BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25562_g6_i3 len=986 path=[19104:0-157 19262:158-160 19265:161-192
37071:193-216 19321:217-240 19345:241-241 19346:242-263
19368:264-284 19412:285-291 19419:292-463 19591:464-465
19593:466-571 19699:572-578 37440:579-595 19723:596-596
35681:597-620 19748:621-658 34138:659-756 23598:757-792
34271:793-985]

Length=986
                                                                      Score     E

ref|XP_009601289.1|  PREDICTED: 50S ribosomal protein L18, chloro...    186   1e-54   
ref|XP_004243576.1|  PREDICTED: 50S ribosomal protein L18, chloro...    185   2e-54   
ref|XP_006357647.1|  PREDICTED: 50S ribosomal protein L18, chloro...    184   4e-54   
ref|XP_009767840.1|  PREDICTED: uncharacterized protein LOC104218929    184   6e-54   
ref|XP_009784687.1|  PREDICTED: 50S ribosomal protein L18, chloro...    183   8e-54   
ref|XP_009609705.1|  PREDICTED: uncharacterized protein LOC104103495    183   1e-53   
ref|XP_011075432.1|  PREDICTED: uncharacterized protein LOC105159910    169   2e-48   
emb|CDP17197.1|  unnamed protein product                                162   2e-45   
gb|EYU18621.1|  hypothetical protein MIMGU_mgv1a015272mg                161   1e-44   
ref|XP_010259526.1|  PREDICTED: 50S ribosomal protein L18, chloro...    154   3e-42   
ref|XP_008668061.1|  PREDICTED: 50S ribosomal protein L18 isoform X1    152   9e-41   
ref|XP_004144339.1|  PREDICTED: 50S ribosomal protein L18-like          149   2e-40   
ref|XP_002512448.1|  50S ribosomal protein L18, putative                148   4e-40   Ricinus communis
gb|KDP23434.1|  hypothetical protein JCGZ_23267                         147   5e-40   
ref|XP_006423823.1|  hypothetical protein CICLE_v10029577mg             147   6e-40   
ref|NP_001152098.1|  50S ribosomal protein L18                          147   7e-40   Zea mays [maize]
ref|XP_008462699.1|  PREDICTED: 50S ribosomal protein L18, chloro...    147   1e-39   
ref|XP_002446092.1|  hypothetical protein SORBIDRAFT_06g001630          145   3e-39   Sorghum bicolor [broomcorn]
ref|XP_006423824.1|  hypothetical protein CICLE_v10029577mg             144   1e-38   
ref|XP_006485249.1|  PREDICTED: 50S ribosomal protein L18, chloro...    144   1e-38   
ref|XP_008679924.1|  PREDICTED: LOC100285345 isoform X1                 144   2e-38   
gb|EAY95556.1|  hypothetical protein OsI_17403                          143   2e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_006644011.1|  PREDICTED: 50S ribosomal protein L18, chloro...    142   4e-38   
ref|XP_004982799.1|  PREDICTED: 50S ribosomal protein L18, chloro...    142   4e-38   
ref|NP_001042627.1|  Os01g0256600                                       142   9e-38   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001151709.1|  LOC100285345                                       141   1e-37   Zea mays [maize]
ref|XP_002466632.1|  hypothetical protein SORBIDRAFT_01g011330          141   1e-37   Sorghum bicolor [broomcorn]
ref|XP_006644212.1|  PREDICTED: 50S ribosomal protein L18, cyanel...    141   2e-37   
ref|XP_010674070.1|  PREDICTED: uncharacterized protein LOC104890327    141   2e-37   
emb|CAN74240.1|  hypothetical protein VITISV_043330                     144   3e-37   Vitis vinifera
gb|EEE54261.1|  hypothetical protein OsJ_01153                          141   4e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010059980.1|  PREDICTED: 50S ribosomal protein L18, chloro...    140   5e-37   
dbj|BAJ89040.1|  predicted protein                                      139   5e-37   
ref|XP_006650433.1|  PREDICTED: 50S ribosomal protein L18, chloro...    139   6e-37   
ref|XP_010059974.1|  PREDICTED: 50S ribosomal protein L18, chloro...    139   6e-37   
ref|XP_003566477.1|  PREDICTED: 50S ribosomal protein L18, cyanelle     139   9e-37   
ref|XP_010676886.1|  PREDICTED: uncharacterized protein LOC104892602    139   1e-36   
gb|EMT26177.1|  50S ribosomal protein L18                               139   1e-36   
gb|EPS70829.1|  hypothetical protein M569_03932                         138   1e-36   
ref|NP_001050972.1|  Os03g0694800                                       138   1e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006286599.1|  hypothetical protein CARUB_v10002200mg             139   2e-36   
ref|XP_010059982.1|  PREDICTED: 50S ribosomal protein L18, chloro...    138   2e-36   
ref|XP_010421568.1|  PREDICTED: 50S ribosomal protein L18, chloro...    136   7e-36   
ref|XP_011022877.1|  PREDICTED: uncharacterized protein LOC105124529    136   1e-35   
ref|XP_003561018.1|  PREDICTED: uncharacterized protein LOC100834269    136   1e-35   
ref|XP_002874345.1|  ribosomal protein L18 family protein               136   1e-35   
ref|NP_198134.1|  ribosomal L18p/L5e family protein                     136   1e-35   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ85195.1|  predicted protein                                      135   2e-35   
ref|XP_006394939.1|  hypothetical protein EUTSA_v10005162mg             135   2e-35   
ref|XP_004982107.1|  PREDICTED: putative 50S ribosomal protein L1...    135   2e-35   
ref|XP_009129881.1|  PREDICTED: 60S ribosomal protein L18, mitoch...    135   2e-35   
gb|EMS63015.1|  50S ribosomal protein L18                               135   2e-35   
ref|XP_010092117.1|  50S ribosomal protein L18                          135   2e-35   
ref|XP_008388525.1|  PREDICTED: 50S ribosomal protein L18, chloro...    135   2e-35   
gb|EMT04490.1|  50S ribosomal protein L18                               135   2e-35   
ref|XP_010256324.1|  PREDICTED: uncharacterized protein LOC104596746    135   3e-35   
ref|XP_009151183.1|  PREDICTED: 50S ribosomal protein L18, chloro...    135   3e-35   
ref|XP_010060177.1|  PREDICTED: LOW QUALITY PROTEIN: 50S ribosoma...    135   3e-35   
emb|CDY05561.1|  BnaA02g31300D                                          134   9e-35   
emb|CDY25020.1|  BnaC02g39880D                                          134   1e-34   
ref|XP_009338243.1|  PREDICTED: uncharacterized protein LOC103930607    133   2e-34   
ref|XP_010546733.1|  PREDICTED: 50S ribosomal protein L18, chloro...    131   7e-34   
ref|XP_007218624.1|  hypothetical protein PRUPE_ppa013614mg             131   7e-34   
emb|CDM83755.1|  unnamed protein product                                130   2e-33   
ref|XP_002283176.1|  PREDICTED: uncharacterized protein LOC100251051    130   2e-33   Vitis vinifera
ref|XP_004497221.1|  PREDICTED: 50S ribosomal protein L18-like is...    130   3e-33   
ref|XP_007031018.1|  Ribosomal L18p/L5e family protein                  133   3e-33   
ref|XP_003592709.1|  50S ribosomal protein L18                          129   5e-33   
ref|XP_006484161.1|  PREDICTED: 50S ribosomal protein L18, chloro...    129   6e-33   
ref|XP_002310534.2|  hypothetical protein POPTR_0007s04640g             131   6e-33   Populus trichocarpa [western balsam poplar]
ref|XP_010931523.1|  PREDICTED: uncharacterized protein LOC105052...    131   6e-33   
ref|XP_006484162.1|  PREDICTED: 50S ribosomal protein L18, chloro...    129   7e-33   
ref|XP_010931525.1|  PREDICTED: uncharacterized protein LOC105052...    128   1e-32   
ref|XP_007207499.1|  hypothetical protein PRUPE_ppa013613mg             128   1e-32   
ref|XP_010550992.1|  PREDICTED: 50S ribosomal protein L18, cyanel...    127   4e-32   
ref|XP_006574357.1|  PREDICTED: uncharacterized protein LOC100526...    127   4e-32   
ref|NP_001236427.1|  uncharacterized protein LOC100526952               126   5e-32   
ref|XP_008806047.1|  PREDICTED: uncharacterized protein LOC103718834    126   6e-32   
ref|XP_004288652.1|  PREDICTED: 50S ribosomal protein L18-like is...    126   8e-32   
gb|KHG04764.1|  50S ribosomal L18                                       126   3e-31   
ref|XP_009382531.1|  PREDICTED: uncharacterized protein LOC103970472    124   4e-31   
ref|XP_003544108.1|  PREDICTED: 50S ribosomal protein L18, chloro...    122   1e-30   
gb|AFK37558.1|  unknown                                                 122   2e-30   
gb|KHN46908.1|  50S ribosomal protein L18                               122   3e-30   
ref|XP_010100963.1|  50S ribosomal protein L18                          126   5e-30   
gb|KCW66478.1|  hypothetical protein EUGRSUZ_F00280                     120   5e-30   
ref|XP_004491596.1|  PREDICTED: 50S ribosomal protein L18-like is...    121   5e-30   
ref|XP_007142510.1|  hypothetical protein PHAVU_008G286800g             120   7e-30   
ref|XP_006404765.1|  hypothetical protein EUTSA_v10000673mg             120   1e-29   
gb|KCW47852.1|  hypothetical protein EUGRSUZ_K01592                     119   3e-29   
ref|XP_010038817.1|  PREDICTED: uncharacterized protein LOC104427419    119   8e-29   
ref|XP_006840507.1|  hypothetical protein AMTR_s00045p00201530          116   3e-28   
gb|KCW66763.1|  hypothetical protein EUGRSUZ_F00513                     113   3e-27   
ref|XP_009384408.1|  PREDICTED: uncharacterized protein LOC103971964    111   3e-26   
ref|XP_010064257.1|  PREDICTED: uncharacterized protein LOC104451247    112   4e-26   
gb|KCW66766.1|  hypothetical protein EUGRSUZ_F00518                     110   5e-26   
ref|XP_004288653.1|  PREDICTED: 50S ribosomal protein L18-like is...    108   1e-25   
gb|KCW66760.1|  hypothetical protein EUGRSUZ_F00510                     108   3e-25   
ref|XP_006437976.1|  hypothetical protein CICLE_v10033184mg             105   2e-24   
gb|ABF98333.1|  ribosomal protein L18 family protein, putative, e...    104   3e-24   Oryza sativa Japonica Group [Japonica rice]
gb|KCW66770.1|  hypothetical protein EUGRSUZ_F00523                     102   3e-23   
ref|XP_010105308.1|  50S ribosomal protein L18                          100   8e-23   
emb|CDX86139.1|  BnaA06g28560D                                        95.1    7e-21   
ref|XP_001763221.1|  predicted protein                                94.7    1e-20   
gb|KCW66768.1|  hypothetical protein EUGRSUZ_F00521                   92.0    2e-19   
gb|KCW66771.1|  hypothetical protein EUGRSUZ_F00526                   90.1    6e-19   
gb|KDP23465.1|  hypothetical protein JCGZ_23298                       83.2    1e-16   
emb|CDX99971.1|  BnaC09g03300D                                        85.1    5e-15   
gb|AAO41877.1|  unknown protein                                       65.1    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002989809.1|  hypothetical protein SELMODRAFT_130450           63.5    3e-09   
gb|KFM27523.1|  50S ribosomal protein L18                             60.8    3e-08   
ref|XP_005649799.1|  translational machinery component                59.7    1e-07   
gb|EMS45387.1|  50S ribosomal protein L18                             58.9    1e-07   
ref|XP_003612287.1|  hypothetical protein MTR_5g023330                54.7    8e-06   
ref|WP_035516947.1|  50S ribosomal protein L18                        53.5    1e-05   
ref|XP_003056604.1|  ribosomal protein L18                            52.4    3e-05   
ref|WP_002649729.1|  50S ribosomal protein L18                        52.4    4e-05   
ref|WP_009574396.1|  50S ribosomal protein L18                        51.6    5e-05   
ref|WP_014161366.1|  50S ribosomal protein L18                        52.0    6e-05   
ref|XP_004150421.1|  PREDICTED: 50S ribosomal protein L18-like        52.8    6e-05   
ref|XP_004172876.1|  PREDICTED: LOW QUALITY PROTEIN: 50S ribosoma...  52.8    7e-05   
ref|WP_007233550.1|  50S ribosomal protein L18                        51.6    8e-05   
ref|WP_028489211.1|  50S ribosomal protein L18                        51.2    9e-05   
ref|WP_033485196.1|  50S ribosomal protein L18                        51.2    1e-04   
ref|XP_001770540.1|  predicted protein                                52.4    1e-04   
ref|XP_011001094.1|  PREDICTED: uncharacterized protein LOC105108469  52.4    1e-04   
ref|XP_008441144.1|  PREDICTED: uncharacterized protein LOC103485371  51.6    1e-04   
ref|WP_025566235.1|  MULTISPECIES: 50S ribosomal protein L18          50.4    2e-04   
ref|WP_003178358.1|  MULTISPECIES: 50S ribosomal protein L18          50.4    2e-04   
ref|WP_036819782.1|  50S ribosomal protein L18                        50.4    2e-04   
ref|WP_007185066.1|  50S ribosomal protein L18                        50.4    2e-04   
ref|WP_028983394.1|  50S ribosomal protein L18                        50.1    2e-04   
ref|WP_019399172.1|  MULTISPECIES: 50S ribosomal protein L18          50.1    2e-04   
ref|WP_035352307.1|  50S ribosomal protein L18                        50.1    3e-04   
ref|WP_006640331.1|  50S ribosomal protein L18                        50.1    3e-04   
ref|WP_022764366.1|  50S ribosomal protein L18                        50.1    3e-04   
ref|WP_028918216.1|  50S ribosomal protein L18                        49.7    3e-04   
ref|WP_021937674.1|  50S ribosomal protein L18                        49.7    3e-04   
ref|WP_008248320.1|  50S ribosomal protein L18                        49.7    3e-04   
ref|WP_020401292.1|  50S ribosomal protein L18                        49.7    3e-04   
gb|EEB59465.1|  50S ribosomal protein L18                             49.7    3e-04   
ref|WP_022772942.1|  50S ribosomal protein L18                        49.7    3e-04   
ref|XP_010061977.1|  PREDICTED: uncharacterized protein LOC104449498  50.4    3e-04   
ref|WP_010024566.1|  50S ribosomal protein L18                        49.7    3e-04   
ref|WP_028466793.1|  50S ribosomal protein L18                        49.7    3e-04   
ref|WP_011143899.1|  50S ribosomal protein L18                        49.7    4e-04   
ref|XP_006376245.1|  hypothetical protein POPTR_0013s11310g           50.4    4e-04   
gb|EWH23390.1|  50S ribosomal protein L18                             49.3    4e-04   
ref|WP_024870233.1|  50S ribosomal protein L18                        49.3    4e-04   
ref|XP_005717753.1|  unnamed protein product                          50.8    5e-04   
ref|WP_020449866.1|  MULTISPECIES: 50S ribosomal protein L18          48.9    5e-04   
ref|WP_034443860.1|  50S ribosomal protein L18                        48.9    5e-04   
ref|WP_008193248.1|  50S ribosomal protein L18                        48.9    5e-04   
ref|WP_038690277.1|  50S ribosomal protein L18                        48.9    5e-04   
ref|WP_011686807.1|  50S ribosomal protein L18                        48.9    5e-04   
ref|WP_007230698.1|  50S ribosomal protein L18                        48.5    5e-04   
ref|WP_019186158.1|  50S ribosomal protein L18                        48.9    5e-04   
ref|WP_022769976.1|  MULTISPECIES: 50S ribosomal protein L18          48.9    5e-04   
gb|AJC45742.1|  50S ribosomal protein L18                             48.9    6e-04   
ref|WP_027849007.1|  MULTISPECIES: 50S ribosomal protein L18          48.9    6e-04   
ref|WP_027950926.1|  50S ribosomal protein L18                        48.9    6e-04   
ref|WP_026586058.1|  50S ribosomal protein L18                        48.9    6e-04   
ref|XP_003612290.1|  Structural constituent of ribosome               48.5    6e-04   
ref|XP_011003994.1|  PREDICTED: uncharacterized protein LOC105110603  49.7    6e-04   
ref|WP_017355421.1|  50S ribosomal protein L18                        48.5    6e-04   
ref|WP_008707271.1|  MULTISPECIES: 50S ribosomal protein L18          48.5    7e-04   
ref|WP_002555473.1|  MULTISPECIES: 50S ribosomal protein L18          48.5    7e-04   
ref|WP_022439394.1|  50S ribosomal protein L18                        48.5    7e-04   
ref|WP_005745983.1|  50S ribosomal protein L18                        48.5    7e-04   
ref|WP_009336596.1|  MULTISPECIES: 50S ribosomal protein L18          48.5    8e-04   
ref|WP_014471360.1|  50S ribosomal protein L18                        47.4    8e-04   
dbj|BAN68185.1|  large subunit ribosomal protein L18                  48.1    9e-04   
ref|WP_029208589.1|  50S ribosomal protein L18                        48.1    9e-04   
gb|AAW76821.1|  50S ribosomal protein L18                             47.8    9e-04   Xanthomonas oryzae pv. oryzae
ref|XP_002325540.2|  hypothetical protein POPTR_0019s11030g           49.7    0.001   Populus trichocarpa [western balsam poplar]
ref|WP_019951443.1|  50S ribosomal protein L18                        48.1    0.001   
ref|WP_024865227.1|  50S ribosomal protein L18                        48.1    0.001   
ref|WP_032112421.1|  50S ribosomal protein L18                        48.1    0.001   
ref|WP_005917142.1|  MULTISPECIES: 50S ribosomal protein L18          48.1    0.001   
ref|WP_034877918.1|  50S ribosomal protein L18                        48.1    0.001   
ref|WP_026515603.1|  MULTISPECIES: 50S ribosomal protein L18          48.1    0.001   
ref|WP_003486684.1|  MULTISPECIES: 50S ribosomal protein L18          48.1    0.001   
ref|WP_028293128.1|  50S ribosomal protein L18                        48.1    0.001   
gb|KEQ12561.1|  50S ribosomal protein L18                             48.1    0.001   
ref|WP_017939152.1|  50S ribosomal protein L18                        48.1    0.001   



>ref|XP_009601289.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=118

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP+RP+RVTK+LKPYVLRMHFTNKYVNAQVVHTP+ATVAT+ASTQEK LRL M+EA
Sbjct  1    MVIPPPIRPDRVTKYLKPYVLRMHFTNKYVNAQVVHTPTATVATSASTQEKGLRLAMVEA  60

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            KENTRDVAAAAKIGKLLGERL+ KGIPA+S+FFK++QRYHGKVKAVIDS++  GIELV
Sbjct  61   KENTRDVAAAAKIGKLLGERLQAKGIPAISIFFKREQRYHGKVKAVIDSVKEAGIELV  118



>ref|XP_004243576.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Solanum 
lycopersicum]
 ref|XP_010323903.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Solanum 
lycopersicum]
Length=118

 Score =   185 bits (469),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPPVRP+RV K+LKPYVLRMHFTNKYVNAQVVHTP+ATVA +AS+QEK LRL M+E+
Sbjct  1    MVIPPPVRPDRVLKYLKPYVLRMHFTNKYVNAQVVHTPTATVAASASSQEKGLRLAMVES  60

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            KENTRDVAAAAKIGKLLGERL+ KG+PAVSVFFKK+QRYHGKVKAVIDS+R  GIELV
Sbjct  61   KENTRDVAAAAKIGKLLGERLQAKGVPAVSVFFKKEQRYHGKVKAVIDSVREAGIELV  118



>ref|XP_006357647.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006357648.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like isoform 
X2 [Solanum tuberosum]
Length=118

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPPVRP+RV K+LKPYVLRMHFTNKYVNAQVVHTP+ATVA +AS+QEK LRL M+E+
Sbjct  1    MVIPPPVRPDRVLKYLKPYVLRMHFTNKYVNAQVVHTPTATVAASASSQEKGLRLAMVES  60

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            KENTRDVAAAAKIGKLLGERL+ KG+PA+SVFFKK+QRYHGKVKAVIDS+R  GIELV
Sbjct  61   KENTRDVAAAAKIGKLLGERLQAKGVPAISVFFKKEQRYHGKVKAVIDSVREAGIELV  118



>ref|XP_009767840.1| PREDICTED: uncharacterized protein LOC104218929 [Nicotiana sylvestris]
 ref|XP_009767842.1| PREDICTED: uncharacterized protein LOC104218929 [Nicotiana sylvestris]
 ref|XP_009767843.1| PREDICTED: uncharacterized protein LOC104218929 [Nicotiana sylvestris]
 ref|XP_009767844.1| PREDICTED: uncharacterized protein LOC104218929 [Nicotiana sylvestris]
Length=118

 Score =   184 bits (467),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP+RP+RVTK+LKPYVLRMHFTNKYVNAQVVHTP+ATVA +ASTQEK LRL M+E 
Sbjct  1    MVIPPPIRPDRVTKYLKPYVLRMHFTNKYVNAQVVHTPTATVAASASTQEKGLRLAMVEG  60

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            KENTRDVAAAAKIGKLLGERL+ KGIPAVSVFFK++QRYHGKVKAVIDS++  GIELV
Sbjct  61   KENTRDVAAAAKIGKLLGERLQAKGIPAVSVFFKREQRYHGKVKAVIDSVKEVGIELV  118



>ref|XP_009784687.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Nicotiana 
sylvestris]
Length=118

 Score =   183 bits (465),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP+RP+RVTK+LKPYVLRMHFTNKYVNA VVHTP+ATVAT+ASTQEK LRL M+EA
Sbjct  1    MVIPPPIRPDRVTKYLKPYVLRMHFTNKYVNAHVVHTPTATVATSASTQEKGLRLAMVEA  60

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            KENTRDVAAAAKIGKLLGERL  KGIPA+SVFFK++QRYHGKVKAVIDS++  GIELV
Sbjct  61   KENTRDVAAAAKIGKLLGERLHAKGIPAISVFFKREQRYHGKVKAVIDSVKEAGIELV  118



>ref|XP_009609705.1| PREDICTED: uncharacterized protein LOC104103495 [Nicotiana tomentosiformis]
Length=118

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP+RP+RVTK+LKPYVLRMHFTNKYVNAQVVHTP+ATVA +ASTQEK LRL M+E 
Sbjct  1    MVIPPPIRPDRVTKYLKPYVLRMHFTNKYVNAQVVHTPTATVAASASTQEKGLRLAMVEG  60

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            KENTRDVAAAAKIGKLLGERL+ KGIPA+SVFFK++QRYHGKVKAVIDS++  GIELV
Sbjct  61   KENTRDVAAAAKIGKLLGERLQAKGIPAISVFFKREQRYHGKVKAVIDSVKEVGIELV  118



>ref|XP_011075432.1| PREDICTED: uncharacterized protein LOC105159910 [Sesamum indicum]
 ref|XP_011075433.1| PREDICTED: uncharacterized protein LOC105159910 [Sesamum indicum]
Length=118

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPPVRPERV K+LKPYVLRMHFTNKYVNAQVVHTP+ATVA+AASTQEKSLRL M +A
Sbjct  1    MVIPPPVRPERVMKYLKPYVLRMHFTNKYVNAQVVHTPTATVASAASTQEKSLRLSMEKA  60

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            KE+TRDVAAAAKIGK+LGERL ++ IPAV+VF K+DQ+YHGKVKAVIDS++  G++L+
Sbjct  61   KESTRDVAAAAKIGKILGERLLLQNIPAVAVFLKRDQKYHGKVKAVIDSLKEAGVKLL  118



>emb|CDP17197.1| unnamed protein product [Coffea canephora]
Length=137

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -1

Query  662  LEMVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMI  483
            ++MVIPP VRPERVT FLKPYVL+MHFTNK+V+AQV+HTP+ATVA++AS+QE++LRL M 
Sbjct  18   IKMVIPPAVRPERVTNFLKPYVLKMHFTNKFVSAQVIHTPTATVASSASSQEQALRLSME  77

Query  482  EAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            +A+E+TRDVAAA KIGK+LGERL +KGIPAVS+F K++Q+YHGKVKAVIDS+R  G++LV
Sbjct  78   KARESTRDVAAAGKIGKILGERLLLKGIPAVSIFLKREQKYHGKVKAVIDSVREAGVKLV  137



>gb|EYU18621.1| hypothetical protein MIMGU_mgv1a015272mg [Erythranthe guttata]
Length=162

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 115/141 (82%), Gaps = 4/141 (3%)
 Frame = -1

Query  725  RRNTTLTPVLLSLAFAQGSRPLEMVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvht  546
            R  T  +   L  +F  G +   MVIPP VR +RVTKFLKPYVLRMHFTNK+VNAQVVHT
Sbjct  26   RSPTQFSAADLRRSFGIGQK---MVIPP-VRLDRVTKFLKPYVLRMHFTNKFVNAQVVHT  81

Query  545  psatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQ  366
            P+ATVA++ASTQEK+LRL M +AKENTRDVAAAAKIGK+LGERL  + IPAVSVF KKDQ
Sbjct  82   PTATVASSASTQEKALRLSMEKAKENTRDVAAAAKIGKILGERLLHQNIPAVSVFLKKDQ  141

Query  365  RYHGKVKAVIDSIRGEGIELV  303
            +YHGKVKAVIDS+   G++L+
Sbjct  142  KYHGKVKAVIDSLSAVGVKLI  162



>ref|XP_010259526.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Nelumbo 
nucifera]
 ref|XP_010259527.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Nelumbo 
nucifera]
Length=114

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 105/118 (89%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPPV+P R+TKF+KPYVLRMHFTNKYV+AQV+H+P+ATVAT+AS+QEK+LRL M   
Sbjct  1    MVIPPPVKPPRITKFIKPYVLRMHFTNKYVSAQVIHSPTATVATSASSQEKALRLSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             ENTRDVAAA+KIGK+LGERL +K IPAVSV  K++Q+YHGK+KAVIDS+R  G++ +
Sbjct  58   -ENTRDVAAASKIGKILGERLLLKDIPAVSVILKREQKYHGKIKAVIDSLRETGVKFI  114



>ref|XP_008668061.1| PREDICTED: 50S ribosomal protein L18 isoform X1 [Zea mays]
Length=208

 Score =   152 bits (385),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 107/133 (80%), Gaps = 4/133 (3%)
 Frame = -1

Query  701  VLLSLAFAQGSRPLEMVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvata  522
            VL    F    RP  MVIPPP R  RVT+FLKPY+LRMHF+NKYV+AQVVHTP+ATVA +
Sbjct  80   VLRIYCFETAERPGAMVIPPPARAARVTRFLKPYLLRMHFSNKYVSAQVVHTPTATVACS  139

Query  521  asTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKA  342
            AS+QEK LR  M    E+TRDVAAAAKIGKLLGERL +KGIPAVS+  K++Q+YHGKVKA
Sbjct  140  ASSQEKLLRPNM----ESTRDVAAAAKIGKLLGERLLLKGIPAVSIHMKREQKYHGKVKA  195

Query  341  VIDSIRGEGIELV  303
            VIDS+R  G++L+
Sbjct  196  VIDSVREAGVKLL  208



>ref|XP_004144339.1| PREDICTED: 50S ribosomal protein L18-like [Cucumis sativus]
 ref|XP_004156021.1| PREDICTED: 50S ribosomal protein L18-like [Cucumis sativus]
 gb|KGN54729.1| hypothetical protein Csa_4G437000 [Cucumis sativus]
Length=114

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 103/118 (87%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP++P R+T++LKPYVL+MHFTNK+V+AQV+H+ +A VA+AAS+QEK+L+  M   
Sbjct  1    MVIPPPIKPPRLTQYLKPYVLKMHFTNKFVSAQVIHSETAIVASAASSQEKALQSSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDVAAAAKIGKLLGERL +KGIPAV V  K++QRYHGKVKAVIDS+R  GI+L+
Sbjct  58   -ESTRDVAAAAKIGKLLGERLLLKGIPAVCVHLKREQRYHGKVKAVIDSVREAGIKLL  114



>ref|XP_002512448.1| 50S ribosomal protein L18, putative [Ricinus communis]
 gb|EEF49900.1| 50S ribosomal protein L18, putative [Ricinus communis]
Length=115

 Score =   148 bits (373),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 104/119 (87%), Gaps = 5/119 (4%)
 Frame = -1

Query  656  MVIPPPVR-PERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIE  480
            MVIPPPV+ P RV  FLKPYVL+MHFTNK+V+AQV+H+PSATVA +AS+QEK+LR  M  
Sbjct  1    MVIPPPVKWPPRVADFLKPYVLKMHFTNKFVSAQVIHSPSATVACSASSQEKALRPSM--  58

Query  479  AKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
              ENTRDVAAAAKIGK+LGERL VKGIPA+SVF K++Q+YHGKVKAV+DS+R  G++L+
Sbjct  59   --ENTRDVAAAAKIGKILGERLLVKGIPAISVFLKREQKYHGKVKAVVDSVRESGVKLL  115



>gb|KDP23434.1| hypothetical protein JCGZ_23267 [Jatropha curcas]
Length=115

 Score =   147 bits (372),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 104/119 (87%), Gaps = 5/119 (4%)
 Frame = -1

Query  656  MVIPPPVR-PERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIE  480
            MVIPPPV+ P RVT++LKPYVL+MHFTNKYV+AQV+H+P+ATVA +AS+QEK+LR  M  
Sbjct  1    MVIPPPVKWPPRVTEYLKPYVLKMHFTNKYVSAQVIHSPTATVACSASSQEKALRSSM--  58

Query  479  AKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
              ENTRDVAAAAKIGK+L ERL VK IPAVSVF K++Q+YHGKVKAV+D++R  G++L+
Sbjct  59   --ENTRDVAAAAKIGKILAERLLVKDIPAVSVFLKREQKYHGKVKAVVDAVRDSGVKLL  115



>ref|XP_006423823.1| hypothetical protein CICLE_v10029577mg [Citrus clementina]
 gb|ESR37063.1| hypothetical protein CICLE_v10029577mg [Citrus clementina]
Length=128

 Score =   147 bits (372),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 105/120 (88%), Gaps = 4/120 (3%)
 Frame = -1

Query  662  LEMVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMI  483
            LEMVIPPPVRP +++ FLKPYVLRMHFTNKYV+AQV+H+P+ATVA++A++QEK+LR  + 
Sbjct  13   LEMVIPPPVRPPKLSNFLKPYVLRMHFTNKYVSAQVIHSPTATVASSATSQEKALRSSI-  71

Query  482  EAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
                 TRDVAAA+KIGK+LGERL +K IPAV+VF K++QRYHGKVKAVIDS+R  G++L+
Sbjct  72   ---GCTRDVAAASKIGKILGERLLLKDIPAVTVFLKREQRYHGKVKAVIDSLRESGVKLL  128



>ref|NP_001152098.1| 50S ribosomal protein L18 [Zea mays]
 ref|NP_001150322.1| 50S ribosomal protein L18 [Zea mays]
 gb|ACG26050.1| 50S ribosomal protein L18 [Zea mays]
 gb|ACG26399.1| 50S ribosomal protein L18 [Zea mays]
 gb|ACG38645.1| 50S ribosomal protein L18 [Zea mays]
 gb|ACG45768.1| 50S ribosomal protein L18 [Zea mays]
 gb|ACN26012.1| unknown [Zea mays]
 tpg|DAA38625.1| TPA: 50S ribosomal protein L18 isoform 1 [Zea mays]
 tpg|DAA38626.1| TPA: 50S ribosomal protein L18 isoform 2 [Zea mays]
Length=114

 Score =   147 bits (371),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 102/118 (86%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP R  RVT+FLKPY+LRMHF+NKYV+AQVVHTP+ATVA +AS+QEK LR  M   
Sbjct  1    MVIPPPARAARVTRFLKPYLLRMHFSNKYVSAQVVHTPTATVACSASSQEKLLRPNM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDVAAAAKIGKLLGERL +KGIPAVS+  K++Q+YHGKVKAVIDS+R  G++L+
Sbjct  58   -ESTRDVAAAAKIGKLLGERLLLKGIPAVSIHMKREQKYHGKVKAVIDSVREAGVKLL  114



>ref|XP_008462699.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Cucumis 
melo]
Length=114

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 103/118 (87%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP++P R+ ++LKPYVL+MHFTNK+V+AQV+H+ +ATVA+AAS+QEK+LR  M   
Sbjct  1    MVIPPPIKPPRLIQYLKPYVLKMHFTNKFVSAQVIHSETATVASAASSQEKALRSSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDVAAAAKIGKLLGERL +KGIPAV V  K++Q+YHGKVKAVIDS+R  GI+L+
Sbjct  58   -ESTRDVAAAAKIGKLLGERLLLKGIPAVCVHLKREQKYHGKVKAVIDSVREAGIKLL  114



>ref|XP_002446092.1| hypothetical protein SORBIDRAFT_06g001630 [Sorghum bicolor]
 gb|EES10420.1| hypothetical protein SORBIDRAFT_06g001630 [Sorghum bicolor]
Length=114

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 101/118 (86%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP R  RVT+FLKPY+LRMHFTNKYV+AQV+HTP++TVA +AS+QEK LR  M   
Sbjct  1    MVIPPPERAARVTRFLKPYLLRMHFTNKYVSAQVIHTPTSTVACSASSQEKLLRPNM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDVAAA KIGKLLGERL +KGIPAVS+  K++Q+YHGKVKAVIDS+R  G++L+
Sbjct  58   -ESTRDVAAAVKIGKLLGERLLLKGIPAVSIHMKREQKYHGKVKAVIDSVREAGVKLL  114



>ref|XP_006423824.1| hypothetical protein CICLE_v10029577mg [Citrus clementina]
 gb|ESR37064.1| hypothetical protein CICLE_v10029577mg [Citrus clementina]
Length=114

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 103/118 (87%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPPVRP +++ FLKPYVLRMHFTNKYV+AQV+H+P+ATVA++A++QEK+LR  +   
Sbjct  1    MVIPPPVRPPKLSNFLKPYVLRMHFTNKYVSAQVIHSPTATVASSATSQEKALRSSI---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
               TRDVAAA+KIGK+LGERL +K IPAV+VF K++QRYHGKVKAVIDS+R  G++L+
Sbjct  58   -GCTRDVAAASKIGKILGERLLLKDIPAVTVFLKREQRYHGKVKAVIDSLRESGVKLL  114



>ref|XP_006485249.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Citrus 
sinensis]
 ref|XP_006492613.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Citrus 
sinensis]
 gb|KDO49690.1| hypothetical protein CISIN_1g033657mg [Citrus sinensis]
Length=114

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 103/118 (87%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPPVRP +++ FLKPYVLRMHFTNKYV+AQV+H+P+ATVA++A++QEK+LR  +   
Sbjct  1    MVIPPPVRPPKLSNFLKPYVLRMHFTNKYVSAQVIHSPTATVASSATSQEKALRSSI---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
               TRDVAAA+KIGK+LGERL +K IPAV+VF K++QRYHGKVKAVIDS+R  G++L+
Sbjct  58   -GCTRDVAAASKIGKILGERLLLKDIPAVTVFLKREQRYHGKVKAVIDSLREAGVKLL  114



>ref|XP_008679924.1| PREDICTED: LOC100285345 isoform X1 [Zea mays]
 gb|ACG25822.1| structural constituent of ribosome [Zea mays]
 gb|ACN28611.1| unknown [Zea mays]
 tpg|DAA50787.1| TPA: structural constituent of ribosome isoform 1 [Zea mays]
 tpg|DAA50788.1| TPA: structural constituent of ribosome isoform 2 [Zea mays]
Length=114

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 99/118 (84%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP R   +TKFLKPY+L+MHFTN +V+AQV+HTP+ATVA +AS+QEK LR  M   
Sbjct  1    MVIPPPARAPAITKFLKPYILKMHFTNSFVSAQVIHTPTATVACSASSQEKLLRPSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDVAAAAKIGKLLGERL  KGIPAVSV   +DQ+YHGKVKAVIDS+RG G++L+
Sbjct  58   -ESTRDVAAAAKIGKLLGERLLFKGIPAVSVSMSRDQKYHGKVKAVIDSLRGVGVKLL  114



>gb|EAY95556.1| hypothetical protein OsI_17403 [Oryza sativa Indica Group]
Length=114

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 101/118 (86%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP R  R+T+FLKPY+LRMHF+NKYV+AQVVHTP+ATVA +AS+QEK LR  M   
Sbjct  1    MVIPPPERAARITRFLKPYLLRMHFSNKYVSAQVVHTPTATVACSASSQEKLLRPNM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDVAAAAKIGKLLGERL  KGIPAVS+  K++Q+YHGKV+AVIDS+R  G++L+
Sbjct  58   -ESTRDVAAAAKIGKLLGERLLQKGIPAVSIHMKREQKYHGKVRAVIDSVREAGVKLL  114



>ref|XP_006644011.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Oryza 
brachyantha]
Length=114

 Score =   142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 100/118 (85%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP R  R+T+FLKPY+LRMHF+NKYV+AQV+HTP+ATVA +AS+QEK LR  M   
Sbjct  1    MVIPPPERAARITRFLKPYLLRMHFSNKYVSAQVIHTPTATVACSASSQEKLLRPNM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDVAAAAKIGKLLGERL  KGIPAVS+  K++Q+YHGKVKAVID +R  G++L+
Sbjct  58   -ESTRDVAAAAKIGKLLGERLLQKGIPAVSIHMKREQKYHGKVKAVIDQVREAGVKLL  114



>ref|XP_004982799.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Setaria 
italica]
Length=114

 Score =   142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 101/118 (86%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP R  RVT+FLKPY+LRMHF+NKYV+AQV+H+P+ATVA +AS+QEK LR  M   
Sbjct  1    MVIPPPERAARVTRFLKPYLLRMHFSNKYVSAQVIHSPTATVACSASSQEKLLRPDM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
              +TRDVAAAAKIGKLLGERL +KGIPAVS+  K++Q+YHGKVKAVIDS+R  G++L+
Sbjct  58   -GSTRDVAAAAKIGKLLGERLLLKGIPAVSIHMKREQKYHGKVKAVIDSVREAGVKLL  114



>ref|NP_001042627.1| Os01g0256600 [Oryza sativa Japonica Group]
 dbj|BAE95806.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04541.1| Os01g0256600 [Oryza sativa Japonica Group]
 dbj|BAG88900.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94092.1| unnamed protein product [Oryza sativa Japonica Group]
Length=114

 Score =   142 bits (357),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 100/118 (85%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP R  R+T+FLKPY+LRMHF+NKYV+AQVVHTP+ATVA +AS+QEK LR  M   
Sbjct  1    MVIPPPERAARITRFLKPYLLRMHFSNKYVSAQVVHTPTATVACSASSQEKLLRPNM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDVAAAAKIGKLLGERL  KGIPAV +  K++Q+YHGKV+AVIDS+R  G++L+
Sbjct  58   -ESTRDVAAAAKIGKLLGERLLQKGIPAVCIHMKREQKYHGKVRAVIDSVREAGVKLL  114



>ref|NP_001151709.1| LOC100285345 [Zea mays]
 gb|ACG44070.1| structural constituent of ribosome [Zea mays]
Length=114

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 98/118 (83%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP R   +TKFLKPY+L+MHFTN +V+AQV+HTP+ATVA +AS+QEK LR  M   
Sbjct  1    MVIPPPARAPAITKFLKPYILKMHFTNSFVSAQVIHTPTATVACSASSQEKLLRPSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDVAAAAKIGKLLGERL  KGIPAVSV   +DQ+YHGKVKAVIDS+ G G++L+
Sbjct  58   -ESTRDVAAAAKIGKLLGERLLFKGIPAVSVSMSRDQKYHGKVKAVIDSLTGVGVKLL  114



>ref|XP_002466632.1| hypothetical protein SORBIDRAFT_01g011330 [Sorghum bicolor]
 gb|EER93630.1| hypothetical protein SORBIDRAFT_01g011330 [Sorghum bicolor]
Length=114

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 97/118 (82%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP R   +TKFLKPY+L+MHFTN +V+AQV+HTP+ATV  +AS+QEK LR  M   
Sbjct  1    MVIPPPARAPAITKFLKPYILKMHFTNNFVSAQVIHTPTATVTCSASSQEKLLRPSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDVAAAAKIGKLLGERL  KGIPAVSV   +DQ+YHGKVKAVIDS+R  G++L+
Sbjct  58   -ESTRDVAAAAKIGKLLGERLLFKGIPAVSVSISRDQKYHGKVKAVIDSLRDAGVKLL  114



>ref|XP_006644212.1| PREDICTED: 50S ribosomal protein L18, cyanelle-like [Oryza brachyantha]
Length=114

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 100/118 (85%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP R  R+T+FLKPY+LRMHF+NKYV+AQV+HTP+ATVA +AS+QEK LR  M   
Sbjct  1    MVIPPPERAARITRFLKPYLLRMHFSNKYVSAQVIHTPTATVACSASSQEKLLRPNM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             ++TRDVAAAAKIGKLLGERL  KGIPAVS+  K++Q+YHGKVKAVID +R  G++L+
Sbjct  58   -DSTRDVAAAAKIGKLLGERLLQKGIPAVSIHMKREQKYHGKVKAVIDHVREAGVKLL  114



>ref|XP_010674070.1| PREDICTED: uncharacterized protein LOC104890327 [Beta vulgaris 
subsp. vulgaris]
Length=114

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 101/118 (86%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVI PP+R  R+T+FLKPYVL+MHFTNKYV+AQVVH+P+ATVA +AS+QEK+LR  M   
Sbjct  1    MVIKPPIRAPRITEFLKPYVLKMHFTNKYVHAQVVHSPTATVAASASSQEKTLRPTM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             + TRDVAAAAKIGK+LGERL  K IPAVS+F K++Q+YHGK+KAVIDS+R  G++L+
Sbjct  58   -DITRDVAAAAKIGKILGERLLSKNIPAVSIFLKREQKYHGKIKAVIDSMREAGVKLL  114



>emb|CAN74240.1| hypothetical protein VITISV_043330 [Vitis vinifera]
Length=241

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 111/144 (77%), Gaps = 7/144 (5%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPPV+P R+ KFLKPYVL+MHFTNK+VNAQV+H+P+ATVA+AAS+QEK+LR  M   
Sbjct  1    MVIPPPVKPPRIMKFLKPYVLKMHFTNKFVNAQVIHSPTATVASAASSQEKTLRSTM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEG---IEL  306
             E+TRDVAAAA IGK+LGERL ++ IPAV+VF K+DQ+YHGKVKAVIDS+R      I+ 
Sbjct  58   -ESTRDVAAAAMIGKILGERLLLQDIPAVTVFLKRDQKYHGKVKAVIDSLREAYFCLIQY  116

Query  305  V*IWILMNNSQFIS*TIYAKKLGL  234
              IW    +      TI+A ++ L
Sbjct  117  GVIWAFETDPSRDDPTIFAPRVVL  140



>gb|EEE54261.1| hypothetical protein OsJ_01153 [Oryza sativa Japonica Group]
Length=150

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 100/118 (85%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP R  R+T+FLKPY+LRMHF+NKYV+AQVVHTP+ATVA +AS+QEK LR  M   
Sbjct  37   MVIPPPERAARITRFLKPYLLRMHFSNKYVSAQVVHTPTATVACSASSQEKLLRPNM---  93

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDVAAAAKIGKLLGERL  KGIPAV +  K++Q+YHGKV+AVIDS+R  G++L+
Sbjct  94   -ESTRDVAAAAKIGKLLGERLLQKGIPAVCIHMKREQKYHGKVRAVIDSVREAGVKLL  150



>ref|XP_010059980.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010059981.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW66483.1| hypothetical protein EUGRSUZ_F00288 [Eucalyptus grandis]
Length=115

 Score =   140 bits (352),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 101/119 (85%), Gaps = 5/119 (4%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP +P R+  FLKPYVL+MHFTNK+V+AQV+H+P+AT+ ++AS+QEK+LR  M   
Sbjct  1    MVIPPPAKPPRIINFLKPYVLKMHFTNKFVSAQVIHSPTATMVSSASSQEKALRPSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKG-IPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             ++TRDVAAAAKIGK LGERL +KG IPAV+V  K++Q+YHGKVKAVIDS+R  G+EL+
Sbjct  58   -DSTRDVAAAAKIGKTLGERLLLKGIIPAVAVHLKREQKYHGKVKAVIDSVREAGVELL  115



>dbj|BAJ89040.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=114

 Score =   139 bits (351),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 99/118 (84%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP R  R+  FLKPY+LRMHF+NKYV AQV+HTP+ATVA +AS+QEK LR  +   
Sbjct  1    MVIPPPDRAARIVGFLKPYLLRMHFSNKYVTAQVIHTPTATVACSASSQEKLLRPNL---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDV+AAAKIGKLLGERL +KGIPAVS+  K++Q+YHGKVKAVIDS+R  G++L+
Sbjct  58   -ESTRDVSAAAKIGKLLGERLLIKGIPAVSIHMKREQKYHGKVKAVIDSVREAGVKLL  114



>ref|XP_006650433.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Oryza 
brachyantha]
Length=114

 Score =   139 bits (351),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 97/118 (82%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP R   +TKFLKPYVL+MHFTN +V+AQV+HTPSATVA +AS+QEK LR  M   
Sbjct  1    MVIPPPARAPAITKFLKPYVLKMHFTNNFVSAQVIHTPSATVACSASSQEKLLRPSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDVAAAAKIGKLLGERL  +GIPAVSV   +DQ YHGKVKAVIDS+R  G++L+
Sbjct  58   -ESTRDVAAAAKIGKLLGERLLFRGIPAVSVSMARDQVYHGKVKAVIDSLRAAGVKLL  114



>ref|XP_010059974.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010059975.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010059976.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010059977.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010059978.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010060172.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010060173.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010060174.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW66476.1| hypothetical protein EUGRSUZ_F00277 [Eucalyptus grandis]
 gb|KCW66757.1| hypothetical protein EUGRSUZ_F00508 [Eucalyptus grandis]
 gb|KCW66758.1| hypothetical protein EUGRSUZ_F00508 [Eucalyptus grandis]
Length=114

 Score =   139 bits (351),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 102/118 (86%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVI PP +P R+  FLKPYVL+MHFTNK+V+AQV+H+P+ATVA++AS+QEK+LR  M   
Sbjct  1    MVILPPAKPPRIINFLKPYVLKMHFTNKFVSAQVIHSPTATVASSASSQEKALRPSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             ++TRDVAAAAKIGK+LGERL +KGIPAV+V  K++Q+YHGKVKAVIDS+R  G++L+
Sbjct  58   -DSTRDVAAAAKIGKILGERLLLKGIPAVAVHLKREQKYHGKVKAVIDSVREAGVKLL  114



>ref|XP_003566477.1| PREDICTED: 50S ribosomal protein L18, cyanelle [Brachypodium 
distachyon]
 ref|XP_010230711.1| PREDICTED: 50S ribosomal protein L18, cyanelle [Brachypodium 
distachyon]
Length=114

 Score =   139 bits (350),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 100/118 (85%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP R  R+  +LKPY+LRMHF+NKYV+AQV+HTP+ATVA +AS+QEK LR  +   
Sbjct  1    MVIPPPDRAARIVSYLKPYLLRMHFSNKYVSAQVIHTPTATVACSASSQEKLLRSDL---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDVAAAAKIGKLLGER+ +KGIPAVS+  K++Q+YHGKV+AVIDS+R  G++L+
Sbjct  58   -ESTRDVAAAAKIGKLLGERMLLKGIPAVSIHMKREQKYHGKVRAVIDSVREAGVKLL  114



>ref|XP_010676886.1| PREDICTED: uncharacterized protein LOC104892602 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010676887.1| PREDICTED: uncharacterized protein LOC104892602 [Beta vulgaris 
subsp. vulgaris]
Length=114

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 100/118 (85%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVI PP R  R+T+FLKPYVL+MHFTNKYV+AQV+H+P+ATVA +AS+QEK+LR  M   
Sbjct  1    MVIRPPARAPRITEFLKPYVLKMHFTNKYVHAQVIHSPTATVAASASSQEKALRSNM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
               TRDVAAAAKIGK+LGERL +K IPAVS+F K++Q+YHGK+KAV+DS+R  G++L+
Sbjct  58   -GITRDVAAAAKIGKILGERLLIKNIPAVSIFLKREQKYHGKIKAVVDSMREVGVKLL  114



>gb|EMT26177.1| 50S ribosomal protein L18 [Aegilops tauschii]
 emb|CDM82649.1| unnamed protein product [Triticum aestivum]
Length=114

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 99/118 (84%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MV+PPP R  R+  FLKPY+LRMHF+NKYV AQV+HTP+ATVA +AS+QEK LR  +   
Sbjct  1    MVVPPPDRAARIVGFLKPYLLRMHFSNKYVTAQVIHTPTATVACSASSQEKLLRPNL---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDV+AAAKIGKLLGERL +KGIPAVS+  K++Q+YHGKVKAVIDS+R  G++L+
Sbjct  58   -ESTRDVSAAAKIGKLLGERLLLKGIPAVSIHMKREQKYHGKVKAVIDSVRESGVKLL  114



>gb|EPS70829.1| hypothetical protein M569_03932 [Genlisea aurea]
Length=114

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 103/118 (87%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPPVR ERV KFLKPYVLRMHFTNK+V+AQV HTP+ATVA++AS++EKSLR  M   
Sbjct  1    MVIPPPVRAERVVKFLKPYVLRMHFTNKFVHAQVFHTPTATVASSASSEEKSLRSSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             + TRDVAAAAKIGK+LGERL ++ IPAVSVF K++QRYHGKVKA++DS++  G++L+
Sbjct  58   -QTTRDVAAAAKIGKILGERLLLQNIPAVSVFLKREQRYHGKVKALMDSLKDAGVKLL  114



>ref|NP_001050972.1| Os03g0694800 [Oryza sativa Japonica Group]
 gb|AAO38489.1| putative ribosomal protein L18 [Oryza sativa Japonica Group]
 gb|ABF98331.1| ribosomal protein L18 family protein, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABF98332.1| ribosomal protein L18 family protein, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABF98334.1| ribosomal protein L18 family protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12886.1| Os03g0694800 [Oryza sativa Japonica Group]
 dbj|BAG92450.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75994.1| hypothetical protein OsI_13119 [Oryza sativa Indica Group]
 gb|EEE59739.1| hypothetical protein OsJ_12198 [Oryza sativa Japonica Group]
Length=114

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 97/118 (82%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP R   +TKFLKPYVL+MHFTN +V+AQV+HTPSATVA +AS+QEK LR  M   
Sbjct  1    MVIPPPARAPAITKFLKPYVLKMHFTNNFVSAQVIHTPSATVACSASSQEKLLRPSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDVAAAAKIGKLLGERL  +GIPAVSV   +DQ YHGKV+AV+DS+R  G++L+
Sbjct  58   -ESTRDVAAAAKIGKLLGERLLFRGIPAVSVSMSRDQTYHGKVRAVMDSLRAAGVKLL  114



>ref|XP_006286599.1| hypothetical protein CARUB_v10002200mg, partial [Capsella rubella]
 gb|EOA19497.1| hypothetical protein CARUB_v10002200mg, partial [Capsella rubella]
Length=149

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 105/130 (81%), Gaps = 4/130 (3%)
 Frame = -1

Query  692  SLAFAQGSRPLEMVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasT  513
            S  F    + L+MVIPP VRP R+  +LKPYVL+MHFTNK+V+AQV+H+P+ATVA +AS+
Sbjct  24   SSTFQDLPQQLQMVIPPAVRPPRLFDYLKPYVLKMHFTNKFVHAQVIHSPTATVACSASS  83

Query  512  QEKSLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVID  333
            QEK+LR    E  + TRDVAAA+KIGK+LGERL +K IPA+++  KK+QRYHGKVKAVID
Sbjct  84   QEKALR----ETMDITRDVAAASKIGKILGERLLMKDIPAITIHMKKEQRYHGKVKAVID  139

Query  332  SIRGEGIELV  303
            S+R  G++L+
Sbjct  140  SVREAGVKLL  149



>ref|XP_010059982.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010059983.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010059984.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010059985.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW66485.1| hypothetical protein EUGRSUZ_F00290 [Eucalyptus grandis]
Length=114

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 101/118 (86%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP +P R+  FLKPYVL+MHFTNK+V+AQV+H+P+ATVA++AS+QEK+L   M   
Sbjct  1    MVIPPPAKPLRIINFLKPYVLKMHFTNKFVSAQVIHSPTATVASSASSQEKALTPSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             ++TRDVAAAAKIGK+LGERL +KG PAV++  K++Q+YHGKVKAVIDS+R  G++L+
Sbjct  58   -DSTRDVAAAAKIGKILGERLLLKGSPAVAIHLKREQKYHGKVKAVIDSVREAGVKLL  114



>ref|XP_010421568.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Camelina 
sativa]
 ref|XP_010455083.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Camelina 
sativa]
 ref|XP_010493972.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Camelina 
sativa]
Length=114

 Score =   136 bits (343),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 100/118 (85%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPP VRP R+  +LKPYVL+MHFTNK+V+AQV+H+P+ATVA +AS+QEK+LR    E 
Sbjct  1    MVIPPAVRPPRLFDYLKPYVLKMHFTNKFVHAQVIHSPTATVACSASSQEKALR----ET  56

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             + TRDVAAAAKIGK+LGERL +K IPA+++  KK+QRYHGKVKAVIDS+R  G++L+
Sbjct  57   MDITRDVAAAAKIGKILGERLLMKDIPAITIQMKKEQRYHGKVKAVIDSVREAGVKLL  114



>ref|XP_011022877.1| PREDICTED: uncharacterized protein LOC105124529 [Populus euphratica]
 ref|XP_011022878.1| PREDICTED: uncharacterized protein LOC105124529 [Populus euphratica]
 ref|XP_011022879.1| PREDICTED: uncharacterized protein LOC105124529 [Populus euphratica]
 ref|XP_011022880.1| PREDICTED: uncharacterized protein LOC105124529 [Populus euphratica]
Length=114

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 104/118 (88%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPPVRP RVT+FLKPYVL+MHFTNKYVNAQV H+P+ATVA+AAS+QEK+LR  M   
Sbjct  1    MVIPPPVRPPRVTQFLKPYVLKMHFTNKYVNAQVTHSPTATVASAASSQEKALRSTM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             ENTRDVAAAAKIGK+LGERL +K IPAV+VF  ++Q+YHGKVKAVIDS+R  GI+++
Sbjct  58   -ENTRDVAAAAKIGKILGERLLLKDIPAVTVFLNRNQKYHGKVKAVIDSLREVGIKII  114



>ref|XP_003561018.1| PREDICTED: uncharacterized protein LOC100834269 [Brachypodium 
distachyon]
Length=114

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 95/118 (81%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP R   +T FLKPYVL+MHFT+ +V+AQV+HTPSAT+A AAS+QEK LR  M   
Sbjct  1    MVIPPPARAPAITNFLKPYVLKMHFTSNFVSAQVIHTPSATIACAASSQEKILRPSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDVAAAAKIGKLLGERL  +GIPAVSV   +DQ YHGKVKAVIDS+   G++LV
Sbjct  58   -ESTRDVAAAAKIGKLLGERLLFRGIPAVSVSMSRDQTYHGKVKAVIDSLTAAGVKLV  114



>ref|XP_002874345.1| ribosomal protein L18 family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50604.1| ribosomal protein L18 family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=114

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 100/118 (85%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPP VRP R+  +LKPYVL+MHFTNK+V+AQV+H+P+ATVA +AS+QEK+LR    E 
Sbjct  1    MVIPPAVRPPRLFDYLKPYVLKMHFTNKFVHAQVIHSPTATVACSASSQEKALR----ET  56

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             + TRDVAAAAKIGK+LGERL +K IPAV++  K++QRYHGKVKAVIDS+R  G++L+
Sbjct  57   MDITRDVAAAAKIGKILGERLLMKDIPAVTIQMKREQRYHGKVKAVIDSVREAGVKLL  114



>ref|NP_198134.1| ribosomal L18p/L5e family protein [Arabidopsis thaliana]
 gb|AAM63167.1| unknown [Arabidopsis thaliana]
 gb|ABD38897.1| At5g27820 [Arabidopsis thaliana]
 gb|AED93728.1| ribosomal L18p/L5e family protein [Arabidopsis thaliana]
Length=114

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 100/118 (85%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPP VRP R+  +LKPYVL+MHFTNK+V+AQV+H+P+ATVA +AS+QEK+LR    E 
Sbjct  1    MVIPPAVRPPRLFDYLKPYVLKMHFTNKFVHAQVIHSPTATVACSASSQEKALR----ET  56

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             + TRDVAAA+KIGK+LGERL +K IPAV++  KK+QRYHGKVKAVIDS+R  G++L+
Sbjct  57   MDITRDVAAASKIGKILGERLLMKDIPAVTIQMKKEQRYHGKVKAVIDSVREAGVKLL  114



>dbj|BAJ85195.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=114

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 94/118 (80%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIP P R   +TKFLKPYVL+MHFTN +V AQV+HTPSAT+A AAS+QEK LR  M   
Sbjct  1    MVIPAPARAPAITKFLKPYVLKMHFTNNFVTAQVIHTPSATIACAASSQEKILRPSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDVAAAAKIGKLLGERL  +GIPAVSV   +DQ YHGKVKAVIDS+   G++L+
Sbjct  58   -ESTRDVAAAAKIGKLLGERLLFQGIPAVSVSMSRDQTYHGKVKAVIDSLTAAGVKLL  114



>ref|XP_006394939.1| hypothetical protein EUTSA_v10005162mg [Eutrema salsugineum]
 gb|ESQ32225.1| hypothetical protein EUTSA_v10005162mg [Eutrema salsugineum]
Length=114

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 99/118 (84%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPP VRP R+  +LKPYVL+MHFTNK+V+AQV+H+P+ATVA +AS+QEK+LR    E 
Sbjct  1    MVIPPAVRPPRLFDYLKPYVLKMHFTNKFVHAQVIHSPTATVACSASSQEKALR----ET  56

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
               TRDVAAAAKIGK+LGERL +K IPAV++  KK+QRYHGKVKAV+DS+R  G++L+
Sbjct  57   MGVTRDVAAAAKIGKILGERLLMKDIPAVTIHMKKEQRYHGKVKAVVDSVREAGVKLL  114



>ref|XP_004982107.1| PREDICTED: putative 50S ribosomal protein L18, apicoplast-like 
[Setaria italica]
Length=114

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 95/118 (81%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MV PPP     +TKFLKPY+L+MHFTN +V+AQV+HTPSATV  +AS+QEK LR  M   
Sbjct  1    MVTPPPAMAPAITKFLKPYILKMHFTNNFVSAQVIHTPSATVTCSASSQEKLLRPSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDVAAAAKIGKLLGERL  KGIPAVSV   ++Q+YHGKVKAVIDS+R  G++L+
Sbjct  58   -ESTRDVAAAAKIGKLLGERLLFKGIPAVSVSMSREQKYHGKVKAVIDSLRDAGVKLL  114



>ref|XP_009129881.1| PREDICTED: 60S ribosomal protein L18, mitochondrial-like [Brassica 
rapa]
Length=114

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 98/118 (83%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPP VRP R+  +LKPYVL++HFTNK+V+AQV+H+P+ATVA +AS+QEK+LR    E 
Sbjct  1    MVIPPAVRPPRLFDYLKPYVLKLHFTNKFVHAQVIHSPTATVACSASSQEKALR----ET  56

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
               TRDVAAAAKIGKLLGERL +K IPAVS+  KK+Q YHGKVKAVIDS+R  G++L+
Sbjct  57   MNVTRDVAAAAKIGKLLGERLLMKDIPAVSIHMKKEQMYHGKVKAVIDSVREAGVKLL  114



>gb|EMS63015.1| 50S ribosomal protein L18 [Triticum urartu]
Length=114

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 94/118 (80%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIP P R   +TKFLKPYVL+MHFTN +V AQV+HTPSAT+A AAS+QEK LR  M   
Sbjct  1    MVIPAPARAPAITKFLKPYVLKMHFTNNFVTAQVIHTPSATIACAASSQEKILRPSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDVAAAAKIGKLLGERL  +GIPAVSV   +DQ YHGKVKAVIDS+   G++L+
Sbjct  58   -ESTRDVAAAAKIGKLLGERLLFRGIPAVSVSMSRDQTYHGKVKAVIDSLTATGVKLL  114



>ref|XP_010092117.1| 50S ribosomal protein L18 [Morus notabilis]
 gb|EXB50268.1| 50S ribosomal protein L18 [Morus notabilis]
Length=114

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 96/118 (81%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVI PP RP  +TK+LKPYVL+MHFTNK+VNAQV+HTP+ATVA +AS+QEK LR    E+
Sbjct  1    MVIRPPARPPLITKYLKPYVLKMHFTNKFVNAQVIHTPTATVAASASSQEKVLR----ES  56

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E TRDVAAAA IGK+L ERL +  IPAV+V  K++Q YHGKVKAVIDS+R  G++L+
Sbjct  57   METTRDVAAAAMIGKILAERLLINNIPAVTVHLKREQTYHGKVKAVIDSVREGGVKLI  114



>ref|XP_008388525.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Malus domestica]
Length=113

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 98/114 (86%), Gaps = 4/114 (4%)
 Frame = -1

Query  644  PPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENT  465
            PPVRP  +TK+LKPYVL+MHFTNKYV+AQV+HTP+ATVA++AS+QEK+LR    E+ E  
Sbjct  4    PPVRPPSITKYLKPYVLKMHFTNKYVSAQVIHTPTATVASSASSQEKALR----ESMEIR  59

Query  464  RDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            RDVAAAAKIGK+LGERL +K IPAVSV  KK+Q+YHGKVKAVIDS+   G++L+
Sbjct  60   RDVAAAAKIGKILGERLLLKNIPAVSVHLKKEQKYHGKVKAVIDSVVEAGVKLL  113



>gb|EMT04490.1| 50S ribosomal protein L18 [Aegilops tauschii]
Length=114

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 94/118 (80%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIP P R   +TKFLKPYVL+MHFTN +V AQV+HTPSAT+A AAS+QEK LR  M   
Sbjct  1    MVIPAPARAPAITKFLKPYVLKMHFTNNFVTAQVIHTPSATIACAASSQEKILRPSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDVAAAAKIGKLLGERL  +GIPAVSV   +DQ YHGKVKAVIDS+   G++L+
Sbjct  58   -ESTRDVAAAAKIGKLLGERLLFRGIPAVSVSMSRDQTYHGKVKAVIDSLMAAGVKLL  114



>ref|XP_010256324.1| PREDICTED: uncharacterized protein LOC104596746 [Nelumbo nucifera]
Length=114

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 92/106 (87%), Gaps = 4/106 (4%)
 Frame = -1

Query  620  TKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAK  441
            T FLKPYVL+MHFTNKYV+AQV+H+P+ATVA +AS+QEK+LR  M    ENTRDVAAAAK
Sbjct  13   TNFLKPYVLKMHFTNKYVSAQVIHSPTATVAASASSQEKALRSSM----ENTRDVAAAAK  68

Query  440  IGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            IGK+LGERL +K IPAVSV  K++Q+YHGKVKAVIDS+R  G++L+
Sbjct  69   IGKILGERLLIKDIPAVSVILKREQKYHGKVKAVIDSVRDAGVKLI  114



>ref|XP_009151183.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Brassica 
rapa]
Length=114

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 99/118 (84%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPP VRP R+  +LKPYVL+MHFTNK+V+AQV+H+P+ATVA AAS+QEK+LR    E 
Sbjct  1    MVIPPAVRPPRLFDYLKPYVLKMHFTNKFVHAQVIHSPTATVACAASSQEKALR----ET  56

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
               TRDVAAA+KIGK+LGERL +K IPAV++  KK+QRYHGKVKAVIDS+R  G++L+
Sbjct  57   MGVTRDVAAASKIGKILGERLLMKDIPAVAIHMKKEQRYHGKVKAVIDSVREAGVKLL  114



>ref|XP_010060177.1| PREDICTED: LOW QUALITY PROTEIN: 50S ribosomal protein L18, chloroplastic-like 
[Eucalyptus grandis]
Length=114

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 99/118 (84%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP +P R+  FLKPYVL+MHFTNK+V+AQV+H+P+ATVA++AS+QEK+LR  M   
Sbjct  1    MVIPPPAKPPRIINFLKPYVLKMHFTNKFVSAQVIHSPTATVASSASSQEKALRPSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             ++TRDVAAA KIGK+ G RL +KGIPAV+V  K++Q+YHGKVKAV DS+R  G++L+
Sbjct  58   -DSTRDVAAAXKIGKIQGXRLLLKGIPAVTVHLKREQKYHGKVKAVTDSVREAGVKLL  114



>emb|CDY05561.1| BnaA02g31300D [Brassica napus]
Length=114

 Score =   134 bits (336),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 98/118 (83%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPP VRP R+  +LKPYVL++HFTNK+V+AQV+H+P+ATVA +AS+QEK+LR    E 
Sbjct  1    MVIPPAVRPPRLFDYLKPYVLKLHFTNKFVHAQVIHSPTATVACSASSQEKALR----ET  56

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
               TRDVAAAAKIGKLLGERL +K IPAV++  KK+Q YHGKVKAVIDS+R  G++L+
Sbjct  57   MGVTRDVAAAAKIGKLLGERLLMKDIPAVTIHMKKEQMYHGKVKAVIDSVREAGVKLL  114



>emb|CDY25020.1| BnaC02g39880D [Brassica napus]
Length=114

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 98/118 (83%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPP VRP R+  +LKPYVL++HFTNK+V+AQV+H+P+ATVA +AS+QEK+LR    E 
Sbjct  1    MVIPPAVRPPRLFDYLKPYVLKLHFTNKFVHAQVIHSPTATVACSASSQEKALR----ET  56

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
               TRDVAAAAKIGKLLGERL +K IPAV++  KK+Q YHGKVKAVIDS+R  G++L+
Sbjct  57   MGVTRDVAAAAKIGKLLGERLLLKDIPAVTIHMKKEQMYHGKVKAVIDSVREAGVKLL  114



>ref|XP_009338243.1| PREDICTED: uncharacterized protein LOC103930607 [Pyrus x bretschneideri]
Length=113

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 97/114 (85%), Gaps = 4/114 (4%)
 Frame = -1

Query  644  PPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENT  465
            PPVRP  +TK+LKPY+L+MHFTNKYV+ QV+HTP+ATVA++AS+QEK+LR    E+ E  
Sbjct  4    PPVRPPSITKYLKPYLLKMHFTNKYVSVQVIHTPTATVASSASSQEKALR----ESMEIQ  59

Query  464  RDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            RDVAAAAKIGK+LGERL +K IPAVSV  KK+Q+YHGKVKAVIDS+   G++L+
Sbjct  60   RDVAAAAKIGKILGERLLLKNIPAVSVHLKKEQKYHGKVKAVIDSVVETGVKLL  113



>ref|XP_010546733.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Tarenaya 
hassleriana]
Length=114

 Score =   131 bits (330),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 102/118 (86%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPPVRP  +  FLKPY+L+MHFTNK+V+AQV+H+P+ATVA +AS+QEK+LR GM   
Sbjct  1    MVIPPPVRPLPLVNFLKPYMLKMHFTNKFVHAQVMHSPTATVAFSASSQEKALRGGM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDVAAAAKIGK+LGERL +KGIPAVS+   +DQRYHGKVKAVIDSIR  G++L+
Sbjct  58   -ESTRDVAAAAKIGKILGERLLMKGIPAVSINLNRDQRYHGKVKAVIDSIREAGVKLL  114



>ref|XP_007218624.1| hypothetical protein PRUPE_ppa013614mg [Prunus persica]
 gb|EMJ19823.1| hypothetical protein PRUPE_ppa013614mg [Prunus persica]
Length=113

 Score =   131 bits (330),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 97/114 (85%), Gaps = 4/114 (4%)
 Frame = -1

Query  644  PPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENT  465
            PPVRP R+ K+LKPYVL+MHFTNK+V AQV+HTP+ATVA++AS+QEK+LR    E+ E  
Sbjct  4    PPVRPPRIIKYLKPYVLKMHFTNKFVTAQVIHTPTATVASSASSQEKALR----ESMEIR  59

Query  464  RDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            RDVAAAAKIGK+LGERL +K IPAVSV  KK+Q+YHGKVKAV+DS+   G++L+
Sbjct  60   RDVAAAAKIGKILGERLLLKNIPAVSVQLKKEQKYHGKVKAVVDSVVEAGVKLL  113



>emb|CDM83755.1| unnamed protein product [Triticum aestivum]
Length=116

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 94/120 (78%), Gaps = 6/120 (5%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIP P R   +TKFLKPYVL+MHFTN +V AQV+HTPSAT+A AAS+QEK LR  M   
Sbjct  1    MVIPAPARAPAITKFLKPYVLKMHFTNNFVTAQVIHTPSATIACAASSQEKILRPSM---  57

Query  476  KENTRDV--AAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+TRDV  AAAAKIGKLLGERL  +GIPAVSV   +DQ YHGKVKAVIDS+   G++L+
Sbjct  58   -ESTRDVGVAAAAKIGKLLGERLLFRGIPAVSVSMSRDQTYHGKVKAVIDSLTAAGVKLL  116



>ref|XP_002283176.1| PREDICTED: uncharacterized protein LOC100251051 [Vitis vinifera]
 emb|CBI39551.3| unnamed protein product [Vitis vinifera]
Length=114

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 93/105 (89%), Gaps = 4/105 (4%)
 Frame = -1

Query  617  KFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKI  438
            KFLKPYVL+MHFTNK+VNAQV+H+P+ATVA+AAS+QEK+LR  M    E+TRDVAAAA I
Sbjct  14   KFLKPYVLKMHFTNKFVNAQVIHSPTATVASAASSQEKTLRSTM----ESTRDVAAAAMI  69

Query  437  GKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            GK+LGERL ++ IPAV+VF K+DQ+YHGKVKAVIDS+R  GI+L+
Sbjct  70   GKILGERLLLQDIPAVTVFLKRDQKYHGKVKAVIDSLREVGIKLL  114



>ref|XP_004497221.1| PREDICTED: 50S ribosomal protein L18-like isoform X1 [Cicer arietinum]
 ref|XP_004497222.1| PREDICTED: 50S ribosomal protein L18-like isoform X2 [Cicer arietinum]
Length=114

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 92/106 (87%), Gaps = 4/106 (4%)
 Frame = -1

Query  620  TKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAK  441
            TKFLKPYVL+MHFTNKYV+AQV+HTP+ATVA++AS+QEK+LR  +    E TRDVAAAAK
Sbjct  13   TKFLKPYVLKMHFTNKYVSAQVIHTPTATVASSASSQEKALRSNL----ETTRDVAAAAK  68

Query  440  IGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            IGKLL ERL +K IPAVS+  K++QRYHGKVKAVIDS+R  G++L+
Sbjct  69   IGKLLAERLLLKDIPAVSIHLKREQRYHGKVKAVIDSLREAGVKLL  114



>ref|XP_007031018.1| Ribosomal L18p/L5e family protein [Theobroma cacao]
 gb|EOY11520.1| Ribosomal L18p/L5e family protein [Theobroma cacao]
Length=236

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 110/125 (88%), Gaps = 4/125 (3%)
 Frame = -1

Query  677  QGSRPLEMVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSL  498
            Q S+  EMVIPPPVRP R+TKFLKPYVL+MHFTNKYV+AQV+H+P+ATVA++AS+QEK+L
Sbjct  116  QFSKIFEMVIPPPVRPPRITKFLKPYVLKMHFTNKYVSAQVIHSPTATVASSASSQEKAL  175

Query  497  RLGMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGE  318
            R  M    E+TRDVAAAAKIGKLLGERL +K IPAVSVF K++Q+YHGKVKAVIDS++  
Sbjct  176  RASM----ESTRDVAAAAKIGKLLGERLLLKEIPAVSVFLKREQKYHGKVKAVIDSLKEA  231

Query  317  GIELV  303
            G++L+
Sbjct  232  GVKLL  236



>ref|XP_003592709.1| 50S ribosomal protein L18 [Medicago truncatula]
 gb|AES62960.1| 50S ribosomal L18-like protein [Medicago truncatula]
Length=114

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 92/107 (86%), Gaps = 4/107 (4%)
 Frame = -1

Query  623  VTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAA  444
            +T++LKPYVL+MHFTNKYV+AQV+HTP+ATVA++AS+QEK+LR  +    E TRDVAAAA
Sbjct  12   LTQYLKPYVLKMHFTNKYVSAQVIHTPTATVASSASSQEKALRSSL----ETTRDVAAAA  67

Query  443  KIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            KIGKLL ERL +K IPAVSV  K++QRYHGKVKAVIDS+R  G+ L+
Sbjct  68   KIGKLLAERLSLKDIPAVSVHLKREQRYHGKVKAVIDSLREAGVRLL  114



>ref|XP_006484161.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like isoform 
X1 [Citrus sinensis]
Length=126

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 99/119 (83%), Gaps = 4/119 (3%)
 Frame = -1

Query  659  EMVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIE  480
            +MV+PPP RP +  +  +PYVL+MH TNKYV+AQVVH+P+ATVA++AS+QEK+LR  +  
Sbjct  12   DMVVPPPRRPLKTYQPSEPYVLKMHLTNKYVSAQVVHSPTATVASSASSQEKALRSTI--  69

Query  479  AKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
                TRDVAAA+KIGKLLGERL +K IPAVSVF K++QRYHGKVKA+IDS+R  G++L+
Sbjct  70   --GCTRDVAAASKIGKLLGERLLLKDIPAVSVFLKREQRYHGKVKAIIDSLREAGVKLL  126



>ref|XP_002310534.2| hypothetical protein POPTR_0007s04640g [Populus trichocarpa]
 gb|EEE90984.2| hypothetical protein POPTR_0007s04640g [Populus trichocarpa]
Length=177

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 89/103 (86%), Gaps = 4/103 (4%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPPVR  RVT+FLKPYVL+MHFTN+YVNAQV H+P+ATVA+AAS+QEK+LR  M   
Sbjct  1    MVIPPPVRAPRVTQFLKPYVLKMHFTNQYVNAQVTHSPTATVASAASSQEKALRSTM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKV  348
             ENTRDVAAAAKIGK+LGERL +K IPAV+VF  ++Q+YHGK 
Sbjct  58   -ENTRDVAAAAKIGKILGERLLLKDIPAVTVFLNRNQKYHGKA  99



>ref|XP_010931523.1| PREDICTED: uncharacterized protein LOC105052425 isoform X1 [Elaeis 
guineensis]
Length=183

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 92/105 (88%), Gaps = 4/105 (4%)
 Frame = -1

Query  617  KFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKI  438
             +LKPYVL+MHFTNK+VNAQVVHTP+ATVA +AS+QEK LR  M    E+TRDVAAAAKI
Sbjct  83   NYLKPYVLKMHFTNKFVNAQVVHTPTATVACSASSQEKLLRPSM----ESTRDVAAAAKI  138

Query  437  GKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            GK+LGERL +KGIPA+SVF K++Q+YHGKVKA+IDS+R  G++L+
Sbjct  139  GKILGERLLLKGIPAISVFLKREQKYHGKVKAIIDSMRDAGVKLL  183



>ref|XP_006484162.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like isoform 
X2 [Citrus sinensis]
 gb|KDO81820.1| hypothetical protein CISIN_1g033650mg [Citrus sinensis]
Length=114

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 98/118 (83%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MV+PPP RP +  +  +PYVL+MH TNKYV+AQVVH+P+ATVA++AS+QEK+LR  +   
Sbjct  1    MVVPPPRRPLKTYQPSEPYVLKMHLTNKYVSAQVVHSPTATVASSASSQEKALRSTI---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
               TRDVAAA+KIGKLLGERL +K IPAVSVF K++QRYHGKVKA+IDS+R  G++L+
Sbjct  58   -GCTRDVAAASKIGKLLGERLLLKDIPAVSVFLKREQRYHGKVKAIIDSLREAGVKLL  114



>ref|XP_010931525.1| PREDICTED: uncharacterized protein LOC105052425 isoform X2 [Elaeis 
guineensis]
Length=114

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 92/104 (88%), Gaps = 4/104 (4%)
 Frame = -1

Query  614  FLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIG  435
            +LKPYVL+MHFTNK+VNAQVVHTP+ATVA +AS+QEK LR  M    E+TRDVAAAAKIG
Sbjct  15   YLKPYVLKMHFTNKFVNAQVVHTPTATVACSASSQEKLLRPSM----ESTRDVAAAAKIG  70

Query  434  KLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            K+LGERL +KGIPA+SVF K++Q+YHGKVKA+IDS+R  G++L+
Sbjct  71   KILGERLLLKGIPAISVFLKREQKYHGKVKAIIDSMRDAGVKLL  114



>ref|XP_007207499.1| hypothetical protein PRUPE_ppa013613mg [Prunus persica]
 gb|EMJ08698.1| hypothetical protein PRUPE_ppa013613mg [Prunus persica]
Length=113

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 95/114 (83%), Gaps = 4/114 (4%)
 Frame = -1

Query  644  PPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENT  465
            PPVR  R+TK+LKPYVL+MHFTNKYV AQV+HTP+ATVA++AS+QEK+LR    E+ E  
Sbjct  4    PPVRAPRITKYLKPYVLKMHFTNKYVTAQVIHTPTATVASSASSQEKALR----ESMEIR  59

Query  464  RDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            RDVAAA KIGK+LGERL +K IPAV V  K++Q+YHGKVKAV+DS+   G++L+
Sbjct  60   RDVAAAGKIGKILGERLLLKNIPAVCVQLKREQKYHGKVKAVVDSVVEAGVKLL  113



>ref|XP_010550992.1| PREDICTED: 50S ribosomal protein L18, cyanelle-like [Tarenaya 
hassleriana]
 ref|XP_010550993.1| PREDICTED: 50S ribosomal protein L18, cyanelle-like [Tarenaya 
hassleriana]
Length=114

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 94/107 (88%), Gaps = 4/107 (4%)
 Frame = -1

Query  623  VTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAA  444
            +  FLKPYVL+MHFTNK+V+AQV+H+P+ATVA++AS+QEK+L+  M    E+TRDVAAAA
Sbjct  12   LADFLKPYVLKMHFTNKFVHAQVIHSPTATVASSASSQEKALKGSM----ESTRDVAAAA  67

Query  443  KIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            KIGK+LGERL +KGIPAV++  ++DQRYHGKVKAVIDS+R  G++L+
Sbjct  68   KIGKILGERLLMKGIPAVAINLRRDQRYHGKVKAVIDSVREAGVKLL  114



>ref|XP_006574357.1| PREDICTED: uncharacterized protein LOC100526952 isoform X1 [Glycine 
max]
 ref|XP_006574358.1| PREDICTED: uncharacterized protein LOC100526952 isoform X2 [Glycine 
max]
 gb|KHN43963.1| 50S ribosomal protein L18 [Glycine soja]
Length=114

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 92/106 (87%), Gaps = 4/106 (4%)
 Frame = -1

Query  620  TKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAK  441
            T+FLKPYVL+MHFTNKYV+AQV+HTP+ATVA++AS+QEK+LR  +    E +RDVAAAAK
Sbjct  13   TQFLKPYVLKMHFTNKYVSAQVIHTPTATVASSASSQEKALRSSL----ETSRDVAAAAK  68

Query  440  IGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            IGK+L ERL +K IPAVSV  K++Q+YHGKVKAVIDSIR  G++L+
Sbjct  69   IGKILAERLLLKDIPAVSVHLKREQKYHGKVKAVIDSIREAGVKLL  114



>ref|NP_001236427.1| uncharacterized protein LOC100526952 [Glycine max]
 gb|ACU15985.1| unknown [Glycine max]
Length=114

 Score =   126 bits (317),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 91/106 (86%), Gaps = 4/106 (4%)
 Frame = -1

Query  620  TKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAK  441
            T+FLKPYVL+MHFTNKYV+AQV+HTP+ATV ++AS+QEK+LR  +    E +RDVAAAAK
Sbjct  13   TQFLKPYVLKMHFTNKYVSAQVIHTPTATVVSSASSQEKALRSSL----ETSRDVAAAAK  68

Query  440  IGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            IGK+L ERL +K IPAVSV  K++Q+YHGKVKAVIDSIR  G++L+
Sbjct  69   IGKILAERLLLKDIPAVSVHLKREQKYHGKVKAVIDSIREAGVKLL  114



>ref|XP_008806047.1| PREDICTED: uncharacterized protein LOC103718834 [Phoenix dactylifera]
Length=114

 Score =   126 bits (317),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 91/104 (88%), Gaps = 4/104 (4%)
 Frame = -1

Query  614  FLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIG  435
            +LKPYVL+MHFTNK+VNAQVVH+P+ATVA +AS+QEK LR  M    E+TRDVAAAAKIG
Sbjct  15   YLKPYVLKMHFTNKFVNAQVVHSPTATVACSASSQEKLLRPSM----ESTRDVAAAAKIG  70

Query  434  KLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            K+LGERL +K IPAVSVF K++Q+YHGKVKAVIDS+R  G++L+
Sbjct  71   KILGERLLLKKIPAVSVFLKREQKYHGKVKAVIDSMRDAGVKLL  114



>ref|XP_004288652.1| PREDICTED: 50S ribosomal protein L18-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=114

 Score =   126 bits (316),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 94/107 (88%), Gaps = 4/107 (4%)
 Frame = -1

Query  623  VTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAA  444
            +TKFLKPYVL+MHFTNKYV+AQVVH+P+ATVA++AS+QEK+LR    E+ E+ RDVAAAA
Sbjct  12   ITKFLKPYVLKMHFTNKYVSAQVVHSPTATVASSASSQEKALR----ESLESHRDVAAAA  67

Query  443  KIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            KIGK+LGERL +K IPAVSV  K++Q+YHGKVKAVID++   G++L+
Sbjct  68   KIGKILGERLLLKNIPAVSVHLKREQKYHGKVKAVIDNVVEAGVKLL  114



>gb|KHG04764.1| 50S ribosomal L18 [Gossypium arboreum]
Length=164

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 113/141 (80%), Gaps = 10/141 (7%)
 Frame = -1

Query  707  TPVLLSLAFAQ--GSRPL----EMVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvht  546
            T  L SL + Q    +PL    EMVIPPPVRP R+ KFLKPY+L+MHFTNKYV+AQV+H+
Sbjct  28   TSFLYSLKWLQYLSRQPLIAVTEMVIPPPVRPPRILKFLKPYILKMHFTNKYVSAQVIHS  87

Query  545  psatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQ  366
            P+ATVA+AAS+QEK+LR  M    E+TRDVAAAAKIGK+L ERL +K IPAVSV  K++Q
Sbjct  88   PTATVASAASSQEKALRSSM----ESTRDVAAAAKIGKILAERLLLKEIPAVSVSLKREQ  143

Query  365  RYHGKVKAVIDSIRGEGIELV  303
            +YHGKVKAVIDS+R  G++L+
Sbjct  144  KYHGKVKAVIDSLREAGVKLL  164



>ref|XP_009382531.1| PREDICTED: uncharacterized protein LOC103970472 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382532.1| PREDICTED: uncharacterized protein LOC103970472 [Musa acuminata 
subsp. malaccensis]
Length=114

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 91/104 (88%), Gaps = 4/104 (4%)
 Frame = -1

Query  614  FLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIG  435
            +LKPYVLRMHF+NKYV+ QVVHTP+ATVA +AS++EK LR  M    E+TRDVAAA+KIG
Sbjct  15   YLKPYVLRMHFSNKYVSTQVVHTPTATVAASASSKEKLLRPVM----ESTRDVAAASKIG  70

Query  434  KLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            K+LGERL +KGIPAVSVF K++Q+YHGKVKAVIDS+R  G++L+
Sbjct  71   KILGERLLLKGIPAVSVFLKREQKYHGKVKAVIDSVRDAGVKLL  114



>ref|XP_003544108.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like isoform 
X1 [Glycine max]
 ref|XP_006595659.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like isoform 
X2 [Glycine max]
Length=114

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 92/106 (87%), Gaps = 4/106 (4%)
 Frame = -1

Query  620  TKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAK  441
            T+FLKPYVL+M+FTNKYV+AQV+H+P+ATVA++AS+QEK+LR  +    E +RDVAAAAK
Sbjct  13   TQFLKPYVLKMNFTNKYVSAQVIHSPTATVASSASSQEKALRSSL----ETSRDVAAAAK  68

Query  440  IGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            IGK+L ERL +K IPAVSV  K++Q+YHGKVKAVIDS+R  G++L+
Sbjct  69   IGKILAERLLLKNIPAVSVHLKREQKYHGKVKAVIDSLREAGVKLL  114



>gb|AFK37558.1| unknown [Lotus japonicus]
Length=114

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 89/104 (86%), Gaps = 4/104 (4%)
 Frame = -1

Query  614  FLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIG  435
            FLKPYVLRMHFTNKYV+AQV+HTP+ATVA++AS+QEK+LR  +    E  RDVAAAAKIG
Sbjct  15   FLKPYVLRMHFTNKYVSAQVIHTPTATVASSASSQEKALRSSL----ETKRDVAAAAKIG  70

Query  434  KLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            K+L ERL +K IPAVSV  K++Q+YHGKVKAVIDS+R  G++L+
Sbjct  71   KILAERLLLKEIPAVSVHLKREQKYHGKVKAVIDSLREAGVKLL  114



>gb|KHN46908.1| 50S ribosomal protein L18 [Glycine soja]
Length=114

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 92/106 (87%), Gaps = 4/106 (4%)
 Frame = -1

Query  620  TKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAK  441
            T+FLKPYVL+M+FTNKYV+AQV+H+P+ATVA++AS+QEK+LR  +    E +RDVAAAAK
Sbjct  13   TQFLKPYVLKMNFTNKYVSAQVIHSPTATVASSASSQEKALRSCL----ETSRDVAAAAK  68

Query  440  IGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            IGK+L ERL +K IPAVSV  K++Q+YHGKVKAVIDS+R  G++L+
Sbjct  69   IGKILAERLLLKNIPAVSVHLKREQKYHGKVKAVIDSLREAGVKLL  114



>ref|XP_010100963.1| 50S ribosomal protein L18 [Morus notabilis]
 gb|EXB86428.1| 50S ribosomal protein L18 [Morus notabilis]
Length=293

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 101/147 (69%), Gaps = 8/147 (5%)
 Frame = -1

Query  743  SAAPPLRRNTTLTPVLLSLAFAQGSRPLEMVIPPPVRPERVTKFLKPYVLRMHFTNKYVN  564
            S A  L R   + P   +L    G R   +V     RP  +TK+LKPYVL+MHFTNK+VN
Sbjct  155  SIAVSLDRMRIVRPRGQNLKLGPGRRDTWLV----ARPRAITKYLKPYVLKMHFTNKFVN  210

Query  563  AQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAVSV  384
             QV+HTP+ATV  +AS+QEK LR    E  E TRDVAAAAKIGK+L E L +  IPAV+V
Sbjct  211  VQVIHTPTATVTASASSQEKVLR----ECMETTRDVAAAAKIGKILAECLLINNIPAVTV  266

Query  383  FFKKDQRYHGKVKAVIDSIRGEGIELV  303
              K++QRYHGKVKAVIDS+R  G++L+
Sbjct  267  HLKREQRYHGKVKAVIDSVREGGVKLI  293



>gb|KCW66478.1| hypothetical protein EUGRSUZ_F00280 [Eucalyptus grandis]
Length=94

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 81/118 (69%), Gaps = 24/118 (20%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP +P R+  FLKPYVL+MHFTNK+                    EK+LR  M   
Sbjct  1    MVIPPPAKPPRIINFLKPYVLKMHFTNKF--------------------EKALRPSM---  37

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             ++ RDVAAAAKIGK+LGERL +KGIPAV+V  K++Q+YH KVKAVIDS+R  G++L+
Sbjct  38   -DSPRDVAAAAKIGKILGERLLLKGIPAVAVHLKREQKYHWKVKAVIDSVREAGVKLL  94



>ref|XP_004491596.1| PREDICTED: 50S ribosomal protein L18-like isoform X1 [Cicer arietinum]
 ref|XP_004491597.1| PREDICTED: 50S ribosomal protein L18-like isoform X2 [Cicer arietinum]
Length=121

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 93/113 (82%), Gaps = 11/113 (10%)
 Frame = -1

Query  620  TKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAK  441
            T+FLKPY+LRMHFTNKYV+AQV+HTP+ATVA++AS+QEK+L+  +    E TRDVAAAAK
Sbjct  13   TQFLKPYLLRMHFTNKYVSAQVIHTPTATVASSASSQEKALKPSL----ETTRDVAAAAK  68

Query  440  IGKLLGERLRVKGI-------PAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            IGK+LGERL +K I       PAVSV  K++QRYHGKVKAVIDS+R  G++L+
Sbjct  69   IGKILGERLLLKDIPAVSVHLPAVSVHLKREQRYHGKVKAVIDSLREAGVKLL  121



>ref|XP_007142510.1| hypothetical protein PHAVU_008G286800g [Phaseolus vulgaris]
 gb|ESW14504.1| hypothetical protein PHAVU_008G286800g [Phaseolus vulgaris]
Length=114

 Score =   120 bits (302),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 89/104 (86%), Gaps = 4/104 (4%)
 Frame = -1

Query  614  FLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIG  435
            FLKPYVL+MHFTNKYV+AQV+HTP+ATVA++AS+QEK+LR  +      TRDVAAAAKIG
Sbjct  15   FLKPYVLKMHFTNKYVSAQVIHTPTATVASSASSQEKALRSSL----GTTRDVAAAAKIG  70

Query  434  KLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            K+L ERL +K IPAVSV  K++Q+YHGKVKAVIDS+R  G++L+
Sbjct  71   KILAERLLLKDIPAVSVHLKREQKYHGKVKAVIDSLRDVGVKLL  114



>ref|XP_006404765.1| hypothetical protein EUTSA_v10000673mg [Eutrema salsugineum]
 gb|ESQ46218.1| hypothetical protein EUTSA_v10000673mg [Eutrema salsugineum]
Length=116

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 89/104 (86%), Gaps = 4/104 (4%)
 Frame = -1

Query  614  FLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIG  435
            +LKPYVL+MHFTNK+V+AQ++H+P+AT+A +AS+QEK+LR    E    TRDVAAAAKIG
Sbjct  17   YLKPYVLKMHFTNKFVHAQIIHSPTATMACSASSQEKALR----ETMGVTRDVAAAAKIG  72

Query  434  KLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            K+LGERL +K IPAV++  KK+QRYHGKVKAV+DS+R  G++L+
Sbjct  73   KILGERLLMKDIPAVTIHMKKEQRYHGKVKAVVDSVREAGVKLL  116



>gb|KCW47852.1| hypothetical protein EUGRSUZ_K01592, partial [Eucalyptus grandis]
Length=110

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 92/111 (83%), Gaps = 4/111 (4%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            +++P P +P R+  FLKPYVL+MHFT+K+V+AQV+H+P ATVA++AS+QEK+LR  +   
Sbjct  2    VIVPTPAKPPRIINFLKPYVLKMHFTSKFVSAQVIHSPIATVASSASSQEKALRPSI---  58

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIR  324
             ++T DVAAAAKIGK+  ERL +KGIPAV V  K++Q+YHGKVKAVIDS+R
Sbjct  59   -DSTGDVAAAAKIGKIPAERLLLKGIPAVEVHLKREQKYHGKVKAVIDSMR  108



>ref|XP_010038817.1| PREDICTED: uncharacterized protein LOC104427419 [Eucalyptus grandis]
Length=164

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 94/116 (81%), Gaps = 4/116 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            +++P P +P R+  FLKPYVL+MHFT+K+V+AQV+H+P ATVA++AS+QEK+LR  +   
Sbjct  2    VIVPTPAKPPRIINFLKPYVLKMHFTSKFVSAQVIHSPIATVASSASSQEKALRPSI---  58

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
             ++T DVAAAAKIGK+  ERL +KGIPAV V  K++Q+YHGKVKAVIDS+R   ++
Sbjct  59   -DSTGDVAAAAKIGKIPAERLLLKGIPAVEVHLKREQKYHGKVKAVIDSMREASVK  113



>ref|XP_006840507.1| hypothetical protein AMTR_s00045p00201530 [Amborella trichopoda]
 gb|ERN02182.1| hypothetical protein AMTR_s00045p00201530 [Amborella trichopoda]
Length=114

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 88/105 (84%), Gaps = 4/105 (4%)
 Frame = -1

Query  617  KFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKI  438
            K+LKPYVL+M+F+NKYV+AQV HTP+ATVA +ASTQEK LR  M    + TRDV AAAKI
Sbjct  14   KYLKPYVLKMNFSNKYVSAQVFHTPTATVACSASTQEKLLRYSM----QCTRDVEAAAKI  69

Query  437  GKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            GK+LG+RL +K IPAV+V+ K +Q+YHGK+KA+IDS+R  GI+L+
Sbjct  70   GKILGDRLLLKDIPAVTVYLKGEQKYHGKIKAIIDSLRDSGIKLI  114



>gb|KCW66763.1| hypothetical protein EUGRSUZ_F00513, partial [Eucalyptus grandis]
Length=114

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 87/118 (74%), Gaps = 4/118 (3%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MV PPP +  R+  FLKPY+L+MHF NK+V+AQV+H+P+ TVA++     ++LR  M   
Sbjct  1    MVFPPPAKSPRIINFLKPYILKMHFINKFVSAQVIHSPTTTVASSRELTGEALRPSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             E+ RDVAAAAKIGK  GERL +KGI AV V  K++Q+Y GKVKAVIDS+R   ++L+
Sbjct  58   -ESARDVAAAAKIGKTPGERLLLKGIAAVEVHLKREQKYQGKVKAVIDSVREASVKLL  114



>ref|XP_009384408.1| PREDICTED: uncharacterized protein LOC103971964 [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 94/114 (82%), Gaps = 4/114 (4%)
 Frame = -1

Query  644  PPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENT  465
            P VRP R+  FLKPYVL+MH T+K+V+AQV+HTP+  VA +AS+QEK LR  +     +T
Sbjct  4    PIVRPSRIPGFLKPYVLKMHITDKHVSAQVIHTPTTEVAVSASSQEKLLRPSI----GST  59

Query  464  RDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            RDVAAAAKIGKLLGERL ++GIPAVSVF KK+Q+YHGKVKAVIDS+R  G++L+
Sbjct  60   RDVAAAAKIGKLLGERLLLRGIPAVSVFLKKEQKYHGKVKAVIDSMRDAGVKLL  113



>ref|XP_010064257.1| PREDICTED: uncharacterized protein LOC104451247 [Eucalyptus grandis]
Length=157

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 83/111 (75%), Gaps = 4/111 (4%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MV PPP +  R+  FLKPY+L+MHF NK+V+AQV+H+P+ TVA++     ++LR  M   
Sbjct  1    MVFPPPAKSPRIINFLKPYILKMHFINKFVSAQVIHSPTTTVASSRELTGEALRPSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIR  324
             E+ RDVAAAAKIGK  GERL +KGI AV V  K++Q+Y GKVKAVIDS+R
Sbjct  58   -ESARDVAAAAKIGKTPGERLLLKGIAAVEVHLKREQKYQGKVKAVIDSVR  107



>gb|KCW66766.1| hypothetical protein EUGRSUZ_F00518 [Eucalyptus grandis]
Length=101

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 17/118 (14%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP +P R+  FLKPYVL+MHFTNK+V+AQV+H+P+ATVA++AS+QEK+LR  M   
Sbjct  1    MVIPPPAKPPRIINFLKPYVLKMHFTNKFVSAQVIHSPTATVASSASSQEKALRPSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             ++TRD             RL +KGIPAV+V  K++Q+YHGKVKAV DS+R  G++L+
Sbjct  58   -DSTRD-------------RLLLKGIPAVTVHLKREQKYHGKVKAVTDSVREAGVKLL  101



>ref|XP_004288653.1| PREDICTED: 50S ribosomal protein L18-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=103

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 80/90 (89%), Gaps = 4/90 (4%)
 Frame = -1

Query  623  VTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAA  444
            +TKFLKPYVL+MHFTNKYV+AQVVH+P+ATVA++AS+QEK+LR    E+ E+ RDVAAAA
Sbjct  12   ITKFLKPYVLKMHFTNKYVSAQVVHSPTATVASSASSQEKALR----ESLESHRDVAAAA  67

Query  443  KIGKLLGERLRVKGIPAVSVFFKKDQRYHG  354
            KIGK+LGERL +K IPAVSV  K++Q+YHG
Sbjct  68   KIGKILGERLLLKNIPAVSVHLKREQKYHG  97



>gb|KCW66760.1| hypothetical protein EUGRSUZ_F00510 [Eucalyptus grandis]
Length=101

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 17/118 (14%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPPP +P R+  FLKP+VL+MHFTNK+V+AQV+H+P+ATVA++AS+QEK+LR  M   
Sbjct  1    MVIPPPAKPPRIINFLKPHVLKMHFTNKFVSAQVIHSPTATVASSASSQEKALRPSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             ++TRD             RL +KGIPAV+V  K++Q YHGKVKAVIDS+R  G++L+
Sbjct  58   -DSTRD-------------RLLLKGIPAVAVHSKREQTYHGKVKAVIDSVREAGVKLL  101



>ref|XP_006437976.1| hypothetical protein CICLE_v10033184mg [Citrus clementina]
 gb|ESR51216.1| hypothetical protein CICLE_v10033184mg [Citrus clementina]
Length=92

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 82/98 (84%), Gaps = 8/98 (8%)
 Frame = -1

Query  590  MHFTNKYVNAQvvhtpsatvataasTQEKSLR--LGMIEAKENTRDVAAAAKIGKLLGER  417
            MH TNKYV+AQVVH+P+ATVA++AS+ EK+LR  +G       TRDVAAA+KIGKLLGER
Sbjct  1    MHLTNKYVSAQVVHSPTATVASSASSHEKALRSTIGC------TRDVAAASKIGKLLGER  54

Query  416  LRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            L +K IPAVSVF K++QRYHGKVKA+IDS+R  G++L+
Sbjct  55   LLLKDIPAVSVFLKREQRYHGKVKAIIDSLREAGVKLL  92



>gb|ABF98333.1| ribosomal protein L18 family protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=92

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 79/96 (82%), Gaps = 4/96 (4%)
 Frame = -1

Query  590  MHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGERLR  411
            MHFTN +V+AQV+HTPSATVA +AS+QEK LR  M    E+TRDVAAAAKIGKLLGERL 
Sbjct  1    MHFTNNFVSAQVIHTPSATVACSASSQEKLLRPSM----ESTRDVAAAAKIGKLLGERLL  56

Query  410  VKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             +GIPAVSV   +DQ YHGKV+AV+DS+R  G++L+
Sbjct  57   FRGIPAVSVSMSRDQTYHGKVRAVMDSLRAAGVKLL  92



>gb|KCW66770.1| hypothetical protein EUGRSUZ_F00523 [Eucalyptus grandis]
Length=96

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 75/119 (63%), Gaps = 24/119 (20%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIP P +P R+  FLKPYVL+MHFTNK+V+AQ                       +I +
Sbjct  1    MVIPLPAKPPRIINFLKPYVLKMHFTNKFVSAQ-----------------------VIHS  37

Query  476  KENT-RDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
               T    A++ K+GK+LGERL +KGIP V+V  K++Q+YHGKVKAV DS+R  G++++
Sbjct  38   PTATVASSASSCKMGKILGERLLLKGIPTVAVHLKREQKYHGKVKAVTDSVREVGVKML  96



>ref|XP_010105308.1| 50S ribosomal protein L18 [Morus notabilis]
 gb|EXC04305.1| 50S ribosomal protein L18 [Morus notabilis]
Length=92

 Score =   100 bits (250),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 62/96 (65%), Positives = 76/96 (79%), Gaps = 4/96 (4%)
 Frame = -1

Query  590  MHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGERLR  411
            MHFTNK+VN QV+HTP+ATV  +AS+QEK LR    E  E TRDVAAAAKIGK+L E L 
Sbjct  1    MHFTNKFVNVQVIHTPTATVTASASSQEKVLR----ECMETTRDVAAAAKIGKILAECLL  56

Query  410  VKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            +  IPAV+V  K++QRYHGKVKAVIDS+R  G++L+
Sbjct  57   INNIPAVTVHLKREQRYHGKVKAVIDSVREGGVKLI  92



>emb|CDX86139.1| BnaA06g28560D [Brassica napus]
 emb|CDX80619.1| BnaC07g28250D [Brassica napus]
Length=84

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 70/118 (59%), Gaps = 34/118 (29%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIPP VRP R+  +LKPY                              EK+LR    E 
Sbjct  1    MVIPPAVRPPRLFDYLKPY------------------------------EKALR----ET  26

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
               TRDVAAA+KIGK+LGERL +K IPAV++  KK+QRYHGKVKAVIDS+R  G++L+
Sbjct  27   MGVTRDVAAASKIGKILGERLLMKDIPAVAIHMKKEQRYHGKVKAVIDSVREAGVKLL  84



>ref|XP_001763221.1| predicted protein [Physcomitrella patens]
 gb|EDQ72098.1| predicted protein [Physcomitrella patens]
Length=103

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 75/105 (71%), Gaps = 4/105 (4%)
 Frame = -1

Query  617  KFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKI  438
            K+LKPY L++HF+NKYV + VVH P++    AA++QEK LR    E    T DVAAAA+I
Sbjct  3    KYLKPYELKLHFSNKYVRSMVVHKPTSHTVVAATSQEKDLR----EQLPATGDVAAAAQI  58

Query  437  GKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
              +L  RL+VK +PAV+   KK +RYHGK+KA +DS+R  GI+L+
Sbjct  59   ASILASRLKVKDVPAVTYELKKGERYHGKIKAFLDSLRENGIQLI  103



>gb|KCW66768.1| hypothetical protein EUGRSUZ_F00521 [Eucalyptus grandis]
Length=101

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 83/118 (70%), Gaps = 17/118 (14%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVIP P +P R+  FLKPYV +MHF+NK+V+AQV+H+P+ATVA++AS+ EK+LR  M   
Sbjct  1    MVIPLPAKPPRIINFLKPYVPKMHFSNKFVSAQVIHSPTATVASSASSHEKALRPSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             + TRD             RL +KGI  V+V  K++Q+YHGKVK+V DS+R  G++L+
Sbjct  58   -DATRD-------------RLLLKGILTVAVHLKREQKYHGKVKSVTDSVREAGVKLL  101



>gb|KCW66771.1| hypothetical protein EUGRSUZ_F00526 [Eucalyptus grandis]
Length=92

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 76/96 (79%), Gaps = 4/96 (4%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEA  477
            MVI PP +P R+  FLK YVL++HFTNK+V+AQV+H+P+ATVA++AS+QEK+LR  M   
Sbjct  1    MVIQPPAKPPRIINFLKTYVLKVHFTNKFVSAQVIHSPTATVASSASSQEKALRPSM---  57

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKD  369
             ++TRDVAAA K+ K+  ERL +KGIPAV V  K++
Sbjct  58   -DSTRDVAAAVKVRKIPAERLLLKGIPAVEVHLKRE  92



>gb|KDP23465.1| hypothetical protein JCGZ_23298 [Jatropha curcas]
Length=73

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 66/77 (86%), Gaps = 5/77 (6%)
 Frame = -1

Query  656  MVIPPPVR-PERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIE  480
            MVIPPPV+ P RV +FLKPY+L+MHFTNKYV+AQV+H+P+ATV+ +AS+QEK+LR  +  
Sbjct  1    MVIPPPVKWPPRVREFLKPYILKMHFTNKYVSAQVIHSPTATVSCSASSQEKALRSSI--  58

Query  479  AKENTRDVAAAAKIGKL  429
              ENTRDVA AAKIGK+
Sbjct  59   --ENTRDVATAAKIGKI  73



>emb|CDX99971.1| BnaC09g03300D [Brassica napus]
Length=483

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 53/70 (76%), Gaps = 4/70 (6%)
 Frame = -1

Query  512  QEKSLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVID  333
            QEK+LR    E    TRDVAAA+KIGK+L ERL +K IPAV++  KK+QRYHGKVKAVID
Sbjct  72   QEKALR----ETMGVTRDVAAASKIGKILRERLLIKDIPAVAIHMKKEQRYHGKVKAVID  127

Query  332  SIRGEGIELV  303
            S+R  G E +
Sbjct  128  SVREAGTESI  137



>gb|AAO41877.1| unknown protein [Arabidopsis thaliana]
Length=45

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  437  GKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            GK+LGERL +K IPAV++  KK+QRYHGKVKAVIDS+R  G++L+
Sbjct  1    GKILGERLLMKDIPAVTIQMKKEQRYHGKVKAVIDSVREAGVKLL  45



>ref|XP_002989809.1| hypothetical protein SELMODRAFT_130450 [Selaginella moellendorffii]
 gb|EFJ09076.1| hypothetical protein SELMODRAFT_130450 [Selaginella moellendorffii]
Length=93

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 61/97 (63%), Gaps = 5/97 (5%)
 Frame = -1

Query  590  MHFTNKYVNAQvvhtps-atvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGERL  414
            M F+N+ V A+V  T     +   AS++++ L+ G+     +  D AAAAK+G+ L ERL
Sbjct  1    MQFSNRSVTAEVFDTLHDNALVVRASSRDEELKQGL----ASLTDCAAAAKVGEALAERL  56

Query  413  RVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            + KGIP V+ F  + + YHGK KA++D +R  G++L+
Sbjct  57   KEKGIPGVTYFRNRGELYHGKRKALLDKLRETGVKLI  93



>gb|KFM27523.1| 50S ribosomal protein L18 [Auxenochlorella protothecoides]
Length=107

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 35/103 (34%), Positives = 58/103 (56%), Gaps = 2/103 (2%)
 Frame = -1

Query  611  LKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGK  432
            ++PY L++ F+NKY  AQ+          AA+    ++  G+ E  E+T D  A A++ +
Sbjct  7    VRPYQLQLFFSNKYAYAQIWKVSGDKHTVAAAAS--TIEKGLQEGLESTSDKGACARVAQ  64

Query  431  LLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
             L ER +  GI  VS   K  QR+HGKV A++  ++  GI+++
Sbjct  65   TLAERAQAAGIDTVSWQRKPRQRFHGKVAALVTGLKEAGIKMM  107



>ref|XP_005649799.1| translational machinery component [Coccomyxa subellipsoidea C-169]
 gb|EIE25255.1| translational machinery component [Coccomyxa subellipsoidea C-169]
Length=107

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 44/101 (44%), Positives = 60/101 (59%), Gaps = 4/101 (4%)
 Frame = -1

Query  608  KPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKL  429
            KP+VL++  +NKY  AQV+      V  AAST EK LR  +     +T D  A+A +GKL
Sbjct  10   KPFVLKLFLSNKYTYAQVIRRADGNVLAAASTIEKDLRKDL----PSTSDKPASALVGKL  65

Query  428  LGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIEL  306
            L ER +  GI AV    K  Q+YHGKVK ++ S++  G+ L
Sbjct  66   LAERAQQAGISAVHWERKYGQKYHGKVKELLASMQEAGLPL  106



>gb|EMS45387.1| 50S ribosomal protein L18 [Triticum urartu]
Length=82

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 53/70 (76%), Gaps = 4/70 (6%)
 Frame = -1

Query  512  QEKSLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVID  333
             EK LR  +    E+T DV+A AKIGKLLG+ L +KGIPAVS+  K++ +YHGKVKAVID
Sbjct  17   HEKLLRPNL----ESTHDVSATAKIGKLLGKCLLLKGIPAVSIHMKRELKYHGKVKAVID  72

Query  332  SIRGEGIELV  303
            S+R  G++L+
Sbjct  73   SVREAGVKLL  82



>ref|XP_003612287.1| hypothetical protein MTR_5g023330 [Medicago truncatula]
 gb|AES95245.1| hypothetical protein MTR_5g023330 [Medicago truncatula]
Length=144

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  656  MVIPPPVRPERVTKFLKPYVLRMHFTNKYVNA  561
            +VI P VRP R+TKFLKPYV++MHFTNKY++A
Sbjct  88   IVIQPSVRPPRITKFLKPYVMKMHFTNKYMSA  119



>ref|WP_035516947.1| 50S ribosomal protein L18 [Pseudohaliea rubra]
 gb|KGE02942.1| LSU ribosomal protein L18p (L5e) [Haliea rubra DSM 19751]
Length=116

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 57/97 (59%), Gaps = 7/97 (7%)
 Frame = -1

Query  596  LRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGER  417
            L +H T +++ AQV       V  +AST ++SLR G       T +V AAA++GKL+ ER
Sbjct  27   LSVHRTPRHIYAQVFSASGDQVLASASTLDESLRSGA------TGNVDAAAQVGKLVAER  80

Query  416  LRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIEL  306
             R  GI  V+ F +   RYHG+VKA+ D+ R  G+E 
Sbjct  81   AREAGIEKVA-FDRSGYRYHGRVKALADAAREGGLEF  116



>ref|XP_003056604.1| ribosomal protein L18 [Micromonas pusilla CCMP1545]
 gb|EEH59980.1| ribosomal protein L18 [Micromonas pusilla CCMP1545]
Length=121

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 61/99 (62%), Gaps = 8/99 (8%)
 Frame = -1

Query  596  LRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGER  417
            L++ F+N +V AQV+      +   AST EK+L++ +    ++T D  AA+ IGK++ ER
Sbjct  15   LKIVFSNSFVYAQVLRRTDNHIVATASTVEKALKVTL----KHTADKTAASVIGKVIAER  70

Query  416  LRVKGIPAVSVFFKK--DQRYHGKVKAVIDSIRGEGIEL  306
                 + AV  +F K   +R+HGK+K ++D++RG G+ L
Sbjct  71   SNAVNVNAV--YFPKPEGKRFHGKLKVLVDTLRGSGLSL  107



>ref|WP_002649729.1| 50S ribosomal protein L18 [Planctomyces maris]
 gb|EDL56149.1| LSU ribosomal protein L18P [Planctomyces maris DSM 8797]
Length=121

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 60/96 (63%), Gaps = 5/96 (5%)
 Frame = -1

Query  596  LRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGER  417
            L ++ +N ++ AQ++   +     +AST++KSL  G IE   N  ++AAA K+GKL+GER
Sbjct  30   LSVYRSNNHIYAQLIDDTAGVTLVSASTKDKSL-AGEIE---NGGNIAAAEKVGKLIGER  85

Query  416  LRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
               KGI  V+ F +   RYHG+V A+ DS R  G++
Sbjct  86   AVEKGIKEVA-FDRGPYRYHGRVAALADSARKAGLD  120



>ref|WP_009574396.1| 50S ribosomal protein L18 [gamma proteobacterium IMCC3088]
 gb|EGG30854.1| LSU ribosomal protein L18p (L5e) [gamma proteobacterium IMCC3088]
Length=98

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 59/97 (61%), Gaps = 7/97 (7%)
 Frame = -1

Query  596  LRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGER  417
            L +H T +++ AQV++     V  AAST +KSLR G       T + AAAA++GKL+ +R
Sbjct  9    LTVHRTPRHIYAQVLNAAGDKVLAAASTLDKSLRDGA------TGNQAAAAEVGKLIAQR  62

Query  416  LRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIEL  306
             +  G+  V+ F +   RYHG+VK++ D+ R  G+E 
Sbjct  63   AKDAGVTQVA-FDRSGFRYHGRVKSLADAARENGLEF  98



>ref|WP_014161366.1| 50S ribosomal protein L18 [Pseudoxanthomonas spadix]
 ref|YP_004931234.1| 50S ribosomal protein L18 [Pseudoxanthomonas spadix BD-a59]
 gb|AER57193.1| 50S ribosomal protein L18 [Pseudoxanthomonas spadix BD-a59]
Length=118

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = -1

Query  503  SLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIR  324
            +L+  + E  +N ++  AAAKIGKL+ ER R  G+  V+ F +   RYHG+VKA+ D+ R
Sbjct  54   TLQADVKEGLKNGKNSDAAAKIGKLIAERARAAGVEKVA-FDRSGYRYHGRVKALADAAR  112

Query  323  GEGIE  309
              G++
Sbjct  113  EGGLQ  117



>ref|XP_004150421.1| PREDICTED: 50S ribosomal protein L18-like [Cucumis sativus]
Length=190

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 64/109 (59%), Gaps = 4/109 (4%)
 Frame = -1

Query  629  ERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAA  450
            +R   +++P++L + F+ K+++A+V+H  ++ V + A+T  K LR  +     +  D  A
Sbjct  85   QRTDMYMRPFLLNVFFSKKFIHAKVMHRGTSKVISVATTNAKDLRNSL----PSLTDHNA  140

Query  449  AAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
               IGKL+ ER +   + A+S   +KD+R  GK+  VID+I+  GI  V
Sbjct  141  CRVIGKLIAERSKEADVYAISYEPRKDERIEGKLGIVIDTIKENGIMFV  189



>ref|XP_004172876.1| PREDICTED: LOW QUALITY PROTEIN: 50S ribosomal protein L18-like 
[Cucumis sativus]
Length=190

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 77/149 (52%), Gaps = 8/149 (5%)
 Frame = -1

Query  740  AAPPLRRNTTLTPVLLSLAFAQGSRPLEMVIPPPVRP---ERVTKFLKPYVLRMHFTNKY  570
             +P    N++   VLL +  A   R  E     P +    +R   +++P+ L + F+ K+
Sbjct  46   GSPFASSNSSYAKVLL-IQSAWTRRSREEAAKRPNKKSWKQRTDMYMRPFXLNVFFSKKF  104

Query  569  VNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAV  390
            ++A+V+H  ++ V + A+T  K LR  +     +  D  A   IGKL+ ER +   + A+
Sbjct  105  IHAKVMHRGTSKVISVATTNAKDLRNSL----PSLTDHNACRVIGKLIAERSKDADVYAI  160

Query  389  SVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
            S   +KD+R  GK+  VID+I+  GI  V
Sbjct  161  SYEPRKDERIEGKLGIVIDTIKENGIMFV  189



>ref|WP_007233550.1| 50S ribosomal protein L18 [marine gamma proteobacterium HTCC2080]
 gb|EAW42376.1| ribosomal protein L18 [marine gamma proteobacterium HTCC2080]
Length=116

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 58/96 (60%), Gaps = 7/96 (7%)
 Frame = -1

Query  596  LRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGER  417
            L +H T +++ AQV+     TV  +AST +K LR G       T +V AA+K+G L+ ER
Sbjct  27   LSVHRTPRHIYAQVIGAEGNTVLASASTLDKDLRAGA------TGNVDAASKVGALIAER  80

Query  416  LRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
             +  G+ AVS F +   +YHG+VKA+ D+ R  G+E
Sbjct  81   AKAAGVTAVS-FDRGGFKYHGRVKALADAAREGGLE  115



>ref|WP_028489211.1| 50S ribosomal protein L18 [Thiothrix lacustris]
Length=117

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 61/96 (64%), Gaps = 5/96 (5%)
 Frame = -1

Query  596  LRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGER  417
            L +H T+ ++ AQVV +  + V  +AST +K L+ G+    + T +VAAA  +GKL+ ER
Sbjct  26   LSIHRTSLHIYAQVVTSDGSQVLASASTLDKDLKAGL----DYTGNVAAAIAVGKLVAER  81

Query  416  LRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
               KGI AV+ F +   +YHG++KA+ DS R  G++
Sbjct  82   ALAKGIDAVA-FDRSGFKYHGRIKALADSAREAGLK  116



>ref|WP_033485196.1| 50S ribosomal protein L18 [Xanthomonas campestris]
 emb|CDN20473.1| ribosomal protein L18 [Xanthomonas campestris pv. viticola]
Length=119

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = -1

Query  503  SLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIR  324
            +L+ G+ +  +N ++  AAAK+GKL+ ER +  GI  V+ F +   RYHG++KA+ D+ R
Sbjct  55   TLQAGVKDGLKNGKNSDAAAKVGKLIAERAKAAGIEKVA-FDRSGYRYHGRIKALADAAR  113

Query  323  GEGIE  309
              G++
Sbjct  114  EGGLQ  118



>ref|XP_001770540.1| predicted protein [Physcomitrella patens]
 gb|EDQ64709.1| predicted protein [Physcomitrella patens]
Length=196

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 65/109 (60%), Gaps = 4/109 (4%)
 Frame = -1

Query  629  ERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAA  450
            +R  K+ KP++L +  ++KYV+A+V+H  +++V + A+T  K LRL +     +  D  A
Sbjct  92   QRTEKYFKPFILDVFISSKYVHAKVMHRVTSSVVSVATTNAKDLRLSL----PSLSDANA  147

Query  449  AAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
               IG+L+ ER   + I AV+   +K+++  GK+  VIDS    G+ LV
Sbjct  148  CRLIGQLIAERSIEQDIYAVAFDLRKNEKLEGKLAIVIDSAIEHGLTLV  196



>ref|XP_011001094.1| PREDICTED: uncharacterized protein LOC105108469 [Populus euphratica]
Length=220

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 75/142 (53%), Gaps = 10/142 (7%)
 Frame = -1

Query  734  PPLRRNTTLTPVLLSLAFAQGSR-PLEMVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQ  558
            P L +N+      +  A+ + SR  LE         +R   ++KP++L + F+ K++ A+
Sbjct  85   PSLNKNS-----FIQAAWTRRSRGELEKKPNKKSWKQRTEMYMKPFLLNVFFSRKFIQAK  139

Query  557  vvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFF  378
            V+H  ++ V + A+T  K LR  +     +  D  A   +GKL+ ER +   + A+S   
Sbjct  140  VMHRGTSKVISVATTNAKDLRHSL----PSLTDHNACRIVGKLIAERSKDADVYAMSYET  195

Query  377  KKDQRYHGKVKAVIDSIRGEGI  312
            +KD+R  GK+  VID+I+  GI
Sbjct  196  RKDERIEGKLGIVIDTIKENGI  217



>ref|XP_008441144.1| PREDICTED: uncharacterized protein LOC103485371 [Cucumis melo]
Length=190

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 64/109 (59%), Gaps = 4/109 (4%)
 Frame = -1

Query  629  ERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAA  450
            +R   +++P++L + F+ K+++A+V+H  ++ V + A+T  K LR  +     +  D  A
Sbjct  85   QRTDMYMRPFLLNVFFSKKFIHAKVMHRGTSKVISVATTNAKDLRNSL----PSLTDHNA  140

Query  449  AAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
               IGKL+ ER +   + A+S   +KD++  GK+  VID+I+  GI  V
Sbjct  141  CRVIGKLIAERSKEADVYAISYEPRKDEKIEGKLGIVIDTIKENGIMFV  189



>ref|WP_025566235.1| MULTISPECIES: 50S ribosomal protein L18 [Bacteria]
Length=116

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 59/96 (61%), Gaps = 7/96 (7%)
 Frame = -1

Query  596  LRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGER  417
            L ++ +N+++ AQV+    + V   AST EKSLR G      +T +  AAA +GKL+ ER
Sbjct  27   LSVNRSNQHIYAQVLSEDGSQVLAQASTTEKSLREG------STGNCDAAATVGKLIAER  80

Query  416  LRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
             +  GI +V+ F +   +YHG+++A+ D+ R  G+E
Sbjct  81   AKQAGITSVA-FDRSGFQYHGRIRALADAARKAGLE  115



>ref|WP_003178358.1| MULTISPECIES: 50S ribosomal protein L18 [Bacillus]
 ref|YP_077416.2| 50S ribosomal protein L18 [Bacillus licheniformis DSM 13 = ATCC 
14580]
 ref|YP_006711601.1| 50S ribosomal protein L18 [Bacillus licheniformis DSM 13 = ATCC 
14580]
 sp|Q65P91.1|RL18_BACLD RecName: Full=50S ribosomal protein L18 [Bacillus licheniformis 
DSM 13 = ATCC 14580]
 gb|AAU39123.1| 50S ribosomal protein L18 [Bacillus licheniformis DSM 13 = ATCC 
14580]
 gb|AAU21778.2| ribosomal protein L18 [Bacillus licheniformis DSM 13 = ATCC 14580]
 gb|EFV69619.1| 50S ribosomal protein L18 [Bacillus sp. BT1B_CT2]
 gb|EID49339.1| 50S ribosomal protein L18 [Bacillus licheniformis WX-02]
 gb|EQM27115.1| 50S ribosomal protein L18 [Bacillus licheniformis CG-B52]
Length=120

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  473  ENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
            EN  D AAAAK+G+L+ +R   KGI  V VF +    YHG+VKA+ D+ R  G+E
Sbjct  66   ENGSDTAAAAKVGELVAKRASEKGITNV-VFDRGGYLYHGRVKALADAAREAGLE  119



>ref|WP_036819782.1| 50S ribosomal protein L18 [Pontibacillus yanchengensis]
 gb|KGP72475.1| 50S ribosomal protein L18 [Pontibacillus yanchengensis Y32]
Length=120

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 64/122 (52%), Gaps = 17/122 (14%)
 Frame = -1

Query  671  SRPLEMVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRL  492
            SR  + V   P RP           L ++ +NK++ AQ++   +    ++AST E  L L
Sbjct  16   SRVRKKVAGTPERPR----------LNVYRSNKHIYAQLIDDVNGVTVSSASTVENDLNL  65

Query  491  GMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGI  312
                  ENT +V AAAKIG+L+ +R +  G   + VF +    YHG+VKA+ D+ R  G+
Sbjct  66   ------ENTGNVEAAAKIGELVAKRAQDNGFKTI-VFDRGGYLYHGRVKALADAAREAGL  118

Query  311  EL  306
            E 
Sbjct  119  EF  120



>ref|WP_007185066.1| 50S ribosomal protein L18 [Hydrocarboniphaga effusa]
 gb|EIT71982.1| 50S ribosomal protein L18 [Hydrocarboniphaga effusa AP103]
Length=118

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 60/102 (59%), Gaps = 5/102 (5%)
 Frame = -1

Query  611  LKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGK  432
            L  + L +H T +++ AQ++   ++    +AST EK +      A E T +V AA KIG+
Sbjct  22   LGAFRLAVHRTPRHIYAQIIAPDASNTVVSASTVEKEV----ASALEGTGNVEAAKKIGQ  77

Query  431  LLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIEL  306
            L+ ER +  GI AV+ F +   +YHG++KA+ D+ R  G+E 
Sbjct  78   LIAERAKAAGITAVA-FDRAGFKYHGRIKALADAAREAGLEF  118



>ref|WP_028983394.1| 50S ribosomal protein L18 [Sporolactobacillus terrae]
Length=120

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = -1

Query  473  ENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIEL  306
            E   DVAAA K+G L+GER   KGI AV VF +    YHG+VKAV +  R  G+E 
Sbjct  66   EKGSDVAAAKKVGALIGERALEKGIKAV-VFDRSGYIYHGRVKAVAEGAREAGLEF  120



>ref|WP_019399172.1| MULTISPECIES: 50S ribosomal protein L18 [Pseudoxanthomonas]
Length=118

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = -1

Query  503  SLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIR  324
            +L+  + E  +N +++ AAAK+GK++ ER +  GI  V+ F +   RYHG++KA+ D+ R
Sbjct  54   TLQADVKEGLKNGKNIEAAAKVGKIIAERAKAAGIEKVA-FDRSGYRYHGRIKALADAAR  112

Query  323  GEGIE  309
              G++
Sbjct  113  EGGLQ  117



>ref|WP_035352307.1| 50S ribosomal protein L18 [Edaphobacter aggregans]
Length=132

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  482  EAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
            EAK+   +VAAA ++GKL+ ER + KGI  V VF +    YHG++KA+ D+ R  G+E
Sbjct  75   EAKKTGGNVAAAVEVGKLIAERAQEKGIKKV-VFDRGGYLYHGRIKALADAAREAGLE  131



>ref|WP_006640331.1| 50S ribosomal protein L18 [Bacillus sonorensis]
 gb|EME72441.1| 50S ribosomal protein L18 [Bacillus sonorensis L12]
Length=120

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = -1

Query  473  ENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIEL  306
            EN+ D +AAAK+G+L+ +R   KGI  V VF +    YHG+VKA+ D+ R  G+E 
Sbjct  66   ENSGDTSAAAKVGELVAKRASEKGITNV-VFDRGGYLYHGRVKALADAAREAGLEF  120



>ref|WP_022764366.1| 50S ribosomal protein L18 [Butyrivibrio sp. XPD2006]
Length=122

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 5/92 (5%)
 Frame = -1

Query  581  TNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKG  402
            +N +V AQV+   + T   +AST EK ++  +    +NT D+ AA KIG ++ +R   KG
Sbjct  36   SNNHVYAQVIDDVNGTTLVSASTTEKDIKAEL----KNTDDIEAATKIGDVVAKRALEKG  91

Query  401  IPAVSVFFKKDQRYHGKVKAVIDSIRGEGIEL  306
            I AV VF +    YHGKVKA+ D+ R  G+E 
Sbjct  92   IKAV-VFDRGGYIYHGKVKALADAAREAGLEF  122



>ref|WP_028918216.1| 50S ribosomal protein L18 [Pseudoxanthomonas sp. J35]
Length=118

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = -1

Query  503  SLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIR  324
            +L+  + E  +N +++ AAAK+GK++ ER +  GI  V+ F +   RYHG++KA+ D+ R
Sbjct  54   TLQADVKEGLKNGKNIDAAAKVGKIIAERAKAAGIEKVA-FDRSGYRYHGRIKALADAAR  112

Query  323  GEGIE  309
              G++
Sbjct  113  EGGLQ  117



>ref|WP_021937674.1| 50S ribosomal protein L18 [Coprococcus sp. CAG:782]
 emb|CCY53719.1| 50S ribosomal protein L18 [Coprococcus sp. CAG:782]
Length=122

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  473  ENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
            E T DVAAAA +GK++ ER   KGI AV +F +    YHGK++A+ D+ R  G+E
Sbjct  68   EKTNDVAAAAYVGKVIAERALEKGIKAV-IFDRGGFVYHGKIQALADAAREAGLE  121



>ref|WP_008248320.1| 50S ribosomal protein L18 [gamma proteobacterium BDW918]
 gb|EIF43987.1| 50S ribosomal protein L18 [gamma proteobacterium BDW918]
Length=116

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 59/101 (58%), Gaps = 7/101 (7%)
 Frame = -1

Query  611  LKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGK  432
            L+   L +H T +++ AQ++      V  +AST +K LR G       T +VAAAA +GK
Sbjct  22   LRAVRLSIHRTPRHMYAQLIAATGDVVLASASTLDKELRAGA------TGNVAAAASVGK  75

Query  431  LLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
            L+ +R +  G+  V+ F +   ++HG+VKA+ D+ R  G+E
Sbjct  76   LIADRAKAAGVTKVA-FDRSGFKFHGRVKALADAAREGGLE  115



>ref|WP_020401292.1| 50S ribosomal protein L18 [Kordiimonas gwangyangensis]
Length=117

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 54/95 (57%), Gaps = 7/95 (7%)
 Frame = -1

Query  596  LRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGER  417
            L +H TN+++ AQ++         AAST EK LR         T ++ AAAK+GKL+ ER
Sbjct  28   LSVHRTNQHIYAQIIDDVKGATLAAASTVEKDLRDAA------TSNIEAAAKVGKLIAER  81

Query  416  LRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGI  312
             +  G+  V VF +    YHG+VKA+ D+ R  G+
Sbjct  82   AKAAGVADV-VFDRGGFLYHGRVKALADAAREGGL  115



>gb|EEB59465.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. tomato T1]
Length=98

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 58/97 (60%), Gaps = 7/97 (7%)
 Frame = -1

Query  596  LRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGER  417
            L +H +++++ AQV+    + V  +AST +K LR G       T ++ AA K+GKL+ ER
Sbjct  9    LCVHRSSQHIYAQVISADGSKVLASASTLDKELRDGA------TGNIDAATKVGKLVAER  62

Query  416  LRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIEL  306
             +  G+  V+ F +   +YHG+VKA+ D+ R  G+E 
Sbjct  63   AKAAGVSQVA-FDRSGFKYHGRVKALADAAREGGLEF  98



>ref|WP_022772942.1| 50S ribosomal protein L18 [Butyrivibrio sp. AE2015]
Length=122

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 55/92 (60%), Gaps = 5/92 (5%)
 Frame = -1

Query  581  TNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKG  402
            +N +V AQV+   +     +AST EK ++  +    +NT D+ AA+K+G ++ +R   KG
Sbjct  36   SNNHVYAQVIDDVAGKTIVSASTLEKDIKAEL----KNTDDIDAASKVGSVVAQRAMEKG  91

Query  401  IPAVSVFFKKDQRYHGKVKAVIDSIRGEGIEL  306
            I AV VF +    YHGKVKA+ D+ R  G+E 
Sbjct  92   IKAV-VFDRGGYIYHGKVKALADAAREAGLEF  122



>ref|XP_010061977.1| PREDICTED: uncharacterized protein LOC104449498 [Eucalyptus grandis]
 gb|KCW69024.1| hypothetical protein EUGRSUZ_F02580 [Eucalyptus grandis]
Length=188

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 63/106 (59%), Gaps = 4/106 (4%)
 Frame = -1

Query  629  ERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAA  450
            +R   +L+P++L + F+ ++V+A+V+H  ++ V   A+T  + LR  +     +  DV A
Sbjct  84   QRTDMYLRPFLLNVFFSKRFVHAKVMHRGTSKVVAVATTNARDLRNNL----PSLTDVNA  139

Query  449  AAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGI  312
               IG+L+ ER +   + A++   +KD+R  GK+  V+D+I+  GI
Sbjct  140  CRVIGQLIAERAKDADVYAIAYEPRKDERIEGKLGIVLDTIKENGI  185



>ref|WP_010024566.1| 50S ribosomal protein L18 [Sporolactobacillus inulinus]
Length=120

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  473  ENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
            E   DVAAA K+G L+GER   KGI A+ VF +    YHG+VKAV +  R  G+E
Sbjct  66   EKGSDVAAAKKVGALIGERALEKGIKAI-VFDRSGYIYHGRVKAVAEGAREAGLE  119



>ref|WP_028466793.1| 50S ribosomal protein L18 [Nisaea denitrificans]
Length=120

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = -1

Query  461  DVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
            D +AAA+IGKL+GER   KG+  V VF +   RYHG+VKA+ D+ R  G++
Sbjct  70   DKSAAAEIGKLIGERAVSKGVTDV-VFDRGGYRYHGRVKALADAAREAGLK  119



>ref|WP_011143899.1| 50S ribosomal protein L18 [Gloeobacter violaceus]
 ref|NP_926857.1| 50S ribosomal protein L18 [Gloeobacter violaceus PCC 7421]
 sp|Q7NEG8.1|RL18_GLOVI RecName: Full=50S ribosomal protein L18 [Gloeobacter violaceus 
PCC 7421]
 dbj|BAC91852.1| 50S ribosomal protein L18 [Gloeobacter violaceus PCC 7421]
Length=120

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 56/96 (58%), Gaps = 5/96 (5%)
 Frame = -1

Query  596  LRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGER  417
            L ++ +N+++ AQV+         AAST E  LR G    +E T    AA  +G+L+ ER
Sbjct  29   LAVYRSNRHIYAQVIDDVHQRTLVAASTLEAPLRSG----EEGTATCEAATAVGRLVAER  84

Query  416  LRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
             + KGI AV VF +  + YHG+VKAV D+ R  G++
Sbjct  85   AKEKGITAV-VFDRGGKLYHGRVKAVADAAREAGLD  119



>ref|XP_006376245.1| hypothetical protein POPTR_0013s11310g [Populus trichocarpa]
 gb|ERP54042.1| hypothetical protein POPTR_0013s11310g [Populus trichocarpa]
Length=188

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 62/106 (58%), Gaps = 4/106 (4%)
 Frame = -1

Query  629  ERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAA  450
            +R   ++KP++L + F+ K++ A+V+H  ++ V + A+T  K LR  +     +  D  A
Sbjct  84   QRTEMYMKPFLLNVFFSRKFIQAKVMHRGTSKVISVATTNAKDLRHSL----PSLTDHNA  139

Query  449  AAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGI  312
               +GKL+ ER +   + A+S   +KD+R  GK+  VID+I+  GI
Sbjct  140  CRIVGKLIAERSKEADVYAMSYEPRKDERIEGKLGIVIDTIKENGI  185



>gb|EWH23390.1| 50S ribosomal protein L18 [Bacillus licheniformis S 16]
Length=120

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  473  ENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
            EN  D +AAAK+G+L+ +R   KGI  V VF +    YHG+VKA+ D+ R  G+E
Sbjct  66   ENGSDTSAAAKVGELVAKRASEKGITNV-VFDRGGYLYHGRVKALADAAREAGLE  119



>ref|WP_024870233.1| 50S ribosomal protein L18 [Pseudoxanthomonas suwonensis]
Length=118

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = -1

Query  503  SLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIR  324
            +L+  + +  +N ++V AAAK+GK++ ER +  GI  V+ F +   RYHG++KA+ D+ R
Sbjct  54   TLQADVKDGLKNGKNVDAAAKVGKIIAERAKAAGIEKVA-FDRSGYRYHGRIKALADAAR  112

Query  323  GEGIE  309
              G++
Sbjct  113  EGGLQ  117



>ref|XP_005717753.1| unnamed protein product [Chondrus crispus]
 emb|CDF37882.1| unnamed protein product [Chondrus crispus]
Length=238

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 56/103 (54%), Gaps = 7/103 (7%)
 Frame = -1

Query  602  YVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLR---LGMIEAKEN--TRDVAAAAKI  438
            + L ++ TN++++AQ+V      V     + + +LR    G    + N  T  VAAA  +
Sbjct  121  FELLLNLTNRHIHAQLVDRAGGRVILGVHSNQPNLRKAIAGPDAPRGNFATASVAAARMV  180

Query  437  GKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
            G+  G     KGI AV  ++ +  +YHGK+KA ID++R  GIE
Sbjct  181  GEAFGTHASSKGISAV--YWTRPGKYHGKIKAFIDAVRDHGIE  221



>ref|WP_020449866.1| MULTISPECIES: 50S ribosomal protein L18 [Bacillus]
 ref|YP_008076315.1| ribosomal protein L18 [Bacillus licheniformis 9945A]
 gb|AGN34578.1| ribosomal protein L18 [Bacillus licheniformis 9945A]
 gb|ETB72006.1| 50S ribosomal protein L18 [Bacillus sp. CPSM8]
 gb|KFM94043.1| ribosomal protein L18 [Bacillus licheniformis]
Length=120

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -1

Query  473  ENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIEL  306
            EN  D +AAAK+G+L+ +R   KGI  V VF +    YHG+VKA+ D+ R  G+E 
Sbjct  66   ENGSDTSAAAKVGELVAKRASEKGITNV-VFDRGGYLYHGRVKALADAAREAGLEF  120



>ref|WP_034443860.1| 50S ribosomal protein L18 [Butyrivibrio sp. AE2032]
Length=122

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 5/92 (5%)
 Frame = -1

Query  581  TNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKG  402
            +N +V AQV+   +     +AST EK ++  +    +NT D+ AA+KIG ++ +R   KG
Sbjct  36   SNNHVYAQVIDDVNGKTLVSASTLEKDIKAEL----KNTDDIEAASKIGDVVAKRALEKG  91

Query  401  IPAVSVFFKKDQRYHGKVKAVIDSIRGEGIEL  306
            I AV VF +    YHGKVKA+ D+ R  G+E 
Sbjct  92   IKAV-VFDRGGYIYHGKVKALADAAREAGLEF  122



>ref|WP_008193248.1| 50S ribosomal protein L18 [Labrenzia alexandrii]
 gb|EEE45357.1| ribosomal protein L18 [Labrenzia alexandrii DFL-11]
Length=120

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 5/68 (7%)
 Frame = -1

Query  509  EKSLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDS  330
            EK L+ G+    +   DV+AAA +GKL+ ER    G+  V VF +   +YHG+VKA+ D+
Sbjct  58   EKDLKGGL----KTGADVSAAAAVGKLVAERAAAAGVKEV-VFDRGGYQYHGRVKALADA  112

Query  329  IRGEGIEL  306
             R  G+E 
Sbjct  113  AREGGLEF  120



>ref|WP_038690277.1| 50S ribosomal protein L18 [Stenotrophomonas rhizophila]
Length=119

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -1

Query  482  EAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
            E  +N ++  AAAK+GKL+ ER +  GI  V+ F +   RYHG++KA+ D+ R  G++
Sbjct  62   EGLKNGKNSDAAAKVGKLVAERAKAAGIEKVA-FDRSGYRYHGRIKALADAAREGGLQ  118



>ref|WP_011686807.1| 50S ribosomal protein L18 [Candidatus Solibacter usitatus]
 ref|YP_826342.1| 50S ribosomal protein L18 [Candidatus Solibacter usitatus Ellin6076]
 sp|Q01WA8.1|RL18_SOLUE RecName: Full=50S ribosomal protein L18 [Candidatus Solibacter 
usitatus Ellin6076]
 gb|ABJ86057.1| LSU ribosomal protein L18P [Candidatus Solibacter usitatus Ellin6076]
Length=119

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -1

Query  482  EAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
            + K    +VAAA  IGKL+ ER + KGI +V VF +   +YHG+VKA+ D+ R  G+E
Sbjct  62   DGKSKGGNVAAAKAIGKLVAERAKEKGIKSV-VFDRGGYQYHGRVKALADAAREAGLE  118



>ref|WP_007230698.1| 50S ribosomal protein L18 [marine gamma proteobacterium HTCC2148]
 gb|EEB76990.1| ribosomal protein L18 [marine gamma proteobacterium HTCC2148]
Length=98

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (57%), Gaps = 7/97 (7%)
 Frame = -1

Query  596  LRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGER  417
            L +H T +++ AQV+      V  +AST +  LR      K  T ++ AAA +GK++ ER
Sbjct  9    LSVHRTPRHIYAQVIAPEGDKVLASASTLDTDLR------KSATGNIDAAAAVGKMVAER  62

Query  416  LRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIEL  306
             +  GI  V+ F +   +YHG+VKA+ D+ R  G+E 
Sbjct  63   AKAAGIEKVA-FDRGGYKYHGRVKALADAARESGLEF  98



>ref|WP_019186158.1| 50S ribosomal protein L18 [Stenotrophomonas maltophilia]
 gb|AHY60145.1| 50S ribosomal protein L18 [Stenotrophomonas rhizophila]
Length=117

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -1

Query  482  EAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
            E  +N ++  AAAK+GKL+ ER +  GI  V+ F +   RYHG++KA+ D+ R  G++
Sbjct  60   EGLKNGKNSDAAAKVGKLVAERAKAAGIEKVA-FDRSGYRYHGRIKALADAAREGGLQ  116



>ref|WP_022769976.1| MULTISPECIES: 50S ribosomal protein L18 [Butyrivibrio]
Length=122

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 5/92 (5%)
 Frame = -1

Query  581  TNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKG  402
            +N +V AQV+   + T   +AST EK ++  +    +NT D+ AA KIG ++ +R   KG
Sbjct  36   SNNHVYAQVIDDVNGTTLVSASTLEKDIKAEL----KNTDDIEAATKIGDVVAKRALEKG  91

Query  401  IPAVSVFFKKDQRYHGKVKAVIDSIRGEGIEL  306
            I AV VF +    YHGKVKA+ D+ R  G+E 
Sbjct  92   IKAV-VFDRGGYIYHGKVKALADAAREAGLEF  122



>gb|AJC45742.1| 50S ribosomal protein L18 [Xanthomonas sacchari]
Length=119

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = -1

Query  503  SLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIR  324
            +L+  + E  +N ++  AAAK+GKL+ ER +  G+  V+ F +   RYHG++KA+ D+ R
Sbjct  55   TLQADVKEGLKNGKNSDAAAKVGKLIAERAKAAGVEKVA-FDRSGYRYHGRIKALADAAR  113

Query  323  GEGIE  309
              G++
Sbjct  114  EGGLQ  118



>ref|WP_027849007.1| MULTISPECIES: 50S ribosomal protein L18 [Marinospirillum]
Length=116

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 41/67 (61%), Gaps = 7/67 (10%)
 Frame = -1

Query  509  EKSLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDS  330
            + SLR G       T ++ AA K+GKL+ ER +  GI AV+ F +   +YHG+VKA+ D+
Sbjct  56   DGSLRTGT------TGNIEAATKVGKLIAERAKAAGINAVA-FDRGGFKYHGRVKALADA  108

Query  329  IRGEGIE  309
             R  G+E
Sbjct  109  AREGGLE  115



>ref|WP_027950926.1| 50S ribosomal protein L18 [Haliea salexigens]
Length=116

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = -1

Query  596  LRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGER  417
            L +H T +++ AQV+      V  +AST + SLR G    +E      AAA +GKL+ ER
Sbjct  27   LSVHRTPRHIYAQVLAPAGDRVLASASTLDSSLRAGSTGNQE------AAAAVGKLVAER  80

Query  416  LRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
             +  GI  V+ F +   +YHG+VKA+ D+ R  G+E
Sbjct  81   AKAAGIEKVA-FDRAGYKYHGRVKALADAARESGLE  115



>ref|WP_026586058.1| 50S ribosomal protein L18 [Bacillus sp. NSP9.1]
Length=120

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -1

Query  473  ENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIEL  306
            EN  D +AAAK+G+L+ +R   KGI  V VF +    YHG+VKA+ D+ R  G+E 
Sbjct  66   ENGGDTSAAAKVGELVAKRASEKGITNV-VFDRGGYLYHGRVKALADAAREAGLEF  120



>ref|XP_003612290.1| Structural constituent of ribosome [Medicago truncatula]
 gb|AES95248.1| hypothetical protein MTR_5g023360 [Medicago truncatula]
Length=93

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  662  LEMVIPPPVRPERVTKFLKPYVLRMHFTNKYVNAQ  558
            + +VIPP VR  ++TKFLKPYV +M+FTNK+V+ Q
Sbjct  44   IWLVIPPSVRAPKITKFLKPYVPKMYFTNKHVSVQ  78



>ref|XP_011003994.1| PREDICTED: uncharacterized protein LOC105110603 [Populus euphratica]
Length=191

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 63/109 (58%), Gaps = 4/109 (4%)
 Frame = -1

Query  629  ERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAA  450
            +R   +++P++L + F+ +++ A+V+H  ++ V + A+T  K LR  +     +  D  A
Sbjct  87   QRTDMYMRPFLLNVFFSRRFIQAKVMHRGTSKVISVATTNAKDLRHSL----PSLTDHNA  142

Query  449  AAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
               +GKL+ ER +   + A+S   +KD+R  GK+  VID+I+  GI  V
Sbjct  143  CRIVGKLIAERSKDADVYAMSYETRKDERIEGKLGIVIDTIKENGIIFV  191



>ref|WP_017355421.1| 50S ribosomal protein L18 [Stenotrophomonas maltophilia]
Length=117

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -1

Query  482  EAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
            E  +N ++  AAAK+GKL+ ER +  GI  V+ F +   RYHG++KA+ D+ R  G++
Sbjct  60   EGLKNGKNSDAAAKVGKLVAERAKAAGIEKVA-FDRSGYRYHGRIKALADAAREGGLQ  116



>ref|WP_008707271.1| MULTISPECIES: 50S ribosomal protein L18 [Clostridiales]
 gb|EES75972.1| 50S ribosomal protein L18 [Ruminococcus sp. 5_1_39BFAA]
 emb|CDD80007.1| 50S ribosomal protein L18 [Ruminococcus sp. CAG:9]
Length=122

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 55/91 (60%), Gaps = 5/91 (5%)
 Frame = -1

Query  581  TNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKG  402
            +NK++ AQ++         +AST +K +R  +    ENT DVAAAA +G ++G++    G
Sbjct  36   SNKHIYAQIIDDTVGKTLVSASTLQKEVRAEL----ENTDDVAAAAHLGTVIGKKAVEAG  91

Query  401  IPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
            I +V VF +    YHGKVKA+ D+ R  G++
Sbjct  92   IESV-VFDRGGYIYHGKVKALADAAREAGLK  121



>ref|WP_002555473.1| MULTISPECIES: 50S ribosomal protein L18 [Pseudomonas syringae 
group]
 ref|NP_790489.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. tomato str. 
DC3000]
 ref|YP_237600.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. syringae 
B728a]
 ref|YP_276690.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. phaseolicola 
1448A]
 sp|Q889V5.1|RL18_PSESM RecName: Full=50S ribosomal protein L18 [Pseudomonas syringae 
pv. tomato str. DC3000]
 sp|Q4ZMR0.1|RL18_PSEU2 RecName: Full=50S ribosomal protein L18 [Pseudomonas syringae 
pv. syringae B728a]
 sp|Q48D52.1|RL18_PSE14 RecName: Full=50S ribosomal protein L18 [Pseudomonas syringae 
pv. phaseolicola 1448A]
 gb|AAO54184.1| ribosomal protein L18 [Pseudomonas syringae pv. tomato str. DC3000]
 gb|AAY39562.1| LSU ribosomal protein L18P [Pseudomonas syringae pv. syringae 
B728a]
 gb|AAZ35442.1| ribosomal protein L18 [Pseudomonas syringae pv. phaseolicola 
1448A]
 gb|EFH97490.1| LSU ribosomal protein L18p (L5e) [Pseudomonas savastanoi pv. 
savastanoi NCPPB 3335]
 gb|EFW78400.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. glycinea 
str. B076]
 gb|EFW87900.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. glycinea 
str. race 4]
 gb|EGH04124.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. aesculi str. 
0893_23]
 gb|EGH13534.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. glycinea 
str. race 4]
 gb|EGH13575.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. morsprunorum 
str. M302280]
 gb|EGH24578.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. mori str. 
301020]
 gb|EGH31139.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. japonica 
str. M301072]
 gb|EGH43856.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. pisi str. 
1704B]
 gb|EGH53441.1| 50S ribosomal protein L18 [Pseudomonas syringae Cit 7]
 gb|EGH62769.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. maculicola 
str. ES4326]
 gb|EGH67155.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
str. M302091]
 gb|EGH69871.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. aceris str. 
M302273]
 gb|EGH76699.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. aptata str. 
DSM 50252]
 gb|EGH92485.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. tabaci str. 
ATCC 11528]
 gb|EGH98232.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. lachrymans 
str. M302278]
 gb|EGI00355.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. oryzae str. 
1_6]
 gb|EKG33824.1| 50S ribosomal protein L18 [Pseudomonas avellanae BPIC 631]
 gb|EKG34858.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. avellanae 
str. ISPaVe013]
 gb|EKG35387.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. avellanae 
str. ISPaVe037]
 gb|EKN45885.1| 50S ribosomal protein L18 [Pseudomonas viridiflava UASWS0038]
 gb|ELP96688.1| 50S ribosomal protein L18 [Pseudomonas syringae BRIP34876]
 gb|ELQ02085.1| 50S ribosomal protein L18 [Pseudomonas syringae BRIP34881]
 gb|ELQ13689.1| 50S ribosomal protein L18 [Pseudomonas syringae BRIP39023]
 gb|ELS41061.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. syringae 
B64]
 gb|EPF68612.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. syringae 
SM]
 gb|EPM46222.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 19103]
 gb|EPM47322.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 19073]
 gb|EPM51835.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 19098]
 gb|EPM63795.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 19071]
 gb|EPM66275.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. theae ICMP 
3923]
 gb|EPM80540.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 19072]
 gb|EPM83320.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 19068]
 gb|EPM90784.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 18886]
 gb|EPM93525.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 19104]
 gb|EPN00544.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 19102]
 gb|EPN08062.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 9855]
 gb|EPN20885.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 18804]
 gb|EPN21827.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 19100]
 gb|EPN26769.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 19070]
 gb|EPN29161.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 19099]
 gb|EPN36290.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 19096]
 gb|EPN37382.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 18883]
 gb|EPN46034.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 19095]
 gb|EPN48193.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 19094]
 gb|EPN56268.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 19079]
 gb|EPN63060.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 18807]
 gb|EPN71889.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 19097]
 gb|EPN84181.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 18801]
 gb|EPN86188.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 19101]
 gb|AHF69712.1| 50S ribosomal protein L18 [Pseudomonas cichorii JBC1]
 gb|AHG39288.1| 50S ribosomal protein L18 [Pseudomonas syringae CC1557]
 gb|EXL32800.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. syringae 
str. B301D-R]
 gb|KAK41686.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 18884]
 gb|KCU99721.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. actinidiae 
ICMP 9617]
 gb|KEZ25841.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. tabaci str. 
6605]
 gb|KEZ69248.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. tabaci str. 
ATCC 11528]
 gb|KEZ72682.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. syringae 
FF5]
 gb|KFE43582.1| 50S ribosomal protein L18 [Pseudomonas syringae]
 gb|KFF82032.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. syringae]
 dbj|BAP41876.1| 50S ribosomal protein L18 [Pseudomonas sp. StFLB209]
 gb|KGK94485.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. tomato]
 gb|KGS16340.1| 50S ribosomal protein L18 [Pseudomonas coronafaciens]
Length=116

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 58/96 (60%), Gaps = 7/96 (7%)
 Frame = -1

Query  596  LRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGER  417
            L +H +++++ AQV+    + V  +AST +K LR G       T ++ AA K+GKL+ ER
Sbjct  27   LCVHRSSQHIYAQVISADGSKVLASASTLDKELRDGA------TGNIDAATKVGKLVAER  80

Query  416  LRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
             +  G+  V+ F +   +YHG+VKA+ D+ R  G+E
Sbjct  81   AKAAGVSQVA-FDRSGFKYHGRVKALADAAREGGLE  115



>ref|WP_022439394.1| 50S ribosomal protein L18 [Clostridium sp. CAG:411]
 emb|CDE42531.1| 50S ribosomal protein L18 [Clostridium sp. CAG:411]
Length=122

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -1

Query  473  ENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIEL  306
            E T DVAAAA +GK++ E+ + KGI  V VF +    Y GKVKA+ D+ R  G+E 
Sbjct  68   EKTNDVAAAAYVGKVIAEKAKAKGINTV-VFDRGGFIYQGKVKALADAAREAGLEF  122



>ref|WP_005745983.1| 50S ribosomal protein L18 [Pseudomonas amygdali]
 gb|EGH86369.1| 50S ribosomal protein L18 [Pseudomonas syringae pv. lachrymans 
str. M301315]
Length=116

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 66/122 (54%), Gaps = 13/122 (11%)
 Frame = -1

Query  656  MVIPPPVRPERVTKF-LKPYVLRM-----HFTNKYVNAQvvhtpsatvataasTQEKSLR  495
            M +    R  R  K  LK + L +     H +++++ AQV+    + V  +AST +K LR
Sbjct  1    MTVKKVTRLRRALKARLKMHELEVVRLCVHRSSQHIYAQVISADGSKVLASASTLDKELR  60

Query  494  LGMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEG  315
             G       T ++ AA K+GKL+ ER +  G+  V+ F +   +YHG+VKA+ D+ R  G
Sbjct  61   DGA------TGNIDAATKVGKLVAERAKAAGVSQVA-FDRSGFKYHGRVKALADAAREGG  113

Query  314  IE  309
            +E
Sbjct  114  LE  115



>ref|WP_009336596.1| MULTISPECIES: 50S ribosomal protein L18 [Bacillus]
 gb|EFV74210.1| 50S ribosomal protein L18 [Bacillus sp. 2_A_57_CT2]
Length=120

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 58/96 (60%), Gaps = 7/96 (7%)
 Frame = -1

Query  596  LRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGER  417
            L ++ +NK++ AQ++   +     +ASTQ+K + L      + T +V AA K+G+L+ +R
Sbjct  31   LNVYRSNKHIYAQLIDDVNGVTVASASTQDKEVNL------DATGNVDAAVKVGELVAKR  84

Query  416  LRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
               KG+ AV VF +    YHG+VKA+ D+ R  G+E
Sbjct  85   AVEKGVKAV-VFDRGGYLYHGRVKALADAARENGLE  119



>ref|WP_014471360.1| 50S ribosomal protein L18 [Bacillus amyloliquefaciens]
 ref|YP_005543915.1| 50S ribosomal protein L18 [Bacillus amyloliquefaciens LL3]
 ref|YP_005548135.1| 50S ribosomal protein L18 [Bacillus amyloliquefaciens XH7]
 ref|YP_006326952.1| 50S ribosomal protein L18 [Bacillus amyloliquefaciens Y2]
 ref|YP_008725428.1| 50S ribosomal protein L18 [Bacillus amyloliquefaciens CC178]
 gb|AEB61687.1| ribosomal protein L18 [Bacillus amyloliquefaciens LL3]
 gb|AEK87287.1| 50S ribosomal protein L18 [Bacillus amyloliquefaciens XH7]
 gb|AFJ60227.1| large subunit ribosomal protein L18 [Bacillus amyloliquefaciens 
Y2]
 gb|AGZ54850.1| 50S ribosomal protein L18 [Bacillus amyloliquefaciens CC178]
Length=56

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = -1

Query  473  ENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIEL  306
            E+T D AAAAK+G+L+ +R   KG+  V VF +    YHG+VKA+ D+ R  G++ 
Sbjct  2    ESTGDSAAAAKVGELVAKRASEKGVSDV-VFDRGGYLYHGRVKALADAAREAGLKF  56



>dbj|BAN68185.1| large subunit ribosomal protein L18 [endosymbiont of unidentified 
scaly snail isolate Monju]
Length=118

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  611  LKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGK  432
            L  + L +H T +++ AQV+    A V  AAST +K ++ G+   + +T +VA AA +G+
Sbjct  21   LGVHRLTVHRTPRHIYAQVIAPNGAEVIAAASTVDKEVKAGI---EGSTGNVAGAAVVGR  77

Query  431  LLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIEL  306
             + ER + KGI  V+ F +   RYHG+VKA+ D+ R  G+E 
Sbjct  78   AIAERAKAKGIERVA-FDRSGFRYHGRVKALADAAREAGLEF  118



>ref|WP_029208589.1| 50S ribosomal protein L18 [gamma proteobacterium HIMB30]
Length=116

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 60/102 (59%), Gaps = 7/102 (7%)
 Frame = -1

Query  611  LKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGK  432
            L    L +H T +++ AQ++    + V   AST +K LR      +++  +V AAA++GK
Sbjct  22   LNANRLCVHRTPRHIYAQIISGDGSNVICTASTLDKDLR------EKSGGNVEAAAEVGK  75

Query  431  LLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIEL  306
             + ER + KGI AV+ F +   RYHG+VKA+ D+ R  G+E 
Sbjct  76   RIAERAKEKGIQAVA-FDRSGFRYHGRVKALADAAREGGLEF  116



>gb|AAW76821.1| 50S ribosomal protein L18 [Xanthomonas oryzae pv. oryzae KACC 
10331]
Length=90

 Score = 47.8 bits (112),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 23/66 (35%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = -1

Query  503  SLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIR  324
            +L+  + +  +N ++  AA K+GKL+ ER +  GI  V+ F +   RYHG++KA+ D+ R
Sbjct  26   TLQADVKDGLKNGKNSDAAVKVGKLIAERAKAAGIEKVA-FDRSGYRYHGRIKALADAAR  84

Query  323  GEGIEL  306
              G++ 
Sbjct  85   EGGLQF  90



>ref|XP_002325540.2| hypothetical protein POPTR_0019s11030g [Populus trichocarpa]
 gb|EEE99921.2| hypothetical protein POPTR_0019s11030g [Populus trichocarpa]
Length=205

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 63/109 (58%), Gaps = 4/109 (4%)
 Frame = -1

Query  629  ERVTKFLKPYVLRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAA  450
            +R   +++P++L + F+ +++ A+V+H  ++ V + A+T  K LR  +     +  D  A
Sbjct  101  QRTDMYMRPFLLNVFFSRRFIQAKVMHRGTSKVVSVATTNAKDLRHSL----PSLTDHNA  156

Query  449  AAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIELV  303
               +GKL+ ER +   + A+S   +KD+R  GK+  VID+I+  GI  V
Sbjct  157  CRIVGKLIAERSKEADVYAMSYEPRKDERIEGKLGIVIDTIKENGIIFV  205



>ref|WP_019951443.1| 50S ribosomal protein L18 [Kushneria aurantia]
Length=116

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -1

Query  476  KENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
            +E T +  AAA++G LL ER R  GI  V+ F +   RYHG+VKA+ D+ R  G++
Sbjct  61   EEATGNADAAARVGSLLAERAREAGITEVA-FDRSGYRYHGRVKALADAAREGGLQ  115



>ref|WP_024865227.1| 50S ribosomal protein L18 [Butyrivibrio sp. FCS014]
Length=122

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 54/92 (59%), Gaps = 5/92 (5%)
 Frame = -1

Query  581  TNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKG  402
            +N +V AQV+   +     +AST EK ++  +    +NT D+ AA K+G ++ +R   KG
Sbjct  36   SNNHVYAQVIDDVAGKTLVSASTLEKDIKAEL----KNTDDIEAATKVGDVVAKRALEKG  91

Query  401  IPAVSVFFKKDQRYHGKVKAVIDSIRGEGIEL  306
            I AV VF +    YHGKVKA+ D+ R  G+E 
Sbjct  92   IKAV-VFDRGGYIYHGKVKALADAAREAGLEF  122



>ref|WP_032112421.1| 50S ribosomal protein L18 [Candidatus Paracaedibacter symbiosus]
Length=120

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 54/95 (57%), Gaps = 5/95 (5%)
 Frame = -1

Query  596  LRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGER  417
            L +H TN ++ AQ++    A     AST EK LR+ +    +N  ++ AA KIG L+ ER
Sbjct  29   LTVHRTNTHIYAQIIDGEKAVTIACASTVEKELRVNL----KNGGNIEAAKKIGNLIAER  84

Query  416  LRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGI  312
                G+ +V VF +    YHG+VKA+ D+ R  G+
Sbjct  85   ALKAGVKSV-VFDRSGYIYHGRVKALADAARESGL  118



>ref|WP_005917142.1| MULTISPECIES: 50S ribosomal protein L18 [Xanthomonas]
 gb|EKQ60446.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. malvacearum 
str. GSPB1386]
Length=119

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  473  ENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
            +N ++  AAAK+GKL+ ER +  GI  V+ F +   RYHG++KA+ D+ R  G++
Sbjct  65   KNGKNSDAAAKVGKLIAERAKAAGIEKVA-FDRSGYRYHGRIKALADAAREGGLQ  118



>ref|WP_034877918.1| 50S ribosomal protein L18 [Endozoicomonas montiporae]
Length=116

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = -1

Query  596  LRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGER  417
            L +H +++++ AQV+      V  AAST EK LR       E T +V AA K+G L+ ER
Sbjct  27   LSVHRSSQHIYAQVIAPEGDKVLAAASTVEKELRA------EATGNVDAAKKVGALIAER  80

Query  416  LRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
             +  G+  V+ F +   +YHG+VKA+ D+ R  G+E
Sbjct  81   AKAAGVSKVA-FDRSGYKYHGRVKALADAAREAGLE  115



>ref|WP_026515603.1| MULTISPECIES: 50S ribosomal protein L18 [Butyrivibrio]
Length=122

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 54/92 (59%), Gaps = 5/92 (5%)
 Frame = -1

Query  581  TNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKG  402
            +N +V AQV+   +     +AST EK ++  +    +NT D+ AA K+G ++ +R   KG
Sbjct  36   SNSHVYAQVIDDVAGKTIVSASTLEKDIKAEL----KNTDDIEAATKVGDIVAKRALEKG  91

Query  401  IPAVSVFFKKDQRYHGKVKAVIDSIRGEGIEL  306
            I AV VF +    YHGKVKA+ D+ R  G+E 
Sbjct  92   IKAV-VFDRGGYIYHGKVKALADAAREAGLEF  122



>ref|WP_003486684.1| MULTISPECIES: 50S ribosomal protein L18 [Xanthomonas]
 ref|NP_641335.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. citri str. 
306]
 ref|YP_362746.1| 50S ribosomal protein L18 [Xanthomonas campestris pv. vesicatoria 
str. 85-10]
 ref|YP_004850565.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. citrumelo 
F1]
 ref|YP_007635480.1| 50S ribosomal protein L18 [Xanthomonas axonopodis Xac29-1]
 ref|YP_007651562.1| Ribosomal protein L18 [Xanthomonas citri subsp. citri Aw12879]
 ref|YP_008637819.1| probable 50S ribosomal protein L18 [Xanthomonas fuscans subsp. 
fuscans]
 sp|Q8PNR1.1|RL18_XANAC RecName: Full=50S ribosomal protein L18 [Xanthomonas axonopodis 
pv. citri str. 306]
 sp|Q3BWW7.1|RL18_XANC5 RecName: Full=50S ribosomal protein L18 [Xanthomonas campestris 
pv. vesicatoria str. 85-10]
 gb|AAM35871.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. citri str. 
306]
 emb|CAJ22646.1| 50S ribosomal protein L18 [Xanthomonas campestris pv. vesicatoria 
str. 85-10]
 gb|EFF41927.1| 50S ribosomal protein L18 [Xanthomonas fuscans subsp. aurantifolii 
str. ICPB 11122]
 gb|EFF49328.1| 50S ribosomal protein L18 [Xanthomonas fuscans subsp. aurantifolii 
str. ICPB 10535]
 gb|EGD15630.1| LSU ribosomal protein L18P [Xanthomonas perforans 91-118]
 gb|AEO41267.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. citrumelo 
F1]
 emb|CCF69996.1| ribosomal protein L18 [Xanthomonas axonopodis pv. punicae str. 
LMG 859]
 emb|CCG37406.1| ribosomal protein L18 [Xanthomonas citri pv. mangiferaeindicae 
LMG 941]
 gb|EKQ59965.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. malvacearum 
str. GSPB2388]
 gb|AGH76521.1| 50S ribosomal protein L18 [Xanthomonas axonopodis Xac29-1]
 gb|AGI09364.1| Ribosomal protein L18 [Xanthomonas citri subsp. citri Aw12879]
 emb|CDF60614.1| probable 50S ribosomal protein L18 [Xanthomonas fuscans subsp. 
fuscans]
 gb|EWC51382.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. glycines 
str. 8ra]
 gb|KGE51069.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. vasculorum]
 gb|KGK67145.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 gb|KGP25912.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 gb|KGP31488.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 gb|KGP31642.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 gb|KGP36701.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 emb|CEH54233.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 emb|CEH65167.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 emb|CEH41897.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 emb|CEH90372.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 emb|CEI37250.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 emb|CEH57750.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 emb|CEH37477.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 emb|CEH55280.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 emb|CEH43733.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 emb|CEH37145.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 emb|CEH89167.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 gb|KGT51420.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 gb|KGT51765.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 gb|KGU42480.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 gb|KGU46419.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 gb|KGU48300.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 gb|KGU51172.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 gb|KGU56878.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 emb|CEI15081.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 emb|CEI20097.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 emb|CEI06506.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 emb|CEI06507.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 emb|CEI03815.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 emb|CEH88513.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 emb|CEH99145.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 emb|CEJ26918.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 emb|CEJ22328.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 gb|KHD65914.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 gb|KHD66829.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 gb|KHD70604.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 gb|KHF48382.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 gb|KHF74949.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 gb|KHL63653.1| 50S ribosomal protein L18 [Xanthomonas euvesicatoria]
 gb|KHL67522.1| 50S ribosomal protein L18 [Xanthomonas euvesicatoria]
 gb|KHS05712.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS22650.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS24814.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS31001.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS38922.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS40786.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 gb|AJD67576.1| LSU ribosomal protein L18P [Xanthomonas citri subsp. citri A306]
 gb|KIF08017.1| 50S ribosomal protein L18 [Xanthomonas axonopodis pv. phaseoli]
 emb|CEL43499.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 emb|CEL41317.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 emb|CEL50481.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
 emb|CEL36404.1| 50S ribosomal protein L18 [Xanthomonas citri pv. citri]
Length=119

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  473  ENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
            +N ++  AAAK+GKL+ ER +  GI  V+ F +   RYHG++KA+ D+ R  G++
Sbjct  65   KNGKNSDAAAKVGKLIAERAKAAGIEKVA-FDRSGYRYHGRIKALADAAREGGLQ  118



>ref|WP_028293128.1| 50S ribosomal protein L18 [Oceanobacter kriegii]
Length=116

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  473  ENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
            + T +V+AA K+G+L+ ER +  GI  V+ F +   +YHG+VKA+ D+ R  G+E
Sbjct  62   DTTGNVSAATKVGQLIAERAKAAGITKVA-FDRSGFKYHGRVKALADAARENGLE  115



>gb|KEQ12561.1| 50S ribosomal protein L18 [Endozoicomonas montiporae]
Length=115

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = -1

Query  596  LRMHFTNKYVNAQvvhtpsatvataasTQEKSLRLGMIEAKENTRDVAAAAKIGKLLGER  417
            L +H +++++ AQV+      V  AAST EK LR       E T +V AA K+G L+ ER
Sbjct  26   LSVHRSSQHIYAQVIAPEGDKVLAAASTVEKELRA------EATGNVDAAKKVGALIAER  79

Query  416  LRVKGIPAVSVFFKKDQRYHGKVKAVIDSIRGEGIE  309
             +  G+  V+ F +   +YHG+VKA+ D+ R  G+E
Sbjct  80   AKAAGVSKVA-FDRSGYKYHGRVKALADAAREAGLE  114



>ref|WP_017939152.1| 50S ribosomal protein L18 [Pseudomonas thermotolerans]
Length=116

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 41/67 (61%), Gaps = 7/67 (10%)
 Frame = -1

Query  509  EKSLRLGMIEAKENTRDVAAAAKIGKLLGERLRVKGIPAVSVFFKKDQRYHGKVKAVIDS  330
            +KSLR G       T +V AA K+G+L+ ER +  GI  V+ F +   +YHG+VKA+ D+
Sbjct  56   DKSLRDGA------TSNVEAAKKVGQLVAERAKAAGITKVA-FDRSGFKYHGRVKALADA  108

Query  329  IRGEGIE  309
             R  G+E
Sbjct  109  AREGGLE  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2169515985086