BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25558_g1_i1 len=1361 path=[1638:0-1 1640:2-33 @646@!:34-225
5536:226-446 2075:447-539 671:540-546 678:547-606 60:607-616
70:617-710 6438:711-717 2345:718-792 6800:793-794 2422:795-887
7004:888-894 2522:895-939 481:940-958 500:959-983 2615:984-985
2617:986-1012 95:1013-1065 148:1066-1091 2742:1092-1094
2745:1095-1136 2787:1137-1145 2796:1146-1166 2821:1167-1262
6220:1263-1360]

Length=1361
                                                                      Score     E

ref|XP_009776532.1|  PREDICTED: adhesive plaque matrix protein-like   54.3    2e-04   
ref|XP_009609703.1|  PREDICTED: adhesive plaque matrix protein-li...  52.4    7e-04   
ref|XP_009609704.1|  PREDICTED: adhesive plaque matrix protein-li...  52.4    7e-04   



>ref|XP_009776532.1| PREDICTED: adhesive plaque matrix protein-like [Nicotiana sylvestris]
Length=663

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 53/115 (46%), Gaps = 25/115 (22%)
 Frame = +2

Query  437  STKPSWPSQEDSPSPDNIENGRDKINTGLVLNKFDELNLQDSRGTSPLPNERSGSDV-SK  613
            STKPSW    DSP      N     +   + NKFDEL LQD+RG+SP    + G +  S 
Sbjct  102  STKPSWSEDHDSPK----YNEHHDFSGSPLRNKFDELLLQDNRGSSPFSYRKDGYEKPSF  157

Query  614  TTSMDSGQRPNWPNRKGHVHN-------------SGISPYKTNKDEHEKPKFNGA  739
            T S DS        + GH  +              GISPY    D++ KPKFNG 
Sbjct  158  TQSADS-------PKAGHFKDYGVNNKWDSPPRSRGISPYSNTNDDYGKPKFNGG  205



>ref|XP_009609703.1| PREDICTED: adhesive plaque matrix protein-like isoform X1 [Nicotiana 
tomentosiformis]
Length=632

 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 60/116 (52%), Gaps = 26/116 (22%)
 Frame = +2

Query  437  STKPSWPSQE-DSPSPDNIENGRDKINTGLVLNKFDELNLQDSRGTSPLPNERSGSDV-S  610
            STKPSW S++ DSP      + RD  +   + NKF+ L+LQD+RG+SP    + G +  S
Sbjct  102  STKPSWRSEDHDSP---KYSDHRD-FDGSPLRNKFEGLHLQDNRGSSPYSYRKDGYEKPS  157

Query  611  KTTSMDSGQRPNWPNRKGHVHN-------------SGISPYKTNKDEHEKPKFNGA  739
             T S DS        + GH  +              GISPY   KD+++KPKFNG 
Sbjct  158  FTHSADS-------PKAGHFKDYGVNNKWDSPPRSRGISPYSNTKDDYDKPKFNGG  206



>ref|XP_009609704.1| PREDICTED: adhesive plaque matrix protein-like isoform X2 [Nicotiana 
tomentosiformis]
Length=564

 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 60/116 (52%), Gaps = 26/116 (22%)
 Frame = +2

Query  437  STKPSWPSQE-DSPSPDNIENGRDKINTGLVLNKFDELNLQDSRGTSPLPNERSGSDV-S  610
            STKPSW S++ DSP      + RD  +   + NKF+ L+LQD+RG+SP    + G +  S
Sbjct  102  STKPSWRSEDHDSP---KYSDHRD-FDGSPLRNKFEGLHLQDNRGSSPYSYRKDGYEKPS  157

Query  611  KTTSMDSGQRPNWPNRKGHVHN-------------SGISPYKTNKDEHEKPKFNGA  739
             T S DS        + GH  +              GISPY   KD+++KPKFNG 
Sbjct  158  FTHSADS-------PKAGHFKDYGVNNKWDSPPRSRGISPYSNTKDDYDKPKFNGG  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3595941013084