPDPKLADFIEAECSKDSWQGIITRLWPNTKYVD  306

Query  1152  VVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFE  973
              ++TG+MSQYIP L+Y+ N LPL+ST Y SSEC F INLNP  KP+EV+YT+IPTM YFE
Sbjct  307   AILTGSMSQYIPILDYYSNSLPLISTLYGSSECHFGINLNPFCKPSEVSYTLIPTMCYFE  366

Query  972   FLPVSREIGV----------PEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILR  823
             FLP     GV           E    +++DL DV++GQEYE+VVTTY+GLYRYRVGD+LR
Sbjct  367   FLPYHGNSGVIDSISMPKSLNEKEQQQLVDLADVEIGQEYELVVTTYSGLYRYRVGDVLR  426

Query  822   VAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANT  643
             VAG+KNN P+FNF+CR+NV LSI AD T+EVEL NAVKNA   L+PFD+ + EYTS+ + 
Sbjct  427   VAGYKNNAPRFNFLCRENVILSIGADFTNEVELQNAVKNAVGDLMPFDSQVTEYTSYVDI  486

Query  642   STIPGHYVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVE  463
             +TIP HYV++WE+  +   P+P  +FEDCC  +EESLN  YRE R S+ SIGPLEIR+VE
Sbjct  487   TTIPSHYVIFWELNANDSTPVPPSVFEDCCLTIEESLNYFYREGRASNASIGPLEIRVVE  546

Query  462   NGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
              GTFDK+MDY  + G+S++QYK PRCV  AP++ELL+SRV+S YFSP  P+W PG+K WN
Sbjct  547   IGTFDKLMDYCSSLGASMNQYKTPRCVKYAPLIELLNSRVVSRYFSPMCPKWVPGYKKWN  606



>gb|AAS02074.1| auxin and ethylene responsive GH3-like protein [Capsicum chinense]
Length=595

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/582 (60%), Positives = 450/582 (77%), Gaps = 4/582 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T NA  VQ+RVL  IL+ N+  EYL R  L+G +DRETFK  IPVVT
Sbjct  17    EKDAKALQFIEEMTRNADAVQQRVLDEILTRNSQTEYLKRFKLDGVSDRETFKSRIPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLF++ E KTPGGLLARPVLTS  K  +FK R + +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFIKSETKTPGGLLARPVLTSYYKSEHFKSRPH-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL+  +QVLR+G +FAS  +RAI FL+ HW  L HDIRTG
Sbjct  196   PNEAILCADSFQSMYTQMLCGLYEREQVLRLGAVFASGLVRAIRFLQLHWPQLAHDIRTG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
              LNP+IT+ S+ E + +I++PNP+LA+F+  EC KE+W+GII RIW  TKY+DV+VTGAM
Sbjct  256   NLNPQITNLSLCERMGKIMRPNPELADFVAGECCKENWEGIITRIWPKTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+Y+   LP   T Y +SEC F +NLNP+ KP+EV+YTI+P M YFEFLP   +
Sbjct  316   AQYIPTLDYYSGGLPKACTMYAASECYFGLNLNPMCKPSEVSYTIMPNMGYFEFLP--HD  373

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
                   +P  ++DLVDV++G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV RK
Sbjct  374   STTTNSSPTNLVDLVDVEVGKEYELVITTYAGLYRYRVGDILRVTGFHNSAPQFHFVRRK  433

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-ITQS  595
             NV LSIDADKTDE EL  AV+NAS +L  F+ S++EYTS+A+T TIPGHYV+YWE + + 
Sbjct  434   NVLLSIDADKTDEAELQKAVENASKLLREFNTSVVEYTSYADTKTIPGHYVIYWELLMKD  493

Query  594   SENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
              +N     +   CC A+EESLN+VYR+ RV+  SIGPLEIR+V+NGTF+++MDYAI+ G+
Sbjct  494   LKNSPSDEVLNKCCLAMEESLNTVYRQGRVACNSIGPLEIRVVKNGTFEELMDYAISRGA  553

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             SI+QYK PRCV  API+ELLDSRVMS++FSP  P+W P  + 
Sbjct  554   SINQYKVPRCVNFAPILELLDSRVMSSHFSPSLPQWTPERRR  595



>ref|XP_006422877.1| hypothetical protein CICLE_v10028058mg [Citrus clementina]
 gb|ESR36117.1| hypothetical protein CICLE_v10028058mg [Citrus clementina]
Length=599

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/585 (61%), Positives = 450/585 (77%), Gaps = 6/585 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + L+FIE++T NA  VQE+VL  ILS NA VEYL R+ L G+TDRETFK  +P++ 
Sbjct  17    EKDAKALRFIEEMTRNAEAVQEKVLAEILSRNADVEYLKRYKLGGATDRETFKSKLPIIK  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S+I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSAILSAHPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E +TPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKALYFLFVKSETRTPGGLLARPVLTSYYKSEHFKTRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL   +QVLR+G +FAS  +RAI FL+ HW+ L  DI +G
Sbjct  196   PNEAILCADSFQSMYAQMLCGLLEREQVLRLGAVFASGLLRAIRFLQLHWQALASDIESG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             T+N +ITDPS+++ + + +KPNP+LAEFI  EC+KE+W+ II RIW NTKY+DV+VTGAM
Sbjct  256   TVNQKITDPSIKDCLGKTLKPNPELAEFIRMECSKENWERIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYF-GNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV--  961
             +QYIPTL+Y+ G  LP+  T Y SSEC F +NLNP+ +P+EV+YTI+P MAYFEFLP   
Sbjct  316   AQYIPTLDYYSGGKLPMACTMYASSECYFGLNLNPICRPSEVSYTIMPNMAYFEFLPQEP  375

Query  960   SREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFV  781
             +   G+   +P  V DLVDV++G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV
Sbjct  376   ADSFGLTSSDPQPV-DLVDVEVGKEYELVITTYAGLYRYRVGDILRVTGFHNSAPQFHFV  434

Query  780   CRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-I  604
              RKNV LSI++DKTDE EL NA+ NAS +L  F+ S+ EYTS+ANT TIPGHYV+YWE +
Sbjct  435   RRKNVLLSIESDKTDEAELQNAIDNASRLLREFNTSVGEYTSYANTKTIPGHYVIYWELL  494

Query  603   TQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIA  424
              + S N     +   CC A+EE LNSVYR+ RV+D SIGPLEIR+V NGTF+++MDYAI+
Sbjct  495   IKDSANSPTNEVLNQCCLAMEECLNSVYRQGRVADNSIGPLEIRVVRNGTFEELMDYAIS  554

Query  423   SGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
              G+SI+QYK PRCV   PIVELLDSR +S +FSP  P W P  + 
Sbjct  555   RGASINQYKVPRCVNFTPIVELLDSRTVSAHFSPALPHWTPERRR  599



>ref|XP_002524947.1| Indole-3-acetic acid-amido synthetase GH3.3, putative [Ricinus 
communis]
 gb|EEF37444.1| Indole-3-acetic acid-amido synthetase GH3.3, putative [Ricinus 
communis]
Length=598

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/584 (61%), Positives = 453/584 (78%), Gaps = 5/584 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T N   VQE+VL  ILS NA  EYL R  LNG+TDR+ FK  +PVVT
Sbjct  17    EKDAKALQFIEEMTRNIDSVQEKVLAEILSRNAETEYLERFQLNGATDRDAFKSKVPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S+I  S PISEF TSSGTS GE KL+PT  EEL+R++L  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSNIFSSHPISEFLTSSGTSAGERKLMPTIHEELDRRTLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E KTPGGL+ARPVLTS  K  +FK R + +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKAETKTPGGLVARPVLTSYYKSEHFKNRPF-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P ETILC DSFQSMYSQMLCGL   ++VLRVG +FAS  +RAI FL+ + + L  DI TG
Sbjct  196   PNETILCPDSFQSMYSQMLCGLIMREEVLRVGAVFASGLLRAIRFLQINCKHLAEDISTG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNP+I+DPS+RE +A+I+KPNP+LAEFI KEC++E+W+GII RIW NTKY+DV+VTGAM
Sbjct  256   TLNPKISDPSIRECMAKILKPNPELAEFITKECSEENWEGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLP-VSR  955
             +QYIPTL Y+ N LP+  T Y SSEC F +NLNP+ KP++V+YTI+P MAYFEFLP  S 
Sbjct  316   AQYIPTLEYYSNGLPMACTMYASSECYFGVNLNPMVKPSDVSYTIMPNMAYFEFLPHESS  375

Query  954   EIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCR  775
                +   +P  ++DL DV++G+EYE+V+TTYAGL RYRVGDILRV GF N  PQF F+ R
Sbjct  376   SSALSRDSPPRLVDLADVEVGKEYELVITTYAGLNRYRVGDILRVTGFHNAAPQFRFIRR  435

Query  774   KNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE--IT  601
             KNV LSID+DKTDE EL  A++NAS +L  F+ S++EYTS+ +T TIPGHYV+YWE  I 
Sbjct  436   KNVLLSIDSDKTDESELQKAIENASLLLREFNTSVVEYTSYGDTKTIPGHYVIYWELLIK  495

Query  600   QSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIAS  421
               S +P  + +   CC A+EESLNSVYR+ RV+D SIGPLEIR+V+NGTF+++MDYAI+ 
Sbjct  496   DPSNSPTEQ-VLNQCCLAMEESLNSVYRQGRVADSSIGPLEIRVVKNGTFEELMDYAISR  554

Query  420   GSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             G+SI+QYK PRCV+  PI+ELLDSRV+S +FSP  P+W P  + 
Sbjct  555   GASINQYKVPRCVSFTPIMELLDSRVVSKHFSPSLPQWTPERRR  598



>ref|XP_010271511.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Nelumbo nucifera]
Length=595

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/584 (61%), Positives = 445/584 (76%), Gaps = 5/584 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E +   LQFIED+T NA  VQ++VL  IL+ NA  EYL R+ L GSTDR+TFK  IPV+T
Sbjct  12    EKHATALQFIEDMTKNADSVQQKVLAEILTQNAETEYLRRYQLGGSTDRDTFKSKIPVIT  71

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S+I+ + PISEF TSSGTS GE KL+PT + EL+R+ L  SLL 
Sbjct  72    YEDLQPEIQRIANGDRSAILSAHPISEFLTSSGTSAGERKLMPTIQAELDRRQLLYSLLT  131

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YF FV+ E KTPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  132   PVMNLYVPGLDKGKALYFYFVKSETKTPGGLLARPVLTSYYKSDHFKTRPY-DPYNVYTS  190

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL+  ++VLRVG +FAS  +RAI FL+ +WR L HDI TG
Sbjct  191   PNEAILCPDSFQSMYTQMLCGLYQREEVLRVGAVFASGLLRAIRFLQLNWRELVHDIATG  250

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLN +ITDPS+RE +   +KPNP LAEFI  EC+ E W+GII RIW  TKY+DV+VTGAM
Sbjct  251   TLNSKITDPSIRECMVSRLKPNPKLAEFITSECSGEKWEGIINRIWPKTKYLDVIVTGAM  310

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL---PV  961
             +QYIPTL+Y+   LPL  T Y SSEC F +NL P+ KP+EVAYTI+P M YFEFL   P 
Sbjct  311   AQYIPTLDYYSGGLPLACTMYASSECYFGLNLKPMCKPSEVAYTIMPNMGYFEFLPHDPT  370

Query  960   SREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFV  781
             S  +   +  P  ++DLVDV++G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV
Sbjct  371   SASLLSRDSPPPRLVDLVDVEVGKEYELVITTYAGLYRYRVGDILRVTGFHNSAPQFHFV  430

Query  780   CRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-I  604
              RKNV LSID+DKTDE EL +AV+NAS +L  F++S++EYTS+A+T TIPGHYV+YWE +
Sbjct  431   RRKNVLLSIDSDKTDEAELQSAVENASKLLREFNSSVVEYTSYADTKTIPGHYVIYWELL  490

Query  603   TQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIA  424
              +   N     +   CC A+EESLNSVYR+ RV+D SIGPLEIR+V++GTF+ +MDYAI+
Sbjct  491   VKDPGNGPTDEVLNKCCLAMEESLNSVYRQGRVADNSIGPLEIRVVKSGTFEALMDYAIS  550

Query  423   SGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
              G+SI+QYK PRCV   PI+ELLDSRV+S +FSP  P W P  +
Sbjct  551   RGASINQYKVPRCVNFTPIMELLDSRVVSVHFSPACPHWTPERR  594



>ref|NP_001055967.1| Os05g0500900 [Oryza sativa Japonica Group]
 sp|Q60EJ6.1|GH34_ORYSJ RecName: Full=Probable indole-3-acetic acid-amido synthetase 
GH3.4; AltName: Full=Auxin-responsive GH3-like protein 4; Short=OsGH3-4 
[Oryza sativa Japonica Group]
 gb|AAU90225.1| putative auxin-responsive protein GH3 [Oryza sativa Japonica 
Group]
 dbj|BAF17881.1| Os05g0500900 [Oryza sativa Japonica Group]
 gb|EAY98588.1| hypothetical protein OsI_20501 [Oryza sativa Indica Group]
 gb|EEE64261.1| hypothetical protein OsJ_19094 [Oryza sativa Japonica Group]
Length=629

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/585 (61%), Positives = 446/585 (76%), Gaps = 10/585 (2%)
 Frame = -1

Query  2013  LQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGST--DRETFKKLIPVVTYEDV  1840
             L+ IE VT NAGQ Q RVL+ IL+ NA  EYL R G+ G      E F++L P+VTYED+
Sbjct  27    LEHIERVTRNAGQEQRRVLEEILAQNAQAEYLRRLGVPGDAPGADEAFRRLAPLVTYEDI  86

Query  1839  KPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLMPVIN  1660
              PD+ R+ANG+ S I+   P+SEF TSSGTS GE KL+PT EEE+ER+S   SLLMPV++
Sbjct  87    LPDVLRIANGDTSPILSGKPVSEFLTSSGTSGGERKLMPTIEEEMERRSGLYSLLMPVMS  146

Query  1659  QFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTSPRET  1480
             + VP L KGK MY  FV+ E +TPGGL ARPVLTS  +  YF +R + +PYT  TSP E 
Sbjct  147   RQVPGLDKGKAMYLYFVKSEWRTPGGLPARPVLTSFYRSRYFLERPH-DPYTVYTSPDEA  205

Query  1479  ILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTGTLNP  1300
             +LC D++QSMY+Q++CGL +   VLRVG +FAS F+RAI FLEKHW  LC DIR G L+ 
Sbjct  206   VLCEDAYQSMYAQLICGLVHRADVLRVGAVFASGFLRAIRFLEKHWPSLCRDIRAGELDG  265

Query  1299  RITDPSVREAVARIVK-PNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAMSQY  1123
              +TDP+VR AV R+++  +P LA+ IE EC + SW+GII R+W +TKYIDV+VTGAM+QY
Sbjct  266   GVTDPAVRGAVGRVLRGADPALADAIEAECARPSWQGIIRRVWPSTKYIDVIVTGAMAQY  325

Query  1122  IPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV---SRE  952
             IPTL ++G  LPL  T Y SSEC F +NLNP+ KP+EVAYT+IPTM YFEFLPV   + +
Sbjct  326   IPTLEFYGGGLPLACTMYASSECYFGLNLNPMCKPSEVAYTLIPTMCYFEFLPVNSGAND  385

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
             +  PEP+   ++DLVDVKLG EYE+VVTTY+GLYRYRVGD+LRVAGFKN  P F FV RK
Sbjct  386   VAAPEPDHRGLVDLVDVKLGHEYELVVTTYSGLYRYRVGDVLRVAGFKNAAPMFAFVRRK  445

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTS-TIPGHYVLYWEI-TQ  598
             NVALSID+DKTDE ELH AV  A   L PF ASL+EYTS+A+T+ TIPGHYVL+WE+ + 
Sbjct  446   NVALSIDSDKTDEAELHAAVTEAVQHLAPFGASLVEYTSYADTATTIPGHYVLFWELRSP  505

Query  597   SSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASG  418
             +   P+P  +FEDCC AVEE LNSVYR+CR +D+SIGPLEIR+V +GTFDK+MDYA++ G
Sbjct  506   AGGTPVPASVFEDCCLAVEEGLNSVYRQCRAADRSIGPLEIRVVADGTFDKLMDYALSRG  565

Query  417   SSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEW-APGHKHW  286
             +SI+QYK PRCV   P+VELLD RV + YFSPK P+W A G+K W
Sbjct  566   ASINQYKAPRCVRPGPVVELLDGRVQATYFSPKCPKWCAGGNKQW  610



>gb|KDO47942.1| hypothetical protein CISIN_1g007532mg [Citrus sinensis]
Length=599

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/585 (61%), Positives = 448/585 (77%), Gaps = 6/585 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + L+FIE++T NA  VQE+VL  ILS NA VEYL R+ L G+TDRETFK  +P++ 
Sbjct  17    EKDAKALRFIEEMTRNAEAVQEKVLAEILSRNADVEYLKRYKLGGATDRETFKSKLPIIK  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S+I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSAILSAHPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E +TPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKALYFLFVKSETRTPGGLLARPVLTSYYKSEHFKTRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY QMLCGL   +QVLR+G +FAS  +RAI FL+ HW+ L  DI +G
Sbjct  196   PNEAILCADSFQSMYVQMLCGLLEREQVLRLGAVFASGLLRAIRFLQLHWQALASDIESG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLN +ITDPS+++ + + +KPN +LAEFI  EC+KE+W+ II RIW NTKY+DV+VTGAM
Sbjct  256   TLNQKITDPSIKDCLGKTLKPNTELAEFIRMECSKENWERIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYF-GNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV--  961
             +QYIPTL+Y+ G  LP+  T Y SSEC F +NLNP+ +P+EV+YTI+P MAYFEFLP   
Sbjct  316   AQYIPTLDYYSGGKLPMACTMYASSECYFGLNLNPICRPSEVSYTIMPNMAYFEFLPQEP  375

Query  960   SREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFV  781
             S   G+   +P  V DLVDV++G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV
Sbjct  376   SDSFGLTSSDPQPV-DLVDVEMGKEYELVITTYAGLYRYRVGDILRVIGFHNSAPQFHFV  434

Query  780   CRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-I  604
              RKNV LSI++DKTDE EL NA+ NAS +L  F+ S+ EYTS+ANT TIPGHYV+YWE +
Sbjct  435   RRKNVLLSIESDKTDEAELQNAIDNASRLLREFNTSVGEYTSYANTKTIPGHYVIYWELL  494

Query  603   TQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIA  424
              + S N     +   CC A+EE LNSVYR+ RV+D SIGPLEIR+V NGTF+++MDYAI+
Sbjct  495   IKDSANSPTNEVLNQCCLAMEECLNSVYRQGRVADNSIGPLEIRVVRNGTFEELMDYAIS  554

Query  423   SGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
              G+SI+QYK PRCV   PIVELLDSR +S +FSP  P W P  + 
Sbjct  555   RGASINQYKVPRCVNFTPIVELLDSRTVSAHFSPALPHWTPERRR  599



>ref|XP_011092528.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Sesamum indicum]
Length=594

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/597 (59%), Positives = 453/597 (76%), Gaps = 15/597 (3%)
 Frame = -1

Query  2070  DALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGST  1891
             D + S+       + + + LQFIE++T NA  VQ+ VL  IL+ NA  EYL    L+G+T
Sbjct  4     DPISSTQMGTPARQKDAKALQFIEEMTRNADSVQQNVLAQILTRNAETEYLKGFSLDGAT  63

Query  1890  DRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEE  1711
             DRETFK  +P+VTYED++P I R+ANG+ S I+ S PISEF TSSGTS GE KL+PT +E
Sbjct  64    DRETFKSKVPIVTYEDLQPLIQRIANGDRSPILSSHPISEFLTSSGTSAGERKLMPTIKE  123

Query  1710  ELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFK  1531
             EL+R+ L  SLLMPV+N +V  L KGK +YFLF++ E +TPGGL+ARPVLTS  K  +FK
Sbjct  124   ELDRRQLLYSLLMPVMNLYVKGLDKGKALYFLFIKSETRTPGGLVARPVLTSYYKSDHFK  183

Query  1530  KRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLE  1351
              R Y +PY   TSP E ILC DSFQSMY+QMLCGL+  +QVLRVG +FAS  +RAI FL+
Sbjct  184   TRPY-DPYNVYTSPNEAILCPDSFQSMYAQMLCGLYEREQVLRVGAVFASGLLRAIRFLQ  242

Query  1350  KHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWR  1171
              +W+ L HDIRTG+LNP++TD S+RE + R+++P+PDLA+FI +EC K++W+ II RIW 
Sbjct  243   LNWQQLTHDIRTGSLNPKVTDISLRECMTRVLRPDPDLADFIARECEKDNWERIITRIWP  302

Query  1170  NTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIP  991
             NTKY++V+VTGAM+QYIPTL+Y+   LP   T Y SSEC F +NLNP+  P+EV+YTI+P
Sbjct  303   NTKYLEVIVTGAMAQYIPTLDYYSGGLPKACTMYASSECYFGLNLNPMCSPSEVSYTIMP  362

Query  990   TMAYFEFLPVSREIGVPEPN------PVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDI  829
              MAYFEFLP        EPN      PV+ +DL +V++G+EYE+V+TTYAGLYRYRVGDI
Sbjct  363   NMAYFEFLP-------HEPNSPGLGLPVQPVDLANVEIGKEYELVITTYAGLYRYRVGDI  415

Query  828   LRVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHA  649
             LRV  F N+ PQF FV RKNV LSID+DKTDE EL  A++NAS +L  F+ S++EYTS+A
Sbjct  416   LRVTRFHNSAPQFQFVRRKNVLLSIDSDKTDEAELQAAIENASQLLQKFNTSVVEYTSYA  475

Query  648   NTSTIPGHYVLYWE-ITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIR  472
             +T TIPGHYV+YWE + + SE      + + CC A+EESLNSVYR+CRVSD SIGPLEIR
Sbjct  476   DTKTIPGHYVIYWELLAKDSETSASDEVLDQCCLAMEESLNSVYRQCRVSDNSIGPLEIR  535

Query  471   IVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAP  301
             +V+NGTF+++MDYAI+ G+SI+QYK PRCV   PI+ELLDSRV+S +FSP  P W P
Sbjct  536   VVKNGTFEELMDYAISRGASINQYKVPRCVNFTPIMELLDSRVVSTHFSPLLPHWIP  592



>ref|XP_004231891.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Solanum lycopersicum]
Length=599

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/584 (60%), Positives = 442/584 (76%), Gaps = 4/584 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + ++LQFI+D+T N    Q +VL  IL+ NA  EYL R  +NG+ DRETFK  +PVVT
Sbjct  17    EKDAKVLQFIDDMTKNIDPEQVKVLAEILTRNANTEYLRRFNINGAIDRETFKSKVPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED+KPDI+R+ANG+ S I  S PISEF TSSGTS GE KL+PT  +ELER+    +LL 
Sbjct  77    YEDLKPDIDRIANGDRSPIFSSHPISEFLTSSGTSAGERKLMPTIADELERRQKLYNLLQ  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLF++ E KTP GL+ARPVLTS  K   FK R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFIKAETKTPSGLVARPVLTSYYKSEQFKTRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P ETILC DSFQSMYSQMLCGL   ++VLRVG +FAS  +RAI FL+ +W+ L  DI +G
Sbjct  196   PNETILCVDSFQSMYSQMLCGLLMREEVLRVGAVFASGLLRAIRFLQLNWKQLSQDIASG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNPR++DPS+R  +++I+KPNP LAEF+ KEC  E+W+GII RIW NTK++DV+VTGAM
Sbjct  256   TLNPRVSDPSIRNCISQILKPNPQLAEFVAKECEGENWEGIITRIWPNTKHLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS--  958
             +QYIPTL+Y+   LP V T Y SSEC F +NLNPL KP EV YTI+P M YFEF+P    
Sbjct  316   AQYIPTLDYYSGGLPKVCTMYASSECYFGLNLNPLCKPCEVCYTIMPNMGYFEFIPHDPV  375

Query  957   REIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVC  778
               + +   +P  ++DL DV++G+EYE+V+TTYAGL RYRVGDIL+V GF N+ PQF FV 
Sbjct  376   NPVQISRDSPPHLVDLADVEIGKEYELVITTYAGLCRYRVGDILQVTGFHNSAPQFKFVR  435

Query  777   RKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-IT  601
             RKNV LSID+DKTDE ELH A++NA+ +L P+D +L+EYTS A+T TIPGHYV+YWE + 
Sbjct  436   RKNVLLSIDSDKTDESELHTAIENATALLRPYDTTLVEYTSFADTKTIPGHYVIYWELLV  495

Query  600   QSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIAS  421
             +   NP    +   CC A+E+SLNSVYR+CRV+D SIGPLEIR+V+NGTF+++MDYAI+ 
Sbjct  496   KDPANPPSDDVLNQCCLAMEQSLNSVYRQCRVADNSIGPLEIRVVKNGTFEELMDYAISR  555

Query  420   GSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             G+SI+QYK PRCV   PIVELLDSRV+S  FSPK P W P  + 
Sbjct  556   GASINQYKAPRCVNFTPIVELLDSRVISVNFSPKAPHWTPERRR  599



>ref|XP_009757027.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Nicotiana 
sylvestris]
Length=651

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/643 (57%), Positives = 466/643 (72%), Gaps = 36/643 (6%)
 Frame = -1

Query  2160  SPSVIHLLLHISEFIALSSILIIFHFDAMTDALESSSDERNLEESNNRILQFIEDVTTNA  1981
             S S I+ LL+I+  + LS                 +S    + E   + L+FIE+VT+N 
Sbjct  25    SSSCIYKLLYITLQVFLS---------MERSVANEASKATIMAEDYKKDLEFIEEVTSNV  75

Query  1980  GQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVTYEDVKPDINRVANGEPS  1801
               VQ RVL  I+S N  VEYL RH LNGSTDR+TFKK++PV+TYED++ DINR+A G+ S
Sbjct  76    DDVQRRVLAEIISQNVHVEYLQRHNLNGSTDRDTFKKVVPVITYEDIQLDINRIAYGDKS  135

Query  1800  SIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLMPVINQFVPDLHKGKTMY  1621
              I+CS PISE  +SSGTS GE+KLIP+TE  L R+     LLM V++Q  PD  KGK MY
Sbjct  136   PILCSQPISELLSSSGTSGGESKLIPSTEAALGRRLQLLKLLMSVMSQVAPDFGKGKGMY  195

Query  1620  FLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC-------TSPRETILCTDS  1462
             F+F+  E KTPGGLLAR          +F    Y +PY +C       TSP  TIL  DS
Sbjct  196   FMFISSEQKTPGGLLAR----------FFTTSFYKSPYINCGYPCRKFTSPTATILSQDS  245

Query  1461  FQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTGTLNPRITDPS  1282
             +QSMYSQMLCGL    +VLRVG++FA+ FIR I FLEKHW LLC+DIR GT+N +ITDPS
Sbjct  246   YQSMYSQMLCGLCQNQEVLRVGSLFATGFIRGIRFLEKHWSLLCNDIRNGTINTQITDPS  305

Query  1281  VREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAMSQYIPTLNYF  1102
             VREAV  I+KP+P LA+FIE EC+K+SW+GII R+W NTKY+D ++TG+MSQYIP L+Y+
Sbjct  306   VREAVMEILKPDPKLADFIEAECSKDSWQGIITRLWPNTKYVDAILTGSMSQYIPILDYY  365

Query  1101  GNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLP------VSREIGVP  940
              N LPL+ST Y SSEC F INLNP  KP+EV+YT+IPTM YFEFLP      V+  I +P
Sbjct  366   SNSLPLISTLYGSSECHFGINLNPFCKPSEVSYTLIPTMCYFEFLPYHGNSGVTDSISMP  425

Query  939   ----EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
                 E    +++DL DV++GQEYE+VVTTY+GLYRYRVGD+LRVAG+KNN P+FNF+CR+
Sbjct  426   KSLNEKEQQQLVDLADVEIGQEYELVVTTYSGLYRYRVGDVLRVAGYKNNAPRFNFLCRE  485

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQSS  592
             NV LSI AD T+EVEL NAVKNA   L+PFD+ + EYTS+ + +TIP HYVL+WE++ + 
Sbjct  486   NVILSIGADFTNEVELQNAVKNAVGNLMPFDSQVTEYTSYVDITTIPSHYVLFWELSAND  545

Query  591   ENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGSS  412
               P+P  +FEDCC  +EESLN  YRE R S++SIGPLEIR+VE  TFDK+MDY  + G+S
Sbjct  546   STPVPPSVFEDCCLTIEESLNYFYREGRASNESIGPLEIRVVEIETFDKLMDYCSSLGAS  605

Query  411   ISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
             ++QYK PRCV  AP++E+L+SRV+SNYFSP  P+W PG+K WN
Sbjct  606   MNQYKTPRCVKYAPLIEMLNSRVVSNYFSPTCPKWVPGYKKWN  648



>ref|XP_002300248.2| auxin-responsive GH3 family protein [Populus trichocarpa]
 gb|EEE85053.2| auxin-responsive GH3 family protein [Populus trichocarpa]
Length=596

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/582 (61%), Positives = 442/582 (76%), Gaps = 3/582 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T     VQE VL  IL  NA VEYL R  L+G+TDRETFK  +P + 
Sbjct  17    EKDAKALQFIEEMTRKTDSVQEDVLAKILIQNAEVEYLKRFNLDGATDRETFKSKLPTIR  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ SSI+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSSILSTHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E +TPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETRTPGGLLARPVLTSYYKSDHFKTRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL   +QVLRVG +FAS  +RAI FL+ HWR L  DI +G
Sbjct  196   PNEAILCADSFQSMYTQMLCGLLEREQVLRVGAVFASGLLRAIRFLQLHWRELADDIESG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
              LN  ITDPSV++ + +I+KPNP LAEF+  EC+KE+W+GII RIW NTKY+DV+VTGAM
Sbjct  256   MLNKEITDPSVKDCMVKILKPNPKLAEFVRMECSKENWEGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+Y+   LPL  T Y SSEC F +NLNP+ KP+EV YTI+P MAYFEFLP    
Sbjct  316   AQYIPTLDYYSGGLPLACTMYASSECYFGLNLNPMCKPSEVCYTIMPNMAYFEFLPHDPN  375

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
              G    +  +++DL DV+LG+EYE+V+TTYAGLYRY+VGDILRV GF N+ PQF+FV RK
Sbjct  376   -GFTHDSTPKLVDLADVELGKEYELVITTYAGLYRYQVGDILRVTGFHNSAPQFHFVRRK  434

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-ITQS  595
             NV LSID+DKTDE EL  AV+NAS +L  F+ S++EYTS+A+T TIPGHYV+YWE + + 
Sbjct  435   NVLLSIDSDKTDEAELQKAVENASQLLREFNTSVVEYTSYADTKTIPGHYVIYWELLVKD  494

Query  594   SENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
               N     +   CC A+EE LNSVYR+ RV+D SIGPLEIR+V+NGTF+++MDYAI+ G+
Sbjct  495   LANSPSDEVLNQCCLAMEECLNSVYRQGRVADYSIGPLEIRVVKNGTFEELMDYAISRGA  554

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             SI+QYK PRCV   PI+ELLDSRV+S +FSP  P W P  + 
Sbjct  555   SINQYKVPRCVNFTPIMELLDSRVVSKHFSPALPYWTPERRR  596



>ref|XP_004233446.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Solanum lycopersicum]
Length=599

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/578 (60%), Positives = 444/578 (77%), Gaps = 4/578 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T N   VQE+VL  ILS NA  EYL R  L G+TDR+TFK  +P++T
Sbjct  18    EKDAKALQFIEEMTRNVDSVQEKVLAEILSQNANTEYLQRFKLGGATDRDTFKSKMPIIT  77

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YE+++PDI R+ANG+ S I  S P+SEF TSSGTS GE KL+PTT++EL+RK L  SLLM
Sbjct  78    YEEIQPDIQRIANGDRSPIFSSHPVSEFLTSSGTSAGERKLMPTTQDELDRKQLLYSLLM  137

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N  VPDL KGK +YFLF++ E KTP GLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  138   PVMNLCVPDLDKGKGLYFLFIKAETKTPSGLLARPVLTSYYKSDHFKTRPY-DPYNVYTS  196

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E +LC DSFQSMYSQMLCGL   +QVLR+G +FAS  +RAIHFL+ +W+ L  DI +G
Sbjct  197   PNEAVLCVDSFQSMYSQMLCGLLMREQVLRLGAVFASGLLRAIHFLQLNWQQLADDIASG  256

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
              LNPR++DPS+RE +++I+KPN +LAEFI KEC K++W+GII RIW NTKY+DV+VTGAM
Sbjct  257   ILNPRVSDPSIRECISKILKPNHELAEFIIKECEKQNWEGIITRIWTNTKYLDVIVTGAM  316

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+Y+   LP   T Y SSEC F +NLNP+ KP+EV+YTI+P M Y+EF+P   +
Sbjct  317   AQYIPTLDYYSGGLPKACTMYASSECYFGLNLNPICKPSEVSYTIMPNMCYYEFIP--HD  374

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
                P  +P  ++DL +V++G+EYE+V+TTYAGL RYRVGDIL+V GF N+ PQF F+ RK
Sbjct  375   SANPSDSPRRLVDLANVEVGKEYELVITTYAGLCRYRVGDILQVTGFHNSAPQFKFIRRK  434

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQSS  592
             NV LSID+DKTDE EL NAV +A+ IL  ++ S++EYTS+A+T TIPGHYV+Y E+    
Sbjct  435   NVLLSIDSDKTDEAELQNAVDSAAAILRLYNTSVVEYTSYADTKTIPGHYVIYCELLIKD  494

Query  591   ENPIPRY-IFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
                 P + +   CC A+EE LNSVYR+CRV+D SIGPLEIR+VENGTF+++MDYAI+ G+
Sbjct  495   PTNSPSHEVLNQCCLAMEECLNSVYRQCRVADNSIGPLEIRVVENGTFEELMDYAISRGA  554

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAP  301
             SI+QYK PRCV   PI ELL+SRV+S +FSP  P WAP
Sbjct  555   SINQYKAPRCVNFTPIAELLNSRVISVHFSPGAPHWAP  592



>ref|XP_010028390.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Eucalyptus grandis]
 gb|KCW55130.1| hypothetical protein EUGRSUZ_I01087 [Eucalyptus grandis]
Length=598

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/590 (59%), Positives = 455/590 (77%), Gaps = 17/590 (3%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + L+FIE++T NA  VQE+VL  ILS NA  EYL R+ L G+TDRETFK  +P+VT
Sbjct  17    EKDAKALRFIEEMTRNADAVQEKVLAEILSRNAETEYLRRYNLGGATDRETFKSKLPMVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P I R+A+G+ S I+ + P+SEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPQIQRIADGDRSPILSAHPVSEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E +TPGGLLARPVLTS  K  +F+ R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETRTPGGLLARPVLTSYYKSDHFRTRPY-DPYMVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P ETILC DS+QSMY+QMLCGL    QVLR+G +FAS  +RAI FL+ +W+ L  DIRTG
Sbjct  196   PNETILCADSYQSMYTQMLCGLVERAQVLRLGAVFASGLLRAIRFLQLNWQQLAEDIRTG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             +LN ++ DP+VR+ + R++KP+P LAEFI KEC++++W+GII RIW NTKY+DV+VTGAM
Sbjct  256   SLNGKVLDPAVRDCIGRMLKPDPALAEFIVKECSRDNWEGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+Y+   LPL  T Y SSEC F +NLNP+ +P+EV+YTI+P MAYFEF+P    
Sbjct  316   AQYIPTLDYYSGGLPLACTMYASSECYFGLNLNPMCQPSEVSYTIMPNMAYFEFMP----  371

Query  951   IGVPEPN--------PVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTP  796
                 EPN        P +++DLVDV++G+EYE+V+TTYAGL RYRVGDILRV GF N  P
Sbjct  372   ---HEPNSHESFRDSPPKLVDLVDVEVGKEYELVITTYAGLCRYRVGDILRVTGFHNAAP  428

Query  795   QFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVL  616
             QF+FV RKNV LSID+DKTDE EL  AV+NAS +L  F+ S++EYTS+A+T TIPGHYV+
Sbjct  429   QFHFVRRKNVLLSIDSDKTDEAELQKAVENASELLREFNTSVVEYTSYADTKTIPGHYVI  488

Query  615   YWE-ITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMM  439
             YWE +T+   N       + CC A+EES+NSVYR+CRV+D SIGPLEIR+V++GTF+++M
Sbjct  489   YWELLTKDLANSPSGDALDRCCLAMEESMNSVYRQCRVADNSIGPLEIRVVKSGTFEELM  548

Query  438   DYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             DYAI+ G+SI+QYK PRCV+  PI+ELLDSRV+S++FSP  P W P  + 
Sbjct  549   DYAISRGASINQYKVPRCVSFRPIMELLDSRVVSSHFSPAQPHWTPERRR  598



>ref|XP_006339838.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like 
[Solanum tuberosum]
Length=599

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/584 (60%), Positives = 440/584 (75%), Gaps = 4/584 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + ++LQFI+D+T N    Q RVL  IL+ NA  EYL R  ++G+ DRETFK  +PVVT
Sbjct  17    EKDAKVLQFIDDMTKNIDPEQVRVLAEILTRNANTEYLQRFNISGAIDRETFKSKVPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED+KPDI+R+ANG+ S I  S PISEF TSSGTS GE KL+PT  +ELER+    +LL 
Sbjct  77    YEDLKPDIDRIANGDRSPIFSSHPISEFLTSSGTSAGERKLMPTVADELERRQKLYNLLQ  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLF++ E KTP GL+ARPVLTS  K   FK R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFIKAETKTPSGLVARPVLTSYYKSEQFKTRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P ETILC DSFQSMYSQMLCGL   ++VLRVG +FAS  +RAI FL+ +W+ L  DI +G
Sbjct  196   PNETILCVDSFQSMYSQMLCGLLMREEVLRVGAVFASGLLRAIRFLQLNWKQLSQDIASG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNPR++DPS+R  ++ I+KPNP LAEF+ KEC  E+W+GII RIW NTKY+DV+VTGAM
Sbjct  256   TLNPRVSDPSIRNCISEILKPNPQLAEFVSKECEGENWEGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS--  958
             +QYIPTL+Y+   LP V T Y SSEC F +NLNP+ KP+EV YTI+P M YFEF+P    
Sbjct  316   AQYIPTLDYYSGGLPKVCTMYASSECYFGLNLNPMCKPSEVCYTIMPNMGYFEFIPHDSV  375

Query  957   REIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVC  778
               + +   +P  ++DL DV++G+EYE+V+TTYAGL RYRVGDIL+V GF N  PQF FV 
Sbjct  376   NPVQISRDSPPHLVDLADVEIGKEYELVITTYAGLCRYRVGDILQVTGFHNLAPQFKFVR  435

Query  777   RKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-IT  601
             RKNV LSID+DKTDE EL  A++NA+ +L P+D +L+EYTS A+T TIPGHYV+YWE + 
Sbjct  436   RKNVLLSIDSDKTDESELQTAIENATALLRPYDTTLVEYTSFADTKTIPGHYVIYWELLV  495

Query  600   QSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIAS  421
             +   NP    +   CC A+EESLNSVYR+CRV+D SIGPLEIR+V+NGTF+++MDYAI+ 
Sbjct  496   KDPSNPPSDDVLSQCCLAMEESLNSVYRQCRVADNSIGPLEIRVVKNGTFEELMDYAISR  555

Query  420   GSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             G+SI+QYK PRCV   PIVELLDSRV+S  FSPK P W P  + 
Sbjct  556   GASINQYKAPRCVNFTPIVELLDSRVISVNFSPKTPHWTPERRR  599



>ref|XP_009617606.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Nicotiana tomentosiformis]
Length=595

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/582 (60%), Positives = 447/582 (77%), Gaps = 4/582 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T NA  VQERVL  IL+ N+  EYL R  L+G +D ETFK  IPVVT
Sbjct  17    EKDAKALQFIEEMTRNADAVQERVLNEILTRNSQTEYLKRFKLDGVSDPETFKNKIPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+A G+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIAYGDRSPILSAHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLF++ E KTPGGLLARPVLTS  K  +FK+R + +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFIKSETKTPGGLLARPVLTSYYKSEHFKRRPH-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL+  +QVLR+G +FAS  +RAI FL+ HW  L HDIRTG
Sbjct  196   PNEAILCADSFQSMYTQMLCGLYEREQVLRLGAVFASGLVRAIRFLQLHWPQLAHDIRTG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNP ITDPS+ E +  +++PNP LA+F+  EC+ E+W+GII RIW  TKY+DV+VTGAM
Sbjct  256   TLNPEITDPSICERMGLVMRPNPKLADFVTDECSNENWEGIIARIWPKTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+Y+   LP   T Y +SEC F +NLNP+ KP+EV+YTI+P M YFEFLP   +
Sbjct  316   AQYIPTLDYYSGGLPKACTMYAASECYFGLNLNPMCKPSEVSYTIMPNMGYFEFLP--HD  373

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
                   +  +++DLVDV++G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV RK
Sbjct  374   PNSSRDSTRKLVDLVDVEVGKEYELVITTYAGLYRYRVGDILRVTGFHNSAPQFHFVRRK  433

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQSS  592
             NV LSID+DKTDE EL  AV+NAS +L  F+ S++EYTS+A+T TIPGHYV+YWE+    
Sbjct  434   NVLLSIDSDKTDEAELQRAVENASKLLKEFNTSVVEYTSYADTKTIPGHYVIYWELLMKD  493

Query  591   ENPIPR-YIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
              N  P   +   CC A+EESLN+VYR+ RV+  SIGPLEIR+V+NGTF+++MDYAI+ G+
Sbjct  494   LNNSPSDEVLNKCCLAMEESLNTVYRQGRVACNSIGPLEIRMVKNGTFEELMDYAISRGA  553

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             SI+QYK PRCV+ API+ELLDSRVMS +FSP  P+W P  + 
Sbjct  554   SINQYKVPRCVSFAPILELLDSRVMSRHFSPSLPQWTPERRR  595



>gb|ADK27716.1| GH3 [Dimocarpus longan]
Length=596

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/582 (60%), Positives = 451/582 (77%), Gaps = 3/582 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             + + + LQFIE++T NA  VQERVL  IL+ NA VEYL R+ L+G+TDR+TFK  +PV+T
Sbjct  17    DKDAKALQFIEEITRNAELVQERVLAEILARNADVEYLKRYKLDGATDRDTFKSKLPVIT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S+I+ + PISEF TSSGTS GE KL+PT +EEL+R+ +  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSNILSAHPISEFLTSSGTSAGERKLMPTIKEELDRRQMLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E KTPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETKTPGGLLARPVLTSYYKSDHFKTRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMYSQMLCGL    QVLR+  +FAS  +RAI FL+ HW+ L +D+ TG
Sbjct  196   PNEAILCADSFQSMYSQMLCGLLDRLQVLRLRAVFASGLLRAIRFLQLHWQSLSNDLETG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TL+P+ITDPS+R  +A  +KP+ +LA+FI  EC+K++W+GII R+W NTKY+DV+VTGAM
Sbjct  256   TLSPKITDPSIRNCMAGTLKPDSELADFIRNECSKQNWEGIITRVWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+++   LPL  T Y SSEC F +NLNP+ KP+EV+YTI+P MAYFEFLP    
Sbjct  316   AQYIPTLDHYSGGLPLACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMAYFEFLPHEPG  375

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
                    P  ++DLVDV++G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV RK
Sbjct  376   STATGSAP-RLVDLVDVEVGKEYELVITTYAGLYRYRVGDILRVTGFHNSAPQFHFVRRK  434

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-ITQS  595
             NV LSID+DKTDE EL +AV+NAS +L  F+ S++EYTS+A+T+TIPGHYV++WE + + 
Sbjct  435   NVLLSIDSDKTDEAELQSAVQNASQLLREFNTSVVEYTSYADTTTIPGHYVIFWELLVKD  494

Query  594   SENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
             S N     +   CC A+E SLNSVYR+ RV+D SIGPLE+R+V NGTF+++MDYAI+ G+
Sbjct  495   SANSPSEEVLNQCCLAMENSLNSVYRQGRVADNSIGPLELRVVRNGTFEELMDYAISRGA  554

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             SI+QYK PRCV   PI+ELLDSRV+S + SP  P W+P  + 
Sbjct  555   SINQYKVPRCVNFTPILELLDSRVVSAHLSPALPRWSPERRR  596



>ref|XP_003539320.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
isoform 1 [Glycine max]
 gb|KHN12966.1| Putative indole-3-acetic acid-amido synthetase GH3.1 [Glycine 
soja]
Length=593

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/583 (60%), Positives = 450/583 (77%), Gaps = 4/583 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE+VT N   VQERVL  IL+ NA  EYL R GLNG+TDR+TFK  +PVVT
Sbjct  11    ERSAKALQFIEEVTKNTDSVQERVLTEILTQNAETEYLKRFGLNGATDRDTFKSKVPVVT  70

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++PDI R+ANG+ S I+CS PISEF TSSGTS GE KL+PT  EE++R+ L  SLLM
Sbjct  71    YEDLQPDIQRIANGDSSPILCSHPISEFLTSSGTSAGERKLMPTIHEEMDRRQLLYSLLM  130

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+NQ+V DL KGK ++FLF++ EAKTPGGL+ARPVLTS  K   F+KR + +PY   TS
Sbjct  131   PVMNQYVSDLDKGKALHFLFIKAEAKTPGGLVARPVLTSYYKSEQFRKRPF-DPYNVLTS  189

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL    +VLRVG +FAS  +RAI FL+ +W  L HDI TG
Sbjct  190   PNEAILCPDSFQSMYTQMLCGLIMRHEVLRVGAVFASGLLRAIRFLQLNWEQLSHDILTG  249

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNP+IT+PS++E +++I+KP+P LA FI+ EC+ E+W+ II RIW NTKY+DV+VTGAM
Sbjct  250   TLNPKITEPSIKERMSKILKPDPQLAAFIKNECSVENWERIIVRIWPNTKYLDVIVTGAM  309

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV--S  958
             +QYIPTL+Y+   LP   T Y SSEC F +NL P+S+P++V+YTI+P M YFEFLP   S
Sbjct  310   AQYIPTLDYYSGGLPKPCTMYASSECFFGLNLKPMSEPSDVSYTILPNMGYFEFLPHDDS  369

Query  957   REIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVC  778
               + + + +P  +++L DV+LG+ YE+++TTY+GL RYRVGDIL+V GF N+ PQF FV 
Sbjct  370   SPVTLSKDSPPRLVELADVELGKYYELIITTYSGLCRYRVGDILQVTGFHNSDPQFRFVR  429

Query  777   RKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEI-T  601
             RKNV LSID+DKTDE EL  A++NAS +L  F+ S++EYTS A+T +IPGHYV+YWE+  
Sbjct  430   RKNVLLSIDSDKTDEAELQKAIENASELLKEFNTSVVEYTSFADTKSIPGHYVIYWELMM  489

Query  600   QSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIAS  421
             + S +P    +   CC  +EESLNSVYR+ RV+D SIGPLEIR+V+NGTF+++MDYAI+ 
Sbjct  490   KDSSHPPTNQVLNQCCLVMEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAISR  549

Query  420   GSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             G+SI+QYK PRCV+  PI+ELLDSRV+S +FSP  P W P  +
Sbjct  550   GASINQYKVPRCVSFTPIMELLDSRVVSFHFSPAAPHWTPERR  592



>ref|XP_010691643.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Beta vulgaris subsp. vulgaris]
Length=592

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/582 (59%), Positives = 448/582 (77%), Gaps = 7/582 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + L+FIE++T NA +VQ++VL  ILS NA  EYL R  LN + DRETFK  +P+VT
Sbjct  17    EKDAKALRFIEEMTRNADEVQQKVLGEILSRNAETEYLRRFKLNAAIDRETFKSKLPMVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E KTPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETKTPGGLLARPVLTSYYKSEHFKTRPY-DPYMVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC+DS+QSMYSQMLCGL+  + VLR+G +FAS  +RAI FL+ +WR L  DIR G
Sbjct  196   PNEAILCSDSYQSMYSQMLCGLYERNSVLRLGAVFASGLLRAIRFLQLNWRQLAQDIRVG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
              LN ++TDP++   + +++KP+P+LA+FI  EC K+ W+GII RIW NTKY+DV+VTGAM
Sbjct  256   KLNSKVTDPNICSTMGQVMKPDPELADFITSECEKDQWEGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+++   LP+  T Y SSEC F +NLNP+ KP+EV+YTI+P MAYFEFL +   
Sbjct  316   AQYIPTLDFYSGGLPMACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMAYFEFLSLESA  375

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
                P      ++DLV+V++G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV RK
Sbjct  376   GSSP-----RLVDLVNVEVGKEYELVITTYAGLYRYRVGDILRVTGFHNSAPQFHFVRRK  430

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-ITQS  595
             NV LSID+DKTDE EL  AV+NA+ +L  ++ S++EYTS+A+T TIPGHYV+YWE + + 
Sbjct  431   NVLLSIDSDKTDESELQKAVENATQLLKDYNTSVVEYTSYADTKTIPGHYVIYWELLAKE  490

Query  594   SENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
             S N +P  + + CC A+EESLNSVYR+ RVSD SIGPLEIR+V+NGTF+++MDYAI+ G+
Sbjct  491   SGNSVPSNVLDQCCLAMEESLNSVYRQGRVSDNSIGPLEIRVVKNGTFEELMDYAISRGA  550

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             SI+QYK PRCV   PI+ELLDSRV+S  FSP  P W P  + 
Sbjct  551   SINQYKVPRCVNFTPIMELLDSRVLSVNFSPSLPHWTPERRR  592



>ref|XP_011097389.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Sesamum indicum]
Length=583

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/591 (59%), Positives = 450/591 (76%), Gaps = 13/591 (2%)
 Frame = -1

Query  2055  SSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETF  1876
             ++D  ++ E   + L+FIE++TTNA +VQE+         A  EYL R    G+TDR+TF
Sbjct  2     AADHSSVPEKFAKALEFIEEMTTNADKVQEK---------ADTEYLQRFNPGGATDRQTF  52

Query  1875  KKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERK  1696
             K  +PVVTYED++P+I R+ANG+ S I+CS PISEF TSSGTS GE KL+PT  EE++R+
Sbjct  53    KSRLPVVTYEDLQPEIQRIANGDRSPILCSHPISEFLTSSGTSAGERKLMPTISEEMDRR  112

Query  1695  SLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYT  1516
              L  SLLMPV+N +VP L KGK +YFLF++ E  TPGGL+ARPVLTS  K ++FK R Y 
Sbjct  113   QLLYSLLMPVMNLYVPGLDKGKALYFLFIKAETMTPGGLVARPVLTSYYKSTHFKTRPY-  171

Query  1515  NPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRL  1336
             +PY   TSP E ILC+DSFQSMY+QMLCGL    +VLRVG +FAS  +RAI FL+ HWR 
Sbjct  172   DPYNVYTSPDEAILCSDSFQSMYTQMLCGLLMRHEVLRVGAVFASGLLRAIRFLQTHWRQ  231

Query  1335  LCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYI  1156
             L HDI TG+LNPRI DP+++E +A+I+ PNPDLAEFI KEC  E+W+ IIPRIW NTKY+
Sbjct  232   LAHDISTGSLNPRIIDPAIQERMAKILYPNPDLAEFITKECEGENWERIIPRIWPNTKYL  291

Query  1155  DVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYF  976
             DV+VTGAM+QYIP L+++   LP   T Y SSEC F +NL P++KP EV+YTI+P M YF
Sbjct  292   DVIVTGAMAQYIPLLDFYSGGLPQACTMYASSECYFGLNLKPMTKPAEVSYTIMPNMGYF  351

Query  975   EFLP--VSREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNN  802
             EF+P   +  + +   +P  ++DL DV++G+EYE+VVTTY+GL RYRVGDILRV GF N+
Sbjct  352   EFIPHDPANPVELHRDSPPRLVDLADVEVGKEYELVVTTYSGLCRYRVGDILRVTGFHNS  411

Query  801   TPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHY  622
              PQF F+ RKNV LSIDADKTDE EL  AV+NAS +L   + S++EYTS+A+T+TIPGHY
Sbjct  412   APQFKFIRRKNVLLSIDADKTDESELQKAVENASALLRELNTSVVEYTSYADTNTIPGHY  471

Query  621   VLYWE-ITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDK  445
             V+YWE + +   N   R + E+CC  +EES+NSVYR+CRV+D S+GPLEIR+V+NGTF++
Sbjct  472   VIYWELLVKDPANGPTREVLEECCRVMEESMNSVYRQCRVADNSVGPLEIRVVKNGTFEE  531

Query  444   MMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             +MDYAI+ G+SI+QYK PRCV+  PIVELLD+RV+S +FSP PP W P  +
Sbjct  532   LMDYAISRGASINQYKAPRCVSFTPIVELLDARVLSAHFSPAPPHWTPERR  582



>ref|XP_009782242.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Nicotiana sylvestris]
Length=599

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/584 (60%), Positives = 443/584 (76%), Gaps = 4/584 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T N   VQE+VL  ILS NA  EYL R  + G+TDR+TFK  +PVVT
Sbjct  17    EKDAKALQFIEEMTKNTDSVQEKVLAEILSRNANTEYLQRFKVGGATDRDTFKSKVPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED+KP I+RVANG+ S I  S PISEF TSSGTS GE KL+PT  +ELER+    SLL 
Sbjct  77    YEDLKPYIDRVANGDRSPIFSSHPISEFLTSSGTSAGERKLMPTIADELERRQKLYSLLQ  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLF++ E KTPGGL+ARPVLTS  K   FK R Y +P    TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFIKAETKTPGGLVARPVLTSYYKSEQFKTRPY-DPSNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL   ++VLRVG +FAS  +RAI FL+ +W+ L HDI TG
Sbjct  196   PNEAILCVDSFQSMYTQMLCGLLMREEVLRVGAVFASGLLRAIRFLQLNWQQLAHDIATG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNPR++DPS+R  +++I+KPNP+LAEF+ K C+ ++W+GII RIW NTKY+DV+VTGAM
Sbjct  256   TLNPRVSDPSIRNCMSKILKPNPELAEFVTKGCDGDNWEGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLP--VS  958
             +QYIPTL+Y+   LP   T Y SSEC F +NL P+ KP+EV YTI+P M YFEF+P   +
Sbjct  316   AQYIPTLDYYSGGLPKACTMYASSECYFGLNLKPMCKPSEVCYTIMPNMGYFEFIPHDPA  375

Query  957   REIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVC  778
               + +   +P  ++DL DV+LG+EYE+V+TTYAGL RYRVGDIL+V GF N+ PQF FV 
Sbjct  376   NPVQISHDSPPHLVDLADVELGKEYELVITTYAGLCRYRVGDILQVTGFHNSAPQFKFVR  435

Query  777   RKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-IT  601
             RKNV LSID+DKTDE EL  A++NA+ +L P+D +L+EYTS A+T TIPGHYV+YWE + 
Sbjct  436   RKNVLLSIDSDKTDESELQMAIENATALLRPYDTNLVEYTSFADTKTIPGHYVIYWELLV  495

Query  600   QSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIAS  421
             +   NP  + +   CC A+EESLNSVYR+CR++D SIGPLEIRIV+NGTF+++MDYAI+ 
Sbjct  496   KDPTNPPSQEVLNQCCLAMEESLNSVYRQCRLADNSIGPLEIRIVKNGTFEELMDYAISR  555

Query  420   GSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             G+SI+QYK PRCV   PIVELLDSRV+S +FSP  P W P  + 
Sbjct  556   GASINQYKAPRCVNFTPIVELLDSRVVSVHFSPAAPHWTPERRR  599



>gb|KHG22898.1| Uncharacterized protein F383_10696 [Gossypium arboreum]
Length=606

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/597 (59%), Positives = 451/597 (76%), Gaps = 5/597 (1%)
 Frame = -1

Query  2070  DALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGST  1891
             D+  SS    +L E + + LQFIE++T N   VQER+L  ILS NA  EYL R  LNG+T
Sbjct  12    DSTLSSVVGASLSEKDAKALQFIEEMTKNVDSVQERILGEILSRNADTEYLKRFQLNGAT  71

Query  1890  DRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEE  1711
             DR+TFK  +PVVTYED++P+I R+ANG+ S I+ S PISEF TSSGTS GE KL+PT  E
Sbjct  72    DRDTFKSKVPVVTYEDLQPEIQRIANGDKSPILSSHPISEFLTSSGTSAGERKLMPTIHE  131

Query  1710  ELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFK  1531
             EL R+ L  SLLMPV+N +VP L KGK +YFLF++ E KTPGGLLARPVLTS  K  +FK
Sbjct  132   ELNRRQLLYSLLMPVMNLYVPGLDKGKGLYFLFIKAETKTPGGLLARPVLTSYYKSDHFK  191

Query  1530  KRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLE  1351
              R Y +P+   TSP ETILC DS QSMY+QMLCGL   ++VLRVG +FAS  ++AI FL+
Sbjct  192   SRPY-DPFNVYTSPNETILCPDSIQSMYAQMLCGLIMREEVLRVGAVFASGLLKAIRFLQ  250

Query  1350  KHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWR  1171
              +W+   +DI TGTLNP++TDPSVRE +++I+KPNP+LA FI KEC++E+W+ II RIW 
Sbjct  251   VNWKQFAYDIETGTLNPKVTDPSVRECMSKILKPNPELAAFITKECSEENWECIITRIWP  310

Query  1170  NTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIP  991
             NTKY+DV+VTGAM+QYIPTL Y+   LP+  T Y SSEC F +NL P+ KP+EV+YTI+P
Sbjct  311   NTKYLDVIVTGAMAQYIPTLEYYSGGLPMACTMYASSECYFGLNLKPMCKPSEVSYTIMP  370

Query  990   TMAYFEFLPV--SREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVA  817
              MAYFEFLP   S        +P  ++DL D+++G+EYE++VTTYAGL RYRVGDILRV 
Sbjct  371   NMAYFEFLPHDDSSAQDSSRDSPPRLVDLADLEVGKEYELIVTTYAGLCRYRVGDILRVT  430

Query  816   GFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTST  637
             GF N  PQF F+ RKNV LSID+DKTDE EL  A++NAS +L  F+ S++EYTS+A+T  
Sbjct  431   GFHNAAPQFRFIRRKNVLLSIDSDKTDESELQQAIENASVLLKEFNTSVVEYTSYADTKQ  490

Query  636   IPGHYVLYWEI-TQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVEN  460
             IPGHYV+YWE+  + + N     +   CCF +EESLN+VYR+CRV+D SIGPLEIR+V+N
Sbjct  491   IPGHYVIYWELFVKDAANAPTDEVLSQCCFQMEESLNAVYRQCRVAD-SIGPLEIRVVKN  549

Query  459   GTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             GTF+++MDYAI+ G+SI+QYK PRCV+  PI+ELLDSRV+S +FS   P W P  + 
Sbjct  550   GTFEELMDYAISRGASINQYKVPRCVSFTPIMELLDSRVVSKHFSRALPHWTPDRRR  606



>ref|XP_006351399.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Solanum 
tuberosum]
Length=594

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/588 (60%), Positives = 438/588 (74%), Gaps = 17/588 (3%)
 Frame = -1

Query  2013  LQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVTYEDVKP  1834
             L+FIE+VT+N  +VQ+ VL  ILS NA VEYL  HGLNG TDR+TFKKLIPV+TY+D++P
Sbjct  10    LEFIEEVTSNVDEVQKNVLAEILSQNAHVEYLQGHGLNGHTDRDTFKKLIPVITYQDIQP  69

Query  1833  DINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLMPVINQF  1654
              INR+ NG+ S I+CS PISE   S+GTS GE+KLIPTTE EL R+     L M V+ Q 
Sbjct  70    HINRIVNGDKSPILCSQPISELLASTGTSGGESKLIPTTEGELGRRFQLVKLQMSVMRQA  129

Query  1653  VPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTSPRETIL  1474
             VP+   G  MY +F++ E KTPGGL AR + TS+ K  YF    Y +   D TSP  TIL
Sbjct  130   VPNYGNGIAMYLMFIKSEEKTPGGLTARALSTSMIKSPYFD---YNHHQNDRTSPTATIL  186

Query  1473  CTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTGTLNPRI  1294
             C DS+QSMYSQMLCGL    QVL VG+ F   FIRAI FLEKHW LLC DIRTG+++  I
Sbjct  187   CPDSYQSMYSQMLCGLCQNQQVLHVGSFFVITFIRAIRFLEKHWSLLCKDIRTGSVDASI  246

Query  1293  TDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAMSQYIPT  1114
             TDPSVR+AV  I+KP+P LA+FIE EC+++SWKGII R+W N  Y++  VTG M+QYIPT
Sbjct  247   TDPSVRDAVMEILKPDPKLADFIEAECSRDSWKGIITRLWPNATYVNATVTGTMAQYIPT  306

Query  1113  LNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLP------VSRE  952
             L+Y+ N LPLV+T Y++SEC F INLNP  KP+EVAYT+I TMAYFEFLP      V   
Sbjct  307   LDYYSNSLPLVNTMYIASECSFGINLNPFCKPSEVAYTLIRTMAYFEFLPNQVSDGVINS  366

Query  951   IGVP----EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNF  784
             I +P    +    +++DL DVK+GQEYE+VVTTY+GLYRYRV D+LRVAG+KNN PQFNF
Sbjct  367   ISMPKSLTKKEQQQLVDLADVKIGQEYELVVTTYSGLYRYRVSDVLRVAGYKNNAPQFNF  426

Query  783   VCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEI  604
             +CR+NV LSID DKT+EVEL NA  N    L PFDA + EYTS+ + +TIP HYVL+WE+
Sbjct  427   LCRENVVLSIDDDKTNEVELQNAAGN----LFPFDAHVTEYTSYVDIATIPSHYVLFWEL  482

Query  603   TQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIA  424
               +  NPIP  +FEDCC  +EESLNS YR+ R SDKSIGPLEIR+VE GTFD +MDY I+
Sbjct  483   RVNGSNPIPPSVFEDCCLTIEESLNSFYRKGRASDKSIGPLEIRVVEIGTFDNLMDYCIS  542

Query  423   SGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNT  280
              G+S++QYK P CV  AP+V+LL+SRV+S+YFSP  P+W P +K+  T
Sbjct  543   LGASMNQYKTPLCVKFAPLVDLLNSRVVSSYFSPMCPKWVPRYKNGTT  590



>ref|XP_004289743.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like 
[Fragaria vesca subsp. vesca]
Length=596

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/584 (60%), Positives = 448/584 (77%), Gaps = 7/584 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE  T NA  VQERVL  ILS NA  EYL R+ L G+TDR++FK  +PV+T
Sbjct  17    EKDAKALQFIEQTTRNAAGVQERVLAEILSRNAETEYLRRYKLGGATDRKSFKSKVPVIT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+    +LLM
Sbjct  77    YEDLQPEIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIQEELDRRQSLYNLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N  VP L KGK +YFLFV+ E+KTPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  137   PVMNLCVPGLDKGKGLYFLFVKSESKTPGGLLARPVLTSYYKSEHFKTRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL    QVLR+G +FAS  +RAI FL+ +W+ L  DIRTG
Sbjct  196   PNEAILCADSFQSMYTQMLCGLLERHQVLRLGAVFASGLLRAIRFLQLNWQQLAADIRTG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLN +ITDP ++E + R +KP+ +LAEF+ ++C +E+W+GII RIW NTKY+DV+VTGAM
Sbjct  256   TLNSKITDPELKECMERTLKPDSELAEFVAEQCGEENWEGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS-R  955
             +QYIPTL+Y+   LP+  T Y SSEC F +NLNP+ KP+EV+YTI+P MAYFEFLP    
Sbjct  316   AQYIPTLDYYSGGLPMACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMAYFEFLPYDPN  375

Query  954   EIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCR  775
              +G+   +P  ++DLVDV++G+EYE+V++TYAGLYRYRVGDILRV GF N+ PQF+FV R
Sbjct  376   SMGL---DPTRLVDLVDVEVGREYELVISTYAGLYRYRVGDILRVTGFHNSAPQFHFVRR  432

Query  774   KNVALSIDADKTDEVELHNAVKNASNILL-PFDASLIEYTSHANTSTIPGHYVLYWE-IT  601
             KNV LSID+DKTDE EL  AV NAS ++L   +AS++EYTS A+T TIPGHYV+YWE + 
Sbjct  433   KNVLLSIDSDKTDEAELQLAVDNASKLVLEKLNASVVEYTSFADTKTIPGHYVIYWELLV  492

Query  600   QSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIAS  421
             + S  P        CC A+EESLNSVYR+CRV+D SIGPLEIR+V++GTF+++MDYAI+ 
Sbjct  493   KDSAEPPSSESLSQCCLAMEESLNSVYRQCRVADNSIGPLEIRVVKSGTFEELMDYAISR  552

Query  420   GSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             G+SI+QYK PRCV   PI+ELLDSRV+S +FSP  P W P  + 
Sbjct  553   GASINQYKVPRCVNFTPIMELLDSRVVSKHFSPSLPHWTPERRR  596



>ref|XP_007047426.1| Auxin-responsive GH3 family protein [Theobroma cacao]
 gb|EOX91583.1| Auxin-responsive GH3 family protein [Theobroma cacao]
Length=598

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/583 (60%), Positives = 443/583 (76%), Gaps = 3/583 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T N   VQE VL  ILS NA  EYL R+ LNG+TDR+TFK  IPVVT
Sbjct  17    EKDAKALQFIEEITKNVDSVQETVLGEILSRNAETEYLKRYKLNGATDRKTFKSKIPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ + PISEF TSSGTS GE KL+PT  EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIANGDKSPILSAHPISEFLTSSGTSAGERKLMPTIHEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E KTPGGLLARPVLTS  K  +FK R Y +P+   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKAETKTPGGLLARPVLTSYYKSEHFKTRPY-DPFNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMYSQMLCGL   ++VLRVG +FAS  +RAIHFL+ +W+ L HDI TG
Sbjct  196   PNEAILCADSFQSMYSQMLCGLIMREEVLRVGAVFASGLLRAIHFLQINWKQLAHDITTG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNP++TD S+RE +++I+KPN +LAEFI KEC +E+W+GII RIW NTKY+DV+VTGAM
Sbjct  256   TLNPKVTDASIRECMSKILKPNQELAEFITKECLEENWEGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL Y+   LP+  T Y SSEC F +NL P+ KP+EV YTI+P MAYFEF P    
Sbjct  316   AQYIPTLEYYSGGLPMACTMYASSECYFGLNLKPMCKPSEVTYTIMPNMAYFEFWPHESS  375

Query  951   IGV-PEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCR  775
               V    +P  ++DL D+++G+EYE+++TTYAGL RYRVGDIL+V GF N  PQF F+ R
Sbjct  376   TSVLSRDSPPRLVDLADLEVGKEYELIITTYAGLCRYRVGDILQVTGFHNAAPQFRFIRR  435

Query  774   KNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-ITQ  598
             KNV LSI++DKTDE EL  A++NAS +L  F+ S++EYTS+A+T  IPGHYV+YWE + +
Sbjct  436   KNVLLSIESDKTDEAELQKAMENASVLLKEFNTSVVEYTSYADTKEIPGHYVIYWELLIK  495

Query  597   SSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASG  418
                N     +   CC  +EESLNSVYR+ RV+D SIGPLEIR+V++GTF+++MDYAI+ G
Sbjct  496   DPANAPTDAVLNQCCLQMEESLNSVYRQSRVADNSIGPLEIRVVKDGTFEELMDYAISRG  555

Query  417   SSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             +SI+QYK PRCV+  PI+ELLDSRV+S +FSP  P W P  + 
Sbjct  556   ASINQYKVPRCVSFTPIMELLDSRVVSKHFSPALPHWTPERRR  598



>gb|KHN36267.1| Putative indole-3-acetic acid-amido synthetase GH3.1 [Glycine 
soja]
Length=579

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/577 (60%), Positives = 444/577 (77%), Gaps = 4/577 (1%)
 Frame = -1

Query  2013  LQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVTYEDVKP  1834
             LQFIE VT N   VQERVL  IL+ NA  EYL R  LNG+TDR+TFK  +PVVTYED++P
Sbjct  3     LQFIEQVTKNTDSVQERVLSEILTQNAETEYLKRFALNGATDRDTFKSKVPVVTYEDLQP  62

Query  1833  DINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLMPVINQF  1654
             DI R+ANG+ S I+C+ PISEF TSSGTS GE KL+PT  EE++R+ L  SLLMPV+NQ+
Sbjct  63    DIERIANGDRSPILCAHPISEFLTSSGTSAGERKLMPTIHEEMDRRQLLYSLLMPVMNQY  122

Query  1653  VPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTSPRETIL  1474
             V DL KGK ++FLF++ EAKTPGGL+ARPVLTS  K   F+KR + +PY   TSP E IL
Sbjct  123   VSDLDKGKALHFLFIKAEAKTPGGLMARPVLTSYYKSEQFRKRPF-DPYNVLTSPNEAIL  181

Query  1473  CTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTGTLNPRI  1294
             C DSFQSMY+QMLCGL    +VLRVG +FAS  +RAI FL+ +W  L HDI TGTLNP+I
Sbjct  182   CPDSFQSMYTQMLCGLIMRHEVLRVGAVFASGLLRAIRFLQLNWEQLSHDILTGTLNPKI  241

Query  1293  TDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAMSQYIPT  1114
             T+PS++E +++I+KP+P+LA FI+ EC+ E+W+ II RIW NTKY+DV+VTGAM+QYIPT
Sbjct  242   TEPSIKERMSKILKPDPELAAFIKSECSGENWERIIVRIWPNTKYLDVIVTGAMAQYIPT  301

Query  1113  LNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV--SREIGVP  940
             L+Y+   LP   T Y SSEC F +NL P+S+P++V+YTI+P M YFEFLP   S  I + 
Sbjct  302   LDYYSGGLPKPCTMYASSECFFGLNLKPMSEPSDVSYTILPNMGYFEFLPHDDSSPITLS  361

Query  939   EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRKNVAL  760
             + +P  +++L DV+LG+ YE+++TTYAGL RYRVGDIL+V GF N+ PQF FV RKNV L
Sbjct  362   KDSPPRLVELADVELGKYYELIITTYAGLCRYRVGDILQVTGFHNSDPQFRFVRRKNVLL  421

Query  759   SIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEI-TQSSENP  583
             SID+DKTDE EL  AV+NAS +L  F+ S+ EYTS A+T +IPGHYV+YWE+  + S +P
Sbjct  422   SIDSDKTDEAELQKAVENASELLKEFNTSVAEYTSFADTKSIPGHYVIYWELMMKDSSHP  481

Query  582   IPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGSSISQ  403
                     CC  +EESLNSVYR+ RV+D SIGPLEIR+V+NGTF+++MDYAI+ G+SI+Q
Sbjct  482   PTNQALNQCCLVMEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAISRGASINQ  541

Query  402   YKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             YK PRCV+  PI+ELLDSRV+S +FSP  P W P  +
Sbjct  542   YKVPRCVSFTPIMELLDSRVLSFHFSPAAPHWTPERR  578



>ref|XP_004490325.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like 
[Cicer arietinum]
Length=601

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/585 (60%), Positives = 449/585 (77%), Gaps = 6/585 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T NA  VQERVL  ILS NA  EYL R  L+G+ DRETFK  IPV+T
Sbjct  17    EKDAKALQFIEEMTRNADTVQERVLAEILSRNAETEYLKRFKLDGAIDRETFKTKIPVIT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDIQPEIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E KTP GLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETKTPSGLLARPVLTSYYKSDHFKTRPY-DPYMVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL   +QVLR+G +FAS  +RAI FL+ +W  L HDIRTG
Sbjct  196   PNEAILCPDSFQSMYTQMLCGLIERNQVLRLGAVFASGLLRAIRFLQLNWVELAHDIRTG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TL+ RIT+P ++  + + +KP+P+LA F+ +EC+K++W+GII +IW NTKY+DV+VTGAM
Sbjct  256   TLSSRITNPMIKNHMNKFIKPDPELASFVIQECSKDNWEGIITKIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV-SR  955
             +QYIPTLNY+   LPL  T Y SSEC F +NLNP+ KP+EV+YTI+P MAYFEFLP  SR
Sbjct  316   AQYIPTLNYYSGGLPLACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMAYFEFLPHNSR  375

Query  954   EI---GVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNF  784
                  G+   +   ++DL DV++G+EYE+V+TTYAGLYRY VGDILRV GF N+ PQF+F
Sbjct  376   STNYHGLTRESCSRLVDLADVEVGKEYELVITTYAGLYRYHVGDILRVTGFHNSAPQFHF  435

Query  783   VCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-  607
             V RKNV LSID+DKTDE EL  A++NAS +L+ F+ S++EYTS+A+T TIPGHYV+YWE 
Sbjct  436   VRRKNVLLSIDSDKTDESELQRAMENASKLLVEFNTSVVEYTSYADTKTIPGHYVIYWEL  495

Query  606   ITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAI  427
             +T+   N     +   CC  +EESLNSVYR+CRV+D SIGPLEIR+V+ GTF+++MDYAI
Sbjct  496   LTKDISNSPSNEVLNQCCLEMEESLNSVYRQCRVADHSIGPLEIRVVKKGTFEELMDYAI  555

Query  426   ASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             + G+SI+QYK PRCV+  PI+ELLDSRV+S +FS   P W P  +
Sbjct  556   SRGASINQYKVPRCVSFTPIMELLDSRVVSVHFSQDLPHWTPERR  600



>ref|XP_006573649.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like 
[Glycine max]
Length=579

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/577 (60%), Positives = 445/577 (77%), Gaps = 4/577 (1%)
 Frame = -1

Query  2013  LQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVTYEDVKP  1834
             LQFIE VT N   VQERVL  IL+ NA  EYL R  LNG+TDR+TFK  +PVVTYED++P
Sbjct  3     LQFIEQVTKNTDSVQERVLSEILTQNAETEYLKRFALNGATDRDTFKSKVPVVTYEDLQP  62

Query  1833  DINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLMPVINQF  1654
             DI R+ANG+ S I+C+ PISEF TSSGTS GE KL+PT  EE++R+ L  SLLMPV+NQ+
Sbjct  63    DIERIANGDRSPILCAHPISEFLTSSGTSAGERKLMPTIHEEMDRRQLLYSLLMPVMNQY  122

Query  1653  VPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTSPRETIL  1474
             V DL KGK ++FLF++ EAKTPGGL+ARPVLTS  K   F+KR + +PY   TSP E IL
Sbjct  123   VSDLDKGKALHFLFIKAEAKTPGGLMARPVLTSYYKSEQFRKRPF-DPYNVLTSPNEAIL  181

Query  1473  CTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTGTLNPRI  1294
             C DSFQSMY+QMLCGL    +VLRVG +FAS  +RAI FL+ +W  L HDI TGTLNP+I
Sbjct  182   CPDSFQSMYTQMLCGLIMRHEVLRVGAVFASGLLRAIRFLQLNWEQLSHDILTGTLNPKI  241

Query  1293  TDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAMSQYIPT  1114
             T+PS++E +++I+KP+P+LA FI+ EC+ E+W+ II RIW NTKY+DV+VTGAM+QYIPT
Sbjct  242   TEPSIKERMSKILKPDPELAAFIKSECSGENWERIIVRIWPNTKYLDVIVTGAMAQYIPT  301

Query  1113  LNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV--SREIGVP  940
             L+Y+   LP   T Y SSEC F +NL P+S+P++V+YTI+P M YFEFLP   S  I + 
Sbjct  302   LDYYSGGLPKPCTMYASSECFFGLNLKPMSEPSDVSYTILPNMGYFEFLPHDDSSPITLS  361

Query  939   EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRKNVAL  760
             + +P  +++L DV+LG+ YE+++TTYAGL RYRVGDIL+V GF N+ PQF FV RKNV L
Sbjct  362   KDSPPRLVELADVELGKYYELIITTYAGLCRYRVGDILQVTGFHNSDPQFRFVRRKNVLL  421

Query  759   SIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEI-TQSSENP  583
             SID+DKTDE EL  AV+NAS +L  F+ S+ EYTS A+T +IPGHYV+YWE+  + S +P
Sbjct  422   SIDSDKTDESELQKAVENASELLKEFNTSVAEYTSFADTKSIPGHYVIYWELMMKDSSHP  481

Query  582   IPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGSSISQ  403
                 +   CC  +EESLNSVYR+ RV+D SIGPLEIR+V+NGTF+++MDYAI+ G+SI+Q
Sbjct  482   PTNQVLNQCCLVMEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAISRGASINQ  541

Query  402   YKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             YK PRCV+  PI+ELLDSRV+S +FSP  P W P  +
Sbjct  542   YKVPRCVSFTPIMELLDSRVLSFHFSPAAPHWTPERR  578



>ref|XP_011012296.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Populus euphratica]
Length=598

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/585 (60%), Positives = 447/585 (76%), Gaps = 15/585 (3%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIED+T N   VQERVLK IL+ NA  EYL ++ LNG+TDR++FK  IP+VT
Sbjct  17    EKDAKALQFIEDMTANVDLVQERVLKEILTSNAETEYLQKYHLNGATDRDSFKSKIPMVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ S PISEF TSSGTS GE KL+PT EEE++R+ L  SLLM
Sbjct  77    YEDLQPEIQRIANGDKSPILSSHPISEFLTSSGTSAGERKLMPTIEEEMDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YF F++ EAKTPGGL+ARPVLTS  K   FK R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFYFIKAEAKTPGGLVARPVLTSYYKSKQFKTRPY-DPYNVITS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P ETILC DSFQSMYSQMLCGL   ++VLRVG +FAS  +RAI FL+ +W+ L +DI TG
Sbjct  196   PNETILCVDSFQSMYSQMLCGLIMREEVLRVGAVFASGLLRAIRFLQLNWKELANDISTG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             +LNP++T+PS+RE +A+I+KPN +LAEFI KEC+ E+W+ II RIW NTKY+DV+VTGAM
Sbjct  256   SLNPKVTNPSIRECMAKILKPNQELAEFITKECSDENWERIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLP----  964
             +QYIPTL+Y+   LP   T Y SSEC F +NL P+SKP+EV+YT++P M YFEFLP    
Sbjct  316   AQYIPTLDYYSGGLPKPCTMYASSECFFGLNLRPMSKPSEVSYTMMPNMGYFEFLPHDPS  375

Query  963   ---VSREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQ  793
                 SRE      +P  +LDL D+++G+EYE+V+TTY+GL RYRVGDIL V GF N  PQ
Sbjct  376   APAFSRE------SPPRLLDLADLEVGKEYELVITTYSGLNRYRVGDILLVTGFYNKAPQ  429

Query  792   FNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLY  613
             F FV RKNV LSI++DKTDE EL  A++NAS +L  F+ S++EYTS+A+T  IPGHYV+Y
Sbjct  430   FRFVRRKNVLLSIESDKTDEAELQKAIENASLLLREFNTSVVEYTSYADTKIIPGHYVIY  489

Query  612   WE-ITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMD  436
             WE + +   N     +   CC A+EESLNSVYR+ RV+D SIGPLEIR+V+NGTF+++MD
Sbjct  490   WELLVKDPANSPTEEVLNQCCLAMEESLNSVYRQSRVADNSIGPLEIRVVKNGTFEELMD  549

Query  435   YAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAP  301
             YAI+ G+SI+QYK PRCV+  PI+ELLD RV+S +FSP  P W P
Sbjct  550   YAISRGASINQYKVPRCVSFTPIMELLDFRVVSKHFSPSAPHWTP  594



>ref|XP_009350660.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Pyrus x bretschneideri]
Length=601

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/592 (59%), Positives = 449/592 (76%), Gaps = 20/592 (3%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             + + + LQFIE+ T NA  VQERVL  IL+ NA  EYL R  L G+TDR+TFK  +PV+T
Sbjct  16    DKDAKALQFIEETTRNADAVQERVLSEILARNAQTEYLKRFELGGATDRKTFKSKLPVIT  75

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  76    YEDLQPEIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLM  135

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N  VP L KGK +YFLFV+ E KTPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  136   PVMNLCVPGLDKGKGLYFLFVKSETKTPGGLLARPVLTSYYKSEHFKTRPY-DPYNVYTS  194

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL   ++VLR+G +FAS  +RAI FL+ +W+ L  DIRTG
Sbjct  195   PNEAILCPDSFQSMYAQMLCGLLEREKVLRLGAVFASGLLRAIRFLQLNWQQLAEDIRTG  254

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TL+ +ITDP ++  +  I++P+P+LA+F+ K+C KE+W GI+ RIW NTKY+DV+VTGAM
Sbjct  255   TLSSKITDPDLKSCIGGILEPDPELADFMSKQCGKENWDGILTRIWPNTKYLDVIVTGAM  314

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+Y+   LP+  T Y SSEC F +NLNP+ KP+EV+YTI+P MAYFEFLP    
Sbjct  315   AQYIPTLDYYSGGLPMACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMAYFEFLPY---  371

Query  951   IGVPEPNPV--------EVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTP  796
                 EPN V         ++DLV+V++G+EYE+V+TTYAGL+RYRVGDILRV GF N+ P
Sbjct  372   ----EPNSVSGGGESGTRLVDLVEVEVGREYELVITTYAGLHRYRVGDILRVTGFHNSAP  427

Query  795   QFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVL  616
             QF+FV RKNV LSID+DKTDE EL  AV NAS +L  F AS++EYTSHA+T+TIPGHYV+
Sbjct  428   QFHFVRRKNVLLSIDSDKTDEAELQLAVDNASKLLKKFSASVVEYTSHADTTTIPGHYVI  487

Query  615   YWEI----TQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
             YWE+    + +SE+     + + CC  +EESLNSVYR+ RV+D SIGPLEIR+V+NGTF+
Sbjct  488   YWELLVKDSTNSESESFDSVMDQCCLTMEESLNSVYRQGRVADNSIGPLEIRVVKNGTFE  547

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             ++MDYAI+ G+SI+QYK PRCV   PI+ELLDSRV+S + SP  P W P  K
Sbjct  548   ELMDYAISRGASINQYKVPRCVNFTPIMELLDSRVISKHISPSLPHWTPERK  599



>ref|XP_010099059.1| hypothetical protein L484_011493 [Morus notabilis]
 gb|EXB76648.1| hypothetical protein L484_011493 [Morus notabilis]
Length=595

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/583 (61%), Positives = 445/583 (76%), Gaps = 8/583 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T NA  VQERVL  IL+ NA  EYL R  L GSTDRET+K  +PV+T
Sbjct  17    EKDAKALQFIEEMTRNADAVQERVLSEILARNAETEYLKRFELGGSTDRETYKSKLPVIT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S+I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSAILSAHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E +TPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETRTPGGLLARPVLTSYYKSDHFKTRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC+DSF SMY+QMLCGL     VLR+G +FAS  IRAI FL+ +W  L  DIR+G
Sbjct  196   PNEAILCSDSFHSMYTQMLCGLLERHHVLRLGAVFASGLIRAIKFLQLNWSNLARDIRSG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNP+I+DP++R  +A I+ P+ DLA+FI  EC+K++W+GII RIW NTKY+DV+VTGAM
Sbjct  256   TLNPKISDPAIRRRLAEILVPDNDLADFISAECSKDNWEGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL Y+   LP+  T Y SSEC F +NLNP+ KP+EV+YTI+P MAYFEFLP    
Sbjct  316   AQYIPTLEYYSAGLPMACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMAYFEFLPDYH-  374

Query  951   IGVPEPNPVEV--LDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVC  778
                P  N  EV  +DLVDV++G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV 
Sbjct  375   ---PNSNSEEVKLVDLVDVEIGKEYELVITTYAGLYRYRVGDILRVTGFHNSAPQFHFVR  431

Query  777   RKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-IT  601
             RKNV LSID+DKTDE EL  AV+NAS +L  F+ S++EYTS+A+T TIPGHYV+YWE + 
Sbjct  432   RKNVLLSIDSDKTDEAELQKAVENASKLLSEFNTSVVEYTSYADTKTIPGHYVIYWELLV  491

Query  600   QSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIAS  421
             + + N     +   CC  +EESLNSVYR+ RV+D SIGPLEIR+V+ GTF+++MDYAI+ 
Sbjct  492   KDAANAPNDDVLGRCCLEMEESLNSVYRQGRVADNSIGPLEIRVVKTGTFEELMDYAISR  551

Query  420   GSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             G+SI+QYK PRCV   PI ELLDSRV+S++FS   P W P  +
Sbjct  552   GASINQYKVPRCVNFTPITELLDSRVVSSHFSLALPHWTPERR  594



>ref|XP_007157602.1| hypothetical protein PHAVU_002G083100g [Phaseolus vulgaris]
 gb|ESW29596.1| hypothetical protein PHAVU_002G083100g [Phaseolus vulgaris]
Length=595

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/585 (60%), Positives = 449/585 (77%), Gaps = 12/585 (2%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             + + + L+FIE++T NA  VQERVL  IL+ NA  EYL R  L  + DR+TFK  IPV++
Sbjct  17    DKDAKALRFIEEMTRNADAVQERVLAEILTRNAHTEYLKRFELGAAADRQTFKSKIPVIS  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YEDV+P+I R+ANG+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDVQPEIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E +TPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETRTPGGLLARPVLTSYYKSDHFKTRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL   + VLR+G +FAS  +RAI FL+ HW  L HDIR+G
Sbjct  196   PNEAILCPDSFQSMYTQMLCGLIERNHVLRLGAVFASGLLRAIRFLQLHWPRLVHDIRSG  255

Query  1311  TLNPRITDPSVREAV-ARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGA  1135
             TL  +ITDP++RE +   ++KP+P LA+F+ +EC+KE W+GII RIW NTKY+DV+VTGA
Sbjct  256   TLTSQITDPAIREYMDNNVIKPDPKLAQFLTEECSKEKWEGIITRIWPNTKYLDVIVTGA  315

Query  1134  MSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL---P  964
             M+QYIPTLNY+   LPL  T Y SSEC F +NLNP+ KP++V+YTI+P MAYFEFL   P
Sbjct  316   MAQYIPTLNYYSGGLPLACTMYASSECYFGLNLNPMCKPSKVSYTIMPNMAYFEFLLHDP  375

Query  963   VSREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNF  784
             +S           +++DLVDV++G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+F
Sbjct  376   ISGSTS------SKLVDLVDVEVGKEYELVITTYAGLYRYRVGDILRVTGFHNSAPQFHF  429

Query  783   VCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-  607
             V RKNV LSID+DKTDE EL N ++NAS +L  F+ S++EYTS+A+T+TIPGHYV+YWE 
Sbjct  430   VRRKNVLLSIDSDKTDESELQNGIENASRLLAEFNTSVVEYTSYADTTTIPGHYVIYWEL  489

Query  606   ITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAI  427
             +++ S N     +   CC  +EE+LNSVYR+CRV+D SIGPLEIR+V+NGTF+++MDYAI
Sbjct  490   LSKDSANSPSHEVLNRCCLEMEEALNSVYRQCRVADHSIGPLEIRVVKNGTFEELMDYAI  549

Query  426   ASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             + G+SI+QYK PRCV   PIVELLDSRV+S +FS + P W P  +
Sbjct  550   SRGASINQYKVPRCVNFTPIVELLDSRVVSVHFSQELPHWTPERR  594



>ref|XP_006380674.1| hypothetical protein POPTR_0007s10350g [Populus trichocarpa]
 gb|ERP58471.1| hypothetical protein POPTR_0007s10350g [Populus trichocarpa]
Length=597

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/588 (60%), Positives = 446/588 (76%), Gaps = 15/588 (3%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIED+T N   VQERVLK IL+ NA  EYL ++ LNG+TDR++FK  IP+VT
Sbjct  16    EKDAKALQFIEDMTANVDLVQERVLKEILTSNAETEYLQKYHLNGATDRDSFKSKIPMVT  75

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P I R+ANG+ S I+ S PISEF TSSGTS GE KL+PT EEE++R+ L  SLLM
Sbjct  76    YEDLQPQIQRIANGDKSPILSSHPISEFLTSSGTSAGERKLMPTIEEEMDRRQLLYSLLM  135

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YF F++ EAKTPGGL+ARPVLTS  K   FK R Y +PY   TS
Sbjct  136   PVMNLYVPGLDKGKGLYFYFIKAEAKTPGGLVARPVLTSYYKSKQFKTRPY-DPYNVITS  194

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P ETILC DSFQSMYSQMLCGL   ++VLRVG +FAS  +RAI FL+ +W+ L +DI TG
Sbjct  195   PNETILCVDSFQSMYSQMLCGLIMREEVLRVGAVFASGLLRAIRFLQLNWKELANDISTG  254

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             +LNP++T+PS+RE +A+I+KPN +LAEFI KEC+ E+W+ II RIW NTKY+DV+VTGAM
Sbjct  255   SLNPKVTNPSIRECMAKILKPNQELAEFITKECSDENWERIITRIWPNTKYLDVIVTGAM  314

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLP----  964
             +QYIPTL+Y+   LP   T Y SSEC F +NL P+S+P+EV+YTI+P M YFEFLP    
Sbjct  315   AQYIPTLDYYSGGLPKPCTMYASSECFFGLNLRPMSEPSEVSYTIMPNMGYFEFLPHDPS  374

Query  963   ---VSREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQ  793
                 SRE      +P  +LDL D+++G+EYE+V+TTY+GL RYRVGDIL V GF N  PQ
Sbjct  375   APAFSRE------SPPRLLDLADLEVGKEYELVITTYSGLNRYRVGDILLVTGFYNKAPQ  428

Query  792   FNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLY  613
             F FV RKNV LSI++DKTDE EL  A+ NAS +L  F+ S++EYTS+A T  IPGHYV+Y
Sbjct  429   FRFVRRKNVLLSIESDKTDEAELQKAIDNASLLLREFNTSVVEYTSYAETKIIPGHYVIY  488

Query  612   WE-ITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMD  436
             WE + +   N     +   CC A+EESLNSVYR+ RV+D SIGPLEIR+V+NGTF+++MD
Sbjct  489   WELLVKDPANSPTEEVLNQCCLAMEESLNSVYRQSRVADNSIGPLEIRVVKNGTFEELMD  548

Query  435   YAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             YAI+ G+SI+QYK PRCV+  PI+ELLDSRV+S +FSP  P W P  +
Sbjct  549   YAISRGASINQYKVPRCVSFTPIMELLDSRVVSKHFSPSVPHWTPERR  596



>ref|XP_003518806.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Glycine max]
Length=595

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/584 (60%), Positives = 451/584 (77%), Gaps = 10/584 (2%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + L+FIE++T NA  VQERVL+ IL+ NA  EYL R  L+G+ DR+ FK  IPV+T
Sbjct  17    EKDAKALRFIEEMTRNADAVQERVLEEILTRNAQTEYLKRFELDGAADRQAFKSKIPVIT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YEDV+P+I R+ANG+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDVQPEIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E +TPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETRTPGGLLARPVLTSYYKSDHFKTRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC+DSFQSMY+QMLCGL     VLR+G +FAS  +RAI FL+ +W  L HDI+TG
Sbjct  196   PNEAILCSDSFQSMYTQMLCGLIERHHVLRLGAVFASGLLRAIRFLQLNWPELAHDIQTG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLN RITDP++R  + +++K +P+LA+F+ ++C+K++W+GII RIW NTKY+DV+VTGAM
Sbjct  256   TLNSRITDPAIRSYMDKVLKSDPELAQFVTQQCSKDNWEGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYF-GNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSR  955
             +QYIPTLNY+ G  LPL  T Y SSEC F +NLNP+ KP+EV+YTI+P MAYFEFLP   
Sbjct  316   AQYIPTLNYYSGGGLPLACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMAYFEFLPHD-  374

Query  954   EIGVPEPNPV--EVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFV  781
                 P+P     ++++L DV++G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV
Sbjct  375   ----PKPGSTSSKLVELADVEVGKEYELVITTYAGLYRYRVGDILRVTGFHNSAPQFHFV  430

Query  780   CRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-I  604
              RKNV LSID+DKTDE EL   ++NAS +L  F+ S++EYTS+A+T+TIPGHYV+YWE +
Sbjct  431   RRKNVLLSIDSDKTDESELQKGIENASKLLSEFNTSVVEYTSYADTTTIPGHYVIYWELL  490

Query  603   TQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIA  424
             T+ S N     +   CC  +EE LNSVYR+CRV+D SIGPLEIR+V NGTF+++MDYAI+
Sbjct  491   TKDSTNSPSHEVLNRCCLEMEECLNSVYRQCRVADHSIGPLEIRVVRNGTFEELMDYAIS  550

Query  423   SGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
              G+SI+QYK PRCV   PI+ELLDSRV+S +FS + P W P  +
Sbjct  551   RGASINQYKVPRCVNFTPIMELLDSRVVSVHFSQELPHWTPERR  594



>ref|XP_009367779.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Pyrus x bretschneideri]
Length=599

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/597 (59%), Positives = 446/597 (75%), Gaps = 4/597 (1%)
 Frame = -1

Query  2070  DALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGST  1891
             D + SS       E + + LQFIE+ T N   VQE VL  IL  NA  EYL R GL G+T
Sbjct  4     DTVTSSPLSPPATEKDAKALQFIEETTRNTDSVQESVLSEILRRNAETEYLKRFGLGGAT  63

Query  1890  DRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEE  1711
             DR++FK  +PVVTYED+ P+I R+ANG+ S I+ S PISEF TSSGTS GE KL+PT  E
Sbjct  64    DRDSFKSKVPVVTYEDLLPEIQRIANGDRSPILSSHPISEFLTSSGTSAGERKLMPTIHE  123

Query  1710  ELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFK  1531
             EL+R++L  SLL PV+N +VPDL KGK +YFLF++ E KTPGGL+ARPVLTS  K  +FK
Sbjct  124   ELDRRTLLYSLLQPVMNLYVPDLDKGKGLYFLFIKAETKTPGGLVARPVLTSYYKSEHFK  183

Query  1530  KRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLE  1351
              R + +PY   TSP E ILC DSFQSMY+QM+CGL    QVLRVG +FAS  +RAI FL+
Sbjct  184   TRPF-DPYNVLTSPNEAILCADSFQSMYTQMVCGLIMRQQVLRVGAVFASGLLRAIRFLQ  242

Query  1350  KHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWR  1171
              +W+ L  DIR GTLNP+ITDPS+RE ++ I+KP+P LA+FI KEC +E+W GII R+W 
Sbjct  243   LNWQQLSLDIRNGTLNPKITDPSLRETMSGILKPDPKLADFITKECCEENWAGIITRVWP  302

Query  1170  NTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIP  991
             NTKY+DV+VTGAM+QYIP L Y+ N LP+  T Y SSEC F +NL P+ KP+EV+YTI+P
Sbjct  303   NTKYLDVIVTGAMAQYIPLLEYYSNGLPMACTMYASSECYFGLNLKPMCKPSEVSYTIMP  362

Query  990   TMAYFEFLPVSREI-GVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAG  814
              MAYFEF+P       + + +P  ++DL D+++G++YE+V+TTYAGL RYRVGDIL V G
Sbjct  363   NMAYFEFIPHDPSAPSLTKHSPPRLVDLADLEVGKKYELVITTYAGLCRYRVGDILEVTG  422

Query  813   FKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTI  634
             F N  PQF FV RKNV LSID+DKTDE EL  A+ NAS +L  F+ +++EYTS+A+T TI
Sbjct  423   FHNAAPQFRFVRRKNVLLSIDSDKTDEAELQKAIDNASVLLREFNTTVVEYTSYADTKTI  482

Query  633   PGHYVLYWE--ITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVEN  460
             PGHYV+YWE  +   + N   R + + CC A+EESLNSVYR+ RV+D SIGPLEIR+V+N
Sbjct  483   PGHYVIYWELLVKDPANNSPSREVLDKCCLAMEESLNSVYRQGRVADNSIGPLEIRVVKN  542

Query  459   GTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             GTF+++MDYAI+ G+SI+QYK PRCV  +PI+ELLDSRV S +FSP  P+W P  +H
Sbjct  543   GTFEELMDYAISRGASINQYKAPRCVNFSPIMELLDSRVFSVHFSPSAPQWTPERRH  599



>ref|XP_002527466.1| Indole-3-acetic acid-amido synthetase GH3.3, putative [Ricinus 
communis]
 gb|EEF34864.1| Indole-3-acetic acid-amido synthetase GH3.3, putative [Ricinus 
communis]
Length=597

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/582 (61%), Positives = 452/582 (78%), Gaps = 3/582 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + L  IE++T NA  VQE+VL  IL+ N  VEYL +  L+G+TDRETFK  +P+VT
Sbjct  17    EKDAKALLLIEEMTRNADLVQEKVLAEILNRNKDVEYLKKFNLDGATDRETFKSKLPMVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S+I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSAILSAHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E +TPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETRTPGGLLARPVLTSYYKSDHFKTRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E+ILC DSFQSMYSQMLCGL    QVLRVG +FAS  +RAI FL+ +W+ L  DI +G
Sbjct  196   PNESILCPDSFQSMYSQMLCGLLERHQVLRVGAVFASGLLRAISFLQLNWQELARDIMSG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLN R+TDPS+R+ +A+++KP+P+LAEFI  EC+KE+W+GII RIW NTKY+DV+VTGAM
Sbjct  256   TLNKRVTDPSIRDCIAKVLKPSPELAEFIRVECSKENWEGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             SQYIPTL+Y+   LPL  T Y SSEC F +NLNP+ KP+EV+YTI+P MAYFEFLP    
Sbjct  316   SQYIPTLDYYSGGLPLACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMAYFEFLPHEPS  375

Query  951   I-GVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCR  775
               G+   +P +++DLVDV +G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV R
Sbjct  376   CSGLTRDSPPKLVDLVDVVVGKEYEIVITTYAGLYRYRVGDILRVTGFHNSAPQFHFVRR  435

Query  774   KNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-ITQ  598
             KNV LSID+DKTDE EL  AV+NAS +L  F+ S++EYTS+A+T TIPGHYV+YWE + +
Sbjct  436   KNVLLSIDSDKTDEAELQKAVENASQLLREFNTSVVEYTSYADTKTIPGHYVIYWELLIK  495

Query  597   SSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASG  418
              S N     +   CC A+EESLNSVYR+ RV   SIGPLEIR+V+NGTF+++MDYAI+ G
Sbjct  496   DSANSPSEKVLSQCCHAMEESLNSVYRQGRVECNSIGPLEIRVVKNGTFEELMDYAISRG  555

Query  417   SSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             +SI+QYK PRCV   PI+ELLDSRV+S +FSP  P W P  +
Sbjct  556   ASINQYKVPRCVNFTPIMELLDSRVVSTHFSPALPHWTPKRR  597



>ref|XP_010679563.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Beta vulgaris subsp. vulgaris]
Length=586

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/578 (59%), Positives = 443/578 (77%), Gaps = 2/578 (0%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E +   LQFI+DVT+   +VQ +VL  ILS NA  EYL RHG+ G  D ETFK  +PVVT
Sbjct  5     EKDLTALQFIDDVTSQCDEVQRKVLAQILSRNAETEYLKRHGMKGCIDPETFKNNVPVVT  64

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++PDI R+ANG+ S I+C+ PI+EF TSSGTS GE KL+PTT EE++R+ L  SLLM
Sbjct  65    YEDIQPDIQRIANGDFSPILCAQPITEFLTSSGTSAGERKLMPTTAEEMDRRQLLYSLLM  124

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+NQ++P L KGK +YFLF++ E KTPGGL+ARPVLTS  K S+FK R Y +PY   TS
Sbjct  125   PVMNQYLPGLDKGKGLYFLFIKAETKTPGGLVARPVLTSYYKSSHFKNRPY-DPYNVYTS  183

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E +LC DSFQSMY+QMLCGL+   QVLRVG +FAS  +RAI FL+ H+  LCHDI TG
Sbjct  184   PNEAVLCPDSFQSMYTQMLCGLYERHQVLRVGAVFASGLLRAIRFLQVHYSDLCHDIATG  243

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TL+P+IT  S+R+ +A+I++ + +LAEFI   C  E W+GII RIW NTKY++V+VTGAM
Sbjct  244   TLSPKITHSSLRDCMAKIIRQDTELAEFINHACKGEDWEGIIKRIWPNTKYLEVIVTGAM  303

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+Y+   LP V T Y SSEC F +NL+P+  P+EV YTI+P MAYFEF+P+   
Sbjct  304   AQYIPTLDYYSGGLPKVCTMYASSECFFGLNLDPMCAPSEVTYTILPNMAYFEFIPLDDS  363

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
             +G+   +   +++L DV++G++YE+VVTT +GLYRYRVGD+L V G+ N+ PQF FV RK
Sbjct  364   VGLTRNSVPRLVNLADVEVGKDYELVVTTQSGLYRYRVGDVLHVTGYYNSAPQFKFVRRK  423

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQSS  592
             NV LSID+DKTDE EL NA++ AS +L PF+ S++EYTS+A+T TIPGHYV+Y E+    
Sbjct  424   NVLLSIDSDKTDESELQNAIERASILLQPFNTSIVEYTSYADTKTIPGHYVIYCELLMKD  483

Query  591   ENPIP-RYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
                 P   +   CC A+EE+LNSVYR+CRV+D+SIGPLEIR+V+NGTF+++MDYAI+ G+
Sbjct  484   PTNGPGNDVLGQCCLAMEEALNSVYRQCRVADRSIGPLEIRVVKNGTFEELMDYAISRGA  543

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAP  301
             SI+QYK PRCV   PIVELLDSRV+S +FSP  P W+P
Sbjct  544   SINQYKVPRCVNVMPIVELLDSRVVSAHFSPSLPHWSP  581



>ref|XP_010087275.1| hypothetical protein L484_009408 [Morus notabilis]
 gb|EXB28722.1| hypothetical protein L484_009408 [Morus notabilis]
Length=599

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/584 (60%), Positives = 443/584 (76%), Gaps = 4/584 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T N   VQERVL  ILS N+  EYL R GL G+TD ++FK  +PVVT
Sbjct  17    EKDAKALQFIEEMTRNTDAVQERVLGEILSRNSETEYLQRFGLEGATDSDSFKSKVPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED+ P+I R+ANG+ S I+CS PISEF TSSGTS GE KL+PT  EEL+R++L  SLLM
Sbjct  77    YEDLLPEIQRIANGDRSKILCSQPISEFLTSSGTSAGERKLMPTIHEELDRRTLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E+KTPGGLLARPVLTS  K  +FKKR Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKAESKTPGGLLARPVLTSYYKSEHFKKRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E IL +DSFQSMY+QMLCGL    +VLRVG +FAS  +RAI FL+ +WRLL  DI TG
Sbjct  196   PDEAILSSDSFQSMYTQMLCGLIMRHEVLRVGAIFASGLLRAIRFLQLNWRLLADDIATG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNPRITDPS+++ +A I+KP+P LA F+  EC  E+W+GII RIW NTKY++V+VTGAM
Sbjct  256   TLNPRITDPSIKQCMAGILKPDPALAAFMTAECAGENWEGIITRIWPNTKYLEVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+Y+ N LP   T Y SSEC F +NL P+  P+EV+YTI+P MA+FEF+P    
Sbjct  316   AQYIPTLDYYSNGLPKACTMYASSECYFGLNLKPMCDPSEVSYTIMPNMAFFEFMPHDDH  375

Query  951   IGVP--EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVC  778
                P    NP  ++D+ DV++G+EYE+V+TTYAGL RYRVGDIL+V GF N+ PQF FV 
Sbjct  376   SSPPLSRDNPPSLVDMADVEVGKEYELVITTYAGLCRYRVGDILQVTGFHNSAPQFRFVR  435

Query  777   RKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-IT  601
             RKNV LSID+DKTDE EL  A++NAS +L  F+ S++EYTS A+T TIPGHYV+YWE + 
Sbjct  436   RKNVLLSIDSDKTDEAELQTAIQNASVLLKEFNTSVVEYTSFADTKTIPGHYVIYWELLA  495

Query  600   QSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIAS  421
             + S N     +   CC A+EESLNSVYR+ RV+D SIG LEI++V++GTF+++MDYAI+ 
Sbjct  496   KDSANSPSHEVLNQCCLAMEESLNSVYRQGRVADNSIGALEIKVVKSGTFEELMDYAISR  555

Query  420   GSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             G+SI+QYK PRCV   PIVELLDSR +S +FSP  P+W P  + 
Sbjct  556   GASINQYKVPRCVNYTPIVELLDSRAVSVHFSPALPQWTPERRR  599



>ref|XP_010547971.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Tarenaya hassleriana]
Length=595

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/578 (61%), Positives = 442/578 (76%), Gaps = 5/578 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + L+FIE++T NA  VQ+ VL  IL+ N+  EYL R GL+G+TDRETFK  +PV+T
Sbjct  17    EKDAKALKFIEEMTRNADAVQQNVLAEILTRNSDTEYLRRFGLDGATDRETFKSKLPVIT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ + PISEF TSSGTS GE KL+PT  EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIREELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK MYFLFV+ E KTPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKAMYFLFVKSETKTPGGLLARPVLTSYYKSDHFKSRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL     VLRVG +FAS  +RAI FL+ HW  L HDI TG
Sbjct  196   PNEAILCPDSFQSMYTQMLCGLLDRLSVLRVGAVFASGLLRAIRFLQMHWPRLAHDIETG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             +L+ ++TD SVR  +  I+KP+P LA FI  EC   +W+GII RIW NTKY+DV+VTGAM
Sbjct  256   SLDQQVTDRSVRNCMDGILKPDPVLARFIRGECESNNWEGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+Y+   LP+  T Y SSEC F +NLNP+S P+EV+YTI+P MAYFEF+P    
Sbjct  316   AQYIPTLDYYSGGLPMACTMYASSECYFGLNLNPMSTPSEVSYTIMPNMAYFEFIPHDPS  375

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
                P   P +++DLVDV++G+EYE+VVTTYAGL RYRVGDILRV GF N+ PQF+FV RK
Sbjct  376   GRDP---PQDLVDLVDVQIGKEYELVVTTYAGLCRYRVGDILRVTGFHNSAPQFHFVRRK  432

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQSS  592
             NV LSID+DKTDE EL  AV+NAS +L P++  ++EYTS+A+TSTIPGHYV+YWE+    
Sbjct  433   NVLLSIDSDKTDESELQKAVENASKLLSPYETRVVEYTSYADTSTIPGHYVVYWELLVRD  492

Query  591   ENPIPRY-IFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
              +  PR+ + + CC  +EESLNSVYR+CRV+D S+GPLEIR+V++GTF+++MDYAI+ G+
Sbjct  493   PSNGPRHEVLDRCCLEMEESLNSVYRQCRVADNSVGPLEIRVVKSGTFEELMDYAISRGA  552

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAP  301
             SI+QYK PRCV   PIVELLDSRV+S +FS   P W P
Sbjct  553   SINQYKVPRCVNFTPIVELLDSRVVSAHFSAGLPHWTP  590



>gb|KCW59512.1| hypothetical protein EUGRSUZ_H02264 [Eucalyptus grandis]
Length=592

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/589 (59%), Positives = 443/589 (75%), Gaps = 15/589 (3%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E +   L FIE +T N   VQERVL  IL+ N+G EYL R GL G+TDR +FK  +PVVT
Sbjct  11    EKDANALAFIEKMTQNVDSVQERVLSEILTQNSGTEYLNRFGLGGATDRGSFKAKVPVVT  70

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++PDI R+A+G+ S+I+CS PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  71    YEDLQPDIQRIASGDRSNILCSQPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLM  130

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLF++ E +TPGGL+ARPVLTS  K  +FK R Y +PY   TS
Sbjct  131   PVMNLYVPGLDKGKGLYFLFIKAETRTPGGLVARPVLTSYYKSDHFKTRPY-DPYNVYTS  189

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QML GL   ++VLRVG +FAS  +RAI FL+ +W  L HDI TG
Sbjct  190   PNEAILCPDSFQSMYTQMLYGLLMREEVLRVGAVFASGLLRAIKFLQLNWEQLAHDIATG  249

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             +LNP++TD ++RE +++I+ P PDLAEFI KEC+ E+W  II RIW NTKY+DV+VTGAM
Sbjct  250   SLNPKVTDLTIRECMSKIMSPKPDLAEFIRKECSGENWDRIITRIWPNTKYLDVIVTGAM  309

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL-----  967
             +QYIPTL Y+   LP+  T Y SSEC F +NL P+ KP+EV+YTI+P M YFEFL     
Sbjct  310   AQYIPTLGYYSGGLPMACTMYASSECYFGLNLKPMCKPSEVSYTIMPNMGYFEFLPHDPS  369

Query  966   --PVSREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQ  793
               P+SR+      +P  ++DL DV++G+EYE+V+TTY GL RYRVGDIL+V GF N  PQ
Sbjct  370   APPLSRD------SPPRLIDLADVEVGKEYELVITTYPGLCRYRVGDILQVTGFHNAAPQ  423

Query  792   FNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLY  613
             F FV RKNV LSID+DKTDE EL  AV++AS +L  F+ S++EYTS+A+T TIPGHYV+Y
Sbjct  424   FRFVRRKNVLLSIDSDKTDESELQKAVESASALLREFNTSVVEYTSYADTKTIPGHYVIY  483

Query  612   WEITQSSENPIP-RYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMD  436
             WE+     N  P   +   CC A+EE LN+VYR+CRV+D SIGPLEIR+V+NGTF+++MD
Sbjct  484   WELLAKEPNKAPSNEVLNRCCLAMEECLNTVYRQCRVADNSIGPLEIRVVKNGTFEELMD  543

Query  435   YAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             YAI+ G+SI+QYK PRCVT  P++ELL+SRV+S +FSP  P W P  +H
Sbjct  544   YAISRGASINQYKAPRCVTYTPMLELLNSRVVSAHFSPSAPHWTPERRH  592



>ref|XP_008236406.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Prunus mume]
Length=600

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/586 (59%), Positives = 448/586 (76%), Gaps = 6/586 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             + + + L+FIE+ T NA  VQERVL  IL+ NA  EYL R+ L G+TDRETFK  +P+++
Sbjct  16    KKDAKALKFIEETTRNADPVQERVLAEILARNAETEYLKRYKLGGATDRETFKSKLPIIS  75

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  76    YEDLQPEIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLM  135

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N  VP L KGK +YFLFV+ E KTPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  136   PVMNLCVPGLDKGKGLYFLFVKSETKTPGGLLARPVLTSYYKSEHFKTRPY-DPYNVYTS  194

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL    QVLR+G +FAS  +RAI FL+ +W+ L +DIRTG
Sbjct  195   PNEAILCPDSFQSMYAQMLCGLLERKQVLRLGAVFASGLLRAIRFLQLNWQQLVNDIRTG  254

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNP+IT+P+++  +  I+KP+P+LA+F+ K+C  E+W GI+ RIW NTKY+DV+VTGAM
Sbjct  255   TLNPKITEPNLKSCMDGILKPDPELADFVSKQCGDENWDGILTRIWPNTKYLDVIVTGAM  314

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS-R  955
             +QYIPTL Y+   LP+  T Y SSEC F +NLNP+ KP+EV+YTI+P MAYFEFLP    
Sbjct  315   AQYIPTLEYYSGGLPMACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMAYFEFLPYDPN  374

Query  954   EIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCR  775
                  +     ++DLV+V++G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV R
Sbjct  375   SASRGDSMTTRLVDLVNVEVGREYELVITTYAGLYRYRVGDILRVTGFHNSAPQFHFVRR  434

Query  774   KNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEI---  604
             KNV LSID+DKTDE EL  AV+NAS +L  F+AS++EYTS+A+T+TIPGHYV+YWE+   
Sbjct  435   KNVLLSIDSDKTDEAELQLAVENASKLLRSFNASVVEYTSYADTTTIPGHYVIYWELLVK  494

Query  603   -TQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAI  427
              + +SE      +   CC A+EESLNSVYR+ RV+D SIGPLEIR+V++GTF+ +MDYAI
Sbjct  495   DSANSETESVDSVMSQCCLAMEESLNSVYRQGRVADNSIGPLEIRVVKSGTFEDLMDYAI  554

Query  426   ASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             + G+SI+QYK PRCV   PI+ELLDSRV+S +FSP  P W P  + 
Sbjct  555   SRGASINQYKVPRCVNFTPIMELLDSRVVSKHFSPSLPHWTPERRR  600



>ref|XP_007199763.1| hypothetical protein PRUPE_ppa003134mg [Prunus persica]
 gb|EMJ00962.1| hypothetical protein PRUPE_ppa003134mg [Prunus persica]
Length=600

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/586 (59%), Positives = 449/586 (77%), Gaps = 6/586 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + L+FIE+ T NA  VQERVL  IL+ NA  EYL R+ L G+TDRETFK  +P+++
Sbjct  16    EKDAKALKFIEETTRNADPVQERVLAEILARNAETEYLKRYKLGGATDRETFKSKLPIIS  75

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  76    YEDLQPEIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLM  135

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N  VP L KGK +YFLFV+ E KTPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  136   PVMNLCVPGLDKGKGLYFLFVKSETKTPGGLLARPVLTSYYKSEHFKTRPY-DPYNVYTS  194

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL   +QVLR+G +FAS  +RAI FL+ +W+ L +DIRTG
Sbjct  195   PNEAILCPDSFQSMYAQMLCGLLERNQVLRLGAVFASGLLRAIRFLQLNWQQLVNDIRTG  254

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNP+IT+P+++  +  I+KP+P+LA+F+ K+C  E+W GI+ RIW NTKY+DV+VTGAM
Sbjct  255   TLNPKITEPNLKSCMDGILKPDPELADFVSKQCGDENWDGILTRIWPNTKYLDVIVTGAM  314

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS-R  955
             +QYIPTL Y+   LP+  T Y SSEC F +NLNP+ KP+EV+YTI+P MAYFEFLP    
Sbjct  315   AQYIPTLEYYSGGLPMACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMAYFEFLPYDPN  374

Query  954   EIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCR  775
                  +     ++DLV+V++G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV R
Sbjct  375   SASRGDSMTTRLVDLVNVEVGREYELVITTYAGLYRYRVGDILRVTGFHNSAPQFHFVRR  434

Query  774   KNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEI---  604
             KNV LSID+DKTDE EL  AV+NAS +L  F+AS++EYTS+A+T+TIPGHYV+YWE+   
Sbjct  435   KNVLLSIDSDKTDEAELQLAVENASKLLRSFNASVVEYTSYADTTTIPGHYVIYWELLVK  494

Query  603   -TQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAI  427
              + + E      +   CC A+EESLNSVYR+ RV+D SIGPLEIR+V++GTF+++MDYAI
Sbjct  495   DSANLETESVDSVMSQCCLAMEESLNSVYRQGRVADNSIGPLEIRVVKSGTFEELMDYAI  554

Query  426   ASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             + G+SI+QYK PRCV   PI+ELLDSRV+S +FSP  P W P  + 
Sbjct  555   SRGASINQYKVPRCVNFTPIMELLDSRVVSKHFSPSLPHWTPERRR  600



>gb|EYU37610.1| hypothetical protein MIMGU_mgv1a003251mg [Erythranthe guttata]
Length=597

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/590 (60%), Positives = 451/590 (76%), Gaps = 18/590 (3%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQF+E++T NA  VQE VL  IL+ NA  EYL    LN +TDRETFK  IP+VT
Sbjct  17    EKDAKALQFVEEMTRNADSVQENVLAQILTRNAETEYLKGFNLNRATDRETFKSKIPMVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P I R+A+G+ S I+ S P+SEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPLIQRIADGDRSPILSSHPVSEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +V  L KGK +YFLF++ E +TPGGL+ARPVLTS  K  +FK R + +PY   TS
Sbjct  137   PVMNLYVKGLDKGKGLYFLFIKSETETPGGLVARPVLTSYYKSEHFKTRPH-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL+  +QVLRVG +FAS  +RAI FL+ +W+ L  DIRTG
Sbjct  196   PNEAILCPDSFQSMYTQMLCGLYQREQVLRVGAVFASGLLRAIRFLQLNWQQLADDIRTG  255

Query  1311  TLNPRITDPSVREAVARIV-KPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGA  1135
             +LNP++TDPSVRE + R++ KP+P+LA+FI +EC++E+W+GII RIW NTKY+DV+VTGA
Sbjct  256   SLNPKVTDPSVRECMTRMMSKPDPELADFIARECSEENWEGIITRIWPNTKYLDVIVTGA  315

Query  1134  MSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSR  955
             M+QYIPTL+Y+   LP   T Y SSEC F +NLNP+ KP+EV+YTI+P MAYFEFLP   
Sbjct  316   MAQYIPTLDYYSGGLPKACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMAYFEFLP---  372

Query  954   EIGVPEPNPV------EVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQ  793
                  EPN         ++DL DV++G+EYE+V+TTYAGL RYRVGDILRV GF N+ PQ
Sbjct  373   ----HEPNSTRDSPARRLVDLADVEIGKEYELVITTYAGLCRYRVGDILRVTGFHNSAPQ  428

Query  792   FNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLY  613
             F F+ RKNV LSID+DKTDE EL  AV+NAS +L   + S++EYTS+A+T TIPGHYV+Y
Sbjct  429   FQFIRRKNVLLSIDSDKTDEAELQAAVENASRLLRESNTSVVEYTSYADTKTIPGHYVIY  488

Query  612   WEI--TQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMM  439
             WE+    S E+P  R + + CC A+EESLNSVYR+CRV+D SIGPLEIR+V NGTF+++M
Sbjct  489   WELLGKDSGESPSGR-VLDRCCLAMEESLNSVYRQCRVADNSIGPLEIRVVRNGTFEELM  547

Query  438   DYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             DYAI+ G+SI+QYK PRCV+  PI+ELLDSRV+S +FSP  P W P  + 
Sbjct  548   DYAISRGASINQYKVPRCVSFTPIMELLDSRVVSTHFSPSLPRWTPERRR  597



>ref|XP_010070615.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Eucalyptus grandis]
Length=597

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/589 (59%), Positives = 443/589 (75%), Gaps = 15/589 (3%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E +   L FIE +T N   VQERVL  IL+ N+G EYL R GL G+TDR +FK  +PVVT
Sbjct  16    EKDANALAFIEKMTQNVDSVQERVLSEILTQNSGTEYLNRFGLGGATDRGSFKAKVPVVT  75

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++PDI R+A+G+ S+I+CS PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  76    YEDLQPDIQRIASGDRSNILCSQPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLM  135

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLF++ E +TPGGL+ARPVLTS  K  +FK R Y +PY   TS
Sbjct  136   PVMNLYVPGLDKGKGLYFLFIKAETRTPGGLVARPVLTSYYKSDHFKTRPY-DPYNVYTS  194

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QML GL   ++VLRVG +FAS  +RAI FL+ +W  L HDI TG
Sbjct  195   PNEAILCPDSFQSMYTQMLYGLLMREEVLRVGAVFASGLLRAIKFLQLNWEQLAHDIATG  254

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             +LNP++TD ++RE +++I+ P PDLAEFI KEC+ E+W  II RIW NTKY+DV+VTGAM
Sbjct  255   SLNPKVTDLTIRECMSKIMSPKPDLAEFIRKECSGENWDRIITRIWPNTKYLDVIVTGAM  314

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL-----  967
             +QYIPTL Y+   LP+  T Y SSEC F +NL P+ KP+EV+YTI+P M YFEFL     
Sbjct  315   AQYIPTLGYYSGGLPMACTMYASSECYFGLNLKPMCKPSEVSYTIMPNMGYFEFLPHDPS  374

Query  966   --PVSREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQ  793
               P+SR+      +P  ++DL DV++G+EYE+V+TTY GL RYRVGDIL+V GF N  PQ
Sbjct  375   APPLSRD------SPPRLIDLADVEVGKEYELVITTYPGLCRYRVGDILQVTGFHNAAPQ  428

Query  792   FNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLY  613
             F FV RKNV LSID+DKTDE EL  AV++AS +L  F+ S++EYTS+A+T TIPGHYV+Y
Sbjct  429   FRFVRRKNVLLSIDSDKTDESELQKAVESASALLREFNTSVVEYTSYADTKTIPGHYVIY  488

Query  612   WEITQSSENPIP-RYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMD  436
             WE+     N  P   +   CC A+EE LN+VYR+CRV+D SIGPLEIR+V+NGTF+++MD
Sbjct  489   WELLAKEPNKAPSNEVLNRCCLAMEECLNTVYRQCRVADNSIGPLEIRVVKNGTFEELMD  548

Query  435   YAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             YAI+ G+SI+QYK PRCVT  P++ELL+SRV+S +FSP  P W P  +H
Sbjct  549   YAISRGASINQYKAPRCVTYTPMLELLNSRVVSAHFSPSAPHWTPERRH  597



>ref|XP_009622718.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Nicotiana tomentosiformis]
Length=601

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/586 (60%), Positives = 443/586 (76%), Gaps = 6/586 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T N   VQE+VL  ILS NA  EYL R  + G+TDR+TFK  +PVVT
Sbjct  17    EKDAKSLQFIEEMTKNTDSVQEKVLVEILSRNANTEYLQRFKVGGATDRDTFKSNVPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED+KPDI+RVANG+ S I  S PISEF TSSGTS GE KL+PT  +ELER+    SLL 
Sbjct  77    YEDLKPDIDRVANGDRSPIFSSHPISEFLTSSGTSAGERKLMPTIADELERRQKLYSLLQ  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N ++P L KGK +YFLF++ E KTPGGL+ARPVLTS  K   FK R Y +P    TS
Sbjct  137   PVMNLYMPGLDKGKGLYFLFIKAETKTPGGLVARPVLTSYYKSEQFKTRPY-DPSNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL   ++VLRVG +FAS  +RAI FL+ +W+ L HDI TG
Sbjct  196   PNEAILCVDSFQSMYTQMLCGLLMREEVLRVGAVFASGLLRAIRFLQLNWQQLAHDIATG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNP+++D S+R  +++I+KPNP+LAEF+ KEC  ++W+GII RIW NTKY+DV+VTGAM
Sbjct  256   TLNPKVSDVSIRNCMSKILKPNPELAEFVTKECEGDNWEGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLP--VS  958
             +QYIPTL+Y+   LP   T Y SSEC F +NL P+ KP+EV YTI+P M YFEF+P   +
Sbjct  316   AQYIPTLDYYSGGLPKACTMYASSECYFGLNLRPMCKPSEVCYTIMPNMGYFEFIPHDPA  375

Query  957   REIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVC  778
               + +   +P  ++DL DV+LG+EYE+V+TTYAGL RYRVGDIL+V GF N+ PQF FV 
Sbjct  376   NPVQISRDSPPHLVDLADVELGKEYELVITTYAGLCRYRVGDILQVTGFHNSAPQFKFVR  435

Query  777   RKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-IT  601
             RKNV LSID+DKTDE EL  A++NA+ +L P+D +L+EYTS A+T TIPGHYV+YWE + 
Sbjct  436   RKNVLLSIDSDKTDESELQKAIENATALLRPYDTNLVEYTSFADTKTIPGHYVIYWELLV  495

Query  600   QSSENPIPRY--IFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAI  427
             +   NP   +  +   CC A+EESLNSVYR+CRV+D SIGPLEIR+V+NGTF+++MDYAI
Sbjct  496   KDPTNPPSDHEEVLNQCCLAMEESLNSVYRQCRVADNSIGPLEIRVVKNGTFEELMDYAI  555

Query  426   ASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             + G+SI+QYK PRCV   PIVELLDSRV+S +FSP  P W P  + 
Sbjct  556   SRGASINQYKAPRCVNFTPIVELLDSRVVSVHFSPAAPHWTPERRR  601



>gb|KHG08695.1| Uncharacterized protein F383_11873 [Gossypium arboreum]
Length=592

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/582 (60%), Positives = 438/582 (75%), Gaps = 9/582 (2%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             + + + LQFIE++T N   VQERVL+ ILS NA  EYL R  LNG+TDRETFK  IPVVT
Sbjct  19    DKDAKALQFIEEMTKNVDSVQERVLREILSRNAETEYLKRFILNGATDRETFKSRIPVVT  78

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I  + PISEF TSSGTS GE KL+PT  EEL+R+ L  SLLM
Sbjct  79    YEDIQPEIQRIANGDKSPIFSAHPISEFLTSSGTSAGERKLMPTIHEELDRRQLLYSLLM  138

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E KTPGGLLARPVLTS     +FK R Y +P+   TS
Sbjct  139   PVMNLYVPGLDKGKGLYFLFVKAETKTPGGLLARPVLTSYYNSDHFKTRPY-DPFNVYTS  197

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL   ++VLRVG +FAS  +RAIHFL+ +W+ L HDI TG
Sbjct  198   PNEAILCVDSFQSMYAQMLCGLIMRNEVLRVGAVFASGLLRAIHFLQNNWKQLAHDIATG  257

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNP+ITD  VRE + +I+KPNP+LA+F+  EC +E+W+ II RIW  TKY+DV+VTGAM
Sbjct  258   TLNPKITDAPVRECMRKILKPNPELAQFVTMECYEENWECIIKRIWPRTKYLDVIVTGAM  317

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL Y+   LP+  T Y SSEC F +NLNP+ KP+EV YTI+P MAYFEFLP    
Sbjct  318   AQYIPTLEYYSGGLPMACTMYASSECYFGLNLNPMCKPSEVTYTIMPNMAYFEFLPHGSS  377

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
                       ++DL DV++G+EYE+++TTYAGL  YRVGDILRV GF N  PQF F+ RK
Sbjct  378   TSC-------LVDLADVEVGKEYELILTTYAGLCGYRVGDILRVTGFHNAAPQFRFIRRK  430

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-ITQS  595
             NV LSI++DKTDE EL NA++NAS +L  F+ S++EYTS+A+T  IPGHYV+YWE + + 
Sbjct  431   NVLLSIESDKTDEAELQNAIENASLLLKEFNTSVVEYTSYADTKQIPGHYVIYWELLVKD  490

Query  594   SENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
             S N     +   CC  +EESLNSVYR+ RV+D SIGPLEIR+VENGTF+++MDYAI+ G+
Sbjct  491   SANAPTDDVLNRCCLQMEESLNSVYRQSRVADNSIGPLEIRVVENGTFEELMDYAISRGA  550

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             SI+QYK PRCV+  PI+ELL+SRV+S +FSP  P W P  + 
Sbjct  551   SINQYKVPRCVSFTPIMELLNSRVVSKHFSPDLPHWTPERRR  592



>ref|XP_004141893.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like 
[Cucumis sativus]
 gb|KGN48572.1| hypothetical protein Csa_6G493310 [Cucumis sativus]
Length=607

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/590 (59%), Positives = 436/590 (74%), Gaps = 10/590 (2%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + L+FIE+ TTN   VQ+RVL  IL+ NA  EY+ R  LNG+TDR+TFK   PVVT
Sbjct  19    EKDAKALRFIEETTTNTDSVQQRVLAEILTQNAHTEYVNRFRLNGATDRDTFKSKFPVVT  78

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++PDI R+ANG+ S I  S PISEF TSSGTS GE KL+PT +EE+ER+ L  SLLM
Sbjct  79    YEDLQPDIQRIANGDRSPIFSSHPISEFLTSSGTSAGERKLMPTIKEEMERRQLLYSLLM  138

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             P++N +VP L KGK +YFLFV+ E KTPGGL+ARPVLTS  K   FK R Y +P+ D TS
Sbjct  139   PIMNLYVPGLDKGKGLYFLFVKAETKTPGGLVARPVLTSYYKSDIFKTRHY-DPFNDYTS  197

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E +LC DSFQSMY+QMLCGL   DQVLRVG +FAS  +RAI FL+ +W+ L HDI TG
Sbjct  198   PNEAVLCADSFQSMYTQMLCGLLMRDQVLRVGAVFASGLLRAIRFLQLNWKQLAHDISTG  257

Query  1311  TLNPRITDPSVREAVAR--IVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             TLNP+ITD  +RE +    +  P P+LAEFI  EC  E W+GII RIW NTKY+DV+VTG
Sbjct  258   TLNPKITDTCLRECITSKYLTNPKPELAEFISSECCTEEWEGIITRIWPNTKYLDVIVTG  317

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLP--  964
             AM+QYIPTL ++   LP+  T Y SSEC F +NLNP+ KP++V YTI+P M YFEFLP  
Sbjct  318   AMAQYIPTLEFYSGGLPMACTMYASSECYFGVNLNPMCKPSDVTYTIMPNMGYFEFLPHD  377

Query  963   -VSREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFN  787
               SR   +   +P  ++DL DV++G+EYE+V+TTYAGL RYRVGD+L V GF N  PQF 
Sbjct  378   SSSRAPALSRDSPPRLVDLADVEVGKEYELVITTYAGLVRYRVGDVLEVTGFHNAAPQFR  437

Query  786   FVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE  607
             FV RKNV LSID+DKTDE EL  AV+NAS++L  F+ +++EYTS+A+T TIPGHYV+YWE
Sbjct  438   FVRRKNVLLSIDSDKTDEAELQKAVENASSLLREFNTTVVEYTSYADTKTIPGHYVIYWE  497

Query  606   ITQSSENPIPRY----IFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMM  439
             +       +  +    I   CC A+EESLNSVYR+ RV+D SIGPLEIR+V+NGTF+++M
Sbjct  498   LLVKDNETMNSHPTDEILNQCCLAIEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELM  557

Query  438   DYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             DYAI+ G+SI+QYK PRCV   PIVELLDSRV S +FSP  P W P  + 
Sbjct  558   DYAISRGASINQYKAPRCVNFTPIVELLDSRVTSFHFSPSKPHWTPERRR  607



>ref|XP_011099346.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Sesamum indicum]
Length=600

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/586 (60%), Positives = 446/586 (76%), Gaps = 5/586 (1%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             + E   + LQFIE++T N   VQE+VL  IL+ NA  EYL R  L G+TDR+TFK  IPV
Sbjct  15    VNEKFAKALQFIEEMTGNTDTVQEKVLAEILARNADTEYLQRFHLGGATDRDTFKSKIPV  74

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             VTYED++P+I R+ANG+ S I+CS PISEF TSSGTS GE KL+PT  EE++R+ L  SL
Sbjct  75    VTYEDLQPEIQRIANGDRSPILCSHPISEFLTSSGTSAGERKLMPTIREEMDRRQLLYSL  134

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV++ +VP L KGK +YFLFV+ E KTPGGL+ARPVLTS  K  +FK R Y +PY   
Sbjct  135   LMPVMSLYVPGLDKGKGLYFLFVKAETKTPGGLVARPVLTSYYKSDHFKTRPY-DPYNVY  193

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP E ILC+DSFQSMY+QMLCGL   ++VLRVG +FAS  +RAI FL+ +WR L HDI 
Sbjct  194   TSPDEAILCSDSFQSMYTQMLCGLLMREEVLRVGAVFASGLLRAIRFLQLNWRQLAHDIS  253

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             TG+LNP+ITDPS++E +A+ +KPNPDLAEFI KEC  E+W+ IIPRIW NT Y+DV+VTG
Sbjct  254   TGSLNPKITDPSIQERMAKTLKPNPDLAEFITKECEGENWERIIPRIWPNTMYLDVIVTG  313

Query  1137  AMSQYIPTLNYFGNDLPLVS-TSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLP-  964
             AM+QYI  L+++   LP  S T Y SSEC F +NL P++KP+EV+YTI+P M YFEF+P 
Sbjct  314   AMAQYITLLDFYSGGLPQASCTMYASSECYFGLNLKPMTKPSEVSYTIMPNMGYFEFIPH  373

Query  963   -VSREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFN  787
               +  + +    P +++DL DV++G+EYE+VVTTY+GL RYRVGDILRV  F N+ PQF 
Sbjct  374   DPANPVQLSRDAPPQLVDLADVEVGKEYELVVTTYSGLCRYRVGDILRVTEFHNSAPQFK  433

Query  786   FVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE  607
             F+ RKNV LSIDADKTDE EL  AV+NAS +L  F+ +++EYTS+A+T TIPGHYV+YWE
Sbjct  434   FIRRKNVLLSIDADKTDESELQKAVENASVLLREFNTTVVEYTSYADTKTIPGHYVIYWE  493

Query  606   ITQSSENPIPR-YIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYA  430
             +        P   +   CCFA+EES+NSVYR+ RV+D S+GPLEIR+V NGTF+++MDYA
Sbjct  494   LLVKDPAHAPTGEVLAQCCFAMEESMNSVYRQSRVADNSVGPLEIRVVRNGTFEELMDYA  553

Query  429   IASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             I+ G+SI+QYK PRCV+  PIVELLD+RV+S +FSP  P W P  +
Sbjct  554   ISRGASINQYKAPRCVSFTPIVELLDARVLSAHFSPAAPNWTPERR  599



>ref|XP_004163839.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like 
[Cucumis sativus]
Length=607

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/590 (59%), Positives = 436/590 (74%), Gaps = 10/590 (2%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + L+FIE+ TTN   VQ+RVL  IL+ NA  EY+ R  LNG+TDR+TFK   PVVT
Sbjct  19    EKDAKALRFIEETTTNTDSVQQRVLAEILTQNAHTEYVNRFRLNGATDRDTFKSKFPVVT  78

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++PDI R+ANG+ S I  S PISEF TSSGTS GE KL+PT +EE+ER+ L  SLLM
Sbjct  79    YEDLQPDIQRIANGDRSPIFSSHPISEFLTSSGTSAGERKLMPTIKEEMERRQLLYSLLM  138

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             P++N +VP L KGK +YFLFV+ E KTPGGL+ARPVLTS  K   FK R Y +P+ D TS
Sbjct  139   PIMNLYVPGLDKGKGLYFLFVKAETKTPGGLVARPVLTSYYKSDIFKTRPY-DPFNDYTS  197

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E +LC DSFQSMY+QMLCGL   DQVLRVG +FAS  +RAI FL+ +W+ L HDI TG
Sbjct  198   PNEAVLCADSFQSMYTQMLCGLLMRDQVLRVGAVFASGLLRAIRFLQLNWKQLAHDISTG  257

Query  1311  TLNPRITDPSVREAVAR--IVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             TLNP+ITD  +RE +    +  P P+LAEFI  EC  E W+GII RIW NTKY+DV+VTG
Sbjct  258   TLNPKITDTCLRECITSKYLTNPKPELAEFISSECCTEEWEGIITRIWPNTKYLDVIVTG  317

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLP--  964
             AM+QYIPTL ++   LP+  T Y SSEC F +NLNP+ KP++V YTI+P M YFEFLP  
Sbjct  318   AMAQYIPTLEFYSGGLPMACTMYASSECYFGVNLNPMCKPSDVTYTIMPNMGYFEFLPHD  377

Query  963   -VSREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFN  787
               SR   +   +P  ++DL DV++G+EYE+V+TTYAGL RYRVGD+L V GF N  PQF 
Sbjct  378   SSSRAPALSRDSPPRLVDLADVEVGKEYELVITTYAGLVRYRVGDVLEVTGFHNAAPQFR  437

Query  786   FVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE  607
             FV RKNV LSID+DKTDE EL  AV+NAS++L  F+ +++EYTS+A+T TIPGHYV+YWE
Sbjct  438   FVRRKNVLLSIDSDKTDEAELQKAVENASSLLREFNTTVVEYTSYADTKTIPGHYVIYWE  497

Query  606   ITQSSENPIPRY----IFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMM  439
             +       +  +    I   CC A+EESLNSVYR+ RV+D SIGPLEIR+V+NGTF+++M
Sbjct  498   LLVKDNETMNSHPTDEILNQCCLAIEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELM  557

Query  438   DYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             DYAI+ G+SI+QYK PRCV   PIVELLDSRV S +FSP  P W P  + 
Sbjct  558   DYAISRGASINQYKAPRCVNFTPIVELLDSRVTSFHFSPSKPHWTPERRR  607



>ref|XP_006367190.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like 
[Solanum tuberosum]
Length=599

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/578 (60%), Positives = 441/578 (76%), Gaps = 4/578 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T N   VQ++VL  ILS NA  EYL R  L G+ DR+TFK  +P+VT
Sbjct  18    EKDAKALQFIEEMTRNVDSVQQKVLAEILSQNANTEYLQRFKLGGAMDRDTFKSKMPIVT  77

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YE+++ DI R+ANG+ S I  S PISEF TSSGTS GE KL+PTT++EL+RK L  SLLM
Sbjct  78    YEEIQHDIQRIANGDRSPIFSSHPISEFLTSSGTSAGERKLMPTTQDELDRKQLLYSLLM  137

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLF++ E KTP GLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  138   PVMNLYVPGLDKGKGLYFLFIKAETKTPSGLLARPVLTSYYKSDHFKTRPY-DPYNVYTS  196

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E +LC DSFQSMYSQMLCGL   +QVLR+G +FAS  +RAIHFL+ +W+ L  DI +G
Sbjct  197   PNEAVLCVDSFQSMYSQMLCGLLMREQVLRLGAVFASGLLRAIHFLQLNWQQLAKDIASG  256

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
              LNPR++DPS+RE +++I+KPN +LAEFI KEC K++W+GII RIW NTKY+DV+VTGAM
Sbjct  257   ILNPRVSDPSIRECISKILKPNHELAEFIIKECEKQNWEGIITRIWPNTKYLDVIVTGAM  316

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+Y+   LP   T Y SSEC F +NLNP+ KP+EV YTI+P M Y+EF+P   +
Sbjct  317   AQYIPTLDYYSGGLPKACTMYASSECYFGLNLNPMCKPSEVCYTIMPNMCYYEFIP--HD  374

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
                P  +P  ++DL +V++G+EYE+V+TTYAGL RYRVGDIL+V GF N+ PQF F+ RK
Sbjct  375   STNPRDSPPRLVDLANVEVGKEYELVITTYAGLCRYRVGDILQVTGFHNSAPQFKFIRRK  434

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQSS  592
             NV LSID+DKTDE EL NAV +A+ IL  ++ S++EYTS+A+T TIPGHYV+Y+E+    
Sbjct  435   NVLLSIDSDKTDEAELQNAVDSAAAILRLYNTSVVEYTSYADTKTIPGHYVIYYELLIKD  494

Query  591   ENPIPRY-IFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGS  415
                 P + +   CC A+EE LNSVYR+CRV+D SIGPLEIR+VENGTF+++MDYAI+ G+
Sbjct  495   PTNSPSHEVLNQCCLAMEECLNSVYRQCRVADNSIGPLEIRVVENGTFEELMDYAISRGA  554

Query  414   SISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAP  301
             SI+QYK PRCV   PIVELLDSRV+S +FS   P W P
Sbjct  555   SINQYKAPRCVNFTPIVELLDSRVISVHFSATAPHWTP  592



>ref|XP_008373075.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Malus domestica]
Length=601

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/592 (59%), Positives = 447/592 (76%), Gaps = 20/592 (3%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE+ T NA  VQERVL  IL+ NA  EYL R  L G+TDR+TFK  +PV+T
Sbjct  16    EKDAKALQFIEETTRNANAVQERVLSEILARNAQTEYLKRFKLGGATDRKTFKSKLPVIT  75

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  76    YEDLQPEIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLM  135

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N  VP L KGK +YFLFV+ E KTPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  136   PVMNLCVPGLDKGKGLYFLFVKSETKTPGGLLARPVLTSYYKSEHFKTRPY-DPYNVYTS  194

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL   ++VLR+G +FAS  +RAI FL+ +W+ L  DIRTG
Sbjct  195   PNEAILCPDSFQSMYAQMLCGLLEREKVLRLGAVFASGLLRAIRFLQLNWQQLAEDIRTG  254

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TL+ +ITDP ++  +  I+KP+P+LA+F+ K+C  E+W GI+ RIW NTKY+DV+VTGAM
Sbjct  255   TLSSKITDPDLKSCIGGILKPHPELADFMSKQCGNENWDGILTRIWPNTKYLDVIVTGAM  314

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+Y+   LP+  T Y SSEC F +NLNP+ KP+EV+YTI+P MAYFEFLP    
Sbjct  315   AQYIPTLDYYSGGLPMACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMAYFEFLPY---  371

Query  951   IGVPEPNPV--------EVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTP  796
                 EPN V         ++DLVDV++G+EYE+V+TTYAGL+RYRVGDILRV GF N+ P
Sbjct  372   ----EPNLVSGGGESGTRLVDLVDVEVGREYELVITTYAGLHRYRVGDILRVTGFHNSAP  427

Query  795   QFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVL  616
             QF+FV RKNV LSID+DKTDE EL  AV NAS +L  F AS++EYTS+A+T+TIPGHYV+
Sbjct  428   QFHFVRRKNVLLSIDSDKTDEAELQLAVDNASKLLKKFSASVVEYTSYADTTTIPGHYVI  487

Query  615   YWEI----TQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
             YWE+    + +SE+     + + CC  +EESLNSVYR+ RV+D SIGPLEIR+V+NGTF+
Sbjct  488   YWELLVKDSANSESESFDAVMDQCCLTMEESLNSVYRQGRVADNSIGPLEIRVVKNGTFE  547

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             ++MDYAI+ G+SI+QYK PRCV   PI+ELLD RV+S + SP  P W P  K
Sbjct  548   ELMDYAISRGASINQYKVPRCVNFTPIMELLDFRVISKHVSPSLPHWTPERK  599



>ref|XP_008365651.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Malus domestica]
Length=601

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/592 (59%), Positives = 447/592 (76%), Gaps = 20/592 (3%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE+ T NA  VQERVL  IL+ NA  EYL R  L G+TDR+TFK  +PV+T
Sbjct  16    EKDAKALQFIEETTRNADAVQERVLSEILARNAQTEYLKRFKLGGATDRKTFKSKLPVIT  75

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  76    YEDLQPEIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLM  135

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N  VP L KGK +YFLFV+ E KTPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  136   PVMNLCVPGLDKGKGLYFLFVKSETKTPGGLLARPVLTSYYKSEHFKTRPY-DPYNVYTS  194

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P + ILC DSFQSMY+QMLCGL   ++VLR+G +FAS  +RAI FL+ +W+ L  DIRTG
Sbjct  195   PTDAILCPDSFQSMYAQMLCGLLEREKVLRLGAVFASGLLRAIRFLQLNWQQLAEDIRTG  254

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TL+ +ITD  ++  + RI+KP+P+LA+F+ K+C  E+W GI+ RIW NTKY+DV+VTGAM
Sbjct  255   TLSSKITDSDLKSCIGRILKPDPELADFMSKQCGNENWDGILTRIWPNTKYLDVIVTGAM  314

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+Y+   LP+  T Y SSEC F +NLNP+ KP+EV+YTI+P MAYFEFLP    
Sbjct  315   AQYIPTLDYYSGGLPMACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMAYFEFLPY---  371

Query  951   IGVPEPNPV--------EVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTP  796
                 EPN V         ++DLV+V++G+EYE+V+TTYAGL+RYRVGDILRV GF N+ P
Sbjct  372   ----EPNLVSGGGESGTRLVDLVNVEVGREYELVITTYAGLHRYRVGDILRVTGFHNSAP  427

Query  795   QFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVL  616
             QF+FV RKNV LSID+DKTDE EL  A+ NAS  L  F AS++EYTS+A+T+TIPGHYV+
Sbjct  428   QFHFVRRKNVLLSIDSDKTDEAELQLAIDNASKRLQKFSASVVEYTSYADTTTIPGHYVI  487

Query  615   YWEI----TQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
             YWE+    + +SE        + CC A+EESLNSVYR+ RVSD SIGPLEIR+V++GTF+
Sbjct  488   YWELLVKDSANSEGESFDSTMDQCCLAMEESLNSVYRQGRVSDNSIGPLEIRVVKSGTFE  547

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             ++MDYAI+ G+SI+QYK PRCV   PI+ELLDSRV+S +FSP  P W P  K
Sbjct  548   ELMDYAISRGASINQYKVPRCVNFTPIMELLDSRVISKHFSPSLPHWTPERK  599



>ref|XP_010939642.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.8 
[Elaeis guineensis]
Length=594

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/581 (60%), Positives = 442/581 (76%), Gaps = 10/581 (2%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E++ + L+FIE++T N  +VQE+VL  ILS NA  EYL R+ L G+ DR+ FK  +PVVT
Sbjct  17    ENDAKKLEFIEEMTANTDKVQEKVLAEILSQNAETEYLQRYKLGGAKDRDAFKAKLPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S+I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSAILSAHPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E KTPGGL ARPVLTS  K  +FK+R + +PY   TS
Sbjct  137   PVMNIYVPGLDKGKGLYFLFVKAETKTPGGLTARPVLTSYYKSDHFKRRPF-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P   ILC DSFQSMYSQMLCGL     VLRVG +FAS  +RAI FL+ HWR L  DI TG
Sbjct  196   PTAAILCADSFQSMYSQMLCGLLQRHDVLRVGAVFASGLLRAIRFLQLHWRDLSTDIATG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TL+PRITDPSVR AVA +++P+P LA++I  EC+ +SW GII RIW NTKY+DV+VTGAM
Sbjct  256   TLSPRITDPSVRAAVADLLRPDPALAQYITSECSTDSWAGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL---PV  961
             +QYIPTL Y+   LP+  T Y SSEC F +NL P+  P+EV+YTI+P MAYFEFL   P 
Sbjct  316   AQYIPTLEYYSGGLPMACTMYASSECYFGLNLKPMCTPSEVSYTIMPNMAYFEFLPHEPC  375

Query  960   SREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFV  781
             S  + +P     +++DL DV+LG+EYE+V+TTYAGLYRYRVGDILRV GF N  PQF F+
Sbjct  376   STGLNIP-----KLVDLADVELGKEYELVITTYAGLYRYRVGDILRVTGFHNRAPQFRFI  430

Query  780   CRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEIT  601
              RKNV LSI++DKTDE EL  AV+ AS +L P+ AS++EYTS A+T  IPGHYV+YWE+ 
Sbjct  431   RRKNVLLSIESDKTDEAELQAAVERASALLRPYGASVVEYTSQADTRAIPGHYVIYWELL  490

Query  600   QSSENPIPR-YIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIA  424
                E   P   + E CC  +EE++N+VYR+ R++D SIGPLEIR+V+ GTF+++MDYAI+
Sbjct  491   VREEGRWPEGEVLERCCLEMEEAMNTVYRQSRLADGSIGPLEIRVVKAGTFEELMDYAIS  550

Query  423   SGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAP  301
              G+SI+QYK PRCV+  P++ELLDSRV+S +FSP  P+WAP
Sbjct  551   RGASINQYKVPRCVSFPPVIELLDSRVVSAHFSPACPKWAP  591



>ref|XP_009339499.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Pyrus x bretschneideri]
 ref|XP_009339514.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Pyrus x bretschneideri]
Length=601

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/592 (59%), Positives = 447/592 (76%), Gaps = 20/592 (3%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             + + + LQFIE+ T NA  VQERVL  IL+ NA  EYL R  L G+TDR+TFK  +PV+T
Sbjct  16    DKDAKALQFIEETTRNADAVQERVLSEILARNAQTEYLKRFKLGGATDRKTFKSKLPVIT  75

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  76    YEDLQPEIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLM  135

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N  VP L KGK +YFLFV+ E KTPGGLLARPVLTS  K  +FK R Y +PY   TS
Sbjct  136   PVMNLCVPGLDKGKGLYFLFVKSETKTPGGLLARPVLTSYYKSEHFKTRPY-DPYNVYTS  194

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P + ILC DSFQSMY+QMLCGL   ++VLR+G +FAS  +RAI FL+ +W+ L  DIRTG
Sbjct  195   PNDAILCPDSFQSMYAQMLCGLLEREKVLRLGAVFASGLLRAIRFLQLNWQQLAEDIRTG  254

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TL+ +ITD  ++  + RI+KP+P+LA+F+ K+C  E+W GI+ RIW NTKY+DV+VTGAM
Sbjct  255   TLSSKITDSDLKSCIGRILKPDPELADFMSKQCGNENWDGILTRIWPNTKYLDVIVTGAM  314

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+Y+   LP+  T Y SSEC F +NLNP+ KP+EV+YTI+P MAYFEFLP    
Sbjct  315   AQYIPTLDYYSGGLPMACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMAYFEFLPY---  371

Query  951   IGVPEPNPV--------EVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTP  796
                 EPN V         ++DLV+V++G+EYE+V+TTYAGL+RYRVGDILRV GF N+ P
Sbjct  372   ----EPNSVSGGGESGTRLVDLVNVEVGREYELVITTYAGLHRYRVGDILRVTGFHNSAP  427

Query  795   QFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVL  616
             QF+FV RKNV LSID+DKTDE EL  AV NAS  L  F AS++EYTS+A+T+TIPGHYV+
Sbjct  428   QFHFVRRKNVLLSIDSDKTDEAELQLAVDNASKRLQKFSASVVEYTSYADTTTIPGHYVI  487

Query  615   YWEI----TQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
             YWE+    + +SE        + CC A+EESLNSVYR+ RV+D SIGPLEIR+V++GTF+
Sbjct  488   YWELLVKDSANSEGESFDSTMDQCCLAMEESLNSVYRQGRVADNSIGPLEIRVVKSGTFE  547

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             ++MDYAI+ G+SI+QYK PRCV   PI+ELLDSRV+S +FSP  P W P  K
Sbjct  548   ELMDYAISRGASINQYKVPRCVNFTPIMELLDSRVISKHFSPSLPHWTPERK  599



>ref|XP_002283886.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Vitis vinifera]
Length=600

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/589 (59%), Positives = 442/589 (75%), Gaps = 15/589 (3%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T N  QVQE++L  ILS N   EYL R  L G+TDR+TFK  +PVVT
Sbjct  17    EKDAKALQFIEEMTRNPDQVQEKILAEILSQNGETEYLQRFKLAGATDRDTFKSKVPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++PDI R+ANG+ S I+ S PISEF TSSGTS GE KL+PT  EE +R+    SLLM
Sbjct  77    YEDLQPDIQRIANGDRSPILSSHPISEFLTSSGTSAGERKLMPTIHEEWDRRQKLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E KTP GL+ARPVLT   +  +FKKR Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETKTPSGLVARPVLTGYYRSEHFKKRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL    +VLRVG +FAS  +RAI FL+ HW+ L HDI TG
Sbjct  196   PDEAILCVDSFQSMYAQMLCGLLMHKEVLRVGAVFASGLLRAIRFLQVHWQQLAHDISTG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
              LNP+ITDPSVRE +A I+KP+ +LA+FI +EC+  +W+ II RIW NTKY+DV+VTGAM
Sbjct  256   ILNPKITDPSVREGLAGILKPSQELADFIIQECSGGNWERIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL-----  967
             +QYIPTL+YF   +PL  T Y SSEC F +NL P+SKP+EV+YTI+P M YFEFL     
Sbjct  316   AQYIPTLDYFSGGIPLACTMYASSECYFGLNLKPMSKPSEVSYTIMPNMGYFEFLPHDPS  375

Query  966   --PVSREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQ  793
               P+SR+      +P  ++DL DV++G+EYE+V+TTYAGL RYRVGDIL+V GF N+ PQ
Sbjct  376   APPLSRD------SPPRLVDLADVEVGKEYELVITTYAGLCRYRVGDILQVTGFHNSAPQ  429

Query  792   FNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLY  613
             F F+ RKNV LSID+DKTDE EL  AV+NAS +L  F+ S++EYTS A+T TIPGHYV+Y
Sbjct  430   FQFIRRKNVLLSIDSDKTDEAELQKAVENASLLLREFNTSVVEYTSFADTKTIPGHYVIY  489

Query  612   WE-ITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMD  436
             WE + +   N     + + CC A+EESLN+VYR+ RV+D SIGPLEIR+V++GTF+++MD
Sbjct  490   WELLVKDPSNSPTDTVLKQCCLAMEESLNTVYRQGRVADNSIGPLEIRVVKSGTFEELMD  549

Query  435   YAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             YAI+ G+SI+QYK PRCV   PI+ELLDSRV+S YFSP  P W P  + 
Sbjct  550   YAISRGASINQYKVPRCVNFTPIMELLDSRVLSTYFSPAAPHWTPERRR  598



>ref|XP_008440335.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Cucumis melo]
Length=607

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/590 (60%), Positives = 437/590 (74%), Gaps = 10/590 (2%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + L+FIE+ TTNA  VQ+RVL  IL+ NA  EY+ R  LNG+TDR+TFK   PVVT
Sbjct  19    EKDAKALRFIEETTTNADLVQQRVLAEILTQNAHTEYVNRFRLNGATDRDTFKSKFPVVT  78

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++PDI R+ANG+ S I  S PISEF TSSGTS GE KL+PT +EE+ER+ L  SLLM
Sbjct  79    YEDLQPDIQRIANGDRSPIFSSHPISEFLTSSGTSAGERKLMPTIKEEMERRQLLYSLLM  138

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             P++N +VP L KGK +YFLFV+ E KTPGGL+ARPVLTS  K   FK R Y +P+ D TS
Sbjct  139   PIMNLYVPGLDKGKGLYFLFVKAETKTPGGLVARPVLTSYYKSDIFKTRPY-DPFNDYTS  197

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E +LC DSFQSMY+QMLCGL   DQVLRVG +FAS  +RAI FL+ +W+ L HDI TG
Sbjct  198   PNEAVLCADSFQSMYTQMLCGLLMRDQVLRVGAVFASGLLRAIRFLQLNWKQLAHDISTG  257

Query  1311  TLNPRITDPSVREAVAR--IVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
             TLNP+ITD  +RE +    +  PNP+LAEFI  EC  E W+GII RIW NTKY+DV+VTG
Sbjct  258   TLNPKITDTCLRECITSKYLTNPNPELAEFISNECYTEEWEGIITRIWPNTKYLDVIVTG  317

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLP--  964
             AM+QYIPTL ++   LP+  T Y SSEC F +NLNP+ KP++V YTI+P M YFEFLP  
Sbjct  318   AMAQYIPTLEFYSGGLPMACTMYASSECYFGVNLNPMCKPSDVTYTIMPNMGYFEFLPHD  377

Query  963   -VSREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFN  787
               SR   +   +P  ++DL DV++G+EYE+V+TTYAGL RYRVGD+L V GF N  PQF 
Sbjct  378   SSSRASALSRDSPPRLVDLADVEVGKEYELVITTYAGLCRYRVGDVLEVTGFHNAAPQFR  437

Query  786   FVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE  607
             FV RKNV LSID+DKTDE EL  AV+NAS++L  F+ +++EYTS+A+T TIPGHYV+YWE
Sbjct  438   FVRRKNVLLSIDSDKTDEAELQKAVENASSLLRDFNTTVVEYTSYADTKTIPGHYVIYWE  497

Query  606   ITQSSENPIPRY----IFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMM  439
             +       +  +    I   CC A+EESLNSVYR+ RV+D SIGPLEIR+V NGTF+++M
Sbjct  498   LLVKDNETMNSHPTDEILNQCCLAIEESLNSVYRQGRVADNSIGPLEIRVVRNGTFEELM  557

Query  438   DYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             DYAI+ G+SI+QYK PRCV   PIVELLDSRV S +FSP  P W P  + 
Sbjct  558   DYAISRGASINQYKAPRCVNFTPIVELLDSRVTSVHFSPSKPHWTPERRR  607



>emb|CAN70815.1| hypothetical protein VITISV_042944 [Vitis vinifera]
Length=607

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/585 (60%), Positives = 441/585 (75%), Gaps = 15/585 (3%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE++T N  QVQE++L  ILS N   EYL R  L G+TDR+TFK  +PVVT
Sbjct  17    EKDAKALQFIEEMTRNPDQVQEKILAEILSQNGETEYLQRFKLAGATDRDTFKSKVPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++PDI R+ANG+ S I+ S PISEF TSSGTS GE KL+PT  EE +R+    SLLM
Sbjct  77    YEDLQPDIQRIANGDRSPILSSHPISEFLTSSGTSAGERKLMPTIHEEWDRRQKLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E KTP GL+ARPVLT   +  +FKKR Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETKTPSGLVARPVLTGYYRSEHFKKRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL    +VLRVG +FAS  +RAI FL+ HW+ L HDI TG
Sbjct  196   PDEAILCVDSFQSMYAQMLCGLLMNKEVLRVGAVFASGLLRAIRFLQVHWQQLAHDISTG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
              LNP+ITDPSVRE +A I+KP+ +LA+FI +EC+  +W+ II RIW NTKY+DV+VTGAM
Sbjct  256   ILNPKITDPSVREGLAGILKPSQELADFIIQECSGGNWERIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL-----  967
             +QYIPTL+YF   +PL  T Y SSEC F +NL P+SKP+EV+YTI+P M YFEFL     
Sbjct  316   AQYIPTLDYFSGGIPLACTMYASSECYFGLNLKPMSKPSEVSYTIMPNMGYFEFLPHDPS  375

Query  966   --PVSREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQ  793
               P+SR+      +P  ++DL DV++G+EYE+V+TTYAGL RYRVGDIL+V GF N+ PQ
Sbjct  376   APPLSRD------SPPRLVDLADVEVGKEYELVITTYAGLCRYRVGDILQVTGFHNSAPQ  429

Query  792   FNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLY  613
             F F+ RKNV LSID+DKTDE EL  AV+NAS +L  F+ S++EYTS A+T TIPGHYV+Y
Sbjct  430   FQFIRRKNVLLSIDSDKTDEAELQKAVENASLLLREFNTSVVEYTSFADTKTIPGHYVIY  489

Query  612   WE-ITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMD  436
             WE + +   N     + + CC A+EESLN+VYR+ RV+D SIGPLEIR+V++GTF+++MD
Sbjct  490   WELLVKDPSNSPTDTVLKQCCLAMEESLNTVYRQGRVADNSIGPLEIRVVKSGTFEELMD  549

Query  435   YAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAP  301
             YAI+ G+SI+QYK PRCV   PI+ELLDSRV+S YFSP  P W P
Sbjct  550   YAISRGASINQYKVPRCVNFTPIMELLDSRVLSTYFSPAAPHWNP  594



>ref|XP_009760129.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Nicotiana sylvestris]
Length=603

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/600 (59%), Positives = 443/600 (74%), Gaps = 4/600 (1%)
 Frame = -1

Query  2079  AMTDALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLN  1900
             A+  +  SS   R   E + + LQFIE++T N   VQE+VL  ILS N   EYL R  L 
Sbjct  2     AIATSTASSPLGRPACEKDAKALQFIEEMTRNVDSVQEKVLAEILSRNDNAEYLQRFKLR  61

Query  1899  GSTDRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPT  1720
             G TDR TFK  +PVVTYE+++PDI R+A+G+ S I  S PISEF TSSGTS GE KL+PT
Sbjct  62    GGTDRNTFKSKVPVVTYEEIQPDIQRIASGDRSLIFSSHPISEFLTSSGTSAGERKLMPT  121

Query  1719  TEEELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRS  1540
              EEEL+R+ L  SLLMPV+N +VP L KGK +YFLF++ E KTPGGLLARPVLTS  K  
Sbjct  122   IEEELDRRQLLYSLLMPVMNLYVPGLDKGKGLYFLFIKAETKTPGGLLARPVLTSYYKSD  181

Query  1539  YFKKRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIH  1360
              FK R Y +PY   TSP E ILC DSFQSMY+QMLCGL   +QVLRVG +FAS  +RAI 
Sbjct  182   QFKTRPY-DPYNVYTSPNEAILCVDSFQSMYTQMLCGLLMREQVLRVGAVFASGLLRAIR  240

Query  1359  FLEKHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPR  1180
             FL+ +W+ L  DI  GTLN R++DPS++E  ++I+KPNP+LAEF+ KEC  ++W+GII R
Sbjct  241   FLQLNWQQLAKDIAYGTLNTRVSDPSIKECTSKILKPNPELAEFVIKECEGQNWEGIITR  300

Query  1179  IWRNTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYT  1000
             IW NTKY+DV+VTGAM+QYI TL+Y+   LP   T Y SSEC F +NLNP+ +P+EV+YT
Sbjct  301   IWPNTKYLDVIVTGAMAQYIHTLDYYSGGLPKACTMYASSECYFGLNLNPMCRPSEVSYT  360

Query  999   IIPTMAYFEFLPVS--REIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDIL  826
             I+P M Y EF+P        +   +P  ++DL DV++G+EYE+V+TTYAGL RYRVGDIL
Sbjct  361   IMPNMCYCEFIPHDPINPATISPDSPPRLVDLADVEMGREYELVITTYAGLCRYRVGDIL  420

Query  825   RVAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHAN  646
             +V GF N+ PQF F+ RKNV LSID+DKTDE EL  AV+NA+ IL P D S++EYTS+A+
Sbjct  421   QVTGFHNSAPQFKFIRRKNVLLSIDSDKTDEAELQKAVENATQILRPHDTSVVEYTSYAD  480

Query  645   TSTIPGHYVLYWEITQSSENPIPRY-IFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRI  469
             T TIPGHYV+YWE+     N  P + +   CC A+EESLNSVYR+CRV+D SIGPLEIR+
Sbjct  481   TKTIPGHYVIYWELLIKDPNNSPSHDVLNKCCLAMEESLNSVYRQCRVADNSIGPLEIRV  540

Query  468   VENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             V+ GTF+++MDYAI+ G+SI+QYK PRCV   PI+ELLDSRV+S +FSP  P W P  + 
Sbjct  541   VKKGTFEELMDYAISRGASINQYKAPRCVNFTPILELLDSRVISVHFSPTAPHWTPERRR  600



>ref|XP_002973755.1| hypothetical protein SELMODRAFT_99818 [Selaginella moellendorffii]
 gb|EFJ25415.1| hypothetical protein SELMODRAFT_99818 [Selaginella moellendorffii]
Length=598

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/602 (59%), Positives = 454/602 (75%), Gaps = 14/602 (2%)
 Frame = -1

Query  2040  NLE--ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKL  1867
             NLE  E   + LQFIE VT+ A +VQ  VL AIL  NA  EYL RHGLNG TD+ +F++ 
Sbjct  2     NLEHKEREKQALQFIEKVTSEAAEVQSAVLSAILERNAHTEYLKRHGLNGRTDKTSFRQC  61

Query  1866  IPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLY  1687
             +PV+TYED++P+I R+ANG+ S I+ + PISEF TSSGTS G+ KL+PT  EE ER+ L 
Sbjct  62    LPVITYEDLEPEIQRIANGDTSPILSAHPISEFLTSSGTSAGQRKLMPTISEEFERRCLL  121

Query  1686  SSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPY  1507
              SLLMPV+NQ++P L +GK MY  F++ EAKTPGGLLARPVLTS  K  YF +R Y +P 
Sbjct  122   YSLLMPVMNQYLPGLDQGKGMYLFFIKSEAKTPGGLLARPVLTSYYKSRYFTERPY-DPC  180

Query  1506  TDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCH  1327
                TSP ET+LC D+ QSMY Q+LCGL    +VLR+G +FAS F+RAI FLE HWR LC 
Sbjct  181   NVYTSPNETVLCPDAHQSMYCQLLCGLLQRHEVLRMGAVFASGFLRAIRFLETHWRELCD  240

Query  1326  DIRTGTLNPRITDPSVREAVARIV-KPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDV  1150
             DIR G LN  + D + R AV  ++ +P+P LA+ I ++C KESW GII R+W NTKYIDV
Sbjct  241   DIRAGGLNELVVDAAARRAVLALMPRPDPALADDIAEQCRKESWAGIIARLWPNTKYIDV  300

Query  1149  VVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEF  970
             +VTG M+QYIPTL+Y+   LPLV T Y SSEC F INL PL  P+EV+YT++P MAYFEF
Sbjct  301   IVTGTMAQYIPTLDYYSGGLPLVCTMYASSECYFGINLQPLCPPSEVSYTLLPNMAYFEF  360

Query  969   LPVSREIGVPE----PNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNN  802
             LP+  + G  +    P+P E+++LVDVK+G EYE+V+TTYAGL RYRVGDILRV GF N+
Sbjct  361   LPIKPKSGKSKAPRVPDPSELVELVDVKMGHEYELVITTYAGLCRYRVGDILRVTGFHNS  420

Query  801   TPQFNFVCRKNVALSIDADKTDEVELHNAVKNA-SNILLPFDASLIEYTSHANTSTIPGH  625
              PQF FVCRKNV LSID+DKT E +L  AV++A + I   + A LIEYTS+A+T+TIPGH
Sbjct  421   APQFAFVCRKNVVLSIDSDKTGEEDLAKAVRSATAGIESSYGARLIEYTSYADTTTIPGH  480

Query  624   YVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDK  445
             YVL+WE+  SS  PIP+ + E+CC A+EESL+SVYR+ RVSD+SIGPLEI++V+ GTFD+
Sbjct  481   YVLFWELRSSS--PIPKDVLEECCLAIEESLDSVYRQGRVSDRSIGPLEIKVVKPGTFDQ  538

Query  444   MMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN*NQN  265
             +MDYA++ G+SI+QYK PRCV   PIVELL++RV+S+YFSP+ P+W+P    W    N N
Sbjct  539   LMDYALSRGASINQYKTPRCVKFTPIVELLNARVVSSYFSPRLPKWSPVRPQWA---NSN  595

Query  264   GL  259
             G+
Sbjct  596   GV  597



>ref|XP_008465614.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Cucumis melo]
Length=601

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/587 (59%), Positives = 449/587 (76%), Gaps = 10/587 (2%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E++ + LQFI+++T NA  VQ  VL  ILS NA  EYL R+ L+G+TD +TFK  +PV+T
Sbjct  17    ETDAKPLQFIDEMTRNADAVQHTVLAEILSRNASTEYLRRYSLDGATDPQTFKAKLPVIT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+A+G+ S I+ S PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIASGDRSPILSSHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E +TPGGLLARPVLTS  K  +FK R Y +P+   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETRTPGGLLARPVLTSYYKSDHFKTRPY-DPFMVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL   +QVLR+G +FAS  +RAI FL+ +W  L  DIR G
Sbjct  196   PNEAILCPDSFQSMYTQMLCGLLQRNQVLRLGAVFASGLLRAIRFLQLNWHDLATDIRNG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLN RITDPS+R+ + +I+KP+  LA+F+  EC+KE W+GI+ RIW  TKY+DV+VTGAM
Sbjct  256   TLNSRITDPSLRDCILKILKPDSQLADFVSDECSKEDWEGIVTRIWPKTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+++   LPL  T Y SSEC F +NLNP+ KP+EV+YTI+P MAYFEFLP+   
Sbjct  316   AQYIPTLDFYSGGLPLACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMAYFEFLPLEPN  375

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
              G  + +P +++DLVDV++G+EYE+V+TTYAGLYRYRVGDILRV GF N  PQF+FV RK
Sbjct  376   SG-SDSSP-KLVDLVDVEIGKEYELVITTYAGLYRYRVGDILRVTGFHNAAPQFHFVRRK  433

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEIT---  601
             NV LSID+DKTDE EL  AV+NAS +L  + AS++EYTS+A T TIPGHYV+YWE+    
Sbjct  434   NVVLSIDSDKTDEAELQKAVENASELLKEWKASVVEYTSYAETKTIPGHYVIYWELMVKE  493

Query  600   ---QSSENPIP-RYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDY  433
                Q  +   P + + E+CC  +EES+NSVYR+ RV+D SIG LEIR+V++GTF+++MDY
Sbjct  494   AGDQEGKGKWPSKEVMEECCLRMEESMNSVYRQGRVADHSIGALEIRVVKSGTFEELMDY  553

Query  432   AIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             AI+ G+SI+QYK PRCV   PI+ELLDSRV+S +FSP  P W P  K
Sbjct  554   AISRGASINQYKVPRCVNFTPIMELLDSRVVSTHFSPALPHWTPARK  600



>ref|XP_004287982.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like 
[Fragaria vesca subsp. vesca]
Length=599

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/586 (59%), Positives = 442/586 (75%), Gaps = 8/586 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE+ T N   VQERVL  IL  NA  EYL R  +NG+TDRE+FK  IPVVT
Sbjct  17    EKDAKALQFIEETTKNTDAVQERVLGEILRQNAEAEYLKRFCMNGATDRESFKSKIPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ S PISEF TSSGTS GE KL+PT  EEL+R++L  SLL 
Sbjct  77    YEDLQPEIQRIANGDRSPILSSRPISEFLTSSGTSAGERKLMPTIHEELDRRTLLYSLLQ  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VPDL KGK +YFLF++ E KTPGGL+ARPVLTS  K  +FK R + +PY   TS
Sbjct  137   PVMNLYVPDLDKGKGLYFLFIKSETKTPGGLVARPVLTSYYKSEHFKTRPH-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC+DSFQSMYSQMLCGL    +VLRVG +FAS  +RAI FL+ +W+ L HDI TG
Sbjct  196   PNEAILCSDSFQSMYSQMLCGLIMRKEVLRVGAVFASGLLRAIRFLQINWQQLAHDIETG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNP+ITD S+RE +  I+KP+ +LAEFI KEC  E+ +GIIPRIW NTKY+DV+VTGAM
Sbjct  256   TLNPKITDASIREKMVEILKPDAELAEFIRKECEGENLEGIIPRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYI TL+Y+ N LP   T Y SSEC F +NL P+  P+EV+YTI+P M YFEF+P   +
Sbjct  316   AQYIQTLDYYSNSLPKACTMYASSECYFGLNLKPMCDPSEVSYTIMPMMGYFEFIP--HD  373

Query  951   IGVP---EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFV  781
                P   + +P  ++DL D+++G+EYE+V++TYAGL RYRVGDILRV GF N  PQF F+
Sbjct  374   PSAPPLSKKSPPRLVDLADLEVGKEYELVISTYAGLCRYRVGDILRVTGFYNAAPQFRFI  433

Query  780   CRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEI-  604
              RKNV LSIDADKTDE EL   + NA+ +L  F+ S++EYTS+A+T T PGHYV+YWE+ 
Sbjct  434   RRKNVLLSIDADKTDEAELQKGIDNAAELLREFNTSVVEYTSYADTKTFPGHYVIYWELM  493

Query  603   TQSSENPIPRY-IFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAI  427
              +      PR+ + + CC  +EESLNSVYR+ RVSDK+IGPLEIR+V++GTF+++MDYAI
Sbjct  494   VKDPSISAPRHEVLDQCCLVMEESLNSVYRQYRVSDKTIGPLEIRVVKSGTFEELMDYAI  553

Query  426   ASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             + G+SI+QYK PRCV  +PI+ELLDSRV S +FSP  P W P  +H
Sbjct  554   SRGASINQYKAPRCVNFSPIMELLDSRVESVHFSPALPHWTPERRH  599



>ref|XP_002441339.1| hypothetical protein SORBIDRAFT_09g024710 [Sorghum bicolor]
 gb|EES19769.1| hypothetical protein SORBIDRAFT_09g024710 [Sorghum bicolor]
Length=647

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/600 (58%), Positives = 447/600 (75%), Gaps = 16/600 (3%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDR--ETFKKLIPV  1858
             E++  +L++IE VT  A QVQ RVL  IL+ NA  EYL R G+ G      + F++  P+
Sbjct  23    ETHRELLEYIERVTAGAAQVQRRVLAEILAQNAPAEYLRRLGVAGDAPGAVDAFRRAAPL  82

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             VTYED+ PD+ R+ANG+ S I+   PI EF TSSGTS GE KL+P   +E++R+SL  SL
Sbjct  83    VTYEDILPDVLRIANGDTSPILSGKPIREFLTSSGTSGGERKLMPAIADEMDRRSLLYSL  142

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV++Q VP L KGK MY  FV+ E++TPGG  ARPVLTS  +  +F +R + +PYT  
Sbjct  143   LMPVMSQAVPGLDKGKCMYLYFVKAESRTPGGHPARPVLTSFYRSRHFLERPH-DPYTVY  201

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP E ILC D++QSMY+Q+LCGL +   VLRVG +FAS F+RAI FLEKHW+ LC DIR
Sbjct  202   TSPDEAILCVDAYQSMYAQLLCGLVHRADVLRVGAVFASGFLRAIRFLEKHWQRLCRDIR  261

Query  1317  TGTLNPR-ITDPSVREAVAR--IVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVV  1147
             TGTL+   +TD +VR AV +  +++ +P LA+ +E EC + SW+GII R+W NTKYIDV+
Sbjct  262   TGTLDAEAVTDRAVRAAVEQRVLLRADPALADAVEAECARTSWQGIIRRVWPNTKYIDVI  321

Query  1146  VTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL  967
             VTGAM+QYIP L ++G  LPL  T Y SSE  F INLNP+ KP+EVAYT+IPTM YFEFL
Sbjct  322   VTGAMAQYIPQLEFYGGGLPLTCTMYASSESYFGINLNPMCKPSEVAYTLIPTMCYFEFL  381

Query  966   PVSR--EIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQ  793
             P+ +  +    EP+  +++DLVDVKLG EYE+VVTTY+GLYRYRVGD+LRVAGFKN  P 
Sbjct  382   PLPQPGDDDAGEPDQRDLVDLVDVKLGHEYELVVTTYSGLYRYRVGDVLRVAGFKNQAPM  441

Query  792   FNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLY  613
             FNF+ RKNV LSIDADKTDE ELH AV  A   L PF ASL+EYTS+A+  TIPGHYVL+
Sbjct  442   FNFLRRKNVVLSIDADKTDEAELHAAVSGAVQHLAPFGASLVEYTSYADAGTIPGHYVLF  501

Query  612   WEI-------TQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGT  454
             WE+         ++  P+P  +FEDCC AVEE+LNSVYR+ R +D+SIGPLEIR+V +GT
Sbjct  502   WELRLRAAAAAGATPTPVPASVFEDCCLAVEEALNSVYRQGRAADRSIGPLEIRVVSDGT  561

Query  453   FDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPG-HKHWNTN  277
             FDK+MDYA+A G+SI+QYK PRCV   P+VELLD RV ++YFSPK P+W+PG  K W+++
Sbjct  562   FDKLMDYALARGASINQYKAPRCVRPGPVVELLDGRVQASYFSPKCPKWSPGVGKQWSSD  621



>ref|XP_002975803.1| hypothetical protein SELMODRAFT_103740 [Selaginella moellendorffii]
 gb|EFJ23432.1| hypothetical protein SELMODRAFT_103740 [Selaginella moellendorffii]
Length=598

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/602 (59%), Positives = 453/602 (75%), Gaps = 14/602 (2%)
 Frame = -1

Query  2040  NLE--ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKL  1867
             NLE  E   + LQFIE VT+ A +VQ  VL AIL  NA  EYL RHGLNG TD+ +F++ 
Sbjct  2     NLEHKEREKQALQFIEKVTSEAAEVQSAVLSAILERNAHTEYLKRHGLNGRTDKASFRQC  61

Query  1866  IPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLY  1687
             +PV+TYED++P+I R+ANG+ S I+ + PISEF TSSGTS G+ KL+PT  EE ER+ L 
Sbjct  62    LPVITYEDLEPEIQRIANGDTSPILSAHPISEFLTSSGTSAGQRKLMPTISEEFERRCLL  121

Query  1686  SSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPY  1507
              SLLMPV+NQ++P L +GK MY  F++ EAKTPGGLLARPVLTS  K  YF +R Y +P 
Sbjct  122   YSLLMPVMNQYLPGLDQGKGMYLFFIKSEAKTPGGLLARPVLTSYYKSRYFTERPY-DPC  180

Query  1506  TDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCH  1327
                TSP ET+LC D+ QSMY Q+LCGL    +VLR+G +FAS F+RAI FLE HWR LC 
Sbjct  181   NVYTSPNETVLCPDAHQSMYCQLLCGLLQRHEVLRMGAVFASGFLRAIRFLETHWRELCD  240

Query  1326  DIRTGTLNPRITDPSVREAVARIV-KPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDV  1150
             DIR G LN  + D + R AV  ++ +P+P LA+ I ++C KESW GII R+W NTKYIDV
Sbjct  241   DIRAGGLNELVVDAAARRAVLALMPRPDPALADDIAEQCRKESWAGIIARLWPNTKYIDV  300

Query  1149  VVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEF  970
             +VTG M+QYIPTL+Y+   LPLV T Y SSEC F INL PL  P+EV+YT++P MAYFEF
Sbjct  301   IVTGTMAQYIPTLDYYSGGLPLVCTMYASSECYFGINLQPLCPPSEVSYTLLPNMAYFEF  360

Query  969   LPVSREIGVPE----PNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNN  802
             LP+  + G  +    P+P E+++LVDVK+G EYE+V+TTYAGL RYRVGDILRV GF N+
Sbjct  361   LPIKPKSGKSKAARVPDPSELVELVDVKMGHEYELVITTYAGLCRYRVGDILRVTGFHNS  420

Query  801   TPQFNFVCRKNVALSIDADKTDEVELHNAVKNA-SNILLPFDASLIEYTSHANTSTIPGH  625
              PQF FVCRKNV LSID+DKT E +L  AV++A + I   + A LIEYTS+A+T+TIPGH
Sbjct  421   APQFAFVCRKNVVLSIDSDKTGEEDLAKAVRSATAGIESSYGARLIEYTSYADTTTIPGH  480

Query  624   YVLYWEITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDK  445
             YVL+WE+  SS  PIP+ + E+CC A+EESL+SVYR+ R SD+SIGPLEI++V+ GTFD+
Sbjct  481   YVLFWELRSSS--PIPKDVLEECCLAIEESLDSVYRQGRASDRSIGPLEIKVVKPGTFDQ  538

Query  444   MMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWNTN*NQN  265
             +MDYA++ G+SI+QYK PRCV   PIVELL++RV+S+YFSP+ P+W+P    W    N N
Sbjct  539   LMDYALSRGASINQYKTPRCVKFTPIVELLNARVVSSYFSPRLPKWSPVRPQWA---NSN  595

Query  264   GL  259
             G+
Sbjct  596   GV  597



>gb|KEH17188.1| indole-3-acetic acid-amido synthetase [Medicago truncatula]
Length=588

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/577 (60%), Positives = 441/577 (76%), Gaps = 9/577 (2%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + L+FIE++T NA  VQERVL  ILS NA  EYL R  LNG+ DRETFK  IPV+T
Sbjct  17    EKDAKALRFIEEMTRNADAVQERVLAEILSRNAETEYLKRFKLNGAIDRETFKTKIPVIT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             Y+DV+P+I R+ANG+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YDDVQPEIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E +TPGGLLARPVLTS  K  +FK R + +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETRTPGGLLARPVLTSYYKSEHFKTRPF-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL   +QVLR+G +FAS  +RAI FL+ +W  L HDI+TG
Sbjct  196   PNEAILCPDSFQSMYTQMLCGLIERNQVLRLGAVFASGLLRAIRFLQLNWAELAHDIQTG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNP+ITD  +++ +   +KP+P LA F+ +EC+ E+W+GII +IW NTKY+DV+VTGAM
Sbjct  256   TLNPKITDQKIKDHMKHFIKPDPKLASFVVQECSNENWEGIIIKIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTLNY+   LPL  T Y SSEC F +NLNP+ KP+EV+YTI+P MAYFEFL     
Sbjct  316   AQYIPTLNYYSGGLPLSCTMYASSECYFGLNLNPMCKPSEVSYTIMPNMAYFEFLH----  371

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
                 E      + L +V++G+EYE+V+TTYAGL RYRVGDILRV GF N+TPQF+FV RK
Sbjct  372   ---HESGSTRTVGLTEVEVGKEYELVITTYAGLNRYRVGDILRVTGFHNSTPQFHFVRRK  428

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQSS  592
             NV LSID+DKTDE EL  AV+NAS +L  F+ S++EYTS+A+T TIPGHYV+YWE+   +
Sbjct  429   NVLLSIDSDKTDESELQKAVENASKLLSEFNTSVVEYTSYADTETIPGHYVIYWELLTKA  488

Query  591   ENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGSS  412
             ++P    +   CC  +E+SLNSVYR+CRV+D SIGPLEIR+V++GTF+++MDYAI+ G+S
Sbjct  489   DSP-SHEVLNMCCLEMEQSLNSVYRQCRVADHSIGPLEIRVVKSGTFEELMDYAISRGAS  547

Query  411   ISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAP  301
             I+QYK PRCV   PI+ELLDSRV+S +FS   P W P
Sbjct  548   INQYKVPRCVNFTPIMELLDSRVVSVHFSQDLPHWTP  584



>ref|XP_010028148.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Eucalyptus grandis]
 gb|KCW54801.1| hypothetical protein EUGRSUZ_I00740 [Eucalyptus grandis]
Length=601

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/590 (58%), Positives = 448/590 (76%), Gaps = 8/590 (1%)
 Frame = -1

Query  2043  RNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLI  1864
             R   E + + L+FIE++T N   VQERVL  ILSGN+  EYL R  L+G TDR+ FK  +
Sbjct  15    RPAREKDAKALEFIEEMTRNCDSVQERVLGEILSGNSDTEYLQRFQLSGKTDRDAFKAKV  74

Query  1863  PVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYS  1684
             PVVTYED++P+I R+ANG+ S I+ S PISEF TSSGTS GE KL+PT EEE  R+ L  
Sbjct  75    PVVTYEDLEPEIRRIANGDRSKILSSRPISEFLTSSGTSAGERKLMPTIEEEWNRRQLLY  134

Query  1683  SLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYT  1504
             SLLMPV+N +VP L KGK +YFLFV+ E KTPGGLLARPVLTS  K  +F+ R + +P+ 
Sbjct  135   SLLMPVMNLYVPGLDKGKALYFLFVKAETKTPGGLLARPVLTSYYKSDHFRTRPH-DPFN  193

Query  1503  DCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHD  1324
               TSP E ILC D+FQSMY+QMLCGL    +VLRVG +FAS  IRAI FL+ +W+LL HD
Sbjct  194   VYTSPNEAILCPDTFQSMYAQMLCGLIMHHEVLRVGAVFASGLIRAIRFLQLNWKLLAHD  253

Query  1323  IRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVV  1144
             I TG LNPRIT+P++R  +   ++P+  LAEFI+ +C  ++W+GII RIW NTKY+DV+V
Sbjct  254   IETGALNPRITNPAIRWCLEERLRPDRGLAEFIQTQCEGQAWEGIITRIWPNTKYLDVIV  313

Query  1143  TGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLP  964
             TGAM+QYIPTL+Y+   LPL  T Y SSEC F +NLNP+ KP+EV+YTI+P M YFEF P
Sbjct  314   TGAMAQYIPTLDYYSRGLPLACTMYASSECYFGLNLNPICKPSEVSYTIMPNMGYFEFAP  373

Query  963   VSREIGVP----EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTP  796
                ++  P    + +P  ++DL +V++G+EYE+VVTTY+GL RYRVGDILRV GF N+ P
Sbjct  374   --HDLQAPAYPSQDSPPWLVDLTNVEVGKEYELVVTTYSGLCRYRVGDILRVTGFHNSAP  431

Query  795   QFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVL  616
             QF FV R+NV LSID+DKTDE EL  AV++AS +L   + S++EYTS+A+T+T+PGHYV+
Sbjct  432   QFRFVKRRNVLLSIDSDKTDEAELQGAVESASRLLCESNTSVVEYTSYADTATMPGHYVI  491

Query  615   YWEITQSSENPIPRY-IFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMM  439
             YWE+    E   P + + + CC A+EE+LNSVYR+CRV+D SIGPLEIR+V+ G+F+++M
Sbjct  492   YWELLGKHEENGPNHEVLDQCCLAMEETLNSVYRQCRVTDNSIGPLEIRVVKTGSFEELM  551

Query  438   DYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             DYAI+ G+SI+QYK PRCV+ APIV+LLDSRV+S +FSP+ P W P  +H
Sbjct  552   DYAISRGASINQYKVPRCVSFAPIVKLLDSRVVSAHFSPRAPSWTPERRH  601



>ref|XP_003611653.1| Indole-3-acetic acid-amido synthetase GH3.3 [Medicago truncatula]
 gb|AES94611.1| indole-3-acetic acid-amido synthetase [Medicago truncatula]
Length=600

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/587 (59%), Positives = 448/587 (76%), Gaps = 8/587 (1%)
 Frame = -1

Query  2058  SSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRET  1879
             SS DE++L    N+ L+FIE++T N   VQERVL  IL  NA  EYL R GLNG+TDRET
Sbjct  13    SSVDEKSL----NKALEFIEEMTKNTDSVQERVLSEILEQNAETEYLKRFGLNGATDRET  68

Query  1878  FKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELER  1699
             FK  + V+TYED+ PDI R+ANG+ S I+ + PISEF TSSGTS GE KL+PT  +E++R
Sbjct  69    FKSKVAVITYEDLLPDIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIHQEMDR  128

Query  1698  KSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTY  1519
             + L  SLLMPV+NQ+VPDL KGK ++FLF++ E KTP GL+ARPVLT+  K   FKKR +
Sbjct  129   RQLLYSLLMPVMNQYVPDLDKGKALHFLFIKAETKTPSGLVARPVLTAYYKSEQFKKRPF  188

Query  1518  TNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWR  1339
              +PY   TSP E ILC DSFQSMY+QMLCGL    +VLRVG +FAS  +RAI FL+ +W 
Sbjct  189   -DPYNVLTSPDEAILCPDSFQSMYTQMLCGLIMRHEVLRVGAVFASGLLRAIRFLQLNWA  247

Query  1338  LLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKY  1159
              L HDI TGTLNP+ITDPS+++ +++I+KPNP+LA+F+ KEC+ ++W+ IIPRIW NTKY
Sbjct  248   ELVHDIETGTLNPKITDPSIKQCMSKILKPNPELAKFVTKECSGDNWERIIPRIWPNTKY  307

Query  1158  IDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAY  979
             ++V+VTGAM+QYIPTL+Y+  +LP   T Y SSEC F +NL P+++P EV+YTI+P M Y
Sbjct  308   LEVIVTGAMAQYIPTLDYYSGNLPKPCTMYASSECYFGLNLKPMTEPNEVSYTIMPNMGY  367

Query  978   FEFLPV--SREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKN  805
             FEFLP   S  I +   +P +++DL DV++G+ YE+V+TTY+G  RYRVGDIL+V GF N
Sbjct  368   FEFLPHDDSSPITLSRDSPPKLVDLADVQIGKFYELVITTYSGFCRYRVGDILQVNGFHN  427

Query  804   NTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGH  625
             + PQF FV RKNV LSID+DKTDE EL  A++NAS +L  F  S++EYTS A T +IPGH
Sbjct  428   SDPQFKFVRRKNVLLSIDSDKTDESELQKAIENASALLKEFKTSVVEYTSFAETKSIPGH  487

Query  624   YVLYWE-ITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
             YV+YWE + + S  P    +   CC  +EESLNSVYR+ RV+D SIGPLEIR+V+NGTF+
Sbjct  488   YVIYWELLMKDSSCPPTDEVLNQCCLVMEESLNSVYRQGRVADNSIGPLEIRVVKNGTFE  547

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEW  307
             ++MDYAI+ G+SI+QYK PRCV+  PI+ELLDSRV+S +FSP  P W
Sbjct  548   ELMDYAISRGASINQYKVPRCVSFTPIMELLDSRVVSVHFSPSLPHW  594



>gb|AFW82417.1| hypothetical protein ZEAMMB73_006681 [Zea mays]
Length=633

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/596 (58%), Positives = 441/596 (74%), Gaps = 23/596 (4%)
 Frame = -1

Query  2016  ILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDR--ETFKKLIPVVTYED  1843
             +L++IE VT  A QVQ RVL  IL+ NA  EYL R G++G+     E F++  P+VTYED
Sbjct  24    LLEYIERVTAGAAQVQRRVLSEILAQNAPAEYLRRLGVSGAAPGAVEAFRRAAPLVTYED  83

Query  1842  VKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLMPVI  1663
             + PD+ R+ANG+ S I+   PI EF TSSGTS GE KL+P   +E++R+SL  SLLMPV+
Sbjct  84    ILPDVLRIANGDTSPILSGKPIREFLTSSGTSGGERKLMPAIADEMDRRSLLYSLLMPVM  143

Query  1662  NQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTSPRE  1483
             +Q VP L +G+ MY  FV+ E++TPGG  ARPVLTS  +  +F +R + +PYT  TSP E
Sbjct  144   SQAVPGLDRGRCMYLYFVKAESRTPGGHPARPVLTSFYRSRHFLERPH-DPYTVHTSPDE  202

Query  1482  TILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTGTLN  1303
              +LC D++QSMY+Q+LCGL +   VLRVG +FAS F+RAI FLEKHW+ LC D+R G L 
Sbjct  203   AVLCVDAYQSMYAQLLCGLVHRADVLRVGAVFASGFLRAIRFLEKHWQRLCRDLRRGALG  262

Query  1302  PRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAMSQY  1123
               +TD SVR AVAR+++ +P LA+ +E EC + SW+GII R+W  TKYIDV+VTGAM+QY
Sbjct  263   AEVTDRSVRAAVARVLRADPALADAVEAECARPSWQGIIRRVWPGTKYIDVIVTGAMAQY  322

Query  1122  IPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSREIGV  943
             IPTL ++G  LPL  T Y SSE  F INLNP+ KP+EVAYT+IPTM YFEFLP      +
Sbjct  323   IPTLEFYGGGLPLTCTMYASSESYFGINLNPMCKPSEVAYTLIPTMCYFEFLP------L  376

Query  942   PEPNPV----------EVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQ  793
             P+P P           +++DLVDVKLG EYE+VVTTY+GLYRYRVGD+LRVAGFKN  P 
Sbjct  377   PQPGPGGTDDADPDHRDLVDLVDVKLGHEYELVVTTYSGLYRYRVGDVLRVAGFKNQAPM  436

Query  792   FNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLY  613
             F F+ RKNV LSID+DKTDE ELH AV  A   L PF ASL+EYTS+A+  TIPGHYVL+
Sbjct  437   FKFLRRKNVVLSIDSDKTDEAELHAAVSGAVQHLAPFGASLVEYTSYADAGTIPGHYVLF  496

Query  612   WEITQSSEN---PIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKM  442
             WE+   + +   P+P  +FEDCC AVEE+LNSVYR+ R +D+SIGPLEIR+V +GTFD++
Sbjct  497   WELRLRAGDVPVPVPASVFEDCCLAVEEALNSVYRQGRAADRSIGPLEIRVVSDGTFDRL  556

Query  441   MDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAP-GHKHWNTN  277
             MDYA+A G+SI+QYK PRCV   P+VELLD RV ++Y SPK P+W+P G K W+++
Sbjct  557   MDYALARGASINQYKVPRCVHPGPVVELLDGRVQASYVSPKCPKWSPGGGKQWSSD  612



>ref|XP_009411073.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.8 
[Musa acuminata subsp. malaccensis]
Length=600

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/589 (59%), Positives = 441/589 (75%), Gaps = 12/589 (2%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E +   L+FIE++T NA  VQERVL  IL+ NA  EYL R+GL  +T+R TFK  IPVVT
Sbjct  17    EKDAEKLRFIEEMTANADAVQERVLAEILTRNADTEYLRRYGLGRATERATFKAKIPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S+I+ + PISE  TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIANGDRSAILSAHPISELLTSSGTSAGERKLMPTIKEELDRRQLLFSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +V  L KGK +YFLFV+ E KTPGGL ARPVLTS  K  +F+ R Y +PY   TS
Sbjct  137   PVMNLYVAGLDKGKGLYFLFVKSETKTPGGLTARPVLTSYYKSEHFQSRPY-DPYNVFTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P   ILC D+FQSMY+QMLCGL     VLRVGT+FAS  +RAI FL+ HW+ LC+DI  G
Sbjct  196   PTAAILCADAFQSMYAQMLCGLLQRIDVLRVGTVFASGLLRAIRFLQLHWQELCNDIAAG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
              L P++TDPS+R AVA ++KP+ +LA F+  EC+K  W  II RIW NTKY+DV+VTGAM
Sbjct  256   ALTPKVTDPSIRGAVAELLKPDTELARFVAAECSKGDWAAIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL Y+   LP+  T Y SSEC F +NL P+  P+EV+YTI+P MAYFEFLP   +
Sbjct  316   AQYIPTLEYYSGGLPMACTMYASSECFFGLNLKPMCDPSEVSYTIMPNMAYFEFLPHGGD  375

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
              GV   +  +++DL DV++G+EYE+V+TTYAGL RYRVGD+LRV GF N  PQF FV RK
Sbjct  376   -GV---DKAQLVDLADVEVGKEYELVITTYAGLNRYRVGDVLRVTGFHNAAPQFRFVRRK  431

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQSS  592
             NV LSI++DKTDE EL  AV++AS +L P++AS++EYTSHA+T  IPGHYV+YWE+    
Sbjct  432   NVLLSIESDKTDEAELQKAVQSASALLRPYNASVVEYTSHADTKAIPGHYVIYWELLAKD  491

Query  591   ENP-----IPR-YIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYA  430
              +P     + R  + E CC A+EE+LNSVYR+ RV+D SIGPLEIR+V  GTF+++MDYA
Sbjct  492   ASPSAAEAVTRDGVMERCCLAMEEALNSVYRQSRVADGSIGPLEIRVVRGGTFEELMDYA  551

Query  429   IASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
             I+ G+SI+QYK PRCV+  PI+ELLDSRV+S +FSP PP+W   H+  N
Sbjct  552   ISRGASINQYKVPRCVSLPPILELLDSRVVSAHFSPAPPKWT-AHRPAN  599



>ref|XP_004157348.1| PREDICTED: LOW QUALITY PROTEIN: probable indole-3-acetic acid-amido 
synthetase GH3.1-like [Cucumis sativus]
Length=598

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/584 (59%), Positives = 447/584 (77%), Gaps = 7/584 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E +++ LQFI+++T NA  VQ  +L  ILS NA  EYL R+ L+G+TD +TFK  +PV+T
Sbjct  17    ERDSKPLQFIDEMTRNAHAVQHTLLSEILSRNASTEYLRRYSLDGATDPQTFKAKLPVIT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+A+G+ S I+ S PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIASGDRSPILSSHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E +TPGGLLARPVLTS  K  +FK R Y +P+   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETRTPGGLLARPVLTSYYKSDHFKTRPY-DPFMVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL   +QVLR+G +FAS  +RAI FL+ +W  L  DIR G
Sbjct  196   PNEAILCPDSFQSMYTQMLCGLLQRNQVLRLGAVFASGLLRAIRFLQLNWHDLATDIRNG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLN RITDPS+R+ + +I+KP+  LA+F+  EC+KE W+GI+ RIW  TKY+DV+VTGAM
Sbjct  256   TLNSRITDPSLRDCIQKILKPDAQLADFVSDECSKEEWEGIVTRIWPKTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+++   LPL  T Y SSEC F +NLNP+ KP+EV+YTI+P MAYFEFLP+ + 
Sbjct  316   AQYIPTLDFYSGGLPLACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMAYFEFLPLEQN  375

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
              G  + +P +++DLVDV++G+EYE+V+TTYAGLYRYRVGDILRV GF N  PQF+FV RK
Sbjct  376   SG-SDSSP-KLVDLVDVEMGKEYELVITTYAGLYRYRVGDILRVTGFHNAAPQFHFVRRK  433

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEIT---  601
             NV LSID+DKTDE EL  AV+ AS +L  + AS++EYTS+A T TIPGHYV+YWE+    
Sbjct  434   NVVLSIDSDKTDEAELQKAVEKASEVLKQWKASVVEYTSYAETKTIPGHYVIYWELMVKE  493

Query  600   -QSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIA  424
                 +    + + E+CC  +EES+NSVYR+ RV+D SIG LEIR+V++GTF+++MDYAI+
Sbjct  494   GGRKQGNGRKEVMEECCLRMEESMNSVYRQGRVADNSIGALEIRVVKSGTFEELMDYAIS  553

Query  423   SGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
              G+SI+QYK PRCV   PI+ELLDSRV+S +FSP  P W P  K
Sbjct  554   RGASINQYKVPRCVNFTPIMELLDSRVVSTHFSPALPHWTPTTK  597



>ref|XP_004140723.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like 
[Cucumis sativus]
 gb|KGN57485.1| hypothetical protein Csa_3G198490 [Cucumis sativus]
Length=599

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/585 (59%), Positives = 448/585 (77%), Gaps = 8/585 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E +++ LQFI+++T NA  VQ  +L  ILS NA  EYL R+ L+G+TD +TFK  +PV+T
Sbjct  17    ERDSKPLQFIDEMTRNAHAVQHTLLSEILSRNASTEYLRRYSLDGATDPQTFKAKLPVIT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+A+G+ S I+ S PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIASGDRSPILSSHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E +TPGGLLARPVLTS  K  +FK R Y +P+   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETRTPGGLLARPVLTSYYKSDHFKTRPY-DPFMVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QMLCGL   +QVLR+G +FAS  +RAI FL+ +W  L  DIR G
Sbjct  196   PNEAILCPDSFQSMYTQMLCGLLQRNQVLRLGAVFASGLLRAIRFLQLNWHDLATDIRNG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLN RITDPS+R+ + +I+KP+  LA+F+  EC+KE W+GI+ RIW  TKY+DV+VTGAM
Sbjct  256   TLNSRITDPSLRDCIQKILKPDAQLADFVSDECSKEEWEGIVTRIWPKTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL+++   LPL  T Y SSEC F +NLNP+ KP+EV+YTI+P MAYFEFLP+ + 
Sbjct  316   AQYIPTLDFYSGGLPLACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMAYFEFLPLEQN  375

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
              G  + +P +++DLVDV++G+EYE+V+TTYAGLYRYRVGDILRV GF N  PQF+FV RK
Sbjct  376   SG-SDSSP-KLVDLVDVEMGKEYELVITTYAGLYRYRVGDILRVTGFHNAAPQFHFVRRK  433

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEIT---  601
             NV LSID+DKTDE EL  AV+ AS +L  + AS++EYTS+A T TIPGHYV+YWE+    
Sbjct  434   NVVLSIDSDKTDEAELQKAVEKASEVLKQWKASVVEYTSYAETKTIPGHYVIYWELMVKE  493

Query  600   --QSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAI  427
               + +     + + E+CC  +EES+NSVYR+ RV+D SIG LEIR+V++GTF+++MDYAI
Sbjct  494   GGEEAGKWGRKEVMEECCLRMEESMNSVYRQGRVADNSIGALEIRVVKSGTFEELMDYAI  553

Query  426   ASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             + G+SI+QYK PRCV   PI+ELLDSRV+S +FSP  P W P  K
Sbjct  554   SRGASINQYKVPRCVNFTPIMELLDSRVVSTHFSPALPHWTPTTK  598



>gb|KHN29920.1| Putative indole-3-acetic acid-amido synthetase GH3.1 [Glycine 
soja]
Length=567

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/572 (60%), Positives = 442/572 (77%), Gaps = 10/572 (2%)
 Frame = -1

Query  1995  VTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVTYEDVKPDINRVA  1816
             +T NA  VQERVL+ IL+ NA  EYL R  L+G+ DR+ FK  IPV+TYEDV+P+I R+A
Sbjct  1     MTRNADAVQERVLEEILTRNAQTEYLKRFELDGAADRQAFKSKIPVITYEDVQPEIQRIA  60

Query  1815  NGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLMPVINQFVPDLHK  1636
             NG+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLMPV+N +VP L K
Sbjct  61    NGDRSPILSAHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLMPVMNLYVPGLDK  120

Query  1635  GKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTSPRETILCTDSFQ  1456
             GK +YFLFV+ E +TPGGLLARPVLTS  K  +FK R Y +PY   TSP E ILC+DSFQ
Sbjct  121   GKGLYFLFVKSETRTPGGLLARPVLTSYYKSDHFKTRPY-DPYNVYTSPNEAILCSDSFQ  179

Query  1455  SMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTGTLNPRITDPSVR  1276
             SMY+QMLCGL     VLR+G +FAS  +RAI FL+ +W  L HDI+TGTLN RITDP++R
Sbjct  180   SMYTQMLCGLIERHHVLRLGAVFASGLLRAIRFLQLNWPELAHDIQTGTLNSRITDPAIR  239

Query  1275  EAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAMSQYIPTLNYF-G  1099
               + +++K +P+LA+F+ ++C+K++W+GII RIW NTKY+DV+VTGAM+QYIPTLNY+ G
Sbjct  240   SYMDKVLKSDPELAQFVTQQCSKDNWEGIITRIWPNTKYLDVIVTGAMAQYIPTLNYYSG  299

Query  1098  NDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSREIGVPEPNPV--  925
               LPL  T Y SSEC F +NLNP+ KP+EV+YTI+P MAYFEFLP       P+P     
Sbjct  300   GGLPLACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMAYFEFLPHD-----PKPGSTSS  354

Query  924   EVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRKNVALSIDAD  745
             ++++L DV++G+EYE+V+TTYAGLYRYRVGDILRV GF N+ PQF+FV RKNV LSID+D
Sbjct  355   KLVELADVEVGKEYELVITTYAGLYRYRVGDILRVTGFHNSAPQFHFVRRKNVLLSIDSD  414

Query  744   KTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-ITQSSENPIPRYI  568
             KTDE EL   ++NAS +L  F+ S++EYTS+A+T+TIPGHYV+YWE +T+ S N     +
Sbjct  415   KTDESELQKGIENASKLLSEFNTSVVEYTSYADTTTIPGHYVIYWELLTKDSTNSPSHEV  474

Query  567   FEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGSSISQYKPPR  388
                CC  +EE LNSVYR+CRV+D SIGPLEIR+V NGTF+++MDYAI+ G+SI+QYK PR
Sbjct  475   LNRCCLEMEECLNSVYRQCRVADHSIGPLEIRVVRNGTFEELMDYAISRGASINQYKVPR  534

Query  387   CVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             CV   PI+ELLDSRV+S +FS + P W P  +
Sbjct  535   CVNFTPIMELLDSRVVSVHFSQELPHWTPERR  566



>gb|ADK27717.1| GH3 [Dimocarpus longan]
Length=598

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/595 (59%), Positives = 443/595 (74%), Gaps = 3/595 (1%)
 Frame = -1

Query  2070  DALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGST  1891
             DA  SS       E + + LQFIE++TTNA  VQE VL  IL  NA  EYL R  L+G+T
Sbjct  4     DATHSSPLGPAAIEKDAKALQFIEEMTTNANAVQETVLAEILRQNAETEYLRRFKLDGAT  63

Query  1890  DRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEE  1711
             DR++FK  IPVVTYED++ +I R+A+G+ S+I+ S P+SEF TSSGTS GE KL+PT   
Sbjct  64    DRDSFKSKIPVVTYEDLQTEIKRIADGDRSAILSSHPVSEFLTSSGTSAGERKLMPTIHA  123

Query  1710  ELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFK  1531
             EL+R+ L  SLLMPV+N +VP L KGK +YFLFV+ E+KTPGGLLARPVLTS  K  +FK
Sbjct  124   ELDRRQLLYSLLMPVMNLYVPGLDKGKGLYFLFVKAESKTPGGLLARPVLTSYYKSEHFK  183

Query  1530  KRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLE  1351
              R Y +P+   TSP E ILC DSFQSMY+QMLCGL   ++VLRVG +FAS  +RAI FL+
Sbjct  184   TRPY-DPFNIYTSPNEAILCADSFQSMYTQMLCGLLMREEVLRVGAVFASGLLRAIRFLQ  242

Query  1350  KHWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWR  1171
              +W+ L  DI TG+LNP+ITDPS+R+ + +I+KPNP+LAEFI KEC+ E+W GII RIW 
Sbjct  243   LNWKQLADDISTGSLNPKITDPSLRDCMTKILKPNPELAEFITKECSGENWDGIITRIWP  302

Query  1170  NTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIP  991
             NTKY+DV+VTGAM+QYIPTL+Y+   LP+  T Y SSEC F +NL P+ KP+EV+YTI+P
Sbjct  303   NTKYLDVIVTGAMAQYIPTLDYYSRGLPMACTMYASSECYFGLNLRPMCKPSEVSYTIMP  362

Query  990   TMAYFEFLPVSREIGVPEPNPVEVL-DLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAG  814
              M YFEF+P       P  +    L DL DV++G +YE+V+TTYAGL RYRVGDIL V G
Sbjct  363   NMGYFEFMPHDPAAPPPSRDSPPRLVDLADVEVGTDYELVITTYAGLCRYRVGDILHVTG  422

Query  813   FKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTI  634
             F N  PQF FV RKNV LSID+DKTDE EL  A+ NAS +L  FD S+IEYTS+A+T+TI
Sbjct  423   FHNAAPQFRFVRRKNVLLSIDSDKTDEAELQKAIDNASLLLKQFDTSVIEYTSYADTTTI  482

Query  633   PGHYVLYWE-ITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENG  457
             PGHYV++WE + +   NP    +   CC A+EE +NSVYR+ RV+D SIGPLEIR+V NG
Sbjct  483   PGHYVIFWELLVKDPSNPPTDEVLSKCCLAMEECMNSVYRQGRVADNSIGPLEIRVVRNG  542

Query  456   TFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             TF+++MDYAI+ G+SI+QYK PRCV+ +PI+ELL +RV+S + SP  P W P  +
Sbjct  543   TFEELMDYAISRGASINQYKAPRCVSFSPILELLGARVVSKHLSPAAPHWNPERR  597



>ref|NP_001146696.1| uncharacterized protein LOC100280297 [Zea mays]
 gb|ACL54563.1| unknown [Zea mays]
Length=633

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/596 (58%), Positives = 440/596 (74%), Gaps = 23/596 (4%)
 Frame = -1

Query  2016  ILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDR--ETFKKLIPVVTYED  1843
             +L++IE VT  A QVQ RVL  IL+ NA  EYL R G++G+     E F++  P+VTYED
Sbjct  24    LLEYIERVTAGAAQVQRRVLSEILAQNAPAEYLRRLGVSGAAPGAVEAFRRAAPLVTYED  83

Query  1842  VKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLMPVI  1663
             + PD+ R+ANG+ S I+   PI EF TSSGTS GE KL+P   +E++R+SL  SLLMPV+
Sbjct  84    ILPDVLRIANGDTSPILSGKPIREFLTSSGTSGGERKLMPAIADEMDRRSLLYSLLMPVM  143

Query  1662  NQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTSPRE  1483
             +Q VP L +G+ MY  FV+  ++TPGG  ARPVLTS  +  +F +R + +PYT  TSP E
Sbjct  144   SQAVPGLDRGRCMYLYFVKAGSRTPGGHPARPVLTSFYRSRHFLERPH-DPYTVHTSPDE  202

Query  1482  TILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTGTLN  1303
              +LC D++QSMY+Q+LCGL +   VLRVG +FAS F+RAI FLEKHW+ LC D+R G L 
Sbjct  203   AVLCVDAYQSMYAQLLCGLVHRADVLRVGAVFASGFLRAIRFLEKHWQRLCRDLRRGALG  262

Query  1302  PRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAMSQY  1123
               +TD SVR AVAR+++ +P LA+ +E EC + SW+GII R+W  TKYIDV+VTGAM+QY
Sbjct  263   AEVTDRSVRAAVARVLRADPALADAVEAECARPSWQGIIRRVWPGTKYIDVIVTGAMAQY  322

Query  1122  IPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSREIGV  943
             IPTL ++G  LPL  T Y SSE  F INLNP+ KP+EVAYT+IPTM YFEFLP      +
Sbjct  323   IPTLEFYGGGLPLTCTMYASSESYFGINLNPMCKPSEVAYTLIPTMCYFEFLP------L  376

Query  942   PEPNPV----------EVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQ  793
             P+P P           +++DLVDVKLG EYE+VVTTY+GLYRYRVGD+LRVAGFKN  P 
Sbjct  377   PQPGPGGTDDADPDHRDLVDLVDVKLGHEYELVVTTYSGLYRYRVGDVLRVAGFKNQAPM  436

Query  792   FNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLY  613
             F F+ RKNV LSID+DKTDE ELH AV  A   L PF ASL+EYTS+A+  TIPGHYVL+
Sbjct  437   FKFLRRKNVVLSIDSDKTDEAELHAAVSGAVQHLAPFGASLVEYTSYADAGTIPGHYVLF  496

Query  612   WEITQSSEN---PIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKM  442
             WE+   + +   P+P  +FEDCC AVEE+LNSVYR+ R +D+SIGPLEIR+V +GTFD++
Sbjct  497   WELRLRAGDVPVPVPASVFEDCCLAVEEALNSVYRQGRAADRSIGPLEIRVVSDGTFDRL  556

Query  441   MDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAP-GHKHWNTN  277
             MDYA+A G+SI+QYK PRCV   P+VELLD RV ++Y SPK P+W+P G K W+++
Sbjct  557   MDYALARGASINQYKVPRCVHPGPVVELLDGRVQASYVSPKCPKWSPGGGKQWSSD  612



>ref|XP_004141994.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like 
[Cucumis sativus]
 ref|XP_004171053.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like 
[Cucumis sativus]
 gb|KGN48571.1| hypothetical protein Csa_6G492310 [Cucumis sativus]
Length=588

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/584 (59%), Positives = 435/584 (74%), Gaps = 9/584 (2%)
 Frame = -1

Query  2028  SNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVTY  1849
             S+ + LQFIE++TTNA  VQ++VL  IL+ N+  EYL R  L+ +  R+ FK  + VVTY
Sbjct  8     SHAKALQFIEEITTNADSVQQKVLAEILNRNSDTEYLKRFQLSRTASRDEFKSNVRVVTY  67

Query  1848  EDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLMP  1669
             ED++PDI R+ANG+ S I  S PISEF TSSGTS GE KL+PT +EE+ER+ L  SLLMP
Sbjct  68    EDLQPDIQRIANGDRSPIFSSHPISEFLTSSGTSAGERKLMPTIKEEMERRQLLYSLLMP  127

Query  1668  VINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTSP  1489
             ++N++VP L KGK +YFLFV+ E KT GGLLARPVLTS  K   FK R Y +P+ D TSP
Sbjct  128   IMNKYVPGLDKGKGLYFLFVKAETKTTGGLLARPVLTSYYKSDIFKTRPY-DPFNDYTSP  186

Query  1488  RETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTGT  1309
              E ILC +SFQSMY+QMLCGL   +QVLRVG +FAS  +RAIHFL+ +W+ L HDI T T
Sbjct  187   NEAILCANSFQSMYTQMLCGLLMREQVLRVGAVFASGLLRAIHFLQHNWKQLAHDISTAT  246

Query  1308  LNPRITDPSVREAVAR--IVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGA  1135
             LNP+ITDP +RE +    +  PNP+LAE I KEC+ E W+GII RIW NTKY+DV+VTGA
Sbjct  247   LNPKITDPCLRECIVSKYLTNPNPELAELISKECSTEEWEGIITRIWPNTKYLDVIVTGA  306

Query  1134  MSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSR  955
             M+QYIPTL ++   LP+  T Y SSEC F +NLNP+ KP++V YTI+P M Y EF+P+  
Sbjct  307   MAQYIPTLEFYSGGLPMACTMYASSECYFGVNLNPMCKPSDVTYTIMPNMCYCEFIPLDN  366

Query  954   EIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCR  775
             ++     +P +++DL DV++G+EYE+V+TTY+GL RYRVGDIL V GF N  PQF FV R
Sbjct  367   DMS---SSPTQLVDLADVEVGKEYELVITTYSGLCRYRVGDILHVTGFHNAAPQFRFVRR  423

Query  774   KNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQS  595
             KNV LSID+DKTDE EL  A+ NA+ +L  F+ S++EYTS+A+T TIPGHYV+YWE+   
Sbjct  424   KNVLLSIDSDKTDEAELQKAIDNAALLLRGFNTSVVEYTSYADTKTIPGHYVIYWELLVK  483

Query  594   SE---NPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIA  424
              E   N  P  I   CC A+EESLNSVYR+ RV+D SIGPLEIR+V NGTF+++MDYAI+
Sbjct  484   DEETGNFPPGEILNQCCLAIEESLNSVYRQGRVADNSIGPLEIRVVRNGTFEELMDYAIS  543

Query  423   SGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
              G+SI+QYK PRCV   PI+ELLDSRV S +FSP  P W P  +
Sbjct  544   RGASINQYKAPRCVNFTPIIELLDSRVTSVHFSPSKPHWTPERR  587



>gb|AFC36444.1| GH3-1 [Quercus robur]
Length=603

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/579 (60%), Positives = 440/579 (76%), Gaps = 3/579 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFI+++TTN   VQERVL  ILS NA  EYL R+ L+G+TDR+TFK  IPVV+
Sbjct  22    EKDAKALQFIDEMTTNTDSVQERVLGEILSQNAETEYLRRYQLDGATDRDTFKSKIPVVS  81

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P I R+ANG+ S I+ S PISEF TSSGTS GE KL+PT  EE +R+S   SLLM
Sbjct  82    YEDLQPYIQRIANGDRSPILSSRPISEFLTSSGTSAGERKLMPTIYEEWDRRSKLYSLLM  141

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV N +VP L KGK +YFLFV+ E KTP GLLARPVLT   K  +FK R Y +PYT  TS
Sbjct  142   PVKNLYVPGLDKGKGLYFLFVKAETKTPSGLLARPVLTGYYKSDHFKTRPY-DPYTVYTS  200

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQS+Y+QMLCGL   ++VLR+G +FAS  +RAI FL+ +W+ L HDI TG
Sbjct  201   PDEAILCADSFQSLYTQMLCGLLMREEVLRLGAVFASGLLRAIRFLQLNWKELAHDISTG  260

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNP+ITDPS++E +++IVKPNP+LAEFI KEC+ E+W+GII RIW NTKY+DV+VTGAM
Sbjct  261   TLNPKITDPSLKECMSKIVKPNPELAEFITKECSGENWEGIITRIWPNTKYLDVIVTGAM  320

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QY PTL+Y+   LP   T Y SSEC F +NL P+ KP+EV+YTI+P M YFEFLP    
Sbjct  321   AQYRPTLDYYSAGLPQSCTMYASSECYFGLNLKPMCKPSEVSYTIMPNMGYFEFLPHDPN  380

Query  951   I-GVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCR  775
                    +P  ++DL DV++G+EYE+++TTYAGL RYRVGDIL+V GF N+ PQF F+ R
Sbjct  381   APAFSRDSPPRLVDLADVEVGKEYELIITTYAGLCRYRVGDILQVTGFHNSAPQFRFIRR  440

Query  774   KNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-ITQ  598
             KNV LSID+DKTDE EL  A+ NAS +L  F+ S++EYTS+A+T +IPGHYV+YWE + +
Sbjct  441   KNVLLSIDSDKTDESELQKAIDNASELLKEFNTSVVEYTSYADTKSIPGHYVIYWELLVK  500

Query  597   SSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASG  418
                N     +   CC  +EES+NSVYR+ RV+D SIGPLEIR+V+NGTF+++MDYAI+ G
Sbjct  501   DPGNSPTEEVLNQCCLVMEESMNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAISRG  560

Query  417   SSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAP  301
             +SI+QYK PRCV+  PI+ELLDSR +S +FSP  P W P
Sbjct  561   ASINQYKVPRCVSFNPIMELLDSRKVSVHFSPALPHWTP  599



>ref|XP_007156752.1| hypothetical protein PHAVU_002G014400g [Phaseolus vulgaris]
 gb|ESW28746.1| hypothetical protein PHAVU_002G014400g [Phaseolus vulgaris]
Length=596

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/577 (59%), Positives = 436/577 (76%), Gaps = 4/577 (1%)
 Frame = -1

Query  2013  LQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVTYEDVKP  1834
             L  IED+T N    QE +L  IL+ NA  EYL R GLN +TDR TFK  +PVVTYED++P
Sbjct  20    LHLIEDLTMNTDAYQEEILCKILTQNANSEYLKRFGLNAATDRHTFKSKVPVVTYEDLRP  79

Query  1833  DINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLMPVINQF  1654
             DI R+ANG+ S I+C+ PISEF TSSGTS GE KL+PT +E+++R+    S+ MPV+NQF
Sbjct  80    DIERIANGDRSPILCAHPISEFLTSSGTSAGERKLMPTIDEDMDRRQFLYSMQMPVMNQF  139

Query  1653  VPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTSPRETIL  1474
             V DL KGK ++FLFV+ E+KTPGGLLARPVLTS      FKKR + +PY   TSP E IL
Sbjct  140   VSDLDKGKALHFLFVKAESKTPGGLLARPVLTSYYNSQQFKKRPF-DPYNVLTSPNEAIL  198

Query  1473  CTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTGTLNPRI  1294
             C DSFQSMY+QMLCGL    +VLRVG +FAS  +RAI FL+ +W  L  DI TGTLNP++
Sbjct  199   CPDSFQSMYTQMLCGLIMRHEVLRVGAVFASGLLRAIRFLQLNWDQLAQDIHTGTLNPKV  258

Query  1293  TDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAMSQYIPT  1114
             TDPS+RE +++I+KP+P+LA FI+ EC+ E+W+ II RIW NTKY++V+VTGAM+QYIPT
Sbjct  259   TDPSIRECMSKILKPDPELATFIKNECSGENWERIIVRIWPNTKYLEVIVTGAMAQYIPT  318

Query  1113  LNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE--IGVP  940
             L+Y+   LP   T Y SSEC F +NL P+S+P++V+YTI+P M YFEFLP   +  + + 
Sbjct  319   LDYYSGGLPKPCTMYASSECFFGLNLKPMSEPSDVSYTILPNMGYFEFLPHDDDSHVTLS  378

Query  939   EPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRKNVAL  760
               +P  ++DL DV+LG+ YE+++TTY+GLYRYRVGDIL+V GF N+ PQF FV RKNV L
Sbjct  379   RDSPPRLVDLADVELGKFYELIITTYSGLYRYRVGDILQVTGFHNSDPQFRFVRRKNVLL  438

Query  759   SIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEITQSSENPI  580
             SID+DKTDE EL  A++NAS +L  F  S++EYTS A+T +IPGHYV+YWE+     +  
Sbjct  439   SIDSDKTDEAELQKAIENASELLKEFKTSVVEYTSFADTKSIPGHYVIYWELLMKDTSHS  498

Query  579   PRY-IFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGSSISQ  403
             P   +   CC  +EESLNSVYR+ RV+D SIGPLEIR+VENGTF+++MDYAI+ G+SI+Q
Sbjct  499   PTSDVLNQCCLVMEESLNSVYRQGRVADNSIGPLEIRVVENGTFEELMDYAISRGASINQ  558

Query  402   YKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             YK PRCV  API+ELLDSRV+S +FSP  P W P  +
Sbjct  559   YKVPRCVNFAPIMELLDSRVVSFHFSPAAPHWTPERR  595



>ref|XP_003566071.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.4 
[Brachypodium distachyon]
Length=629

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/613 (58%), Positives = 450/613 (73%), Gaps = 15/613 (2%)
 Frame = -1

Query  2061  ESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLR-HGLNGST--  1891
             E++S   + E+++ + L  IE +TT   + Q+ VLK IL  NA  EYL R  G++G++  
Sbjct  12    EAASASWDWEDAHRKTLDLIEHLTTYPAETQQLVLKEILQQNAPAEYLRRIVGVSGASPG  71

Query  1890  DRETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEE  1711
               E F++L P+VTYED+ P + R+ANG+ S I+   PI EF TSSGTS GE KL+P+  E
Sbjct  72    AAEDFRRLAPLVTYEDILPFVTRIANGDSSPILSGRPIREFLTSSGTSGGERKLMPSIAE  131

Query  1710  ELERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFK  1531
             E+ER+SL  SLLMPV++Q VP L KGK MY  FV+ E++TPGGL ARPVLTS  K  +F+
Sbjct  132   EMERRSLLYSLLMPVMSQAVPGLDKGKAMYLYFVKAESRTPGGLPARPVLTSYYKSRHFR  191

Query  1530  KRTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLE  1351
             +R + +P+T  TSP E ILC D+ QSMY+Q+LCGL +   VLRVG +FAS F+RAI FL 
Sbjct  192   ERAH-DPFTVHTSPDEAILCVDAHQSMYAQLLCGLVHRADVLRVGAVFASGFLRAIDFLR  250

Query  1350  KHWRLLCHDIRTGTLNPR-ITDPSVREAVARIVK-PNPDLAEFIEKECNKESWKGIIPRI  1177
             +HW  LCHDIRTG ++   ITD +VR AV R+++ P+P LA+ +E  C   SW+GII ++
Sbjct  251   QHWPRLCHDIRTGAVDAGVITDRAVRGAVERVLRAPDPALADAVEDACAGASWQGIIRKV  310

Query  1176  WRNTKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTI  997
             W NTKYIDV+VTGAM+QYIPTL ++G  LPL  T Y SSEC F +NLNP+  P EVAYT+
Sbjct  311   WPNTKYIDVIVTGAMAQYIPTLEHYGGGLPLACTMYASSECYFGLNLNPICDPAEVAYTL  370

Query  996   IPTMAYFEFLPV--SREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILR  823
             IPTM +FEFLPV  + E G  EP+  +++ L DVKLG EYE+VVTTY+GLYRYRVGD+LR
Sbjct  371   IPTMCFFEFLPVQSNAETG-EEPDHRDLVGLADVKLGHEYELVVTTYSGLYRYRVGDVLR  429

Query  822   VAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANT  643
             VAGFKN  P FNFV RKNVALSIDADKTDE ELH AV  A   L PF ASL+EYTS+A+T
Sbjct  430   VAGFKNAAPSFNFVRRKNVALSIDADKTDEAELHAAVSAAVQHLEPFGASLVEYTSYADT  489

Query  642   S-TIPGHYVLYWEITQSSEN-----PIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPL  481
             + T PGHYVL+WE+   +       P+P  +FEDCC A+EESLNSVYR+CRV+D+S+GPL
Sbjct  490   AGTSPGHYVLFWELRLRASGTPTPMPVPASVFEDCCLAMEESLNSVYRQCRVADRSVGPL  549

Query  480   EIRIVENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAP  301
             EIR+V  GTFDK+MDYA++ G+SI+QYK PRCV   P+VELLD RV   YFSPK P+W P
Sbjct  550   EIRVVAAGTFDKLMDYALSRGASINQYKAPRCVRPGPVVELLDGRVEERYFSPKCPKWNP  609

Query  300   GHKHWNTN*NQNG  262
             G+K W    N N 
Sbjct  610   GNKQWAAATNNNA  622



>ref|XP_009395628.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.8 
[Musa acuminata subsp. malaccensis]
Length=615

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/596 (59%), Positives = 438/596 (73%), Gaps = 15/596 (3%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E +   L+FIE++TTNA  VQE+VL  IL  NA  EYL R+GL G TDR TFK  +PVVT
Sbjct  22    EKDAEKLRFIEEMTTNADAVQEKVLAEILKRNAETEYLRRYGLGGVTDRATFKAKVPVVT  81

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S+I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  82    YEDLQPEIQRIANGDRSAILSAHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  141

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E KTPGGL ARPVLTS  K  +FK R Y +PY   TS
Sbjct  142   PVMNLYVPGLDKGKGLYFLFVKSETKTPGGLTARPVLTSYYKSEHFKSRPY-DPYNVYTS  200

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P   ILC D+FQSMY+QMLCGL     VLRVG +FAS  +RAI FL+ HW+ L  DI  G
Sbjct  201   PTAAILCADAFQSMYAQMLCGLLQRHDVLRVGAVFASGLLRAIRFLQLHWQELSQDIAVG  260

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TL  +ITDPSVR AV+ ++KP+P+LA  I  EC+K  W GII RIW NTKY+DV+VTGAM
Sbjct  261   TLTVKITDPSVRAAVSELLKPDPELARLIAVECSKGDWAGIITRIWPNTKYLDVIVTGAM  320

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSR-  955
             +QYIPTL Y+   LP+  T Y SSEC F +NL P+  P EV+YTI+P MAYFEFLP    
Sbjct  321   AQYIPTLEYYSGGLPMACTMYASSECYFGLNLKPMCDPAEVSYTIMPNMAYFEFLPHGDC  380

Query  954   ---EIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNF  784
                +   P  +  +++DL DV++G+EYE+V+TTYAGL RYRVGDILRV GF N  PQF F
Sbjct  381   GDGQSHRPGRDKAQLVDLADVEVGKEYELVITTYAGLNRYRVGDILRVNGFYNAAPQFRF  440

Query  783   VCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEI  604
             V RKNV LSI++DKTDE EL  AV++AS +L P+ AS++EYTSHA+T  IPGHYV+YWE+
Sbjct  441   VRRKNVLLSIESDKTDESELQKAVESASALLRPYSASVVEYTSHADTKAIPGHYVIYWEL  500

Query  603   -----TQSSENPIPRY----IFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTF  451
                  + S+   +       + E CC A+EE+LNSVYR+ RV+D SIGPLEIR+V  GTF
Sbjct  501   LAKDKSASAAEAVGALARDGVMERCCLAMEEALNSVYRQSRVADGSIGPLEIRVVRGGTF  560

Query  450   DKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
             +++MDYAI+ G+SI+QYK PRCV+  PI+ELLDSRV+S +FSP  P W+P H+  N
Sbjct  561   EELMDYAISRGASINQYKVPRCVSFPPILELLDSRVVSAHFSPALPRWSP-HRSGN  615



>emb|CAA42636.1| auxin-responsive GH3 product [Glycine max]
Length=593

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/586 (59%), Positives = 433/586 (74%), Gaps = 6/586 (1%)
 Frame = -1

Query  2034  EESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVV  1855
              + N + LQFIED+T N   VQERVL  ILS N+  EYL R  LNG+TDR+TFK  +PVV
Sbjct  8     HDKNAKALQFIEDMTQNTESVQERVLAEILSQNSQTEYLKRFELNGATDRDTFKSKVPVV  67

Query  1854  TYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLL  1675
             +Y+D+K DI+R+ANG+ S I+C+ PISEF TSSGTS GE KL+PT  +E++R+ L  SL 
Sbjct  68    SYDDLKHDIHRIANGDRSPILCAHPISEFLTSSGTSAGERKLMPTIRQEMDRRQLIFSLP  127

Query  1674  MPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCT  1495
             MPV+NQ+V D+ KGK + FLF + E KTP GL+ARPV  S+ K   FK R Y +PY   T
Sbjct  128   MPVMNQYVTDMDKGKALIFLFTKAEQKTPSGLVARPVSASMYKSDQFKNRPY-DPYNVYT  186

Query  1494  SPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRT  1315
             SP E ILC DSFQSMY+QMLCGL    QVLRVG  FAS  +R+IH L+ +W  L HDI T
Sbjct  187   SPDEAILCPDSFQSMYTQMLCGLIMRHQVLRVGANFASGLLRSIHLLQLNWAQLSHDIST  246

Query  1314  GTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGA  1135
             GTLNP+ITDP++++ + +I+KP+P+LAEFI KEC+ E+W+ IIPRIW NTKY++VVVTGA
Sbjct  247   GTLNPKITDPAIKQRMTQILKPDPELAEFIVKECSGENWERIIPRIWPNTKYVEVVVTGA  306

Query  1134  MSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSR  955
             M+QY+PTL+Y+   LPL S  Y SSEC F INLNP   P++V+YTI+P M YFEFLP   
Sbjct  307   MAQYVPTLDYYSGGLPLASNIYGSSECFFGINLNPFCNPSDVSYTIMPNMGYFEFLPQDH  366

Query  954   EIGVPEPNPV----EVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFN  787
             +              ++DL DV+LG+ YE+VVTTY+GL RYRVGDILRV GF N  PQF+
Sbjct  367   DDASSSSGSSFTLSRLIDLDDVELGKSYEIVVTTYSGLCRYRVGDILRVTGFHNTAPQFS  426

Query  786   FVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE  607
             FV RKNV LSID+DKTDE EL NAV+ AS +L  F  S++EYTS A+T +IPGHYV+YWE
Sbjct  427   FVRRKNVLLSIDSDKTDEAELQNAVEKASVLLKEFKTSVVEYTSFADTKSIPGHYVIYWE  486

Query  606   -ITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYA  430
              + + S N       E CC  +EESLN+VYR+ RV+D SIGPLEIR+V+NGTF+++MDYA
Sbjct  487   LLMKDSSNAPTTEALEQCCLTMEESLNAVYRQGRVADHSIGPLEIRVVKNGTFEELMDYA  546

Query  429   IASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             I+ G+SISQYK PRCVT  PI ELLDSRV S +FSP  P W P  +
Sbjct  547   ISRGASISQYKVPRCVTFTPITELLDSRVESVHFSPSEPHWTPERR  592



>ref|XP_008338396.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Malus domestica]
Length=599

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/589 (59%), Positives = 442/589 (75%), Gaps = 16/589 (3%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE+ T N   VQERVL  ILS NA  EY  R GL+G+TDR +FK  +PVVT
Sbjct  17    EKDAKALQFIEETTKNTDLVQERVLSEILSRNAETEYFKRFGLDGATDRNSFKSKVPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ S PISEF TSSGTS GE KL+PT  EEL+R++L  SLL 
Sbjct  77    YEDLQPEIQRIANGDRSPILSSHPISEFLTSSGTSAGERKLMPTIHEELDRRTLLYSLLQ  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VPDL KGK +YFLF++ E KTPGGL+ARPVLTS  K  +FK R   +PY   TS
Sbjct  137   PVMNLYVPDLDKGKGLYFLFIKAETKTPGGLVARPVLTSYYKSEHFKTRP-IDPYNVLTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QM+CGL    QVLRVG +FAS  +RAI FL+ +W+ L  DI  G
Sbjct  196   PNEAILCPDSFQSMYTQMVCGLVMRQQVLRVGAVFASGLLRAIRFLQLNWQQLAIDICNG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNP+ITDPS+RE ++ I+KP+ +LA+FI KEC  E+W+GII R+W NTKY+DV+VTGAM
Sbjct  256   TLNPKITDPSLRETMSGILKPDLELADFITKECCGENWEGIITRVWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL-----  967
             +QYIP L Y+ N LP+  T Y SSEC F +NL P+ KP+EV+YTI+P MAYFEF+     
Sbjct  316   AQYIPLLEYYSNGLPMACTMYASSECYFGLNLKPMCKPSEVSYTIMPNMAYFEFIPHDPS  375

Query  966   --PVSREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQ  793
               P+SR       +P  ++DL D+++G+EYE+V+TTYAGL RYRVGD+L V G+ N  PQ
Sbjct  376   APPLSRH------SPPRLVDLADLEVGKEYELVITTYAGLCRYRVGDVLEVTGYHNAAPQ  429

Query  792   FNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLY  613
             F FV RKNV LSID+DKTDE EL  A+ NAS +L  F+ +++EYTS+A+T TIPGHYV+Y
Sbjct  430   FRFVRRKNVLLSIDSDKTDEAELQKAIDNASVLLREFNTTVVEYTSYADTKTIPGHYVIY  489

Query  612   WE--ITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMM  439
             WE  +   + N     + + CC A+EESLNSVYR+ RV+D SIGPLEIR+V+NGTF+++M
Sbjct  490   WELLVKDPANNSPXHEVLDKCCLAMEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELM  549

Query  438   DYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             DYAI+ G+SI+QYK PRCV  +PI+ELLDSRV+S +FSP  P+W P  +
Sbjct  550   DYAISRGASINQYKAPRCVNFSPIMELLDSRVVSVHFSPXAPQWTPEQR  598



>ref|XP_009399301.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Musa acuminata subsp. malaccensis]
Length=595

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/580 (59%), Positives = 436/580 (75%), Gaps = 7/580 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E +   L+FI+++TTNA +VQE+VL  ILS NA  EY+ R+ L G+TDRETFK  +P+VT
Sbjct  17    EKDAEKLEFIDEMTTNADEVQEKVLTEILSQNAETEYVQRYNLGGATDRETFKSKVPMVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I+R+ANG+ S+I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIHRIANGDRSAILSAHPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLF++ E+KTPGGL ARPVLTS  K  +F+ R + +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFIKSESKTPGGLPARPVLTSYYKSQHFRARPF-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P   ILC D+FQSMYSQMLCGL     VLRVG +FAS  +RAI FL+ HW+ L HDI  G
Sbjct  196   PTAAILCADAFQSMYSQMLCGLLDRLAVLRVGAVFASGLLRAIRFLQLHWQELAHDIAAG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
              L+ ++TDP+VR+AVA ++KP+P LAEFI  EC    W GII RIW NT Y+DV+VTGAM
Sbjct  256   ALSSKVTDPAVRDAVAEVLKPDPGLAEFIVSECAAGDWAGIITRIWPNTMYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL Y+   LP+  T Y SSEC F +NL P+ KP+EV+YTI+P MAYFEFLP+   
Sbjct  316   AQYIPTLEYYSGGLPMTCTMYASSECYFGLNLRPMCKPSEVSYTIMPNMAYFEFLPLD--  373

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
                   +P +++DL DV++G+EYE+V+TTYAGLYRYRVGDIL V GF N  PQF FV RK
Sbjct  374   -AAAAGSPPQLVDLADVEVGKEYELVITTYAGLYRYRVGDILHVTGFHNAAPQFRFVRRK  432

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE--ITQ  598
             NV LSI++DKTDE EL  AV+ AS +L P+ AS+ EYTS A+T+ IPGHYV+YWE  + +
Sbjct  433   NVLLSIESDKTDEAELQKAVERASELLKPWGASVAEYTSQADTTAIPGHYVIYWELLVRE  492

Query  597   SSENPIP-RYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIAS  421
                   P +   E CC  +EE++N+VYR+ RV+D SIGPLEIR+V NGTF+++MDYAIA 
Sbjct  493   GEGGKWPEKEALEACCLEMEEAMNTVYRQSRVADGSIGPLEIRVVRNGTFEELMDYAIAR  552

Query  420   GSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAP  301
             G+SI+QYK PRCVT  PI+ELLDS V+  +FSP  P+W P
Sbjct  553   GASINQYKVPRCVTFPPIIELLDSSVVEAHFSPACPKWTP  592



>ref|XP_009394335.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.8 
[Musa acuminata subsp. malaccensis]
Length=615

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/594 (58%), Positives = 435/594 (73%), Gaps = 15/594 (3%)
 Frame = -1

Query  2034  EESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVV  1855
              E +   L+FIE++T NA  VQE+VL  IL+ NA  EYL R+GL G+TDR  FK  +PVV
Sbjct  22    HEKHAEKLRFIEEMTGNADAVQEKVLAEILTRNAETEYLRRYGLGGATDRLAFKAKVPVV  81

Query  1854  TYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLL  1675
             TYED++P+I R+ANG+ S+I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLL
Sbjct  82    TYEDLQPEIQRIANGDRSAILSAHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLL  141

Query  1674  MPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCT  1495
             MPV+N +VP L KGK +YFLFV+ E  TPGGL ARPVLTS  K  +FK R Y +PY   T
Sbjct  142   MPVMNLYVPGLDKGKGLYFLFVKSETSTPGGLTARPVLTSYYKSEHFKSRPY-DPYNVYT  200

Query  1494  SPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRT  1315
             SP   ILC D+FQSMY+QMLCGL     VLRVG +FAS  +RAI FL+ HWR L  DI  
Sbjct  201   SPTAAILCADAFQSMYAQMLCGLLQRLDVLRVGAVFASGLLRAIRFLQLHWRELSQDIAA  260

Query  1314  GTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGA  1135
             GTL  ++TDPS+R AVA ++KP+P+LA F+  EC++  W GII RIW NTKY+DV+VTGA
Sbjct  261   GTLTAKVTDPSIRGAVAELLKPDPELARFVAAECSEGEWAGIITRIWPNTKYLDVIVTGA  320

Query  1134  MSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSR  955
             M+QYIPTL Y+   LP+  T Y SSEC F +NLNP+  P+EV+YTI+P MAYFEFLP   
Sbjct  321   MAQYIPTLEYYSGGLPMACTMYASSECYFGLNLNPMCDPSEVSYTIMPNMAYFEFLPHGG  380

Query  954   EIGVPEP--NPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFV  781
             +   P    +  +++DL DV++G+EYE+V+TTYAGL RYRVGD+LRV GF N  PQF FV
Sbjct  381   DGHHPGEGVDTAQLVDLADVEVGKEYELVITTYAGLNRYRVGDVLRVTGFHNAAPQFRFV  440

Query  780   CRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWEIT  601
              RKNV LSI++DKTDE EL  AV+ AS +L P++AS++EYTSHA+T  IPGHYV+YWE+ 
Sbjct  441   RRKNVLLSIESDKTDEAELQKAVERASALLRPYNASVVEYTSHADTKAIPGHYVIYWELL  500

Query  600   QSSENPIPRY---------IFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFD  448
                 +              + E CC A+EE+LNSVYR+ RV+D SIGPLEIR+V  GTF+
Sbjct  501   AKDSSSSAAAAAAALARDGVMERCCLAMEEALNSVYRQSRVADGSIGPLEIRVVRGGTFE  560

Query  447   KMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWA---PGH  295
             ++MDYAI+ G+SI+QYK PRCV   PI+ELLDSRV+S +FSP  P+W    PGH
Sbjct  561   ELMDYAISRGASINQYKVPRCVNFPPILELLDSRVVSAHFSPALPKWIPHFPGH  614



>ref|XP_010548443.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.3 [Tarenaya 
hassleriana]
Length=595

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/583 (59%), Positives = 442/583 (76%), Gaps = 6/583 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE ++ N   VQE VLK ILS NA  EYL R  L+GSTDR TFK  +PVVT
Sbjct  17    EKDAKALQFIEQMSRNTDPVQETVLKEILSRNAETEYLKRFDLDGSTDRTTFKSKVPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED+KP+I R+ANG+ S I+ S PISEF TSSGTS GE KL+PT +E+L+R+ L  SLLM
Sbjct  77    YEDLKPEIQRIANGDRSPILSSHPISEFLTSSGTSAGERKLMPTIDEDLDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E KTPGGL ARPVLTS  K  +FKKR Y +PY + TS
Sbjct  137   PVMNLYVPGLDKGKALYFLFVKAETKTPGGLPARPVLTSYYKSDHFKKRPY-DPYNNYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DS QSMY+QMLCGL    +VLR+G +FAS  +RAI FL+ +W  L  DI TG
Sbjct  196   PNEAILCPDSSQSMYTQMLCGLLMRHEVLRLGAVFASGLLRAISFLQNNWLELVRDISTG  255

Query  1311  TLNPRITDPSVREAVARIV-KPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGA  1135
             TLNP+ITDP++R+ +A+I+ KP+ +LA+ I + C++ESW+GII +IW NTKY+DV+VTGA
Sbjct  256   TLNPKITDPAIRDCMAKILTKPDQELADVITRVCSQESWQGIITKIWPNTKYLDVIVTGA  315

Query  1134  MSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSR  955
             M+QYIPTL ++   LP+  T Y SSE  F INL P+ KPTEV+YTI+P MAYFEF+P   
Sbjct  316   MAQYIPTLEFYSGGLPMACTMYASSESYFGINLKPMCKPTEVSYTIMPNMAYFEFIPFEH  375

Query  954   EIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCR  775
             +      +P  +++L DV++G+EYE+V+TT+AGLYRYRVGDIL+V GF N+ PQF F+ R
Sbjct  376   DGST---DPAALVELADVEVGKEYELVITTFAGLYRYRVGDILQVTGFHNSAPQFKFIRR  432

Query  774   KNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-ITQ  598
             KNV LSI++DKTDE EL  AV+NAS +L  ++  +IEYTS+A T TIPGHYV+YWE + +
Sbjct  433   KNVLLSIESDKTDEAELQKAVENASGLLAGYETRVIEYTSYAETKTIPGHYVIYWELLVK  492

Query  597   SSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASG  418
               +N     +   CC  +EESLNSVYR+ RV+DKSIGPLEIR+V+ GTF+++MDYAI+ G
Sbjct  493   DQKNAPDDEMMARCCLEMEESLNSVYRQSRVADKSIGPLEIRVVKAGTFEELMDYAISRG  552

Query  417   SSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             +SI+QYK PRCV+  PI+ELLDSRV S++FSP  P W+P  + 
Sbjct  553   ASINQYKVPRCVSFTPIMELLDSRVESSHFSPALPHWSPERRR  595



>ref|XP_003524670.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like 
[Glycine max]
 gb|KHN21427.1| Putative indole-3-acetic acid-amido synthetase GH3.1 [Glycine 
soja]
Length=594

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/587 (59%), Positives = 434/587 (74%), Gaps = 7/587 (1%)
 Frame = -1

Query  2034  EESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVV  1855
              + N + LQFIED+T N   VQERVL  ILS N+  EYL R  LNG+TDR+TFK  +PVV
Sbjct  8     HDKNAKALQFIEDMTQNTESVQERVLAEILSQNSQTEYLKRFELNGATDRDTFKSKVPVV  67

Query  1854  TYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLL  1675
             +Y+D+K DI+R+ANG+ S I+C+ PISEF TSSGTS GE KL+PT  +E++R+ L  SL 
Sbjct  68    SYDDLKHDIHRIANGDRSPILCAHPISEFLTSSGTSAGERKLMPTIRQEMDRRQLIFSLP  127

Query  1674  MPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCT  1495
             MPV+NQ+V D+ KGK + FLF + E KTP GL+ARPV  S+ K   FK R Y +PY   T
Sbjct  128   MPVMNQYVTDMDKGKALIFLFTKAEQKTPSGLVARPVSASMYKSDQFKNRPY-DPYNVYT  186

Query  1494  SPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRT  1315
             SP E ILC DSFQSMY+QMLCGL    QVLRVG  FAS  +R+IH L+ +W  L HDI T
Sbjct  187   SPDEAILCPDSFQSMYTQMLCGLIMRHQVLRVGANFASGLLRSIHLLQLNWAQLSHDIST  246

Query  1314  GTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGA  1135
             GTLNP+ITDP++++ + +I+KP+P+LAEFI KEC+ E+W+ IIPRIW NTKY++VVVTGA
Sbjct  247   GTLNPKITDPAIKQRMTQILKPDPELAEFIVKECSGENWERIIPRIWPNTKYVEVVVTGA  306

Query  1134  MSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSR  955
             M+QY+PTL+Y+   LPL S  Y SSEC F INLNP   P++V+YTI+P M YFEFLP   
Sbjct  307   MAQYVPTLDYYSGGLPLASNIYGSSECFFGINLNPFCNPSDVSYTIMPNMGYFEFLPQDH  366

Query  954   EIGVPEPNPV-----EVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQF  790
             +      +        ++DL DV+LG+ YE+VVTTY+GL RYRVGDILRV GF N  PQF
Sbjct  367   DDDASSSSGSSFTLSRLIDLDDVELGKSYEIVVTTYSGLCRYRVGDILRVTGFHNTAPQF  426

Query  789   NFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYW  610
             +FV RKNV LSID+DKTDE EL NAV+ AS +L  F  S++EYTS A+T +IPGHYV+YW
Sbjct  427   SFVRRKNVLLSIDSDKTDEAELQNAVEKASVLLKEFKTSVVEYTSFADTKSIPGHYVIYW  486

Query  609   E-ITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDY  433
             E + + S N       E CC  +EESLN+VYR+ RV+D SIGPLEIR+V+NGTF+++MDY
Sbjct  487   ELLMKDSSNAPTTEALEQCCLTMEESLNAVYRQGRVADHSIGPLEIRVVKNGTFEELMDY  546

Query  432   AIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             AI+ G+SISQYK PRCVT  PI ELLDSRV S +FSP  P W P  +
Sbjct  547   AISRGASISQYKVPRCVTFTPITELLDSRVESVHFSPSEPHWTPERR  593



>ref|XP_009372462.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Pyrus x bretschneideri]
 ref|XP_009336077.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Pyrus x bretschneideri]
 ref|XP_009336078.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Pyrus x bretschneideri]
Length=599

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/589 (59%), Positives = 444/589 (75%), Gaps = 16/589 (3%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + LQFIE+ T N   VQERVL  ILS NA  EYL R  L+G+TDR +FK  +PVVT
Sbjct  17    EKDAKALQFIEETTKNTDLVQERVLGEILSRNAETEYLKRFSLDGATDRNSFKSKVPVVT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S I+ S PISEF TSSGTS GE KL+PT  EEL+R++L  SLL 
Sbjct  77    YEDLQPEIQRIANGDRSPILSSHPISEFLTSSGTSAGERKLMPTIHEELDRRTLLYSLLQ  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VPDL KGK +YFLF++ E KTPGGL+ARPVLTS  K  +FK R   +PY   TS
Sbjct  137   PVMNLYVPDLDKGKGLYFLFIKAETKTPGGLVARPVLTSYYKSEHFKTRP-IDPYNVLTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMY+QM+CGL    QVLRVG +FAS  +RAI FL+ +W+ L  DI  G
Sbjct  196   PNEAILCPDSFQSMYTQMVCGLVMRQQVLRVGAVFASGLLRAIRFLQLNWQQLAIDICNG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TLNP+I DPS+RE ++ I+KP+P+LA+FI KEC +E+W+GII R+W NTKY+DV+VTGAM
Sbjct  256   TLNPKIIDPSLRETMSGILKPDPELADFITKECCEENWEGIITRVWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFL-----  967
             +QYIP L Y+ N LP+  T Y SSEC F +NL P+ KP+EV+YTI+P MAYFEF+     
Sbjct  316   AQYIPLLEYYSNGLPMACTMYASSECYFGLNLKPMCKPSEVSYTIMPNMAYFEFIPHDPS  375

Query  966   --PVSREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQ  793
               P+SR       +P  ++DL D+++G+EYE+V+TTYAGL RYRVGD+L V G+ N  PQ
Sbjct  376   APPLSRH------SPPRLVDLADLEVGKEYELVITTYAGLCRYRVGDVLEVTGYHNAAPQ  429

Query  792   FNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLY  613
             F FV RKNV LSID+DKTDE EL  A+ NAS +L  F+ +++EYTS+A+T TIPGHYV+Y
Sbjct  430   FRFVRRKNVLLSIDSDKTDEAELQKAIDNASVLLREFNTTVVEYTSYADTKTIPGHYVIY  489

Query  612   WE-ITQSSENPIPRY-IFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMM  439
              E + +   N  P + + + CC A+EESLNSVYR+ RV+D SIGPLEIR+V+NGTF+++M
Sbjct  490   LELLVKDPANNSPNHEVLDKCCLAMEESLNSVYRQGRVADSSIGPLEIRVVKNGTFEELM  549

Query  438   DYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             DYAI+ G+SI+QYK PRCV  +PI+ELLDSRV+S +FSP  P+W P  +
Sbjct  550   DYAISRGASINQYKAPRCVNFSPIMELLDSRVVSVHFSPSAPQWTPEQR  598



>ref|XP_007155870.1| hypothetical protein PHAVU_003G238700g [Phaseolus vulgaris]
 gb|ESW27864.1| hypothetical protein PHAVU_003G238700g [Phaseolus vulgaris]
Length=605

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/598 (58%), Positives = 441/598 (74%), Gaps = 12/598 (2%)
 Frame = -1

Query  2067  ALESSSDERNLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTD  1888
             AL  +SD++N      + L+FIE++T N  +VQERVL  ILS NA  EYL R  LN +TD
Sbjct  13    ALPPTSDDKNA-----KALRFIEEITRNTDRVQERVLAEILSQNAPTEYLKRFQLNEATD  67

Query  1887  RETFKKLIPVVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEE  1708
             R TFK  +P+V+YED+K DI R+ANG+ S I C+ P+SEF TSSGTS GE KL+PT  EE
Sbjct  68    RHTFKSKVPIVSYEDLKHDIQRIANGDRSPIFCAHPVSEFLTSSGTSAGERKLMPTIREE  127

Query  1707  LERKSLYSSLLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKK  1528
             ++R+ L  SLLMPV+NQ+V  L KGK + FLF++ E KTP GL+ARPVLTS  K   FK 
Sbjct  128   MDRRQLLYSLLMPVMNQYVGGLDKGKALLFLFIKSETKTPSGLVARPVLTSYYKSEQFKN  187

Query  1527  RTYTNPYTDCTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEK  1348
             R + +PY   TSP E ILC DSFQSMY+QMLCGL    +VLRVG +FAS  +RAI FL+ 
Sbjct  188   RPH-DPYNVYTSPDEAILCPDSFQSMYTQMLCGLIMRHEVLRVGAVFASGLLRAIRFLQL  246

Query  1347  HWRLLCHDIRTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRN  1168
             +W  L HDI TGTLNP+ITDP++ E +A+I+KPNP+LA FI KEC+ E+W+ II RIW N
Sbjct  247   NWAQLAHDISTGTLNPKITDPAITERMAQILKPNPELANFIIKECSGETWERIITRIWPN  306

Query  1167  TKYIDVVVTGAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPT  988
             TKY+DV+VTGAM+QYIPTLNY+   LPL  T Y SSEC F +NLNP+  P++V+YTI+P 
Sbjct  307   TKYLDVIVTGAMAQYIPTLNYYSGGLPLACTMYASSECYFGLNLNPICNPSDVSYTIMPN  366

Query  987   MAYFEFLP-----VSREIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILR  823
             M YFEFLP      +        +P  ++DL DV+LG+ YE+V+T Y+GL RYRVGD+L+
Sbjct  367   MGYFEFLPHDDDSSTSSSTSSRDSPPPLVDLADVELGKSYELVLTGYSGLCRYRVGDVLQ  426

Query  822   VAGFKNNTPQFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANT  643
             V GF N+ P+F FV RKNV LSID+DKTDE EL NAV+NAS +L   + S++EYTS A+T
Sbjct  427   VTGFHNSAPEFRFVRRKNVLLSIDSDKTDEAELQNAVENASVLLKELNTSVVEYTSFADT  486

Query  642   STIPGHYVLYWEITQSSENPIP-RYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIV  466
              +IPGHYV+YWE+        P R + E CC  +EESLNSVYR+ RVSD SIGPLEIR+V
Sbjct  487   KSIPGHYVIYWELLMKDSRHAPSRDVLEKCCLTMEESLNSVYRQGRVSDHSIGPLEIRVV  546

Query  465   ENGTFDKMMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             +NGTF+++MDYAI+ G+SI+QYK PRCVT  PI ELLDSRV S +FSP  P W+P  +
Sbjct  547   KNGTFEELMDYAISRGASINQYKVPRCVTFTPITELLDSRVESVHFSPAEPHWSPERR  604



>ref|XP_009123229.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Brassica rapa]
Length=590

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/583 (60%), Positives = 433/583 (74%), Gaps = 12/583 (2%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + L+FIE++T NA  VQE +L  IL  NA  EYL R  L G+TDR+TFK  +P++T
Sbjct  17    EKDAKALRFIEEMTRNADTVQENLLAEILRRNAETEYLRRFNLGGATDRDTFKSKLPIIT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+A+G+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIADGDRSPILSAHPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E KTPGGL ARPVLTS  K   F+ R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETKTPGGLPARPVLTSYYKSDKFRSRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMYSQMLCGL     VLRVG +FAS  +RAI FL+ HW  L +DI TG
Sbjct  196   PNEAILCPDSFQSMYSQMLCGLLDRLSVLRVGAVFASGLLRAIRFLQLHWSRLAYDIETG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             +L+  ITDPS+R+ ++ I+KP+  LAEFI +EC  E+W+GII RIW NTKY+DV+VTGAM
Sbjct  256   SLDSEITDPSIRQCMSDILKPDQHLAEFIRQECQTENWEGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL Y+   LP+  T Y SSEC F +NLNP+SKP+EV+YTI+P MAYFEF+P+   
Sbjct  316   AQYIPTLEYYSGGLPMACTMYASSECYFGLNLNPMSKPSEVSYTIMPNMAYFEFIPLGGS  375

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
               V         +LVDVK+G+EYE+VVTTYAGL RYRVGDILRV GF N+ PQF+FV RK
Sbjct  376   KAV---------ELVDVKIGKEYELVVTTYAGLCRYRVGDILRVTGFHNSAPQFHFVRRK  426

Query  771   NVALSIDADKTDEVELHNAVKNASNILLP-FDASLIEYTSHANTSTIPGHYVLYWE-ITQ  598
             NV LSID+DKTDE EL  AV+NAS +LL      + EYTS+A+TSTIPGHYVLYWE + +
Sbjct  427   NVLLSIDSDKTDESELQKAVENASKLLLKECGTRVAEYTSYADTSTIPGHYVLYWELLVR  486

Query  597   SSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASG  418
               E          CC  +EESLNSVYR+CRV+D S+GPLEIR+V NGTF+++MDYAI+ G
Sbjct  487   EGERQPSHDTLTRCCLEMEESLNSVYRQCRVADNSVGPLEIRVVRNGTFEELMDYAISRG  546

Query  417   SSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             +SI+QYK PRCV   PIVELLDSRV+S +FSP  P W P  + 
Sbjct  547   ASINQYKVPRCVNFTPIVELLDSRVVSAHFSPALPHWTPERRR  589



>ref|XP_003550026.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like 
[Glycine max]
Length=593

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/589 (58%), Positives = 436/589 (74%), Gaps = 7/589 (1%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             N ++ N + LQFIED+T N   VQERVL  ILS NA  EYL R  LNG+TDR+TFK  +P
Sbjct  5     NCDDKNAKTLQFIEDMTRNTDSVQERVLAEILSQNAQTEYLKRFELNGATDRDTFKSKVP  64

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             VV+Y+D+K DI R+ANG+ S I+C+ PI+EF TSSGTS GE KL+PT  +E ER+ L  S
Sbjct  65    VVSYDDLKHDIQRIANGDRSPILCAHPITEFLTSSGTSAGERKLMPTISQETERRQLIFS  124

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             L MPV+NQ+V DL KGK + FLF + E KTP GL+ARPV  S+ K   FK R Y +PY  
Sbjct  125   LPMPVMNQYVADLDKGKALLFLFTKAETKTPSGLVARPVSASMYKSEQFKNRPY-DPYNV  183

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP E ILC DSFQSMY+Q+LCGL    QVLR+G  FAS  +RAI FL+ +W  L HDI
Sbjct  184   YTSPNEAILCLDSFQSMYTQVLCGLIMRHQVLRIGANFASGLLRAIRFLQLNWAELAHDI  243

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
              TGTLNP+I+D  +++ + +I+KP+P+LA+FI KEC+ E+W+ IIPRIW NTK+++V+VT
Sbjct  244   STGTLNPKISDLPIKQRMTQILKPDPELADFIVKECSGENWESIIPRIWPNTKFVEVIVT  303

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             GAM+QYIPTL+Y+   LP+ S  Y SSEC F INLNP   P++V+YTI+P M YFEFLP 
Sbjct  304   GAMAQYIPTLDYYSGGLPIASNIYGSSECFFGINLNPFCNPSDVSYTIMPNMGYFEFLPH  363

Query  960   SRE-----IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTP  796
               +     +     +   + DL DV+LG+ YE+VVTTY+G+ RYRVGDILRV GF N+TP
Sbjct  364   DHDDDDGALYSGSDSSSRLTDLADVELGKSYEIVVTTYSGICRYRVGDILRVTGFHNSTP  423

Query  795   QFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVL  616
             QF+FV RKNV LSID+DKTDE EL NAV+NAS +L  F  S++EYTS A+T +IPGHYV+
Sbjct  424   QFSFVRRKNVLLSIDSDKTDEAELQNAVENASVLLKEFKTSVVEYTSFADTKSIPGHYVI  483

Query  615   YWE-ITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMM  439
             YWE + + S N       E CC  +EESLN+VYR+CRV++ SIGPLEIR+V+NGTF+++M
Sbjct  484   YWELLMKDSSNAPTSEALEQCCLRMEESLNAVYRQCRVAEHSIGPLEIRVVKNGTFEELM  543

Query  438   DYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             DYAI+ G+SISQYK PRCV+  PI ELLDSRV S +FSP  P W P  +
Sbjct  544   DYAISRGASISQYKVPRCVSFTPITELLDSRVESVHFSPAEPHWTPERR  592



>ref|XP_004983963.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.8-like 
[Setaria italica]
Length=617

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/568 (60%), Positives = 423/568 (74%), Gaps = 6/568 (1%)
 Frame = -1

Query  2013  LQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVTYEDVKP  1834
             L+FIE++T+N   VQERVL  IL+ NAG EYL R GL G+TDR  F+  +PVVTYED++P
Sbjct  36    LRFIEEMTSNVDAVQERVLAEILARNAGTEYLARCGLAGATDRAAFRARVPVVTYEDLQP  95

Query  1833  DINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLMPVINQF  1654
             DI R+ANG+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLMPV+N +
Sbjct  96    DIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLMPVMNLY  155

Query  1653  VPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTSPRETIL  1474
             VP L KGK +YFLFV+ E  TPGGL ARPVLTS  K  +FK R Y +PY D TSP   IL
Sbjct  156   VPGLDKGKALYFLFVKSETTTPGGLTARPVLTSYYKSEHFKNRPY-DPYHDYTSPTAAIL  214

Query  1473  CTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTGTLNPRI  1294
             C D+FQSMY+QM CGL     VLRVG +FAS  +RAI FL+ HW  L  DI  G+L PR+
Sbjct  215   CADAFQSMYAQMACGLCQRHDVLRVGAVFASGLLRAIRFLQLHWEQLADDIEAGSLTPRV  274

Query  1293  TDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAMSQYIPT  1114
             TDPSVREAVA I++P+P+LA F+  EC++  W GI+ R+W NTKY+DV+VTGAM QYIPT
Sbjct  275   TDPSVREAVADILRPDPELARFLRAECSRGDWAGIVTRVWPNTKYLDVIVTGAMQQYIPT  334

Query  1113  LNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSREIGVPEP  934
             L Y+   LP+  T Y SSEC F +NL P+ +P+EV+YTI+P M YFEFLPV    GV   
Sbjct  335   LQYYSGGLPMACTMYASSECYFGLNLRPMCRPSEVSYTIMPNMGYFEFLPVDEASGVASG  394

Query  933   NPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRKNVALSI  754
             +  +++DL  V+ G+EYE+V+TTYAGLYRYRVGDILRV GF N  PQF FV RKNV LSI
Sbjct  395   DAAQLVDLARVEAGREYELVITTYAGLYRYRVGDILRVTGFHNAAPQFRFVRRKNVLLSI  454

Query  753   DADKTDEVELHNAVKNASNILLP-FDASLIEYTSHANTSTIPGHYVLYWEI----TQSSE  589
             ++DKTDE EL  AV  AS +L     A+++EYTSHA T +IPGHYV+YWE+     +  E
Sbjct  455   ESDKTDEAELQRAVDRASALLRERRGAAVVEYTSHACTRSIPGHYVVYWELLATAAEQGE  514

Query  588   NPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASGSSI  409
             + +     E CC  +EE+LNSVYR+ RV+D SIGPLEIR+V +GTF+++MDYAI+ G+SI
Sbjct  515   DAVDGETLERCCLEMEEALNSVYRQSRVADGSIGPLEIRVVRSGTFEELMDYAISRGASI  574

Query  408   SQYKPPRCVTRAPIVELLDSRVMSNYFS  325
             +QYK PRCV+  PIVELLDSRV+S +FS
Sbjct  575   NQYKVPRCVSFPPIVELLDSRVVSRHFS  602



>ref|XP_006426015.1| hypothetical protein CICLE_v10025211mg [Citrus clementina]
 gb|ESR39255.1| hypothetical protein CICLE_v10025211mg [Citrus clementina]
Length=598

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/585 (59%), Positives = 438/585 (75%), Gaps = 3/585 (1%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             L E + + L+FIE++T NA  VQERVL AILS N   EYL R  L+G+TDR+TFK  +PV
Sbjct  15    LCEKDAKALRFIEEMTRNADPVQERVLAAILSRNGETEYLRRFNLDGATDRDTFKSKVPV  74

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             VTYED++P+I R+ANG+ S+I+ S P+SEF TSSGTS GE KL+PT  EEL+R+ L  SL
Sbjct  75    VTYEDLQPEIQRIANGDRSAILSSHPVSEFLTSSGTSAGERKLMPTIHEELDRRQLLFSL  134

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV+N +VP L KGK +YFLFV+ E KT  GLLARPVLTS  K   FK R Y +P+   
Sbjct  135   LMPVMNLYVPGLDKGKGLYFLFVKAETKTASGLLARPVLTSYYKSEQFKTRPY-DPFNVY  193

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP E ILC DSFQSMY QMLCGL   ++VLRVG +FAS  +RAI FL+ +W+ L  DI 
Sbjct  194   TSPDEAILCVDSFQSMYIQMLCGLIMREEVLRVGAVFASGLLRAIRFLQLNWKQLADDIS  253

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
              GTLNP +TDPS+R+ +  I+KPNP+LAEFI KEC+ E W GII RIW NTKY+DV+VTG
Sbjct  254   AGTLNPNVTDPSIRKCMENILKPNPELAEFITKECSGEEWDGIITRIWPNTKYLDVIVTG  313

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
             AM+QYIPTL+++   LPL  T Y SSEC F +N+ P+ KP+EV+YTI+P M YFEFLP  
Sbjct  314   AMAQYIPTLDHYSGGLPLACTMYASSECFFGLNMKPMCKPSEVSYTIMPNMGYFEFLPHD  373

Query  957   -REIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFV  781
                  +   +P  ++DL  V++G++YE+VVTTYAGL RYRVGDIL V G+ N+ PQF FV
Sbjct  374   PNSPPLSPESPPRLVDLAHVQVGKQYELVVTTYAGLNRYRVGDILLVTGYYNSAPQFRFV  433

Query  780   CRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-I  604
              RKNV LSID+DKTDE EL   + NAS +L  F+AS+IEYTS+A+T+TIPGHYV++WE +
Sbjct  434   KRKNVLLSIDSDKTDEAELQKGIDNASLLLKEFNASVIEYTSYADTTTIPGHYVIFWELL  493

Query  603   TQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIA  424
              + + N     +   CC  VEESLNSVYR+ RV+D SIGPLEIR+V+NGTF+++MDYAI+
Sbjct  494   VKDAANSPSDEVLNQCCLVVEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAIS  553

Query  423   SGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
              G+SI+QYK PRCV+  PI+ELL+ RV+S +FSP  P W P  + 
Sbjct  554   RGASINQYKAPRCVSFTPILELLNGRVVSKHFSPAAPHWVPERRR  598



>gb|KDO79042.1| hypothetical protein CISIN_1g007558mg [Citrus sinensis]
Length=598

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/585 (59%), Positives = 438/585 (75%), Gaps = 3/585 (1%)
 Frame = -1

Query  2037  LEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPV  1858
             L E + + L+FIE++T NA  VQERVL AILS N   EYL R  L+G+TDR+TFK  +PV
Sbjct  15    LCEKDAKALRFIEEMTRNADPVQERVLAAILSRNGETEYLRRFNLDGATDRDTFKSKVPV  74

Query  1857  VTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSL  1678
             VTYED++P+I R+ANG+ S+I+ S P+SEF TSSGTS GE KL+PT  EEL+R+ L  SL
Sbjct  75    VTYEDLQPEIQRIANGDRSAILSSHPVSEFLTSSGTSAGERKLMPTIHEELDRRQLLFSL  134

Query  1677  LMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDC  1498
             LMPV+N +VP L KGK +YFLFV+ E KT  GLLARPVLTS  K   FK R Y +P+   
Sbjct  135   LMPVMNLYVPGLDKGKGLYFLFVKAETKTASGLLARPVLTSYYKSEQFKTRPY-DPFNVY  193

Query  1497  TSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIR  1318
             TSP E ILC DSFQSMY QMLCGL   ++VLRVG +FAS  +RAI FL+ +W+ L  DI 
Sbjct  194   TSPDEAILCVDSFQSMYIQMLCGLIMREEVLRVGAVFASGLLRAIRFLQLNWKQLADDIS  253

Query  1317  TGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTG  1138
              GTLNP +TDPS+R+ +  I+KPNP+LAEFI KEC+ E W GII RIW NTKY+DV+VTG
Sbjct  254   AGTLNPNVTDPSIRKCMENILKPNPELAEFITKECSGEKWDGIITRIWPNTKYLDVIVTG  313

Query  1137  AMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVS  958
             AM+QYIPTL+++   LPL  T Y SSEC F +N+ P+ KP+EV+YTI+P M YFEFLP  
Sbjct  314   AMAQYIPTLDHYSGGLPLACTMYASSECFFGLNMKPMCKPSEVSYTIMPNMGYFEFLPHD  373

Query  957   -REIGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFV  781
                  +   +P  ++DL  V++G++YE+VVTTYAGL RYRVGDIL V G+ N+ PQF FV
Sbjct  374   PNSPPLSPESPPRLVDLAHVQVGKQYELVVTTYAGLNRYRVGDILLVTGYYNSAPQFRFV  433

Query  780   CRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-I  604
              RKNV LSID+DKTDE EL   + NAS +L  F+AS+IEYTS+A+T+TIPGHYV++WE +
Sbjct  434   KRKNVLLSIDSDKTDEAELQKGIDNASLLLKEFNASVIEYTSYADTTTIPGHYVIFWELL  493

Query  603   TQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIA  424
              + + N     +   CC  VEESLNSVYR+ RV+D SIGPLEIR+V+NGTF+++MDYAI+
Sbjct  494   VKDAANSPSDEVLNQCCLVVEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAIS  553

Query  423   SGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
              G+SI+QYK PRCV+  PI+ELL+ RV+S +FSP  P W P  + 
Sbjct  554   RGASINQYKAPRCVSFTPILELLNGRVVSKHFSPAAPHWVPERRR  598



>ref|XP_009397263.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Musa acuminata subsp. malaccensis]
Length=603

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/580 (59%), Positives = 428/580 (74%), Gaps = 7/580 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E +   L FIE++T NA +VQE+VL  IL  NA  EYL RH L G+ DR+TFK  IP+VT
Sbjct  24    EKDAEKLGFIEEMTVNADKVQEKVLAEILGQNAETEYLQRHKLGGAADRKTFKSKIPMVT  83

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S+I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  84    YEDLRPEIQRIANGDRSAILSAHPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLM  143

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +V  L KGK +YFLFV+ E+KTPGGL ARPVLTS  K  +F+ R + +PY   TS
Sbjct  144   PVMNLYVAGLDKGKGLYFLFVKSESKTPGGLPARPVLTSYYKSHHFRARPF-DPYNVYTS  202

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P   ILC D+FQSMYSQMLCGL     VLRVG +FAS  +RAI FL+ HW+   HDI TG
Sbjct  203   PTAAILCADAFQSMYSQMLCGLLDRLAVLRVGAVFASGLLRAIRFLQLHWQEFAHDIATG  262

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TL+  +TD +VR+AVA ++KP+P LAEFI  EC    W GII RIW NTKY+DV+VTGAM
Sbjct  263   TLSSMVTDAAVRDAVAEVLKPDPGLAEFIVSECAAGDWAGIITRIWPNTKYLDVIVTGAM  322

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL Y+   LP+  T Y SSEC F INL P+ KP EVAYTI+P MAYFEFLP+   
Sbjct  323   AQYIPTLEYYSGGLPMTCTMYASSECYFGINLRPMCKPREVAYTIMPNMAYFEFLPLDSA  382

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
                P P   +++DL DV++G+EYE+V+TTYAGLYRYRVGDIL V GF N  PQF FV RK
Sbjct  383   ASGPPP---QLVDLADVEVGKEYELVITTYAGLYRYRVGDILHVTGFHNAAPQFRFVRRK  439

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE--ITQ  598
             NV LSI++DKTDE EL  AV+ A+ +L P+ A+++EYTS A+T  IPGHYV+YWE  + +
Sbjct  440   NVLLSIESDKTDEAELQRAVERATELLKPWGATVVEYTSQADTRAIPGHYVIYWELLVKE  499

Query  597   SSENPIP-RYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIAS  421
                   P +   E CC  +EE++N+VYR+ R +D SIGPLEIR+V  GTF+++MDYAIA 
Sbjct  500   GEGGRWPGKEALEACCLEMEEAMNTVYRQSRAADGSIGPLEIRVVRGGTFEELMDYAIAR  559

Query  420   GSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAP  301
             G+SI+QYK PRCVT  PI+ELLDSRV+  +FSP  P+W P
Sbjct  560   GASINQYKVPRCVTFPPIIELLDSRVVEAHFSPATPKWTP  599



>gb|AEL22119.1| GH31 [Echinochloa crus-galli]
Length=612

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/590 (57%), Positives = 430/590 (73%), Gaps = 8/590 (1%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             + N   L+FIE++T++   VQ+RVL  IL+ NA  EYL R GL G+TDR  F+  +P+ T
Sbjct  24    DKNAEKLRFIEEMTSDVDAVQKRVLAEILARNAETEYLARCGLAGATDRAAFRAKVPMAT  83

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++PDI R+ANG+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  84    YEDLQPDIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  143

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E  TPGGL ARPVLTS  K  +FK R Y +PY D TS
Sbjct  144   PVMNLYVPGLDKGKALYFLFVKSETTTPGGLTARPVLTSYYKSEHFKNRPY-DPYHDYTS  202

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P   ILC D+FQSMY+QM CGL     VLRVG +FAS  +RAI FL+ HW  L  DI  G
Sbjct  203   PTAAILCADAFQSMYAQMACGLCQRHDVLRVGAVFASGLLRAIRFLQLHWEQLADDIERG  262

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             +L PR++DPSVR+AVA I++P+P+LA F+  EC++  W GI+ R+W NT+Y+DV+VTGAM
Sbjct  263   SLTPRVSDPSVRDAVAAILRPDPELARFLRAECSRGDWAGIVTRVWPNTRYLDVIVTGAM  322

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
              QYIPTL Y+   LP+  T Y SSEC F +NL P+ +P+EV+YTI+P M YFEFLPV   
Sbjct  323   QQYIPTLEYYSGGLPMACTMYASSECYFGLNLRPMCRPSEVSYTIMPNMGYFEFLPVDEA  382

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
              GV   +  +++DL  V+ G+EYE+V+TTYAGLYRYRVGDILRVAGF N  PQF FV RK
Sbjct  383   SGVASGDAAQLVDLARVEAGREYELVITTYAGLYRYRVGDILRVAGFHNAAPQFRFVRRK  442

Query  771   NVALSIDADKTDEVELHNAVKNASNILLP-FDASLIEYTSHANTSTIPGHYVLYWEITQS  595
             NV LSI++DKTDE EL  AV  AS +L     A++ EYTSHA T +IPGHYV+YWE+  +
Sbjct  443   NVLLSIESDKTDEAELQRAVDRASALLRARRGAAVAEYTSHACTRSIPGHYVVYWELLVA  502

Query  594   SENPIPRYIFED------CCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDY  433
             +       + +D      CC  +EE+LNSVYR+ RV+D SIGPLEIR+V  GTF+++MDY
Sbjct  503   TAGAEQGAVEDDGETLERCCLEMEEALNSVYRQSRVADGSIGPLEIRVVRPGTFEELMDY  562

Query  432   AIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKHWN  283
             AI+ G+SI+QYK PRCV+  PIVELLDSRV+S +FSP PP WAP  +  +
Sbjct  563   AISRGASINQYKVPRCVSFPPIVELLDSRVVSRHFSPSPPHWAPAARRAD  612



>emb|CDY54470.1| BnaA09g52740D [Brassica napus]
Length=590

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/583 (60%), Positives = 433/583 (74%), Gaps = 12/583 (2%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + L+FIE++T NA  VQE +L  IL  NA  EYL R  L G+TDR+TFK  +P++T
Sbjct  17    EKDAKALRFIEEMTRNADTVQENLLAEILRRNAETEYLRRFNLGGATDRDTFKSKLPIIT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+A+G+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIADGDRSPILSAHPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E KTPGGL ARPVLTS  K   F+ R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETKTPGGLPARPVLTSYYKSDKFRSRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMYSQMLCGL     VLRVG +FAS  +RAI FL+ HW  L +DI +G
Sbjct  196   PNEAILCPDSFQSMYSQMLCGLLDRLSVLRVGAVFASGLLRAIRFLQLHWSRLANDIESG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             +L+  ITDPS+R+ ++ I+KP+  LAEFI +EC  E+W GII RIW NTKY+DV+VTGAM
Sbjct  256   SLDSEITDPSIRQCMSDILKPDQHLAEFIRQECQMENWDGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL Y+   LP+  T Y SSEC F +NLNP+SKP+EV+YTI+P MAYFEF+P+   
Sbjct  316   AQYIPTLEYYSGGLPMACTMYASSECYFGLNLNPMSKPSEVSYTIMPNMAYFEFIPLGGS  375

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
               V         +LVDVK+G+EYE+VVTTYAGL RYRVGDILRV GF N+ PQF+FV RK
Sbjct  376   KAV---------ELVDVKIGKEYELVVTTYAGLCRYRVGDILRVTGFHNSAPQFHFVRRK  426

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLI-EYTSHANTSTIPGHYVLYWE-ITQ  598
             NV LSID+DKTDE EL  AV+NAS +LL    + + EYTS+A+TSTIPGHYVLYWE + +
Sbjct  427   NVLLSIDSDKTDESELQKAVENASKLLLKECGTRVAEYTSYADTSTIPGHYVLYWELLVR  486

Query  597   SSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASG  418
               E          CC  +EESLNSVYR+CRV+D S+GPLEIR+V NGTF+++MDYAI+ G
Sbjct  487   DGERQPSHDTLTRCCLEMEESLNSVYRQCRVADNSVGPLEIRVVRNGTFEELMDYAISRG  546

Query  417   SSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             +SI+QYK PRCV   PIVELLDSRV+S +FSP  P W P  + 
Sbjct  547   ASINQYKVPRCVNFTPIVELLDSRVVSAHFSPALPHWTPERRR  589



>gb|KHN27054.1| Indole-3-acetic acid-amido synthetase GH3.3 [Glycine soja]
Length=593

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/589 (58%), Positives = 435/589 (74%), Gaps = 7/589 (1%)
 Frame = -1

Query  2040  NLEESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIP  1861
             N ++ N + LQFIED+T N   VQERVL  ILS NA  EYL R  LNG+TDR+TFK  +P
Sbjct  5     NCDDKNAKTLQFIEDMTRNTDSVQERVLAEILSQNAQTEYLKRFELNGATDRDTFKSKVP  64

Query  1860  VVTYEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSS  1681
             VV+Y+D+K DI R+ANG+ S I+C+ PI+EF TSSGTS GE KL+PT  +E ER+ L  S
Sbjct  65    VVSYDDLKHDIQRIANGDRSPILCAHPITEFLTSSGTSAGERKLMPTISQETERRQLIFS  124

Query  1680  LLMPVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTD  1501
             L MPV+NQ+V DL KGK + FLF + E KTP GL+ARPV  S+ K   FK R Y +PY  
Sbjct  125   LPMPVMNQYVADLDKGKALLFLFTKAETKTPSGLVARPVSASMYKSEQFKNRPY-DPYNV  183

Query  1500  CTSPRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDI  1321
              TSP E ILC DSFQSMY+Q+LCGL    QVLR+G  FAS  +RAI FL+ +W  L HDI
Sbjct  184   YTSPNEAILCLDSFQSMYTQVLCGLIMRHQVLRIGANFASGLLRAIRFLQLNWAELAHDI  243

Query  1320  RTGTLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVT  1141
              TGTLNP+I+D  +++ + +I+KP+P+LA+FI KEC+ E+W+ IIPRIW NTK+++V+VT
Sbjct  244   STGTLNPKISDLPIKQRMTQILKPDPELADFIVKECSGENWESIIPRIWPNTKFVEVIVT  303

Query  1140  GAMSQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPV  961
             GAM+QYIPTL+Y+   LP+ S  Y SSEC F INLNP   P++V+YTI+P M YFEFLP 
Sbjct  304   GAMAQYIPTLDYYSGGLPIASNIYGSSECFFGINLNPFCNPSDVSYTIMPNMGYFEFLPH  363

Query  960   SRE-----IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTP  796
               +     +     +   + DL DV+LG+ YE+VVTTY+G+ RYRVGDILRV GF N+TP
Sbjct  364   DHDDDDGALYSGSDSSSRLTDLADVELGKSYEIVVTTYSGICRYRVGDILRVTGFHNSTP  423

Query  795   QFNFVCRKNVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVL  616
             QF+FV RKNV LSID+DKTDE EL NAV+ AS +L  F  S++EYTS A+T +IPGHYV+
Sbjct  424   QFSFVRRKNVLLSIDSDKTDEAELQNAVEKASVLLKEFKTSVVEYTSFADTKSIPGHYVI  483

Query  615   YWE-ITQSSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMM  439
             YWE + + S N       E CC  +EESLN+VYR+CRV++ SIGPLEIR+V+NGTF+++M
Sbjct  484   YWELLMKDSSNAPTSEALEQCCLRMEESLNAVYRQCRVAEHSIGPLEIRVVKNGTFEELM  543

Query  438   DYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHK  292
             DYAI+ G+SISQYK PRCV+  PI ELLDSRV S +FSP  P W P  +
Sbjct  544   DYAISRGASISQYKVPRCVSFTPITELLDSRVESVHFSPAEPHWTPERR  592



>ref|XP_009394764.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.8 
[Musa acuminata subsp. malaccensis]
Length=612

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/588 (58%), Positives = 441/588 (75%), Gaps = 13/588 (2%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             ++++  L+FIE++T NA  VQE VL  IL  NA  EYL R+ L G+ DR TFK  +PVVT
Sbjct  23    DNDSEKLRFIEEMTANADAVQETVLAEILMRNAETEYLQRYLLGGAADRVTFKAKVPVVT  82

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+ANG+ S+I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  83    YEDLQPEIQRIANGDRSAILSAHPISEFLTSSGTSAGERKLMPTIKEELDRRQLLYSLLM  142

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L+KGK +YFLFV+ E KTPGGL ARPVLTS  K  +FK R Y +PY   TS
Sbjct  143   PVMNLYVPGLNKGKGLYFLFVKSETKTPGGLTARPVLTSYYKSEHFKSRPY-DPYNVYTS  201

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P   ILC D+FQSMY QMLCGL     VLRVG +FAS  +RAI FL+ +W+ L  DI TG
Sbjct  202   PTAAILCADAFQSMYVQMLCGLLQRLDVLRVGAVFASGLLRAIRFLQLNWQELSQDIATG  261

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             TL  ++TDPSVR++VA ++KP+P+LA FI  EC+K  W GI+ RIW NTKY+DV+VTGAM
Sbjct  262   TLTVKVTDPSVRDSVAELLKPDPELARFIVAECSKGEWSGIVTRIWPNTKYLDVIVTGAM  321

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL Y+   LP+  T Y SSEC F +NL P+  P+EV+YTI+P MAYFEFLP   +
Sbjct  322   AQYIPTLEYYSGGLPMACTMYASSECYFGLNLKPICDPSEVSYTIMPNMAYFEFLPHGGD  381

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
              G+   +  +++DL DV++G+EYE+V+TTYAGL RYRVGDILRV GF N  PQF FV RK
Sbjct  382   -GLSVGDKAQLVDLADVEVGKEYELVITTYAGLNRYRVGDILRVTGFYNAAPQFRFVRRK  440

Query  771   NVALSIDADKTDEVELHNAVKNASNILLPFDASLIEYTSHANTSTIPGHYVLYWE-ITQS  595
             NV LSI++DKTDE EL  AV++AS +L P+ A+++EYTSHA T  IPGHYV+YWE + + 
Sbjct  441   NVLLSIESDKTDEAELQRAVESASALLRPYRANVVEYTSHAYTKAIPGHYVIYWELLVKD  500

Query  594   SENP----------IPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDK  445
             S +P          +   + + CC A+EE+LNSVYR+ RV+D SIGPLEIR+V  GTF++
Sbjct  501   SSSPAAAEAAMEALVRDGVLKRCCLAMEEALNSVYRQSRVADGSIGPLEIRVVRGGTFEE  560

Query  444   MMDYAIASGSSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAP  301
             +MDYAI+ G+SI+QYK PRCV+  PI+ELLDSRV+S +FSP PP+W+P
Sbjct  561   LMDYAISRGASINQYKVPRCVSFPPILELLDSRVVSAHFSPAPPKWSP  608



>emb|CDY52419.1| BnaCnng22400D [Brassica napus]
Length=590

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/583 (60%), Positives = 432/583 (74%), Gaps = 12/583 (2%)
 Frame = -1

Query  2031  ESNNRILQFIEDVTTNAGQVQERVLKAILSGNAGVEYLLRHGLNGSTDRETFKKLIPVVT  1852
             E + + L+FIE++T NA  VQE +L  IL  NA  EYL R  L G+TDR+TFK  +P++T
Sbjct  17    EKDAKALRFIEEMTRNADTVQENLLAEILRRNAETEYLRRFNLGGATDRDTFKSKLPIIT  76

Query  1851  YEDVKPDINRVANGEPSSIICSTPISEFFTSSGTSKGENKLIPTTEEELERKSLYSSLLM  1672
             YED++P+I R+A+G+ S I+ + PISEF TSSGTS GE KL+PT +EEL+R+ L  SLLM
Sbjct  77    YEDLQPEIQRIADGDRSPILSAHPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLM  136

Query  1671  PVINQFVPDLHKGKTMYFLFVREEAKTPGGLLARPVLTSLQKRSYFKKRTYTNPYTDCTS  1492
             PV+N +VP L KGK +YFLFV+ E KTPGGL ARPVLTS  K   F+ R Y +PY   TS
Sbjct  137   PVMNLYVPGLDKGKGLYFLFVKSETKTPGGLPARPVLTSYYKSDKFRSRPY-DPYNVYTS  195

Query  1491  PRETILCTDSFQSMYSQMLCGLWYGDQVLRVGTMFASAFIRAIHFLEKHWRLLCHDIRTG  1312
             P E ILC DSFQSMYSQMLCGL     VLRVG +FAS  +RAI FL+ HW  L +DI +G
Sbjct  196   PNEAILCADSFQSMYSQMLCGLLDRLSVLRVGAVFASGLLRAIRFLQLHWSRLANDIESG  255

Query  1311  TLNPRITDPSVREAVARIVKPNPDLAEFIEKECNKESWKGIIPRIWRNTKYIDVVVTGAM  1132
             +L+  ITDPS+R+ ++ I+KP+  LAEFI + C  E+W+GII RIW NTKY+DV+VTGAM
Sbjct  256   SLDSEITDPSIRQCMSVILKPDQHLAEFIRQGCQTENWEGIITRIWPNTKYLDVIVTGAM  315

Query  1131  SQYIPTLNYFGNDLPLVSTSYVSSECCFAINLNPLSKPTEVAYTIIPTMAYFEFLPVSRE  952
             +QYIPTL Y+   LP+  T Y SSEC F +NLNP+SKP+EV+YTI+P MAYFEF+P+   
Sbjct  316   AQYIPTLEYYSGGLPMACTMYASSECYFGLNLNPMSKPSEVSYTIMPNMAYFEFIPLGGS  375

Query  951   IGVPEPNPVEVLDLVDVKLGQEYEVVVTTYAGLYRYRVGDILRVAGFKNNTPQFNFVCRK  772
               V         +LVDVK+G+EYE+VVTTYAGL RYRVGDILRV GF N+ PQF+FV RK
Sbjct  376   KAV---------ELVDVKIGKEYELVVTTYAGLCRYRVGDILRVTGFHNSAPQFHFVRRK  426

Query  771   NVALSIDADKTDEVELHNAVKNASNILLP-FDASLIEYTSHANTSTIPGHYVLYWE-ITQ  598
             NV LSID+DKTDE EL  AV+NAS +LL      + EYTS+A+TSTIPGHYVLYWE + +
Sbjct  427   NVLLSIDSDKTDESELQKAVENASKLLLKECGTRVAEYTSYADTSTIPGHYVLYWELLVR  486

Query  597   SSENPIPRYIFEDCCFAVEESLNSVYRECRVSDKSIGPLEIRIVENGTFDKMMDYAIASG  418
               E          CC  +EESLNSVYR+CRV+D S+GPLEIR+V NGTF+++MDYAI+ G
Sbjct  487   DGERQPSHDTLTRCCLEMEESLNSVYRQCRVADNSVGPLEIRVVRNGTFEELMDYAISRG  546

Query  417   SSISQYKPPRCVTRAPIVELLDSRVMSNYFSPKPPEWAPGHKH  289
             +SI+QYK PRCV   PIVELLDSRV+S +FSP  P W P  + 
Sbjct  547   ASINQYKVPRCVNFTPIVELLDSRVVSAHFSPALPHWTPERRR  589



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6889519046694