BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25553_g2_i1 len=1540 path=[207:0-1539]

Length=1540
                                                                      Score     E

ref|XP_008238780.1|  PREDICTED: MATE efflux family protein LAL5-like    690   0.0      
ref|XP_009364190.1|  PREDICTED: MATE efflux family protein 5-like       692   0.0      
emb|CDP09810.1|  unnamed protein product                                689   0.0      
ref|XP_009623490.1|  PREDICTED: MATE efflux family protein 5-like       689   0.0      
ref|XP_009339656.1|  PREDICTED: MATE efflux family protein 5-like       688   0.0      
ref|XP_009364191.1|  PREDICTED: MATE efflux family protein 5-like       688   0.0      
ref|XP_011033802.1|  PREDICTED: MATE efflux family protein LAL5-like    684   0.0      
ref|XP_011081156.1|  PREDICTED: MATE efflux family protein 5            682   0.0      
ref|XP_002274808.1|  PREDICTED: MATE efflux family protein 6            684   0.0      Vitis vinifera
ref|XP_009377927.1|  PREDICTED: MATE efflux family protein 5-like       680   0.0      
ref|XP_002303561.2|  hypothetical protein POPTR_0003s12140g             678   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007210853.1|  hypothetical protein PRUPE_ppa015493mg             676   0.0      
ref|XP_008369500.1|  PREDICTED: MATE efflux family protein 5            677   0.0      
ref|XP_009344271.1|  PREDICTED: MATE efflux family protein 5-like       674   0.0      
ref|XP_009764157.1|  PREDICTED: MATE efflux family protein 5-like       674   0.0      
ref|XP_009759894.1|  PREDICTED: MATE efflux family protein 5-like       674   0.0      
ref|XP_002509706.1|  multidrug resistance pump, putative                673   0.0      Ricinus communis
ref|XP_009628917.1|  PREDICTED: MATE efflux family protein 5-like       667   0.0      
ref|XP_009371284.1|  PREDICTED: MATE efflux family protein LAL5-like    667   0.0      
ref|XP_004300756.1|  PREDICTED: MATE efflux family protein 8-like       663   0.0      
ref|XP_007040126.1|  MATE efflux family protein                         662   0.0      
ref|XP_008376528.1|  PREDICTED: MATE efflux family protein LAL5-like    664   0.0      
ref|XP_008234289.1|  PREDICTED: MATE efflux family protein LAL5         662   0.0      
ref|XP_009341257.1|  PREDICTED: MATE efflux family protein LAL5-l...    660   0.0      
ref|XP_006358865.1|  PREDICTED: MATE efflux family protein DTX1-like    659   0.0      
ref|XP_009341256.1|  PREDICTED: MATE efflux family protein LAL5-l...    660   0.0      
ref|XP_011030028.1|  PREDICTED: MATE efflux family protein LAL5         660   0.0      
ref|XP_007220655.1|  hypothetical protein PRUPE_ppa003689mg             660   0.0      
ref|XP_008354220.1|  PREDICTED: MATE efflux family protein LAL5-like    659   0.0      
ref|XP_002510841.1|  multidrug resistance pump, putative                659   0.0      Ricinus communis
ref|XP_009798743.1|  PREDICTED: MATE efflux family protein DTX1-like    657   0.0      
ref|XP_009620467.1|  PREDICTED: MATE efflux family protein DTX1-like    655   0.0      
ref|XP_011041639.1|  PREDICTED: MATE efflux family protein LAL5-like    655   0.0      
ref|XP_010278542.1|  PREDICTED: MATE efflux family protein 5-like       654   0.0      
ref|XP_003611148.1|  Multidrug and toxin extrusion protein              653   0.0      
ref|XP_002322435.2|  hypothetical protein POPTR_0015s13900g             653   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006477591.1|  PREDICTED: multidrug and toxin extrusion pro...    650   0.0      
ref|XP_011076230.1|  PREDICTED: MATE efflux family protein DTX1         652   0.0      
ref|XP_006421854.1|  hypothetical protein CICLE_v10007191mg             650   0.0      
gb|KHN02797.1|  MATE efflux family protein 9                            647   0.0      
ref|XP_002318258.2|  hypothetical protein POPTR_0012s13930g             643   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003535626.1|  PREDICTED: MATE efflux family protein 5-like       647   0.0      
ref|XP_003550878.1|  PREDICTED: MATE efflux family protein 5-like       647   0.0      
ref|XP_006440531.1|  hypothetical protein CICLE_v10019758mg             646   0.0      
gb|KDO63568.1|  hypothetical protein CISIN_1g042512mg                   645   0.0      
ref|XP_007155701.1|  hypothetical protein PHAVU_003G223900g             645   0.0      
gb|KHN34999.1|  MATE efflux family protein 6                            643   0.0      
ref|XP_006358411.1|  PREDICTED: MATE efflux family protein 5-like       643   0.0      
ref|XP_003538709.1|  PREDICTED: MATE efflux family protein 6-like       643   0.0      
ref|XP_007038589.1|  MATE efflux family protein                         642   0.0      
ref|XP_002276226.1|  PREDICTED: MATE efflux family protein 5-like       640   0.0      Vitis vinifera
ref|XP_007155565.1|  hypothetical protein PHAVU_003G212600g             640   0.0      
ref|XP_006340580.1|  PREDICTED: MATE efflux family protein 5-like       639   0.0      
ref|XP_007158465.1|  hypothetical protein PHAVU_002G154600g             638   0.0      
ref|XP_003516689.1|  PREDICTED: MATE efflux family protein 6-like       639   0.0      
ref|XP_007152342.1|  hypothetical protein PHAVU_004G121900g             639   0.0      
ref|XP_010086543.1|  MATE efflux family protein LAL5                    637   0.0      
ref|XP_003555370.1|  PREDICTED: MATE efflux family protein 5-like       635   0.0      
ref|XP_010061388.1|  PREDICTED: MATE efflux family protein 5            631   0.0      
ref|XP_003592313.1|  Multidrug and toxin extrusion protein              630   0.0      
ref|XP_006587359.1|  PREDICTED: multidrug and toxin extrusion pro...    629   0.0      
ref|XP_004244600.1|  PREDICTED: MATE efflux family protein 5-like       629   0.0      
ref|XP_004246128.1|  PREDICTED: MATE efflux family protein 6-like       628   0.0      
ref|XP_006600090.1|  PREDICTED: multidrug and toxin extrusion pro...    629   0.0      
ref|XP_003525539.2|  PREDICTED: MATE efflux family protein 5-like       628   0.0      
ref|XP_006353367.1|  PREDICTED: MATE efflux family protein 5-like       627   0.0      
ref|XP_004511602.1|  PREDICTED: MATE efflux family protein 5-like       627   0.0      
gb|KHN40254.1|  Multidrug and toxin extrusion protein 1                 628   0.0      
gb|KHN31537.1|  Multidrug and toxin extrusion protein 1                 627   0.0      
ref|XP_004143992.1|  PREDICTED: MATE efflux family protein 6-like       622   0.0      
ref|XP_009796993.1|  PREDICTED: MATE efflux family protein 5-like       623   0.0      
gb|KGN50143.1|  hypothetical protein Csa_5G155540                       622   0.0      
ref|XP_004165956.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    620   0.0      
ref|XP_010255527.1|  PREDICTED: MATE efflux family protein 9-like       620   0.0      
ref|XP_004496604.1|  PREDICTED: multidrug and toxin extrusion pro...    620   0.0      
ref|XP_010035093.1|  PREDICTED: MATE efflux family protein LAL5-like    619   0.0      
ref|XP_004234355.1|  PREDICTED: MATE efflux family protein 5            618   0.0      
ref|XP_004173805.1|  PREDICTED: multidrug and toxin extrusion pro...    616   0.0      
ref|XP_010053335.1|  PREDICTED: MATE efflux family protein LAL5-like    615   0.0      
ref|XP_004140853.1|  PREDICTED: multidrug and toxin extrusion pro...    615   0.0      
gb|EYU25058.1|  hypothetical protein MIMGU_mgv1a026738mg                613   0.0      
ref|XP_010107396.1|  Multidrug and toxin extrusion protein 2            616   0.0      
ref|XP_008437213.1|  PREDICTED: MATE efflux family protein 5            614   0.0      
gb|KGN57343.1|  hypothetical protein Csa_3G180310                       614   0.0      
ref|XP_008439170.1|  PREDICTED: MATE efflux family protein LAL5         613   0.0      
gb|KHN25727.1|  MATE efflux family protein 6                            608   0.0      
ref|XP_004515891.1|  PREDICTED: MATE efflux family protein 5-like       610   0.0      
ref|XP_004240795.1|  PREDICTED: MATE efflux family protein 5-like       609   0.0      
ref|XP_009600301.1|  PREDICTED: MATE efflux family protein 5-like       604   0.0      
ref|XP_010676553.1|  PREDICTED: MATE efflux family protein LAL5-like    602   0.0      
emb|CBI31838.3|  unnamed protein product                                601   0.0      
gb|KCW46389.1|  hypothetical protein EUGRSUZ_K00224                     597   0.0      
gb|KHN34434.1|  MATE efflux family protein LAL5                         597   0.0      
gb|KEH17144.1|  MATE efflux family protein                              594   0.0      
emb|CBI34748.3|  unnamed protein product                                589   0.0      
ref|XP_004513681.1|  PREDICTED: multidrug and toxin extrusion pro...    590   0.0      
gb|KDP25510.1|  hypothetical protein JCGZ_20666                         582   0.0      
emb|CDP05245.1|  unnamed protein product                                585   0.0      
gb|KCW90739.1|  hypothetical protein EUGRSUZ_A02813                     583   0.0      
gb|EPS70572.1|  hypothetical protein M569_04188                         582   0.0      
emb|CDY41255.1|  BnaA01g12840D                                          582   0.0      
ref|XP_009136646.1|  PREDICTED: MATE efflux family protein 5            582   0.0      
gb|KFK28869.1|  hypothetical protein AALP_AA7G059000                    576   0.0      
ref|XP_010529544.1|  PREDICTED: MATE efflux family protein 5            573   0.0      
emb|CDY53130.1|  BnaC01g41400D                                          570   0.0      
ref|XP_006413586.1|  hypothetical protein EUTSA_v10024949mg             568   0.0      
ref|XP_006284940.1|  hypothetical protein CARUB_v10006239mg             558   0.0      
ref|XP_010933890.1|  PREDICTED: MATE efflux family protein 5-like       559   0.0      
ref|XP_009401759.1|  PREDICTED: MATE efflux family protein 5            556   0.0      
ref|XP_009389312.1|  PREDICTED: MATE efflux family protein LAL5-like    555   0.0      
ref|XP_010693502.1|  PREDICTED: MATE efflux family protein 9-like       553   0.0      
ref|XP_003615399.1|  Multidrug and toxin extrusion protein              551   0.0      
ref|XP_010448784.1|  PREDICTED: MATE efflux family protein LAL5-like    548   0.0      
ref|NP_194034.1|  MATE efflux family protein                            548   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CAN77415.1|  hypothetical protein VITISV_000475                     544   0.0      Vitis vinifera
ref|XP_010439241.1|  PREDICTED: MATE efflux family protein LAL5-like    543   0.0      
ref|XP_004301437.1|  PREDICTED: multidrug and toxin extrusion pro...    544   0.0      
ref|XP_002283609.2|  PREDICTED: MATE efflux family protein 5            544   0.0      Vitis vinifera
ref|XP_009394090.1|  PREDICTED: MATE efflux family protein LAL5-like    543   0.0      
gb|KGN62780.1|  hypothetical protein Csa_2G372760                       545   0.0      
emb|CBI19327.3|  unnamed protein product                                544   0.0      
ref|XP_004490498.1|  PREDICTED: MATE efflux family protein 5-like...    543   0.0      
ref|XP_009382291.1|  PREDICTED: MATE efflux family protein 5-like       541   0.0      
ref|XP_009411460.1|  PREDICTED: MATE efflux family protein 5-like       541   0.0      
gb|KCW68566.1|  hypothetical protein EUGRSUZ_F02179                     541   0.0      
ref|XP_008219166.1|  PREDICTED: MATE efflux family protein 5            541   0.0      
ref|XP_002510003.1|  multidrug resistance pump, putative                540   0.0      Ricinus communis
gb|KDP41539.1|  hypothetical protein JCGZ_15946                         540   0.0      
ref|XP_008444968.1|  PREDICTED: MATE efflux family protein 5            542   0.0      
ref|XP_010061582.1|  PREDICTED: MATE efflux family protein 5            540   0.0      
ref|XP_010695442.1|  PREDICTED: MATE efflux family protein 5            539   0.0      
ref|XP_004490499.1|  PREDICTED: MATE efflux family protein 5-like...    536   0.0      
gb|AES73927.2|  MATE efflux family protein                              536   0.0      
ref|XP_002869794.1|  predicted protein                                  534   0.0      
ref|XP_009385179.1|  PREDICTED: MATE efflux family protein LAL5-like    533   0.0      
ref|XP_009765487.1|  PREDICTED: MATE efflux family protein 5            533   0.0      
ref|XP_009615001.1|  PREDICTED: MATE efflux family protein 5            532   0.0      
ref|XP_010271543.1|  PREDICTED: MATE efflux family protein 5-like       531   0.0      
gb|EAY87054.1|  hypothetical protein OsI_08452                          531   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001047724.1|  Os02g0676400                                       531   1e-180   Oryza sativa Japonica Group [Japonica rice]
emb|CDP21676.1|  unnamed protein product                                531   1e-180   
ref|NP_001170523.1|  putative MATE efflux family protein                531   2e-180   Zea mays [maize]
ref|XP_006364986.1|  PREDICTED: MATE efflux family protein 5-like       530   4e-180   
ref|XP_006647679.1|  PREDICTED: MATE efflux family protein 9-like       529   6e-180   
ref|XP_004238041.1|  PREDICTED: MATE efflux family protein 5            529   7e-180   
dbj|BAJ96265.1|  predicted protein                                      526   9e-180   
ref|XP_008663473.1|  PREDICTED: MATE efflux family protein 5-like       530   1e-179   
ref|XP_011016948.1|  PREDICTED: MATE efflux family protein 5            529   1e-179   
ref|XP_002446957.1|  hypothetical protein SORBIDRAFT_06g025870          529   1e-179   Sorghum bicolor [broomcorn]
ref|XP_008795373.1|  PREDICTED: MATE efflux family protein 5-like       528   1e-179   
ref|XP_007018359.1|  Multidrug and toxin extrusion protein 1            528   2e-179   
ref|XP_002301101.2|  MATE efflux family protein                         528   2e-179   Populus trichocarpa [western balsam poplar]
ref|XP_010268640.1|  PREDICTED: MATE efflux family protein 5-like       527   4e-179   
ref|XP_004976540.1|  PREDICTED: MATE efflux family protein 9-like       527   5e-179   
ref|XP_002454487.1|  hypothetical protein SORBIDRAFT_04g031980          526   1e-178   Sorghum bicolor [broomcorn]
ref|XP_008779545.1|  PREDICTED: MATE efflux family protein 5-like       526   2e-178   
ref|XP_004501069.1|  PREDICTED: MATE efflux family protein 5-like       526   2e-178   
ref|XP_010919223.1|  PREDICTED: MATE efflux family protein 5-like       525   2e-178   
ref|XP_011074298.1|  PREDICTED: MATE efflux family protein 5            525   3e-178   
ref|XP_008785753.1|  PREDICTED: MATE efflux family protein 5-like       523   1e-177   
ref|XP_010939303.1|  PREDICTED: MATE efflux family protein 5-like       523   1e-177   
ref|XP_010536483.1|  PREDICTED: MATE efflux family protein 5            520   7e-177   
ref|XP_010548775.1|  PREDICTED: MATE efflux family protein 5-like       520   9e-177   
ref|XP_006433714.1|  hypothetical protein CICLE_v10000751mg             521   9e-177   
ref|XP_007141312.1|  hypothetical protein PHAVU_008G185200g             521   1e-176   
ref|XP_009387104.1|  PREDICTED: MATE efflux family protein 5-like       518   5e-176   
gb|EYU36423.1|  hypothetical protein MIMGU_mgv1a019568mg                519   1e-175   
ref|XP_010936249.1|  PREDICTED: MATE efflux family protein 5-like       518   1e-175   
ref|XP_010104547.1|  MATE efflux family protein 5                       519   2e-175   
ref|XP_006472377.1|  PREDICTED: MATE efflux family protein 5-like       518   3e-175   
ref|XP_006652664.1|  PREDICTED: MATE efflux family protein 9-like       518   3e-175   
ref|XP_008646051.1|  PREDICTED: MATE efflux family protein 9-like       518   3e-175   
ref|XP_009398732.1|  PREDICTED: MATE efflux family protein 5-like       516   4e-175   
ref|XP_002981285.1|  hypothetical protein SELMODRAFT_53188              512   1e-174   
ref|XP_009405972.1|  PREDICTED: MATE efflux family protein 5-like       516   2e-174   
ref|XP_002969674.1|  hypothetical protein SELMODRAFT_63250              512   2e-174   
gb|KHN39984.1|  Multidrug and toxin extrusion protein 1                 515   2e-174   
ref|XP_008803288.1|  PREDICTED: MATE efflux family protein 5-like       513   2e-174   
gb|EMS68526.1|  MATE efflux family protein 9                            514   5e-174   
ref|XP_009400058.1|  PREDICTED: MATE efflux family protein 5-like       514   1e-173   
gb|EPS65920.1|  hypothetical protein M569_08857                         512   1e-173   
ref|XP_008339010.1|  PREDICTED: MATE efflux family protein 5-like       513   2e-173   
ref|XP_006857900.1|  hypothetical protein AMTR_s00069p00129640          511   5e-173   
ref|XP_008378671.1|  PREDICTED: MATE efflux family protein 5-like       511   1e-172   
ref|XP_004953434.1|  PREDICTED: MATE efflux family protein 9-like       510   2e-172   
gb|EPS74212.1|  hypothetical protein M569_00540                         507   2e-172   
ref|NP_001053606.2|  Os04g0571600                                       509   5e-172   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010555652.1|  PREDICTED: MATE efflux family protein 9-like       508   6e-172   
ref|XP_003580355.1|  PREDICTED: MATE efflux family protein 5-like       509   8e-172   
ref|XP_009335488.1|  PREDICTED: MATE efflux family protein 5-like       508   9e-172   
gb|EAZ31690.1|  hypothetical protein OsJ_15838                          508   2e-171   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006852723.1|  hypothetical protein AMTR_s00033p00071400          503   9e-171   
ref|XP_009357241.1|  PREDICTED: MATE efflux family protein 5-like       505   1e-170   
ref|XP_007137291.1|  hypothetical protein PHAVU_009G114900g             505   2e-170   
ref|XP_010553670.1|  PREDICTED: MATE efflux family protein 5-like       504   2e-170   
gb|EMT29118.1|  Multidrug and toxin extrusion protein 1                 506   2e-170   
emb|CDY65506.1|  BnaCnng47370D                                          502   5e-170   
emb|CDX91621.1|  BnaC02g15390D                                          502   5e-170   
emb|CAH67053.1|  OSIGBa0127A14.5                                        504   5e-170   Oryza sativa [red rice]
ref|XP_006859062.1|  hypothetical protein AMTR_s00068p00197570          500   2e-169   
ref|XP_008781774.1|  PREDICTED: MATE efflux family protein DTX1-like    502   2e-169   
ref|XP_010925990.1|  PREDICTED: MATE efflux family protein 6-like       499   3e-169   
ref|XP_003572811.1|  PREDICTED: MATE efflux family protein 9-like       502   7e-169   
ref|XP_010511083.1|  PREDICTED: MATE efflux family protein 7-like       499   2e-168   
ref|XP_008450787.1|  PREDICTED: MATE efflux family protein 5-like       498   9e-168   
ref|XP_010242557.1|  PREDICTED: MATE efflux family protein 6-like       496   1e-167   
ref|XP_008657622.1|  PREDICTED: MATE efflux family protein 5            495   2e-167   
ref|XP_009127259.1|  PREDICTED: MATE efflux family protein DTX1-like    495   3e-167   
ref|XP_010444324.1|  PREDICTED: MATE efflux family protein 5-like       495   4e-167   
ref|XP_010442727.1|  PREDICTED: multidrug and toxin extrusion pro...    494   7e-167   
ref|XP_002984600.1|  hypothetical protein SELMODRAFT_120748             493   2e-166   
tpg|DAA46004.1|  TPA: putative MATE efflux family protein               495   2e-166   
gb|KHN19255.1|  MATE efflux family protein DTX1                         494   2e-166   
ref|XP_002864149.1|  hypothetical protein ARALYDRAFT_495276             493   2e-166   
ref|XP_002978667.1|  hypothetical protein SELMODRAFT_109192             493   3e-166   
ref|XP_003527862.1|  PREDICTED: MATE efflux family protein 5-like       493   5e-166   
ref|XP_010482557.1|  PREDICTED: MATE efflux family protein 5-like       492   6e-166   
ref|XP_009400053.1|  PREDICTED: MATE efflux family protein 5-like       491   2e-165   
ref|XP_010442726.1|  PREDICTED: MATE efflux family protein 5-like...    490   2e-165   
gb|KFK29476.1|  hypothetical protein AALP_AA7G138700                    491   3e-165   
ref|XP_006339903.1|  PREDICTED: multidrug and toxin extrusion pro...    490   4e-165   
ref|NP_200018.1|  MATE efflux family protein                            489   5e-165   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010470264.1|  PREDICTED: MATE efflux family protein 7-like       490   6e-165   
ref|XP_010536256.1|  PREDICTED: multidrug and toxin extrusion pro...    489   8e-165   
ref|XP_004157307.1|  PREDICTED: multidrug and toxin extrusion pro...    490   9e-165   
ref|XP_009412273.1|  PREDICTED: MATE efflux family protein 5-like       489   2e-164   
ref|XP_006280325.1|  hypothetical protein CARUB_v10026248mg             488   2e-164   
ref|XP_009109050.1|  PREDICTED: MATE efflux family protein 5-like       489   3e-164   
ref|XP_006842445.1|  hypothetical protein AMTR_s00077p00047440          487   4e-164   
ref|XP_010414741.1|  PREDICTED: MATE efflux family protein 7-like       488   6e-164   
dbj|BAC42620.2|  putative integral membrane protein                     486   1e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010438335.1|  PREDICTED: MATE efflux family protein 5-like       487   1e-163   
ref|NP_194643.1|  putative MATE transport protein ADS1                  487   1e-163   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564731.1|  MATE family protein ZRIZ1                             487   1e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869450.1|  hypothetical protein ARALYDRAFT_913597             486   2e-163   
emb|CDY14218.1|  BnaA08g13490D                                          487   2e-163   
ref|XP_006401870.1|  hypothetical protein EUTSA_v10015455mg             486   2e-163   
ref|XP_010433131.1|  PREDICTED: MATE efflux family protein 5-like       486   2e-163   
ref|XP_007013017.1|  Multidrug and toxin extrusion protein 2            486   2e-163   
ref|XP_003523763.1|  PREDICTED: MATE efflux family protein 5-like       486   2e-163   
ref|XP_002888219.1|  hypothetical protein ARALYDRAFT_893660             486   3e-163   
dbj|BAD43969.1|  putative protein                                       486   3e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004135806.1|  PREDICTED: multidrug and toxin extrusion pro...    484   4e-163   
ref|XP_006412876.1|  hypothetical protein EUTSA_v10024865mg             486   4e-163   
gb|KFK26810.1|  hypothetical protein AALP_AA8G296500                    484   5e-163   
ref|XP_009603911.1|  PREDICTED: multidrug and toxin extrusion pro...    484   5e-163   
gb|KFK40898.1|  hypothetical protein AALP_AA2G057700                    485   6e-163   
gb|KHN15680.1|  Multidrug and toxin extrusion protein 1                 484   1e-162   
ref|XP_009774724.1|  PREDICTED: multidrug and toxin extrusion pro...    482   4e-162   
ref|XP_009113320.1|  PREDICTED: MATE efflux family protein 5            483   4e-162   
ref|XP_006283510.1|  hypothetical protein CARUB_v10004563mg             482   8e-162   
ref|XP_008809496.1|  PREDICTED: multidrug and toxin extrusion pro...    481   9e-162   
ref|XP_010316145.1|  PREDICTED: multidrug and toxin extrusion pro...    481   2e-161   
emb|CDY42050.1|  BnaC09g15370D                                          481   2e-161   
ref|XP_002514223.1|  multidrug resistance pump, putative                481   2e-161   Ricinus communis
ref|XP_004232036.1|  PREDICTED: multidrug and toxin extrusion pro...    481   3e-161   
ref|XP_008218990.1|  PREDICTED: MATE efflux family protein LAL5-like    476   3e-161   
ref|XP_010940890.1|  PREDICTED: MATE efflux family protein 5-like       481   5e-161   
ref|XP_009137829.1|  PREDICTED: MATE efflux family protein 5-like       481   5e-161   
ref|XP_010519669.1|  PREDICTED: multidrug and toxin extrusion pro...    479   7e-161   
ref|XP_009132561.1|  PREDICTED: MATE efflux family protein 5            479   9e-161   
ref|XP_009786207.1|  PREDICTED: MATE efflux family protein LAL5-like    479   2e-160   
ref|XP_002467627.1|  hypothetical protein SORBIDRAFT_01g031150          480   3e-160   Sorghum bicolor [broomcorn]
ref|XP_008242482.1|  PREDICTED: MATE efflux family protein 5            479   3e-160   
ref|XP_007204791.1|  hypothetical protein PRUPE_ppa017241mg             478   4e-160   
ref|XP_009415321.1|  PREDICTED: MATE efflux family protein 5-like       478   4e-160   
ref|XP_006392202.1|  hypothetical protein EUTSA_v10024168mg             477   6e-160   
ref|XP_009352558.1|  PREDICTED: multidrug and toxin extrusion pro...    477   9e-160   
ref|XP_009352559.1|  PREDICTED: multidrug and toxin extrusion pro...    476   1e-159   
emb|CDY38893.1|  BnaA03g12860D                                          476   1e-159   
ref|XP_009619046.1|  PREDICTED: MATE efflux family protein LAL5-like    476   1e-159   
ref|XP_008387339.1|  PREDICTED: multidrug and toxin extrusion pro...    476   1e-159   
ref|XP_010921552.1|  PREDICTED: MATE efflux family protein LAL5         475   2e-159   
ref|XP_002523569.1|  multidrug resistance pump, putative                476   2e-159   Ricinus communis
ref|XP_010270081.1|  PREDICTED: multidrug and toxin extrusion pro...    475   4e-159   
gb|KDP33803.1|  hypothetical protein JCGZ_07374                         475   4e-159   
emb|CDP02490.1|  unnamed protein product                                474   5e-159   
gb|KCW77608.1|  hypothetical protein EUGRSUZ_D01922                     470   5e-159   
ref|XP_008337604.1|  PREDICTED: MATE efflux family protein 6-like       474   7e-159   
ref|XP_010526432.1|  PREDICTED: MATE efflux family protein 5-like       474   1e-158   
ref|XP_010054788.1|  PREDICTED: multidrug and toxin extrusion pro...    469   1e-158   
gb|KDO66595.1|  hypothetical protein CISIN_1g009588mg                   473   2e-158   
ref|XP_006475598.1|  PREDICTED: multidrug and toxin extrusion pro...    473   3e-158   
ref|XP_007047235.1|  Multidrug resistance pump, putative                472   5e-158   
ref|XP_010656264.1|  PREDICTED: MATE efflux family protein 5            471   2e-157   
emb|CDY06833.1|  BnaC01g09320D                                          468   6e-156   
ref|XP_009402775.1|  PREDICTED: MATE efflux family protein LAL5         466   1e-155   
ref|XP_011043558.1|  PREDICTED: MATE efflux family protein 5-like       466   2e-155   
ref|XP_010249483.1|  PREDICTED: MATE efflux family protein 5-like       466   3e-155   
ref|XP_004986862.1|  PREDICTED: MATE efflux family protein 9-like       466   3e-155   
gb|KHG20829.1|  Multidrug and toxin extrusion 1                         465   4e-155   
ref|XP_009128977.1|  PREDICTED: MATE efflux family protein 5-like       464   9e-155   
ref|XP_004513054.1|  PREDICTED: multidrug and toxin extrusion pro...    462   1e-154   
emb|CDY44936.1|  BnaA02g04410D                                          462   2e-154   
ref|XP_008458946.1|  PREDICTED: multidrug and toxin extrusion pro...    462   2e-154   
ref|XP_010666625.1|  PREDICTED: MATE efflux family protein 5-like       463   2e-154   
ref|XP_002277534.2|  PREDICTED: MATE efflux family protein 5            463   2e-154   
emb|CDP03248.1|  unnamed protein product                                464   3e-154   
emb|CDY42287.1|  BnaC02g08930D                                          462   3e-154   
ref|XP_003571986.2|  PREDICTED: MATE efflux family protein 5            461   4e-154   
ref|XP_006400532.1|  hypothetical protein EUTSA_v10013302mg             461   5e-154   
ref|XP_010688344.1|  PREDICTED: multidrug and toxin extrusion pro...    464   5e-154   
ref|XP_001769309.1|  predicted protein                                  458   1e-153   
gb|AAO00710.1|  putative membrane protein                               462   1e-153   
gb|EAY79255.1|  hypothetical protein OsI_34372                          461   1e-153   
emb|CDY47785.1|  BnaC07g41750D                                          461   1e-153   
emb|CBI21435.3|  unnamed protein product                                462   1e-153   
ref|XP_009780268.1|  PREDICTED: multidrug and toxin extrusion pro...    462   2e-153   
ref|XP_004516053.1|  PREDICTED: multidrug and toxin extrusion pro...    459   3e-153   
ref|XP_004157950.1|  PREDICTED: multidrug and toxin extrusion pro...    457   5e-153   
ref|XP_010493049.1|  PREDICTED: multidrug and toxin extrusion pro...    459   6e-153   
ref|XP_011093635.1|  PREDICTED: MATE efflux family protein LAL5-like    459   1e-152   
ref|XP_004141162.1|  PREDICTED: multidrug and toxin extrusion pro...    458   1e-152   
ref|XP_002873960.1|  hypothetical protein ARALYDRAFT_910007             457   2e-152   
emb|CDY30234.1|  BnaA03g49360D                                          458   2e-152   
ref|XP_009126384.1|  PREDICTED: multidrug and toxin extrusion pro...    457   2e-152   
ref|XP_004288895.1|  PREDICTED: multidrug and toxin extrusion pro...    458   4e-152   
ref|XP_002310147.2|  hypothetical protein POPTR_0007s11110g             456   6e-152   
ref|XP_003524407.1|  PREDICTED: multidrug and toxin extrusion pro...    455   9e-152   
ref|NP_197471.1|  MATE efflux family protein                            455   2e-151   
emb|CDX92508.1|  BnaA10g15470D                                          455   2e-151   
ref|XP_003532472.1|  PREDICTED: multidrug and toxin extrusion pro...    454   2e-151   
emb|CDX98784.1|  BnaA03g45690D                                          452   2e-151   
ref|XP_006289719.1|  hypothetical protein CARUB_v10003286mg             454   4e-151   
dbj|BAD09230.1|  putative ripening regulated protein DDTFR18            455   6e-151   
ref|XP_009120863.1|  PREDICTED: MATE efflux family protein 5            454   6e-151   
ref|XP_010420784.1|  PREDICTED: multidrug and toxin extrusion pro...    453   1e-150   
gb|KEH27218.1|  MATE efflux family protein                              452   1e-150   
ref|XP_010454256.1|  PREDICTED: multidrug and toxin extrusion pro...    452   1e-150   
ref|XP_010253821.1|  PREDICTED: MATE efflux family protein 5            453   1e-150   
emb|CDY67118.1|  BnaC09g54330D                                          452   2e-150   
ref|XP_008794104.1|  PREDICTED: MATE efflux family protein 5-like       453   3e-150   
ref|XP_009625852.1|  PREDICTED: multidrug and toxin extrusion pro...    452   5e-150   
ref|XP_010263570.1|  PREDICTED: multidrug and toxin extrusion pro...    450   7e-150   
ref|XP_009106804.1|  PREDICTED: multidrug and toxin extrusion pro...    451   8e-150   
ref|XP_006451313.1|  hypothetical protein CICLE_v10008296mg             447   2e-149   
ref|XP_009405226.1|  PREDICTED: MATE efflux family protein 6-like       451   4e-149   
gb|EAZ07875.1|  hypothetical protein OsI_30133                          447   1e-148   
gb|KDP31922.1|  hypothetical protein JCGZ_12383                         447   2e-148   
ref|NP_001175680.1|  Os08g0545900                                       446   3e-148   
ref|XP_007160282.1|  hypothetical protein PHAVU_002G308300g             445   7e-148   
ref|XP_010267127.1|  PREDICTED: multidrug and toxin extrusion pro...    446   2e-147   
ref|XP_010252086.1|  PREDICTED: MATE efflux family protein LAL5-like    444   6e-147   
gb|EMT00279.1|  Multidrug and toxin extrusion protein 1                 444   6e-147   
ref|XP_009351404.1|  PREDICTED: multidrug and toxin extrusion pro...    440   1e-146   
emb|CDY70771.1|  BnaAnng34940D                                          442   2e-146   
gb|KHN08206.1|  Multidrug and toxin extrusion protein 1                 439   3e-146   
ref|XP_007152968.1|  hypothetical protein PHAVU_004G175400g             441   4e-146   
gb|KCW88330.1|  hypothetical protein EUGRSUZ_A00719                     440   4e-146   
ref|XP_004305086.1|  PREDICTED: multidrug and toxin extrusion pro...    442   7e-146   
emb|CAN77541.1|  hypothetical protein VITISV_021602                     440   1e-145   
ref|XP_006845801.1|  hypothetical protein AMTR_s00019p00255670          441   2e-145   
ref|XP_010043120.1|  PREDICTED: MATE efflux family protein 6-like       441   2e-145   
tpg|DAA48363.1|  TPA: putative MATE efflux family protein               439   6e-145   
ref|XP_002985441.1|  hypothetical protein SELMODRAFT_446267             438   7e-145   
ref|XP_002275181.2|  PREDICTED: MATE efflux family protein DTX1 i...    436   8e-145   
ref|XP_004974080.1|  PREDICTED: MATE efflux family protein 5-like       437   3e-144   
ref|NP_001168821.1|  uncharacterized protein LOC100382626               434   6e-144   
gb|EMT23798.1|  Multidrug and toxin extrusion protein 1                 432   1e-143   
ref|XP_010247682.1|  PREDICTED: MATE efflux family protein 5-like       434   2e-143   
ref|XP_010256297.1|  PREDICTED: MATE efflux family protein 5            434   3e-143   
ref|XP_008798548.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    433   8e-143   
ref|XP_006859201.1|  hypothetical protein AMTR_s00070p00181900          432   1e-142   
ref|XP_008659673.1|  PREDICTED: MATE efflux family protein 7-like       434   2e-142   
ref|XP_002979778.1|  hypothetical protein SELMODRAFT_111626             430   4e-142   
ref|XP_002444635.1|  hypothetical protein SORBIDRAFT_07g025190          431   9e-142   
ref|XP_009421432.1|  PREDICTED: MATE efflux family protein 5-like       431   1e-141   
ref|XP_007011338.1|  MATE efflux family protein isoform 1               431   1e-141   
ref|XP_006481176.1|  PREDICTED: multidrug and toxin extrusion pro...    427   3e-141   
dbj|BAD54145.1|  putative NIC2                                          431   4e-141   
ref|XP_006429560.1|  hypothetical protein CICLE_v10013499mg             425   2e-140   
ref|XP_004965614.1|  PREDICTED: multidrug and toxin extrusion pro...    428   3e-140   
gb|EAY89130.1|  hypothetical protein OsI_10621                          430   4e-140   
gb|EYU44392.1|  hypothetical protein MIMGU_mgv1a021539mg                424   5e-140   
ref|XP_004515105.1|  PREDICTED: MATE efflux family protein 5-like       425   8e-140   
ref|NP_001173325.1|  Os03g0227966                                       429   1e-139   
ref|XP_010910775.1|  PREDICTED: MATE efflux family protein 6-like       426   1e-139   
ref|XP_001777255.1|  predicted protein                                  423   5e-139   
ref|XP_003560663.2|  PREDICTED: MATE efflux family protein 5-like       425   6e-139   
gb|KEH26072.1|  MATE efflux family protein                              423   7e-139   
ref|XP_003630706.1|  Multidrug and toxin extrusion protein              421   7e-139   
ref|XP_010062021.1|  PREDICTED: MATE efflux family protein 5            422   8e-139   
gb|KEH26071.1|  MATE efflux family protein                              422   1e-138   
gb|KDP30286.1|  hypothetical protein JCGZ_17156                         422   1e-138   
ref|XP_008674006.1|  PREDICTED: antiporter/ drug transporter/ tra...    426   1e-138   
ref|XP_003561861.1|  PREDICTED: MATE efflux family protein 5-like...    426   2e-138   
ref|XP_009593168.1|  PREDICTED: MATE efflux family protein 5            421   2e-138   
ref|XP_007134692.1|  hypothetical protein PHAVU_010G068200g             422   3e-138   
ref|XP_007020248.1|  MATE efflux family protein                         421   3e-138   
ref|XP_010683521.1|  PREDICTED: MATE efflux family protein 5            421   4e-138   
ref|XP_010925540.1|  PREDICTED: multidrug and toxin extrusion pro...    422   5e-138   
ref|XP_003533662.2|  PREDICTED: MATE efflux family protein 9-like       421   8e-138   
ref|XP_011038168.1|  PREDICTED: MATE efflux family protein 5            419   1e-137   
ref|XP_004985113.1|  PREDICTED: MATE efflux family protein 5-like       424   2e-137   
ref|XP_003551612.2|  PREDICTED: MATE efflux family protein 9-like       418   3e-137   
ref|XP_010091090.1|  Multidrug and toxin extrusion protein 1            420   4e-137   
ref|XP_003603676.1|  Multidrug and toxin extrusion protein              414   4e-137   
emb|CDY61580.1|  BnaCnng38060D                                          416   5e-137   
gb|KHG30609.1|  MATE efflux family protein 9                            417   6e-137   
ref|XP_003576751.1|  PREDICTED: MATE efflux family protein 5-like       418   7e-137   
ref|XP_009792677.1|  PREDICTED: MATE efflux family protein 5            417   7e-137   
ref|XP_002326006.2|  hypothetical protein POPTR_0019s11600g             417   1e-136   
ref|XP_008388882.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    416   2e-136   
ref|XP_002532864.1|  multidrug resistance pump, putative                415   2e-136   
ref|XP_003605273.1|  Multidrug and toxin extrusion protein              419   4e-136   
gb|AES87470.2|  MATE efflux family protein                              419   5e-136   
ref|XP_011002496.1|  PREDICTED: MATE efflux family protein 5-like...    415   7e-136   
ref|XP_003516431.2|  PREDICTED: multidrug and toxin extrusion pro...    416   8e-136   
ref|XP_011008753.1|  PREDICTED: MATE efflux family protein 6            415   1e-135   
ref|XP_004292491.1|  PREDICTED: MATE efflux family protein 9-like       414   1e-135   
ref|XP_002462694.1|  hypothetical protein SORBIDRAFT_02g030360          415   2e-135   
ref|XP_002323066.2|  MATE efflux family protein                         413   2e-135   
ref|XP_008442329.1|  PREDICTED: multidrug and toxin extrusion pro...    412   2e-135   
emb|CDX94147.1|  BnaC07g37810D                                          411   2e-135   
ref|XP_007011339.1|  MATE efflux family protein isoform 2               410   3e-135   
emb|CDX72839.1|  BnaC06g32870D                                          412   4e-135   
emb|CBI25357.3|  unnamed protein product                                409   9e-135   
gb|KDO42966.1|  hypothetical protein CISIN_1g012464mg                   410   1e-134   
ref|XP_010228931.1|  PREDICTED: MATE efflux family protein 5-like...    413   2e-134   
ref|XP_008652959.1|  PREDICTED: MATE efflux family protein 5-like       414   2e-134   
ref|XP_004506446.1|  PREDICTED: MATE efflux family protein DTX1-like    413   2e-134   
ref|NP_181385.1|  MATE efflux family protein                            410   2e-134   
ref|XP_008245032.1|  PREDICTED: LOW QUALITY PROTEIN: multidrug an...    410   2e-134   
ref|XP_006434640.1|  hypothetical protein CICLE_v10000855mg             411   2e-134   
gb|AGW47739.1|  putative MatE protein                                   412   3e-134   
ref|XP_006376322.1|  MATE efflux family protein                         409   3e-134   
ref|XP_006473222.1|  PREDICTED: MATE efflux family protein 5-like       411   3e-134   
ref|XP_009375700.1|  PREDICTED: multidrug and toxin extrusion pro...    410   5e-134   
ref|XP_011084832.1|  PREDICTED: multidrug and toxin extrusion pro...    409   6e-134   
ref|XP_007206715.1|  hypothetical protein PRUPE_ppa024316mg             411   7e-134   
ref|XP_002468217.1|  hypothetical protein SORBIDRAFT_01g041970          412   7e-134   
gb|KHN43738.1|  Multidrug and toxin extrusion protein 1                 410   1e-133   
ref|NP_001168360.1|  uncharacterized protein LOC100382128               410   1e-133   
ref|XP_004137889.1|  PREDICTED: multidrug and toxin extrusion pro...    407   2e-133   
ref|XP_004167879.1|  PREDICTED: multidrug and toxin extrusion pro...    407   2e-133   
emb|CDY03676.1|  BnaA02g15610D                                          408   3e-133   
gb|EYU35220.1|  hypothetical protein MIMGU_mgv1a023873mg                406   5e-133   
ref|XP_006295452.1|  hypothetical protein CARUB_v10024555mg             407   5e-133   
tpg|DAA40586.1|  TPA: putative MATE efflux family protein               411   5e-133   
gb|KCW79611.1|  hypothetical protein EUGRSUZ_C00965                     408   5e-133   
ref|XP_007140094.1|  hypothetical protein PHAVU_008G083800g             407   7e-133   
gb|KGN58699.1|  hypothetical protein Csa_3G728650                       408   7e-133   
ref|XP_011099184.1|  PREDICTED: MATE efflux family protein 5            407   8e-133   
ref|XP_006435907.1|  hypothetical protein CICLE_v10031455mg             405   9e-133   
ref|XP_010507613.1|  PREDICTED: multidrug and toxin extrusion pro...    406   1e-132   
ref|XP_010509130.1|  PREDICTED: multidrug and toxin extrusion pro...    406   1e-132   
ref|NP_001147434.1|  antiporter/ drug transporter/ transporter          409   1e-132   
tpg|DAA44217.1|  TPA: putative MATE efflux family protein               409   1e-132   
ref|XP_003522000.2|  PREDICTED: multidrug and toxin extrusion pro...    411   2e-132   
ref|XP_002879750.1|  hypothetical protein ARALYDRAFT_903087             405   2e-132   
ref|XP_002267095.1|  PREDICTED: MATE efflux family protein 5            406   2e-132   
ref|XP_010674324.1|  PREDICTED: MATE efflux family protein 5            405   3e-132   
gb|EMT18133.1|  Multidrug and toxin extrusion protein 2                 400   4e-132   
ref|XP_007151906.1|  hypothetical protein PHAVU_004G085700g             405   4e-132   
ref|XP_010269642.1|  PREDICTED: MATE efflux family protein 5-like       405   9e-132   
gb|KFK31447.1|  hypothetical protein AALP_AA6G113000                    404   9e-132   
ref|XP_002888851.1|  mate efflux family protein                         404   1e-131   
ref|XP_004289222.1|  PREDICTED: uncharacterized transporter C4B3....    405   2e-131   
ref|XP_006599450.1|  PREDICTED: MATE efflux family protein 5-like...    404   2e-131   
emb|CDX91473.1|  BnaC04g06770D                                          402   2e-131   
ref|XP_008338305.1|  PREDICTED: multidrug and toxin extrusion pro...    404   2e-131   
ref|XP_002267054.1|  PREDICTED: MATE efflux family protein DTX1         403   2e-131   
ref|XP_009127878.1|  PREDICTED: MATE efflux family protein 5-like       403   3e-131   
ref|XP_004246273.2|  PREDICTED: MATE efflux family protein 5            403   3e-131   
ref|NP_001063714.2|  Os09g0524300                                       404   4e-131   
ref|XP_006390732.1|  hypothetical protein EUTSA_v10018419mg             402   5e-131   
ref|XP_009143380.1|  PREDICTED: multidrug and toxin extrusion pro...    401   7e-131   
ref|XP_006411066.1|  hypothetical protein EUTSA_v10017583mg             401   8e-131   
ref|XP_010415902.1|  PREDICTED: MATE efflux family protein 5-like...    402   1e-130   
ref|XP_010428035.1|  PREDICTED: MATE efflux family protein 5-like       402   1e-130   
emb|CDY60750.1|  BnaA05g34750D                                          400   2e-130   
ref|XP_009105850.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    401   3e-130   
ref|XP_008461457.1|  PREDICTED: MATE efflux family protein 5            400   3e-130   
gb|EAZ09807.1|  hypothetical protein OsI_32095                          402   3e-130   
emb|CDY37931.1|  BnaC02g20800D                                          399   1e-129   
ref|XP_006302154.1|  hypothetical protein CARUB_v10020163mg             399   1e-129   
ref|XP_006351175.1|  PREDICTED: MATE efflux family protein 5-like...    398   2e-129   
ref|XP_006574768.1|  PREDICTED: MATE efflux family protein 5-like...    398   3e-129   
gb|ABG73448.1|  MATE efflux family protein                              399   3e-129   
ref|XP_008775816.1|  PREDICTED: MATE efflux family protein 5-like       399   4e-129   
ref|XP_004139701.1|  PREDICTED: multidrug and toxin extrusion pro...    396   7e-129   
ref|XP_010916827.1|  PREDICTED: MATE efflux family protein 5-like       395   1e-128   
ref|XP_010471203.1|  PREDICTED: MATE efflux family protein 5-like       394   5e-128   
emb|CDY18381.1|  BnaA04g22060D                                          394   5e-128   
ref|XP_009141744.1|  PREDICTED: MATE efflux family protein DTX1-like    394   5e-128   
ref|XP_011084831.1|  PREDICTED: multidrug and toxin extrusion pro...    392   6e-128   
ref|XP_011011677.1|  PREDICTED: MATE efflux family protein 5            395   7e-128   
ref|XP_009626118.1|  PREDICTED: MATE efflux family protein LAL5         395   8e-128   
ref|NP_177332.1|  MATE efflux family protein                            394   9e-128   
gb|KHN40621.1|  MATE efflux family protein 9                            391   1e-127   
emb|CDX93318.1|  BnaC04g45780D                                          393   1e-127   
ref|XP_010433951.1|  PREDICTED: MATE efflux family protein LAL5-like    388   1e-127   
ref|XP_008442330.1|  PREDICTED: multidrug and toxin extrusion pro...    391   2e-127   
ref|XP_002314374.2|  hypothetical protein POPTR_0010s01500g             393   2e-127   
ref|XP_010312814.1|  PREDICTED: MATE efflux family protein 5            392   6e-127   
ref|XP_011074913.1|  PREDICTED: MATE efflux family protein 5-like       391   6e-127   
emb|CDP20804.1|  unnamed protein product                                391   8e-127   
ref|XP_002270564.1|  PREDICTED: MATE efflux family protein 5            391   1e-126   
gb|EYU23942.1|  hypothetical protein MIMGU_mgv1a005197mg                390   1e-126   
gb|KDP22774.1|  hypothetical protein JCGZ_00361                         391   1e-126   



>ref|XP_008238780.1| PREDICTED: MATE efflux family protein LAL5-like [Prunus mume]
Length=504

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/473 (77%), Positives = 414/473 (88%), Gaps = 2/473 (0%)
 Frame = +1

Query  100   APLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlg  279
             AP I  ENPK E  N  +THLSLA  EAKCI++IA PM++TGLLLY R+MISMLFLGRLG
Sbjct  5     APFI-PENPKLEQENQ-KTHLSLALIEAKCIANIAFPMVLTGLLLYSRTMISMLFLGRLG  62

Query  280   dlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTS  459
             +L+LAGGSLAIGFANITGYS+LSGLAMGMEPICGQA+GAKRFKL+GL+LQRT++LLL TS
Sbjct  63    ELALAGGSLAIGFANITGYSVLSGLAMGMEPICGQAYGAKRFKLLGLTLQRTVILLLLTS  122

Query  460   IPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPL  639
             IPIA+LW NM+RIL+ C Q  +I+ +AQS+I YSLPDLIAQSLLHPLRIYLRSQS+T+PL
Sbjct  123   IPIALLWFNMKRILLSCGQQDDIATQAQSYIFYSLPDLIAQSLLHPLRIYLRSQSITVPL  182

Query  640   TFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGG  819
             TFCA  AI++H+PINY LV VLNLGIKGVALS VW N N+VGSL+ Y+  SGVYKKTWGG
Sbjct  183   TFCATLAILLHIPINYLLVCVLNLGIKGVALSGVWTNVNLVGSLIFYIAISGVYKKTWGG  242

Query  820   VSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLI  999
              S ECF+G+KSL+NLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTT LI
Sbjct  243   FSKECFEGWKSLMNLAIPSCISVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTGLI  302

Query  1000  YIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIF  1179
             YIFPSSLSFGVSTRVGNELGA RP RAKLA IVGL  SFILG +AL F V VRN+WAS++
Sbjct  303   YIFPSSLSFGVSTRVGNELGANRPKRAKLATIVGLSYSFILGFSALLFAVTVRNIWASMY  362

Query  1180  TQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAG  1359
             TQD+EI+ LT+ VLPIIGLCELGNCPQTTGCG LRGTARPKLGA INL CFY VG+PVA 
Sbjct  363   TQDSEIITLTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLGCFYLVGMPVAV  422

Query  1360  WLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISL  1518
             WLGFFAGFDF+GLWLGLLAAQ SC +TML VL RT+W  QA+RAKELT T ++
Sbjct  423   WLGFFAGFDFRGLWLGLLAAQGSCVVTMLFVLARTNWEIQAQRAKELTGTFTI  475



>ref|XP_009364190.1| PREDICTED: MATE efflux family protein 5-like [Pyrus x bretschneideri]
Length=559

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/479 (76%), Positives = 420/479 (88%), Gaps = 3/479 (1%)
 Frame = +1

Query  88    EKMEAPLISEENPKEE--DHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISML  261
             + + +PLI  E+PK E  + NH++THLSLA  EAKCI++IA PM++TGLLLY RSMISML
Sbjct  51    DSLNSPLI-PESPKLEQYNQNHHKTHLSLALIEAKCIANIAFPMVLTGLLLYSRSMISML  109

Query  262   FlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIV  441
             FLGRLG+LSLAGGSLAIGFANITGYS+LSGLAMGMEPICGQA+GAKRFKL+G +LQRT++
Sbjct  110   FLGRLGELSLAGGSLAIGFANITGYSVLSGLAMGMEPICGQAYGAKRFKLLGQTLQRTVI  169

Query  442   LLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQ  621
             LL  TSIPIA LW NM+RIL+ C Q  EI+ EA S+ILYSLPDLIAQSLLHPLRIYLR+Q
Sbjct  170   LLFLTSIPIAFLWLNMKRILLSCGQQDEIATEAYSYILYSLPDLIAQSLLHPLRIYLRTQ  229

Query  622   SVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVY  801
             S+T+PLTFCAA AI++H+P+NY LV VLNLGIKGVALS VW N N+VGSL+ Y+  SGVY
Sbjct  230   SITVPLTFCAALAILLHIPVNYLLVHVLNLGIKGVALSGVWTNVNLVGSLIAYIAISGVY  289

Query  802   KKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLI  981
             KKTWGG S ECFKG+K+L+NLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LI
Sbjct  290   KKTWGGFSKECFKGWKNLMNLAIPSCISVCLEWWWYEIMILLCGLLLNPQATVASMGILI  349

Query  982   QTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRN  1161
             QTT+LIYIFPSSLSFGVSTRVGNELGA RP RA+LA IVGL  SFILG +AL F V VRN
Sbjct  350   QTTALIYIFPSSLSFGVSTRVGNELGANRPERARLATIVGLSYSFILGFSALLFAVTVRN  409

Query  1162  VWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFV  1341
             +WAS+FTQ++EI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPKLGA INL CFY V
Sbjct  410   IWASMFTQESEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLGCFYLV  469

Query  1342  GLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISL  1518
             G+PVA WL F+AGFDF+GLWLGLLAAQ SC LTML+VL RT+W+ Q +RAKELT T ++
Sbjct  470   GMPVAVWLSFYAGFDFRGLWLGLLAAQGSCVLTMLIVLFRTNWDLQGQRAKELTGTFTI  528



>emb|CDP09810.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/488 (75%), Positives = 430/488 (88%), Gaps = 7/488 (1%)
 Frame = +1

Query  94    MEAPLISEENP--KEEDH-NHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLF  264
             M  PL+  ENP  K +D  +  +THLSLA  EAKC+++IA+PMI+TGLLLY RSMISMLF
Sbjct  1     MLTPLV-YENPTLKPQDTLSAKKTHLSLAITEAKCMANIAIPMILTGLLLYSRSMISMLF  59

Query  265   lgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVL  444
             LGRLG+LSLAGG+LAIGFANITGYSILSGLAMGMEPICGQAFGA+R+KL+GL+LQRT+++
Sbjct  60    LGRLGELSLAGGALAIGFANITGYSILSGLAMGMEPICGQAFGAQRYKLLGLTLQRTVLM  119

Query  445   LLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQS  624
             LL+TSIPIA++WCNM+RIL+ C QD  I+ EAQS+I YSLPDLIA S LHPLRIYLRSQS
Sbjct  120   LLWTSIPIALIWCNMKRILLFCGQDHAIATEAQSYIFYSLPDLIALSFLHPLRIYLRSQS  179

Query  625   VTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYK  804
             +T+PLTFCAA +I++H+PINYFLVVVLNLGIKGVA+S VW NFN+V SL+ YV FSGV K
Sbjct  180   ITVPLTFCAALSILLHIPINYFLVVVLNLGIKGVAISGVWTNFNLVISLITYVTFSGVAK  239

Query  805   KTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQ  984
             KTWGG+S +C KG++SL+NLAIPSC SVCLEWWWYE+MILL G L NP+ATVASMG+LIQ
Sbjct  240   KTWGGMSSQCLKGWRSLMNLAIPSCISVCLEWWWYEIMILLSGFLLNPQATVASMGILIQ  299

Query  985   TTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNV  1164
             TTSLIYIFPSSLSF VSTRVGNELGA RP +AKLAAI+GL +SF+LGL+AL+F + VRNV
Sbjct  300   TTSLIYIFPSSLSFSVSTRVGNELGASRPEKAKLAAIIGLSSSFMLGLSALSFAIMVRNV  359

Query  1165  WASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVG  1344
             WAS+FTQDA I+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL CFY VG
Sbjct  360   WASMFTQDASIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKMGANINLGCFYLVG  419

Query  1345  LPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATIS---  1515
             +PVA WL FF G+DF+GLW+GLLAAQ SCA+TML+VL RTDW+ QA+RAKELTATI+   
Sbjct  420   MPVAIWLSFFLGYDFRGLWVGLLAAQGSCAVTMLVVLVRTDWDLQAQRAKELTATIASFN  479

Query  1516  LVDDDDDD  1539
              +D ++D+
Sbjct  480   TIDRNEDE  487



>ref|XP_009623490.1| PREDICTED: MATE efflux family protein 5-like [Nicotiana tomentosiformis]
Length=513

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/489 (75%), Positives = 428/489 (88%), Gaps = 7/489 (1%)
 Frame = +1

Query  94    MEAPLISE----ENPKEEDHN--HNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMIS  255
             M +PLISE    E+ KE+ +N    + +L+LA  E KCI++IA PMI TGLLLY RSMIS
Sbjct  1     MLSPLISENTTIEDQKEQINNIPSQKNNLTLAILEVKCIANIAFPMIFTGLLLYSRSMIS  60

Query  256   MLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRT  435
             M+FLGRLG+LSLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFKL+GL+LQRT
Sbjct  61    MIFLGRLGELSLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFKLLGLTLQRT  120

Query  436   IVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLR  615
             I+LLL TSIPI+ LW  M+R+LILC Q+  I+ EAQ++ILYSLPDL+ QS LHPLRIYLR
Sbjct  121   IILLLLTSIPISFLWLYMKRLLILCGQNHNIASEAQNYILYSLPDLLTQSFLHPLRIYLR  180

Query  616   SQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSG  795
             SQS+TLPLT+CAAFAI++H+PINYFLV+VLNLGIKGVALS VW NFN+VGSL++Y+L S 
Sbjct  181   SQSITLPLTYCAAFAILIHIPINYFLVIVLNLGIKGVALSGVWTNFNLVGSLILYILVSE  240

Query  796   VYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGV  975
             V+KKTW G++ EC KG+KSLLNLAIPSC SVCLEWWWYE+MILLCGLL NP++TVASMG+
Sbjct  241   VHKKTWNGITSECLKGWKSLLNLAIPSCISVCLEWWWYEIMILLCGLLINPQSTVASMGI  300

Query  976   LIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAV  1155
             LIQTT+LIYIFPSSLSFGVSTRVGNELGA RP RAKLAAI+GLC+SFILG++AL F   V
Sbjct  301   LIQTTALIYIFPSSLSFGVSTRVGNELGANRPNRAKLAAIIGLCSSFILGVSALFFATMV  360

Query  1156  RNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFY  1335
             R +WA IFT D EI+ALTA VLPIIGLCELGNCPQTTGCG LRGTARPKLGA INL CFY
Sbjct  361   RKIWARIFTLDQEILALTAMVLPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLGCFY  420

Query  1336  FVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLL-VLGRTDWNDQARRAKELTATI  1512
              VG+PVA WLGFF G+DF+GLWLGLLAAQASCA+TM+L +L +T+W +QARRAKELTA I
Sbjct  421   LVGMPVAIWLGFFMGYDFRGLWLGLLAAQASCAVTMMLIILAKTNWEEQARRAKELTAII  480

Query  1513  SLVDDDDDD  1539
             +   +++D+
Sbjct  481   NGDYENEDE  489



>ref|XP_009339656.1| PREDICTED: MATE efflux family protein 5-like [Pyrus x bretschneideri]
Length=509

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/475 (77%), Positives = 418/475 (88%), Gaps = 3/475 (1%)
 Frame = +1

Query  100   APLISEENPKEE--DHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgr  273
             APLI  E+PK E  + NH++THLSLA  EAKCI++IA PM++TGLLLY RSMISMLFLGR
Sbjct  5     APLI-PESPKLEQYNQNHHKTHLSLALIEAKCIANIAFPMVLTGLLLYSRSMISMLFLGR  63

Query  274   lgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLF  453
             LG+LSLAGGSLAIGFANITGYS+LSGLAMGMEPICGQA+GAKRFKL+G +LQRT++LL  
Sbjct  64    LGELSLAGGSLAIGFANITGYSVLSGLAMGMEPICGQAYGAKRFKLLGQTLQRTVILLFL  123

Query  454   TSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTL  633
             TSIPIA LW NM+RIL+ C Q  EI+ EA S+ILYSLPDLIAQSLLHPLRIYLR+QS+T+
Sbjct  124   TSIPIAFLWLNMKRILLSCGQQDEIATEAYSYILYSLPDLIAQSLLHPLRIYLRTQSITV  183

Query  634   PLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTW  813
             PLTFCAA AI++H+P+NY LV VLNLGIKGVALS VW N N+VGSL+ Y+  SGVYKKTW
Sbjct  184   PLTFCAALAILLHIPVNYLLVHVLNLGIKGVALSGVWTNVNLVGSLIAYIAISGVYKKTW  243

Query  814   GGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTS  993
             GG S ECFKG+K+L+NLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTT+
Sbjct  244   GGFSKECFKGWKNLMNLAIPSCISVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTA  303

Query  994   LIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWAS  1173
             LIYIFPSSLSFGVSTRVGNELGA RP RA+LA IVGL  SFILG +AL F V VRN+WAS
Sbjct  304   LIYIFPSSLSFGVSTRVGNELGANRPERARLATIVGLSYSFILGFSALLFAVTVRNIWAS  363

Query  1174  IFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPV  1353
             +FTQ++EI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPKLGA INL CFY VG+PV
Sbjct  364   MFTQESEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLGCFYLVGMPV  423

Query  1354  AGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISL  1518
             A WL F+AGFDF+GLWLGLLAAQ SC LTML+VL RT+W+ Q +RAKELT T ++
Sbjct  424   AVWLSFYAGFDFRGLWLGLLAAQGSCVLTMLIVLFRTNWDLQGQRAKELTGTFTI  478



>ref|XP_009364191.1| PREDICTED: MATE efflux family protein 5-like [Pyrus x bretschneideri]
Length=509

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/475 (77%), Positives = 418/475 (88%), Gaps = 3/475 (1%)
 Frame = +1

Query  100   APLISEENPKEE--DHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgr  273
             APLI  E+PK E  + NH++THLSLA  EAKCI++IA PM++TGLLLY RSMISMLFLGR
Sbjct  5     APLI-PESPKLEQYNQNHHKTHLSLALIEAKCIANIAFPMVLTGLLLYSRSMISMLFLGR  63

Query  274   lgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLF  453
             LG+LSLAGGSLAIGFANITGYS+LSGLAMGMEPICGQA+GAKRFKL+G +LQRT++LL  
Sbjct  64    LGELSLAGGSLAIGFANITGYSVLSGLAMGMEPICGQAYGAKRFKLLGQTLQRTVILLFL  123

Query  454   TSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTL  633
             TSIPIA LW NM+RIL+ C Q  EI+ EA S+ILYSLPDLIAQSLLHPLRIYLR+QS+T+
Sbjct  124   TSIPIAFLWLNMKRILLSCGQQDEIATEAYSYILYSLPDLIAQSLLHPLRIYLRTQSITV  183

Query  634   PLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTW  813
             PLTFCAA AI++H+P+NY LV VLNLGIKGVALS VW N N+VGSL+ Y+  SGVYKKTW
Sbjct  184   PLTFCAALAILLHIPVNYLLVHVLNLGIKGVALSGVWTNVNLVGSLIAYIAISGVYKKTW  243

Query  814   GGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTS  993
             GG S ECFKG+K+L+NLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTT+
Sbjct  244   GGFSKECFKGWKNLMNLAIPSCISVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTA  303

Query  994   LIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWAS  1173
             LIYIFPSSLSFGVSTRVGNELGA RP RA+LA IVGL  SFILG +AL F V VRN+WAS
Sbjct  304   LIYIFPSSLSFGVSTRVGNELGANRPERARLATIVGLSYSFILGFSALLFAVTVRNIWAS  363

Query  1174  IFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPV  1353
             +FTQ++EI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPKLGA INL CFY VG+PV
Sbjct  364   MFTQESEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLGCFYLVGMPV  423

Query  1354  AGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISL  1518
             A WL F+AGFDF+GLWLGLLAAQ SC LTML+VL RT+W+ Q +RAKELT T ++
Sbjct  424   AVWLSFYAGFDFRGLWLGLLAAQGSCVLTMLIVLFRTNWDLQGQRAKELTGTFTI  478



>ref|XP_011033802.1| PREDICTED: MATE efflux family protein LAL5-like [Populus euphratica]
Length=526

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/496 (73%), Positives = 422/496 (85%), Gaps = 9/496 (2%)
 Frame = +1

Query  79    ACKEKMEAP--------LISEENPKEED-HNHNQTHLSLAAKEAKCISDIALPMIVTGLL  231
             +CK KM+          LI+   PK+    N  +THL+LA +EA+CI++IALPMI+TGLL
Sbjct  10    SCKCKMDPSSKVQESDRLITALIPKDPTFENQQRTHLALAIREARCIANIALPMILTGLL  69

Query  232   LYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKL  411
             LY RSMISMLFLGR G+L+LAGGSLAIGFANITGYSILSGL+MGMEPICGQAFGAKR+KL
Sbjct  70    LYSRSMISMLFLGRQGELALAGGSLAIGFANITGYSILSGLSMGMEPICGQAFGAKRYKL  129

Query  412   MGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLL  591
             +GL+LQRTI+LL   SIPIA+LW NM++IL+ C Q+ +IS EAQ +ILYSLPDL+AQS+L
Sbjct  130   LGLALQRTILLLFLVSIPIALLWFNMKKILLFCGQEDDISTEAQLYILYSLPDLVAQSIL  189

Query  592   HPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSL  771
             HPLRIYLRSQS+TLPLTFCA  +I++H+P+NY LV V NLGIKGVALS+VW NF++VGSL
Sbjct  190   HPLRIYLRSQSITLPLTFCATLSILLHIPVNYLLVSVFNLGIKGVALSAVWTNFSLVGSL  249

Query  772   VVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPR  951
             V+YV+ SGVYKKTWGG+S EC KG++SLLNLAIPSC SVCLEWWWYE+MILLCGLL NP 
Sbjct  250   VIYVMISGVYKKTWGGISLECLKGWRSLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPT  309

Query  952   ATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLA  1131
             ATVASMG+LIQTT+ IYIFPSSLSFGVSTRVGNELGA  P +AKLAA VGL +SF+LG A
Sbjct  310   ATVASMGILIQTTAFIYIFPSSLSFGVSTRVGNELGANNPQKAKLAATVGLSSSFVLGFA  369

Query  1132  ALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGA  1311
             AL F V VR +WAS+FTQDAEI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA
Sbjct  370   ALCFAVMVRKIWASMFTQDAEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKMGA  429

Query  1312  KINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRA  1491
              INL CFY VG+PVA WL F+AGFDF+GLWLGLLAAQ SC +TML VL RTDW  QA+RA
Sbjct  430   NINLGCFYLVGMPVAVWLSFYAGFDFKGLWLGLLAAQGSCVVTMLFVLARTDWECQAQRA  489

Query  1492  KELTATISLVDDDDDD  1539
             KELT  +S   D +++
Sbjct  490   KELTGNVSNDADHNEE  505



>ref|XP_011081156.1| PREDICTED: MATE efflux family protein 5 [Sesamum indicum]
Length=503

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/478 (75%), Positives = 416/478 (87%), Gaps = 4/478 (1%)
 Frame = +1

Query  94    MEAPLISEENPKEEDHNHN----QTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISML  261
             M  PL+SE    + +H+ +      HLSL+ KEAK I++I+LPMI+TGLL+Y RSMISML
Sbjct  1     MLNPLVSETPTSQLEHDGSCKKIDDHLSLSLKEAKSIANISLPMILTGLLVYSRSMISML  60

Query  262   FlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIV  441
             FLGRLGDLSLAGG+LA+GFANITGYSILSGLAMGMEPICGQAFGA+RFKL+GL+LQRT++
Sbjct  61    FLGRLGDLSLAGGALALGFANITGYSILSGLAMGMEPICGQAFGAQRFKLLGLTLQRTVI  120

Query  442   LLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQ  621
             LLL TSIPIA LW NM++ILI+C QD +I+MEAQS+IL+SLPDLIAQS LHPLRIYLRSQ
Sbjct  121   LLLLTSIPIAFLWLNMKQILIVCGQDHDIAMEAQSYILFSLPDLIAQSFLHPLRIYLRSQ  180

Query  622   SVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVY  801
             S+TLPLT+CAAF+I++H+PINY LV VLNLGIKG+AL+ VW NFN+VGSL++YV  SG Y
Sbjct  181   SITLPLTYCAAFSILLHIPINYLLVTVLNLGIKGIALAGVWTNFNLVGSLIMYVAISGAY  240

Query  802   KKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLI  981
             KKTW G+S +CFKG++SL+NLAIPSC SVCLEWWWYE+MILLCGLL NPRATVASMG+LI
Sbjct  241   KKTWAGISSDCFKGWRSLINLAIPSCISVCLEWWWYEIMILLCGLLINPRATVASMGILI  300

Query  982   QTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRN  1161
             QTTSLIYIFPSSLSFGVSTRVGNELGA RP  AKL+A +GLCASF LGLAAL F   VRN
Sbjct  301   QTTSLIYIFPSSLSFGVSTRVGNELGANRPKCAKLSATLGLCASFFLGLAALFFAFTVRN  360

Query  1162  VWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFV  1341
             +WAS+FTQD EI+ALT+ VLPIIGLCELGNCPQTTGCGALRGTARPK+GA INL CFY V
Sbjct  361   IWASLFTQDPEILALTSTVLPIIGLCELGNCPQTTGCGALRGTARPKMGANINLGCFYLV  420

Query  1342  GLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATIS  1515
             G+PVA  L F+ G+DF+GLW+GLLAAQ SCA+ ML VL RTDW  QA RAKELT   S
Sbjct  421   GMPVAVLLSFYYGYDFKGLWMGLLAAQGSCAVAMLFVLARTDWEVQAVRAKELTGKTS  478



>ref|XP_002274808.1| PREDICTED: MATE efflux family protein 6 [Vitis vinifera]
Length=534

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/485 (75%), Positives = 417/485 (86%), Gaps = 2/485 (0%)
 Frame = +1

Query  85    KEKMEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLF  264
             +  M  PLI  ++P      + QTHLSLA +EA  I+ IALPMI+TGLLLY RSMISMLF
Sbjct  27    EPHMGTPLI-PKSPTSNQQQYTQTHLSLAIREANSIAKIALPMILTGLLLYSRSMISMLF  85

Query  265   lgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVL  444
             LGRLG+L+LAGGSLA+GFANITGYSILSGLAMGMEPICGQAFGAKR  L+GLSLQRT++L
Sbjct  86    LGRLGELALAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGAKRHALLGLSLQRTVLL  145

Query  445   LLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQS  624
             LLFTS+PIA LW NM+RIL+ C QD +I+ EAQS++LYSLPDL AQSLLHPLRIYLR+QS
Sbjct  146   LLFTSLPIAFLWLNMKRILLFCGQDEDIAAEAQSYLLYSLPDLFAQSLLHPLRIYLRTQS  205

Query  625   VTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYK  804
             +TLPLTFCA  +I +H+PINY LV  LNLGIKGVALS VW NFN+VGSL++Y+L SGVYK
Sbjct  206   ITLPLTFCATMSIFMHIPINYLLVSHLNLGIKGVALSGVWTNFNLVGSLIIYLLISGVYK  265

Query  805   KTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQ  984
             KTWGG+S EC +G+K LLNLA+PSC SVCLEWWWYE+MILLCGLL NPRATVASMG+LIQ
Sbjct  266   KTWGGLSMECLRGWKPLLNLAVPSCISVCLEWWWYEIMILLCGLLLNPRATVASMGILIQ  325

Query  985   TTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNV  1164
             TTSLIYIFPSSLSF VSTRVGNELGA +P +AK AAI+GL  SF LG +AL F V VRNV
Sbjct  326   TTSLIYIFPSSLSFSVSTRVGNELGANQPNKAKCAAIIGLACSFTLGFSALLFAVMVRNV  385

Query  1165  WASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVG  1344
             WAS+FTQDAEI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARP++GA INL CFY VG
Sbjct  386   WASMFTQDAEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPRVGANINLGCFYLVG  445

Query  1345  LPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVD  1524
              PVA  LGF+AGFDF+GLWLGLLAAQASC +TML+VL RTDW  +A+RAK+LT+   LV 
Sbjct  446   TPVAVGLGFYAGFDFEGLWLGLLAAQASCVVTMLVVLNRTDWEVEAQRAKQLTSG-PLVP  504

Query  1525  DDDDD  1539
             D++DD
Sbjct  505   DEEDD  509



>ref|XP_009377927.1| PREDICTED: MATE efflux family protein 5-like, partial [Pyrus 
x bretschneideri]
Length=518

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/478 (76%), Positives = 413/478 (86%), Gaps = 3/478 (1%)
 Frame = +1

Query  91    KMEAPLISEENPKEEDHNHN--QTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLF  264
             K  APLI  E+PK E +N N  +THLSLA  EAKCI++IA PM++TGLLLY RSMISMLF
Sbjct  12    KKLAPLI-PESPKLEQYNQNPHKTHLSLALTEAKCIANIAFPMVLTGLLLYSRSMISMLF  70

Query  265   lgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVL  444
             LG LG+LSLAGGSLAIGFANITGYS+LSGLAMGMEPICGQA+GAK+FKL+GL+LQRT++L
Sbjct  71    LGHLGELSLAGGSLAIGFANITGYSVLSGLAMGMEPICGQAYGAKKFKLLGLTLQRTVIL  130

Query  445   LLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQS  624
             LL TSIPIA LW NM+ IL+ C Q  EI+ EA S+ILYSLPDLIAQSLLHPLRIYLR+QS
Sbjct  131   LLLTSIPIAFLWFNMKTILLFCGQQDEIATEAHSYILYSLPDLIAQSLLHPLRIYLRTQS  190

Query  625   VTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYK  804
             +T+PLTFCAA AI++H+PINY LV VLNLGIKGVALS VW N N+VGSL+ Y+  SGVYK
Sbjct  191   ITMPLTFCAALAILLHIPINYLLVHVLNLGIKGVALSGVWTNVNLVGSLIAYIAISGVYK  250

Query  805   KTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQ  984
             +TWGG S ECF G+K+L+NLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQ
Sbjct  251   RTWGGFSKECFAGWKNLMNLAIPSCISVCLEWWWYEIMILLCGLLLNPQATVASMGILIQ  310

Query  985   TTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNV  1164
             TT+LIYIFPSSLSFGVSTRVGNELGA RP RA+LA IVGL  SFILG +AL F V VRN+
Sbjct  311   TTALIYIFPSSLSFGVSTRVGNELGANRPERARLATIVGLSYSFILGFSALLFAVTVRNI  370

Query  1165  WASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVG  1344
             WAS+FT+D+EI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPKLGA INL CFY VG
Sbjct  371   WASMFTKDSEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLGCFYLVG  430

Query  1345  LPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISL  1518
             +PVA WL F+  FDF+GLWLGLLAAQ SC LTML  L  T+W+ QA+RAKELT T ++
Sbjct  431   MPVAVWLSFYEQFDFRGLWLGLLAAQGSCVLTMLFALFTTNWDLQAQRAKELTGTFTI  488



>ref|XP_002303561.2| hypothetical protein POPTR_0003s12140g [Populus trichocarpa]
 gb|EEE78540.2| hypothetical protein POPTR_0003s12140g [Populus trichocarpa]
Length=526

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/486 (73%), Positives = 416/486 (86%), Gaps = 1/486 (0%)
 Frame = +1

Query  85    KEKMEAPLISEENPKEED-HNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISML  261
             K +    LI+   PK+    N  +THL+LA +EA+CI++IALPMI+TGLLLY RSMISML
Sbjct  20    KVQESDRLITALIPKDPTFENQQRTHLALAIREARCIANIALPMILTGLLLYSRSMISML  79

Query  262   FlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIV  441
             FLGR G+L+LAGGSLAIGFANITGYSILSGL+MGMEPICGQAFGAKR+KL+GL+LQRTI+
Sbjct  80    FLGRQGELALAGGSLAIGFANITGYSILSGLSMGMEPICGQAFGAKRYKLLGLALQRTIL  139

Query  442   LLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQ  621
             LL   SIPIA+LW NM++IL+ C Q+ +IS EAQ +ILYSLPDL+AQS+LHPLRIYLRSQ
Sbjct  140   LLFLVSIPIALLWFNMKKILLFCGQEDDISTEAQLYILYSLPDLVAQSILHPLRIYLRSQ  199

Query  622   SVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVY  801
             S+TLPLTFCA  +I++H+P+NY LV V NLGIKGVAL +VW NF++VGSLV+YV+ SGV 
Sbjct  200   SITLPLTFCATLSILLHIPVNYLLVSVFNLGIKGVALGAVWTNFSLVGSLVIYVMISGVS  259

Query  802   KKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLI  981
             KKTWGG+S EC KG++SLLNLAIPSC SVCLEWWWYE+MILLCGLL NP ATVASMG+LI
Sbjct  260   KKTWGGISLECLKGWRSLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPTATVASMGILI  319

Query  982   QTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRN  1161
             QTT+ IYIFPSSLSFGVSTRVGNELGA  P +AKLAA VGL +SF+LG AAL F V VR 
Sbjct  320   QTTAFIYIFPSSLSFGVSTRVGNELGANNPQKAKLAATVGLSSSFVLGFAALCFAVMVRK  379

Query  1162  VWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFV  1341
             +WAS+FTQDAEI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL CFY V
Sbjct  380   IWASMFTQDAEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKIGANINLGCFYLV  439

Query  1342  GLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLV  1521
             G+PVA WL F+AGFDF+GLWLGLLAAQ SC +TML VL RTDW  QA+RAKELT  +S  
Sbjct  440   GMPVAVWLSFYAGFDFKGLWLGLLAAQGSCVVTMLFVLARTDWECQAQRAKELTGNVSND  499

Query  1522  DDDDDD  1539
              D +++
Sbjct  500   ADHNEE  505



>ref|XP_007210853.1| hypothetical protein PRUPE_ppa015493mg, partial [Prunus persica]
 gb|EMJ12052.1| hypothetical protein PRUPE_ppa015493mg, partial [Prunus persica]
Length=485

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/456 (78%), Positives = 404/456 (89%), Gaps = 0/456 (0%)
 Frame = +1

Query  151   QTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANIT  330
             +THLSLA  EAKCI++IA PM++TGLLLY R+MISMLFLGRLG+L+LAGGSLAIGFANIT
Sbjct  1     KTHLSLALIEAKCIANIAFPMVLTGLLLYSRTMISMLFLGRLGELALAGGSLAIGFANIT  60

Query  331   GYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILC  510
             GYS+LSGLAMGMEPICGQA+GAKRFKL+GL+LQRT++LLL TSIPIA+LW NM+RIL+ C
Sbjct  61    GYSVLSGLAMGMEPICGQAYGAKRFKLLGLTLQRTVILLLLTSIPIALLWFNMKRILLSC  120

Query  511   RQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYF  690
              Q  +I+ +A+S+I YSLPDLIAQSLLHPLRIYLRSQS+T+PLTFCA  AI++H+PINY 
Sbjct  121   GQQDDIATQAKSYIFYSLPDLIAQSLLHPLRIYLRSQSITVPLTFCATLAILLHIPINYL  180

Query  691   LVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAI  870
             LV VLNLGIKGVALS VW N N+VGSL+ Y+  SGVYKKTWGG S ECFKG+KSL+NLAI
Sbjct  181   LVCVLNLGIKGVALSGVWSNVNLVGSLIFYIAISGVYKKTWGGFSKECFKGWKSLMNLAI  240

Query  871   PSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGN  1050
             PSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTT LIYIFPSSLSFGVSTRVGN
Sbjct  241   PSCISVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTGLIYIFPSSLSFGVSTRVGN  300

Query  1051  ELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPII  1230
             ELGA RP RAKLA IVGL  SFILG +AL F V VRN+WAS++TQD+EI+ LT+ VLPII
Sbjct  301   ELGANRPERAKLATIVGLSYSFILGFSALLFAVTVRNIWASMYTQDSEIITLTSMVLPII  360

Query  1231  GLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgl  1410
             GLCELGNCPQTTGCG LRG ARPKLGA INL CFY VG+PVA WLGFFAGFDF+GLWLGL
Sbjct  361   GLCELGNCPQTTGCGVLRGAARPKLGANINLGCFYLVGMPVAVWLGFFAGFDFRGLWLGL  420

Query  1411  laaqaSCALTMLLVLGRTDWNDQARRAKELTATISL  1518
             LAAQ SC +TML VL RT+W  QA+RAKELT T ++
Sbjct  421   LAAQGSCVVTMLFVLARTNWELQAQRAKELTGTFTI  456



>ref|XP_008369500.1| PREDICTED: MATE efflux family protein 5 [Malus domestica]
 ref|XP_008345365.1| PREDICTED: MATE efflux family protein 5-like [Malus domestica]
Length=507

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/476 (75%), Positives = 411/476 (86%), Gaps = 3/476 (1%)
 Frame = +1

Query  97    EAPLISEENPKEEDHNHN--QTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlg  270
             +APLI  E+PK E +N N  +THLSLA  EAKCI++IA PM++TGLLLY RSMISMLFLG
Sbjct  3     KAPLI-PESPKLEQYNQNPHKTHLSLALTEAKCIANIAFPMVLTGLLLYSRSMISMLFLG  61

Query  271   rlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLL  450
              LG+LSLAGGSL+IGFANITGYS+L GLAMGMEPICGQA+GAK+FKL+GL+LQRT++LLL
Sbjct  62    HLGELSLAGGSLSIGFANITGYSVLXGLAMGMEPICGQAYGAKKFKLLGLTLQRTVILLL  121

Query  451   FTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVT  630
              TSIPIA LW NM+ IL+ C Q  EI+ EA S+ILYSLPDL+AQSLLHPLRIYLR+QS T
Sbjct  122   LTSIPIAFLWFNMKXILLFCGQQDEIATEAHSYILYSLPDLLAQSLLHPLRIYLRTQSXT  181

Query  631   LPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKT  810
             +PLTFCAA AI++H+PINY LV VLNLGIKG ALS VW N N+VGSL+ Y+  SGVYKKT
Sbjct  182   MPLTFCAALAILLHIPINYLLVHVLNLGIKGXALSGVWTNVNLVGSLIAYIAISGVYKKT  241

Query  811   WGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTT  990
             WGG S ECF G+K+L+NLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTT
Sbjct  242   WGGFSKECFTGWKNLMNLAIPSCISVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTT  301

Query  991   SLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWA  1170
             +LIYIFPSSLSFGVSTRVGNELGA RP RA+LA IVGL  SFILG +AL F V VRN+WA
Sbjct  302   ALIYIFPSSLSFGVSTRVGNELGANRPERARLATIVGLSYSFILGFSALLFAVTVRNIWA  361

Query  1171  SIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLP  1350
             S+FT+D+EI+ALT+ VLPIIGLCELGNCPQTTGCG LRG ARPKLGA INL CFY VG+P
Sbjct  362   SMFTKDSEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGIARPKLGANINLGCFYLVGMP  421

Query  1351  VAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISL  1518
             VA WL F+  FDF+GLWLGLLAAQ SC LTML VL RT+W+ QA+RAKELT T ++
Sbjct  422   VAVWLSFYVQFDFRGLWLGLLAAQGSCVLTMLFVLFRTNWDLQAQRAKELTGTFTI  477



>ref|XP_009344271.1| PREDICTED: MATE efflux family protein 5-like [Pyrus x bretschneideri]
Length=508

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/475 (76%), Positives = 411/475 (87%), Gaps = 3/475 (1%)
 Frame = +1

Query  100   APLISEENPKEEDHNHN--QTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgr  273
             APLI  E+PK E +N N  +THLSLA  EAKCI++IA PM++TGLLLY RSMISMLFLG 
Sbjct  5     APLI-PESPKLEQYNQNPHKTHLSLALTEAKCIANIAFPMVLTGLLLYSRSMISMLFLGH  63

Query  274   lgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLF  453
             LG+LSLAGGSLAIGFANITGYS+LSGLAMGMEPICGQA+GAK+FKL+GL+LQRT++LLL 
Sbjct  64    LGELSLAGGSLAIGFANITGYSVLSGLAMGMEPICGQAYGAKKFKLLGLTLQRTVILLLL  123

Query  454   TSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTL  633
             TSIPIA LW NM+ IL+ C Q  EI+ EA S+ILYSLPDLIAQSLLHPLRIYLR+QS+T+
Sbjct  124   TSIPIAFLWFNMKTILLFCGQQDEIATEAHSYILYSLPDLIAQSLLHPLRIYLRTQSITM  183

Query  634   PLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTW  813
             PLTFCAA AI++H+PINY LV VLNLGIKGVALS VW N N+VGSL+ Y+  SGVYK+TW
Sbjct  184   PLTFCAALAILLHIPINYLLVHVLNLGIKGVALSGVWTNANLVGSLIAYIAISGVYKRTW  243

Query  814   GGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTS  993
             GG S E F G+K+L+NLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTT+
Sbjct  244   GGFSKEFFAGWKNLMNLAIPSCISVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTA  303

Query  994   LIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWAS  1173
             LIYIFPSSLSFGVSTRVGNELGA RP RA+LA IVGL  SFILG +AL F V VRN+WAS
Sbjct  304   LIYIFPSSLSFGVSTRVGNELGANRPERARLATIVGLSYSFILGFSALLFAVTVRNIWAS  363

Query  1174  IFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPV  1353
             +FT+D+EI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPKLGA INL CFY VG+PV
Sbjct  364   MFTKDSEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLGCFYLVGMPV  423

Query  1354  AGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISL  1518
             A WL  +  FDF+GLWLGLLAAQ SC LTML  L RT+W+ QA+RAKELT T ++
Sbjct  424   AVWLSLYEQFDFRGLWLGLLAAQGSCVLTMLFALFRTNWDLQAQRAKELTGTFTI  478



>ref|XP_009764157.1| PREDICTED: MATE efflux family protein 5-like [Nicotiana sylvestris]
Length=517

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/479 (75%), Positives = 414/479 (86%), Gaps = 6/479 (1%)
 Frame = +1

Query  94    MEAPLISE----ENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISML  261
             M  PL+SE    EN  EE      T L LA  E K I+ IALPMI  GLLLY RSMISML
Sbjct  1     MLTPLVSEIPRLENQNEESKTEQNT-LFLAISETKSIATIALPMIFIGLLLYSRSMISML  59

Query  262   FlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIV  441
             FLGRLG+LSLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFK++GLSLQRTI+
Sbjct  60    FLGRLGELSLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFKILGLSLQRTIL  119

Query  442   LLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQ  621
             LLL  SIPI+ +WCNM++ILI C QD EI+ +AQS+I+YS+PDL A S LHPLRIYLRSQ
Sbjct  120   LLLLVSIPISFMWCNMKKILIFCGQDHEIATQAQSYIIYSIPDLFALSFLHPLRIYLRSQ  179

Query  622   SVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVY  801
             S+ +PLT+CAA AI+VH+PINYFLV+VLNLGIKGVALS VW NFN+VGSL+ Y++ SGV+
Sbjct  180   SIIMPLTYCAALAILVHIPINYFLVIVLNLGIKGVALSGVWTNFNLVGSLIAYIIVSGVH  239

Query  802   KKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLI  981
             KKTW  +S ECFKG+K+LLNLAIPSC SVCLEWWWYE+MILLCGLL NP+A+VASMG+LI
Sbjct  240   KKTWSAISKECFKGWKTLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPKASVASMGILI  299

Query  982   QTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRN  1161
             QTTSLIYIFPSSLSFGVSTRVGNELGA RP +AK+AAI+GLC SFI GL AL+F + VRN
Sbjct  300   QTTSLIYIFPSSLSFGVSTRVGNELGANRPNQAKIAAIIGLCYSFIFGLLALSFAILVRN  359

Query  1162  VWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFV  1341
             +WAS++TQD EI+ALT+ +LPIIGLCELGNCPQTTGCG LRGTARPKLGA INL CFY V
Sbjct  360   IWASMYTQDQEIIALTSIILPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLGCFYLV  419

Query  1342  GLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLL-VLGRTDWNDQARRAKELTATIS  1515
             G+P+A +LGFF GFDF+GLW+GLLAAQASCA+TMLL +L RT+W DQA+RAKELTA I 
Sbjct  420   GMPIAIYLGFFRGFDFEGLWIGLLAAQASCAVTMLLIILARTNWEDQAKRAKELTANIQ  478



>ref|XP_009759894.1| PREDICTED: MATE efflux family protein 5-like [Nicotiana sylvestris]
Length=512

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/489 (75%), Positives = 424/489 (87%), Gaps = 7/489 (1%)
 Frame = +1

Query  94    MEAPLISEENPKEEDHNHN------QTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMIS  255
             M  PLISE    E    HN      + HL+L+  EAKCI++IA PMI TGL+LY RSMIS
Sbjct  1     MLTPLISENPTIEYQKEHNNYIPRQKNHLTLSILEAKCIANIAFPMIFTGLILYSRSMIS  60

Query  256   MLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRT  435
             M+FLGRLG+LSLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFKL+GL+LQRT
Sbjct  61    MIFLGRLGELSLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFKLLGLTLQRT  120

Query  436   IVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLR  615
             I+LLL TSIPI+ LW  M+R+LILC Q+  I+ +AQ++ILYSLPDL+ QS LHPLRIYLR
Sbjct  121   ILLLLLTSIPISFLWLYMKRLLILCGQNHNIATQAQNYILYSLPDLLTQSFLHPLRIYLR  180

Query  616   SQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSG  795
             SQS+TLPLT+CAAF+I++H+PINYFLV+VLNLGIKGVALS VW NFN+VGSL++Y++FS 
Sbjct  181   SQSITLPLTYCAAFSILIHIPINYFLVIVLNLGIKGVALSGVWTNFNLVGSLILYIIFSR  240

Query  796   VYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGV  975
             V+KKTW G+S EC KG+KSLLNLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+
Sbjct  241   VHKKTWNGISSECLKGWKSLLNLAIPSCISVCLEWWWYEIMILLCGLLINPQATVASMGI  300

Query  976   LIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAV  1155
             LIQTTSLIYIFPSSLSFGVSTRVGNELGA RP RAKLAAI+GLC+S ILG++AL F   V
Sbjct  301   LIQTTSLIYIFPSSLSFGVSTRVGNELGANRPNRAKLAAIIGLCSSLILGISALFFATMV  360

Query  1156  RNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFY  1335
             RN+WA IFTQD EI+ LTA +LPIIGLCELGNCPQTTGCG LRGTARPKLGA INL CFY
Sbjct  361   RNIWARIFTQDQEIVTLTAMILPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLGCFY  420

Query  1336  FVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVL-GRTDWNDQARRAKELTATI  1512
             FVG+PVA WLGF+ GFD +GLWLGLLAAQASCA+TM+L++  +T+W DQARRAKELT+ I
Sbjct  421   FVGMPVAIWLGFYMGFDLKGLWLGLLAAQASCAVTMMLIIFAKTNWEDQARRAKELTSII  480

Query  1513  SLVDDDDDD  1539
                D++D+ 
Sbjct  481   GDYDNEDEK  489



>ref|XP_002509706.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF51093.1| multidrug resistance pump, putative [Ricinus communis]
Length=539

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/499 (73%), Positives = 417/499 (84%), Gaps = 4/499 (1%)
 Frame = +1

Query  40    KNPLFFLPFAFISACKEKMEAPLISEENP---KEEDHNHNQTHLSLAAKEAKCISDIALP  210
             K+ L   P   +    + +  PL+  +NP   + ++ N    HLSLA KEAKCI++IA P
Sbjct  12    KSNLELDPSTKVQKQSDMLSTPLV-PKNPTLSQPQNTNPQNNHLSLAIKEAKCIANIAFP  70

Query  211   MIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAF  390
             MI+TGLLLY RSMISMLFLGRLG+L+LAGGSLAIGFANITGYSILSGLAMGMEPICGQAF
Sbjct  71    MILTGLLLYSRSMISMLFLGRLGELALAGGSLAIGFANITGYSILSGLAMGMEPICGQAF  130

Query  391   GAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPD  570
             GAKR+KL+GL+LQRTI+LL   S PIA LW NM++ILI C Q+ +I+ EAQS+ILYSLPD
Sbjct  131   GAKRYKLIGLTLQRTILLLFLISFPIAFLWFNMKKILIFCGQEDDIATEAQSYILYSLPD  190

Query  571   LIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCN  750
             LI QSLLHPLRIYLR+QS+TLPLTFCAA +I++H+PINYFLV VLNLGIKGVALS +W N
Sbjct  191   LILQSLLHPLRIYLRTQSITLPLTFCAALSILLHIPINYFLVSVLNLGIKGVALSGIWTN  250

Query  751   FNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLC  930
             FN+V SL++YVLFSGVYKKTW G+S ECFKG+KSLLNLAIPSC SVCLEWWWYE+MILLC
Sbjct  251   FNLVASLIIYVLFSGVYKKTWSGISSECFKGWKSLLNLAIPSCISVCLEWWWYEIMILLC  310

Query  931   GLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCA  1110
             GLL NPRATVASMG+LIQTT+LIYIFPSSLSF VSTRVGNELGA  P +AK AAIV L +
Sbjct  311   GLLLNPRATVASMGILIQTTALIYIFPSSLSFSVSTRVGNELGASNPLKAKFAAIVCLSS  370

Query  1111  SFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGT  1290
             SF LG +AL F V VRNVW+ +FT+DAEI+ALT+ VLPIIGLCELGNCPQTTGCG LRGT
Sbjct  371   SFFLGFSALFFAVMVRNVWSCMFTEDAEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGT  430

Query  1291  ARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDW  1470
             A PK GA INL CFY VG+PVA +L F+AGFDF+GLWLGLLAAQ SC +TML VL RTDW
Sbjct  431   ATPKTGANINLACFYLVGMPVAVFLSFYAGFDFKGLWLGLLAAQGSCVVTMLFVLTRTDW  490

Query  1471  NDQARRAKELTATISLVDD  1527
               QARRA++LT  +  V  
Sbjct  491   ELQARRARQLTGNVENVGS  509



>ref|XP_009628917.1| PREDICTED: MATE efflux family protein 5-like [Nicotiana tomentosiformis]
Length=517

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/479 (75%), Positives = 413/479 (86%), Gaps = 6/479 (1%)
 Frame = +1

Query  94    MEAPLISE----ENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISML  261
             M  PL+SE    EN  E+      T L LA  E K +++IALPMI  GLLLY RSMISML
Sbjct  1     MLTPLVSEIPRLENQNEQSKTEQHT-LFLAISETKSMANIALPMIFIGLLLYSRSMISML  59

Query  262   FlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIV  441
             FLGRLG+LSLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFK++GLSLQRTI+
Sbjct  60    FLGRLGELSLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFKILGLSLQRTIL  119

Query  442   LLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQ  621
             LLL  SIPI+ LWCNM++IL+ C QD +I+ +AQS+I+YS+PDL A S LHPLRIYLRSQ
Sbjct  120   LLLLVSIPISFLWCNMKQILVFCGQDHDIATQAQSYIIYSIPDLFALSFLHPLRIYLRSQ  179

Query  622   SVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVY  801
             S+ +PLT+CAA AI+VH+PINYFLV+VLNLGIKGVALS VW NFN+VGSL+ Y++ SGV+
Sbjct  180   SIIMPLTYCAALAILVHIPINYFLVIVLNLGIKGVALSGVWTNFNLVGSLIAYIIVSGVH  239

Query  802   KKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLI  981
             KKTW  +S ECFKG+K+LLNL+IPSC SVCLEWWWYE+MILLCGLL NP+A VASMG+LI
Sbjct  240   KKTWSAISKECFKGWKTLLNLSIPSCISVCLEWWWYEIMILLCGLLLNPKANVASMGILI  299

Query  982   QTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRN  1161
             QTTSLIYIFPSSLS GVSTRVGNELGA RP +AKLAAI+GLC SFI GL AL+F + VRN
Sbjct  300   QTTSLIYIFPSSLSVGVSTRVGNELGANRPNQAKLAAIIGLCYSFIFGLLALSFAILVRN  359

Query  1162  VWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFV  1341
             +WAS++TQD EI+ALT+ +LPIIGLCELGNCPQTTGCG LRGTARPKLGA INL CFY V
Sbjct  360   IWASMYTQDQEIIALTSIILPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLGCFYLV  419

Query  1342  GLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLL-VLGRTDWNDQARRAKELTATIS  1515
             G+PVA +LGFF G+DF+GLW+GLLAAQASCA+TMLL +L RT+W DQA+RAKELTA I 
Sbjct  420   GMPVAIYLGFFRGYDFKGLWIGLLAAQASCAVTMLLIILARTNWEDQAKRAKELTANIQ  478



>ref|XP_009371284.1| PREDICTED: MATE efflux family protein LAL5-like [Pyrus x bretschneideri]
Length=556

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/479 (73%), Positives = 414/479 (86%), Gaps = 7/479 (1%)
 Frame = +1

Query  88    EKMEAPLIS-------EENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRS  246
             + + +PLIS       E+ PK + + H ++H SLA KEA  I+ IA PMI+TGLLLY RS
Sbjct  29    KTLTSPLISKTLTSQPEQVPKLQFNPHKESHFSLALKEANSIAVIAFPMILTGLLLYSRS  88

Query  247   MISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSL  426
             +ISMLFLGRLG+L+LAGGSLA+GFANITGYSI+SGLAMGMEPICGQAFGA++  L+GLSL
Sbjct  89    IISMLFLGRLGELALAGGSLAVGFANITGYSIISGLAMGMEPICGQAFGARKHTLLGLSL  148

Query  427   QRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRI  606
             QRT++LLLFTS+PI++LW NM++IL++C QD  I+ EAQ ++L SLPDL+AQS LHPLRI
Sbjct  149   QRTVLLLLFTSLPISLLWLNMKKILLICGQDEAIAAEAQLYLLCSLPDLLAQSFLHPLRI  208

Query  607   YLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVL  786
             YLRSQS+TLPL+ CA  AI++H+PINYFLV  L+LGIKGVALS VW NFN+V SL+VY++
Sbjct  209   YLRSQSITLPLSLCATLAIILHIPINYFLVSHLDLGIKGVALSGVWSNFNLVASLIVYII  268

Query  787   FSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVAS  966
              SGVYKKTWGG+S ECF+ +++LLNLA+PSC SVCLEWWWYE+MILLCGLL NPRATVAS
Sbjct  269   VSGVYKKTWGGISMECFREWRTLLNLAVPSCISVCLEWWWYEIMILLCGLLINPRATVAS  328

Query  967   MGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFG  1146
             MGVLIQTT+LIYIFPSSLSF VSTRVGNE+GA  P +AKLAAIVGLC SF+LGL+AL F 
Sbjct  329   MGVLIQTTALIYIFPSSLSFSVSTRVGNEIGANNPKKAKLAAIVGLCCSFVLGLSALVFA  388

Query  1147  VAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLR  1326
               VRN+WAS+FTQD EI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL 
Sbjct  389   TMVRNIWASMFTQDKEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLG  448

Query  1327  CFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
             CFY VG+PVA  LGFF GFDFQGLWLGLLAA+ SCALTML+VLGRTDW  +AR+AKELT
Sbjct  449   CFYLVGMPVAVGLGFFLGFDFQGLWLGLLAAEGSCALTMLVVLGRTDWELEARKAKELT  507



>ref|XP_004300756.1| PREDICTED: MATE efflux family protein 8-like [Fragaria vesca 
subsp. vesca]
Length=500

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/484 (74%), Positives = 413/484 (85%), Gaps = 7/484 (1%)
 Frame = +1

Query  109   ISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdls  288
             +S ++   ++    +THLSLA  EAK I+ IA PM++TGLLLY RSMISMLFLG LG+L+
Sbjct  1     MSTDSLIPQNQRPQKTHLSLALNEAKSIASIAFPMVLTGLLLYSRSMISMLFLGHLGELA  60

Query  289   laggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPI  468
             LAGGSLAIGFANITGYS+LSGLAMGMEPICGQAFGAKRFK++G +LQRT++LLL TSIPI
Sbjct  61    LAGGSLAIGFANITGYSVLSGLAMGMEPICGQAFGAKRFKVLGHTLQRTVILLLLTSIPI  120

Query  469   AILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFC  648
             + LW NM+RIL+ C Q  EI+ EAQS+ILYSLPDLIAQSLLHPLRIYLR+QS+T+PLT C
Sbjct  121   SFLWFNMKRILLFCGQQDEIANEAQSYILYSLPDLIAQSLLHPLRIYLRTQSITVPLTCC  180

Query  649   AAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSW  828
             A  AI++H+PINY LV VL LGIKGVALS VW N N+VGSL+VY+  SGVYKKTWGG S 
Sbjct  181   ATLAILLHIPINYLLVSVLGLGIKGVALSGVWTNVNLVGSLIVYMAVSGVYKKTWGGFST  240

Query  829   ECF-KGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYI  1005
             + F KG+KSLLNLA+PSC SVCLEWWWYE+MILLCGLL +P+ATVASMG+LIQTT+LIYI
Sbjct  241   QYFFKGWKSLLNLAVPSCISVCLEWWWYEIMILLCGLLLDPQATVASMGILIQTTALIYI  300

Query  1006  FPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQ  1185
             FPSSLSFGVSTRVGNELGA RP RAKLAAI+GL  SF+ GL+AL F V VRN+WAS+FT+
Sbjct  301   FPSSLSFGVSTRVGNELGANRPERAKLAAIIGLAYSFVFGLSALLFAVMVRNIWASMFTE  360

Query  1186  DAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWL  1365
             D+ I+ALTA VLPIIGLCELGNCPQTTGCG LRG+ARPKLGA INL CFY VG+PVA WL
Sbjct  361   DSHIIALTAMVLPIIGLCELGNCPQTTGCGVLRGSARPKLGANINLGCFYLVGMPVAVWL  420

Query  1366  GFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTA-TISLVDD-----  1527
             GFFAGFDF+GLWLGLLAAQ SC +TML VL +T+W  QA+RAKELTA + + VDD     
Sbjct  421   GFFAGFDFRGLWLGLLAAQGSCVVTMLFVLAKTNWELQAKRAKELTAESYTTVDDGSLNF  480

Query  1528  DDDD  1539
             D+ D
Sbjct  481   DEAD  484



>ref|XP_007040126.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY24627.1| MATE efflux family protein [Theobroma cacao]
Length=511

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/484 (72%), Positives = 413/484 (85%), Gaps = 3/484 (1%)
 Frame = +1

Query  94    MEAPLISEENP--KEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFl  267
             M  PL + +NP  ++ D +  +T LSL  KEAKCI+ IA PM++TG+LLY RSMISMLFL
Sbjct  1     MLTPL-NPKNPTAQKGDQDSEKTCLSLVVKEAKCIASIAFPMVLTGILLYSRSMISMLFL  59

Query  268   grlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLL  447
             GRLG+L+LAGGSLAIGFANITGYS+LSGLAMGMEPICGQAFGAKR+KL+GL++QR I+LL
Sbjct  60    GRLGELALAGGSLAIGFANITGYSVLSGLAMGMEPICGQAFGAKRYKLLGLTMQRMILLL  119

Query  448   LFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSV  627
             L TSI IA LW NM+ IL+ C QD  I+ EAQS+ILYSLPDL+AQS+LHPLR YLR+QS+
Sbjct  120   LLTSIFIASLWFNMKNILLFCGQDENIANEAQSYILYSLPDLLAQSILHPLRTYLRTQSI  179

Query  628   TLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKK  807
             TLPLT+C+A AI++H+P+NY LV VLNLGIKGVAL S+W NFN+VGSL+VYV  SGVYKK
Sbjct  180   TLPLTYCSALAILLHIPVNYLLVSVLNLGIKGVALGSIWTNFNLVGSLIVYVKISGVYKK  239

Query  808   TWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQT  987
             TWGG+S EC KG+K LLNL+IPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQT
Sbjct  240   TWGGISSECLKGWKYLLNLSIPSCISVCLEWWWYEIMILLCGLLLNPQATVASMGILIQT  299

Query  988   TSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVW  1167
             TSLIYIFPSSLSFGVSTRVGNELGA  P +AKLAAIVGL +S ++GL+AL F + VR  W
Sbjct  300   TSLIYIFPSSLSFGVSTRVGNELGANNPNKAKLAAIVGLSSSSVIGLSALAFAILVRKKW  359

Query  1168  ASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGL  1347
             A++FT+D EI+ALT+ VLPI+GLCELGNCPQTTGCG LRGTARPK GA INL CFY VG+
Sbjct  360   ATMFTEDPEIIALTSMVLPILGLCELGNCPQTTGCGVLRGTARPKSGANINLGCFYLVGM  419

Query  1348  PVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDD  1527
             P+A WL F AGFDF+GLWLGLLAAQASC +TML V+  TDW+ QARRA+ELT  + + DD
Sbjct  420   PIAVWLSFLAGFDFKGLWLGLLAAQASCVVTMLFVVACTDWDLQARRAQELTRAVPVDDD  479

Query  1528  DDDD  1539
             D  +
Sbjct  480   DQTN  483



>ref|XP_008376528.1| PREDICTED: MATE efflux family protein LAL5-like [Malus domestica]
Length=556

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/477 (73%), Positives = 409/477 (86%), Gaps = 7/477 (1%)
 Frame = +1

Query  94    MEAPLIS-------EENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMI  252
             + +PLIS       E+ PK + + H ++H SLA KEA  I+ IA PMI+TGLLLY RS+I
Sbjct  31    LTSPLISKTITSQPEQVPKLQFNPHKESHFSLALKEANSIAVIAFPMILTGLLLYSRSII  90

Query  253   SMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQR  432
             SMLFLGRLG+L+LAGGSLA+GFANITGYSILSGLAMGMEPICGQAFGA++  L+GLSLQR
Sbjct  91    SMLFLGRLGELALAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGARKHALLGLSLQR  150

Query  433   TIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYL  612
             T++LLLFTS+PI++LW NM++IL++C QD  I+ EAQ ++L SLPDL+AQS LHPLRIYL
Sbjct  151   TVLLLLFTSLPISLLWLNMKKILLICGQDEAIAAEAQLYLLCSLPDLLAQSFLHPLRIYL  210

Query  613   RSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFS  792
             RSQS+TLPL+ CA  AI++H+PINYFLV  L+LGIKGVALS VW NFN+V SL+ Y++  
Sbjct  211   RSQSITLPLSLCATLAIILHIPINYFLVSHLDLGIKGVALSGVWTNFNLVASLIAYIIVY  270

Query  793   GVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMG  972
             GVYKKTWGG+S ECFK +++LLNLA+PSC SVCLEWWWYE+MILLCGLL NPRATVASMG
Sbjct  271   GVYKKTWGGISMECFKEWRTLLNLAVPSCISVCLEWWWYEIMILLCGLLINPRATVASMG  330

Query  973   VLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVA  1152
             VLIQTT+LIYIFPSSLSF VSTRVGNE+GA  P +AKLAAIVGLC SF+LGL+AL F   
Sbjct  331   VLIQTTALIYIFPSSLSFSVSTRVGNEIGANNPKKAKLAAIVGLCCSFVLGLSALVFATM  390

Query  1153  VRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCF  1332
             VRN+WAS+FTQD EI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL CF
Sbjct  391   VRNIWASMFTQDKEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCF  450

Query  1333  YFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
             Y VG+PVA  LGFF GFDFQGLW GLLAA+ SCALTML VLGRTDW  +AR+AKELT
Sbjct  451   YLVGMPVAVGLGFFLGFDFQGLWFGLLAAEGSCALTMLAVLGRTDWELEARKAKELT  507



>ref|XP_008234289.1| PREDICTED: MATE efflux family protein LAL5 [Prunus mume]
Length=555

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/473 (73%), Positives = 408/473 (86%), Gaps = 1/473 (0%)
 Frame = +1

Query  121   NPKEEDHN-HNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslag  297
             N   + H  + ++H SLA KEA  I+ IA PMI+TGLLLY RSMISMLFLGRLG+L+LAG
Sbjct  55    NAHHQTHKPYQKSHFSLALKEANSIASIAFPMILTGLLLYSRSMISMLFLGRLGELALAG  114

Query  298   gslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAIL  477
             GSLA+GFANITGYSILSGLAMGMEPICGQAFGAKR  L+GLSLQRT++LL+FTS+PI++L
Sbjct  115   GSLAVGFANITGYSILSGLAMGMEPICGQAFGAKRHTLLGLSLQRTVLLLIFTSLPISLL  174

Query  478   WCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAF  657
             W NM+++L+LC QD  I+ EAQ ++L SLPDL+AQSLLHPLRIYLR+QS+TLPLTFCA  
Sbjct  175   WLNMKKLLLLCGQDETIASEAQLYLLCSLPDLLAQSLLHPLRIYLRTQSITLPLTFCATL  234

Query  658   AIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECF  837
             AI++H+PINYFLV  LNLGI+GVALS VW NFN+V SL++Y++ SGV+KKTWGG+S +CF
Sbjct  235   AIILHIPINYFLVSYLNLGIRGVALSGVWSNFNLVASLIIYIIISGVHKKTWGGISMDCF  294

Query  838   KGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSS  1017
             + +++LLNLA+PSC SVCLEWWWYE+MILLCGLL NPRATVASMG+LIQTTSLIYIFPSS
Sbjct  295   REWRTLLNLAVPSCISVCLEWWWYEIMILLCGLLLNPRATVASMGILIQTTSLIYIFPSS  354

Query  1018  LSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEI  1197
             LSF VSTRVGNE+GA +P +AK+AAIVGLC SFILGLAAL F V VRN+WAS+FTQD EI
Sbjct  355   LSFSVSTRVGNEIGANQPKKAKIAAIVGLCCSFILGLAALIFAVMVRNIWASMFTQDKEI  414

Query  1198  MALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFA  1377
             M LT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL CFY VG+PVA  LGF  
Sbjct  415   MKLTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGMPVAVGLGFVL  474

Query  1378  GFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDD  1536
               DFQGLWLGLLAAQ  CALTML+VLG TDW  +A++AK+LT    +VDD ++
Sbjct  475   ELDFQGLWLGLLAAQGCCALTMLVVLGVTDWEFEAQKAKQLTGAEEVVDDSEE  527



>ref|XP_009341257.1| PREDICTED: MATE efflux family protein LAL5-like isoform X2 [Pyrus 
x bretschneideri]
Length=549

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/493 (71%), Positives = 417/493 (85%), Gaps = 11/493 (2%)
 Frame = +1

Query  88    EKMEAPLIS-------EENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRS  246
             + + +PLIS       E+  K +   H ++H SLA KEA  I+ IA PMI+TGLLLY RS
Sbjct  29    KTLTSPLISKTITPQPEQVHKSQFKPHKRSHFSLALKEANSIAAIAFPMILTGLLLYSRS  88

Query  247   MISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSL  426
             MISMLFLG LG+L+LAGGSLA+GFANITGYSILSGLAMGMEPICGQAFGAK+  L+GLSL
Sbjct  89    MISMLFLGGLGELALAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGAKKNTLLGLSL  148

Query  427   QRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRI  606
             QRT++LLLFTS+PI++LW N+++IL++C QD  I+ EAQ ++L SLPDL+AQS LHPLRI
Sbjct  149   QRTVLLLLFTSLPISLLWLNVKKILLICGQDEAIAAEAQLYLLCSLPDLLAQSFLHPLRI  208

Query  607   YLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVL  786
             YLRSQS+TLPLT CA  AI++H+PINY LV  L+LGIKGVALS VW NFN+V S+++Y++
Sbjct  209   YLRSQSITLPLTLCATLAIILHIPINYLLVSHLDLGIKGVALSGVWSNFNLVASVIIYII  268

Query  787   FSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVAS  966
              SGV+KKTWGG+S +CF+ +++LLNLA+PSC SVCLEWWWYE+MILLCGLL NPRATVAS
Sbjct  269   VSGVHKKTWGGISMDCFREWRTLLNLAVPSCISVCLEWWWYEIMILLCGLLINPRATVAS  328

Query  967   MGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFG  1146
             MGVLIQTT+LIYIFPSSLSF VSTRVGNE+GA  P +AKLAAIVGLC SF+LGL+AL F 
Sbjct  329   MGVLIQTTALIYIFPSSLSFSVSTRVGNEIGANNPKKAKLAAIVGLCCSFMLGLSALVFA  388

Query  1147  VAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLR  1326
               VRN+WAS+FTQD +I+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL 
Sbjct  389   TTVRNIWASMFTQDKDIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLG  448

Query  1327  CFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT-  1503
             CFY VG+PVA  LGFF GFDFQGLWLGLLAA+ SCALTML+VLGRTDW  +AR+AKELT 
Sbjct  449   CFYLVGMPVAVGLGFFLGFDFQGLWLGLLAAEGSCALTMLVVLGRTDWEFEARKAKELTG  508

Query  1504  ---ATISLVDDDD  1533
                A +++ D +D
Sbjct  509   ANAAEVAVGDSED  521



>ref|XP_006358865.1| PREDICTED: MATE efflux family protein DTX1-like [Solanum tuberosum]
Length=498

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/485 (74%), Positives = 419/485 (86%), Gaps = 8/485 (2%)
 Frame = +1

Query  94    MEAPLISEENPKEEDHN--HNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFl  267
             M +PL+ E   KEE +N    + HL+LA  EAKCI +IA PMI TGL+LY RS+ISM+FL
Sbjct  1     MLSPLVDE---KEESNNIPKQKNHLTLAISEAKCIGNIAFPMIFTGLILYSRSIISMIFL  57

Query  268   grlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLL  447
             G LG+LSLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRF ++GL+LQRTI+LL
Sbjct  58    GHLGELSLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFNILGLTLQRTILLL  117

Query  448   LFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSV  627
             L TSIPI+ILW  M+++LILC QD EI+  AQ++IL+SLPDL AQSLLHPLRIYLRSQS+
Sbjct  118   LLTSIPISILWLFMQKLLILCGQDHEIAKMAQNYILFSLPDLFAQSLLHPLRIYLRSQSI  177

Query  628   TLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKK  807
             TLPLTFCA FAI++H+PINYFL+ +LNLGIKGVALS VW +FN+VGSL++Y++FS +YKK
Sbjct  178   TLPLTFCAIFAIILHIPINYFLIKILNLGIKGVALSGVWTDFNLVGSLIIYIIFSKIYKK  237

Query  808   TWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQT  987
             TW G+S ECFKG+KSLLNLAIPSC SVCLEWWWYE+MILLCG+L NP++TVASMG+LIQT
Sbjct  238   TWSGISLECFKGWKSLLNLAIPSCISVCLEWWWYEIMILLCGILINPQSTVASMGILIQT  297

Query  988   TSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVW  1167
             TSLIYIFPSSLSFGVSTRVGNELGA RP RAKLAAI+GLC SF+LG+++L F + VRN+W
Sbjct  298   TSLIYIFPSSLSFGVSTRVGNELGANRPNRAKLAAIIGLCTSFVLGISSLFFAILVRNIW  357

Query  1168  ASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGL  1347
             A +FTQD EIM LTA VLPIIGLCELGNCPQT GCG LRGTARPKLGA +NL CFY VG+
Sbjct  358   AKMFTQDQEIMKLTAMVLPIIGLCELGNCPQTIGCGVLRGTARPKLGANVNLGCFYLVGM  417

Query  1348  PVAGWLGFFAGFDFqglwlgllaaqaSCALTMLL-VLGRTDWNDQARRAKELTATISLVD  1524
             P+A WL FF GFDF+GLWLGLLAAQ SCA+TM+L +L +T+W DQARRAKEL   I   D
Sbjct  418   PIAIWLTFFMGFDFKGLWLGLLAAQGSCAVTMMLIILVKTNWEDQARRAKEL--IIGDCD  475

Query  1525  DDDDD  1539
             + D+ 
Sbjct  476   NQDEK  480



>ref|XP_009341256.1| PREDICTED: MATE efflux family protein LAL5-like isoform X1 [Pyrus 
x bretschneideri]
Length=559

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/493 (71%), Positives = 417/493 (85%), Gaps = 11/493 (2%)
 Frame = +1

Query  88    EKMEAPLIS-------EENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRS  246
             + + +PLIS       E+  K +   H ++H SLA KEA  I+ IA PMI+TGLLLY RS
Sbjct  29    KTLTSPLISKTITPQPEQVHKSQFKPHKRSHFSLALKEANSIAAIAFPMILTGLLLYSRS  88

Query  247   MISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSL  426
             MISMLFLG LG+L+LAGGSLA+GFANITGYSILSGLAMGMEPICGQAFGAK+  L+GLSL
Sbjct  89    MISMLFLGGLGELALAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGAKKNTLLGLSL  148

Query  427   QRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRI  606
             QRT++LLLFTS+PI++LW N+++IL++C QD  I+ EAQ ++L SLPDL+AQS LHPLRI
Sbjct  149   QRTVLLLLFTSLPISLLWLNVKKILLICGQDEAIAAEAQLYLLCSLPDLLAQSFLHPLRI  208

Query  607   YLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVL  786
             YLRSQS+TLPLT CA  AI++H+PINY LV  L+LGIKGVALS VW NFN+V S+++Y++
Sbjct  209   YLRSQSITLPLTLCATLAIILHIPINYLLVSHLDLGIKGVALSGVWSNFNLVASVIIYII  268

Query  787   FSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVAS  966
              SGV+KKTWGG+S +CF+ +++LLNLA+PSC SVCLEWWWYE+MILLCGLL NPRATVAS
Sbjct  269   VSGVHKKTWGGISMDCFREWRTLLNLAVPSCISVCLEWWWYEIMILLCGLLINPRATVAS  328

Query  967   MGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFG  1146
             MGVLIQTT+LIYIFPSSLSF VSTRVGNE+GA  P +AKLAAIVGLC SF+LGL+AL F 
Sbjct  329   MGVLIQTTALIYIFPSSLSFSVSTRVGNEIGANNPKKAKLAAIVGLCCSFMLGLSALVFA  388

Query  1147  VAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLR  1326
               VRN+WAS+FTQD +I+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL 
Sbjct  389   TTVRNIWASMFTQDKDIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLG  448

Query  1327  CFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT-  1503
             CFY VG+PVA  LGFF GFDFQGLWLGLLAA+ SCALTML+VLGRTDW  +AR+AKELT 
Sbjct  449   CFYLVGMPVAVGLGFFLGFDFQGLWLGLLAAEGSCALTMLVVLGRTDWEFEARKAKELTG  508

Query  1504  ---ATISLVDDDD  1533
                A +++ D +D
Sbjct  509   ANAAEVAVGDSED  521



>ref|XP_011030028.1| PREDICTED: MATE efflux family protein LAL5 [Populus euphratica]
Length=547

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/488 (72%), Positives = 410/488 (84%), Gaps = 3/488 (1%)
 Frame = +1

Query  85    KEKMEAPLISEENPK---EEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMIS  255
             + +M   L+  ++P    +E    +  +LSLA +EA  I+ IA PMI+TGLLLY RSMIS
Sbjct  27    EPQMFTSLLIPKSPTCIPQETQEPDIINLSLAIREAISIAKIAFPMILTGLLLYPRSMIS  86

Query  256   MLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRT  435
             MLFLGRLG+L+LAGGSLA+GFANITGYSILSGLAMGMEPICGQAFGA++ +L+GL+LQRT
Sbjct  87    MLFLGRLGELALAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGAQKHRLLGLTLQRT  146

Query  436   IVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLR  615
             I+LL+  S+PI+ LW NM+ IL+ C QD  I+ EAQSF++YSLPDL+AQS LHPLRIYLR
Sbjct  147   ILLLIVASLPISFLWLNMKSILLFCGQDESIATEAQSFLVYSLPDLLAQSFLHPLRIYLR  206

Query  616   SQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSG  795
             +Q++TLPLTFCA  AI++H+PINYFLV  LNLG KGVALS VW NF +VGSL++Y+L SG
Sbjct  207   TQTITLPLTFCATLAIILHIPINYFLVTHLNLGTKGVALSGVWTNFILVGSLIIYILVSG  266

Query  796   VYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGV  975
             V+KKTWGG S ECFK +K+LLNLAIPSC SVCLEWWWYE+MILLCGLL NPRATVASMG+
Sbjct  267   VHKKTWGGFSMECFKEWKTLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPRATVASMGI  326

Query  976   LIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAV  1155
             LIQTT+LIYIFPSSLSF VSTRVGNELGA +P +AKLAA VGL  SFI G +AL F V V
Sbjct  327   LIQTTALIYIFPSSLSFSVSTRVGNELGANQPKKAKLAANVGLSLSFIFGFSALAFAVMV  386

Query  1156  RNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFY  1335
             R VWAS+FTQD EI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL CFY
Sbjct  387   RKVWASMFTQDKEIIALTSLVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFY  446

Query  1336  FVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATIS  1515
              VG PVA WLGF+AGFDF+GLWLGLLAAQ SC +TMLLVLGRTDW  +A+RAK+LT  + 
Sbjct  447   LVGTPVAVWLGFYAGFDFEGLWLGLLAAQGSCVVTMLLVLGRTDWESEAQRAKKLTNALV  506

Query  1516  LVDDDDDD  1539
             LV + DD 
Sbjct  507   LVSNVDDS  514



>ref|XP_007220655.1| hypothetical protein PRUPE_ppa003689mg [Prunus persica]
 gb|EMJ21854.1| hypothetical protein PRUPE_ppa003689mg [Prunus persica]
Length=556

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/473 (73%), Positives = 407/473 (86%), Gaps = 1/473 (0%)
 Frame = +1

Query  121   NPKEEDHN-HNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslag  297
             N   + H  H ++H SLA KEA  I+ IA PMI+TGLLLY RSMISMLFLGRLG+L+LAG
Sbjct  55    NAHHQTHKPHQKSHFSLALKEANSIASIAFPMILTGLLLYSRSMISMLFLGRLGELALAG  114

Query  298   gslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAIL  477
             GSLA+GFANITGYSILSGLAMGMEPICGQAFGAKR  L+GLSLQRT++LL+FTS+PI++L
Sbjct  115   GSLAVGFANITGYSILSGLAMGMEPICGQAFGAKRHTLLGLSLQRTVLLLIFTSLPISLL  174

Query  478   WCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAF  657
             W NM+++L+LC QD  I+ EAQ ++L SLPDL+AQ LLHPLRIYLR+QS+TLPLTFCA  
Sbjct  175   WLNMKKLLLLCGQDEAIASEAQLYLLCSLPDLLAQCLLHPLRIYLRTQSITLPLTFCATL  234

Query  658   AIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECF  837
             AI++H+PINYFLV  LNLGI+GVALS VW NFN+V SL++Y++ SGV+KKTWGG+S +CF
Sbjct  235   AIILHIPINYFLVSYLNLGIRGVALSGVWSNFNLVASLIIYIIISGVHKKTWGGISMDCF  294

Query  838   KGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSS  1017
             + +K+LLNLA+PSC SVCLEWWWYE+MILLCGLL NPRATVASMG+LIQTTSLIYIFPSS
Sbjct  295   REWKTLLNLAVPSCISVCLEWWWYEIMILLCGLLLNPRATVASMGILIQTTSLIYIFPSS  354

Query  1018  LSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEI  1197
             LSF VSTRVGNE+GA +P +A++AAIVGLC SF+LGLAAL F V VRN+WAS+FTQD EI
Sbjct  355   LSFSVSTRVGNEIGANQPKKARIAAIVGLCCSFMLGLAALIFAVMVRNIWASMFTQDKEI  414

Query  1198  MALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFA  1377
             + LT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL CFY VG+PVA  LGF  
Sbjct  415   IKLTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGMPVAVGLGFVL  474

Query  1378  GFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDD  1536
               DFQGLWLGLLAAQ  CALTML+VLG TDW  +A++AK+LT    +VDD ++
Sbjct  475   ELDFQGLWLGLLAAQGCCALTMLVVLGVTDWEFEAQKAKQLTGAEEVVDDSEE  527



>ref|XP_008354220.1| PREDICTED: MATE efflux family protein LAL5-like [Malus domestica]
Length=559

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/493 (71%), Positives = 415/493 (84%), Gaps = 10/493 (2%)
 Frame = +1

Query  88    EKMEAPLIS-------EENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRS  246
             + + +PLIS       E+  K +   HN++H SLA KEA  I+ IA PMI+TGLLLY RS
Sbjct  29    KTLTSPLISKTITPQPEQVHKSQFKPHNKSHFSLALKEANSIAAIAFPMILTGLLLYLRS  88

Query  247   MISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSL  426
             MISMLFLGRLG+L+LAGGSLA+GFANITGYSILSGLAMGMEPICGQAFGAK+  L+GLSL
Sbjct  89    MISMLFLGRLGELALAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGAKKHTLLGLSL  148

Query  427   QRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRI  606
             QR ++LLLFTS+PI++LW NM++IL++C QD  I+ EAQ ++L SLPDL+AQS LHPLRI
Sbjct  149   QRMVLLLLFTSLPISLLWLNMKKILLICGQDEAIAAEAQLYLLCSLPDLLAQSFLHPLRI  208

Query  607   YLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVL  786
             YLRSQS+TLPLT CA  AI++H+PINY LV  L+LGIKGVALS VW NFN+V S++VY++
Sbjct  209   YLRSQSITLPLTLCATLAIILHIPINYLLVSHLDLGIKGVALSGVWSNFNLVASVIVYII  268

Query  787   FSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVAS  966
              SGV+KKTWGG+S +CF  +++LLNLA+PSC SVCLEWWWYE+MILLCGLL NPRATVAS
Sbjct  269   VSGVHKKTWGGISMDCFGEWRTLLNLAVPSCISVCLEWWWYEIMILLCGLLINPRATVAS  328

Query  967   MGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFG  1146
             MGVLIQTT+LIYIFPSSLSF VSTRVGNE+GA  P +AKLAAIVGLC SF+LGL+AL F 
Sbjct  329   MGVLIQTTALIYIFPSSLSFSVSTRVGNEIGANNPKKAKLAAIVGLCFSFMLGLSALVFA  388

Query  1147  VAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLR  1326
               VRN+WAS+FTQD +I+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL 
Sbjct  389   TTVRNIWASMFTQDKDIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLG  448

Query  1327  CFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTA  1506
             CFY VG+PVA  LGFF GFDFQGLWLGLLAA+ SCALTML+VLGRTDW  +AR+A+ELT 
Sbjct  449   CFYLVGMPVAVGLGFFLGFDFQGLWLGLLAAEGSCALTMLVVLGRTDWEFEARKARELTG  508

Query  1507  ---TISLVDDDDD  1536
                  + V D +D
Sbjct  509   AAAAEAAVGDSED  521



>ref|XP_002510841.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF51443.1| multidrug resistance pump, putative [Ricinus communis]
Length=553

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/472 (74%), Positives = 410/472 (87%), Gaps = 0/472 (0%)
 Frame = +1

Query  124   PKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggs  303
             P+EE    N+THLSLA +E   I+ IALPMI+TGL+LY RSMISMLFLGRLG+L+LAGGS
Sbjct  54    PQEEIQEPNKTHLSLAIREGISIAKIALPMILTGLVLYSRSMISMLFLGRLGELALAGGS  113

Query  304   laigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWC  483
             LA+GFANITGYSILSGLAMGMEPICGQAFGA++  L+GLSLQRTI+LL+ TS+PI  LW 
Sbjct  114   LAMGFANITGYSILSGLAMGMEPICGQAFGAQKHSLLGLSLQRTILLLILTSLPITFLWL  173

Query  484   NMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAI  663
             NM+RIL+ C QD +I+ EAQSF+LYSLPDL+AQS LHPLRIYLR+QS+ LPLTFCA  +I
Sbjct  174   NMKRILLFCGQDLDIATEAQSFLLYSLPDLLAQSFLHPLRIYLRTQSINLPLTFCATLSI  233

Query  664   VVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKG  843
             ++HVPINYFLV  LNLGIKGVALS VW NFN+V SL++Y+L SGV+K+TWGG+S ECFK 
Sbjct  234   LLHVPINYFLVTHLNLGIKGVALSGVWTNFNLVASLIIYILISGVHKRTWGGLSMECFKE  293

Query  844   YKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLS  1023
             +K+LLNLAIPSC SVCLEWWWYE+M LLCGLL NPRATVA+MG+LIQTTSLIYIFPSSL 
Sbjct  294   WKALLNLAIPSCISVCLEWWWYEIMTLLCGLLLNPRATVAAMGILIQTTSLIYIFPSSLG  353

Query  1024  FGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMA  1203
             F VSTRVGNELGA +P +AKLAAIVGL  SFILG +AL+F V VR +WA++FTQD EI+A
Sbjct  354   FSVSTRVGNELGANQPKKAKLAAIVGLAFSFILGFSALSFTVTVRKIWATMFTQDKEIIA  413

Query  1204  LTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGF  1383
             LT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL CFY VG PVA WL FFAGF
Sbjct  414   LTSLVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGTPVAIWLAFFAGF  473

Query  1384  DFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDDD  1539
             DF+GLWLGL+AAQ SC +TML+VLG TDW+ QA+RAKELT ++ ++DD D +
Sbjct  474   DFEGLWLGLVAAQGSCVVTMLVVLGCTDWDFQAQRAKELTGSVGIIDDVDGE  525



>ref|XP_009798743.1| PREDICTED: MATE efflux family protein DTX1-like [Nicotiana sylvestris]
Length=520

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/489 (72%), Positives = 408/489 (83%), Gaps = 3/489 (1%)
 Frame = +1

Query  82    CKEKMEAPLISEENPKEEDHN---HNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMI  252
             C E  EA + +   PK    N      TH SL  KEA+ +++IA PMI+TGLLLY RS+I
Sbjct  15    CNEPQEANMFTLLIPKCPTKNLLLDKTTHFSLVFKEAQSVANIAFPMILTGLLLYSRSLI  74

Query  253   SMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQR  432
             SMLFLGRLG L+LAGGSLA+GFANITGYSILSGLAMGMEPICGQAFGAK++ L+GLSLQR
Sbjct  75    SMLFLGRLGGLALAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGAKKYNLLGLSLQR  134

Query  433   TIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYL  612
             TI+LL+FTS PIA+LW NM+ IL+ C QD +I+ EAQS++ YS+PDL AQSLLHPLRIYL
Sbjct  135   TILLLIFTSSPIALLWVNMKTILLYCGQDEDIATEAQSYLFYSIPDLFAQSLLHPLRIYL  194

Query  613   RSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFS  792
             R+QS+TLPLTFCA   I++H+PIN+ LV  LNLG+KGVALS+VW NFN+V SL+VY+L S
Sbjct  195   RTQSITLPLTFCAVLTILLHIPINFLLVTKLNLGVKGVALSAVWTNFNLVASLIVYILIS  254

Query  793   GVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMG  972
             GVYKKTW  +S EC KG+K LLNL+IPSC SVCLEWWWYE+MILLCG L NP+ATVASMG
Sbjct  255   GVYKKTWENLSTECLKGWKELLNLSIPSCISVCLEWWWYEIMILLCGGLLNPKATVASMG  314

Query  973   VLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVA  1152
             +LIQ TSLIYIFPSSLSF VSTRVGNELGA  P +AKLAAIVGL  SFILG +AL F V 
Sbjct  315   ILIQITSLIYIFPSSLSFSVSTRVGNELGARNPNKAKLAAIVGLAGSFILGFSALFFAVT  374

Query  1153  VRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCF  1332
             VR VWA +FTQD EI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL CF
Sbjct  375   VRKVWAKMFTQDNEILALTSLVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCF  434

Query  1333  YFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATI  1512
             YFVG+PVA  L F+AGFDF+GLWLGLLAAQASC +TML+VL RTDW+ +A RAK+LT TI
Sbjct  435   YFVGMPVAVGLSFYAGFDFEGLWLGLLAAQASCMVTMLVVLIRTDWDFEAVRAKDLTETI  494

Query  1513  SLVDDDDDD  1539
               V DD++D
Sbjct  495   VSVVDDNED  503



>ref|XP_009620467.1| PREDICTED: MATE efflux family protein DTX1-like [Nicotiana tomentosiformis]
Length=529

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/477 (72%), Positives = 404/477 (85%), Gaps = 0/477 (0%)
 Frame = +1

Query  109   ISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdls  288
             + ++N  ++  ++  TH SL  KEA+ I++IA PMI+TGLLLY RS+ISMLFLGR+G L+
Sbjct  36    LHDKNNLDKTISYKTTHFSLVFKEAQSIANIAFPMILTGLLLYSRSLISMLFLGRVGGLA  95

Query  289   laggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPI  468
             LAGGSLA+GFANITGYSILSGLAMGMEPICGQAFGAK++ L+GLSLQRTI+LL+ TS PI
Sbjct  96    LAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGAKKYNLLGLSLQRTILLLILTSFPI  155

Query  469   AILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFC  648
             A+LW NM+ IL+ C QD  I+ EAQS++ YS+PDL AQSLLHPLRIYLR+QS+TLPLTFC
Sbjct  156   ALLWVNMKTILLYCGQDENIATEAQSYLFYSIPDLFAQSLLHPLRIYLRTQSITLPLTFC  215

Query  649   AAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSW  828
             A  AI++H+PIN+ LV  LNLG+KGVALS+VW NFN+V SL+VY+L SGVYKKTW  +S 
Sbjct  216   AVLAILLHIPINFLLVTKLNLGVKGVALSAVWTNFNLVASLIVYILISGVYKKTWENLST  275

Query  829   ECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIF  1008
             EC KG+K LLNLAIPSC SVCLEWWWYE+MILLCG+L NP+ATVASMG+LIQTTSLIYIF
Sbjct  276   ECLKGWKKLLNLAIPSCISVCLEWWWYEIMILLCGVLLNPKATVASMGILIQTTSLIYIF  335

Query  1009  PSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQD  1188
             PSSLSF VSTRVGNELGA  P +AKLAAIVGL  S ILG +AL F V VR VWA +FTQD
Sbjct  336   PSSLSFSVSTRVGNELGARNPNKAKLAAIVGLAGSIILGFSALFFAVTVRKVWAKMFTQD  395

Query  1189  AEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLG  1368
              EI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL CFY VG+PVA  L 
Sbjct  396   NEILALTSLVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYIVGMPVAVGLS  455

Query  1369  FFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDDD  1539
             F+ GFDF+GLWLGLLAAQ SC +TML+VL RTDW+ +A RAK+LT TI  V DD++D
Sbjct  456   FYVGFDFEGLWLGLLAAQVSCMVTMLVVLLRTDWDFEAERAKDLTETIVSVVDDNED  512



>ref|XP_011041639.1| PREDICTED: MATE efflux family protein LAL5-like [Populus euphratica]
Length=549

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/503 (70%), Positives = 414/503 (82%), Gaps = 11/503 (2%)
 Frame = +1

Query  64    FAFISACKEK---MEAPLISEENP--------KEEDHNHNQTHLSLAAKEAKCISDIALP  210
             F F+ + K++   M  PL+  ++P        ++E    NQT L+L  +EA  I+ IA P
Sbjct  17    FPFLVSIKDQEPNMFTPLLIPKSPTCVTQKELRQETQIPNQTDLTLFIREAISIAKIAFP  76

Query  211   MIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAF  390
             M++TGLLLY RSMISMLFLGRLG+L+LAGGSLA+GFANITGYSILSGLA+GMEPICGQAF
Sbjct  77    MMLTGLLLYPRSMISMLFLGRLGELALAGGSLAVGFANITGYSILSGLAVGMEPICGQAF  136

Query  391   GAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPD  570
             GA++  L+G +LQRTI+LL+  S+PI+ LW NM+ IL+ C QD  I+ EAQSF++YSLPD
Sbjct  137   GAQKHHLLGQTLQRTILLLIVASLPISFLWLNMKSILLFCGQDESIATEAQSFLVYSLPD  196

Query  571   LIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCN  750
             L+AQS LHPLRIYLR+Q++TLPLTFCA  AI++H+PINYFLV  LNLG KGVALS VW N
Sbjct  197   LLAQSFLHPLRIYLRTQTITLPLTFCATLAIILHIPINYFLVTHLNLGTKGVALSGVWTN  256

Query  751   FNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLC  930
             F +VGSL++Y+L SGV+KKTWGG S ECFK +K+LLNLAIPSC SVCLEWWWYE+MILLC
Sbjct  257   FILVGSLIIYILVSGVHKKTWGGFSVECFKEWKTLLNLAIPSCISVCLEWWWYEIMILLC  316

Query  931   GLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCA  1110
             GLL NP+ATVASMG+LIQTT+LIYIFPSSLSF VSTRVGNELGA +P +AK AAI GL  
Sbjct  317   GLLLNPKATVASMGILIQTTALIYIFPSSLSFSVSTRVGNELGANQPKKAKFAAIAGLSF  376

Query  1111  SFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGT  1290
             SFI G +AL+F V VR VWAS+FTQD EI+ALT+ VLPIIGLCELGNCPQTTGCG LRGT
Sbjct  377   SFIFGFSALSFAVMVRKVWASMFTQDEEIIALTSLVLPIIGLCELGNCPQTTGCGVLRGT  436

Query  1291  ARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDW  1470
             ARPK+GA INL CFY VG PVA WLGF+AGFDF+GLWLGLLAAQ SC +TML VLGRTDW
Sbjct  437   ARPKVGANINLGCFYLVGTPVAVWLGFYAGFDFEGLWLGLLAAQGSCVVTMLFVLGRTDW  496

Query  1471  NDQARRAKELTATISLVDDDDDD  1539
               +A+RAKELT  + LV + DD 
Sbjct  497   EIEAQRAKELTHALVLVTNVDDS  519



>ref|XP_010278542.1| PREDICTED: MATE efflux family protein 5-like [Nelumbo nucifera]
Length=552

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/464 (74%), Positives = 404/464 (87%), Gaps = 0/464 (0%)
 Frame = +1

Query  148   NQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANI  327
             N+THLSLA  EAK I++IALPM++TGLLLY RSMISMLFLGRLG+L+LAGG+LAIGFANI
Sbjct  64    NKTHLSLAITEAKSIANIALPMVLTGLLLYSRSMISMLFLGRLGELALAGGALAIGFANI  123

Query  328   TGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILIL  507
             TGYSILSGLAMGMEPICGQAFGAKR+KL+GLSLQR ++LLL  S+PI++LW NMERIL+ 
Sbjct  124   TGYSILSGLAMGMEPICGQAFGAKRYKLLGLSLQRMVLLLLLISVPISLLWINMERILVF  183

Query  508   CRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINY  687
               QD +I+ EAQS+IL+SLPDL  QSLLHPLRIYLRSQS+TLPLT+CAA AI++H+PINY
Sbjct  184   FGQDEDIAREAQSYILFSLPDLFLQSLLHPLRIYLRSQSITLPLTYCAALAILLHIPINY  243

Query  688   FLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLA  867
              LV VLNLGI+GVA S +W NFN+VGSL++Y+  SG+Y+KTW G+S EC KG+KSLL+LA
Sbjct  244   LLVCVLNLGIRGVAFSGIWTNFNLVGSLIIYICISGIYRKTWAGISSECLKGWKSLLSLA  303

Query  868   IPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVG  1047
             IPSC SVCLEWWWYE+MI LCGLL NPRATVASMG+LIQTT+LIYIFPSSLSFGVSTRVG
Sbjct  304   IPSCISVCLEWWWYEIMIFLCGLLLNPRATVASMGILIQTTALIYIFPSSLSFGVSTRVG  363

Query  1048  NELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPI  1227
             NELGA +P +AKLAAIVGLC SF+LG  ALTF V+VR VWA +FT+DAEI+ALT+ VLPI
Sbjct  364   NELGANQPAKAKLAAIVGLCCSFLLGFTALTFAVSVRGVWARMFTRDAEIIALTSLVLPI  423

Query  1228  IGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlg  1407
             IG+CELGNCPQTTGCG LRGTARP++GA INL  FY  G+PVA  LGFFA +DF+GLWLG
Sbjct  424   IGMCELGNCPQTTGCGVLRGTARPRVGANINLTSFYLFGMPVAVGLGFFAEWDFEGLWLG  483

Query  1408  llaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDDD  1539
             LLAAQ SC L ML VLGRTDWN +A+RA+ LT  +  V   +++
Sbjct  484   LLAAQGSCVLIMLFVLGRTDWNSEAQRAQALTGAVPAVGSKEEE  527



>ref|XP_003611148.1| Multidrug and toxin extrusion protein [Medicago truncatula]
 gb|AES94106.1| MATE efflux family protein [Medicago truncatula]
Length=539

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/474 (73%), Positives = 402/474 (85%), Gaps = 5/474 (1%)
 Frame = +1

Query  85    KEKMEAPLISEENPKEED-HNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISML  261
             K  M  PLI    PK        +TH SLA  EAK IS+IALPM++TGLLLY RS+ISML
Sbjct  38    KPDMLTPLI----PKSPTFKQQKKTHFSLALNEAKHISNIALPMVLTGLLLYSRSIISML  93

Query  262   FlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIV  441
             FLGR+G+L+LAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFKL+GL++QRT++
Sbjct  94    FLGRVGELALAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFKLLGLTMQRTVI  153

Query  442   LLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQ  621
             LLL TSI I+ LW NM+R+L+LC Q  +I+  AQS+ILYSLPDL+AQSLLHPLRIYLRSQ
Sbjct  154   LLLVTSIFISFLWLNMKRLLLLCGQQEDIANVAQSYILYSLPDLVAQSLLHPLRIYLRSQ  213

Query  622   SVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVY  801
             S+TLPLT+ A  +I++H+PINYFLV VL LGI+G+AL SVW NFN+V SL++Y+  SG +
Sbjct  214   SITLPLTYSATLSILLHIPINYFLVNVLQLGIRGIALGSVWTNFNLVVSLIIYIWVSGTH  273

Query  802   KKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLI  981
             KKTW G+S  CFKG+KSLLNLAIPSC SVCLEWWWYE+MILLCGLL NP ATVASMGVLI
Sbjct  274   KKTWSGISSACFKGWKSLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPHATVASMGVLI  333

Query  982   QTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRN  1161
             QTT+LIYIFPSSLSFGVSTRVGNELGA  P +AKLAAIVGLC SF+LG +AL F  +VRN
Sbjct  334   QTTALIYIFPSSLSFGVSTRVGNELGAENPQKAKLAAIVGLCFSFVLGFSALFFAFSVRN  393

Query  1162  VWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFV  1341
             +WA++FT D +I+ALT+ VLPIIGLCELGNCPQTT CG LRGTARPKLGA INL CFY V
Sbjct  394   IWATMFTSDPQIIALTSMVLPIIGLCELGNCPQTTVCGVLRGTARPKLGANINLGCFYLV  453

Query  1342  GLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
             G+PVA WL FFAGFDF+GLW GL+AAQ SC +TML VL RT+W +QA RAKELT
Sbjct  454   GMPVAVWLSFFAGFDFKGLWFGLMAAQGSCMITMLFVLVRTNWENQAERAKELT  507



>ref|XP_002322435.2| hypothetical protein POPTR_0015s13900g [Populus trichocarpa]
 gb|EEF06562.2| hypothetical protein POPTR_0015s13900g [Populus trichocarpa]
Length=554

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/503 (69%), Positives = 414/503 (82%), Gaps = 11/503 (2%)
 Frame = +1

Query  64    FAFISACKEK---MEAPLISEENP--------KEEDHNHNQTHLSLAAKEAKCISDIALP  210
             F F+ + K++   M  PL+  ++P        ++E    NQT LSL  +EA  I++IA P
Sbjct  17    FPFLVSIKDQEPNMFTPLLIPKSPTCKPQKERRQETQIPNQTDLSLFLREAISIANIAFP  76

Query  211   MIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAF  390
             M++TGLLLY RSMISMLFLGRLG+L+LAGGSLA+GFANITGYSILSGLA+GMEPICGQAF
Sbjct  77    MMLTGLLLYPRSMISMLFLGRLGELALAGGSLAVGFANITGYSILSGLAVGMEPICGQAF  136

Query  391   GAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPD  570
             GA++  L+G +LQRTI+LL+  S+PI+ LW NM+ IL+ C QD  I+ EAQ F++YS+PD
Sbjct  137   GAQKHHLLGQTLQRTILLLIVASLPISFLWLNMKSILLFCGQDESIATEAQLFLIYSIPD  196

Query  571   LIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCN  750
             L+AQS LHPLRIYLR+QS+TLPLTFCA  AI++H+PINYFLV  LNLG KGVALS VW N
Sbjct  197   LLAQSFLHPLRIYLRTQSITLPLTFCATLAIILHIPINYFLVTHLNLGTKGVALSGVWTN  256

Query  751   FNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLC  930
             F +VGSL++Y+L SGV+KKTWGG S ECFK +K+LLNLAIPSC SVCLEWWWYE+MILLC
Sbjct  257   FILVGSLIIYILVSGVHKKTWGGFSVECFKEWKTLLNLAIPSCISVCLEWWWYEIMILLC  316

Query  931   GLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCA  1110
             GLL NP+ATVASMG+LIQTT+LIYIFPSSLSF VSTRVGN+LGA +P +AK AAI GL  
Sbjct  317   GLLVNPKATVASMGILIQTTALIYIFPSSLSFSVSTRVGNQLGANQPKKAKFAAIAGLSF  376

Query  1111  SFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGT  1290
             SFI G +AL+F V VR VWAS+FTQD EI+ALT+ VLPIIGLCELGNCPQTTGCG LRGT
Sbjct  377   SFIFGFSALSFAVMVRKVWASMFTQDKEIIALTSLVLPIIGLCELGNCPQTTGCGVLRGT  436

Query  1291  ARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDW  1470
             ARPK+GA INL CFY VG+PVA WLGFF  FDF+GLWLGLLAAQ SCA+TML VLGRTDW
Sbjct  437   ARPKVGANINLGCFYLVGMPVAVWLGFFTRFDFEGLWLGLLAAQGSCAVTMLFVLGRTDW  496

Query  1471  NDQARRAKELTATISLVDDDDDD  1539
               +A+RAKELT  + LV + DD 
Sbjct  497   EHEAQRAKELTNALVLVANVDDS  519



>ref|XP_006477591.1| PREDICTED: multidrug and toxin extrusion protein 1-like [Citrus 
sinensis]
Length=494

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/481 (74%), Positives = 420/481 (87%), Gaps = 1/481 (0%)
 Frame = +1

Query  94    MEAPLISEENPKEEDHNHNQ-THLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlg  270
             M +P+IS+     +++N N+ THL LA KEA+ I++IALPMI+TGLLLY RSMISMLFLG
Sbjct  1     MLSPMISKNPTTNQENNQNESTHLFLAIKEARRIANIALPMILTGLLLYSRSMISMLFLG  60

Query  271   rlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLL  450
             RLGDL+LAGGSLAIGF NITGYS+LSGLAMGMEPICGQAFGA R+KL+GL+LQRTI+LLL
Sbjct  61    RLGDLALAGGSLAIGFGNITGYSLLSGLAMGMEPICGQAFGAARYKLLGLTLQRTILLLL  120

Query  451   FTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVT  630
              +SIPIA LW NM+ IL+ C Q+++I+ EAQ ++LYSLPDLIA S LHPLRIYLR+QS+T
Sbjct  121   LSSIPIAFLWLNMKTILLFCGQEKDIAHEAQIYLLYSLPDLIALSFLHPLRIYLRTQSIT  180

Query  631   LPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKT  810
             LPLTFCA FAI++H+PINY LV VLNLG+KG+ALSSVW NFN+V SL++Y++ SGV++KT
Sbjct  181   LPLTFCATFAIILHIPINYLLVSVLNLGLKGIALSSVWTNFNLVISLILYIMISGVHEKT  240

Query  811   WGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTT  990
             WGG+S ECFK ++SLLNLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTT
Sbjct  241   WGGISLECFKEWRSLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTT  300

Query  991   SLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWA  1170
             SLIYIFPSSLSFGVSTRVGNELGA  P +AKLAAI+GL +SF+LG  AL F   VRN+WA
Sbjct  301   SLIYIFPSSLSFGVSTRVGNELGANCPKKAKLAAIIGLLSSFMLGFTALVFTAIVRNIWA  360

Query  1171  SIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLP  1350
             S+FTQDAEI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPKLGA INL CFY VG+P
Sbjct  361   SMFTQDAEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLGCFYLVGMP  420

Query  1351  VAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDD  1530
             VA WL F++GFDF+GLWLGLLAAQ SC +TML V+ RTDW+ QA+RAKELT   ++ D+ 
Sbjct  421   VAVWLSFYSGFDFEGLWLGLLAAQGSCVVTMLFVVARTDWDLQAQRAKELTGNATIDDET  480

Query  1531  D  1533
             +
Sbjct  481   E  481



>ref|XP_011076230.1| PREDICTED: MATE efflux family protein DTX1 [Sesamum indicum]
Length=540

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/490 (71%), Positives = 410/490 (84%), Gaps = 3/490 (1%)
 Frame = +1

Query  79    ACKEKMEAPLISEENPKEEDHNHN-QTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMIS  255
             A    M   LI +   K+    HN  THLSL  +EA  +S IA PMI+TGLLLY RSMIS
Sbjct  35    AQDTDMFTSLIPKSATKQSQKPHNPTTHLSLVIQEAISLSGIAFPMILTGLLLYSRSMIS  94

Query  256   MLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRT  435
             MLFLGRLGDL+LAGGSLA+GFANITGYSILSGLAMGMEPICGQAFGAK++ L+GLSLQRT
Sbjct  95    MLFLGRLGDLALAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGAKKYTLLGLSLQRT  154

Query  436   IVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLR  615
             ++LL+ TS PI++LW NM+RIL+ C QD  I+ +AQ+++ YS+PDL AQ+LLHPLRIYLR
Sbjct  155   VLLLVLTSFPISLLWLNMKRILLFCGQDEAIATQAQAYLFYSVPDLFAQALLHPLRIYLR  214

Query  616   SQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSG  795
             +QS TLPLTFCA  +I+ H+PINYFLV  L+LGIKGVALS VW NFN+V SL++Y+L SG
Sbjct  215   TQSNTLPLTFCAVVSILGHIPINYFLVSKLSLGIKGVALSGVWTNFNLVASLILYILLSG  274

Query  796   VYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGV  975
             VYKKTWGG+S EC KG+KSLLNLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+
Sbjct  275   VYKKTWGGLSMECLKGWKSLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPKATVASMGI  334

Query  976   LIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAV  1155
             LIQTTSLIYIFPSSLSF VSTRVGNE+G  RP +AKLAA+VGL  SF+LG +AL F V+V
Sbjct  335   LIQTTSLIYIFPSSLSFSVSTRVGNEIGGRRPEKAKLAAVVGLSGSFVLGFSALFFAVSV  394

Query  1156  RNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFY  1335
             RN+WAS+FTQD EI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL CFY
Sbjct  395   RNIWASMFTQDKEIIALTSLVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFY  454

Query  1336  FVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATIS  1515
              VG+PVA  L FF   DF+GLWLGLLAAQASC +TM++VL RTDW  +ARRA+ELT    
Sbjct  455   LVGMPVAVGLAFFYKMDFEGLWLGLLAAQASCMVTMMVVLLRTDWEFEARRAEELTGGYE  514

Query  1516  LVDDDD--DD  1539
             ++D+++  DD
Sbjct  515   ILDENEGVDD  524



>ref|XP_006421854.1| hypothetical protein CICLE_v10007191mg [Citrus clementina]
 ref|XP_006490328.1| PREDICTED: multidrug and toxin extrusion protein 2-like [Citrus 
sinensis]
 gb|ESR35094.1| hypothetical protein CICLE_v10007191mg [Citrus clementina]
 gb|KDO60095.1| hypothetical protein CISIN_1g048788mg [Citrus sinensis]
Length=525

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/487 (71%), Positives = 407/487 (84%), Gaps = 9/487 (2%)
 Frame = +1

Query  76    SACKEKMEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMIS  255
             S+    M APLI++            T  SLA +EA  I+ IALPMI+TGLLLY RSMIS
Sbjct  12    SSIHPNMHAPLITKSP---------TTDSSLAIREAISIAKIALPMILTGLLLYSRSMIS  62

Query  256   MLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRT  435
             +LFLGRLG+L+LAGGSLA+GFANITGYSILSGLAMGMEPICGQAFGA+R  L+GL+LQ+T
Sbjct  63    VLFLGRLGELALAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGAQRHNLLGLALQKT  122

Query  436   IVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLR  615
             I+LL+FTSIPI++LW NM+ IL+ C Q+ +I+  AQS++ YSLPDL+AQSLLHPLRIYLR
Sbjct  123   ILLLMFTSIPISLLWLNMKNILLFCGQNEDIATVAQSYLFYSLPDLLAQSLLHPLRIYLR  182

Query  616   SQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSG  795
             SQ++TLPLTFCA  +I++H+PINYFLV  LNLGIKGVALS VW NFN+V SL++Y++ S 
Sbjct  183   SQAITLPLTFCATLSILLHIPINYFLVTQLNLGIKGVALSGVWTNFNLVASLIIYIIISK  242

Query  796   VYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGV  975
             VY+KTWGG S +CFK  K+LLNLAIPSC SVCLEWWWYE+MILLCG L NPRAT+ASMG+
Sbjct  243   VYQKTWGGFSMDCFKECKTLLNLAIPSCISVCLEWWWYEIMILLCGYLLNPRATIASMGI  302

Query  976   LIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAV  1155
             LIQTTSLIYIFPSSLSF VSTRVGNELGA +P +AKLAAIVGL  SF+LG +AL F  +V
Sbjct  303   LIQTTSLIYIFPSSLSFSVSTRVGNELGANQPKKAKLAAIVGLSCSFMLGFSALFFAASV  362

Query  1156  RNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFY  1335
             R +WAS+FTQD EI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL CFY
Sbjct  363   RKIWASMFTQDKEIIALTSIVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFY  422

Query  1336  FVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATIS  1515
              VG PVA WL F+ GFDF+GLWLGLLAAQ SC +TML+VLG+TDW  +A+RAKELT    
Sbjct  423   IVGFPVAVWLAFYMGFDFEGLWLGLLAAQGSCVVTMLVVLGKTDWEFEAQRAKELTGDGV  482

Query  1516  LVDDDDD  1536
             +VDD  D
Sbjct  483   VVDDSKD  489



>gb|KHN02797.1| MATE efflux family protein 9 [Glycine soja]
Length=530

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/482 (71%), Positives = 403/482 (84%), Gaps = 7/482 (1%)
 Frame = +1

Query  91    KMEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlg  270
             K+  PLI ++      H+H         KE   IS IALPMI+TGLLLYCRSMISMLFLG
Sbjct  26    KITNPLIQKDITVTPPHHH-------VLKELISISKIALPMILTGLLLYCRSMISMLFLG  78

Query  271   rlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLL  450
             RLG+L+LAGGSLA+GFANITGYSILSGLA+GMEP CGQA+GAK+F L+GL LQRTI+LLL
Sbjct  79    RLGELALAGGSLAVGFANITGYSILSGLAVGMEPFCGQAYGAKKFTLLGLCLQRTILLLL  138

Query  451   FTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVT  630
             FTSIPI++LW  M+ IL+LC QD  I+ +AQS++LYS+PDL+AQS LHPLRIYLRSQS+T
Sbjct  139   FTSIPISLLWLYMKHILLLCGQDEAIATQAQSYLLYSIPDLLAQSFLHPLRIYLRSQSIT  198

Query  631   LPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKT  810
             LPLT CA F+I++H+PINY LV  LN GIKGVALS VW N N+V SL++Y++FSG +KKT
Sbjct  199   LPLTLCATFSILLHIPINYLLVSHLNWGIKGVALSGVWTNLNLVASLILYIVFSGTHKKT  258

Query  811   WGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTT  990
             WGG S+ECF  +KSLLNLAIPSC SVCLEWWWYE+MILLCGLL NPRATVASMG+LIQTT
Sbjct  259   WGGFSFECFTQWKSLLNLAIPSCISVCLEWWWYEIMILLCGLLVNPRATVASMGILIQTT  318

Query  991   SLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWA  1170
             SL+YI PSS+SF VSTRVGN+LGA +P +AKL+AIVGL  SF+LG  A  F + VRN+WA
Sbjct  319   SLLYILPSSISFSVSTRVGNKLGAQKPSKAKLSAIVGLSCSFMLGFLAFVFTILVRNIWA  378

Query  1171  SIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLP  1350
             S+FTQD EI+ LT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL CFY VG+P
Sbjct  379   SMFTQDKEIITLTSLVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGMP  438

Query  1351  VAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDD  1530
             VA WLGFFAG DFQGLWLGLLAAQ SCA+TML+V+ +TDW+ +A RAK+LT+ +  VDD 
Sbjct  439   VAVWLGFFAGLDFQGLWLGLLAAQGSCAVTMLVVMSQTDWDVEALRAKKLTSVVVAVDDS  498

Query  1531  DD  1536
              +
Sbjct  499   KE  500



>ref|XP_002318258.2| hypothetical protein POPTR_0012s13930g, partial [Populus trichocarpa]
 gb|EEE96478.2| hypothetical protein POPTR_0012s13930g, partial [Populus trichocarpa]
Length=445

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/443 (76%), Positives = 387/443 (87%), Gaps = 0/443 (0%)
 Frame = +1

Query  211   MIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAF  390
             MI+TGLLLY RSMISMLFLGRLG+L+LAGGSLA+GFANITGYSILSGLAMGMEPICGQAF
Sbjct  1     MILTGLLLYPRSMISMLFLGRLGELALAGGSLAVGFANITGYSILSGLAMGMEPICGQAF  60

Query  391   GAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPD  570
             GA++ +L+GL+LQRTI+LL+  S+PI+ LW NM+ IL+ C QD  I+ EAQSF++YSLPD
Sbjct  61    GAQKHRLLGLTLQRTILLLIVASLPISFLWLNMKSILLFCGQDESIATEAQSFLVYSLPD  120

Query  571   LIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCN  750
             L+AQS LHPLRIYLR+Q++TLPLTFCA  AI++H+PINYFLV  LNLG KGVALS VW N
Sbjct  121   LLAQSFLHPLRIYLRTQTITLPLTFCATLAIILHIPINYFLVTHLNLGTKGVALSGVWTN  180

Query  751   FNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLC  930
             FN+VGSL++Y+L SGV+KKTWGG S ECFK +K+LLNLAIPSC SVCLEWWWYE+MILLC
Sbjct  181   FNLVGSLIIYILVSGVHKKTWGGFSMECFKEWKTLLNLAIPSCISVCLEWWWYEIMILLC  240

Query  931   GLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCA  1110
             GLL NPRATVASMG+LIQTT+LIYIFPSSLSF VSTRVGNELGA +P +AKLAA VGL  
Sbjct  241   GLLLNPRATVASMGILIQTTALIYIFPSSLSFSVSTRVGNELGANQPMKAKLAANVGLSL  300

Query  1111  SFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGT  1290
             SFI G +AL F V VR VWAS+FTQD EI+ALT+ VLPIIGLCELGNCPQTTGCG LRGT
Sbjct  301   SFIFGFSALAFAVMVRKVWASMFTQDKEIIALTSLVLPIIGLCELGNCPQTTGCGVLRGT  360

Query  1291  ARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDW  1470
             ARPK+GA INL CFY VG PVA WLGF+AGFDF+GLWLGLLAAQ SC +TMLLVLGRTDW
Sbjct  361   ARPKVGANINLGCFYLVGTPVAVWLGFYAGFDFEGLWLGLLAAQGSCVVTMLLVLGRTDW  420

Query  1471  NDQARRAKELTATISLVDDDDDD  1539
               +A+RAKELT  + LV + DD 
Sbjct  421   ESEAKRAKELTNALVLVSNVDDS  443



>ref|XP_003535626.1| PREDICTED: MATE efflux family protein 5-like [Glycine max]
Length=530

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/482 (71%), Positives = 404/482 (84%), Gaps = 7/482 (1%)
 Frame = +1

Query  91    KMEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlg  270
             K+  PLI ++      H+H         KE   IS IALPMI+TGLLLYCRSMISMLFLG
Sbjct  26    KITNPLIQKDITVTPPHHH-------VLKELISISKIALPMILTGLLLYCRSMISMLFLG  78

Query  271   rlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLL  450
             RLG+L+LAGGSLA+GFANITGYSILSGLA+GMEP CGQA+GAK+F L+GL LQRTI+LLL
Sbjct  79    RLGELALAGGSLAVGFANITGYSILSGLAVGMEPFCGQAYGAKKFTLLGLCLQRTILLLL  138

Query  451   FTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVT  630
             FTSIPI++LW  M+ IL+LC QD  I+ +AQS++LYS+PDL+AQS LHPLRIYLRSQS+T
Sbjct  139   FTSIPISLLWLYMKHILLLCGQDEAIATQAQSYLLYSIPDLLAQSFLHPLRIYLRSQSIT  198

Query  631   LPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKT  810
             LPLT CA F+I++H+PINY LV  LN GIKGVALS VW NFN++ SL++Y++FSG +KKT
Sbjct  199   LPLTLCATFSILLHIPINYLLVSHLNWGIKGVALSGVWTNFNLIASLILYIVFSGTHKKT  258

Query  811   WGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTT  990
             WGG S+ECF  +KSLL+LAIPSC SVCLEWWWYE+MILLCGLL NPRATVASMG+LIQTT
Sbjct  259   WGGFSFECFTQWKSLLDLAIPSCISVCLEWWWYEIMILLCGLLVNPRATVASMGILIQTT  318

Query  991   SLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWA  1170
             SL+YI PSS+SF VSTRVGN+LGA +P +AKL+AIVGL  SF+LG  A  F + VRN+WA
Sbjct  319   SLLYILPSSISFSVSTRVGNKLGAQKPSKAKLSAIVGLSCSFMLGFLAFVFTILVRNIWA  378

Query  1171  SIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLP  1350
             S+FTQD EI+ LT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL CFY VG+P
Sbjct  379   SMFTQDKEIITLTSLVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGMP  438

Query  1351  VAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDD  1530
             VA WLGFFAG DFQGLWLGLLAAQ SCA+TML+V+ +TDW+ +A RAK+LT+ +  VDD 
Sbjct  439   VAVWLGFFAGLDFQGLWLGLLAAQGSCAVTMLVVMSQTDWDVEALRAKKLTSVVVAVDDS  498

Query  1531  DD  1536
              +
Sbjct  499   KE  500



>ref|XP_003550878.1| PREDICTED: MATE efflux family protein 5-like [Glycine max]
Length=541

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/487 (71%), Positives = 410/487 (84%), Gaps = 6/487 (1%)
 Frame = +1

Query  97    EAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrl  276
             ++P       +   +N N THLSL+  EAKCI++I+  MI+TGLLLY RS+ISMLFLG L
Sbjct  38    KSPTCQLHQMQNPHNNINTTHLSLSLVEAKCIANISFSMILTGLLLYSRSVISMLFLGHL  97

Query  277   gdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFT  456
             G+L+LAGGSLAIGFANITGYS+LSGLAMGMEPICGQAFGAKRFKL+GL++QRT++LLL T
Sbjct  98    GELALAGGSLAIGFANITGYSVLSGLAMGMEPICGQAFGAKRFKLLGLTMQRTVLLLLIT  157

Query  457   SIPIAIL-WCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTL  633
             S  I++  W NM++IL+LC Q+++I+ EA+ +I YSLPDL+ QSLLHPLRIYLRSQS+TL
Sbjct  158   SCLISLFFWLNMKKILLLCAQEQDIANEAELYIFYSLPDLVLQSLLHPLRIYLRSQSITL  217

Query  634   PLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTW  813
             PLT CAA +I++HVP+NY  V +LNLGIKGVALS+V  N N+V  L++Y++FSG +KKTW
Sbjct  218   PLTCCAAVSILLHVPVNYLFVSILNLGIKGVALSAVITNLNLVVLLIIYIVFSGTHKKTW  277

Query  814   GGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTS  993
              G+S ECF G+K LLNLAIPSC SVCLEWWWYE+MILLCGLL NP A+VASMGVLIQTT+
Sbjct  278   PGISRECFNGWKKLLNLAIPSCVSVCLEWWWYEIMILLCGLLVNPHASVASMGVLIQTTA  337

Query  994   LIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWAS  1173
             LIYIFPSSLSFGVSTRVGNELGAG P RAKLAAIVGLC SF+ GL+AL F V+VRNVWAS
Sbjct  338   LIYIFPSSLSFGVSTRVGNELGAGNPRRAKLAAIVGLCFSFVFGLSALAFAVSVRNVWAS  397

Query  1174  IFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPV  1353
             +FT D EI+ALT AVLPIIGLCELGNCPQTT CG LRGTARPKLGA INL CFY VG+PV
Sbjct  398   MFTLDGEIIALTTAVLPIIGLCELGNCPQTTVCGVLRGTARPKLGANINLGCFYLVGMPV  457

Query  1354  AGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTAT-----ISL  1518
             A WLGFFAGFDF+GLWLG+LAAQ SC +TM+ VL RT+W  QA RAKELT++       L
Sbjct  458   AVWLGFFAGFDFKGLWLGMLAAQGSCIVTMMFVLARTNWEGQALRAKELTSSDPREEKKL  517

Query  1519  VDDDDDD  1539
             V+++ ++
Sbjct  518   VEEEHEE  524



>ref|XP_006440531.1| hypothetical protein CICLE_v10019758mg [Citrus clementina]
 gb|ESR53771.1| hypothetical protein CICLE_v10019758mg [Citrus clementina]
Length=513

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/497 (72%), Positives = 424/497 (85%), Gaps = 5/497 (1%)
 Frame = +1

Query  58    LPFAFISAC----KEKMEAPLISEENPKEEDHNHNQ-THLSLAAKEAKCISDIALPMIVT  222
             LP +  S C    +  M +PL S+     +++N N+ THL LA KEA+ I++IALPMI+T
Sbjct  4     LPSSHSSKCNFNQESNMLSPLTSKNPTTNQENNPNESTHLFLAIKEARRIANIALPMILT  63

Query  223   GLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKR  402
             GLLLY RSMISMLFLGRLGDL+LAGGSLAIGF NITGYS+LSGLAMGME ICGQAFGA R
Sbjct  64    GLLLYSRSMISMLFLGRLGDLALAGGSLAIGFGNITGYSLLSGLAMGMETICGQAFGAAR  123

Query  403   FKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQ  582
             +KL+GL+LQRTI+LLL +SIPIA LW NM+ IL+ C Q+++I+ EAQ ++LYSLPDLIA 
Sbjct  124   YKLLGLTLQRTILLLLLSSIPIAFLWLNMKTILLFCGQEQDIAHEAQIYLLYSLPDLIAL  183

Query  583   SLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVV  762
             S LHPLRIYLR+QS+TLPLTFCA FAI++H+PINY LV VLNLG+KG+ALSSVW NFN+V
Sbjct  184   SFLHPLRIYLRTQSITLPLTFCATFAIILHIPINYLLVSVLNLGLKGIALSSVWTNFNLV  243

Query  763   GSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLA  942
              SL++Y++ SGV++KTWGG+S ECF+ ++SLLNLAIPSC SVCLEWWWYE+MILLCGLL 
Sbjct  244   ISLILYIMISGVHEKTWGGISLECFREWRSLLNLAIPSCISVCLEWWWYEIMILLCGLLL  303

Query  943   NPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFIL  1122
             NP+ATVASMG+LIQTTSLIYIFPSSLSFGVSTRVGNELGA  P +AKLAAI+GL +SF+L
Sbjct  304   NPQATVASMGILIQTTSLIYIFPSSLSFGVSTRVGNELGANCPKKAKLAAIIGLSSSFML  363

Query  1123  GLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPK  1302
             G  AL F V VRN+WAS+FTQDAEI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPK
Sbjct  364   GFTALVFTVMVRNIWASMFTQDAEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPK  423

Query  1303  LGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQA  1482
             LGA INL CFY VG+PVA WL F++GFDF+GLW GLLAAQ SC +TML V+ RTDW+ QA
Sbjct  424   LGANINLGCFYLVGMPVAVWLSFYSGFDFEGLWCGLLAAQGSCVVTMLFVVARTDWDLQA  483

Query  1483  RRAKELTATISLVDDDD  1533
             +RAKELT   ++ D+ +
Sbjct  484   QRAKELTGNATIDDETE  500



>gb|KDO63568.1| hypothetical protein CISIN_1g042512mg [Citrus sinensis]
Length=513

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/497 (72%), Positives = 423/497 (85%), Gaps = 5/497 (1%)
 Frame = +1

Query  58    LPFAFISAC----KEKMEAPLISEENPKEEDHNHNQ-THLSLAAKEAKCISDIALPMIVT  222
             LP +  S C    +  M +PL S+     +++N N+ THL LA KEA+ I++IALPMI+T
Sbjct  4     LPSSHSSKCNFNQESNMLSPLTSKNPTTNQENNPNESTHLFLAIKEARRIANIALPMILT  63

Query  223   GLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKR  402
             GLLLY RSMISMLFLGRLGDL+LAGGSLAIGF NITGYS+LSGLAMGME ICGQAFGA R
Sbjct  64    GLLLYSRSMISMLFLGRLGDLALAGGSLAIGFGNITGYSLLSGLAMGMETICGQAFGAAR  123

Query  403   FKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQ  582
             +KL+GL+LQRTI+LLL +SIPIA LW NM+ IL+ C Q+++I+ EAQ ++LYSLPDLIA 
Sbjct  124   YKLLGLTLQRTILLLLLSSIPIAFLWLNMKTILLFCGQEQDIAHEAQIYLLYSLPDLIAL  183

Query  583   SLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVV  762
             S LHPLRIYLR+QS+TLPLTFCA FAI++H+PINY LV VLNLG+KG+ALSSVW NFN+V
Sbjct  184   SFLHPLRIYLRTQSITLPLTFCATFAIILHIPINYLLVSVLNLGLKGIALSSVWTNFNLV  243

Query  763   GSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLA  942
              SL++Y++ SGV++KTWGG+S ECFK ++SLLNLAIPSC SVCLEWWWYE+MILLCGLL 
Sbjct  244   ISLILYIMISGVHEKTWGGISLECFKEWRSLLNLAIPSCISVCLEWWWYEIMILLCGLLL  303

Query  943   NPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFIL  1122
             NP+ATVASMG+LIQTTSLIYIFPSSLSFGVSTRVGNELGA  P +AKLAAI+GL +SF+L
Sbjct  304   NPQATVASMGILIQTTSLIYIFPSSLSFGVSTRVGNELGANCPKKAKLAAIIGLLSSFML  363

Query  1123  GLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPK  1302
             G  AL F   VRN+WAS+FTQDAEI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPK
Sbjct  364   GFTALVFTAIVRNIWASMFTQDAEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPK  423

Query  1303  LGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQA  1482
             LGA INL CFY VG+PVA WL F++GFDF+GLW GLLAAQ SC +TML V+ RTDW+ QA
Sbjct  424   LGANINLGCFYLVGMPVAVWLSFYSGFDFEGLWCGLLAAQGSCVVTMLFVVARTDWDLQA  483

Query  1483  RRAKELTATISLVDDDD  1533
             +RAKELT   ++ D+ +
Sbjct  484   QRAKELTGNATIDDETE  500



>ref|XP_007155701.1| hypothetical protein PHAVU_003G223900g [Phaseolus vulgaris]
 gb|ESW27695.1| hypothetical protein PHAVU_003G223900g [Phaseolus vulgaris]
Length=549

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/475 (72%), Positives = 406/475 (85%), Gaps = 7/475 (1%)
 Frame = +1

Query  94    MEAPLISE---ENPK-EEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISML  261
             + +PLI +     P+ E++    QTH+    KE   I+ IALPMI+TGLLLYCRSMISML
Sbjct  34    ISSPLIQKGIVTTPQVEKNSAAMQTHV---FKEVISIAKIALPMILTGLLLYCRSMISML  90

Query  262   FlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIV  441
             FLG LG+L+LAGGSLA+GFANITGYSILSGLA+GMEPICGQA+GAK+F L+GL LQRT++
Sbjct  91    FLGHLGELALAGGSLAVGFANITGYSILSGLAVGMEPICGQAYGAKKFTLLGLCLQRTVL  150

Query  442   LLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQ  621
             LLLFTS+PI++LW  M+ IL+LC QD++I+ +AQS++LYS+PDL+ QS LHPLRIYLRSQ
Sbjct  151   LLLFTSLPISLLWLYMKHILLLCGQDQDIASQAQSYLLYSIPDLLTQSFLHPLRIYLRSQ  210

Query  622   SVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVY  801
             S+TLPLT CA  +I++HVPINY LV  LNLGIKGVALS VW N N+V SL++YV+FSG +
Sbjct  211   SITLPLTLCATLSILLHVPINYLLVSHLNLGIKGVALSGVWTNLNLVASLILYVVFSGTH  270

Query  802   KKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLI  981
             KKTWGG S ECF  +KSLLNLAIPSC SVCLEWWWYE+MILLCGLL NPRATVASMG+LI
Sbjct  271   KKTWGGFSVECFTQWKSLLNLAIPSCISVCLEWWWYEIMILLCGLLVNPRATVASMGILI  330

Query  982   QTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRN  1161
             QTTSL+YIFPSS+SF VSTRVGN+LGA +P +A+L+AIVGL  SFILG  AL F + VRN
Sbjct  331   QTTSLLYIFPSSISFSVSTRVGNKLGAQKPSKARLSAIVGLSCSFILGGLALVFTIMVRN  390

Query  1162  VWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFV  1341
             +WAS+FTQD EI+ LT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL CFY V
Sbjct  391   IWASMFTQDMEIINLTSLVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLV  450

Query  1342  GLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTA  1506
             G+PVA WLGFFAGFDFQGLW+GLLAAQ SCA+TML+VL RTDW+ +A RAK+LT+
Sbjct  451   GMPVAVWLGFFAGFDFQGLWVGLLAAQGSCAVTMLVVLSRTDWDAEALRAKKLTS  505



>gb|KHN34999.1| MATE efflux family protein 6 [Glycine soja]
Length=502

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/482 (72%), Positives = 410/482 (85%), Gaps = 6/482 (1%)
 Frame = +1

Query  103   PLISEENPK---EEDHNHNQT--HLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFl  267
             PL+  + P    E+  N++QT  H SLA  E KCI++IALPM++TGLLLY RS+ISMLFL
Sbjct  3     PLLIPKPPTTLFEQGQNNHQTKTHFSLALNEVKCIANIALPMVLTGLLLYSRSVISMLFL  62

Query  268   grlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLL  447
             GR+G+L+LAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFKL+GL++QRTIVLL
Sbjct  63    GRVGELALAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFKLLGLAMQRTIVLL  122

Query  448   LFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSV  627
             L TS+ I+ LW NM+++LILC Q  +I+ EAQSFIL+S+PDL+AQSLLHPLRIYLRSQS+
Sbjct  123   LLTSVLISFLWLNMKKLLILCGQQEDIATEAQSFILFSIPDLVAQSLLHPLRIYLRSQSI  182

Query  628   TLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKK  807
             TLPLT+ A+ +I++HVPINYFLV VL LGIKG+AL +VW NFN+V SL++Y+  SGVYKK
Sbjct  183   TLPLTYTASLSILLHVPINYFLVSVLKLGIKGIALGAVWTNFNLVVSLILYIWVSGVYKK  242

Query  808   TWGGVSWE-CFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQ  984
             TW GVS +    G+KSLLNLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMGVLIQ
Sbjct  243   TWPGVSLKGILSGWKSLLNLAIPSCISVCLEWWWYEIMILLCGLLINPQATVASMGVLIQ  302

Query  985   TTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNV  1164
             TT+LIYIFPSSLSF VSTRVGNELGA  P +AK+AA+VGLC S+ LG +AL F V+VR  
Sbjct  303   TTALIYIFPSSLSFAVSTRVGNELGAENPKKAKVAALVGLCISYGLGFSALFFAVSVRQA  362

Query  1165  WASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVG  1344
             WAS+FT+DAEI+ALT+ VLPIIGLCELGNCPQTT CG LRGTARPKLGA INL CFY VG
Sbjct  363   WASMFTRDAEIIALTSMVLPIIGLCELGNCPQTTVCGVLRGTARPKLGANINLGCFYLVG  422

Query  1345  LPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVD  1524
             +PVA  L FFAGFDF+GLWLGLLAAQASC  TML+VL RT+W  Q +RAKELT++    D
Sbjct  423   MPVAVRLSFFAGFDFKGLWLGLLAAQASCMFTMLIVLARTNWEGQVQRAKELTSSSEEQD  482

Query  1525  DD  1530
              +
Sbjct  483   QN  484



>ref|XP_006358411.1| PREDICTED: MATE efflux family protein 5-like [Solanum tuberosum]
Length=507

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/481 (73%), Positives = 408/481 (85%), Gaps = 5/481 (1%)
 Frame = +1

Query  94    MEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgr  273
             M  PL+S+    + + N     L LA  EAK I++IA PMI TG LLY RSMISMLFLGR
Sbjct  1     MLNPLVSQNKQSKTEQNP----LFLAYCEAKSIANIAFPMIFTGFLLYSRSMISMLFLGR  56

Query  274   lgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLF  453
             LG+LSLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKR+K++GLSLQRTI+LLL 
Sbjct  57    LGELSLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRYKILGLSLQRTILLLLL  116

Query  454   TSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTL  633
              SIPI+ LWCNMERILI C QD +I+ EAQ++IL+SLPDL   S LHPLRIYLRSQS+ +
Sbjct  117   ISIPISFLWCNMERILIFCGQDHDIAREAQNYILFSLPDLFTLSFLHPLRIYLRSQSIIM  176

Query  634   PLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTW  813
             PLT+CAA A +VH+PINY LV+VL+LGIKGVALS VW NFN+VGSL+ Y++ S V+  TW
Sbjct  177   PLTYCAALASLVHIPINYLLVIVLDLGIKGVALSGVWTNFNLVGSLIAYIVVSKVHNNTW  236

Query  814   GGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTS  993
               +S +CFKG+KSLL+LAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTTS
Sbjct  237   SSISLDCFKGWKSLLDLAIPSCVSVCLEWWWYEIMILLCGLLVNPKATVASMGILIQTTS  296

Query  994   LIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWAS  1173
             LIYIFPSSLSFGVSTRVGNELGA RP  A+L A+VGL +SFILGL ALTF V VR+VWAS
Sbjct  297   LIYIFPSSLSFGVSTRVGNELGANRPNVARLTALVGLSSSFILGLIALTFAVLVRDVWAS  356

Query  1174  IFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPV  1353
             +FTQD EI+ALT+ +LPIIGLCELGNCPQTTGCG LRGTARPKLGA INL CFY VG+PV
Sbjct  357   MFTQDQEIIALTSLILPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLVCFYLVGMPV  416

Query  1354  AGWLGFFAGFDFqglwlgllaaqaSCALTMLL-VLGRTDWNDQARRAKELTATISLVDDD  1530
             A +LGFF G+ F GLW+GLLAAQASCA+TMLL +L RT+W DQA+RAKELT+TI   D++
Sbjct  417   AVYLGFFRGYHFTGLWIGLLAAQASCAVTMLLAILSRTNWEDQAKRAKELTSTIEYEDEE  476

Query  1531  D  1533
              
Sbjct  477   K  477



>ref|XP_003538709.1| PREDICTED: MATE efflux family protein 6-like [Glycine max]
Length=534

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/482 (72%), Positives = 410/482 (85%), Gaps = 6/482 (1%)
 Frame = +1

Query  103   PLISEENPK---EEDHNHNQT--HLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFl  267
             PL+  + P    E+  N++QT  H SLA  E KCI++IALPM++TGLLLY RS+ISMLFL
Sbjct  35    PLLIPKPPTTLFEQGQNNHQTKTHFSLALNEVKCIANIALPMVLTGLLLYSRSVISMLFL  94

Query  268   grlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLL  447
             GR+G+L+LAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFKL+GL++QRTIVLL
Sbjct  95    GRVGELALAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFKLLGLAMQRTIVLL  154

Query  448   LFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSV  627
             L TS+ I+ LW NM+++LILC Q  +I+ EAQSFIL+S+PDL+AQSLLHPLRIYLRSQS+
Sbjct  155   LLTSVLISFLWLNMKKLLILCGQQEDIATEAQSFILFSIPDLVAQSLLHPLRIYLRSQSI  214

Query  628   TLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKK  807
             TLPLT+ A+ +I++HVPINYFLV VL LGIKG+AL +VW NFN+V SL++Y+  SGVYKK
Sbjct  215   TLPLTYTASLSILLHVPINYFLVSVLKLGIKGIALGAVWTNFNLVVSLILYIWVSGVYKK  274

Query  808   TWGGVSWE-CFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQ  984
             TW GVS +    G+KSLLNLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMGVLIQ
Sbjct  275   TWPGVSLKGILSGWKSLLNLAIPSCISVCLEWWWYEIMILLCGLLINPQATVASMGVLIQ  334

Query  985   TTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNV  1164
             TT+LIYIFPSSLSF VSTRVGNELGA  P +AK+AA+VGLC S+ LG +AL F V+VR  
Sbjct  335   TTALIYIFPSSLSFAVSTRVGNELGAENPKKAKVAALVGLCISYGLGFSALFFAVSVRQA  394

Query  1165  WASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVG  1344
             WAS+FT+DAEI+ALT+ VLPIIGLCELGNCPQTT CG LRGTARPKLGA INL CFY VG
Sbjct  395   WASMFTRDAEIIALTSMVLPIIGLCELGNCPQTTVCGVLRGTARPKLGANINLGCFYLVG  454

Query  1345  LPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVD  1524
             +PVA  L FFAGFDF+GLWLGLLAAQASC  TML+VL RT+W  Q +RAKELT++    D
Sbjct  455   MPVAVRLSFFAGFDFKGLWLGLLAAQASCMFTMLIVLARTNWEGQVQRAKELTSSSEEQD  514

Query  1525  DD  1530
              +
Sbjct  515   QN  516



>ref|XP_007038589.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY23090.1| MATE efflux family protein [Theobroma cacao]
Length=553

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/507 (69%), Positives = 416/507 (82%), Gaps = 10/507 (2%)
 Frame = +1

Query  19    DKRQSNTKNPLFFLPFA-FISACKEKMEAPLISEENPKEEDHNHNQTHLSLAAKEAKCIS  195
             D   SN   PL  +P +  +   ++K   P+     P+++D       L LA KEA  I+
Sbjct  25    DSEGSNIYEPL--IPKSPTVPNQEQKYPVPI----QPQKQD---GAPSLPLAVKEAISIA  75

Query  196   DIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPI  375
              IALPMI+TGL+LY RS+ISMLFLGRLG+L+LAGGSLAIGFANITGYSILSGLAMGME I
Sbjct  76    KIALPMILTGLMLYSRSLISMLFLGRLGELALAGGSLAIGFANITGYSILSGLAMGMESI  135

Query  376   CGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFIL  555
             CGQAFGA+++ L+G++LQRT++LL  +S+PI++LW NM+ ILILC QD  I+ EAQS+++
Sbjct  136   CGQAFGARKYTLLGITLQRTVLLLFVSSLPISLLWINMKTILILCGQDETIATEAQSYLV  195

Query  556   YSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALS  735
             YS+PDL+AQSLLHPLRIYLR+QS+T PLT CA  +I++H+PINY LV  L LGIKGVALS
Sbjct  196   YSVPDLLAQSLLHPLRIYLRTQSITFPLTCCAILSILLHIPINYLLVSHLKLGIKGVALS  255

Query  736   SVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYEL  915
              V  NFN+VGSL++Y+L+ GV+KKTWGG S ECFK +KSL NLAIPSC SVCLEWWWYE+
Sbjct  256   GVLTNFNLVGSLIIYILYFGVHKKTWGGFSMECFKEWKSLTNLAIPSCISVCLEWWWYEI  315

Query  916   MILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAI  1095
             MILLCGLL NP ATVASMG+LIQTT+LIYIFPSSLSF VSTRVGNELGA +P RAKLAA 
Sbjct  316   MILLCGLLLNPEATVASMGILIQTTALIYIFPSSLSFSVSTRVGNELGANQPKRAKLAAF  375

Query  1096  VGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCG  1275
             VGL   F+LG +AL F V VRN+WAS+FT D EI+ALT+ VLPIIGLCELGNCPQTTGCG
Sbjct  376   VGLFCGFMLGFSALLFAVMVRNMWASMFTDDREIIALTSLVLPIIGLCELGNCPQTTGCG  435

Query  1276  ALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVL  1455
              LRGTARPK+GA INL CFY VG+PVA WLGFFAGFDF+GLWLGLLAAQ SC LTM++VL
Sbjct  436   VLRGTARPKVGANINLGCFYLVGMPVAVWLGFFAGFDFKGLWLGLLAAQGSCMLTMMMVL  495

Query  1456  GRTDWNDQARRAKELTATISLVDDDDD  1536
              RTDW+ +A+RAKELT T+ +VDD  +
Sbjct  496   VRTDWDSEAQRAKELTGTVVVVDDSKE  522



>ref|XP_002276226.1| PREDICTED: MATE efflux family protein 5-like [Vitis vinifera]
Length=530

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/498 (73%), Positives = 424/498 (85%), Gaps = 9/498 (2%)
 Frame = +1

Query  67    AFISACKEK--MEAPLIS-----EENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTG  225
               +SA +++  M  PL+      ++ P  ++ N ++THLSLA  EA+ I+ IA PMI+TG
Sbjct  19    GLLSAVEQEPHMLTPLVPKAPTLDDQPHGQEQNPSKTHLSLALTEARHIASIAFPMILTG  78

Query  226   LLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRF  405
             LLLY RSMISMLFLGRLG+L+LAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGA+R+
Sbjct  79    LLLYSRSMISMLFLGRLGELALAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAQRY  138

Query  406   KLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQS  585
             KL+GL+LQRT++LLL TSIPIA LW NM+ IL+ C QD +I+ EAQS+ILYSLPDL+AQS
Sbjct  139   KLLGLTLQRTVLLLLLTSIPIAFLWFNMKEILLFCGQDEDIATEAQSYILYSLPDLVAQS  198

Query  586   LLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVG  765
              LHPLRIYLR+QS+TLPLT+CA  AI++H+PINYFLV VL+LGIKGVALS +W N N+VG
Sbjct  199   FLHPLRIYLRTQSITLPLTYCATLAILLHIPINYFLVSVLDLGIKGVALSGIWTNLNLVG  258

Query  766   SLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLAN  945
             SL+ YV+ S VYKKTWGGVS EC + +KSLLNLA+PSC SVCLEWWWYE+MILLCGLL N
Sbjct  259   SLIAYVVVSRVYKKTWGGVSSECLRDWKSLLNLAVPSCISVCLEWWWYEIMILLCGLLLN  318

Query  946   PRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILG  1125
             PRATVASMG+LIQTT+LIYIFPSSLSF +STRVGNELGA RP +A+LAAIVGL +SFILG
Sbjct  319   PRATVASMGILIQTTALIYIFPSSLSFSLSTRVGNELGANRPEKARLAAIVGLSSSFILG  378

Query  1126  LAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKL  1305
               AL F V VR  WA++FTQD EI+ LT+ VLPIIGLCELGNCPQTTGCGALRGTARPKL
Sbjct  379   FLALFFAVMVRKTWATMFTQDPEILTLTSMVLPIIGLCELGNCPQTTGCGALRGTARPKL  438

Query  1306  GAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQAR  1485
             GA INL CFY VG+PVA WLGFFAGFDF+GLWLGLLAAQ SCA+TML VL +T+W+ QA+
Sbjct  439   GANINLGCFYLVGMPVAVWLGFFAGFDFKGLWLGLLAAQGSCAVTMLFVLFQTNWDQQAQ  498

Query  1486  RAKELTATISLVDDDDDD  1539
             RAKELT T S  DDD++ 
Sbjct  499   RAKELTGTGS--DDDEES  514



>ref|XP_007155565.1| hypothetical protein PHAVU_003G212600g [Phaseolus vulgaris]
 gb|ESW27559.1| hypothetical protein PHAVU_003G212600g [Phaseolus vulgaris]
Length=536

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/479 (71%), Positives = 406/479 (85%), Gaps = 9/479 (2%)
 Frame = +1

Query  118   ENPKEEDHNH-----NQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgd  282
             ++P  + H+H     ++THLSLA  EAKCIS I+  MI+TGLLLY RSMISMLFLG LG+
Sbjct  33    KSPTCQHHHHQTQNPHKTHLSLALSEAKCISSISFSMILTGLLLYSRSMISMLFLGHLGE  92

Query  283   lslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSI  462
             L+LAGGSLAIGFANITGYS+LSGLAMGMEPICGQAFGAKRFKL+GL++QRT++LLL TS+
Sbjct  93    LALAGGSLAIGFANITGYSVLSGLAMGMEPICGQAFGAKRFKLLGLTMQRTVLLLLLTSL  152

Query  463   PIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLT  642
              I+  W N++++L+LC Q+ +I+ EAQ +I Y+LPDL+ QSLLHPLRI LRSQS+TLPLT
Sbjct  153   FISCFWLNIKKLLLLCGQEEDIANEAQFYIYYTLPDLVLQSLLHPLRINLRSQSITLPLT  212

Query  643   FCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGV  822
               AA +I++HVPINY  V VLNLGI+G+A+S+V  NFN+V SLV+YV+ SG +KKTW G+
Sbjct  213   CIAALSIILHVPINYLFVSVLNLGIRGIAISAVITNFNLVLSLVIYVVVSGTHKKTWPGI  272

Query  823   SWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIY  1002
             SW CFKG+K LLNLAIPSC SVCLEWWWYE+MILLCGLL NP A+VASMGVLIQTT+LIY
Sbjct  273   SWSCFKGWKRLLNLAIPSCVSVCLEWWWYEIMILLCGLLVNPHASVASMGVLIQTTALIY  332

Query  1003  IFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFT  1182
             IFPSSLSFGVSTRVGNELGAG PGRAK+AAIVGLC SF+LG +AL F ++VR VWA++FT
Sbjct  333   IFPSSLSFGVSTRVGNELGAGNPGRAKIAAIVGLCFSFVLGFSALVFAISVRKVWATMFT  392

Query  1183  QDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGW  1362
              D EI+ALT+ VLPIIGLCELGNCPQTT CG LRGTARPKLGA INL CFY VG+PVA W
Sbjct  393   GDGEILALTSMVLPIIGLCELGNCPQTTVCGVLRGTARPKLGANINLGCFYLVGMPVAVW  452

Query  1363  LGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDDD  1539
             LGFFAGFDF+GLWLG+LAAQ SC +TM+ VL RT+W  QA RAKELT+     D +++ 
Sbjct  453   LGFFAGFDFKGLWLGMLAAQGSCMITMMFVLARTNWEGQALRAKELTS----CDSNEEK  507



>ref|XP_006340580.1| PREDICTED: MATE efflux family protein 5-like [Solanum tuberosum]
Length=499

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/480 (71%), Positives = 407/480 (85%), Gaps = 1/480 (0%)
 Frame = +1

Query  103   PLISEENPKEEDHNH-NQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlg  279
             PL+  + P  + H+H N TH +L   EAK I++IA PMI+TGLLLY RS+ISMLFLG+LG
Sbjct  3     PLLIPKTPTNKLHDHKNNTHFTLIFIEAKSIANIAFPMILTGLLLYSRSLISMLFLGQLG  62

Query  280   dlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTS  459
              L+LAGGSLA+GFANITGYSILSGLAMGMEPICGQAFGAK++ L+GL+LQRTI+LL+  S
Sbjct  63    GLALAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGAKKYNLLGLTLQRTILLLILIS  122

Query  460   IPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPL  639
              PIA+LW NM+ IL+ C QD +I+ EAQS+++YS+PDL AQSLLHPLRIYLR+QS+TLPL
Sbjct  123   FPIALLWINMKNILLYCGQDEDIATEAQSYLIYSIPDLFAQSLLHPLRIYLRTQSITLPL  182

Query  640   TFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGG  819
             TFCA  ++ +HVPINY LV  LNLG+KG+ALSSVW NFN+V SL++Y++ +GVYKKTW  
Sbjct  183   TFCAILSVSLHVPINYLLVTKLNLGVKGIALSSVWTNFNLVISLIIYIIITGVYKKTWEN  242

Query  820   VSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLI  999
             +S ECFKG+K LLNLAIPSC SVCLEWWWYE+MILLCGLL NPRATVASMG+LIQTTSLI
Sbjct  243   LSTECFKGWKKLLNLAIPSCISVCLEWWWYEIMILLCGLLINPRATVASMGILIQTTSLI  302

Query  1000  YIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIF  1179
             YIFPSSLSF VSTRVGNELGA +P +AK+AAIVGL  SFILG +AL F V VR +WA +F
Sbjct  303   YIFPSSLSFSVSTRVGNELGARQPNKAKIAAIVGLAGSFILGFSALFFAVTVRKIWAKMF  362

Query  1180  TQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAG  1359
             T D +I+ LT+ VLPIIGLCE+GNCPQTTGCG LRGTARPK+GA INL CFY VG+PVA 
Sbjct  363   TNDQDILTLTSLVLPIIGLCEIGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGMPVAV  422

Query  1360  WLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDDD  1539
              L F+AGFDF+GLWLGLLAAQASC +TMLLVL RTDW+ +A RAK+LT T+    D++++
Sbjct  423   GLSFYAGFDFEGLWLGLLAAQASCMVTMLLVLLRTDWDLEAERAKDLTGTLLNGFDENEN  482



>ref|XP_007158465.1| hypothetical protein PHAVU_002G154600g [Phaseolus vulgaris]
 gb|ESW30459.1| hypothetical protein PHAVU_002G154600g [Phaseolus vulgaris]
Length=533

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/470 (73%), Positives = 401/470 (85%), Gaps = 1/470 (0%)
 Frame = +1

Query  103   PLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgd  282
             P  + + P++    H  TH SLA  EAKCI++ ALPM++TGLLLY RS+ISMLFLGR GD
Sbjct  39    PPTTFQQPQKNQKPHETTHFSLAFNEAKCIANTALPMVLTGLLLYSRSVISMLFLGRAGD  98

Query  283   lslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSI  462
             L+LAGGSLAIGFANITGYSILSGLAMGMEPIC QAFGAKRFKL+G ++QRTIVLLL TSI
Sbjct  99    LALAGGSLAIGFANITGYSILSGLAMGMEPICVQAFGAKRFKLLGFAMQRTIVLLLLTSI  158

Query  463   PIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLT  642
              I+ LW NM+ IL+LC Q  +I+ +AQSFILYSLPDL+AQSLLHPLRIYLRSQS+TLPLT
Sbjct  159   FISFLWLNMKNILLLCGQQEDIATQAQSFILYSLPDLVAQSLLHPLRIYLRSQSITLPLT  218

Query  643   FCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGV  822
             + A  +I++H+PINY LV V  LGIKG+AL +VW NFN+V SL++Y+  SG+Y KTW  +
Sbjct  219   YSAFLSILLHLPINYLLVSVFKLGIKGIALGAVWTNFNLVFSLLLYIWLSGIYSKTWTRI  278

Query  823   SWE-CFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLI  999
             S +  F G+K+LLNLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMGVLIQTT+LI
Sbjct  279   SLKGIFCGWKALLNLAIPSCISVCLEWWWYEIMILLCGLLINPQATVASMGVLIQTTALI  338

Query  1000  YIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIF  1179
             YIFPSSLSF VS RVGNE+GA  P RAKLAA+VGL  S+++GL+AL F V+VR+VWAS+F
Sbjct  339   YIFPSSLSFAVSARVGNEVGAENPKRAKLAALVGLFFSYVMGLSALFFAVSVRHVWASMF  398

Query  1180  TQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAG  1359
             T+DAEI+ALTA VLPIIGLCELGNCPQTT CG LRGTARPKLGA INL CFY VG+P+A 
Sbjct  399   TRDAEIIALTATVLPIIGLCELGNCPQTTVCGVLRGTARPKLGANINLGCFYIVGMPIAV  458

Query  1360  WLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTAT  1509
             WLGFFAGFDF+GLWLGLLAAQASC +TML VL RT+W DQ +RAK+LT++
Sbjct  459   WLGFFAGFDFKGLWLGLLAAQASCMITMLFVLARTNWEDQVQRAKQLTSS  508



>ref|XP_003516689.1| PREDICTED: MATE efflux family protein 6-like [Glycine max]
Length=541

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/459 (75%), Positives = 400/459 (87%), Gaps = 1/459 (0%)
 Frame = +1

Query  130   EEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggsla  309
             + +   ++TH SLA  E KCI++IALPM++TGLLLY RS+ISMLFLGR+G+L+LAGGSLA
Sbjct  50    QNNQKPHKTHFSLALDEVKCIANIALPMVLTGLLLYSRSVISMLFLGRVGELALAGGSLA  109

Query  310   igFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNM  489
             IGFANITGYSILSGLAMGMEPICGQAFGAKRFKL+GL++QRT+VLLL T + I+ LW NM
Sbjct  110   IGFANITGYSILSGLAMGMEPICGQAFGAKRFKLLGLAMQRTMVLLLLTCVFISFLWFNM  169

Query  490   ERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVV  669
             ++IL+LC Q  +I+ EAQSFIL+S+PDL+AQSLLHPLRIYLRSQS+TLPLT+ A+ +I++
Sbjct  170   KKILVLCGQQEDIATEAQSFILFSIPDLVAQSLLHPLRIYLRSQSITLPLTYTASLSILL  229

Query  670   HVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWE-CFKGY  846
             HVPINYFLV VL LGIKG+AL +VW NFN+V SL++Y+  SGVYKKTW GVS +  F G+
Sbjct  230   HVPINYFLVSVLKLGIKGIALGAVWTNFNLVFSLILYIWVSGVYKKTWPGVSLKGVFSGW  289

Query  847   KSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSF  1026
             KSLLNLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMGVLIQTT+LIYIFPSSLSF
Sbjct  290   KSLLNLAIPSCISVCLEWWWYEIMILLCGLLINPQATVASMGVLIQTTALIYIFPSSLSF  349

Query  1027  GVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMAL  1206
              VSTRVGNELGA  P +AKLAA+VGLC S+ LG +AL F V+VR+VWAS+FT DAEI+AL
Sbjct  350   AVSTRVGNELGAENPKKAKLAALVGLCFSYGLGFSALFFAVSVRHVWASMFTSDAEIIAL  409

Query  1207  TAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFD  1386
             T+ VLPIIGLCELGNCPQTT CG LRGTARPKLGA INL CFY VG+PVA  L FFAGFD
Sbjct  410   TSMVLPIIGLCELGNCPQTTVCGVLRGTARPKLGANINLGCFYLVGMPVAVRLSFFAGFD  469

Query  1387  FqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
             F+GLWLGLLAAQASC  TML+VL RT+W  Q +RAKELT
Sbjct  470   FKGLWLGLLAAQASCMFTMLIVLARTNWEGQVQRAKELT  508



>ref|XP_007152342.1| hypothetical protein PHAVU_004G121900g [Phaseolus vulgaris]
 gb|ESW24336.1| hypothetical protein PHAVU_004G121900g [Phaseolus vulgaris]
Length=571

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/465 (72%), Positives = 401/465 (86%), Gaps = 2/465 (0%)
 Frame = +1

Query  151   QTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANIT  330
             ++HL     E   IS IA+PMI+TGLLLYCRSMISMLFLG LG+L+LAGGSLA+GFANIT
Sbjct  80    KSHLPDTINEVISISKIAIPMILTGLLLYCRSMISMLFLGHLGELALAGGSLAVGFANIT  139

Query  331   GYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILC  510
             GYSILSGLA+GMEPICGQAFGAKRF L+GL LQRTI+LLLFTS+PI++LW +M++IL+LC
Sbjct  140   GYSILSGLAVGMEPICGQAFGAKRFTLLGLCLQRTILLLLFTSLPISLLWLHMKKILLLC  199

Query  511   RQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYF  690
              QD  ++ +AQS+++YS+PDLIAQS LHPLRIYLRSQS+TLPLT CA+ +I++H+PINYF
Sbjct  200   GQDEAMATQAQSYLVYSIPDLIAQSFLHPLRIYLRSQSITLPLTLCASLSILLHIPINYF  259

Query  691   LVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAI  870
             LV  L LGIKGVAL  VW NFN+V SL++Y++FSG +KKTWGG S+ECF  +KSLLNLAI
Sbjct  260   LVSHLRLGIKGVALGGVWTNFNLVASLILYIVFSGTHKKTWGGFSFECFTQWKSLLNLAI  319

Query  871   PSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGN  1050
             PSC SVCLEWWWYE+MILLCGLL NPRATVASMG+LIQTTSL+YIFPSSLSF VSTRVGN
Sbjct  320   PSCVSVCLEWWWYEIMILLCGLLVNPRATVASMGILIQTTSLLYIFPSSLSFSVSTRVGN  379

Query  1051  ELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPII  1230
             +LGA +P +A+L+AIVGL  SF+ G+ AL F + VRN WAS+FT+D EI++LT+ VLPII
Sbjct  380   KLGAQKPSKARLSAIVGLSCSFVSGVLALVFALMVRNTWASMFTKDKEIISLTSMVLPII  439

Query  1231  GLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgl  1410
             GLCELGNCPQTTGCG LRGTARPK+GA INL CFY VG+PV+ WL FF+G+DFQGLWLGL
Sbjct  440   GLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGMPVSIWLAFFSGYDFQGLWLGL  499

Query  1411  laaqaSCALTMLLVLGRTDWNDQARRAKELTAT--ISLVDDDDDD  1539
             LAAQ SCA++ML+VL RTDW  +A+RAK+LT     S VDD + +
Sbjct  500   LAAQGSCAVSMLVVLCRTDWEFEAQRAKKLTGMGGASSVDDHNHE  544



>ref|XP_010086543.1| MATE efflux family protein LAL5 [Morus notabilis]
 gb|EXB19760.1| MATE efflux family protein LAL5 [Morus notabilis]
Length=547

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/457 (76%), Positives = 396/457 (87%), Gaps = 1/457 (0%)
 Frame = +1

Query  142   NHNQTH-LSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigF  318
                QT+ +SL  KEAKCI+ ++LPM++TGLLLY RS+ISMLFLGRLG+L LAGGSLAI F
Sbjct  45    TQTQTNNVSLVLKEAKCIAKVSLPMVLTGLLLYSRSLISMLFLGRLGELPLAGGSLAIAF  104

Query  319   ANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERI  498
             ANITGYS+LSGLA+GMEPICGQAFGAKRFKL+ L++QRTI+LLL TSIPI+ILW NM++I
Sbjct  105   ANITGYSLLSGLAIGMEPICGQAFGAKRFKLLSLAMQRTILLLLLTSIPISILWLNMKKI  164

Query  499   LILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVP  678
             L+ C Q   I+  AQS+IL+S+PDLIAQSLLHPLRIYLR+QSVTLPLTFCAAFAI++H+P
Sbjct  165   LLFCGQQENIAANAQSYILFSIPDLIAQSLLHPLRIYLRTQSVTLPLTFCAAFAILLHIP  224

Query  679   INYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLL  858
             IN+ LV  L+LGIKGVALS VW N N VGSL+VYV+ SGVYKKTW GVS ECFK +KSLL
Sbjct  225   INFLLVSFLDLGIKGVALSGVWTNANFVGSLIVYVVVSGVYKKTWCGVSSECFKEWKSLL  284

Query  859   NLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVST  1038
             NLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTT+L+YIFPSSLSFGVST
Sbjct  285   NLAIPSCVSVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTALMYIFPSSLSFGVST  344

Query  1039  RVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAV  1218
             RVGNELGA  P RA+LAA VGL  SF+LG +AL F V VR VWAS+FT+D EI+ALT+ V
Sbjct  345   RVGNELGANNPWRARLAAKVGLLCSFVLGFSALFFAVVVRKVWASMFTKDGEIIALTSMV  404

Query  1219  LPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqgl  1398
             LPIIGLCELGNCPQTTGCG LRGTARP LGA INL CFY VG+PVA WL F+AGFDF+GL
Sbjct  405   LPIIGLCELGNCPQTTGCGVLRGTARPCLGANINLGCFYLVGMPVAIWLSFYAGFDFKGL  464

Query  1399  wlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTAT  1509
             WLGLLAAQ SC LTML  LGRT+W  +A+RAKELT  
Sbjct  465   WLGLLAAQGSCVLTMLFCLGRTNWEVEAQRAKELTGN  501



>ref|XP_003555370.1| PREDICTED: MATE efflux family protein 5-like [Glycine max]
Length=550

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/486 (70%), Positives = 406/486 (84%), Gaps = 11/486 (2%)
 Frame = +1

Query  103   PLISEE--------NPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISM  258
             PLI ++        + ++ D    QTH  +  KE   I  IA PMI+TGLLLYCRSMISM
Sbjct  34    PLIQKDITVTLTTLHEEKNDPRTMQTHHHVL-KELISICKIAFPMILTGLLLYCRSMISM  92

Query  259   LFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTI  438
             LFLGRLG+L+LAGGSLA+GFANI+GYSILSGLA+GME ICGQA+GAK+F L+GL LQRTI
Sbjct  93    LFLGRLGELALAGGSLAVGFANISGYSILSGLAVGMESICGQAYGAKKFSLLGLCLQRTI  152

Query  439   VLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRS  618
             +LLLFT IPI++LW  M+ IL+LC QD  I+ +AQS++LYS+PDL+AQS LHPLRIYLRS
Sbjct  153   LLLLFTCIPISLLWLYMKHILLLCGQDEAIATQAQSYLLYSIPDLLAQSFLHPLRIYLRS  212

Query  619   QSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGV  798
             QS+TLPLT CA F+I++H+PINY LV  LN GIKGVALS VW N N+V SL++Y++FSG 
Sbjct  213   QSITLPLTLCATFSILLHIPINYLLVSHLNWGIKGVALSGVWTNLNLVASLILYIVFSGT  272

Query  799   YKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVL  978
             +KKTWGG S+ECF  +KSLLNLAIPSC SVCLEWWWYE+MILLCGLL NPRATVASMG+L
Sbjct  273   HKKTWGGFSFECFTQWKSLLNLAIPSCISVCLEWWWYEIMILLCGLLVNPRATVASMGIL  332

Query  979   IQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVR  1158
             IQTTSL+YIFPSS+SF VSTRVGN+LGA +P +AK ++IVGL  SF+LG+ AL F + VR
Sbjct  333   IQTTSLLYIFPSSISFSVSTRVGNKLGAQKPSKAKFSSIVGLSCSFMLGVFALVFTILVR  392

Query  1159  NVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYF  1338
             N+WA++FTQD EI+ LT+ VLP+IGLCELGNCPQTTGCG LRGTARPK+GA INL CFY 
Sbjct  393   NIWANMFTQDKEIITLTSFVLPVIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYL  452

Query  1339  VGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISL  1518
             VG+PVA WLGFFAGFDFQGLWLGLLAAQ SCA+TML+VL RTDW+ +A RAK+LT+ +  
Sbjct  453   VGMPVAVWLGFFAGFDFQGLWLGLLAAQGSCAVTMLVVLSRTDWDAEALRAKKLTSVV--  510

Query  1519  VDDDDD  1536
             VDD  +
Sbjct  511   VDDSKE  516



>ref|XP_010061388.1| PREDICTED: MATE efflux family protein 5 [Eucalyptus grandis]
Length=520

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/463 (72%), Positives = 392/463 (85%), Gaps = 4/463 (1%)
 Frame = +1

Query  127   KEEDHNHNQ----THLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlsla  294
             K   HN +Q    T+L+L  +E + I+ IALPMI+TGLLLYCRSMISMLFLG LG+L+LA
Sbjct  8     KHPQHNQSQKGQKTNLTLVVREVRAIAQIALPMILTGLLLYCRSMISMLFLGGLGELALA  67

Query  295   ggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAI  474
             GGSLA+GFANITGYSILSGLAMGMEPIC QAFGAK+  L+GLSLQRT++LL+ TS+PI+ 
Sbjct  68    GGSLALGFANITGYSILSGLAMGMEPICSQAFGAKKHALLGLSLQRTVLLLMLTSLPISF  127

Query  475   LWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAA  654
             LW NM+RIL+   QD +I+ EAQSF+LY++PDL+A S+LHPLRIYLRSQS+TLPLTFCA 
Sbjct  128   LWLNMKRILLFAGQDEDIATEAQSFLLYTIPDLLALSVLHPLRIYLRSQSITLPLTFCAT  187

Query  655   FAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWEC  834
              +++ HVPIN FLV  L LGIKGVAL  VW NFN+V SL++Y+L SGV+KKTWGG+S +C
Sbjct  188   LSVIFHVPINLFLVKHLGLGIKGVALGGVWTNFNLVASLIIYILVSGVHKKTWGGLSSDC  247

Query  835   FKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPS  1014
             F+ +++LLNLAIPSC SVCLEWWWYE+MILLCGL  NPRATVASMG+LIQTTSLIYIFPS
Sbjct  248   FREWRNLLNLAIPSCVSVCLEWWWYEIMILLCGLFLNPRATVASMGILIQTTSLIYIFPS  307

Query  1015  SLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAE  1194
             SLSF VSTRVGNELGA RP +AKL+AIVGL   F+LGL+AL F + VR  WA++FT D E
Sbjct  308   SLSFSVSTRVGNELGANRPLKAKLSAIVGLGCGFVLGLSALVFAITVRKTWATMFTLDEE  367

Query  1195  IMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFF  1374
             IM LT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA +NL CFY VG+PV   L FF
Sbjct  368   IMRLTSLVLPIIGLCELGNCPQTTGCGVLRGTARPKIGAHVNLGCFYVVGMPVGIGLAFF  427

Query  1375  AGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
              GF+FQGLWLGLLAAQASC +TML+VLG TDW  +ARRA+ELT
Sbjct  428   WGFNFQGLWLGLLAAQASCLVTMLVVLGFTDWEHEARRAEELT  470



>ref|XP_003592313.1| Multidrug and toxin extrusion protein [Medicago truncatula]
 gb|AES62564.1| MATE efflux family protein [Medicago truncatula]
Length=540

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/483 (69%), Positives = 398/483 (82%), Gaps = 4/483 (1%)
 Frame = +1

Query  103   PLISEE-NPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlg  279
             PLI ++ N +       +THL    KE   IS IA PMI TGLLLYCRSMISMLFLG LG
Sbjct  39    PLIQKDINIENPTTQFQKTHLRATFKEVISISKIAFPMIFTGLLLYCRSMISMLFLGHLG  98

Query  280   dlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTS  459
             +L+LAGGSLA+GFANITGYSILSGLA+GMEPICGQAFGAKRF L+GL LQ+TI+LLL TS
Sbjct  99    ELALAGGSLAVGFANITGYSILSGLAVGMEPICGQAFGAKRFTLLGLCLQKTILLLLLTS  158

Query  460   IPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPL  639
             IPI++LW   + IL+LC Q+ +I+ +AQ ++LYS+PDL+AQS LHPLRIYLRSQS+TLPL
Sbjct  159   IPISLLWLYTKHILLLCGQEEDIATQAQIYLLYSIPDLLAQSFLHPLRIYLRSQSITLPL  218

Query  640   TFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGG  819
             T CA  AI +H+PINYFLV  LN+GIKGVALS VW NFN+V SL++Y++FSG +KKTWGG
Sbjct  219   TLCATLAIFLHIPINYFLVSHLNMGIKGVALSGVWTNFNLVASLILYIVFSGTHKKTWGG  278

Query  820   VSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLI  999
              S +CFK +KSLLNLA+PSC SVCLEWWWYE+MILLCGLL NPRATVASMG+LIQTTSL+
Sbjct  279   FSSQCFKQWKSLLNLAVPSCLSVCLEWWWYEIMILLCGLLINPRATVASMGILIQTTSLL  338

Query  1000  YIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIF  1179
             YIFPSS+SF VSTRVGN+LGA +P +AKL+AIVGL  SFILG+ AL F V VRN+WAS+F
Sbjct  339   YIFPSSISFSVSTRVGNKLGAQKPSKAKLSAIVGLTCSFILGVFALVFAVMVRNIWASMF  398

Query  1180  TQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAG  1359
             T+D EI+ +T+ VLP+IGLCELGNCPQTTGCG LRGTARPK+GA IN  CFY VG+PVA 
Sbjct  399   TEDKEIIKITSLVLPLIGLCELGNCPQTTGCGVLRGTARPKVGANINFGCFYIVGMPVAI  458

Query  1360  WLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDD--  1533
             WL F+ GFDFQGLW+GLL AQ +CA+TML+VL +TDW+ +A RAK+LT         D  
Sbjct  459   WLAFYVGFDFQGLWIGLLVAQGTCAVTMLVVLSQTDWDCEALRAKKLTGIGEATKTSDVF  518

Query  1534  -DD  1539
              DD
Sbjct  519   IDD  521



>ref|XP_006587359.1| PREDICTED: multidrug and toxin extrusion protein 2-like, partial 
[Glycine max]
Length=502

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/444 (74%), Positives = 387/444 (87%), Gaps = 0/444 (0%)
 Frame = +1

Query  175   KEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGL  354
             KE   IS IA+PMI+TGLLLYCRSMISMLFLG LG+L+LAGGSLA+GFANITGYSILSGL
Sbjct  23    KEVFSISKIAIPMILTGLLLYCRSMISMLFLGHLGELALAGGSLAVGFANITGYSILSGL  82

Query  355   AMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISM  534
             A+GMEPICGQAFGAKRF L+GL LQRTI+LLLFTS+PI +LW  M++IL+LC QD  I+ 
Sbjct  83    AVGMEPICGQAFGAKRFTLLGLCLQRTILLLLFTSLPITLLWLYMKQILLLCGQDEAIAT  142

Query  535   EAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLG  714
             +AQ +++YS+PDLIAQS LHPLRIYLR+QS+TLPLT CA+F+I++H+PINYFLV  L LG
Sbjct  143   QAQQYLVYSIPDLIAQSFLHPLRIYLRTQSITLPLTLCASFSILLHIPINYFLVAHLKLG  202

Query  715   IKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCL  894
             IKGVAL  VW NFN+V SL++Y++FS  +KKTWGG S+ECF  +KSLLNLAIPSC SVCL
Sbjct  203   IKGVALGGVWTNFNLVASLILYIVFSSTHKKTWGGFSFECFTQWKSLLNLAIPSCVSVCL  262

Query  895   EWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPG  1074
             EWWWYE+MILLCGLL NP+ATVASMG+LIQTTSL+YIFPSSLSF VSTRVGN+LGA +P 
Sbjct  263   EWWWYEIMILLCGLLVNPKATVASMGILIQTTSLLYIFPSSLSFSVSTRVGNKLGAQKPS  322

Query  1075  RAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNC  1254
             +A+L+AIVGL  SF+ G+ AL F + VRN WAS+FT+D EI+ LT+ VLPIIGLCELGNC
Sbjct  323   KARLSAIVGLSCSFMSGVLALFFALMVRNTWASMFTKDKEIITLTSMVLPIIGLCELGNC  382

Query  1255  PQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCA  1434
             PQTTGCG LRGTARPK+GA INL CFY VG+PV+ WL FF G+DFQGLWLGLLAAQ SCA
Sbjct  383   PQTTGCGVLRGTARPKVGANINLGCFYLVGMPVSIWLAFFTGYDFQGLWLGLLAAQGSCA  442

Query  1435  LTMLLVLGRTDWNDQARRAKELTA  1506
             +TML+VL RTDW  +A+RAK+LT 
Sbjct  443   VTMLVVLCRTDWEFEAQRAKKLTG  466



>ref|XP_004244600.1| PREDICTED: MATE efflux family protein 5-like [Solanum lycopersicum]
Length=508

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/471 (73%), Positives = 401/471 (85%), Gaps = 1/471 (0%)
 Frame = +1

Query  130   EEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggsla  309
             ++     +  L     EAK I  I+ PMI +GLLLY RSMISMLFLGRLG++SLAGGSLA
Sbjct  11    KQSKKTEENPLFFVYCEAKSIGKISFPMIFSGLLLYSRSMISMLFLGRLGEMSLAGGSLA  70

Query  310   igFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNM  489
             IGFANITGYSILSGL+MGMEPIC QAFGAKR+K++G+SLQRTI+LLL  SIPI+ LWCNM
Sbjct  71    IGFANITGYSILSGLSMGMEPICVQAFGAKRYKILGISLQRTILLLLLISIPISSLWCNM  130

Query  490   ERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVV  669
             E+IL+ C QDR I++EAQ++ILYSLPDLI  S LHPLRIYLRSQS+ +PLT+CAA A ++
Sbjct  131   EKILVFCGQDRGIAIEAQNYILYSLPDLITLSFLHPLRIYLRSQSIIMPLTYCAALASLL  190

Query  670   HVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYK  849
             H+PINY LV+VLNLGIKGVALS VW NFN+VGSL+ Y++ S VY  TW  +S++CFKG+K
Sbjct  191   HIPINYLLVIVLNLGIKGVALSGVWTNFNLVGSLIAYIVVSKVYINTWSSISFDCFKGWK  250

Query  850   SLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFG  1029
             SLL+LAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTTSLIYIFPSSLSFG
Sbjct  251   SLLDLAIPSCVSVCLEWWWYEIMILLCGLLVNPKATVASMGILIQTTSLIYIFPSSLSFG  310

Query  1030  VSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALT  1209
             +STRVGNELGA RP  A+L A+VGL  SF+LGL AL F V VR+VWAS+FTQD EI+ALT
Sbjct  311   LSTRVGNELGANRPNVARLTALVGLSCSFVLGLMALAFAVLVRDVWASMFTQDREIIALT  370

Query  1210  AAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDF  1389
             + +LPIIGLCELGNCPQTTGCG LRGTARPKLGA INL CFY VG+PVA +LGFF G+DF
Sbjct  371   SLILPIIGLCELGNCPQTTGCGILRGTARPKLGANINLGCFYLVGMPVAVYLGFFRGYDF  430

Query  1390  qglwlgllaaqaSCALTMLLV-LGRTDWNDQARRAKELTATISLVDDDDDD  1539
              GLW+GLLAAQASCA+TMLLV L RT+W DQA+RAKELT+TI    +D++ 
Sbjct  431   TGLWIGLLAAQASCAVTMLLVILSRTNWEDQAKRAKELTSTIEFEYEDEEK  481



>ref|XP_004246128.1| PREDICTED: MATE efflux family protein 6-like [Solanum lycopersicum]
Length=494

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/484 (73%), Positives = 417/484 (86%), Gaps = 11/484 (2%)
 Frame = +1

Query  94    MEAPLISEENPKEEDHNHNQ-THLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlg  270
             M +PLI +   KEE++   Q +HL+LA  EAKCI  IA PMI TGL+LY RS+ISM+FLG
Sbjct  1     MLSPLIDQ---KEENNIPKQKSHLTLAILEAKCIGKIAFPMIFTGLILYSRSIISMIFLG  57

Query  271   rlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLL  450
              LG+LSLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRF ++GL+LQRTI+LLL
Sbjct  58    HLGELSLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFNILGLTLQRTILLLL  117

Query  451   FTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVT  630
              TSIPI+ILW  M+++LILC Q+ EI+  AQ++IL+SLPDL AQSLLHPLRIYLRSQS+T
Sbjct  118   LTSIPISILWLFMQKLLILCGQNHEIAKMAQNYILFSLPDLFAQSLLHPLRIYLRSQSIT  177

Query  631   LPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKT  810
             LPLTFCA FAI++H+PINYFL+ +LNLGIKGVALS VW NFN+VGSL++Y++ S +YKKT
Sbjct  178   LPLTFCAIFAIILHIPINYFLIKILNLGIKGVALSGVWTNFNLVGSLIIYIISSKIYKKT  237

Query  811   WGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTT  990
             W G+S ECFKG++SLLNLAIPSC SVCLEWWWYE+MILLCG+L NP++TVASMG+LIQTT
Sbjct  238   WCGISLECFKGWRSLLNLAIPSCISVCLEWWWYEIMILLCGILINPQSTVASMGILIQTT  297

Query  991   SLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWA  1170
             SLIYIFPSSLSFGVSTRVGNELGA RP RAKLAAI+GLC SF+LG+++L F + VRN+WA
Sbjct  298   SLIYIFPSSLSFGVSTRVGNELGANRPNRAKLAAIIGLCTSFVLGISSLFFAILVRNIWA  357

Query  1171  SIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLP  1350
              +FT D EIM LTA VLPIIGLCELGNCPQTTGCG LRGTARPKLGA INL CFY +G+P
Sbjct  358   KMFTHDQEIMKLTAMVLPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLGCFYLIGMP  417

Query  1351  VAGWLGFFAGFDFqglwlgllaaqaSCALTMLL-VLGRTDWNDQARRAKELTATISLVDD  1527
             +A WL F+ GFDF+GLWLGLL AQ SCA+TM+L +L +T+W DQARRAKE      L++ 
Sbjct  418   IAIWLSFYMGFDFKGLWLGLLGAQGSCAVTMMLIILVKTNWEDQARRAKE------LING  471

Query  1528  DDDD  1539
             D D+
Sbjct  472   DYDN  475



>ref|XP_006600090.1| PREDICTED: multidrug and toxin extrusion protein 2-like [Glycine 
max]
Length=522

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/450 (73%), Positives = 391/450 (87%), Gaps = 0/450 (0%)
 Frame = +1

Query  157   HLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGY  336
             H+  A KE   IS I +PMI+TGLLLYCRSMISMLFLG LG+L+LAGGSLAIGFANITGY
Sbjct  34    HVPEAIKEVFSISKIVIPMILTGLLLYCRSMISMLFLGHLGELALAGGSLAIGFANITGY  93

Query  337   SILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQ  516
             SILSGLA+GMEPICGQAFGAKRF L+GL LQRTI+LLLFTS+PI++LW  M++IL+LC Q
Sbjct  94    SILSGLAVGMEPICGQAFGAKRFTLLGLCLQRTILLLLFTSLPISLLWLYMKQILLLCGQ  153

Query  517   DREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLV  696
             D  I+ +AQS+++YS+PDLIAQS LHPLRIYLR+QS+TLPLT CA+F+I++H+PINYFLV
Sbjct  154   DVAIATQAQSYLVYSIPDLIAQSFLHPLRIYLRTQSITLPLTLCASFSILLHIPINYFLV  213

Query  697   VVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPS  876
               L LGIKGVAL  V  NFN+V SL++Y++FSG +KKTWGG S+ECF  +KSLLNLAIPS
Sbjct  214   AHLKLGIKGVALGGVLTNFNLVASLILYIVFSGTHKKTWGGFSFECFTQWKSLLNLAIPS  273

Query  877   CASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNEL  1056
             C SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTTSL+YIFPSSLSF VSTRVGN+L
Sbjct  274   CVSVCLEWWWYEIMILLCGLLVNPKATVASMGILIQTTSLLYIFPSSLSFSVSTRVGNKL  333

Query  1057  GAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGL  1236
             GA +P +A+L+AIVGL  SF+ G+ AL F + VRN WAS+FT+D +I+ LT+ VLPIIGL
Sbjct  334   GAQKPSKARLSAIVGLSCSFMSGVLALVFALMVRNTWASMFTKDKDIITLTSMVLPIIGL  393

Query  1237  CELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlglla  1416
             CELGNCPQTTGCG LRGTARPK+GA INL CFY VG+PV+ WL FF G+DFQGLWLGLLA
Sbjct  394   CELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGMPVSIWLAFFTGYDFQGLWLGLLA  453

Query  1417  aqaSCALTMLLVLGRTDWNDQARRAKELTA  1506
             AQ SCA+TML+VL RTDW  +A+RAK+LT 
Sbjct  454   AQGSCAVTMLVVLCRTDWEFEAQRAKKLTG  483



>ref|XP_003525539.2| PREDICTED: MATE efflux family protein 5-like [Glycine max]
Length=531

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/458 (74%), Positives = 396/458 (86%), Gaps = 4/458 (1%)
 Frame = +1

Query  154   THLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITG  333
             THLSL+  EAKCI++I+  M++TGLLLY RSMISMLFLG LG+L+LAGGSLAIGFANITG
Sbjct  46    THLSLSLNEAKCIANISFSMVLTGLLLYSRSMISMLFLGHLGELALAGGSLAIGFANITG  105

Query  334   YSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAIL-WCNMERILILC  510
             YS+LSGLAMGMEPICGQAFGA+RFKL+GL++QRT++LLL TS  I++  W NM +IL+LC
Sbjct  106   YSVLSGLAMGMEPICGQAFGARRFKLLGLTMQRTVLLLLVTSCLISLFFWLNMRKILLLC  165

Query  511   RQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYF  690
              Q+ +I+ EA+ +ILYSLPDL+ QSLLHPLRIYLRSQS+TLPLT CAA +I++HVPINY 
Sbjct  166   GQEEDIANEAELYILYSLPDLVLQSLLHPLRIYLRSQSITLPLTCCAAVSILLHVPINYL  225

Query  691   LVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGY---KSLLN  861
              V +L LGIKGVALS+V  N N+V  L+VYV+ SG +KKTW G+S ECF+G+   K+L+N
Sbjct  226   FVSILKLGIKGVALSAVVTNLNLVWLLIVYVVVSGTHKKTWPGISRECFQGWNSWKTLMN  285

Query  862   LAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTR  1041
             LAIPSC SVCLEWWWYE+MILLCGLL NP A+VASMGVLIQTT+LIYIFPSSLSFGVSTR
Sbjct  286   LAIPSCVSVCLEWWWYEIMILLCGLLVNPHASVASMGVLIQTTALIYIFPSSLSFGVSTR  345

Query  1042  VGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVL  1221
             VGNELGAG P RAKLAA+VGLC SF+ GL+AL F V+VRNVWAS+FT D +I+ALT+AVL
Sbjct  346   VGNELGAGNPRRAKLAAMVGLCFSFVFGLSALAFAVSVRNVWASMFTLDGQIIALTSAVL  405

Query  1222  PIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglw  1401
             PIIGLCELGNCPQTT CG LRGTARPKLGA INL CFY VG+PVA WLGFFAGFDF+GLW
Sbjct  406   PIIGLCELGNCPQTTVCGVLRGTARPKLGANINLGCFYLVGMPVAVWLGFFAGFDFKGLW  465

Query  1402  lgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATIS  1515
             LG+LAAQ SC +TM+ VL RT+W  QA RAKELT + S
Sbjct  466   LGMLAAQGSCMMTMMFVLARTNWEGQALRAKELTDSDS  503



>ref|XP_006353367.1| PREDICTED: MATE efflux family protein 5-like [Solanum tuberosum]
Length=530

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/488 (72%), Positives = 408/488 (84%), Gaps = 4/488 (1%)
 Frame = +1

Query  79    ACKEKMEAPLISEENPKEEDHNH--NQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMI  252
             A +  M  PLI  ++P  + + H  N+   SL   EAK I++IA PMI+TGLLLY RSMI
Sbjct  27    AEESDMSTPLI-PKSPTNDTYPHITNKKITSLVFNEAKSIANIAFPMILTGLLLYSRSMI  85

Query  253   SMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQR  432
             SMLFLGRLG L+LAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGA+++ L+GL+LQR
Sbjct  86    SMLFLGRLGGLALAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAQKYNLLGLTLQR  145

Query  433   TIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYL  612
             T++LLL  S PIA+ W NM+ IL+ C QD +I+ EAQS++ YSLPDL AQSLLHPLRIYL
Sbjct  146   TVLLLLLISFPIALFWVNMKTILLYCGQDEDIATEAQSYLFYSLPDLFAQSLLHPLRIYL  205

Query  613   RSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFS  792
             R+QS+TLPLT CA FAI++H+PIN+ LV+ LNLG++GVA+S VW NFN+VGSL+VY++ S
Sbjct  206   RTQSITLPLTCCAIFAILLHIPINFLLVIKLNLGVRGVAMSGVWTNFNLVGSLIVYIVVS  265

Query  793   GVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMG  972
             GVYKKTW  +S EC KG+KSLLNLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG
Sbjct  266   GVYKKTWERLSMECLKGWKSLLNLAIPSCISVCLEWWWYEIMILLCGLLINPKATVASMG  325

Query  973   VLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVA  1152
             +LIQTTSLIYIFPSSLSF VSTRVGNELGA RPG+AK+AAIVGL  SFILG  AL F V 
Sbjct  326   ILIQTTSLIYIFPSSLSFSVSTRVGNELGARRPGKAKVAAIVGLAGSFILGFTALFFAVT  385

Query  1153  VRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCF  1332
             VRNVWA +FT D EI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL CF
Sbjct  386   VRNVWAKMFTNDKEILALTSVVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCF  445

Query  1333  YFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATI  1512
             Y VG+PVA  L F+ GFDFQGLW+GLLAAQASC LTMLLVL  TDW  +A RAK+LT T 
Sbjct  446   YIVGMPVAVGLSFYMGFDFQGLWIGLLAAQASCMLTMLLVLLHTDWEFEAIRAKQLTGT-  504

Query  1513  SLVDDDDD  1536
             +++D+  +
Sbjct  505   TILDETKE  512



>ref|XP_004511602.1| PREDICTED: MATE efflux family protein 5-like [Cicer arietinum]
Length=530

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/472 (73%), Positives = 399/472 (85%), Gaps = 2/472 (0%)
 Frame = +1

Query  94    MEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgr  273
             M  PLI +    ++ H   ++H SLA  EAK I++IALPM++TGLLLY RS+ISMLFLGR
Sbjct  34    MFTPLIPKSPTFKQQHK--KSHFSLALNEAKYIANIALPMVLTGLLLYSRSIISMLFLGR  91

Query  274   lgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLF  453
             +G+L+LAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFKL+GL++QRT +LLL 
Sbjct  92    VGELALAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFKLLGLTMQRTTILLLV  151

Query  454   TSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTL  633
             TSI I+ LW NM++ILI C Q  +I+  AQS+I+YSLPDLIAQSLLHPLRIYLRSQS+TL
Sbjct  152   TSIFISFLWLNMKKILIFCGQQEDIANVAQSYIIYSLPDLIAQSLLHPLRIYLRSQSITL  211

Query  634   PLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTW  813
             PLT+ A  +I++HVPINY+LV VL LGIKG+AL +VW NFN+V SL++Y+  SG +KKTW
Sbjct  212   PLTYSATLSILLHVPINYYLVSVLKLGIKGIALGAVWTNFNLVVSLIIYIWVSGTHKKTW  271

Query  814   GGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTS  993
              G S  CFK +K LLNLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTT+
Sbjct  272   PGFSSACFKRWKPLLNLAIPSCISVCLEWWWYEIMILLCGLLINPQATVASMGILIQTTA  331

Query  994   LIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWAS  1173
             LIYIFPSSLSFGVSTRVGNELGA  P RAKLAA+VGLC SF LG  AL F ++VRN+WAS
Sbjct  332   LIYIFPSSLSFGVSTRVGNELGAENPQRAKLAALVGLCFSFFLGFFALFFAISVRNIWAS  391

Query  1174  IFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPV  1353
             +FT D EI+ALT+ VLPIIGLCELGNCPQTT CG LRGTARPKLGA INL CFY VG+PV
Sbjct  392   MFTNDVEIIALTSMVLPIIGLCELGNCPQTTVCGVLRGTARPKLGANINLGCFYLVGMPV  451

Query  1354  AGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTAT  1509
             A WL FFAGFDF+GLW GLLAAQ SC LTML VL RT+W  Q +RAKELT++
Sbjct  452   AVWLSFFAGFDFKGLWFGLLAAQGSCMLTMLFVLFRTNWECQVQRAKELTSS  503



>gb|KHN40254.1| Multidrug and toxin extrusion protein 1 [Glycine soja]
Length=572

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/444 (74%), Positives = 387/444 (87%), Gaps = 0/444 (0%)
 Frame = +1

Query  175   KEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGL  354
             KE   IS IA+PMI+TGLLLYCRSMISMLFLG LG+L+LAGGSLA+GFANITGYSILSGL
Sbjct  93    KEVFSISKIAIPMILTGLLLYCRSMISMLFLGHLGELALAGGSLAVGFANITGYSILSGL  152

Query  355   AMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISM  534
             A+GMEPICGQAFGAKRF L+GL LQRTI+LLLFTS+PI +LW  M++IL+LC QD  I+ 
Sbjct  153   AVGMEPICGQAFGAKRFTLLGLCLQRTILLLLFTSLPITLLWLYMKQILLLCGQDEAIAT  212

Query  535   EAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLG  714
             +AQ +++YS+PDLIAQS LHPLRIYLR+QS+TLPLT CA+F+I++H+PINYFLV  L LG
Sbjct  213   QAQQYLVYSIPDLIAQSFLHPLRIYLRTQSITLPLTLCASFSILLHIPINYFLVAHLKLG  272

Query  715   IKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCL  894
             IKGVAL  VW NFN+V SL++Y++FS  +KKTWGG S+ECF  +KSLLNLAIPSC SVCL
Sbjct  273   IKGVALGGVWTNFNLVASLILYIVFSSTHKKTWGGFSFECFTQWKSLLNLAIPSCVSVCL  332

Query  895   EWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPG  1074
             EWWWYE+MILLCGLL NP+ATVASMG+LIQTTSL+YIFPSSLSF VSTRVGN+LGA +P 
Sbjct  333   EWWWYEIMILLCGLLVNPKATVASMGILIQTTSLLYIFPSSLSFSVSTRVGNKLGAQKPS  392

Query  1075  RAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNC  1254
             +A+L+AIVGL  SF+ G+ AL F + VRN WAS+FT+D EI+ LT+ VLPIIGLCELGNC
Sbjct  393   KARLSAIVGLSCSFMSGVLALFFALMVRNTWASMFTKDKEIITLTSMVLPIIGLCELGNC  452

Query  1255  PQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCA  1434
             PQTTGCG LRGTARPK+GA INL CFY VG+PV+ WL FF G+DFQGLWLGLLAAQ SCA
Sbjct  453   PQTTGCGVLRGTARPKVGANINLGCFYLVGMPVSIWLAFFTGYDFQGLWLGLLAAQGSCA  512

Query  1435  LTMLLVLGRTDWNDQARRAKELTA  1506
             +TML+VL RTDW  +A+RAK+LT 
Sbjct  513   VTMLVVLCRTDWEFEAQRAKKLTG  536



>gb|KHN31537.1| Multidrug and toxin extrusion protein 1 [Glycine soja]
Length=562

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/450 (73%), Positives = 391/450 (87%), Gaps = 0/450 (0%)
 Frame = +1

Query  157   HLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGY  336
             H+  A KE   IS I +PMI+TGLLLYCRSMISMLFLG LG+L+LAGGSLAIGFANITGY
Sbjct  74    HVPEAIKEVFSISKIVIPMILTGLLLYCRSMISMLFLGHLGELALAGGSLAIGFANITGY  133

Query  337   SILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQ  516
             SILSGLA+GMEPICGQAFGAKRF L+GL LQRTI+LLLFTS+PI++LW  M++IL+LC Q
Sbjct  134   SILSGLAVGMEPICGQAFGAKRFTLLGLCLQRTILLLLFTSLPISLLWLYMKQILLLCGQ  193

Query  517   DREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLV  696
             D  I+ +AQS+++YS+PDLIAQS LHPLRIYLR+QS+TLPLT CA+F+I++H+PINYFLV
Sbjct  194   DEAIATQAQSYLVYSIPDLIAQSFLHPLRIYLRTQSITLPLTLCASFSILLHIPINYFLV  253

Query  697   VVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPS  876
               L LGIKGVAL  V  NFN+V SL++Y++FSG +KKTWGG S+ECF  +KSLLNLAIPS
Sbjct  254   AHLKLGIKGVALGGVLTNFNLVASLILYIVFSGTHKKTWGGFSFECFTQWKSLLNLAIPS  313

Query  877   CASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNEL  1056
             C SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTTSL+YIFPSSLSF VSTRVGN+L
Sbjct  314   CVSVCLEWWWYEIMILLCGLLVNPKATVASMGILIQTTSLLYIFPSSLSFSVSTRVGNKL  373

Query  1057  GAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGL  1236
             GA +P +A+L+AIVGL  SF+ G+ AL F + VRN WAS+FT+D +I+ LT+ VLPIIGL
Sbjct  374   GAQKPSKARLSAIVGLSCSFMSGVLALVFALMVRNTWASMFTKDKDIITLTSMVLPIIGL  433

Query  1237  CELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlglla  1416
             CELGNCPQTTGCG LRGTARPK+GA INL CFY VG+PV+ WL FF G+DFQGLWLGLLA
Sbjct  434   CELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGMPVSIWLAFFTGYDFQGLWLGLLA  493

Query  1417  aqaSCALTMLLVLGRTDWNDQARRAKELTA  1506
             AQ SCA+TML+VL RTDW  +A+RAK+LT 
Sbjct  494   AQGSCAVTMLVVLCRTDWEFEAQRAKKLTG  523



>ref|XP_004143992.1| PREDICTED: MATE efflux family protein 6-like [Cucumis sativus]
Length=490

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/470 (71%), Positives = 388/470 (83%), Gaps = 6/470 (1%)
 Frame = +1

Query  94    MEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgr  273
             ++ PLI      EE         S    EAK I+DIA PMI+ G L+Y RSMISMLFLGR
Sbjct  13    LKTPLI------EETETKFPYRFSHVLSEAKSIADIAFPMILVGFLMYSRSMISMLFLGR  66

Query  274   lgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLF  453
             LG LSLAGGSLAIGFANITGYS+LSGLAMGMEPICGQAFGAKRFKL+GL+LQRTI+LLL 
Sbjct  67    LGGLSLAGGSLAIGFANITGYSLLSGLAMGMEPICGQAFGAKRFKLLGLTLQRTIILLLI  126

Query  454   TSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTL  633
             +S+PI+ LW NM++IL+ C QD +I+ EA S+IL SLPDL+A S LHPLRIYLRSQS+ L
Sbjct  127   SSLPISFLWFNMKKILLFCGQDVDIANEAHSYILCSLPDLVALSFLHPLRIYLRSQSINL  186

Query  634   PLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTW  813
             PLT+CA  AI+ H+PINYF V V   GI+GVAL +VW NFN VGSLVV+VLFSGVYKKTW
Sbjct  187   PLTYCAILAILFHIPINYFFVCVFEWGIRGVALGAVWTNFNFVGSLVVFVLFSGVYKKTW  246

Query  814   GGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTS  993
              G+S +C K +KSLL LAIPSC SVCLEWWWYE+MILL G + NP++TVASMG+LIQTT+
Sbjct  247   PGMSSDCLKEWKSLLGLAIPSCISVCLEWWWYEIMILLSGFMLNPQSTVASMGILIQTTA  306

Query  994   LIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWAS  1173
             LIYIFPSSLSFGVSTRVGNELGA  P +AKLAAIVGLC SF LG++AL F   +R VWA+
Sbjct  307   LIYIFPSSLSFGVSTRVGNELGANHPNKAKLAAIVGLCISFFLGISALLFAFKIRKVWAT  366

Query  1174  IFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPV  1353
             +FT+D +I+ LT+ +LPIIGLCELGNCPQTT CG LRGTARPKLGA INL CFY VG+PV
Sbjct  367   MFTEDIQIIELTSLILPIIGLCELGNCPQTTSCGVLRGTARPKLGANINLGCFYMVGMPV  426

Query  1354  AGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
             A WL F+ G+DF+GLW+GLLAAQASCA+TML+VL RT+W +QA RAKELT
Sbjct  427   AIWLSFYGGWDFKGLWIGLLAAQASCAMTMLMVLTRTNWEEQAERAKELT  476



>ref|XP_009796993.1| PREDICTED: MATE efflux family protein 5-like [Nicotiana sylvestris]
Length=533

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/499 (71%), Positives = 412/499 (83%), Gaps = 12/499 (2%)
 Frame = +1

Query  79    ACKEKMEAPLI-----------SEENPKEEDHNHNQ-THLSLAAKEAKCISDIALPMIVT  222
             A +  M APLI           + E P      +N+ THLSL  KEA+ I++IA PMI+T
Sbjct  19    AQEADMFAPLIPKSPTNQYQAQNSEVPNYPHKTNNKITHLSLIFKEAQSIANIAFPMILT  78

Query  223   GLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKR  402
             GLLLY RSMISMLFLGRLGDL+LAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGA++
Sbjct  79    GLLLYSRSMISMLFLGRLGDLALAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAQK  138

Query  403   FKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQ  582
             F L+GL+LQRTI+LLL TS PIA+LW NM+ IL+ C QD +I+ EAQS++ Y+LPDL AQ
Sbjct  139   FNLLGLTLQRTILLLLLTSFPIALLWVNMKTILLYCGQDEDIATEAQSYLFYALPDLFAQ  198

Query  583   SLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVV  762
             SLLHPLRIYLR+QS+TLPLT CA  AI++H+PIN+ LV  LNLG+KGVALSSVW NFN+V
Sbjct  199   SLLHPLRIYLRTQSITLPLTCCAVLAILLHIPINFLLVTKLNLGVKGVALSSVWTNFNLV  258

Query  763   GSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLA  942
              SL++Y++ SG+YKKTW  +S E  KG+KSLLNLAIPSC SVCLEWWWYE+MILLCGLL 
Sbjct  259   VSLIIYIIISGLYKKTWQKLSMEIIKGWKSLLNLAIPSCISVCLEWWWYEIMILLCGLLI  318

Query  943   NPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFIL  1122
             NP+ATVASMG+LIQTTSLIYIFPSSLSF VSTRVGN+LGA RP +AK+AAIVGL  SFIL
Sbjct  319   NPKATVASMGILIQTTSLIYIFPSSLSFSVSTRVGNKLGARRPDKAKVAAIVGLAGSFIL  378

Query  1123  GLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPK  1302
             G +AL F V VR VWA +FT D EI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPK
Sbjct  379   GFSALFFAVTVRKVWAKMFTNDKEILALTSLVLPIIGLCELGNCPQTTGCGVLRGTARPK  438

Query  1303  LGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQA  1482
             +GA INL CFY VG+PVA  L F+AGFDFQGLWLGLLAAQASC +TMLLVL  TDW+ +A
Sbjct  439   VGANINLGCFYLVGMPVAVGLSFYAGFDFQGLWLGLLAAQASCMVTMLLVLLHTDWDFEA  498

Query  1483  RRAKELTATISLVDDDDDD  1539
             +RAKELT T ++ +  D +
Sbjct  499   QRAKELTGTTTVSNFLDHN  517



>gb|KGN50143.1| hypothetical protein Csa_5G155540 [Cucumis sativus]
Length=534

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/470 (71%), Positives = 388/470 (83%), Gaps = 6/470 (1%)
 Frame = +1

Query  94    MEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgr  273
             ++ PLI      EE         S    EAK I+DIA PMI+ G L+Y RSMISMLFLGR
Sbjct  13    LKTPLI------EETETKFPYRFSHVLSEAKSIADIAFPMILVGFLMYSRSMISMLFLGR  66

Query  274   lgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLF  453
             LG LSLAGGSLAIGFANITGYS+LSGLAMGMEPICGQAFGAKRFKL+GL+LQRTI+LLL 
Sbjct  67    LGGLSLAGGSLAIGFANITGYSLLSGLAMGMEPICGQAFGAKRFKLLGLTLQRTIILLLI  126

Query  454   TSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTL  633
             +S+PI+ LW NM++IL+ C QD +I+ EA S+IL SLPDL+A S LHPLRIYLRSQS+ L
Sbjct  127   SSLPISFLWFNMKKILLFCGQDVDIANEAHSYILCSLPDLVALSFLHPLRIYLRSQSINL  186

Query  634   PLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTW  813
             PLT+CA  AI+ H+PINYF V V   GI+GVAL +VW NFN VGSLVV+VLFSGVYKKTW
Sbjct  187   PLTYCAILAILFHIPINYFFVCVFEWGIRGVALGAVWTNFNFVGSLVVFVLFSGVYKKTW  246

Query  814   GGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTS  993
              G+S +C K +KSLL LAIPSC SVCLEWWWYE+MILL G + NP++TVASMG+LIQTT+
Sbjct  247   PGMSSDCLKEWKSLLGLAIPSCISVCLEWWWYEIMILLSGFMLNPQSTVASMGILIQTTA  306

Query  994   LIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWAS  1173
             LIYIFPSSLSFGVSTRVGNELGA  P +AKLAAIVGLC SF LG++AL F   +R VWA+
Sbjct  307   LIYIFPSSLSFGVSTRVGNELGANHPNKAKLAAIVGLCISFFLGISALLFAFKIRKVWAT  366

Query  1174  IFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPV  1353
             +FT+D +I+ LT+ +LPIIGLCELGNCPQTT CG LRGTARPKLGA INL CFY VG+PV
Sbjct  367   MFTEDIQIIELTSLILPIIGLCELGNCPQTTSCGVLRGTARPKLGANINLGCFYMVGMPV  426

Query  1354  AGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
             A WL F+ G+DF+GLW+GLLAAQASCA+TML+VL RT+W +QA RAKELT
Sbjct  427   AIWLSFYGGWDFKGLWIGLLAAQASCAMTMLMVLTRTNWEEQAERAKELT  476



>ref|XP_004165956.1| PREDICTED: LOW QUALITY PROTEIN: MATE efflux family protein 6-like 
[Cucumis sativus]
Length=542

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/470 (71%), Positives = 387/470 (82%), Gaps = 6/470 (1%)
 Frame = +1

Query  94    MEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgr  273
             ++ PLI      EE         S    EAK I+DIA PMI+ G L+Y RSMISMLFLGR
Sbjct  13    LKTPLI------EETETKFPYRFSHVLSEAKSIADIAFPMILVGFLMYSRSMISMLFLGR  66

Query  274   lgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLF  453
             LG LSLAGGSLAIGFANITGYS+LSGLAMGMEPICGQAFGAKRFKL+GL+LQRTI+LLL 
Sbjct  67    LGGLSLAGGSLAIGFANITGYSLLSGLAMGMEPICGQAFGAKRFKLLGLTLQRTIILLLI  126

Query  454   TSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTL  633
             +S+PI+ LW NM++IL+ C QD +I+ EA S+IL SLPDL+A S LHPLRIYLRSQS+ L
Sbjct  127   SSLPISFLWFNMKKILLFCGQDVDIANEAHSYILCSLPDLVALSFLHPLRIYLRSQSINL  186

Query  634   PLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTW  813
             PLT+CA  AI+ H+PINYF V V   GI+GVAL +VW NFN VGSLVV+VLFSGVYKKTW
Sbjct  187   PLTYCAILAILFHIPINYFXVCVFEWGIRGVALGAVWTNFNFVGSLVVFVLFSGVYKKTW  246

Query  814   GGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTS  993
              G+S +C K +KSLL LAIPSC SVCLEWWWYE+M LL G + NP++TVASMG+LIQTT+
Sbjct  247   PGMSSDCLKEWKSLLGLAIPSCISVCLEWWWYEIMXLLSGFMLNPQSTVASMGILIQTTA  306

Query  994   LIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWAS  1173
             LIYIFPSSLSFGVSTRVGNELGA  P +AKLAAIVGLC SF LG++AL F   +R VWA+
Sbjct  307   LIYIFPSSLSFGVSTRVGNELGANHPNKAKLAAIVGLCISFFLGISALLFAFKIRKVWAT  366

Query  1174  IFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPV  1353
             +FT+D +I+ LT+ +LPIIGLCELGNCPQTT CG LRGTARPKLGA INL CFY VG+PV
Sbjct  367   MFTEDIQIIELTSLILPIIGLCELGNCPQTTSCGVLRGTARPKLGANINLGCFYMVGMPV  426

Query  1354  AGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
             A WL F+ G+DF+GLW+GLLAAQASCA+TML+VL RT+W +QA RAKELT
Sbjct  427   AIWLSFYGGWDFKGLWIGLLAAQASCAMTMLMVLTRTNWEEQAERAKELT  476



>ref|XP_010255527.1| PREDICTED: MATE efflux family protein 9-like [Nelumbo nucifera]
Length=547

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/464 (73%), Positives = 405/464 (87%), Gaps = 0/464 (0%)
 Frame = +1

Query  148   NQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANI  327
             N+THLSLA  E + I++IALPM+VTGLLLY RS+ISMLFLGRLGDL+LAGG+LAIGFANI
Sbjct  59    NKTHLSLAIAEVQSIANIALPMVVTGLLLYSRSIISMLFLGRLGDLALAGGALAIGFANI  118

Query  328   TGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILIL  507
             TGYSILSGLAMGMEPIC Q FGA+R+KL+GLSLQRT++LLL  S PI++LW NM+RIL+ 
Sbjct  119   TGYSILSGLAMGMEPICSQNFGAQRYKLLGLSLQRTVLLLLLISTPISLLWINMKRILVF  178

Query  508   CRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINY  687
             C Q+++I+ EAQS+ILYSLPDL+ QSLLHPLRIYLR+QS+TLPLT+CAA +I++H+PINY
Sbjct  179   CGQNQDIATEAQSYILYSLPDLLLQSLLHPLRIYLRTQSITLPLTYCAALSILLHIPINY  238

Query  688   FLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLA  867
              LV V+NLGIKGVALS VW NFN+V SL++Y+  SGVY+KTWGG SW+C KG+K LLNLA
Sbjct  239   LLVYVINLGIKGVALSGVWTNFNLVFSLIIYICVSGVYQKTWGGFSWDCLKGWKCLLNLA  298

Query  868   IPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVG  1047
             IP+C SVCLEWWWYE+MI+LCGLL NPRATVASMG+LIQTT+LIYIFPSSLSFGVSTRVG
Sbjct  299   IPNCISVCLEWWWYEIMIILCGLLVNPRATVASMGILIQTTALIYIFPSSLSFGVSTRVG  358

Query  1048  NELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPI  1227
             NELGA +P +A+LAAIVGL  SF LG  AL F V VR  WA +FTQDAEI+ALT+ VLPI
Sbjct  359   NELGANQPNKARLAAIVGLSCSFFLGFTALIFAVIVRRSWAIMFTQDAEIIALTSLVLPI  418

Query  1228  IGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlg  1407
             IG+CELGNCPQTTGCG LRGTARP++GA INL  FY VG+PVA  LGF+AGFDF+GLW G
Sbjct  419   IGVCELGNCPQTTGCGVLRGTARPRVGANINLGSFYLVGMPVAVALGFYAGFDFEGLWFG  478

Query  1408  llaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDDD  1539
             LLAAQ +CA+TML +LG+TDWN QA+RA+ELT    +VD +++ 
Sbjct  479   LLAAQGTCAVTMLFILGQTDWNLQAQRAQELTGAALVVDSEENK  522



>ref|XP_004496604.1| PREDICTED: multidrug and toxin extrusion protein 2-like [Cicer 
arietinum]
Length=545

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/477 (70%), Positives = 396/477 (83%), Gaps = 9/477 (2%)
 Frame = +1

Query  94    MEAPLISEENP----KEEDHNH-----NQTHLSLAAKEAKCISDIALPMIVTGLLLYCRS  246
             M  PLI ++      +++  N       +THL    KE   I+ IALPMI+TGLLLYCRS
Sbjct  34    MTIPLIQKDTNIATYQQQQKNPTTIQIQKTHLRATFKEIISIAKIALPMILTGLLLYCRS  93

Query  247   MISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSL  426
             MISMLFLG LG+L+LAGGSLA+GFANITGYSILSGLA+GMEPICGQAFGAKR+ L+GL L
Sbjct  94    MISMLFLGHLGELALAGGSLAVGFANITGYSILSGLAVGMEPICGQAFGAKRYTLLGLCL  153

Query  427   QRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRI  606
             QRTI+LLL TSIPI+ILW   ++IL+LC Q+  I+ +AQ +++YS+PDL+AQS LHPLRI
Sbjct  154   QRTILLLLLTSIPISILWLYTKKILLLCGQEESIATQAQLYLIYSIPDLLAQSFLHPLRI  213

Query  607   YLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVL  786
             YLRSQS+TLPLT CA  AI +HVPINYFLV  LN+GIKGVALS VW NFNVV SL++Y++
Sbjct  214   YLRSQSITLPLTLCATLAIFLHVPINYFLVSHLNMGIKGVALSGVWTNFNVVASLILYIV  273

Query  787   FSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVAS  966
             FSG +KKTWGG S +CFK +KSLLNLAIPSC SVCLEWWWYE+MILLCGLL NPRATVAS
Sbjct  274   FSGTHKKTWGGFSSQCFKQWKSLLNLAIPSCLSVCLEWWWYEIMILLCGLLINPRATVAS  333

Query  967   MGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFG  1146
             MG+LIQTTSL+YIFPSSLSF VSTRVGN+LGA +P +AK++AIVGL  SFILG+ +L F 
Sbjct  334   MGILIQTTSLLYIFPSSLSFSVSTRVGNKLGAQKPSKAKISAIVGLSCSFILGVFSLIFA  393

Query  1147  VAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLR  1326
             V VR +WAS+FT+D EI+ +T+ VLP+IGLCELGNCPQTTGCG LRGTARP++GA IN  
Sbjct  394   VMVRKIWASMFTEDKEIIKITSLVLPLIGLCELGNCPQTTGCGVLRGTARPRVGANINFG  453

Query  1327  CFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKE  1497
             CFY +G+PVA  L FF GFDFQGLWLGLL AQ SCA+TML+VL +TDW+ +A RAK+
Sbjct  454   CFYIIGMPVAICLAFFVGFDFQGLWLGLLVAQGSCAVTMLVVLSQTDWDGEALRAKK  510



>ref|XP_010035093.1| PREDICTED: MATE efflux family protein LAL5-like [Eucalyptus grandis]
Length=548

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/478 (69%), Positives = 399/478 (83%), Gaps = 1/478 (0%)
 Frame = +1

Query  73    ISACKEKMEAPLISEENP-KEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSM  249
             ++   +++  PL+ + +P   +  N  +  L+ A +EA+ I  IALPMI+TGLLLY R M
Sbjct  30    VNTPDQEVNTPLVLKASPAPPQPPNSTRFPLAQAVEEARSICRIALPMILTGLLLYSRCM  89

Query  250   ISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQ  429
             ISMLFLGRLG L+LAGGSLAIGFANITGYS+LSGLAMGMEPICGQAFGAKR  ++G++LQ
Sbjct  90    ISMLFLGRLGGLALAGGSLAIGFANITGYSVLSGLAMGMEPICGQAFGAKRLSVLGITLQ  149

Query  430   RTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIY  609
             RT++LLL TSIPI++LW NM+ IL+ CRQD  IS++AQS++LYS+PDL+AQSLLHPLRIY
Sbjct  150   RTVLLLLLTSIPISLLWLNMKSILLFCRQDESISVQAQSYLLYSVPDLLAQSLLHPLRIY  209

Query  610   LRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLF  789
             LRSQS+ LPLTFCA+ +I +H+PINYFLV+ L LGIKGVALS+VW NFN+V SLV+Y+++
Sbjct  210   LRSQSINLPLTFCASISIFLHIPINYFLVIHLGLGIKGVALSAVWTNFNLVASLVIYIIY  269

Query  790   SGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASM  969
             SGVY+ TWGG S ECF+ ++ LL+LA+PSC SVCLEWWWYE+MILLCGLL NPRATVASM
Sbjct  270   SGVYRDTWGGYSLECFREWRPLLSLAVPSCISVCLEWWWYEIMILLCGLLLNPRATVASM  329

Query  970   GVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGV  1149
             G+LIQTT+ IYIFPSSLSF VSTRVGNELGA RP +A+LAA VG+  SF+LG +AL F V
Sbjct  330   GILIQTTAFIYIFPSSLSFSVSTRVGNELGANRPAKARLAASVGIGLSFVLGCSALLFAV  389

Query  1150  AVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRC  1329
              VRN WA +FT+D EI ALT  VLPIIGLCELGNCPQTTGCG LRG+ARPK+GA INL C
Sbjct  390   TVRNHWARMFTEDGEIAALTLTVLPIIGLCELGNCPQTTGCGVLRGSARPKIGANINLGC  449

Query  1330  FYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
             FY VG+PVA  L F+   DF+GLWLGLLAAQASC  TML+VL RTDW  QA RA+ELT
Sbjct  450   FYLVGMPVAVGLAFYCHLDFRGLWLGLLAAQASCMATMLVVLRRTDWEHQAMRAQELT  507



>ref|XP_004234355.1| PREDICTED: MATE efflux family protein 5 [Solanum lycopersicum]
Length=527

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/487 (71%), Positives = 405/487 (83%), Gaps = 4/487 (1%)
 Frame = +1

Query  85    KEKMEAPLISEENPKEEDHNH--NQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISM  258
             +  M  PLI++ +P  + + H  N+   SL   EAK I++IA PMI+TGLLLY RSMISM
Sbjct  29    ESDMSTPLITK-SPTNDTYPHITNKKITSLVFNEAKSIANIAFPMILTGLLLYSRSMISM  87

Query  259   LFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTI  438
             LFLGRLG L+LAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGA+++ L+GL+LQRT+
Sbjct  88    LFLGRLGGLALAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAQKYNLLGLTLQRTV  147

Query  439   VLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRS  618
             +LLL  S PIA+ W NM+ IL+ C QD +I+ EAQS++ YSLPDL AQSLLHPLRIYLR+
Sbjct  148   LLLLLISFPIALFWVNMKTILLYCGQDEDIATEAQSYLFYSLPDLFAQSLLHPLRIYLRT  207

Query  619   QSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGV  798
             QS+TLPLT CA FAI++H+PIN+ LV+ LNLG++GVA+S V  NFN+VGSL+VY+L SGV
Sbjct  208   QSITLPLTCCAVFAILLHIPINFLLVIKLNLGVRGVAMSGVLTNFNLVGSLIVYILVSGV  267

Query  799   YKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVL  978
             YKKTW  +S EC KG+KSLLNLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+L
Sbjct  268   YKKTWEKLSMECVKGWKSLLNLAIPSCISVCLEWWWYEIMILLCGLLINPKATVASMGIL  327

Query  979   IQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVR  1158
             IQTTSLIYIFPSSLSF VSTRVGNE+GA R G+AK+AAIVGL  SFILG+ AL F V VR
Sbjct  328   IQTTSLIYIFPSSLSFSVSTRVGNEVGAMRAGKAKVAAIVGLGCSFILGVTALFFAVTVR  387

Query  1159  NVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYF  1338
             NVWA +FT D EI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL CFY 
Sbjct  388   NVWAKMFTNDKEILALTSLVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYI  447

Query  1339  VGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISL  1518
             VG+PVA  L F+ GFDFQGLWLGLLAAQASC +TMLLVL  TDW  +  RAK+LT TI +
Sbjct  448   VGMPVAVGLSFYMGFDFQGLWLGLLAAQASCMVTMLLVLLHTDWEFETLRAKQLTGTI-I  506

Query  1519  VDDDDDD  1539
             +D    +
Sbjct  507   IDQTQGN  513



>ref|XP_004173805.1| PREDICTED: multidrug and toxin extrusion protein 2-like [Cucumis 
sativus]
Length=498

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/478 (69%), Positives = 393/478 (82%), Gaps = 0/478 (0%)
 Frame = +1

Query  103   PLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgd  282
             PL + ++ +        TH SLA +EA  IS IA PM++T LLLY RS+ISMLFLGRLG+
Sbjct  11    PLPTSQHFQLPTKQTTNTHFSLAIQEAFSISQIAFPMVLTSLLLYSRSLISMLFLGRLGE  70

Query  283   lslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSI  462
             L LAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAK+F L+GL+LQRTI+LL  TSI
Sbjct  71    LPLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKKFTLLGLALQRTILLLSLTSI  130

Query  463   PIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLT  642
             PIA LW N++ IL+LC+QD  I+ +AQ F+LYSLPDL AQSL+HPLRIYLRSQS+TLPLT
Sbjct  131   PIAFLWFNVKNILLLCKQDPSIASQAQLFLLYSLPDLFAQSLIHPLRIYLRSQSITLPLT  190

Query  643   FCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGV  822
             FCAAF+I++H+PINYFLV  LN GI+GVA++ VW NFN+V SL++Y+L   V+K TWGG 
Sbjct  191   FCAAFSILLHIPINYFLVSYLNFGIRGVAIAGVWTNFNLVASLILYILVFRVHKDTWGGF  250

Query  823   SWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIY  1002
             S +CFK +  LLNLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTT+LIY
Sbjct  251   SLQCFKEWGDLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPKATVASMGILIQTTALIY  310

Query  1003  IFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFT  1182
             IFPSSLSF VSTRVGNELGA +P +A+LAAIVGL  SF+LG+ AL F V++R +WAS+FT
Sbjct  311   IFPSSLSFSVSTRVGNELGAEQPKKARLAAIVGLSCSFVLGICALFFAVSIRKIWASMFT  370

Query  1183  QDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGW  1362
              D +I+ LT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL CFY VG+PVA  
Sbjct  371   DDKDIIGLTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKIGANINLGCFYLVGMPVAVG  430

Query  1363  LGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDD  1536
             L F+ GFDF+GLWLGLLAAQ  CA  ML+VLG TDW  +A RA++LT     V + + 
Sbjct  431   LSFYGGFDFRGLWLGLLAAQGCCAAAMLVVLGFTDWEFEAIRARKLTGGCEQVVEAES  488



>ref|XP_010053335.1| PREDICTED: MATE efflux family protein LAL5-like [Eucalyptus grandis]
 gb|KCW77609.1| hypothetical protein EUGRSUZ_D01923 [Eucalyptus grandis]
Length=497

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/492 (69%), Positives = 402/492 (82%), Gaps = 12/492 (2%)
 Frame = +1

Query  94    MEAPLIS----------EENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCR  243
             M APL+S          +E+P  ED    +T L +  KE + +S IA+PM++TGLL+Y R
Sbjct  1     MLAPLVSKDSTSPRWRDQEDPSAEDPG--KTSLGVLLKEGRSLSAIAVPMVLTGLLIYAR  58

Query  244   SMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLS  423
             S ISMLFLGRLGDL+LAGGSLAIGFANITGYS+LSGLAMGMEPICGQAFGA R+K++GL+
Sbjct  59    SAISMLFLGRLGDLALAGGSLAIGFANITGYSVLSGLAMGMEPICGQAFGAGRYKVLGLT  118

Query  424   LQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLR  603
             +QRTI+LLL TSIPI++LW NM+ IL+   Q  +IS +AQ +IL SLPDL+AQSLLHPLR
Sbjct  119   MQRTILLLLLTSIPISVLWLNMKPILLYFGQQDDISSQAQLYILCSLPDLVAQSLLHPLR  178

Query  604   IYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYV  783
             IYLRSQS+T+PLTFCAA AI++HV INY LV VL LGI+GVAL++V  N N+V SL++YV
Sbjct  179   IYLRSQSITMPLTFCAAQAIILHVLINYLLVNVLGLGIRGVALAAVLTNINLVASLILYV  238

Query  784   LFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVA  963
             L SGV+K TWGG S EC KG+KSL++LA+PSC SVCLEWWWYE+MILLCG L NPRATVA
Sbjct  239   LISGVHKNTWGGFSSECLKGFKSLVDLAVPSCISVCLEWWWYEIMILLCGYLLNPRATVA  298

Query  964   SMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTF  1143
             SMGVLIQTT+L+YIFPSSLSF VSTRVGNELGAG+P +A+LA  VGL  SF+LG AAL F
Sbjct  299   SMGVLIQTTALVYIFPSSLSFSVSTRVGNELGAGQPDKARLAMNVGLAFSFVLGFAALVF  358

Query  1144  GVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINL  1323
                VR+ WA +FTQD +I+ALT+ VLP+IGLCELGNCPQTTGCG LRGTARPK+GA INL
Sbjct  359   TTMVRHTWARMFTQDTDIVALTSMVLPLIGLCELGNCPQTTGCGVLRGTARPKMGAHINL  418

Query  1324  RCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
              CFY VG+P+A WL FF GFDF+GLWLGLLAAQ SC +TMLLVL RT+W  +ARRA+ELT
Sbjct  419   GCFYLVGMPIAVWLSFFLGFDFKGLWLGLLAAQGSCVVTMLLVLVRTNWEGEARRAQELT  478

Query  1504  ATISLVDDDDDD  1539
                +   D D D
Sbjct  479   RENATTVDGDHD  490



>ref|XP_004140853.1| PREDICTED: multidrug and toxin extrusion protein 2-like [Cucumis 
sativus]
Length=498

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/478 (69%), Positives = 393/478 (82%), Gaps = 0/478 (0%)
 Frame = +1

Query  103   PLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgd  282
             PL + ++ +        TH SLA +EA  IS IA PM++T LLLY RS+ISMLFLGRLG+
Sbjct  11    PLPTSQHFQLPTKQTTNTHFSLAIQEAFSISQIAFPMVLTSLLLYSRSLISMLFLGRLGE  70

Query  283   lslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSI  462
             L LAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAK+F L+GL+LQRTI+LL  TSI
Sbjct  71    LPLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKKFTLLGLALQRTILLLSLTSI  130

Query  463   PIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLT  642
             PIA LW N++ IL+LC+QD  I+ +AQ F+LYSLPDL AQSL+HPLRIYLRSQS+TLPLT
Sbjct  131   PIAFLWFNVKNILLLCKQDPSIASQAQLFLLYSLPDLFAQSLIHPLRIYLRSQSITLPLT  190

Query  643   FCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGV  822
             FCAAF+I++H+PINYFLV  LN GI+GVA++ VW NFN+V SL++Y+L   V+K TWGG 
Sbjct  191   FCAAFSILLHIPINYFLVSYLNFGIRGVAIAGVWTNFNLVASLILYILVFRVHKDTWGGF  250

Query  823   SWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIY  1002
             S +CFK +  LLNLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTT+LIY
Sbjct  251   SLQCFKEWGDLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPKATVASMGILIQTTALIY  310

Query  1003  IFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFT  1182
             IFPSSLSF VSTRVGNELGA +P +A+LAAIVGL  SF+LG+ AL F V++R +WAS+FT
Sbjct  311   IFPSSLSFSVSTRVGNELGAEQPKKARLAAIVGLFCSFVLGICALFFAVSIRKIWASMFT  370

Query  1183  QDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGW  1362
              D +I+ LT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL CFY VG+PVA  
Sbjct  371   DDKDIIGLTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKIGANINLGCFYLVGMPVAVG  430

Query  1363  LGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDD  1536
             L F+ GFDF+GLWLGLLAAQ  CA  ML+VLG TDW  +A RA++LT     V + + 
Sbjct  431   LSFYGGFDFRGLWLGLLAAQGCCAAAMLVVLGFTDWEFEAIRARKLTGGCEQVVEAES  488



>gb|EYU25058.1| hypothetical protein MIMGU_mgv1a026738mg, partial [Erythranthe 
guttata]
Length=454

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/457 (73%), Positives = 389/457 (85%), Gaps = 14/457 (3%)
 Frame = +1

Query  136   DHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaig  315
             DH+   THLSL  +E+  IS IA PMI+TGLLLY RSMISMLFLGRLGDL+LAGGSLAIG
Sbjct  10    DHHKPTTHLSLLLQESISISKIAFPMILTGLLLYSRSMISMLFLGRLGDLALAGGSLAIG  69

Query  316   FANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMER  495
             FANITGYSILSGLA+GMEPICGQAFGA++F L+GLSLQRTI+LLLFTS+PI++LW NM++
Sbjct  70    FANITGYSILSGLAIGMEPICGQAFGAQKFSLLGLSLQRTILLLLFTSLPISLLWLNMKQ  129

Query  496   ILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHV  675
             IL+LC QD  I+ +AQ+++ YSLPDL AQSLLHPLRIYLR+QS+TLPLTFCAA +I++HV
Sbjct  130   ILLLCGQDPAIATQAQAYLFYSLPDLFAQSLLHPLRIYLRTQSITLPLTFCAAASILLHV  189

Query  676   PINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSL  855
             PINYFLV  L +GIKGVALS VW NFN+V SL++Y++ SGVYKKTWGG+S EC KG+KSL
Sbjct  190   PINYFLVSKLGMGIKGVALSGVWTNFNLVASLILYIIISGVYKKTWGGLSMECLKGWKSL  249

Query  856   LNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVS  1035
             L+LAIPSC SVCLEWWWYE+MILLCGLL NPRATVASMG+LIQTTSLIYIFPSSLSF VS
Sbjct  250   LDLAIPSCISVCLEWWWYEIMILLCGLLLNPRATVASMGILIQTTSLIYIFPSSLSFSVS  309

Query  1036  TRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAA  1215
             TRVGNE+ A RP +AKLAA+VGL  SFILG +AL F                EI+ALT+ 
Sbjct  310   TRVGNEMRARRPRKAKLAAVVGLSGSFILGFSALFF--------------CGEIIALTSL  355

Query  1216  VLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqg  1395
             VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL CFY VG+PVA  LGF+ G DF+G
Sbjct  356   VLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYMVGMPVAVVLGFYCGMDFEG  415

Query  1396  lwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTA  1506
             LW+GLLAAQASC +TM++VL RTDW+ +A RA+ELT 
Sbjct  416   LWIGLLAAQASCMVTMMVVLLRTDWDYEAGRAEELTG  452



>ref|XP_010107396.1| Multidrug and toxin extrusion protein 2 [Morus notabilis]
 gb|EXC15934.1| Multidrug and toxin extrusion protein 2 [Morus notabilis]
Length=545

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/499 (67%), Positives = 403/499 (81%), Gaps = 22/499 (4%)
 Frame = +1

Query  91    KMEAPLISE------------ENPKEEDHNHNQTHLSLAA----------KEAKCISDIA  204
             K+ +PL+S+               K++D+ + +  +++            KEA  IS IA
Sbjct  3     KLSSPLLSKCDSSSPNDDHLLSTNKQDDNKNEELVITIPTTQESQKPNFLKEANAISQIA  62

Query  205   LPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQ  384
             LPMI+TGLLLY RSMISMLFLGRLG+L+LAGGSLA+GFANITGYSILSGLAMGMEPICGQ
Sbjct  63    LPMILTGLLLYSRSMISMLFLGRLGELALAGGSLAVGFANITGYSILSGLAMGMEPICGQ  122

Query  385   AFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSL  564
             AFGAK+  L+GLSLQRT++LL   SIPI++LW NM++IL+LC QD  I+ +AQS++L+SL
Sbjct  123   AFGAKKNTLLGLSLQRTVLLLTLASIPISLLWLNMKKILLLCGQDDAIATQAQSYLLFSL  182

Query  565   PDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVW  744
             PDL+AQSLLHPLRIYLR+QS+TLPLT+CA  +I++H+PINY LV  LN GI+GVALS V 
Sbjct  183   PDLLAQSLLHPLRIYLRTQSITLPLTYCATLSILLHIPINYLLVSHLNFGIRGVALSGVL  242

Query  745   CNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMIL  924
              NFN+V SL++Y+L SGV+K TW G+S +CFK +++LL LAIPSC SVCLEWWWYE+MIL
Sbjct  243   TNFNLVASLILYILISGVHKNTWPGISTDCFKQWRTLLGLAIPSCISVCLEWWWYEIMIL  302

Query  925   LCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGL  1104
             LCGLL NPRATVASMG+LIQTT+LIYIFPSSLSF VSTRVGNELGA +P RA+ AA VGL
Sbjct  303   LCGLLINPRATVASMGILIQTTALIYIFPSSLSFSVSTRVGNELGANKPKRARYAAHVGL  362

Query  1105  CASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALR  1284
               S ILGL AL F V VRNVWA +FTQD EI++LT+ VLPIIGLCELGNCPQTTGCG LR
Sbjct  363   LCSAILGLLALVFSVMVRNVWAKMFTQDKEIVSLTSMVLPIIGLCELGNCPQTTGCGVLR  422

Query  1285  GTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRT  1464
             GTARPK+GA INL CFY VG+PVA  L +F GFDF+GLWLGLLAAQ  CALTML+VLG T
Sbjct  423   GTARPKVGANINLGCFYMVGMPVALVLAYFLGFDFKGLWLGLLAAQWCCALTMLVVLGLT  482

Query  1465  DWNDQARRAKELTATISLV  1521
             DW+ +A+RA  LT   S+V
Sbjct  483   DWDSEAKRALVLTGAYSVV  501



>ref|XP_008437213.1| PREDICTED: MATE efflux family protein 5 [Cucumis melo]
Length=533

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/470 (70%), Positives = 386/470 (82%), Gaps = 6/470 (1%)
 Frame = +1

Query  94    MEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgr  273
             ++ P I E    E    +  +H+     EAK I+DIA PMI+ G L+Y RSMISMLFLGR
Sbjct  13    LKTPFIEE---TETKFPYRSSHV---LTEAKSIADIAFPMILVGFLMYSRSMISMLFLGR  66

Query  274   lgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLF  453
             LG L+LAGGSLAIGFANITGYS+LSGL+MGMEPICGQAFGAK+FKL+GL+LQRTI+LLL 
Sbjct  67    LGGLALAGGSLAIGFANITGYSLLSGLSMGMEPICGQAFGAKKFKLLGLTLQRTIILLLI  126

Query  454   TSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTL  633
             +S+PI+ LW NM++IL+ C QD +I+ EA S+IL SLPDLIA S LHPLRIYLRSQS+ L
Sbjct  127   SSLPISFLWFNMKKILLFCGQDVDIANEAHSYILCSLPDLIALSFLHPLRIYLRSQSINL  186

Query  634   PLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTW  813
             PLT+CA  AI+ H+PINY  V V   GI+GVAL +VW NFN VGSLVV+VLFSGVYKKTW
Sbjct  187   PLTYCAIIAILFHIPINYLFVCVFEWGIRGVALGAVWTNFNFVGSLVVFVLFSGVYKKTW  246

Query  814   GGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTS  993
              G+S +C   +KSLL LAIPSC SVCLEWWWYE+MILL G + NP++TVASMG+LIQTT+
Sbjct  247   PGMSSDCLTEWKSLLGLAIPSCISVCLEWWWYEIMILLSGFMLNPQSTVASMGILIQTTA  306

Query  994   LIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWAS  1173
             LIYIFPSSLSFGVSTRVGNELGA  P RAKLAAIVGLC SF LG++AL F   +R VW +
Sbjct  307   LIYIFPSSLSFGVSTRVGNELGANHPNRAKLAAIVGLCISFFLGISALVFAFKIRKVWTT  366

Query  1174  IFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPV  1353
             +FT+D +I+ LT+ +LPIIGLCELGNCPQTT CG LRGTARPKLGA INL CFY VG+PV
Sbjct  367   MFTEDIQIIELTSLILPIIGLCELGNCPQTTSCGVLRGTARPKLGANINLGCFYMVGMPV  426

Query  1354  AGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
             A WL F+ G+DF+GLW+GLLAAQASCA+TML VL RT+W +QA RAKELT
Sbjct  427   AIWLSFYGGWDFKGLWIGLLAAQASCAMTMLWVLARTNWEEQAERAKELT  476



>gb|KGN57343.1| hypothetical protein Csa_3G180310 [Cucumis sativus]
Length=555

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/478 (69%), Positives = 393/478 (82%), Gaps = 0/478 (0%)
 Frame = +1

Query  103   PLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgd  282
             PL + ++ +        TH SLA +EA  IS IA PM++T LLLY RS+ISMLFLGRLG+
Sbjct  68    PLPTSQHFQLPTKQTTNTHFSLAIQEAFSISQIAFPMVLTSLLLYSRSLISMLFLGRLGE  127

Query  283   lslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSI  462
             L LAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAK+F L+GL+LQRTI+LL  TSI
Sbjct  128   LPLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKKFTLLGLALQRTILLLSLTSI  187

Query  463   PIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLT  642
             PIA LW N++ IL+LC+QD  I+ +AQ F+LYSLPDL AQSL+HPLRIYLRSQS+TLPLT
Sbjct  188   PIAFLWFNVKNILLLCKQDPSIASQAQLFLLYSLPDLFAQSLIHPLRIYLRSQSITLPLT  247

Query  643   FCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGV  822
             FCAAF+I++H+PINYFLV  LN GI+GVA++ VW NFN+V SL++Y+L   V+K TWGG 
Sbjct  248   FCAAFSILLHIPINYFLVSYLNFGIRGVAIAGVWTNFNLVASLILYILVFRVHKDTWGGF  307

Query  823   SWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIY  1002
             S +CFK +  LLNLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTT+LIY
Sbjct  308   SLQCFKEWGDLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPKATVASMGILIQTTALIY  367

Query  1003  IFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFT  1182
             IFPSSLSF VSTRVGNELGA +P +A+LAAIVGL  SF+LG+ AL F V++R +WAS+FT
Sbjct  368   IFPSSLSFSVSTRVGNELGAEQPKKARLAAIVGLFCSFVLGICALFFAVSIRKIWASMFT  427

Query  1183  QDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGW  1362
              D +I+ LT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL CFY VG+PVA  
Sbjct  428   DDKDIIGLTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKIGANINLGCFYLVGMPVAVG  487

Query  1363  LGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDD  1536
             L F+ GFDF+GLWLGLLAAQ  CA  ML+VLG TDW  +A RA++LT     V + + 
Sbjct  488   LSFYGGFDFRGLWLGLLAAQGCCAAAMLVVLGFTDWEFEAIRARKLTGGCEQVVEAES  545



>ref|XP_008439170.1| PREDICTED: MATE efflux family protein LAL5 [Cucumis melo]
Length=543

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/478 (69%), Positives = 394/478 (82%), Gaps = 0/478 (0%)
 Frame = +1

Query  103   PLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgd  282
             PL + ++ +        TH SLA +EA  IS IA PM++T LLLY RS+ISMLFLGRLG+
Sbjct  56    PLPTSQHFQLPTKLTTNTHFSLAVQEAFSISQIAFPMVLTSLLLYSRSLISMLFLGRLGE  115

Query  283   lslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSI  462
             L LAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAK+F L+GL+LQRT++LL  TSI
Sbjct  116   LPLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKKFTLLGLALQRTVLLLSLTSI  175

Query  463   PIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLT  642
             PI++LW N++ IL+LC+QD  I+ +AQ F+LYSLPDL AQSL+HPLRIYLRSQS+TLPLT
Sbjct  176   PISLLWFNVKNILLLCKQDPSIASQAQLFLLYSLPDLFAQSLIHPLRIYLRSQSITLPLT  235

Query  643   FCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGV  822
             FCAAF+I++H+PINY LV  LN GI+GVA++ VW NFN+V SL++Y+L   V+K TW G 
Sbjct  236   FCAAFSILLHIPINYLLVSYLNFGIRGVAIAGVWTNFNLVASLILYILIFRVHKDTWAGF  295

Query  823   SWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIY  1002
             S +CFK +  LLNLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTT+LIY
Sbjct  296   SLQCFKEWGDLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPKATVASMGILIQTTALIY  355

Query  1003  IFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFT  1182
             IFPSSLSF VSTRVGNELGA +P +AKLAAIVGL  SF+LG+ AL F V++R +WAS+FT
Sbjct  356   IFPSSLSFSVSTRVGNELGAEQPKKAKLAAIVGLSCSFLLGICALFFAVSIRKIWASMFT  415

Query  1183  QDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGW  1362
             +D +I+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL CFY VG+PVA  
Sbjct  416   EDKDIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKIGANINLGCFYLVGMPVAVG  475

Query  1363  LGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDD  1536
             L FF GFDF+GLWLGLLAAQ  CA  ML+VLG TDW  +A RA++LT     V + + 
Sbjct  476   LSFFGGFDFRGLWLGLLAAQGCCAAAMLVVLGFTDWEFEAIRARKLTGGCEEVVEAES  533



>gb|KHN25727.1| MATE efflux family protein 6 [Glycine soja]
Length=465

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/432 (76%), Positives = 381/432 (88%), Gaps = 1/432 (0%)
 Frame = +1

Query  211   MIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAF  390
             M++TGLLLY RS+ISMLFLGR+G+L+LAGGSLAIGFANITGYSILSGLAMGMEPICGQAF
Sbjct  1     MVLTGLLLYSRSVISMLFLGRVGELALAGGSLAIGFANITGYSILSGLAMGMEPICGQAF  60

Query  391   GAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPD  570
             GAKRFKL+GL++QRT+VLLL T + I+ LW NM++IL+LC Q  +I+ EAQSFIL+S+PD
Sbjct  61    GAKRFKLLGLAMQRTMVLLLLTCVFISFLWFNMKKILVLCGQQEDIATEAQSFILFSIPD  120

Query  571   LIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCN  750
             L+AQSLLHPLRIYLRSQS+TLPLT+ A+ +I++HVPINYFLV VL LGIKG+AL +VW N
Sbjct  121   LVAQSLLHPLRIYLRSQSITLPLTYTASLSILLHVPINYFLVSVLKLGIKGIALGAVWTN  180

Query  751   FNVVGSLVVYVLFSGVYKKTWGGVSWE-CFKGYKSLLNLAIPSCASVCLEWWWYELMILL  927
             FN+V SL++Y+  SGVYKKTW GVS +  F G+KSLLNLAIPSC SVCLEWWWYE+MILL
Sbjct  181   FNLVFSLILYIWVSGVYKKTWPGVSLKGVFSGWKSLLNLAIPSCISVCLEWWWYEIMILL  240

Query  928   CGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLC  1107
             CGLL NP+ATVASMGVLIQTT+LIYIFPSSLSF VSTRVGNELGA  P +AKLAA+VGLC
Sbjct  241   CGLLINPQATVASMGVLIQTTALIYIFPSSLSFAVSTRVGNELGAENPKKAKLAALVGLC  300

Query  1108  ASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRG  1287
              S+ LG +AL F V+VR+VWAS+FT DAEI+ALT+ VLPIIGLCELGNCPQTT CG LRG
Sbjct  301   FSYGLGFSALFFAVSVRHVWASMFTSDAEIIALTSMVLPIIGLCELGNCPQTTVCGVLRG  360

Query  1288  TARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTD  1467
             TARPKLGA INL CFY VG+PVA  L FFAGFDF+GLWLGLLAAQASC  TML+VL RT+
Sbjct  361   TARPKLGANINLGCFYLVGMPVAVRLSFFAGFDFKGLWLGLLAAQASCMFTMLIVLARTN  420

Query  1468  WNDQARRAKELT  1503
             W  Q +RAKELT
Sbjct  421   WEGQVQRAKELT  432



>ref|XP_004515891.1| PREDICTED: MATE efflux family protein 5-like [Cicer arietinum]
Length=516

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/511 (66%), Positives = 396/511 (77%), Gaps = 12/511 (2%)
 Frame = +1

Query  25    RQSNTKNPLFFLPFAFISACKEKMEAPLISEEN------PKEEDHNHNQTHLSLAAKEAK  186
               S T   L   P  F S   E     L+ E N      PK      N THLSL   EAK
Sbjct  5     ESSTTAASLGQFPVPF-SERNESEPNILVEEPNMLTTLIPKSPTCEEN-THLSLVLNEAK  62

Query  187   CISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGM  366
              IS+I+L M++T L+LY RSMISMLFLGRLG+LSLAGGSLAIGFANITGYS+LSGLAMG+
Sbjct  63    YISNISLSMVLTALILYSRSMISMLFLGRLGELSLAGGSLAIGFANITGYSVLSGLAMGI  122

Query  367   EPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQS  546
             EP+CGQAFGAKRFKL+GL++Q+ ++LLLFTS  IA+LW NM++ILI C Q  +I+ EAQ 
Sbjct  123   EPLCGQAFGAKRFKLLGLAMQKMVLLLLFTSFFIALLWLNMKKILIFCNQQEDIANEAQF  182

Query  547   FILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGV  726
             +I YSLPDLI QSLLHPLRIYLRSQS+T PLT CA  +I++HVPINYFLV +L LGIKGV
Sbjct  183   YIFYSLPDLIIQSLLHPLRIYLRSQSITFPLTCCATLSILLHVPINYFLVSMLKLGIKGV  242

Query  727   ALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWW  906
             ALSSVW NFN VGSL++Y++ SG +K+TW G+SW C KG+ +LLNLAIPSC SVCLEWWW
Sbjct  243   ALSSVWTNFNFVGSLIIYIMVSGTHKRTWNGISWRCLKGWNTLLNLAIPSCVSVCLEWWW  302

Query  907   YELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKL  1086
             YE+M LLCGL+ NP A+VASMGVLIQTTSLIYIFPSSLSFGVSTRVGN+LGAG   +AK 
Sbjct  303   YEIMTLLCGLMMNPHASVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNQLGAGNSHQAKT  362

Query  1087  AAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTT  1266
             AAIVG+C SF+LG  A  F   VRNVWAS+FT D +I+ LT  VLPI+GLCE GNCPQTT
Sbjct  363   AAIVGVCFSFVLGFFAFVFAFWVRNVWASMFTNDVDIIGLTKIVLPIVGLCEFGNCPQTT  422

Query  1267  GCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTML  1446
              CG LRG+ARPKLGA INL CFY VG+PV  WL FF GFDF+GLW+G+LAAQ  C + M+
Sbjct  423   VCGVLRGSARPKLGANINLCCFYVVGMPVGVWLSFFGGFDFEGLWIGMLAAQGCCMMAMM  482

Query  1447  LVLGRTDWNDQARRAKELTATISLVDDDDDD  1539
              VL  T+W+ Q  RAKELT++    D  +++
Sbjct  483   FVLVHTNWDGQVLRAKELTSS----DHGEEE  509



>ref|XP_004240795.1| PREDICTED: MATE efflux family protein 5-like [Solanum lycopersicum]
Length=520

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/500 (68%), Positives = 407/500 (81%), Gaps = 14/500 (3%)
 Frame = +1

Query  82    CKEKMEAPLISEEN---------PKE-----EDHNHNQTHLSLAAKEAKCISDIALPMIV  219
             C ++  +PL+S ++         PK       DH +  TH +L   EAK I++IA PMI+
Sbjct  2     CNKQTSSPLLSTKDTTNMFPLLIPKTPTNLLHDHKNTTTHFTLIFIEAKSIANIAFPMIL  61

Query  220   TGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAK  399
             T LLLY RS+ISMLFLG+LG L+LAGGSLA+GFANITGYSILSGLAMGMEPICGQAFGAK
Sbjct  62    TALLLYSRSLISMLFLGQLGGLALAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGAK  121

Query  400   RFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIA  579
             ++ L+GL+LQRTI+LLL TS PIA+LW NM+ IL+ C QD +I+ EAQS+++YSLPDL A
Sbjct  122   KYNLLGLTLQRTILLLLLTSFPIALLWINMKNILVYCGQDEDIATEAQSYLIYSLPDLFA  181

Query  580   QSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNV  759
             QSLLHPLRIYLR+QS+TLPLTFCA  +I +HVPINY LV  LNLG+KG+ALSSVW N N+
Sbjct  182   QSLLHPLRIYLRTQSITLPLTFCAIVSISLHVPINYLLVTKLNLGVKGIALSSVWTNLNL  241

Query  760   VGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLL  939
             V SL++Y++ SGV+KKTW  +S EC KG+K LLNLAIPSC SVCLEWWWYE+MIL+CG+L
Sbjct  242   VISLIIYIIISGVHKKTWENLSTECLKGWKELLNLAIPSCISVCLEWWWYEIMILVCGVL  301

Query  940   ANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFI  1119
              NPRATVASMG+LIQTTSLIYIFPSSLSF VSTRVGNELGA  P +AK+AAIVGL  SF+
Sbjct  302   INPRATVASMGILIQTTSLIYIFPSSLSFSVSTRVGNELGAREPKKAKIAAIVGLAGSFV  361

Query  1120  LGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARP  1299
             LG +AL F V VR +WA +FT D +I+ LT+ VLPIIGLCE+GNCPQTTGCG LRG+ARP
Sbjct  362   LGFSALFFAVTVRKIWAKMFTNDQDILTLTSLVLPIIGLCEIGNCPQTTGCGVLRGSARP  421

Query  1300  KLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQ  1479
             K+GA INL CFY VG+PVA  L F+AGFDF+GLWLGLLAAQASC +TML+VL RTDW+ Q
Sbjct  422   KVGANINLVCFYLVGMPVAVVLSFYAGFDFEGLWLGLLAAQASCMVTMLMVLLRTDWDLQ  481

Query  1480  ARRAKELTATISLVDDDDDD  1539
             A RAK LT T  L   D+++
Sbjct  482   AERAKHLTGTTLLYGVDENE  501



>ref|XP_009600301.1| PREDICTED: MATE efflux family protein 5-like [Nicotiana tomentosiformis]
Length=540

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/521 (69%), Positives = 417/521 (80%), Gaps = 22/521 (4%)
 Frame = +1

Query  22    KRQSNTKNPLFFLPFAFISACKE-KMEAPLI-----------SEENPKEEDHNHNQ-THL  162
             K  SN  N      F  I   +E  M APLI           + E P      +N+ THL
Sbjct  12    KCHSNEPN------FLSIKVAQEADMFAPLIPKSPTNQYQAQNSEVPNYPHKTNNKITHL  65

Query  163   SLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSI  342
             SL  KE + I+DIA PMI+TGLLLY RSMISMLFLGRLGDL+LAGGSLAIGFANITGYSI
Sbjct  66    SLVFKEVQSIADIAFPMILTGLLLYSRSMISMLFLGRLGDLALAGGSLAIGFANITGYSI  125

Query  343   LSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDR  522
             LSGLAMGMEPICGQAFGA+++ L+GL+LQRTI+LLL TS PIA+LW NM+ IL+ C QD 
Sbjct  126   LSGLAMGMEPICGQAFGAQKYNLLGLTLQRTILLLLLTSFPIALLWVNMKTILLYCGQDE  185

Query  523   EISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVV  702
             +I+ EAQS++ Y+LPDL AQSLLHPLRIYLR+QS+TLPLT CA  AI++H+PIN+ LV  
Sbjct  186   DIATEAQSYLFYALPDLFAQSLLHPLRIYLRTQSITLPLTCCAVLAILLHIPINFLLVTK  245

Query  703   LNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCA  882
             LNLG+KGVALSSVW NFN+V SL++Y++ SG+YKKTW  +S E  KG+KSLLNLAIPSC 
Sbjct  246   LNLGVKGVALSSVWTNFNLVVSLIIYIIISGIYKKTWEKLSMEIIKGWKSLLNLAIPSCI  305

Query  883   SVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGA  1062
             SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTTSLIYIFPSSLSF VSTRVGNELGA
Sbjct  306   SVCLEWWWYEIMILLCGLLINPKATVASMGILIQTTSLIYIFPSSLSFSVSTRVGNELGA  365

Query  1063  GRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCE  1242
              RP +AK+AAIVGL  SFILG +AL F V VR VWA +FT D EI+ALT+ VLPIIGLCE
Sbjct  366   RRPDKAKVAAIVGLAGSFILGFSALFFAVIVRKVWAKMFTNDKEILALTSLVLPIIGLCE  425

Query  1243  LGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaq  1422
             LGNCPQTTGCG LRGTARPK+GA INL CFY VG+PVA  L F+AGFDF+GLWLGLLAAQ
Sbjct  426   LGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGMPVAVGLSFYAGFDFEGLWLGLLAAQ  485

Query  1423  aSCALTMLLVLGRTDWNDQARRAKEL---TATISLVDDDDD  1536
             ASC +TMLLVL  TDW+ +A+RAKEL   TA  + +D + D
Sbjct  486   ASCMVTMLLVLLHTDWDFEAQRAKELTGITAVSNFLDHNKD  526



>ref|XP_010676553.1| PREDICTED: MATE efflux family protein LAL5-like [Beta vulgaris 
subsp. vulgaris]
Length=508

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/510 (66%), Positives = 401/510 (79%), Gaps = 14/510 (3%)
 Frame = +1

Query  13    YGDKRQSNTKNPLFFLPFAFISACKEKMEAPLISEENPKEEDHN---HNQTHLSLAAKEA  183
             Y  K Q N     F  P    +  K+ M+           EDH       THL LA  EA
Sbjct  4     YTSKTQENKSIKTFHEPL-LSTTYKQIMQL----------EDHEIIPQKTTHLILAINEA  52

Query  184   KCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMG  363
             K I+ +ALP+++TGLLLY RSMISMLFLGR+GDL+LAGGSLAIGFANITGYSILSGLAMG
Sbjct  53    KSITKLALPLVLTGLLLYSRSMISMLFLGRIGDLALAGGSLAIGFANITGYSILSGLAMG  112

Query  364   MEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQ  543
             MEPICGQAFGAKR+KL+GL +Q+TI+LLL  SIPI+ILW NM++IL+ C QD  I+ EA 
Sbjct  113   MEPICGQAFGAKRYKLLGLVMQKTIILLLLASIPISILWFNMKKILLFCNQDINIANEAH  172

Query  544   SFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKG  723
             S+IL+SLPDLI QSLLHP+RIYLRSQS+TLP+T CAA AI +H+PINYFLVV LNLG+KG
Sbjct  173   SYILFSLPDLITQSLLHPIRIYLRSQSITLPITLCAAIAIFLHIPINYFLVVHLNLGVKG  232

Query  724   VALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWW  903
             VA+S V  NFN+V SL++Y++ SG+Y  TW  +S EC KG+K+L+NLAIPSC SVCLEWW
Sbjct  233   VAISGVLTNFNLVASLIIYIILSGIYTNTWCAISKECIKGWKTLINLAIPSCISVCLEWW  292

Query  904   WYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAK  1083
             WYE+MILLCGLL+NP+ATVASMG+LIQTT+LIYIFPSSLS  VSTRVGN++GA +P  AK
Sbjct  293   WYEIMILLCGLLSNPQATVASMGILIQTTALIYIFPSSLSLSVSTRVGNQMGANQPKIAK  352

Query  1084  LAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQT  1263
             L+ IVGL  S ILG  AL F + VRN+WA  FT+D EI+ALT+ VLPIIGLCE+GNCPQT
Sbjct  353   LSTIVGLLFSIILGFCALFFTMMVRNIWAGFFTKDVEIIALTSTVLPIIGLCEIGNCPQT  412

Query  1264  TGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTM  1443
             TGCG LRG ARPKLGA +NL  FY VG+PVA WLGF  GF F+GLWLGLLAAQ SC + M
Sbjct  413   TGCGVLRGLARPKLGATVNLGSFYLVGMPVALWLGFKLGFGFKGLWLGLLAAQGSCVVAM  472

Query  1444  LLVLGRTDWNDQARRAKELTATISLVDDDD  1533
             L+VL RT+W  QA+RA+ELT  +   + ++
Sbjct  473   LIVLVRTNWKIQAQRAQELTLDVGCFEGEN  502



>emb|CBI31838.3| unnamed protein product [Vitis vinifera]
Length=498

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/485 (69%), Positives = 384/485 (79%), Gaps = 38/485 (8%)
 Frame = +1

Query  85    KEKMEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLF  264
             +  M  PLI  ++P      + QTHLSLA +EA  I+ IALPMI+TGLLLY RSMISMLF
Sbjct  27    EPHMGTPLI-PKSPTSNQQQYTQTHLSLAIREANSIAKIALPMILTGLLLYSRSMISMLF  85

Query  265   lgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVL  444
             LGRLG+L+LAGGSLA+GFANITGYSILSGLAMGMEPICGQAFGAKR  L+GLSLQRT++L
Sbjct  86    LGRLGELALAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGAKRHALLGLSLQRTVLL  145

Query  445   LLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQS  624
             LLFTS+PIA LW NM+RIL+ C QD +I+ EAQS++LYSLPDL AQSLLHPLRIYLR+QS
Sbjct  146   LLFTSLPIAFLWLNMKRILLFCGQDEDIAAEAQSYLLYSLPDLFAQSLLHPLRIYLRTQS  205

Query  625   VTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYK  804
             +TLPLTFCA  +I +H+PINY LV  LNLGIKGVALS VW NFN+VGSL++Y+L SGVYK
Sbjct  206   ITLPLTFCATMSIFMHIPINYLLVSHLNLGIKGVALSGVWTNFNLVGSLIIYLLISGVYK  265

Query  805   KTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQ  984
             KTWGG+S EC +G                                    ATVASMG+LIQ
Sbjct  266   KTWGGLSMECLRG------------------------------------ATVASMGILIQ  289

Query  985   TTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNV  1164
             TTSLIYIFPSSLSF VSTRVGNELGA +P +AK AAI+GL  SF LG +AL F V VRNV
Sbjct  290   TTSLIYIFPSSLSFSVSTRVGNELGANQPNKAKCAAIIGLACSFTLGFSALLFAVMVRNV  349

Query  1165  WASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVG  1344
             WAS+FTQDAEI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARP++GA INL CFY VG
Sbjct  350   WASMFTQDAEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPRVGANINLGCFYLVG  409

Query  1345  LPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVD  1524
              PVA  LGF+AGFDF+GLWLGLLAAQASC +TML+VL RTDW  +A+RAK+LT+   LV 
Sbjct  410   TPVAVGLGFYAGFDFEGLWLGLLAAQASCVVTMLVVLNRTDWEVEAQRAKQLTSG-PLVP  468

Query  1525  DDDDD  1539
             D++DD
Sbjct  469   DEEDD  473



>gb|KCW46389.1| hypothetical protein EUGRSUZ_K00224, partial [Eucalyptus grandis]
Length=450

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/431 (74%), Positives = 373/431 (87%), Gaps = 0/431 (0%)
 Frame = +1

Query  211   MIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAF  390
             MI+TGLLLY R MISMLFLGRLG L+LAGGSLAIGFANITGYS+LSGLAMGMEPICGQAF
Sbjct  1     MILTGLLLYSRCMISMLFLGRLGGLALAGGSLAIGFANITGYSVLSGLAMGMEPICGQAF  60

Query  391   GAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPD  570
             GAKR  ++G++LQRT++LLL TSIPI++LW NM+ IL+ CRQD  IS++AQS++LYS+PD
Sbjct  61    GAKRLSVLGITLQRTVLLLLLTSIPISLLWLNMKSILLFCRQDESISVQAQSYLLYSVPD  120

Query  571   LIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCN  750
             L+AQSLLHPLRIYLRSQS+ LPLTFCA+ +I +H+PINYFLV+ L LGIKGVALS+VW N
Sbjct  121   LLAQSLLHPLRIYLRSQSINLPLTFCASISIFLHIPINYFLVIHLGLGIKGVALSAVWTN  180

Query  751   FNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLC  930
             FN+V SLV+Y+++SGVY+ TWGG S ECF+ ++ LL+LA+PSC SVCLEWWWYE+MILLC
Sbjct  181   FNLVASLVIYIIYSGVYRDTWGGYSLECFREWRPLLSLAVPSCISVCLEWWWYEIMILLC  240

Query  931   GLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCA  1110
             GLL NPRATVASMG+LIQTT+ IYIFPSSLSF VSTRVGNELGA RP +A+LAA VG+  
Sbjct  241   GLLLNPRATVASMGILIQTTAFIYIFPSSLSFSVSTRVGNELGANRPAKARLAASVGIGL  300

Query  1111  SFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGT  1290
             SF+LG +AL F V VRN WA +FT+D EI ALT  VLPIIGLCELGNCPQTTGCG LRG+
Sbjct  301   SFVLGCSALLFAVTVRNHWARMFTEDGEIAALTLTVLPIIGLCELGNCPQTTGCGVLRGS  360

Query  1291  ARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDW  1470
             ARPK+GA INL CFY VG+PVA  L F+   DF+GLWLGLLAAQASC  TML+VL RTDW
Sbjct  361   ARPKIGANINLGCFYLVGMPVAVGLAFYCHLDFRGLWLGLLAAQASCMATMLVVLRRTDW  420

Query  1471  NDQARRAKELT  1503
               QA RA+ELT
Sbjct  421   EHQAMRAQELT  431



>gb|KHN34434.1| MATE efflux family protein LAL5 [Glycine soja]
Length=504

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/458 (70%), Positives = 373/458 (81%), Gaps = 31/458 (7%)
 Frame = +1

Query  154   THLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITG  333
             THLSL+  EAKCI++I+  M++TGLLLY RSMISMLFLG LG+L+LAGGSLAIGFANITG
Sbjct  46    THLSLSLNEAKCIANISFSMVLTGLLLYSRSMISMLFLGHLGELALAGGSLAIGFANITG  105

Query  334   YSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAIL-WCNMERILILC  510
             YS+LSGLAMGMEPICGQAFGA+RFKL+GL++QRT++LLL TS  I++  W NM +IL+LC
Sbjct  106   YSVLSGLAMGMEPICGQAFGARRFKLLGLTMQRTVLLLLVTSCLISLFFWLNMRKILLLC  165

Query  511   RQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYF  690
              Q+ +I+ EA+ +ILYSLPDL+ QSLLHPLRIYLRSQS+TLPLT CAA +I++HVPINY 
Sbjct  166   GQEEDIANEAELYILYSLPDLVLQSLLHPLRIYLRSQSITLPLTCCAAVSILLHVPINYL  225

Query  691   LVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGY---KSLLN  861
              V +L LGIKGVALS+V  N N+V  L+VYV+ SG +KKTW G+S ECF+G+   K+L+N
Sbjct  226   FVSILKLGIKGVALSAVVTNLNLVWLLIVYVVVSGTHKKTWPGISRECFQGWNSWKTLMN  285

Query  862   LAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTR  1041
             LAIPSC SVCLEWWWYE+MILLCGLL NP A+VASMGVLIQTT+LIYIFPSSLSFGVSTR
Sbjct  286   LAIPSCVSVCLEWWWYEIMILLCGLLVNPHASVASMGVLIQTTALIYIFPSSLSFGVSTR  345

Query  1042  VGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVL  1221
             VGNELGAG P RAKLAA+VGLC SF+ GL+AL F V+VRNVWAS+FT D +I+ALT+AVL
Sbjct  346   VGNELGAGNPRRAKLAAMVGLCFSFVFGLSALAFAVSVRNVWASMFTLDGQIIALTSAVL  405

Query  1222  PIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglw  1401
             PIIGLCELGNCPQTT CG LRGTARPKLGA INL CFY VG+PVA WLGFFAG       
Sbjct  406   PIIGLCELGNCPQTTVCGVLRGTARPKLGANINLGCFYLVGMPVAVWLGFFAG-------  458

Query  1402  lgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATIS  1515
                                 T+W  QA RAKELT + S
Sbjct  459   --------------------TNWEGQALRAKELTDSDS  476



>gb|KEH17144.1| MATE efflux family protein [Medicago truncatula]
Length=527

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/492 (66%), Positives = 387/492 (79%), Gaps = 15/492 (3%)
 Frame = +1

Query  109   ISEENPKEEDH----------NHNQT-----HLSLAAKEAKCISDIALPMIVTGLLLYCR  243
             +SE NP + +             NQT     HL+   KE   IS IA PMI+T LLLYCR
Sbjct  1     MSETNPNQSNMILTNPLIPKPKKNQTFSFYHHLTHTFKEMNSISKIAFPMILTCLLLYCR  60

Query  244   SMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLS  423
             SMISMLFLG L DL+LAGGSLAIGFANITGYSILSGLA+GMEPICGQAFGAK+F L+GL 
Sbjct  61    SMISMLFLGHLNDLALAGGSLAIGFANITGYSILSGLAVGMEPICGQAFGAKKFTLLGLC  120

Query  424   LQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLR  603
             LQRTI+LLL  SIPI+  W  M+++L+   QD EI+  AQ++ILYS+PDLIAQS +HPLR
Sbjct  121   LQRTILLLLLVSIPISFSWLYMKKMLLFFNQDEEIATMAQTYILYSIPDLIAQSFIHPLR  180

Query  604   IYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYV  783
             IYLR+QS+TLPLT CA F+I++H+PINYFLV+ LNLGIKGVALS VW NFN+V SL+ Y+
Sbjct  181   IYLRTQSITLPLTLCATFSILLHIPINYFLVIYLNLGIKGVALSGVWTNFNLVASLIFYI  240

Query  784   LFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVA  963
              +SG +KKTW G S E F+ +  LLNLAIPSC SVCLEWWWYE M + CG L+NPR++VA
Sbjct  241   YYSGTHKKTWAGFSLESFREWLPLLNLAIPSCVSVCLEWWWYEFMTIFCGYLSNPRSSVA  300

Query  964   SMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTF  1143
             SMGVLIQ TSL+YIFP SLS  VSTRVGN +GA +P +AKL+AI GL  SFI G+ A  F
Sbjct  301   SMGVLIQITSLMYIFPYSLSNSVSTRVGNMIGAQKPSKAKLSAISGLSFSFICGVFAFIF  360

Query  1144  GVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINL  1323
              + VRN+WAS+FT+D EI+ALT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA INL
Sbjct  361   TLCVRNMWASMFTKDKEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINL  420

Query  1324  RCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
              CFY VG+PV+ WL F+ G+DFQGLWLGLLAAQ SCALTML+VL +TDW  +A RA++LT
Sbjct  421   GCFYLVGMPVSVWLAFYGGYDFQGLWLGLLAAQGSCALTMLIVLYKTDWKFEALRARKLT  480

Query  1504  ATISLVDDDDDD  1539
              +    ++ + D
Sbjct  481   GSEKENENKEID  492



>emb|CBI34748.3| unnamed protein product [Vitis vinifera]
Length=504

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/498 (69%), Positives = 402/498 (81%), Gaps = 35/498 (7%)
 Frame = +1

Query  67    AFISACKEK--MEAPLIS-----EENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTG  225
               +SA +++  M  PL+      ++ P  ++ N ++THLSLA  EA+ I+ IA PMI+TG
Sbjct  19    GLLSAVEQEPHMLTPLVPKAPTLDDQPHGQEQNPSKTHLSLALTEARHIASIAFPMILTG  78

Query  226   LLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRF  405
             LLLY RSMISMLFLGRLG+L+LAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGA+R+
Sbjct  79    LLLYSRSMISMLFLGRLGELALAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAQRY  138

Query  406   KLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQS  585
             KL+GL+LQRT++LLL TSIPIA LW NM+ IL+ C QD +I+ EAQS+ILYSLPDL+AQS
Sbjct  139   KLLGLTLQRTVLLLLLTSIPIAFLWFNMKEILLFCGQDEDIATEAQSYILYSLPDLVAQS  198

Query  586   LLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVG  765
              LHPLRIYLR+QS+TLPLT+CA  AI++H+PINYFLV VL+LGIKGVALS +W N N+VG
Sbjct  199   FLHPLRIYLRTQSITLPLTYCATLAILLHIPINYFLVSVLDLGIKGVALSGIWTNLNLVG  258

Query  766   SLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLAN  945
             SL+ YV+ S VYKKTWG                          EWWWYE+MILLCGLL N
Sbjct  259   SLIAYVVVSRVYKKTWG--------------------------EWWWYEIMILLCGLLLN  292

Query  946   PRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILG  1125
             PRATVASMG+LIQTT+LIYIFPSSLSF +STRVGNELGA RP +A+LAAIVGL +SFILG
Sbjct  293   PRATVASMGILIQTTALIYIFPSSLSFSLSTRVGNELGANRPEKARLAAIVGLSSSFILG  352

Query  1126  LAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKL  1305
               AL F V VR  WA++FTQD EI+ LT+ VLPIIGLCELGNCPQTTGCGALRGTARPKL
Sbjct  353   FLALFFAVMVRKTWATMFTQDPEILTLTSMVLPIIGLCELGNCPQTTGCGALRGTARPKL  412

Query  1306  GAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQAR  1485
             GA INL CFY VG+PVA WLGFFAGFDF+GLWLGLLAAQ SCA+TML VL +T+W+ QA+
Sbjct  413   GANINLGCFYLVGMPVAVWLGFFAGFDFKGLWLGLLAAQGSCAVTMLFVLFQTNWDQQAQ  472

Query  1486  RAKELTATISLVDDDDDD  1539
             RAKELT T S  DDD++ 
Sbjct  473   RAKELTGTGS--DDDEES  488



>ref|XP_004513681.1| PREDICTED: multidrug and toxin extrusion protein 2-like [Cicer 
arietinum]
Length=535

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/469 (67%), Positives = 385/469 (82%), Gaps = 5/469 (1%)
 Frame = +1

Query  103   PLIS-EENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlg  279
             PLI  ++ PK+   N+    LS   KE   IS+IALPMI+T LLLYCRSMISMLFLG L 
Sbjct  19    PLIQKQQKPKKRILNN----LSKTFKEMSSISNIALPMILTCLLLYCRSMISMLFLGHLD  74

Query  280   dlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTS  459
             +L+LAGGSLA+GFANITGYSILSGLA+GMEPICGQA+GAK+F L+GL LQ+TI+LLL  S
Sbjct  75    ELALAGGSLAVGFANITGYSILSGLAVGMEPICGQAYGAKKFTLLGLCLQKTILLLLLVS  134

Query  460   IPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPL  639
             +PI+ILW  M++IL+   QD+EI+  AQ +ILYS+PDLIAQS+LHPLRIYLR+QS+TLPL
Sbjct  135   MPISILWLYMKKILLFFNQDQEIAEMAQIYILYSIPDLIAQSILHPLRIYLRTQSITLPL  194

Query  640   TFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGG  819
             T CA F+I +H+PINYFLV  LNLG+KGVALS VW NFN+VGSL++Y+++S  ++KTWGG
Sbjct  195   TLCATFSIFLHIPINYFLVFYLNLGVKGVALSGVWTNFNLVGSLIIYIIYSKTHEKTWGG  254

Query  820   VSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLI  999
              S+ECF  +  LLNLAIPSC S+CLEWWWYE M L CG L NP++TVASMG+LIQ TSL+
Sbjct  255   FSFECFSKWAPLLNLAIPSCVSICLEWWWYEFMTLFCGYLNNPKSTVASMGILIQITSLM  314

Query  1000  YIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIF  1179
             YI P SLS  VSTRVGN +GA +P +AKL+AIVGL  SF+ GL AL+F   VRN+WA++F
Sbjct  315   YILPHSLSNSVSTRVGNMIGAQKPSKAKLSAIVGLFFSFLCGLLALSFTFLVRNIWATMF  374

Query  1180  TQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAG  1359
             T D +I+ LT+ VLPIIGLCE+GNCPQTTGCG LRGTARPK+GA INL CFY VG+PV+ 
Sbjct  375   TNDKDIIFLTSMVLPIIGLCEVGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGMPVSV  434

Query  1360  WLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTA  1506
             WL F+ G+DFQGLW GLLAAQ SCA+TM +V+ +TDWN +A +A++LT 
Sbjct  435   WLAFYGGYDFQGLWFGLLAAQGSCAVTMFIVVYKTDWNFEALKARKLTG  483



>gb|KDP25510.1| hypothetical protein JCGZ_20666 [Jatropha curcas]
Length=409

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/390 (74%), Positives = 331/390 (85%), Gaps = 0/390 (0%)
 Frame = +1

Query  364   MEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQ  543
             MEPICGQAFGAKR+KL+GL++QRTI+LL   SIPIA LW NM++IL+ C Q+ +I+ EAQ
Sbjct  1     MEPICGQAFGAKRYKLLGLTMQRTILLLFLISIPIAFLWLNMKKILLFCGQENDIATEAQ  60

Query  544   SFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKG  723
              +ILYSLPDLI QS LHPLRIYLR+QS+TLPLT+CA F+I++H+PINYFLV VLNLGIKG
Sbjct  61    IYILYSLPDLILQSFLHPLRIYLRTQSITLPLTYCATFSILLHIPINYFLVSVLNLGIKG  120

Query  724   VALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWW  903
             VALS +W NFN+V SL+ YV+ SGVYKKTW G+S EC  G+KSLLNLAIPSC SVCLEWW
Sbjct  121   VALSGIWTNFNLVASLISYVMVSGVYKKTWSGISLECLNGWKSLLNLAIPSCVSVCLEWW  180

Query  904   WYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAK  1083
             WYE+MILLCGLL NPRATVASMG+LIQTT+ +YIFPSSLSF VSTRVGNELGA  P RAK
Sbjct  181   WYEIMILLCGLLLNPRATVASMGILIQTTAFLYIFPSSLSFSVSTRVGNELGANNPRRAK  240

Query  1084  LAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQT  1263
             LAAI+GL +SF LG +AL F V VR +WAS+FTQDAEI+ALT  VLPIIGLCELGNCPQT
Sbjct  241   LAAIIGLSSSFALGFSALFFAVVVRKIWASMFTQDAEIIALTTMVLPIIGLCELGNCPQT  300

Query  1264  TGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTM  1443
             TGCG LRGTARPKLGA INL CFY VG+P+A WL F+ GFDF+GLWLGLLAAQ SC +TM
Sbjct  301   TGCGVLRGTARPKLGANINLGCFYLVGMPIAIWLSFYGGFDFEGLWLGLLAAQGSCVVTM  360

Query  1444  LLVLGRTDWNDQARRAKELTATISLVDDDD  1533
             L  L RTDW  QA +AKELT  +   +DD+
Sbjct  361   LFFLTRTDWEWQALKAKELTRNMESNNDDN  390



>emb|CDP05245.1| unnamed protein product [Coffea canephora]
Length=532

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/476 (67%), Positives = 390/476 (82%), Gaps = 32/476 (7%)
 Frame = +1

Query  127   KEEDHNHNQTHLSLAA-KEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggs  303
             K   HNH+ TH+S +  KEA  +++IALPMI+TGLLLY RSMISMLFLGRLGDL+LAGGS
Sbjct  71    KPHKHNHD-THISSSVLKEATSVANIALPMILTGLLLYSRSMISMLFLGRLGDLALAGGS  129

Query  304   laigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWC  483
             LA+GFANI+GYSILSGLAMGMEPICGQAFGAKR+ L+GLSLQRT++LL+ TS+PIA+LW 
Sbjct  130   LALGFANISGYSILSGLAMGMEPICGQAFGAKRYTLLGLSLQRTVLLLMLTSLPIALLWV  189

Query  484   NMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAI  663
             NM+ IL+   QD+ I+ EAQS+++Y+LPDL AQSLLHPLRIYLR+QS+TLPLTFCAA +I
Sbjct  190   NMKTILLFFGQDQAIAREAQSYLMYTLPDLFAQSLLHPLRIYLRAQSITLPLTFCAALSI  249

Query  664   VVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKG  843
             ++H+PINYFLV  L+LGIKGVALS VW NFN+V SL++Y+L SGVYKKTWGG++ EC KG
Sbjct  250   LLHIPINYFLVTKLSLGIKGVALSGVWTNFNLVASLIIYILISGVYKKTWGGLTTECLKG  309

Query  844   YKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLS  1023
             ++SLL L+IPS                         +TVASMG+LIQTTSLIYIFPSSLS
Sbjct  310   WQSLLYLSIPS-------------------------STVASMGILIQTTSLIYIFPSSLS  344

Query  1024  FGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMA  1203
             F VSTRVGNELGA +P +AKLAA+VGLC SF+LG +AL F V++R+VWA +FT D EI+A
Sbjct  345   FSVSTRVGNELGARQPAKAKLAAVVGLCCSFVLGFSALMFAVSMRHVWARMFTADNEIIA  404

Query  1204  LTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGF  1383
             LT+ VLPIIGLCELGNCPQTTGCG LRGTARP++GA INL CFY VG+PVA  LGF+AGF
Sbjct  405   LTSLVLPIIGLCELGNCPQTTGCGVLRGTARPRVGANINLGCFYLVGMPVAVGLGFYAGF  464

Query  1384  DFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT-----ATISLVDDDDD  1536
             DF+GLW+GLLAAQASC ++ML+VL  TDW  +A+RAKELT     A +  ++++D 
Sbjct  465   DFEGLWMGLLAAQASCMVSMLVVLYLTDWEFEAQRAKELTSAGADAAVEKIEEEDK  520



>gb|KCW90739.1| hypothetical protein EUGRSUZ_A02813, partial [Eucalyptus grandis]
Length=465

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/419 (74%), Positives = 361/419 (86%), Gaps = 0/419 (0%)
 Frame = +1

Query  247   MISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSL  426
             MISMLFLG LG+L+LAGGSLA+GFANITGYSILSGLAMGMEPIC QAFGAK+  L+GLSL
Sbjct  1     MISMLFLGGLGELALAGGSLALGFANITGYSILSGLAMGMEPICSQAFGAKKHALLGLSL  60

Query  427   QRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRI  606
             QRT++LL+ TS+PI+ LW NM+RIL+   QD +I+ EAQSF+LY++PDL+A S+LHPLRI
Sbjct  61    QRTVLLLMLTSLPISFLWLNMKRILLFAGQDEDIATEAQSFLLYTIPDLLALSVLHPLRI  120

Query  607   YLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVL  786
             YLRSQS+TLPLTFCA  +++ HVPIN FLV  L LGIKGVAL  VW NFN+V SL++Y+L
Sbjct  121   YLRSQSITLPLTFCATLSVIFHVPINLFLVKHLGLGIKGVALGGVWTNFNLVASLIIYIL  180

Query  787   FSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVAS  966
              SGV+KKTWGG+S +CF+ +++LLNLAIPSC SVCLEWWWYE+MILLCGL  NPRATVAS
Sbjct  181   VSGVHKKTWGGLSSDCFREWRNLLNLAIPSCVSVCLEWWWYEIMILLCGLFLNPRATVAS  240

Query  967   MGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFG  1146
             MG+LIQTTSLIYIFPSSLSF VSTRVGNELGA RP +AKL+AIVGL   F+LGL+AL F 
Sbjct  241   MGILIQTTSLIYIFPSSLSFSVSTRVGNELGANRPLKAKLSAIVGLGCGFVLGLSALVFA  300

Query  1147  VAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLR  1326
             + VR  WA++FT D EIM LT+ VLPIIGLCELGNCPQTTGCG LRGTARPK+GA +NL 
Sbjct  301   ITVRKTWATMFTLDEEIMRLTSLVLPIIGLCELGNCPQTTGCGVLRGTARPKIGAHVNLG  360

Query  1327  CFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
             CFY VG+PV   L FF GF+FQGLWLGLLAAQASC +TML+VLG TDW  +ARRA+ELT
Sbjct  361   CFYVVGMPVGIGLAFFWGFNFQGLWLGLLAAQASCLVTMLVVLGFTDWEHEARRAEELT  419



>gb|EPS70572.1| hypothetical protein M569_04188, partial [Genlisea aurea]
Length=470

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/466 (67%), Positives = 383/466 (82%), Gaps = 0/466 (0%)
 Frame = +1

Query  106   LISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdl  285
             L S  +   E       +L L  +E+  ++ IA P+++T L LY RS+ISMLFLG LGDL
Sbjct  5     LHSPTSAAPETGKSVVGYLVLVVEESLALTRIAFPIVLTALFLYSRSLISMLFLGGLGDL  64

Query  286   slaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIP  465
              LAGG+LA+GFANITGYSILSGLA+GMEPICGQAFGAK++K +GL LQRT++LLL  SIP
Sbjct  65    PLAGGALAVGFANITGYSILSGLAVGMEPICGQAFGAKKYKRLGLCLQRTVLLLLLASIP  124

Query  466   IAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTF  645
             I++LW N+E IL+L +QD  ++ +AQ ++LYS+PDL+AQSLLHPLRIYLR+QS+ LPLTF
Sbjct  125   ISLLWINVETILVLFKQDESVAAQAQIYLLYSVPDLLAQSLLHPLRIYLRTQSINLPLTF  184

Query  646   CAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVS  825
             CAA +I +HV IN+FLV  L +GIKGVALS VW NFN+VGSL +YV+FS V++KT+GG+S
Sbjct  185   CAAGSIPLHVGINFFLVSKLGMGIKGVALSGVWTNFNIVGSLALYVVFSNVHEKTFGGLS  244

Query  826   WECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYI  1005
              E  +G+K+LLNL+IPSC SVCLEWWWYE+MILLCGLL NP+ TVASMG+LIQTT+LIYI
Sbjct  245   IEALRGWKTLLNLSIPSCISVCLEWWWYEIMILLCGLLLNPKVTVASMGILIQTTALIYI  304

Query  1006  FPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQ  1185
             FPSSLSF VSTRVGNE+GAGRP +AKLAA+VGL   F+LG +AL F  +VRNVWA +FT 
Sbjct  305   FPSSLSFSVSTRVGNEIGAGRPEKAKLAAMVGLSGGFLLGFSALLFAFSVRNVWAKMFTH  364

Query  1186  DAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWL  1365
             DAEI+ALT+ VLPIIGLCE+GNCPQTTGCG LRGTARPK+GA INL CFY +G+PVA  L
Sbjct  365   DAEIIALTSLVLPIIGLCEIGNCPQTTGCGVLRGTARPKIGANINLACFYLIGMPVAVGL  424

Query  1366  GFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
               F   DF+G W+GLLAAQ SC +TM+ VL RTDW  +A+RA+++T
Sbjct  425   ALFHRMDFEGFWIGLLAAQTSCMVTMMWVLLRTDWELEAQRAEQIT  470



>emb|CDY41255.1| BnaA01g12840D [Brassica napus]
Length=512

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/476 (66%), Positives = 381/476 (80%), Gaps = 4/476 (1%)
 Frame = +1

Query  94    MEAPLI---SEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLF  264
             M APLI     ++ ++ + N N T LS + +EAK I+ I+LP+I+TGLLLY RSMISMLF
Sbjct  1     MAAPLILKYHRDHQQDPNPNPNPTRLSSSIQEAKSIAKISLPIILTGLLLYSRSMISMLF  60

Query  265   lgrlgdlslaggslaig-FANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIV  441
             LGRL DL    G      FANITGYS+LSGL+ GMEPIC QAFGAKRFKL+GL+LQRTI+
Sbjct  61    LGRLNDLPSLSGGSLALGFANITGYSLLSGLSTGMEPICVQAFGAKRFKLLGLALQRTIL  120

Query  442   LLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQ  621
             LLL  S+P++ILW N++ IL+   QD+EIS +A+ FIL+SLPDL  QS LHPLRIYLRSQ
Sbjct  121   LLLLCSLPVSILWLNIKNILLFFGQDQEISDKAEIFILFSLPDLFLQSFLHPLRIYLRSQ  180

Query  622   SVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVY  801
             S+TLPLT+ A FA+++H+PINY LV    LG+KGVAL ++W N N++G L++Y++FSGVY
Sbjct  181   SITLPLTYSAFFAVLLHIPINYLLVSSFGLGLKGVALGAIWSNVNLLGFLIIYIVFSGVY  240

Query  802   KKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLI  981
             +KTWGG S +CFKG++SLL LAIPSC SVCLEWWWYE+MILLCGLL +P+ATVASMG+LI
Sbjct  241   EKTWGGFSMDCFKGWRSLLTLAIPSCVSVCLEWWWYEIMILLCGLLLHPQATVASMGILI  300

Query  982   QTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRN  1161
             QTT+LIYIFPSSLSF VSTRVGNELGA +P +A++AA  GL  S  LG  A+ F   VRN
Sbjct  301   QTTALIYIFPSSLSFSVSTRVGNELGANQPDKARIAARTGLFLSLGLGFFAMFFAFMVRN  360

Query  1162  VWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFV  1341
              WA +FT + EI+ LT+ VLPIIGLCELGNCPQTT CG LRG+ARPKLGA INL CFYFV
Sbjct  361   CWARLFTDEEEILKLTSMVLPIIGLCELGNCPQTTMCGVLRGSARPKLGANINLCCFYFV  420

Query  1342  GLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTAT  1509
             G+PVA WL FF GFDF+GLWLGL AAQ SC ++ML+VL +TDW  +  RAKEL ++
Sbjct  421   GMPVAIWLSFFGGFDFKGLWLGLFAAQGSCLVSMLVVLAKTDWEAEVHRAKELMSS  476



>ref|XP_009136646.1| PREDICTED: MATE efflux family protein 5 [Brassica rapa]
Length=510

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/474 (67%), Positives = 388/474 (82%), Gaps = 2/474 (0%)
 Frame = +1

Query  94    MEAPLISE-ENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlg  270
             M APLI +     ++D N N T LS + +EAK I+ I+LP+I+TGLLLY RSMISMLFLG
Sbjct  1     MAAPLILKYHKDHQQDPNPNPTRLSSSIQEAKSIAKISLPIILTGLLLYSRSMISMLFLG  60

Query  271   rlgdl-slaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLL  447
             RL DL +L+GGSLA+GFAN TGYS+LSGL+ GMEPIC QAFGAKRFKL+GL+LQRTI+LL
Sbjct  61    RLNDLPALSGGSLALGFANNTGYSLLSGLSTGMEPICVQAFGAKRFKLLGLALQRTILLL  120

Query  448   LFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSV  627
             L  S+P++ILW N++ IL+   QD+EIS +A+ FIL+SLPDL  QS LHPLRIYLRSQS+
Sbjct  121   LLCSLPVSILWLNIKNILLFFGQDQEISDKAEIFILFSLPDLFLQSFLHPLRIYLRSQSI  180

Query  628   TLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKK  807
             TLPLT+ A FA+++H+PINY LV    LG+KGVAL ++W N N++G L++Y++FSGVY+K
Sbjct  181   TLPLTYSAFFAVLLHIPINYLLVSSFGLGLKGVALGAIWSNVNLLGFLIIYIVFSGVYEK  240

Query  808   TWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQT  987
             TWGG S +CFKG++SLL LAIPSC SVCLEWWWYE+MILLCGLL +P+ATVASMG+LIQT
Sbjct  241   TWGGFSMDCFKGWRSLLTLAIPSCVSVCLEWWWYEIMILLCGLLLHPQATVASMGILIQT  300

Query  988   TSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVW  1167
             T+LIYIFPSSLSF VSTRVGNELGA +P +A++AA  GL  S  LG  A+ F   VRN W
Sbjct  301   TALIYIFPSSLSFSVSTRVGNELGANQPDKARIAARTGLFLSLGLGFFAMFFAFMVRNCW  360

Query  1168  ASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGL  1347
             A +FT + EI+ LT+ VLPIIGLCELGNCPQTT CG LRG+ARPKLGA INL CFYFVG+
Sbjct  361   ARLFTDEEEILKLTSTVLPIIGLCELGNCPQTTMCGVLRGSARPKLGANINLCCFYFVGM  420

Query  1348  PVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTAT  1509
             PVA WL FF GFDF+GLWLGL AAQ SC ++ML+VL +TDW  +  RAKEL ++
Sbjct  421   PVAIWLSFFGGFDFKGLWLGLFAAQGSCLVSMLVVLAKTDWEAEVHRAKELMSS  474



>gb|KFK28869.1| hypothetical protein AALP_AA7G059000 [Arabis alpina]
Length=510

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/484 (67%), Positives = 392/484 (81%), Gaps = 2/484 (0%)
 Frame = +1

Query  94    MEAPLI-SEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlg  270
             M  PLI   +    +D N NQTHLS + +EAK I+ I+ PMI+TGLLLY RSMISMLFLG
Sbjct  1     MATPLILKNQTDHRQDPNLNQTHLSTSIQEAKSIAKISFPMILTGLLLYSRSMISMLFLG  60

Query  271   rlgdlslaggslaig-FANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLL  447
             RL DLS   G      FANITGYS+LSGL++GMEPIC QAFGAKRFKL+GL+LQRT +LL
Sbjct  61    RLNDLSALSGGSLALGFANITGYSLLSGLSIGMEPICVQAFGAKRFKLLGLALQRTTLLL  120

Query  448   LFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSV  627
             L  S+PI++LW N++ IL+   QD+EIS +A+ FIL+SLPDLI QS LHPLRIYLRSQS+
Sbjct  121   LLCSLPISLLWLNIKNILLFFGQDQEISNQAEIFILFSLPDLILQSFLHPLRIYLRSQSI  180

Query  628   TLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKK  807
             TLPLT+ A FA+++H+PINY LV  L LG+KGVAL ++W N N++G L++YV+FSG+Y+K
Sbjct  181   TLPLTYSAFFAVILHIPINYLLVCYLGLGLKGVALGAIWTNVNLLGFLIIYVVFSGLYEK  240

Query  808   TWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQT  987
             TWGG+S +CFKG++SL+ LAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQT
Sbjct  241   TWGGLSMDCFKGWRSLMKLAIPSCVSVCLEWWWYEIMILLCGLLLNPQATVASMGILIQT  300

Query  988   TSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVW  1167
             T+LIYIFPS+LSF VSTRVGNELGA RP +A++AA  GLC S  LGL A+ F + VRN W
Sbjct  301   TALIYIFPSTLSFSVSTRVGNELGANRPDKARIAARTGLCLSLGLGLFAMFFALMVRNCW  360

Query  1168  ASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGL  1347
             A +FT + EI+ LT+ VLPIIGLCELGNCPQTT CG LRG+ARPKLGA INL CFYFVG+
Sbjct  361   AKLFTNEEEIVKLTSMVLPIIGLCELGNCPQTTMCGVLRGSARPKLGANINLCCFYFVGM  420

Query  1348  PVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDD  1527
             PVA WL FF+GFDF+GLWLGL AAQ SC ++ML+VL +TDW  + RRAKEL +  S   D
Sbjct  421   PVAIWLSFFSGFDFKGLWLGLFAAQGSCLVSMLVVLAKTDWEVEVRRAKELMSGSSCDGD  480

Query  1528  DDDD  1539
              ++D
Sbjct  481   SEED  484



>ref|XP_010529544.1| PREDICTED: MATE efflux family protein 5 [Tarenaya hassleriana]
Length=494

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/474 (69%), Positives = 386/474 (81%), Gaps = 2/474 (0%)
 Frame = +1

Query  94    MEAPLI-SEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlg  270
             M A LI   +    +D N   THL  + +EAK I+ I+LPMI+TGLL+Y RSMISMLFLG
Sbjct  1     MAASLILKNQTDHRKDPNPTPTHLLSSIQEAKSIAKISLPMILTGLLIYSRSMISMLFLG  60

Query  271   rlgdlslaggslaig-FANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLL  447
             RLGDLS   G      FANITGYS+LSGLAMGMEPICGQAFGAKRFKL+GL+LQRT +LL
Sbjct  61    RLGDLSALAGGSLALGFANITGYSVLSGLAMGMEPICGQAFGAKRFKLLGLALQRTTLLL  120

Query  448   LFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSV  627
             L  S+PI++LW NM++IL+   Q+ +I+ +A+ FIL+SLPDL  QS LHPLRIYLR+QS+
Sbjct  121   LLCSLPISLLWLNMKKILVFFGQEDDIASKAEIFILFSLPDLFLQSFLHPLRIYLRTQSI  180

Query  628   TLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKK  807
             TLPLT+ A FA+++HVPINY LVV L LG+KGVAL+ VW NFN+VG L+++V+FSGVY+K
Sbjct  181   TLPLTYSAFFAVLLHVPINYLLVVFLGLGLKGVALAVVWSNFNLVGFLIIFVVFSGVYEK  240

Query  808   TWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQT  987
             TW G+S +C KG++SLLNLAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQT
Sbjct  241   TWCGISSDCLKGWRSLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPQATVASMGILIQT  300

Query  988   TSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVW  1167
             T+LIYIFPSSL FGVSTRVGNELGA +P +AK +A  GL  S + G +AL F   VRNVW
Sbjct  301   TALIYIFPSSLGFGVSTRVGNELGANQPEKAKTSARTGLYMSIVFGFSALFFTSLVRNVW  360

Query  1168  ASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGL  1347
             A +FT D EI++LTAAVLPIIGLCELGNCPQTTGCG LRG+ARPKLGA INL CFYFVG+
Sbjct  361   AKLFTDDGEIISLTAAVLPIIGLCELGNCPQTTGCGVLRGSARPKLGANINLCCFYFVGM  420

Query  1348  PVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTAT  1509
             PVA WL FF GFDF+GLWLGLLAAQ SC + ML+ L RTDW  Q  RAKELT +
Sbjct  421   PVAVWLSFFGGFDFKGLWLGLLAAQGSCLVAMLIALARTDWEVQVHRAKELTMS  474



>emb|CDY53130.1| BnaC01g41400D [Brassica napus]
Length=508

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/473 (65%), Positives = 379/473 (80%), Gaps = 2/473 (0%)
 Frame = +1

Query  94    MEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgr  273
             M APLI + +  +   + N T L  + +EAK I+ I+LP+I+TGLLLY RSMISMLFLGR
Sbjct  1     MAAPLILKYH-IDHQQDPNPTRLFSSIQEAKSIAKISLPIILTGLLLYSRSMISMLFLGR  59

Query  274   lgdlslaggslaig-FANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLL  450
             L DL    G      FANITGYS+LSGL+ GMEPIC QAFGAKRFKL+GL+LQRTI+LLL
Sbjct  60    LNDLPALSGGSLALGFANITGYSLLSGLSTGMEPICVQAFGAKRFKLLGLALQRTILLLL  119

Query  451   FTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVT  630
               S+P++ILW N+++IL+   QD+EIS +A+ FIL+SLPDL  QS LHPLRIYLRSQS+T
Sbjct  120   LCSLPVSILWLNIKKILLYFGQDQEISDKAEIFILFSLPDLFLQSFLHPLRIYLRSQSIT  179

Query  631   LPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKT  810
             LPLT+ A FA+++H+PINY LV    LG+KGVAL ++W N N++G L++Y++FSGVY+KT
Sbjct  180   LPLTYSAFFAVLLHIPINYILVSYFALGLKGVALGAIWSNVNLLGFLIIYIVFSGVYEKT  239

Query  811   WGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTT  990
             WGG S +CF+G++SLL LAIPSC SVCLEWWWYE+MILLCGLL +P+ATV+SMG+LIQTT
Sbjct  240   WGGFSMDCFEGWRSLLTLAIPSCVSVCLEWWWYEIMILLCGLLLHPQATVSSMGILIQTT  299

Query  991   SLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWA  1170
             +LIYIFPSSLSF VSTRVGNELGA +P +A++AA  GL  S  LGL A+ F   VRN WA
Sbjct  300   ALIYIFPSSLSFSVSTRVGNELGANQPNKARIAARTGLFLSLGLGLFAMFFAFMVRNCWA  359

Query  1171  SIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLP  1350
              +FT + EI+ LT+ VLPIIGLCELGNCPQTT CG LRG+ARPKLGA INL CFYFVG+P
Sbjct  360   RLFTDEEEILKLTSMVLPIIGLCELGNCPQTTMCGVLRGSARPKLGANINLCCFYFVGMP  419

Query  1351  VAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTAT  1509
             VA WL FF GFDF+GLWLGL AAQ SC ++ML+VL +TDW  +  RAKEL  +
Sbjct  420   VAIWLSFFGGFDFKGLWLGLFAAQGSCLVSMLVVLAKTDWEAEVHRAKELMTS  472



>ref|XP_006413586.1| hypothetical protein EUTSA_v10024949mg [Eutrema salsugineum]
 gb|ESQ55039.1| hypothetical protein EUTSA_v10024949mg [Eutrema salsugineum]
Length=512

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/471 (68%), Positives = 385/471 (82%), Gaps = 2/471 (0%)
 Frame = +1

Query  94    MEAPLI-SEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlg  270
             M APLI   +    +D N N THLS + KEAK I+ ++LPM++TGLLLY RSMISMLFLG
Sbjct  1     MAAPLIIKNQTDHRQDPNLNLTHLSSSIKEAKSIAKLSLPMVLTGLLLYSRSMISMLFLG  60

Query  271   rlgdlslaggslaig-FANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLL  447
             RL DLS   G      FANITGYS+LSGL++GMEPIC QAFGAKRFKL+GL+LQRT +LL
Sbjct  61    RLNDLSALSGGSLALGFANITGYSLLSGLSIGMEPICVQAFGAKRFKLLGLALQRTTLLL  120

Query  448   LFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSV  627
             L  S+PI+ILW N++ IL+   QD EIS +A+ FIL+SLPDLI QS LHPLRIYLRSQS+
Sbjct  121   LLCSLPISILWLNIKEILLFVGQDEEISNQAEIFILFSLPDLILQSFLHPLRIYLRSQSI  180

Query  628   TLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKK  807
             TLPLT+ A FA+++H+PINY LV  L LG+KGVAL ++W N N++G L++YV+FSGVYKK
Sbjct  181   TLPLTYSAFFAVILHIPINYLLVSSLGLGLKGVALGAIWTNVNLLGFLIIYVVFSGVYKK  240

Query  808   TWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQT  987
             TWGG S +CF G++SL+ LAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQT
Sbjct  241   TWGGFSMDCFNGWRSLMKLAIPSCVSVCLEWWWYEIMILLCGLLLNPQATVASMGILIQT  300

Query  988   TSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVW  1167
             T+LIYIFPSSLS  VSTRVGNELGA +PG+A++AA +GLC S  LGL A+ F + VRN W
Sbjct  301   TALIYIFPSSLSISVSTRVGNELGANQPGKARIAARIGLCLSLGLGLVAMFFALMVRNCW  360

Query  1168  ASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGL  1347
             A +FT + EI+ LT+ VLPIIGLCELGNCPQTT CG LRG+ARPKLGA INL CFYFVG+
Sbjct  361   ARLFTHEVEILKLTSMVLPIIGLCELGNCPQTTMCGVLRGSARPKLGANINLCCFYFVGM  420

Query  1348  PVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKEL  1500
             PVA WL FF+GFDF+GLWLGL AAQ SC ++ML+VL +TDW+ +  RAK+L
Sbjct  421   PVAIWLSFFSGFDFKGLWLGLFAAQGSCLVSMLVVLAKTDWDFEVHRAKDL  471



>ref|XP_006284940.1| hypothetical protein CARUB_v10006239mg [Capsella rubella]
 gb|EOA17838.1| hypothetical protein CARUB_v10006239mg [Capsella rubella]
Length=509

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/483 (66%), Positives = 384/483 (80%), Gaps = 2/483 (0%)
 Frame = +1

Query  94    MEAPLISEEN-PKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlg  270
             M APLI + +    +D N +Q HLS   +EAK I+ I+LPMI+TGLLLY RSMISMLFLG
Sbjct  1     MAAPLIIKNHIDHRQDPNPDQNHLSSLIQEAKSIAKISLPMILTGLLLYSRSMISMLFLG  60

Query  271   rlgdlslaggslaig-FANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLL  447
             RL DLS   G      FANITGYS+LSGL++GMEPIC QAFGAKRFKL+GL+LQRT +LL
Sbjct  61    RLNDLSALSGGSLALGFANITGYSLLSGLSIGMEPICVQAFGAKRFKLLGLALQRTTLLL  120

Query  448   LFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSV  627
             L  S+PI+ILW N+++IL+   QD EIS +A+ FIL+SLPDLI QS LHP+RIYLRSQS+
Sbjct  121   LLCSLPISILWLNIKKILLFFGQDEEISNQAEIFILFSLPDLILQSFLHPIRIYLRSQSI  180

Query  628   TLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKK  807
             TLPLT+ A FA+++H+PINY LV  L LG+KGVAL ++W N N++G L++Y++FSGVY K
Sbjct  181   TLPLTYSAFFAVLLHIPINYLLVSSLGLGLKGVALGAIWTNVNLLGFLIIYIVFSGVYDK  240

Query  808   TWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQT  987
             TWGG S +CF+G+ SL+ LAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQT
Sbjct  241   TWGGFSMDCFRGWGSLMKLAIPSCVSVCLEWWWYEIMILLCGLLLNPQATVASMGILIQT  300

Query  988   TSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVW  1167
             T+LIYIFPSSLS  VSTRVGNELGA +P +A++AA  GL  S  LGL A+ F   VRN W
Sbjct  301   TALIYIFPSSLSISVSTRVGNELGANQPDKARIAARTGLGLSLGLGLFAMFFAFMVRNCW  360

Query  1168  ASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGL  1347
             A +FT + EI+ LT+ VLPIIGLCELGNCPQTT CG LRG+ARPKLGA INL CFYFVG+
Sbjct  361   ARLFTDEEEILKLTSMVLPIIGLCELGNCPQTTVCGVLRGSARPKLGANINLCCFYFVGM  420

Query  1348  PVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDD  1527
             PVA WL FF G+DF GLWLGL AAQ+SC ++ML+VL RTDW  +  RAKEL       ++
Sbjct  421   PVAIWLSFFNGYDFTGLWLGLFAAQSSCLVSMLVVLARTDWEVEVDRAKELMTRSCDGEE  480

Query  1528  DDD  1536
             +DD
Sbjct  481   EDD  483



>ref|XP_010933890.1| PREDICTED: MATE efflux family protein 5-like [Elaeis guineensis]
Length=550

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/508 (64%), Positives = 385/508 (76%), Gaps = 29/508 (6%)
 Frame = +1

Query  76    SACKEKMEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMIS  255
             +A     +AP+++ + P E         L+LA  EA+ I  +ALPM +TGLL+Y RSMIS
Sbjct  35    TATNPSEDAPVLTPKPPTE---------LALAFVEARSILSLALPMALTGLLIYSRSMIS  85

Query  256   MLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRT  435
             MLFLGRLG L LAGGSLAIGFANITGYS+LSGLAMGMEPICGQAFGAK+  ++GL+LQRT
Sbjct  86    MLFLGRLGGLPLAGGSLAIGFANITGYSVLSGLAMGMEPICGQAFGAKKLPILGLALQRT  145

Query  436   IVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLR  615
             I+LLL  SIPIA +W NM  +L+LC QD +IS  AQS+IL+SLPDL  QS LHPLRIYLR
Sbjct  146   ILLLLSASIPIAFIWANMRPLLLLCGQDADISAAAQSYILFSLPDLFLQSFLHPLRIYLR  205

Query  616   SQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSG  795
             SQS+TLPLT+ A  A ++H+PINY LV +  LGI GVAL+SVW N N++  L+ Y+  SG
Sbjct  206   SQSITLPLTYAATIAALLHLPINYLLVSIFRLGIPGVALASVWTNLNLLLLLLAYLYLSG  265

Query  796   VYKKTWGGV-SWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMG  972
             V K T G + S E F+ + SLLNLA+PSC SVCLEWWWYE+MILLCGLL NP++TVASMG
Sbjct  266   VSKSTGGIIPSAESFRCWSSLLNLALPSCVSVCLEWWWYEIMILLCGLLLNPKSTVASMG  325

Query  973   VLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVA  1152
             +LIQTTSLIYIFPSSLSFGVSTRVGNELGA RP RA+ AA VGL +SF+LGL AL+F V+
Sbjct  326   ILIQTTSLIYIFPSSLSFGVSTRVGNELGANRPDRARRAAFVGLSSSFLLGLFALSFAVS  385

Query  1153  VRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCF  1332
             VR+VW+ +FT D  I  LT +VLPI+G+CELGNCPQTTGCG LRG+ARP+ GA INL  F
Sbjct  386   VRHVWSRMFTADPAIAVLTTSVLPILGMCELGNCPQTTGCGVLRGSARPRAGANINLGSF  445

Query  1333  YFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTAT-  1509
             YFVG PVA  L F+ G DF+GLWLGLLAAQA+C L ML V+ RTDW+ QA RAK LT   
Sbjct  446   YFVGTPVAVALAFWGGLDFKGLWLGLLAAQAACVLLMLAVIHRTDWDLQAERAKRLTGAG  505

Query  1510  ------------------ISLVDDDDDD  1539
                                S VDDD+D+
Sbjct  506   ILNGDLDEPAQKQTQKLKASTVDDDEDE  533



>ref|XP_009401759.1| PREDICTED: MATE efflux family protein 5 [Musa acuminata subsp. 
malaccensis]
Length=539

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/493 (63%), Positives = 384/493 (78%), Gaps = 14/493 (3%)
 Frame = +1

Query  94    MEAPLISEENPKEEDHNHNQT---------HLSLAAKEAKCISDIALPMIVTGLLLYCRS  246
             + AP + E +P +     +            +SLA  E K I  +ALPM++TGLLL+CRS
Sbjct  26    LTAPFVVETSPTKNQAEVSSPPAPTLKPLGSVSLAFVEGKSILSLALPMVLTGLLLHCRS  85

Query  247   MISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSL  426
             M+SMLFLGRLGDL+LAGGSLAIGFANITGYS+LSGLAMGMEPICGQAFGA+R+ L+GL+L
Sbjct  86    MVSMLFLGRLGDLALAGGSLAIGFANITGYSVLSGLAMGMEPICGQAFGARRYHLLGLAL  145

Query  427   QRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRI  606
              RT++LLL  SIPIA+LW  +  +L+L  Q+  ++  A S++   LPDLI QS LHPLRI
Sbjct  146   HRTVLLLLSVSIPIALLWYYIRPLLLLLGQEPALAAAASSYLHACLPDLILQSFLHPLRI  205

Query  607   YLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVL  786
             YLR+QS+TLPLT CA  A+ +H+PINY  V VL+LGI GVAL+SV  NFNVV  L+VY+ 
Sbjct  206   YLRTQSITLPLTLCAGLAVGLHLPINYLFVSVLHLGIGGVALASVLFNFNVVLFLLVYIY  265

Query  787   FSGVYKKTWGGVSW--ECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATV  960
             FSG+ + T GG+S+  ECFKG+ SLLNLAIPSC SVCLEWWWYE+MI+LCGLL NP+ATV
Sbjct  266   FSGINRST-GGLSFSSECFKGWSSLLNLAIPSCISVCLEWWWYEIMIILCGLLLNPKATV  324

Query  961   ASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALT  1140
             ASMG+LIQTTSL+YIFPSSLSFGVSTRVGNELGA RP RA+ AA VGL  SF+LGL A +
Sbjct  325   ASMGILIQTTSLVYIFPSSLSFGVSTRVGNELGANRPDRARRAATVGLSCSFVLGLLAFS  384

Query  1141  FGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKIN  1320
             F  +VR++WA +FT D+ I+ LTA+VLPI+GLCELGNCPQTTGCG LRG+ARPKLGA IN
Sbjct  385   FAFSVRHLWARMFTGDSTILELTASVLPILGLCELGNCPQTTGCGVLRGSARPKLGANIN  444

Query  1321  LRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKEL  1500
             L  FY VG+PVA  L F+   DF GLWLGLL+AQA+C + ML+V+ RT W  QA RA++L
Sbjct  445   LGSFYVVGMPVAVGLAFWTSLDFSGLWLGLLSAQATCVVLMLVVIERTHWESQAERAQQL  504

Query  1501  TATISLVDDDDDD  1539
             T   +  DD + +
Sbjct  505   TGAAT--DDTEKE  515



>ref|XP_009389312.1| PREDICTED: MATE efflux family protein LAL5-like [Musa acuminata 
subsp. malaccensis]
Length=539

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/506 (62%), Positives = 389/506 (77%), Gaps = 14/506 (3%)
 Frame = +1

Query  25    RQSNTKNPLFFLPFAFISACKEKMEA--PLISEENPKEEDHNHNQTHLSLAAKEAKCISD  198
             R  +  NP  FL F F+   ++ +    P++  + P           ++LA  EAK I  
Sbjct  14    RCDHHHNPHGFLTFPFVVDVQKPLTTVPPVLQPKPPNS---------VTLALIEAKSILS  64

Query  199   IALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPIC  378
             +ALPM++TGLLLY RSMISMLFLGRLGDL LAGG+LAIGFANITGYS+LSGLAMGMEPIC
Sbjct  65    LALPMVLTGLLLYSRSMISMLFLGRLGDLPLAGGALAIGFANITGYSVLSGLAMGMEPIC  124

Query  379   GQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILY  558
             GQAFGA+R +L+GL+L RT++LLLF S+PIA+LW  +  IL+L  QD  ++  A +++  
Sbjct  125   GQAFGAQRHRLLGLALHRTVLLLLFASLPIALLWFYIRPILLLLGQDPALAAAASAYLHA  184

Query  559   SLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSS  738
             SLPDL+ QS LHPLRIYLR+QS+TLPLT CAA ++ +H+PI+Y LV VL LGI GVAL+S
Sbjct  185   SLPDLLLQSFLHPLRIYLRTQSITLPLTACAAISVALHLPISYLLVSVLRLGIGGVALAS  244

Query  739   VWCNFNVVGSLVVYVLFSGVYKKTWGGVSW--ECFKGYKSLLNLAIPSCASVCLEWWWYE  912
             VW N N+V  LV Y+  S +++ T GG+S+  ECF+ ++ LLNLA+PSC SVCLEWWWYE
Sbjct  245   VWTNVNLVLFLVAYIYLSDLHRST-GGLSFSTECFRDWRPLLNLAVPSCVSVCLEWWWYE  303

Query  913   LMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAA  1092
             +MI+LCGLL NP+ATVASMG+LIQTTSLIYIFPSSLSFGVSTRVGNELGA RP RA+ AA
Sbjct  304   IMIILCGLLLNPQATVASMGILIQTTSLIYIFPSSLSFGVSTRVGNELGANRPDRARRAA  363

Query  1093  IVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGC  1272
              VGL  SF LGL A  F V+VR+ WA++FT D+ I+ LT++VLPI+GLCE GNCPQTTGC
Sbjct  364   TVGLSCSFALGLFAFCFSVSVRHAWATMFTADSAILGLTSSVLPILGLCEFGNCPQTTGC  423

Query  1273  GALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLV  1452
             G LRG+ARP +GA +NL  FY VG+PVA  L FF G DF+GLWLGLLAAQ +C L MLLV
Sbjct  424   GVLRGSARPSVGANVNLGSFYAVGMPVAVGLAFFTGLDFKGLWLGLLAAQTTCVLLMLLV  483

Query  1453  LGRTDWNDQARRAKELTATISLVDDD  1530
             + RTDW  QA RA++LT  +S   +D
Sbjct  484   IKRTDWITQAERAQQLTGAVSGAVND  509



>ref|XP_010693502.1| PREDICTED: MATE efflux family protein 9-like [Beta vulgaris subsp. 
vulgaris]
Length=576

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/466 (70%), Positives = 385/466 (83%), Gaps = 4/466 (1%)
 Frame = +1

Query  154   THLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITG  333
             T+L    +EAK  SDIALPMI+TGLLLY RSMISMLFLGRLG+L+LAGGSLAIGFANITG
Sbjct  100   TNLVPYLREAKLTSDIALPMILTGLLLYSRSMISMLFLGRLGELALAGGSLAIGFANITG  159

Query  334   YSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCR  513
             YSILSGLAMGMEPICGQAFGAK+  L+G++LQRTI+LLL TS+PI+ LW NM+++L+LCR
Sbjct  160   YSILSGLAMGMEPICGQAFGAKKHSLLGVTLQRTILLLLLTSLPISFLWLNMDKLLLLCR  219

Query  514   QDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFL  693
             QD  I+ +AQ++++Y+LPDL+AQS+LHPLRIYLR+QS+TLPLTF AA AI +H+P+N+ L
Sbjct  220   QDSAIAAQAQAYLIYTLPDLLAQSILHPLRIYLRTQSITLPLTFTAALAIALHLPLNWLL  279

Query  694   VVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIP  873
             VV L LG+KGVAL+ V  N+N++  L +Y+LFS   K+ W  +S +C +GY SLL LAIP
Sbjct  280   VVKLKLGLKGVALAGVLTNYNMIIFLFIYILFSKSCKQGWAPLSKDCLQGYTSLLQLAIP  339

Query  874   SCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNE  1053
             SC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTTSLIYIFPSSLS  VSTRVGNE
Sbjct  340   SCISVCLEWWWYEIMILLCGLLVNPKATVASMGILIQTTSLIYIFPSSLSVTVSTRVGNE  399

Query  1054  LGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIG  1233
             LGA RP RAK AAI GL  SFI G +AL F   VR+ WA +FT+D +I+ LT+ VLPIIG
Sbjct  400   LGASRPIRAKRAAITGLFFSFIFGFSALFFTFIVRDKWAGMFTKDGDIIRLTSLVLPIIG  459

Query  1234  LCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgll  1413
             LCELGNCPQTTGCG LRGTARPK+GA INL CFY VG+PVA W GFFAGFDFQGLWLGLL
Sbjct  460   LCELGNCPQTTGCGVLRGTARPKVGANINLACFYLVGMPVALWFGFFAGFDFQGLWLGLL  519

Query  1414  aaqaSCALTMLLVLGRTDWNDQARRAKELTATIS----LVDDDDDD  1539
             AAQASC +TM+LV   T+W  +A+RAK+LT   S    L+  DD  
Sbjct  520   AAQASCVVTMMLVFSTTNWEFEAQRAKDLTHHSSPPLILIQQDDKQ  565



>ref|XP_003615399.1| Multidrug and toxin extrusion protein [Medicago truncatula]
 gb|AES98357.1| MATE efflux family protein [Medicago truncatula]
Length=560

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/495 (59%), Positives = 377/495 (76%), Gaps = 7/495 (1%)
 Frame = +1

Query  70    FISACKEKMEAPLISE---ENPKEEDHNHNQTH----LSLAAKEAKCISDIALPMIVTGL  228
             F+S  K  +  P   +    +  ++DH  ++ H    L  A  E K I  I+ P  +TGL
Sbjct  13    FLSPTKTHLINPHTKDPYSNSTLDDDHVQDELHRWPTLKEAITEIKEIGKISGPTTITGL  72

Query  229   LLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFK  408
             LLY R+MISM+FLG LG++ LAGGSL+IGFANITGYS++SGLAMGMEPICGQA+GAK++K
Sbjct  73    LLYSRAMISMIFLGYLGEMELAGGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQWK  132

Query  409   LMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSL  588
             ++GL+LQRT++LLL TSIPI+ +W NM+RIL+   QD EIS  AQSFIL+ +PDL   S+
Sbjct  133   ILGLTLQRTVLLLLSTSIPISFIWINMKRILLFSGQDLEISSMAQSFILFLVPDLFLLSI  192

Query  589   LHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGS  768
             LHPLRIYLR+Q +TLPLT+C+A ++++H+P+N+ LVV   +GI GV+++ V  N N+V  
Sbjct  193   LHPLRIYLRTQGITLPLTYCSAVSVLLHIPLNFLLVVHFQMGIAGVSIAMVLTNLNLVIL  252

Query  769   LVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANP  948
             L  ++ FS VYKK+W   S +C KG+ SLL+LAIP+C SVCLEWWWYE MI++CGLL NP
Sbjct  253   LSSFLYFSSVYKKSWISPSLDCIKGWSSLLSLAIPTCVSVCLEWWWYEFMIMMCGLLVNP  312

Query  949   RATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGL  1128
             +AT+ASMG+LIQTTSL+Y+FPSSLS GVSTR+GNELGA RP +A+++ IV L  + +LGL
Sbjct  313   KATIASMGILIQTTSLVYVFPSSLSLGVSTRIGNELGANRPQKARISMIVSLFLAMVLGL  372

Query  1129  AALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLG  1308
              A+ F   +RN W   FT D EI+ LT+ VLPI+GLCELGNCPQTTGCG LRG+ARP +G
Sbjct  373   GAMLFTTLMRNQWGKFFTNDREILELTSIVLPIVGLCELGNCPQTTGCGVLRGSARPTIG  432

Query  1309  AKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARR  1488
             A INL  FY VG+PVA +LGF A   F GLW+GLLAAQ SCA+ ML+VL RTDWN Q +R
Sbjct  433   ANINLGSFYLVGMPVAIFLGFVAKLGFPGLWIGLLAAQGSCAMLMLVVLCRTDWNLQVQR  492

Query  1489  AKELTATISLVDDDD  1533
             AKELT + +  DD D
Sbjct  493   AKELTKSSTTSDDVD  507



>ref|XP_010448784.1| PREDICTED: MATE efflux family protein LAL5-like [Camelina sativa]
Length=506

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/483 (66%), Positives = 382/483 (79%), Gaps = 2/483 (0%)
 Frame = +1

Query  94    MEAPLI-SEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlg  270
             M APLI   +    +D N N  HLS   +EAK I+ I+LPMI+TGLLLY RSMISMLFLG
Sbjct  1     MAAPLIIKNQTDHRQDPNPNPNHLSSLIQEAKSIAKISLPMILTGLLLYSRSMISMLFLG  60

Query  271   rlgdlslaggslaig-FANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLL  447
             RL DLS   G      FANITGYS+LSGL++GMEPIC QAFGAKRFKL+GL+LQRT +LL
Sbjct  61    RLNDLSALSGGSLALGFANITGYSLLSGLSIGMEPICVQAFGAKRFKLLGLALQRTTLLL  120

Query  448   LFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSV  627
             L  S+PI++LW N+++IL+   QD EIS +A+ FIL+SLPDLI QS LHP+RIYLRSQS+
Sbjct  121   LLCSLPISLLWLNIKKILLFFGQDEEISNQAEIFILFSLPDLILQSFLHPIRIYLRSQSI  180

Query  628   TLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKK  807
             TLPLT+ A FA+++H+PINY LV  L LG+KGVAL ++W N N++G L++Y++FSGVY K
Sbjct  181   TLPLTYSAFFAVLLHIPINYLLVSSLGLGLKGVALGAIWTNVNLLGFLIIYIVFSGVYDK  240

Query  808   TWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQT  987
             TWGG S +CFKG++SL+ LAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQT
Sbjct  241   TWGGFSMDCFKGWRSLMKLAIPSCVSVCLEWWWYEIMILLCGLLLNPQATVASMGILIQT  300

Query  988   TSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVW  1167
             T+LIYIFPSSLS  VSTRVGNELGA +P +A++AA  GL  S  LGL A+ F   VRN W
Sbjct  301   TALIYIFPSSLSVSVSTRVGNELGANQPDKARIAARTGLGLSLGLGLFAMFFAFMVRNCW  360

Query  1168  ASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGL  1347
             A +FT + EI+ LT+ VLPIIGLCELGNCPQTT CG LRG+ARPKLGA INL CFYFVG+
Sbjct  361   ARLFTDEEEIVKLTSMVLPIIGLCELGNCPQTTVCGVLRGSARPKLGANINLCCFYFVGM  420

Query  1348  PVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDD  1527
             PVA WL FF+GFDF+GLWLGL AAQ SC ++ML+VL  TDW  +  RAKEL       +D
Sbjct  421   PVAIWLSFFSGFDFKGLWLGLFAAQGSCLVSMLVVLATTDWEVEVHRAKELMTRSCDGED  480

Query  1528  DDD  1536
             D +
Sbjct  481   DGN  483



>ref|NP_194034.1| MATE efflux family protein [Arabidopsis thaliana]
 emb|CAA19819.1| putative protein [Arabidopsis thaliana]
 emb|CAB79258.1| putative protein [Arabidopsis thaliana]
 gb|AAM03451.1| putative transporter NIC1 [Arabidopsis thaliana]
 gb|AEE84697.1| MATE efflux family protein [Arabidopsis thaliana]
Length=502

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/486 (66%), Positives = 388/486 (80%), Gaps = 4/486 (1%)
 Frame = +1

Query  94    MEAPL---ISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLF  264
             M APL   I  +    +D N N THLS + +EAK I+ I+LP+I+TGLLLY RSMISMLF
Sbjct  1     MAAPLLMIIKNQTDHRQDPNPNPTHLSSSIQEAKSIAKISLPLILTGLLLYSRSMISMLF  60

Query  265   lgrlgdlslaggslaig-FANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIV  441
             LGRL DLS   G      FANITGYS+LSGL++GMEPIC QAFGAKRFKL+GL+LQRT +
Sbjct  61    LGRLNDLSALSGGSLALGFANITGYSLLSGLSIGMEPICVQAFGAKRFKLLGLALQRTTL  120

Query  442   LLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQ  621
             LLL  S+PI+ILW N+++IL+   QD EIS +A+ FIL+SLPDLI QS LHP+RIYLRSQ
Sbjct  121   LLLLCSLPISILWLNIKKILLFFGQDEEISNQAEIFILFSLPDLILQSFLHPIRIYLRSQ  180

Query  622   SVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVY  801
             S+TLPLT+ A FA+++H+PINY LV  L LG+KGVAL ++W N N++G L++Y++FSGVY
Sbjct  181   SITLPLTYSAFFAVLLHIPINYLLVSSLGLGLKGVALGAIWTNVNLLGFLIIYIVFSGVY  240

Query  802   KKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLI  981
             +KTWGG S +CFKG++SL+ LAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LI
Sbjct  241   QKTWGGFSMDCFKGWRSLMKLAIPSCVSVCLEWWWYEIMILLCGLLLNPQATVASMGILI  300

Query  982   QTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRN  1161
             QTT+LIYIFPSSLS  VSTRVGNELGA +P +A++AA  GL  S  LGL A+ F + VRN
Sbjct  301   QTTALIYIFPSSLSISVSTRVGNELGANQPDKARIAARTGLSLSLGLGLLAMFFALMVRN  360

Query  1162  VWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFV  1341
              WA +FT + EI+ LT+ VLPIIGLCELGNCPQTT CG LRG+ARPKLGA INL CFYFV
Sbjct  361   CWARLFTDEEEIVKLTSMVLPIIGLCELGNCPQTTLCGVLRGSARPKLGANINLCCFYFV  420

Query  1342  GLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLV  1521
             G+PVA WL FF+GFDF+GLWLGL AAQ SC ++ML+VL RTDW  +  RAKEL       
Sbjct  421   GMPVAVWLSFFSGFDFKGLWLGLFAAQGSCLISMLVVLARTDWEVEVHRAKELMTRSCDG  480

Query  1522  DDDDDD  1539
             D+DD +
Sbjct  481   DEDDGN  486



>emb|CAN77415.1| hypothetical protein VITISV_000475 [Vitis vinifera]
Length=527

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/467 (63%), Positives = 360/467 (77%), Gaps = 0/467 (0%)
 Frame = +1

Query  115   EENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlsla  294
               + +EE   H     S A +E K I  I+ P  VTGLLLY R+MISMLFLG LG+L LA
Sbjct  4     HTDDEEEQQLHRWPTPSEALEEIKAIGKISGPTAVTGLLLYSRAMISMLFLGYLGELELA  63

Query  295   ggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAI  474
             GGSL+IGFANITGYS++SGLAMGMEPICGQA+GAK++KL+GL+LQRT++LLL TSIPI+ 
Sbjct  64    GGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQWKLLGLTLQRTVLLLLSTSIPISF  123

Query  475   LWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAA  654
             +W NM+RIL  C QD EIS  A +FI++S+PDL   S+LHPLRIYLR+QS+TLPLT+C+A
Sbjct  124   MWLNMKRILSWCGQDEEISSMAHTFIIFSIPDLFFLSILHPLRIYLRTQSITLPLTYCSA  183

Query  655   FAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWEC  834
              ++++HVP+N+ LVV   LGI GVA++ VW N N+   L+ ++ FSGVYK +W   S +C
Sbjct  184   ISVLLHVPLNFLLVVHFKLGIAGVAIAMVWTNLNLFLLLISFIFFSGVYKGSWVAPSIDC  243

Query  835   FKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPS  1014
              +G+ SLL LA+P+C SVCLEWWWYE MI+LCGLLANP+AT+ASMG+LIQTTSL+Y+FPS
Sbjct  244   LRGWSSLLALAVPTCISVCLEWWWYEFMIMLCGLLANPKATIASMGILIQTTSLVYVFPS  303

Query  1015  SLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAE  1194
             +LS GVSTRVGNELGA RP +A++  IV L  +  LGLAA+ F   +R+ W   FT DAE
Sbjct  304   ALSLGVSTRVGNELGANRPAKARICMIVSLFCAVALGLAAMLFTTLMRHQWGRFFTNDAE  363

Query  1195  IMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFF  1374
             ++ LTA  LPI GLCELGNCPQTTGCG LRG+ARP  GA INL  FY VG+PVA  +GF 
Sbjct  364   VLELTAVALPIAGLCELGNCPQTTGCGVLRGSARPTEGANINLGSFYLVGMPVAIIMGFV  423

Query  1375  AGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATIS  1515
             A   F GLWLGLLAAQ SCA  ML VL RTDW  Q +RA++LT T S
Sbjct  424   AKMGFAGLWLGLLAAQTSCAFLMLYVLCRTDWVVQVKRARDLTQTSS  470



>ref|XP_010439241.1| PREDICTED: MATE efflux family protein LAL5-like [Camelina sativa]
Length=506

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/483 (65%), Positives = 381/483 (79%), Gaps = 2/483 (0%)
 Frame = +1

Query  94    MEAPLI-SEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlg  270
             M APLI   +    +D N N  HLS   +EAK I+ I+LPMI+TGLLLY RSMISMLFLG
Sbjct  1     MAAPLIIKNQTDHRQDPNPNPNHLSSLIQEAKSIAKISLPMILTGLLLYSRSMISMLFLG  60

Query  271   rlgdlslaggslaig-FANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLL  447
             RL DLS   G      FANITGYS+LSGL++GMEPIC QAFGAKRFKL+GL+LQRT +LL
Sbjct  61    RLNDLSALSGGSLALGFANITGYSLLSGLSIGMEPICVQAFGAKRFKLLGLALQRTTLLL  120

Query  448   LFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSV  627
             L  S+PI++LW N+++IL+   QD EIS +A+ FIL+SLPDLI QS LHP+RIYLRSQS+
Sbjct  121   LLCSLPISLLWLNIKKILLFFGQDEEISDQAEIFILFSLPDLILQSFLHPIRIYLRSQSI  180

Query  628   TLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKK  807
             TLPLT+ A FA+++H+PINY LV  L LG+KGVAL ++W N N++G L++Y++FSGVY K
Sbjct  181   TLPLTYSAFFAVLLHIPINYLLVSSLGLGLKGVALGAIWTNVNLLGFLIIYIVFSGVYDK  240

Query  808   TWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQT  987
             TWGG S +CFKG++SL+ LAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQT
Sbjct  241   TWGGFSMDCFKGWRSLMKLAIPSCVSVCLEWWWYEIMILLCGLLLNPQATVASMGILIQT  300

Query  988   TSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVW  1167
             T+L+YIFPSSLS  VSTRVGNELGA +P +AK+AA  GL  S  LGL A+ F   VRN W
Sbjct  301   TALVYIFPSSLSVSVSTRVGNELGANQPDKAKVAARTGLGLSLGLGLFAMFFAFMVRNCW  360

Query  1168  ASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGL  1347
             A +FT + EI+ LT+ VLPIIGLCELGNCPQTT CG LRG+ARPKLGA INL CFYFVG+
Sbjct  361   ARLFTDEEEIVKLTSMVLPIIGLCELGNCPQTTVCGVLRGSARPKLGANINLCCFYFVGM  420

Query  1348  PVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDD  1527
             PVA WL FF+GFDF+GLWLGL AAQ S  ++ML+VL  TDW  +  R+KEL       +D
Sbjct  421   PVAIWLSFFSGFDFKGLWLGLFAAQGSYLVSMLVVLATTDWEVEVHRSKELMTRSCDGED  480

Query  1528  DDD  1536
             D +
Sbjct  481   DGN  483



>ref|XP_004301437.1| PREDICTED: multidrug and toxin extrusion protein 1-like [Fragaria 
vesca subsp. vesca]
Length=546

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/481 (61%), Positives = 361/481 (75%), Gaps = 1/481 (0%)
 Frame = +1

Query  76    SACKEKMEAPLISEENPKEEDHN-HNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMI  252
             S+ K     P  + +   ++D   H    LS A +E K I  I+ P  +TGLLLY R+MI
Sbjct  10    SSFKAHFMKPNKTHDQDVDQDQELHRWPTLSEALQEIKAIGKISGPTTITGLLLYSRAMI  69

Query  253   SMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQR  432
             SMLFLG LG+L LAGGSL+IGFANITGYS++SGLAMGMEPICGQA+GAK+ KL+GL+LQR
Sbjct  70    SMLFLGYLGELELAGGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQMKLLGLTLQR  129

Query  433   TIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYL  612
             T++LLL TSIPI+ +W NM+RIL+ C QD EIS  A +FIL+S+PDL   SLLHPLRIYL
Sbjct  130   TVLLLLSTSIPISFMWFNMKRILLWCGQDEEISSVAHTFILFSIPDLFFLSLLHPLRIYL  189

Query  613   RSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFS  792
             R+QS+TLP+T+C+A +++ HVP+N+ LVV L +G+ GVA++ VW N N+   L  +  FS
Sbjct  190   RTQSITLPVTYCSAISVIFHVPLNFLLVVKLEMGVAGVAIAMVWTNLNLFILLFSFTYFS  249

Query  793   GVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMG  972
              VYK +W   S +C KG+ SLL LAIP+C SVCLEWWWYE MILLCGLL NP+AT+ASMG
Sbjct  250   NVYKDSWVAPSSDCLKGWSSLLALAIPTCISVCLEWWWYEFMILLCGLLTNPKATIASMG  309

Query  973   VLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVA  1152
             +LIQTTSL+Y+FPSSLS GVSTR+GNELGA RP +A+++ IV L  +F LGL A+ F   
Sbjct  310   ILIQTTSLVYVFPSSLSLGVSTRIGNELGANRPAKARISMIVSLGCAFALGLLAMLFTTL  369

Query  1153  VRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCF  1332
             +R+ W   FT D EI+ LTA  LPI GLCELGNCPQTTGCG LRG+ARP +GA INL  F
Sbjct  370   MRHQWGRFFTNDTEILELTAIALPIAGLCELGNCPQTTGCGVLRGSARPTVGANINLGSF  429

Query  1333  YFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATI  1512
             Y VG+PVA  +GF     F GLWLGLLAAQ SCAL ML VL  TDW  Q +RA ELTA  
Sbjct  430   YLVGMPVAMVMGFVVKMGFAGLWLGLLAAQGSCALLMLYVLCTTDWMVQVKRASELTAET  489

Query  1513  S  1515
             S
Sbjct  490   S  490



>ref|XP_002283609.2| PREDICTED: MATE efflux family protein 5 [Vitis vinifera]
Length=553

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/467 (63%), Positives = 360/467 (77%), Gaps = 0/467 (0%)
 Frame = +1

Query  115   EENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlsla  294
               + +EE   H     S A +E K I  I+ P  VTGLLLY R+MISMLFLG LG+L LA
Sbjct  30    HTDDEEEQQLHRWPTPSEALEEIKAIGKISGPTAVTGLLLYSRAMISMLFLGYLGELELA  89

Query  295   ggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAI  474
             GGSL+IGFANITGYS++SGLAMGMEPICGQA+GAK++KL+GL+LQRT++LLL TSIPI+ 
Sbjct  90    GGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQWKLLGLTLQRTVLLLLSTSIPISF  149

Query  475   LWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAA  654
             +W NM+RIL  C QD EIS  A +FI++S+PDL   S+LHPLRIYLR+QS+TLPLT+C+A
Sbjct  150   MWLNMKRILSWCGQDEEISSMAHTFIIFSIPDLFFLSILHPLRIYLRTQSITLPLTYCSA  209

Query  655   FAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWEC  834
              ++++HVP+N+ LVV   LGI GVA++ VW N N+   L+ ++ FSGVYK +W   S +C
Sbjct  210   ISVLLHVPLNFLLVVHFKLGIAGVAIAMVWTNLNLFLLLISFIFFSGVYKGSWVAPSIDC  269

Query  835   FKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPS  1014
              +G+ SLL LA+P+C SVCLEWWWYE MI+LCGLLANP+AT+ASMG+LIQTTSL+Y+FPS
Sbjct  270   LRGWSSLLALAVPTCISVCLEWWWYEFMIMLCGLLANPKATIASMGILIQTTSLVYVFPS  329

Query  1015  SLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAE  1194
             +LS GVSTRVGNELGA RP +A++  IV L  +  LGLAA+ F   +R+ W   FT DAE
Sbjct  330   ALSLGVSTRVGNELGANRPAKARICMIVSLFCAVALGLAAMLFTTLMRHQWGRFFTNDAE  389

Query  1195  IMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFF  1374
             ++ LTA  LPI GLCELGNCPQTTGCG LRG+ARP  GA INL  FY VG+PVA  +GF 
Sbjct  390   VLELTAVALPIAGLCELGNCPQTTGCGVLRGSARPTEGANINLGSFYLVGMPVAIIMGFV  449

Query  1375  AGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATIS  1515
             A   F GLWLGLLAAQ SCA  ML VL RTDW  Q +RA++LT T S
Sbjct  450   AKMGFAGLWLGLLAAQTSCAFLMLYVLCRTDWVVQVKRARDLTQTSS  496



>ref|XP_009394090.1| PREDICTED: MATE efflux family protein LAL5-like [Musa acuminata 
subsp. malaccensis]
Length=516

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/469 (65%), Positives = 365/469 (78%), Gaps = 7/469 (1%)
 Frame = +1

Query  127   KEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggsl  306
             K + H    T +S A  E KCI  +ALP  +TGLLLY RSMISMLFLGRLGDL LAGG+L
Sbjct  12    KPQPH----TPISSAFVETKCILGLALPTALTGLLLYSRSMISMLFLGRLGDLPLAGGAL  67

Query  307   aigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCN  486
             AIGFANITGYS+LSGLAMGMEPICGQAFGA+R  L+GL+  RTI+LLL TS+PIA+LW  
Sbjct  68    AIGFANITGYSVLSGLAMGMEPICGQAFGARRHHLLGLAFHRTILLLLCTSLPIALLWYC  127

Query  487   MERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIV  666
             +  IL+L  Q   ++  A  ++  SLPDL  QS LHPLRIYLR+Q +TLPLT CAA +I 
Sbjct  128   IHPILLLLGQRPALAAAASVYLQASLPDLFLQSFLHPLRIYLRTQCITLPLTACAALSIA  187

Query  667   VHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWG-GVSWECFKG  843
             +H+PINY LV VL LGI GVAL+SVW N N+V  LV Y+  SG+++ T G   S ECFKG
Sbjct  188   LHLPINYLLVSVLRLGIGGVALASVWTNLNLVVFLVAYIYLSGLHRNTSGLSFSAECFKG  247

Query  844   YKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLS  1023
             ++SLLNLA+PSC SVCLEWWWYE+MI+LCGLL NP+ATVASMG+LIQT SLIYIFPSSLS
Sbjct  248   WRSLLNLAVPSCVSVCLEWWWYEIMIILCGLLLNPQATVASMGILIQTMSLIYIFPSSLS  307

Query  1024  FGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMA  1203
             FGVSTRV NELGA RP RA+ AA VGL  SF+LGL AL F V+VR+VWA++FT D+ I+ 
Sbjct  308   FGVSTRVANELGANRPDRARRAATVGLSCSFVLGLIALGFAVSVRHVWATMFTADSAILG  367

Query  1204  LTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGF  1383
             LT++VLPI+G+CELGNCPQTTGCG LRG+ARP +GA INL  FY +G+PVA    F  G 
Sbjct  368   LTSSVLPILGMCELGNCPQTTGCGVLRGSARPTVGANINLGSFYAIGMPVAVGFAFCTGL  427

Query  1384  DFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDD  1530
             DF+GLWLGLL+AQA+C + M+ V+ RTDW  QA RA +LT   S  DD 
Sbjct  428   DFKGLWLGLLSAQATCVVLMITVIRRTDWEAQAERAHQLTGAPS--DDS  474



>gb|KGN62780.1| hypothetical protein Csa_2G372760 [Cucumis sativus]
Length=588

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/463 (63%), Positives = 358/463 (77%), Gaps = 4/463 (1%)
 Frame = +1

Query  127   KEEDHNHNQTH----LSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlsla  294
             K  D    Q H    LS A +E K I  I+ P  +TGLLLY R+MISMLFLG LG+L LA
Sbjct  53    KPSDDQLAQLHRLPTLSEAVEEMKEIGKISGPTAITGLLLYSRAMISMLFLGYLGELELA  112

Query  295   ggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAI  474
             GGSL+IGFANITGYS+LSGLAMGMEPICGQA+GAK++KL+G++LQRT++LLL +S+PI+ 
Sbjct  113   GGSLSIGFANITGYSVLSGLAMGMEPICGQAYGAKQWKLLGITLQRTVLLLLTSSVPISF  172

Query  475   LWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAA  654
             +W NM+RIL+ C QD EIS  AQ+FIL+S+PDLI  SLLHPLRIYLR+QS+TLPLT+C+A
Sbjct  173   MWLNMKRILLWCGQDEEISTVAQTFILFSIPDLIFLSLLHPLRIYLRTQSITLPLTYCSA  232

Query  655   FAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWEC  834
              ++++HVP+N+ LVV   +GI GVA++ VW N NV   LV +V FSGVYK +W   S +C
Sbjct  233   LSVLLHVPLNFLLVVHFKMGISGVAIAMVWFNLNVFLFLVSFVYFSGVYKDSWVSPSVDC  292

Query  835   FKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPS  1014
               G+  LL+LAIP+C SVCLEWWWYE MI+LCGLL NP+AT+ASMG+LIQTTSL+Y+FPS
Sbjct  293   LHGWTPLLSLAIPTCVSVCLEWWWYEFMIMLCGLLVNPKATIASMGILIQTTSLVYVFPS  352

Query  1015  SLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAE  1194
             SLSFGVSTRVGNELGA RP +A+++ IV L  +  LG+AA+ F   +R+ W   FT DAE
Sbjct  353   SLSFGVSTRVGNELGANRPAKARISMIVSLICAVALGVAAMVFTTLMRHKWGRFFTDDAE  412

Query  1195  IMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFF  1374
             I+ LTA  LPI+GLCELGNCPQTTGCG LRG+ARP  GA INL  FY VG PVA  +GF 
Sbjct  413   ILELTAVALPIVGLCELGNCPQTTGCGVLRGSARPTTGANINLGSFYLVGFPVAILMGFV  472

Query  1375  AGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
                 F GLW+GLLAAQ +CAL M+ VL  TDW  Q  RA +LT
Sbjct  473   VKMGFAGLWIGLLAAQGTCALMMIYVLCTTDWMVQVERAMQLT  515



>emb|CBI19327.3| unnamed protein product [Vitis vinifera]
Length=576

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/467 (63%), Positives = 360/467 (77%), Gaps = 0/467 (0%)
 Frame = +1

Query  115   EENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlsla  294
               + +EE   H     S A +E K I  I+ P  VTGLLLY R+MISMLFLG LG+L LA
Sbjct  4     HTDDEEEQQLHRWPTPSEALEEIKAIGKISGPTAVTGLLLYSRAMISMLFLGYLGELELA  63

Query  295   ggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAI  474
             GGSL+IGFANITGYS++SGLAMGMEPICGQA+GAK++KL+GL+LQRT++LLL TSIPI+ 
Sbjct  64    GGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQWKLLGLTLQRTVLLLLSTSIPISF  123

Query  475   LWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAA  654
             +W NM+RIL  C QD EIS  A +FI++S+PDL   S+LHPLRIYLR+QS+TLPLT+C+A
Sbjct  124   MWLNMKRILSWCGQDEEISSMAHTFIIFSIPDLFFLSILHPLRIYLRTQSITLPLTYCSA  183

Query  655   FAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWEC  834
              ++++HVP+N+ LVV   LGI GVA++ VW N N+   L+ ++ FSGVYK +W   S +C
Sbjct  184   ISVLLHVPLNFLLVVHFKLGIAGVAIAMVWTNLNLFLLLISFIFFSGVYKGSWVAPSIDC  243

Query  835   FKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPS  1014
              +G+ SLL LA+P+C SVCLEWWWYE MI+LCGLLANP+AT+ASMG+LIQTTSL+Y+FPS
Sbjct  244   LRGWSSLLALAVPTCISVCLEWWWYEFMIMLCGLLANPKATIASMGILIQTTSLVYVFPS  303

Query  1015  SLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAE  1194
             +LS GVSTRVGNELGA RP +A++  IV L  +  LGLAA+ F   +R+ W   FT DAE
Sbjct  304   ALSLGVSTRVGNELGANRPAKARICMIVSLFCAVALGLAAMLFTTLMRHQWGRFFTNDAE  363

Query  1195  IMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFF  1374
             ++ LTA  LPI GLCELGNCPQTTGCG LRG+ARP  GA INL  FY VG+PVA  +GF 
Sbjct  364   VLELTAVALPIAGLCELGNCPQTTGCGVLRGSARPTEGANINLGSFYLVGMPVAIIMGFV  423

Query  1375  AGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATIS  1515
             A   F GLWLGLLAAQ SCA  ML VL RTDW  Q +RA++LT T S
Sbjct  424   AKMGFAGLWLGLLAAQTSCAFLMLYVLCRTDWVVQVKRARDLTQTSS  470



>ref|XP_004490498.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Cicer 
arietinum]
Length=559

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/469 (62%), Positives = 369/469 (79%), Gaps = 0/469 (0%)
 Frame = +1

Query  133   EDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslai  312
             +D  H    LS A +E K I  I+ P  +TGLLLY R+MISM+FLG LG++ LAGGSL+I
Sbjct  41    QDELHTWPTLSEALEEIKEIGKISCPTTITGLLLYSRAMISMIFLGYLGEMELAGGSLSI  100

Query  313   gFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNME  492
             GFANITGYS++SGLAMGMEPICGQA+GAK++K++GL+LQRTI+LLL TSIPI+ +W NME
Sbjct  101   GFANITGYSVISGLAMGMEPICGQAYGAKQWKILGLTLQRTILLLLSTSIPISFIWLNME  160

Query  493   RILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVH  672
              IL+   Q++EIS +AQ+FIL+ +PDL   S+LHPLRIYLR+Q +T+PLT+C+A ++  H
Sbjct  161   TILLWSGQNQEISSKAQTFILFLIPDLFLLSILHPLRIYLRTQGITMPLTYCSAISVFFH  220

Query  673   VPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKS  852
             VP+N+ LVV L +GI GVA++ V  N N++  L  ++ FS VYK++W   S EC KG+ S
Sbjct  221   VPLNFLLVVHLEMGIGGVAIAMVLTNLNLILLLSSFLYFSSVYKQSWVPPSLECIKGWSS  280

Query  853   LLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGV  1032
             LL+LAIP+C SVCLEWWWYE MI++CGLL NP+AT+ASMG+LIQTTSL+Y+FPSSLS GV
Sbjct  281   LLSLAIPTCVSVCLEWWWYEFMIMMCGLLVNPKATIASMGILIQTTSLVYVFPSSLSLGV  340

Query  1033  STRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTA  1212
             STR+GNELGA RP +A+++ IV L  + ILGL A+ F   +R+ W   FT D EI+ LT+
Sbjct  341   STRIGNELGANRPRKARISMIVSLFCALILGLGAMVFTTLMRHKWGKFFTNDNEILELTS  400

Query  1213  AVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFq  1392
              VLPI+GLCELGNCPQTTGCG LRG+ARP +GA INL  FY VG+P+A +LGFFA   F 
Sbjct  401   IVLPIVGLCELGNCPQTTGCGVLRGSARPTIGANINLGSFYLVGMPIAIFLGFFAKMGFA  460

Query  1393  glwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDDD  1539
             GLWLGLLAAQASCA  ML+VL RTDWN Q +RAKELT T ++    DDD
Sbjct  461   GLWLGLLAAQASCACLMLVVLCRTDWNVQVQRAKELTKTSTITTCHDDD  509



>ref|XP_009382291.1| PREDICTED: MATE efflux family protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=535

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/506 (62%), Positives = 382/506 (75%), Gaps = 8/506 (2%)
 Frame = +1

Query  31    SNTKNPLFFLPFAFISACKEKMEAPLISEENPKEEDHNHNQTH-LSLAAKEAKCISDIAL  207
              +  +P   L   F+ A  EK  A   SE  P             SLA  E      +AL
Sbjct  10    DHHHDPQGLLTAPFVVA--EKQPAKRQSEVAPAVPVGTRKPLRSASLAFVELSSTLSLAL  67

Query  208   PMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQA  387
             PM +TGLLLYCRSM+SMLFLGRLGDL+LAGGSLAIGFANITGYS+LSGLAMGMEPICGQA
Sbjct  68    PMALTGLLLYCRSMVSMLFLGRLGDLALAGGSLAIGFANITGYSVLSGLAMGMEPICGQA  127

Query  388   FGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLP  567
              GA+R  L+GL+L RT++LLL  S+PIA+LW  +  +L+L  Q   ++  A S++   LP
Sbjct  128   VGARRHHLVGLALHRTVLLLLAASVPIALLWYYIRPLLLLAGQQPALAAAASSYLHACLP  187

Query  568   DLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWC  747
             DLI  S LHPLRIYLR+QS+TLPLT CA  A+V H+PINY LV VL+LG++GVAL+SVW 
Sbjct  188   DLIFLSFLHPLRIYLRTQSITLPLTLCAGLAVVFHLPINYLLVSVLHLGVRGVALASVWF  247

Query  748   NFNVVGSLVVYVLFSGVYKKTWGGVSW--ECFKGYKSLLNLAIPSCASVCLEWWWYELMI  921
             NFNVV  L+VY+ FSG+++ T GG+S+  ECFK ++SLL+LA+PSC SVCLEWWWYE+MI
Sbjct  248   NFNVVLFLIVYICFSGIHRST-GGLSFSSECFKEWRSLLHLAVPSCISVCLEWWWYEIMI  306

Query  922   LLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVG  1101
             +LCGLL NP ATVASMG+LIQTTSLIYIFPSSLSFGVSTRV NELGA  P RA+ AA VG
Sbjct  307   ILCGLLINPEATVASMGILIQTTSLIYIFPSSLSFGVSTRVSNELGANSPDRAQRAATVG  366

Query  1102  LCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGAL  1281
             L  SF+LGL A  F  +VR++WA +FT D  I  LTA+VLPI+G+CE GNCPQTTGCG L
Sbjct  367   LSCSFVLGLLAFGFAFSVRHMWARMFTGDPAIFELTASVLPILGMCEFGNCPQTTGCGVL  426

Query  1282  RGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGR  1461
             RGTARPKLGA INL  FY VG+PVA  L F+   DF+GLWLGLL+AQA+C + ML+V+ R
Sbjct  427   RGTARPKLGADINLGSFYVVGMPVAVGLAFWTLLDFKGLWLGLLSAQATCVVLMLVVIQR  486

Query  1462  TDWNDQARRAKELTATISLVDDDDDD  1539
             TDW+ QA+RA++LT   + +D+ D +
Sbjct  487   TDWDSQAKRAQQLTG--AAIDEADKE  510



>ref|XP_009411460.1| PREDICTED: MATE efflux family protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=537

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/491 (63%), Positives = 379/491 (77%), Gaps = 15/491 (3%)
 Frame = +1

Query  94    MEAPLISEENPKEEDHNHNQT----------HLSLAAKEAKCISDIALPMIVTGLLLYCR  243
             + APL+  E P  +                  +SL   EA  +  IALPM++TGLLLYCR
Sbjct  25    LTAPLVVVEKPVAKTQAEVAPAPVLTPKPLGSVSLGLVEATSVLSIALPMVLTGLLLYCR  84

Query  244   SMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLS  423
             SM+SMLFLGRLGDL+LAGGSLAIGFANITGYS+LSGLAMGMEPICGQAFGA+R +L+GL+
Sbjct  85    SMVSMLFLGRLGDLALAGGSLAIGFANITGYSVLSGLAMGMEPICGQAFGAQRHRLLGLA  144

Query  424   LQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLR  603
             L RT++LLL  S+PIA+LW  +  +L+L  Q+  ++  A S++   LPDL+ QS LHPLR
Sbjct  145   LHRTVLLLLSASVPIALLWYYIRPLLLLVGQEPALAAAASSYLHACLPDLLLQSFLHPLR  204

Query  604   IYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYV  783
             IYLR+QS+TLPLT CA  A+V+H+PINY LV VL LGI GVAL+SV  NFNVV  L+ YV
Sbjct  205   IYLRTQSITLPLTVCAGLAVVLHLPINYLLVSVLRLGIGGVALASVLFNFNVVVFLIGYV  264

Query  784   LFSGVYKKTWGGVSW--ECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRAT  957
              FSG+++ T GG+S+  EC K ++SLLNLA+PSC SVCLEWWWYE+MI+LCGLL NP+ T
Sbjct  265   YFSGIHRST-GGLSFSSECLKEWRSLLNLAVPSCISVCLEWWWYEIMIILCGLLLNPQVT  323

Query  958   VASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAAL  1137
             VASMG+LIQTTSL+YIFPSSLSFGVSTRVGNELGA RP RA+ AA  GL  SF++GL AL
Sbjct  324   VASMGILIQTTSLLYIFPSSLSFGVSTRVGNELGANRPDRAQRAATAGLSCSFVVGLLAL  383

Query  1138  TFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKI  1317
              F  +VR+VWA +FT D  I+ LTA+VLPI+GLCELGNCPQTTGCG LRG+ARPKLGA I
Sbjct  384   GFAFSVRHVWARMFTGDPAILDLTASVLPILGLCELGNCPQTTGCGVLRGSARPKLGADI  443

Query  1318  NLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKE  1497
             NL  FY VG+PVA  L F+   DF+GLWLGLL+AQA+C + ML+ +  TDW+ QA RA+ 
Sbjct  444   NLGSFYAVGMPVAVGLAFWTPLDFRGLWLGLLSAQATCVVLMLVTIDSTDWDAQAERAQL  503

Query  1498  LTATISLVDDD  1530
             LT   + +D+D
Sbjct  504   LTG--AAIDED  512



>gb|KCW68566.1| hypothetical protein EUGRSUZ_F02179 [Eucalyptus grandis]
Length=539

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/457 (64%), Positives = 360/457 (79%), Gaps = 0/457 (0%)
 Frame = +1

Query  133   EDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslai  312
             +D  H     S A +E K I  I+ P  VTGLLLY R+MISMLFLGRLG+L L+GGSLAI
Sbjct  4     QDDLHRWPTPSEALEEIKAIGKISGPTAVTGLLLYLRAMISMLFLGRLGELELSGGSLAI  63

Query  313   gFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNME  492
             GFANITGYS++SGLAMGMEPICGQA+GA++ K++GL+LQRT++LLL  S+PI+ +W NM+
Sbjct  64    GFANITGYSVISGLAMGMEPICGQAYGARQCKMLGLTLQRTVLLLLSASVPISFMWANMK  123

Query  493   RILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVH  672
              IL+ C QD EIS  A +FIL+S+PDL   SLLHPLRIYLR+Q++TLPLT+C+A ++++H
Sbjct  124   EILLWCGQDEEISSTAHTFILFSMPDLFFLSLLHPLRIYLRTQNITLPLTYCSAASVLLH  183

Query  673   VPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKS  852
             VP+N+ LVV   +GI GVA++ VW N N+   L  Y+ FS VY+ +W   S +C +G+ S
Sbjct  184   VPLNFLLVVHFKMGIAGVAIAMVWTNLNLFVLLSAYIYFSRVYEGSWVAPSADCLRGWSS  243

Query  853   LLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGV  1032
             LL LA+P+C SVCLEWWWYELMI+LCGLLA+PRATVASMG+LIQTTSL+Y+FPSSLS GV
Sbjct  244   LLALAVPTCVSVCLEWWWYELMIVLCGLLASPRATVASMGILIQTTSLVYVFPSSLSLGV  303

Query  1033  STRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTA  1212
             STRVGNELGA RP RA+++AI+ L  +  LGL A+ F   VR+ W  +FT++AEI+ LTA
Sbjct  304   STRVGNELGARRPARARISAIIALVCAVGLGLGAMLFTTLVRHQWGRLFTENAEILELTA  363

Query  1213  AVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFq  1392
             A LPI GLCELGNCPQTTGCG LRG+ARP +GA INL  FY +G+PVA  +GF A   F 
Sbjct  364   AALPIAGLCELGNCPQTTGCGVLRGSARPTIGANINLGSFYLIGMPVAIVMGFVAKVGFA  423

Query  1393  glwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
             GLWLGLLAAQASCAL ML VL RTDW  Q  RAKELT
Sbjct  424   GLWLGLLAAQASCALLMLYVLCRTDWAVQVERAKELT  460



>ref|XP_008219166.1| PREDICTED: MATE efflux family protein 5 [Prunus mume]
Length=549

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/453 (64%), Positives = 353/453 (78%), Gaps = 0/453 (0%)
 Frame = +1

Query  145   HNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFAN  324
             H    LS A +E K I  I+ P  +TGLLLY R+MISMLFLG LG+L LAGGSL+IGFAN
Sbjct  42    HRWPTLSEALQEIKAIGKISGPTTITGLLLYSRAMISMLFLGYLGELELAGGSLSIGFAN  101

Query  325   ITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILI  504
             ITGYS++SGLAMGMEPICGQA+GAK+ KL+GL+LQRT++LLL TSIPI+ +W NM+R+L+
Sbjct  102   ITGYSVISGLAMGMEPICGQAYGAKQMKLLGLTLQRTVLLLLSTSIPISFMWLNMKRVLL  161

Query  505   LCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPIN  684
              C QD EIS  A +FIL+S+PDL   SLLHPLRIYLR+Q++TLPLT+C+A ++V+HVP+N
Sbjct  162   WCGQDEEISSVAHTFILFSIPDLFFLSLLHPLRIYLRTQNITLPLTYCSAISVVLHVPLN  221

Query  685   YFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNL  864
             + LVV  N+GI GVA++ VW N N+   L  +  FS VYK +W   S +C +G+ SLL L
Sbjct  222   FLLVVKFNMGISGVAIAMVWFNLNLFILLSSFTYFSNVYKDSWVCPSTDCIRGWSSLLAL  281

Query  865   AIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRV  1044
             AIP+C SVCLEWWWYELMI+LCGLLANP+AT+ASMG+LIQTT+L+Y+FPSSLS GVSTRV
Sbjct  282   AIPTCISVCLEWWWYELMIMLCGLLANPKATIASMGILIQTTALVYVFPSSLSLGVSTRV  341

Query  1045  GNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLP  1224
             GNELGA R  +A+++ IV L  +  LGL A+ F   +R+ W   FT D EI+ LTA  LP
Sbjct  342   GNELGANRAAKARISTIVSLACAVALGLLAMLFTTLMRHQWGRFFTSDPEILELTAIALP  401

Query  1225  IIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwl  1404
             I+GLCELGNCPQTTGCG LRG+ARP +GA INL  FY VG+PVA  +GF     F GLWL
Sbjct  402   IVGLCELGNCPQTTGCGVLRGSARPTIGANINLGSFYLVGMPVAMLMGFVVKMGFAGLWL  461

Query  1405  gllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
             GLLAAQ SCAL M  VL  TDWN Q +RA+ELT
Sbjct  462   GLLAAQGSCALLMFYVLRTTDWNAQVKRARELT  494



>ref|XP_002510003.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF52190.1| multidrug resistance pump, putative [Ricinus communis]
Length=528

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/459 (61%), Positives = 357/459 (78%), Gaps = 0/459 (0%)
 Frame = +1

Query  133   EDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslai  312
             E+  H     S   +E K I  I+ P  +TGL+LY R+MISMLFLG LG+L LAGGSL+I
Sbjct  9     EEELHRWPTPSEVLEEIKAIGKISGPTAITGLILYSRAMISMLFLGYLGELELAGGSLSI  68

Query  313   gFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNME  492
             GFANITGYS++SGLAMGMEPICGQA+GAK+ K +GL+LQRT++LLL TS+PI+ +W NM+
Sbjct  69    GFANITGYSVISGLAMGMEPICGQAYGAKQMKFLGLTLQRTVLLLLSTSVPISFMWLNMK  128

Query  493   RILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVH  672
             RIL+ C QD+EIS  A +FIL+++PDL   SLLHPLR+YLR+QS+TLPLT+C+A ++++H
Sbjct  129   RILLWCGQDQEISSTAHTFILFAIPDLFFLSLLHPLRVYLRTQSITLPLTYCSAISVLLH  188

Query  673   VPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKS  852
             VP+N+ LVV   LG+ GVA++ VW N N+   L+ ++ FSG+YK +W   S +C +G+ S
Sbjct  189   VPLNFLLVVHFKLGVAGVAIAMVWTNLNLFLFLISFIYFSGIYKDSWVAPSMDCLRGWSS  248

Query  853   LLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGV  1032
             LL LA+P+C SVCLEWWWYE MI+LCGLL NP+AT+ASMG+LIQTTSL+Y+FPSSLS GV
Sbjct  249   LLALAVPTCVSVCLEWWWYEFMIMLCGLLVNPKATIASMGILIQTTSLVYVFPSSLSLGV  308

Query  1033  STRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTA  1212
             STRVGNELGA RP +A+++ IV L  +  LGL A+ F   +R+ W   FT D EI+ LTA
Sbjct  309   STRVGNELGANRPAKARISMIVSLSCAVGLGLLAMLFTTLMRHQWGRFFTNDVEILELTA  368

Query  1213  AVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFq  1392
               LPI+GLCELGNCPQT GCG LRG+ARP +GA INL  FY VG+PV   +GF A   F 
Sbjct  369   VALPIVGLCELGNCPQTAGCGVLRGSARPTIGANINLGSFYLVGMPVGMLMGFVAKMGFA  428

Query  1393  glwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTAT  1509
             GLWLGLLAAQASCA+ ML VL RTDW+ QA RA++LT T
Sbjct  429   GLWLGLLAAQASCAILMLYVLCRTDWSVQAERARKLTQT  467



>gb|KDP41539.1| hypothetical protein JCGZ_15946 [Jatropha curcas]
Length=537

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/459 (63%), Positives = 357/459 (78%), Gaps = 0/459 (0%)
 Frame = +1

Query  127   KEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggsl  306
              ++   H     S   +E K +  I+ P  +TGL+LY R+MISM+FLG LG+L LAGGSL
Sbjct  5     SDDGELHRWPTPSEVLEEIKALGKISGPTAITGLILYSRAMISMIFLGYLGELELAGGSL  64

Query  307   aigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCN  486
             +IGFANITGYS++SGLAMGMEPICGQA+GAK++K++GL+LQRT++LLL TSIPI+ +W N
Sbjct  65    SIGFANITGYSVISGLAMGMEPICGQAYGAKQWKILGLTLQRTVLLLLSTSIPISFMWIN  124

Query  487   MERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIV  666
             M+RIL+ C QD+EIS  A +FIL+S+PDL   SLLHPLRIYLR+QS+TLPLT+C+A +++
Sbjct  125   MKRILLWCGQDQEISSVAHTFILFSVPDLFFLSLLHPLRIYLRTQSITLPLTYCSAISVL  184

Query  667   VHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGY  846
             +HVP+N+ LVV   LGI GVA++ VW N NV   L  +V FSGVYK +W   S +C KG+
Sbjct  185   LHVPLNFLLVVHFKLGIAGVAIAMVWTNLNVFLLLFSFVYFSGVYKDSWVSPSLDCLKGW  244

Query  847   KSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSF  1026
              SLL LA+P+C SVCLEWWWYE MI+LCGLL NP+ATVASMG+LIQTTSL+Y+FPSSLS 
Sbjct  245   SSLLALAVPTCVSVCLEWWWYEFMIMLCGLLVNPKATVASMGILIQTTSLVYVFPSSLSL  304

Query  1027  GVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMAL  1206
             GVSTRVGNELGA RP +A+++ IV L  +  LGL A+ F   +R+ W   FT D+EI+ L
Sbjct  305   GVSTRVGNELGANRPAKARISMIVSLACAVCLGLLAMLFTTFMRHQWGRFFTSDSEILQL  364

Query  1207  TAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFD  1386
             TA  LPI GLCELGNCPQTTGCGALR +ARP +GA INL  FY VG PVA ++GF A   
Sbjct  365   TAIALPIAGLCELGNCPQTTGCGALRASARPTIGANINLGSFYLVGFPVAIFMGFVAKLG  424

Query  1387  FqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
             F GLWLGLLAAQASCA  ML VL +TDW  QA RAKELT
Sbjct  425   FAGLWLGLLAAQASCATFMLYVLWKTDWKVQAERAKELT  463



>ref|XP_008444968.1| PREDICTED: MATE efflux family protein 5 [Cucumis melo]
Length=590

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/463 (63%), Positives = 358/463 (77%), Gaps = 4/463 (1%)
 Frame = +1

Query  127   KEEDHNHNQTH----LSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlsla  294
             K  D    Q H    LS A +E K I  I+ P  +TGLLLY R+MIS+LFLG LG+L LA
Sbjct  53    KPSDDQLAQLHRFPTLSEAVEEMKEIGKISGPTAITGLLLYSRAMISVLFLGYLGELELA  112

Query  295   ggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAI  474
             GGSL+IGFANITGYS+LSGLAMGMEPICGQA+GAK++KL+G++LQRT++LLL +S+PI+ 
Sbjct  113   GGSLSIGFANITGYSVLSGLAMGMEPICGQAYGAKQWKLLGITLQRTVLLLLTSSVPISF  172

Query  475   LWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAA  654
             +W NM+RIL+ C QD EIS  AQ+FIL+S+PDLI  SLLHPLRIYLR+QS+TLPLT+C+A
Sbjct  173   MWLNMKRILLWCGQDEEISTVAQTFILFSIPDLIFLSLLHPLRIYLRTQSITLPLTYCSA  232

Query  655   FAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWEC  834
              ++++HVP+N+ LVV   +GI GVA++ VW N NV   LV +V FSGVYK +W   S +C
Sbjct  233   LSVLLHVPLNFLLVVHFKMGISGVAIAMVWFNLNVFLFLVSFVYFSGVYKDSWVSPSVDC  292

Query  835   FKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPS  1014
               G+  LL+LAIP+C SVCLEWWWYE MI+LCGLL NP+AT+ASMG+LIQTTSL+Y+FPS
Sbjct  293   LHGWTPLLSLAIPTCVSVCLEWWWYEFMIMLCGLLVNPKATIASMGILIQTTSLVYVFPS  352

Query  1015  SLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAE  1194
             SLSFGVSTRVGNELGA RP +A+++ IV L  +  LG+AA+ F   +R+ W   FT DAE
Sbjct  353   SLSFGVSTRVGNELGANRPAKARISMIVSLICAVALGVAAMVFTTLMRHKWGRFFTDDAE  412

Query  1195  IMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFF  1374
             I+ LTA  LPI+GLCELGNCPQTTGCG LRG+ARP  GA INL  FY VG PVA  +GF 
Sbjct  413   ILELTAVALPIVGLCELGNCPQTTGCGVLRGSARPTTGANINLGSFYLVGFPVAILMGFV  472

Query  1375  AGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
                 F GLW+GLLAAQ +CAL M+ VL  TDW  Q  RA +LT
Sbjct  473   VKMGFAGLWIGLLAAQGTCALMMIYVLCTTDWMVQVERAMQLT  515



>ref|XP_010061582.1| PREDICTED: MATE efflux family protein 5 [Eucalyptus grandis]
Length=566

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/457 (64%), Positives = 360/457 (79%), Gaps = 0/457 (0%)
 Frame = +1

Query  133   EDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslai  312
             +D  H     S A +E K I  I+ P  VTGLLLY R+MISMLFLGRLG+L L+GGSLAI
Sbjct  31    QDDLHRWPTPSEALEEIKAIGKISGPTAVTGLLLYLRAMISMLFLGRLGELELSGGSLAI  90

Query  313   gFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNME  492
             GFANITGYS++SGLAMGMEPICGQA+GA++ K++GL+LQRT++LLL  S+PI+ +W NM+
Sbjct  91    GFANITGYSVISGLAMGMEPICGQAYGARQCKMLGLTLQRTVLLLLSASVPISFMWANMK  150

Query  493   RILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVH  672
              IL+ C QD EIS  A +FIL+S+PDL   SLLHPLRIYLR+Q++TLPLT+C+A ++++H
Sbjct  151   EILLWCGQDEEISSTAHTFILFSMPDLFFLSLLHPLRIYLRTQNITLPLTYCSAASVLLH  210

Query  673   VPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKS  852
             VP+N+ LVV   +GI GVA++ VW N N+   L  Y+ FS VY+ +W   S +C +G+ S
Sbjct  211   VPLNFLLVVHFKMGIAGVAIAMVWTNLNLFVLLSAYIYFSRVYEGSWVAPSADCLRGWSS  270

Query  853   LLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGV  1032
             LL LA+P+C SVCLEWWWYELMI+LCGLLA+PRATVASMG+LIQTTSL+Y+FPSSLS GV
Sbjct  271   LLALAVPTCVSVCLEWWWYELMIVLCGLLASPRATVASMGILIQTTSLVYVFPSSLSLGV  330

Query  1033  STRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTA  1212
             STRVGNELGA RP RA+++AI+ L  +  LGL A+ F   VR+ W  +FT++AEI+ LTA
Sbjct  331   STRVGNELGARRPARARISAIIALVCAVGLGLGAMLFTTLVRHQWGRLFTENAEILELTA  390

Query  1213  AVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFq  1392
             A LPI GLCELGNCPQTTGCG LRG+ARP +GA INL  FY +G+PVA  +GF A   F 
Sbjct  391   AALPIAGLCELGNCPQTTGCGVLRGSARPTIGANINLGSFYLIGMPVAIVMGFVAKVGFA  450

Query  1393  glwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
             GLWLGLLAAQASCAL ML VL RTDW  Q  RAKELT
Sbjct  451   GLWLGLLAAQASCALLMLYVLCRTDWAVQVERAKELT  487



>ref|XP_010695442.1| PREDICTED: MATE efflux family protein 5 [Beta vulgaris subsp. 
vulgaris]
Length=572

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/457 (64%), Positives = 350/457 (77%), Gaps = 0/457 (0%)
 Frame = +1

Query  145   HNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFAN  324
             H    LS    E + I  I+ P  VTGLLLY R+MISMLFLG LG+L LAGGSLAIGFAN
Sbjct  56    HKWPTLSEVVGEMRAIGKISGPTTVTGLLLYSRAMISMLFLGYLGELELAGGSLAIGFAN  115

Query  325   ITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILI  504
             ITGYSI+SGLAMGMEPICGQA+GAK+ KL+GL+LQRT++LL   S+PIA +W NM+RIL+
Sbjct  116   ITGYSIISGLAMGMEPICGQAYGAKQMKLLGLTLQRTVLLLFSISLPIAFMWVNMKRILL  175

Query  505   LCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPIN  684
              C QD EIS  A  FIL+S+PDL   SLLHPLRIYLR+QS+TLPLT+C A ++V H+P+N
Sbjct  176   WCGQDEEISSVAHVFILFSIPDLFFLSLLHPLRIYLRTQSITLPLTYCTAISVVFHIPLN  235

Query  685   YFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNL  864
             + LVV L LGI GVA++ VW N N+      ++ FS VYK +W   S +C +G+ SLL L
Sbjct  236   FLLVVHLKLGIAGVAIAMVWTNLNLCILFSSFIYFSRVYKDSWIAPSMDCLRGWSSLLAL  295

Query  865   AIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRV  1044
             AIP+CASVCLEWWWYE MI+LCGLLANPRAT+ASMG+LIQTTSL+Y+FPSSLS GVSTRV
Sbjct  296   AIPTCASVCLEWWWYEFMIMLCGLLANPRATIASMGILIQTTSLVYVFPSSLSLGVSTRV  355

Query  1045  GNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLP  1224
             GNELGA RP +A+++ IV L  + +LGL A+ F   +R+ W   FT D EI+ LTA  LP
Sbjct  356   GNELGARRPAKARVSMIVSLACAVLLGLCAMLFTTLMRHQWGRFFTSDPEILHLTAIALP  415

Query  1225  IIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwl  1404
             I+GLCELGNCPQTTGCG LRG+ARP +GA INL  FY VG+PVA + GF     F GLWL
Sbjct  416   IVGLCELGNCPQTTGCGVLRGSARPTIGANINLGSFYLVGMPVAMFFGFVMKMGFAGLWL  475

Query  1405  gllaaqaSCALTMLLVLGRTDWNDQARRAKELTATIS  1515
             GLLAAQ SCAL ML VL RTDW  Q  RAKELT + S
Sbjct  476   GLLAAQGSCALLMLYVLCRTDWTLQVDRAKELTNSSS  512



>ref|XP_004490499.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Cicer 
arietinum]
Length=515

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/457 (63%), Positives = 364/457 (80%), Gaps = 0/457 (0%)
 Frame = +1

Query  169   AAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILS  348
             A +E K I  I+ P  +TGLLLY R+MISM+FLG LG++ LAGGSL+IGFANITGYS++S
Sbjct  9     ALEEIKEIGKISCPTTITGLLLYSRAMISMIFLGYLGEMELAGGSLSIGFANITGYSVIS  68

Query  349   GLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREI  528
             GLAMGMEPICGQA+GAK++K++GL+LQRTI+LLL TSIPI+ +W NME IL+   Q++EI
Sbjct  69    GLAMGMEPICGQAYGAKQWKILGLTLQRTILLLLSTSIPISFIWLNMETILLWSGQNQEI  128

Query  529   SMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLN  708
             S +AQ+FIL+ +PDL   S+LHPLRIYLR+Q +T+PLT+C+A ++  HVP+N+ LVV L 
Sbjct  129   SSKAQTFILFLIPDLFLLSILHPLRIYLRTQGITMPLTYCSAISVFFHVPLNFLLVVHLE  188

Query  709   LGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASV  888
             +GI GVA++ V  N N++  L  ++ FS VYK++W   S EC KG+ SLL+LAIP+C SV
Sbjct  189   MGIGGVAIAMVLTNLNLILLLSSFLYFSSVYKQSWVPPSLECIKGWSSLLSLAIPTCVSV  248

Query  889   CLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGR  1068
             CLEWWWYE MI++CGLL NP+AT+ASMG+LIQTTSL+Y+FPSSLS GVSTR+GNELGA R
Sbjct  249   CLEWWWYEFMIMMCGLLVNPKATIASMGILIQTTSLVYVFPSSLSLGVSTRIGNELGANR  308

Query  1069  PGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELG  1248
             P +A+++ IV L  + ILGL A+ F   +R+ W   FT D EI+ LT+ VLPI+GLCELG
Sbjct  309   PRKARISMIVSLFCALILGLGAMVFTTLMRHKWGKFFTNDNEILELTSIVLPIVGLCELG  368

Query  1249  NCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaS  1428
             NCPQTTGCG LRG+ARP +GA INL  FY VG+P+A +LGFFA   F GLWLGLLAAQAS
Sbjct  369   NCPQTTGCGVLRGSARPTIGANINLGSFYLVGMPIAIFLGFFAKMGFAGLWLGLLAAQAS  428

Query  1429  CALTMLLVLGRTDWNDQARRAKELTATISLVDDDDDD  1539
             CA  ML+VL RTDWN Q +RAKELT T ++    DDD
Sbjct  429   CACLMLVVLCRTDWNVQVQRAKELTKTSTITTCHDDD  465



>gb|AES73927.2| MATE efflux family protein [Medicago truncatula]
Length=553

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/484 (59%), Positives = 361/484 (75%), Gaps = 4/484 (1%)
 Frame = +1

Query  97    EAPLISEENPKEEDHNHNQTHL----SLAAKEAKCISDIALPMIVTGLLLYCRSMISMLF  264
             +  L+  + P +E  + N+       +   +E K I  I+ P  +TGLLLY R+MISMLF
Sbjct  21    DPKLLINDPPHDEVQDQNELQRWPTPNEVIEELKAIGKISGPTAITGLLLYSRAMISMLF  80

Query  265   lgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVL  444
             LG LG+  LAGGSL+IGFANITGYS+LSGLAMGMEPICGQA+GAK++K++GL+LQRT++L
Sbjct  81    LGYLGETELAGGSLSIGFANITGYSVLSGLAMGMEPICGQAYGAKQWKILGLTLQRTVLL  140

Query  445   LLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQS  624
             LL TSIPIA LW NM++IL+ C QD EIS  AQ+FIL+SLPDL   S LHPLRIYLR+Q+
Sbjct  141   LLSTSIPIAYLWLNMKKILMSCGQDEEISSTAQTFILFSLPDLFFLSFLHPLRIYLRTQN  200

Query  625   VTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYK  804
             +TLPLT+C+A ++ +HVP+N+ LV+   +G+ GVA++ +W N N++  L  +V FS VYK
Sbjct  201   ITLPLTYCSAISVTLHVPLNFLLVIHFKMGVAGVAIAMIWFNLNLLIFLSSFVFFSRVYK  260

Query  805   KTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQ  984
              +W   S +C KG+ SLL L+IPSC SVCLEWWWYELMI+LCGLL NP++T++SMG+LIQ
Sbjct  261   DSWVFPSIDCLKGWSSLLALSIPSCVSVCLEWWWYELMIILCGLLVNPKSTISSMGILIQ  320

Query  985   TTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNV  1164
             TTSL+Y+FPSSLSFGVSTRVGN LGA  P +A+ + IV +   F LG+ A+ F   +RN 
Sbjct  321   TTSLVYVFPSSLSFGVSTRVGNLLGANSPSKARFSMIVSMFCGFGLGILAMVFTTLMRNQ  380

Query  1165  WASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVG  1344
             W  +FT D EI+ LTA  LPI+GLCE+GNCPQTTGCG LRG+ARP +GA INL  FY VG
Sbjct  381   WGRLFTSDDEIINLTAMALPIVGLCEIGNCPQTTGCGVLRGSARPTVGANINLGSFYLVG  440

Query  1345  LPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVD  1524
             +PVA  LGF     F GLW GLLAAQ SCA+ ML VL  TDWNDQ  RAK LT   + + 
Sbjct  441   MPVAIVLGFVVKMGFVGLWFGLLAAQGSCAILMLYVLCTTDWNDQIERAKNLTKATTTIG  500

Query  1525  DDDD  1536
               D 
Sbjct  501   FSDS  504



>ref|XP_002869794.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46053.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=502

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/485 (66%), Positives = 386/485 (80%), Gaps = 3/485 (1%)
 Frame = +1

Query  94    MEAPL--ISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFl  267
             M APL  I  +    +D N N THLS + +EAK I+ I+LP+I+TGLLLY RSMISMLFL
Sbjct  1     MAAPLLIIKNQTDHRQDPNSNPTHLSSSIQEAKSIAKISLPLILTGLLLYSRSMISMLFL  60

Query  268   grlgdlslaggslaig-FANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVL  444
             GRL DLS   G      FANITGYS+LSGL++GMEPIC QAFGAKRFKL+GL+LQRT +L
Sbjct  61    GRLNDLSALSGGSLALGFANITGYSLLSGLSIGMEPICVQAFGAKRFKLLGLALQRTTLL  120

Query  445   LLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQS  624
             LL  S+PI++LW N++ IL+   QD EIS +A+ FIL+SLPDLI QS LHP+RIYLRSQS
Sbjct  121   LLLCSLPISLLWLNIKNILLFFGQDEEISNQAEIFILFSLPDLILQSFLHPIRIYLRSQS  180

Query  625   VTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYK  804
             +TLPLT+ A FA+++H+PINY LV  L LG+KGVAL ++W N N++G L++Y++FSGVY+
Sbjct  181   ITLPLTYSAFFAVLLHIPINYLLVSSLGLGLKGVALGAIWTNVNLLGFLIIYIVFSGVYE  240

Query  805   KTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQ  984
             KTWGG S +CFKG++SL+ LAIPSC SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQ
Sbjct  241   KTWGGFSLDCFKGWRSLMKLAIPSCVSVCLEWWWYEIMILLCGLLLNPQATVASMGILIQ  300

Query  985   TTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNV  1164
             TT+LIYIFPSSLS  VSTRVGNELGA +P +A++AA  GL  S  LGL A+ F   VRN 
Sbjct  301   TTALIYIFPSSLSISVSTRVGNELGANQPDKARIAARTGLGLSLGLGLIAMFFAFMVRNC  360

Query  1165  WASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVG  1344
             WA +FT + EI+ LT+ VLPIIGLCELGNCPQTT CG LRG+ARPKLGA INL CFYFVG
Sbjct  361   WARLFTDEEEIVKLTSMVLPIIGLCELGNCPQTTVCGVLRGSARPKLGANINLCCFYFVG  420

Query  1345  LPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVD  1524
             +PVA WL FF+GFDF+GLWLGL AAQ SC ++ML+VL RTDW  +  RAKEL       D
Sbjct  421   MPVAIWLSFFSGFDFKGLWLGLFAAQGSCLVSMLVVLARTDWEVEVHRAKELMTRSCDGD  480

Query  1525  DDDDD  1539
             +D+ +
Sbjct  481   EDEGN  485



>ref|XP_009385179.1| PREDICTED: MATE efflux family protein LAL5-like [Musa acuminata 
subsp. malaccensis]
Length=522

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/449 (66%), Positives = 359/449 (80%), Gaps = 3/449 (1%)
 Frame = +1

Query  163   SLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSI  342
             SLA  EAK I  +ALP+  TGLLLYCRS+ISMLFLGRLGD ++AGGSLAIGFANITGYS+
Sbjct  53    SLAFVEAKSILSLALPIAFTGLLLYCRSLISMLFLGRLGDFAIAGGSLAIGFANITGYSV  112

Query  343   LSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDR  522
             LSGLAMGMEPICGQAFGA+R  L+G +L RT++LLL  S+PIA+LW  +  +L+L  QD 
Sbjct  113   LSGLAMGMEPICGQAFGARRSHLLGPALHRTVLLLLSASVPIALLWYYIRSLLLLVCQDM  172

Query  523   EISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVV  702
              +   A S++   LPDLI QS LHPLRIYLR+QS+TLPLT  A  A+V+H+PINY LV V
Sbjct  173   ALVAAASSYLRACLPDLILQSFLHPLRIYLRAQSITLPLTMSAGLAVVLHLPINYLLVSV  232

Query  703   LNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSW--ECFKGYKSLLNLAIPS  876
             L LGI GVAL+SVW +FNVV  L+ Y+ FS + ++T GG+S+  ECFKG++ LLN+A+PS
Sbjct  233   LRLGIGGVALASVWFHFNVVLFLLGYIYFSDL-RRTTGGLSFSSECFKGWRPLLNVAVPS  291

Query  877   CASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNEL  1056
             C SVCLEWWWYE+MI+LCGLL NP ATVASMG+LIQTTSLIYIFP+SLSF VSTRVGNEL
Sbjct  292   CISVCLEWWWYEIMIILCGLLVNPAATVASMGILIQTTSLIYIFPTSLSFAVSTRVGNEL  351

Query  1057  GAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGL  1236
             G  RP RA+ A  VGL  S  LGLAA  F V+VR+VWA +F +D+ I  LTA+ LP++GL
Sbjct  352   GENRPDRARRATTVGLSCSVALGLAAFGFAVSVRHVWARMFARDSAIFELTASALPVLGL  411

Query  1237  CELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlglla  1416
             CELGNCPQTTGCG LRG+ARPKLGA INL  FY VG+PVA  L F+   DF+GLWLGLL+
Sbjct  412   CELGNCPQTTGCGVLRGSARPKLGANINLASFYVVGMPVAVGLAFWTPLDFKGLWLGLLS  471

Query  1417  aqaSCALTMLLVLGRTDWNDQARRAKELT  1503
             AQA+C + ML+ + RTDW+ QA RA++LT
Sbjct  472   AQATCVVLMLVAIHRTDWDTQAERAQQLT  500



>ref|XP_009765487.1| PREDICTED: MATE efflux family protein 5 [Nicotiana sylvestris]
Length=549

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/496 (59%), Positives = 371/496 (75%), Gaps = 9/496 (2%)
 Frame = +1

Query  43    NPLFFLPFAFISACKEKMEAPLISEENP-----KEEDHNHNQTHLSLAAKEAKCISDIAL  207
             NP    P +F+S  K    A  ++   P      +E+  H     + A +E K I  I+ 
Sbjct  3     NPKTDSPSSFVSTEK----AHFVNSHKPMDFQADDEELLHRWPTPTEAFEEIKEIGKISG  58

Query  208   PMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQA  387
             P  +TGL+LY RSMISMLFLG LG+L LAGGSL+IGFANITGYS++SGLAMGMEPICGQA
Sbjct  59    PTALTGLVLYSRSMISMLFLGYLGELELAGGSLSIGFANITGYSVISGLAMGMEPICGQA  118

Query  388   FGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLP  567
             +GAK+ KL+G++LQRT++LLL TSIPI+ +W NM+RIL+ C QD +IS  A +FI++++P
Sbjct  119   YGAKQMKLLGITLQRTVLLLLSTSIPISFMWLNMKRILLWCGQDEDISSMAHTFIVFAIP  178

Query  568   DLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWC  747
             DL   SLLHPLRIYLR+Q++TLPLT+C+A ++++HVP+N+ LV   NLGI GVAL+ VW 
Sbjct  179   DLFFLSLLHPLRIYLRTQNITLPLTYCSAISVLLHVPLNFLLVRYFNLGIAGVALAMVWT  238

Query  748   NFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILL  927
             N N+   L  ++ FSGVYK +W   S +C +G+ SLL LAIP+C SVCLEWWWYE MI+L
Sbjct  239   NLNLFLLLCSFIYFSGVYKDSWVVPSMDCVRGWSSLLGLAIPTCVSVCLEWWWYEFMIML  298

Query  928   CGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLC  1107
             CGLLANP+AT+ASMG+LIQTTSL+Y+FPS+LS GVSTRVGN+LGA RP RA+++ IV L 
Sbjct  299   CGLLANPKATIASMGILIQTTSLVYVFPSALSLGVSTRVGNQLGANRPARARISMIVSLF  358

Query  1108  ASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRG  1287
              +  LGL A+ F   +R+ W   FT+D EI+ LT+  LPI+GLCELGNCPQTTGCG LRG
Sbjct  359   CAIGLGLGAMLFTTLMRHKWGLFFTKDVEILKLTSIALPIVGLCELGNCPQTTGCGVLRG  418

Query  1288  TARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTD  1467
             +ARP +GA INL  FY VG+PVA  LGF     F GLWLGLLAAQASCA  ML VL +TD
Sbjct  419   SARPTIGANINLGSFYLVGMPVAFILGFILKMGFAGLWLGLLAAQASCATLMLCVLFKTD  478

Query  1468  WNDQARRAKELTATIS  1515
             W  Q  R+K+LT + S
Sbjct  479   WKVQVERSKQLTQSSS  494



>ref|XP_009615001.1| PREDICTED: MATE efflux family protein 5 [Nicotiana tomentosiformis]
Length=552

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/496 (59%), Positives = 371/496 (75%), Gaps = 9/496 (2%)
 Frame = +1

Query  43    NPLFFLPFAFISACKEKMEAPLISEENP-----KEEDHNHNQTHLSLAAKEAKCISDIAL  207
             NP    P +F+S  K    A  ++   P      +E+  H     + A +E K I  I+ 
Sbjct  3     NPKTNSPSSFVSTEK----AHFVNSHKPMDFQADDEELLHRWPTPTEAFEEIKEIGKISG  58

Query  208   PMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQA  387
             P  +TGL+LY RSMISMLFLG LG+L LAGGSL+IGFANITGYS++SGLAMGMEPICGQA
Sbjct  59    PTALTGLVLYSRSMISMLFLGYLGELELAGGSLSIGFANITGYSVISGLAMGMEPICGQA  118

Query  388   FGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLP  567
             +GAK+ KL+G++LQRT++LLL TSIPI+ +W NM+RIL+ C QD +IS  A +FI++++P
Sbjct  119   YGAKQMKLLGITLQRTVLLLLSTSIPISFMWLNMKRILLWCGQDEDISSMAHTFIVFAIP  178

Query  568   DLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWC  747
             DL   SLLHPLRIYLR+Q++TLPLT+C+A ++++HVP+N+ LV   NLGI GVAL+ VW 
Sbjct  179   DLFFLSLLHPLRIYLRTQNITLPLTYCSAISVLLHVPLNFLLVRYFNLGIAGVALAMVWT  238

Query  748   NFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILL  927
             N N+   L  ++ FSGVYK +W   S +C +G+ SLL LAIP+C SVCLEWWWYE MI+L
Sbjct  239   NLNLFLLLCSFIYFSGVYKDSWVVPSMDCVRGWSSLLGLAIPTCVSVCLEWWWYEFMIML  298

Query  928   CGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLC  1107
             CGLLANP+AT+ASMG+LIQTTSL+Y+FPS+LS GVSTRVGNELGA RP RA+++ IV L 
Sbjct  299   CGLLANPKATIASMGILIQTTSLVYVFPSALSLGVSTRVGNELGANRPARARISMIVSLF  358

Query  1108  ASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRG  1287
              +  LGL A+ F   +++ W   FT+D EI+ LT+  LPI+GLCELGNCPQTTGCG LRG
Sbjct  359   CAIGLGLGAMLFTTLMKHKWGLFFTKDVEILKLTSIALPIVGLCELGNCPQTTGCGVLRG  418

Query  1288  TARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTD  1467
             +ARP +GA INL  FY VG+PVA  LGF     F GLWLGLLAAQASCA  ML VL +TD
Sbjct  419   SARPTIGANINLGSFYLVGMPVAFILGFILKMGFAGLWLGLLAAQASCATLMLCVLCKTD  478

Query  1468  WNDQARRAKELTATIS  1515
             W  Q  R+K+LT + S
Sbjct  479   WKVQVERSKQLTQSSS  494



>ref|XP_010271543.1| PREDICTED: MATE efflux family protein 5-like [Nelumbo nucifera]
Length=542

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/477 (61%), Positives = 364/477 (76%), Gaps = 0/477 (0%)
 Frame = +1

Query  85    KEKMEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLF  264
             K     P  +  +   ++  H     S A +E K I  I+ P  +TGLL+Y R+MISMLF
Sbjct  17    KTHFANPNKTMNDLNNDEELHRWPTPSEAVEEIKAIGKISGPTALTGLLMYSRAMISMLF  76

Query  265   lgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVL  444
             LG LG L LAGGSL+IGFANITGYS++SGLAMGM+PICGQA+GAK++KL+GL+LQRT++L
Sbjct  77    LGHLGQLELAGGSLSIGFANITGYSVISGLAMGMDPICGQAYGAKQWKLLGLTLQRTVLL  136

Query  445   LLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQS  624
             LL  SIPI+++W NM+RIL+ C QD+E+S  A  FIL+S+PDL   SLLHPLRIYLR+QS
Sbjct  137   LLAASIPISLMWLNMKRILLWCGQDQEVSTVAHVFILFSIPDLFFLSLLHPLRIYLRTQS  196

Query  625   VTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYK  804
             +TLPLT C+A ++++HVP+N+ LVV L +GI GVA++ VW N N+V  L  +VLFSGVYK
Sbjct  197   ITLPLTCCSAISVIIHVPLNFLLVVHLKMGIAGVAIAMVWTNLNLVLLLSAFVLFSGVYK  256

Query  805   KTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQ  984
              +W   S +C +G+ SLL LA+P+C SVCLEWWWYELMI+LCGLL NP+AT+ASMG+LIQ
Sbjct  257   DSWIAPSMDCLRGWSSLLGLAVPTCISVCLEWWWYELMIMLCGLLVNPKATIASMGILIQ  316

Query  985   TTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNV  1164
             TTSL+Y+FPSSLS GVSTRVGNELGA RP +A+ A IV L  +  LGLAA+ F   +R+ 
Sbjct  317   TTSLVYVFPSSLSLGVSTRVGNELGANRPAKARSAMIVSLACAAALGLAAMLFTTLMRHR  376

Query  1165  WASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVG  1344
             W   FT DAEI+ +T+  LPI+GLCELGNCPQTTGCG LRG+ARP  GA INL  FY VG
Sbjct  377   WGQFFTGDAEILNITSVALPIVGLCELGNCPQTTGCGVLRGSARPTTGANINLGSFYLVG  436

Query  1345  LPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATIS  1515
             +PVA ++GF A   F GLW+GLLAAQA+CA  ML VL  TDW  Q  RA++LT T S
Sbjct  437   MPVAIFMGFVAKLGFPGLWIGLLAAQATCATLMLYVLATTDWMLQVERARQLTLTSS  493



>gb|EAY87054.1| hypothetical protein OsI_08452 [Oryza sativa Indica Group]
Length=549

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/453 (66%), Positives = 357/453 (79%), Gaps = 1/453 (0%)
 Frame = +1

Query  169   AAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILS  348
             A  EA+ I  +ALPMI+TGLLLY RSMISMLFLGRLG L+LAGGSLAIGFANITGYS+LS
Sbjct  79    AGAEARSILGLALPMILTGLLLYLRSMISMLFLGRLGGLALAGGSLAIGFANITGYSVLS  138

Query  349   GLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREI  528
             GLAMGMEPICGQAFGA  + L+G+++QRT++LL+  S+PIA LW +M  +L+LC QD  I
Sbjct  139   GLAMGMEPICGQAFGAGHYDLLGVTMQRTVLLLVAASVPIAGLWVHMRPLLLLCGQDAAI  198

Query  529   SMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLN  708
             +  A+++IL SLPDL+ Q+ LHP+RIYLR+QS+ LPLT CAA AI +H+PINY  V VL 
Sbjct  199   AAVAETYILASLPDLLLQAFLHPVRIYLRTQSINLPLTVCAALAIALHLPINYVAVSVLG  258

Query  709   LGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWG-GVSWECFKGYKSLLNLAIPSCAS  885
             LGIKGVAL+SV  N N+V  L  Y+ F GV+K+T G  +S +C +G+  L++LA+PSC S
Sbjct  259   LGIKGVALASVLANLNLVLFLFGYIWFKGVHKRTGGFALSADCLRGWGELVSLALPSCIS  318

Query  886   VCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAG  1065
             VCLEWWWYE+MILLCGLLANP+ATVASMG+LIQTTSLIYIFPSSL FGVSTRV NELGA 
Sbjct  319   VCLEWWWYEIMILLCGLLANPQATVASMGILIQTTSLIYIFPSSLGFGVSTRVSNELGAN  378

Query  1066  RPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCEL  1245
             RP RA  AA VGL   F  G  A  F   VR  WA++FT D  I+ALTA+VLPI+G CEL
Sbjct  379   RPERACRAATVGLMLGFAFGGVASAFACHVRGAWATMFTADPAIVALTASVLPILGACEL  438

Query  1246  GNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqa  1425
             GNCPQTTGCG LRG+ARPK  A INLR FY VG PVA  L F+  +DF+GLWLGLLAAQA
Sbjct  439   GNCPQTTGCGVLRGSARPKDAASINLRSFYLVGTPVALILAFWYHYDFRGLWLGLLAAQA  498

Query  1426  SCALTMLLVLGRTDWNDQARRAKELTATISLVD  1524
             +C + MLLV+G TDW  +A+RA++LT    + D
Sbjct  499   TCVVRMLLVIGETDWTAEAKRAQQLTGAADIKD  531



>ref|NP_001047724.1| Os02g0676400 [Oryza sativa Japonica Group]
 dbj|BAD29535.1| membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF09638.1| Os02g0676400 [Oryza sativa Japonica Group]
 gb|EAZ31639.1| hypothetical protein OsJ_15781 [Oryza sativa Japonica Group]
Length=549

 Score =   531 bits (1368),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 297/453 (66%), Positives = 357/453 (79%), Gaps = 1/453 (0%)
 Frame = +1

Query  169   AAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILS  348
             A  EA+ I  +ALPMI+TGLLLY RSMISMLFLGRLG L+LAGGSLAIGFANITGYS+LS
Sbjct  79    AGAEARSILGLALPMILTGLLLYLRSMISMLFLGRLGGLALAGGSLAIGFANITGYSVLS  138

Query  349   GLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREI  528
             GLAMGMEPICGQAFGA  + L+G+++QRT++LL+  S+PIA LW +M  +L+LC QD  I
Sbjct  139   GLAMGMEPICGQAFGAGHYDLLGVTMQRTVLLLVAASVPIAGLWVHMRPLLLLCGQDAAI  198

Query  529   SMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLN  708
             +  A+++IL SLPDL+ Q+ LHP+RIYLR+QS+ LPLT CAA AI +H+PINY  V VL 
Sbjct  199   AAVAETYILASLPDLLLQAFLHPVRIYLRTQSINLPLTVCAALAIALHLPINYVAVSVLG  258

Query  709   LGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWG-GVSWECFKGYKSLLNLAIPSCAS  885
             LGIKGVAL+SV  N N+V  L  Y+ F GV+K+T G  +S +C +G+  L++LA+PSC S
Sbjct  259   LGIKGVALASVLANLNLVLFLFGYIWFKGVHKRTGGFALSADCLRGWGELVSLALPSCIS  318

Query  886   VCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAG  1065
             VCLEWWWYE+MILLCGLLANP+ATVASMG+LIQTTSLIYIFPSSL FGVSTRV NELGA 
Sbjct  319   VCLEWWWYEIMILLCGLLANPQATVASMGILIQTTSLIYIFPSSLGFGVSTRVSNELGAN  378

Query  1066  RPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCEL  1245
             RP RA  AA VGL   F  G  A  F   VR  WA++FT D  I+ALTA+VLPI+G CEL
Sbjct  379   RPERACRAATVGLMLGFAFGGVASAFACHVRGAWATMFTADPAIVALTASVLPILGACEL  438

Query  1246  GNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqa  1425
             GNCPQTTGCG LRG+ARPK  A INLR FY VG PVA  L F+  +DF+GLWLGLLAAQA
Sbjct  439   GNCPQTTGCGVLRGSARPKDAASINLRSFYLVGTPVALILAFWYHYDFRGLWLGLLAAQA  498

Query  1426  SCALTMLLVLGRTDWNDQARRAKELTATISLVD  1524
             +C + MLLV+G TDW  +A+RA++LT    + D
Sbjct  499   TCVVRMLLVIGETDWTAEAKRAQQLTGAADIKD  531



>emb|CDP21676.1| unnamed protein product [Coffea canephora]
Length=555

 Score =   531 bits (1368),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 285/444 (64%), Positives = 351/444 (79%), Gaps = 0/444 (0%)
 Frame = +1

Query  169   AAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILS  348
             A +E K I  I+ P  +TGLLLY R+MISMLFLG LG+L LAGGSLAIGFANITGYS++S
Sbjct  54    ALQEIKAIGKISGPTALTGLLLYSRAMISMLFLGYLGELELAGGSLAIGFANITGYSVIS  113

Query  349   GLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREI  528
             GLAMGMEPICGQA+GA++ KL+G++LQRT++LLL TSIPI++ W NM+RIL+ C QD EI
Sbjct  114   GLAMGMEPICGQAYGARQMKLLGITLQRTVLLLLATSIPISLTWLNMKRILLWCGQDEEI  173

Query  529   SMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLN  708
             S  + +F++Y++PDL   SLLHPLRIYLR+QS+TLPLT+C+A ++++HVP+N+ LV   N
Sbjct  174   SSMSHTFLVYAIPDLFFLSLLHPLRIYLRTQSITLPLTYCSAISVLLHVPLNFLLVRYFN  233

Query  709   LGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASV  888
             +GI GVAL+ VW N N+   L  ++ FSGVYK +W   S +C +G+ SLL LA+P+C SV
Sbjct  234   MGIAGVALAMVWTNLNLFLLLCSFLYFSGVYKDSWVAPSMDCLRGWSSLLALAVPTCVSV  293

Query  889   CLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGR  1068
             CLEWWWYE MI+LCGLL NP+ATVASMG+LIQTTSL+Y+FPS+LS GVSTRVGNELGA R
Sbjct  294   CLEWWWYEFMIMLCGLLLNPKATVASMGILIQTTSLVYVFPSALSLGVSTRVGNELGANR  353

Query  1069  PGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELG  1248
             P  A+++ IV L  +  LGLAA+ F + +R+ W   FT DAEI+ LT+  LPI+GLCELG
Sbjct  354   PASARISMIVSLICAVALGLAAMLFTILMRHQWGRFFTSDAEILELTSVALPIVGLCELG  413

Query  1249  NCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaS  1428
             NCPQTTGCG LRG+ARP  GA INL  FY VG+PVA  +GF     F GLWLGLLAAQAS
Sbjct  414   NCPQTTGCGVLRGSARPTTGANINLGSFYLVGMPVAILIGFVLKMGFAGLWLGLLAAQAS  473

Query  1429  CALTMLLVLGRTDWNDQARRAKEL  1500
             CAL ML VL RTDW  Q  RAKEL
Sbjct  474   CALLMLYVLCRTDWIVQVERAKEL  497



>ref|NP_001170523.1| putative MATE efflux family protein [Zea mays]
 gb|ACR33951.1| unknown [Zea mays]
 tpg|DAA36411.1| TPA: putative MATE efflux family protein [Zea mays]
Length=568

 Score =   531 bits (1368),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 304/460 (66%), Positives = 366/460 (80%), Gaps = 3/460 (1%)
 Frame = +1

Query  163   SLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSI  342
             S A  EA+ I  +ALPMI+TGLLLY RSMISMLFLGRLG L+LAGGSLAIGFANITGYS+
Sbjct  85    SDAHAEARSILGLALPMILTGLLLYLRSMISMLFLGRLGGLALAGGSLAIGFANITGYSV  144

Query  343   LSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDR  522
             LSGLAMGMEPICGQAFGA  F L+G+++QRT++LL+  ++PI  LW +M  +L+LC QD 
Sbjct  145   LSGLAMGMEPICGQAFGAGNFSLLGITMQRTVLLLIAAAVPIGGLWMHMRPLLLLCGQDA  204

Query  523   EISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVV  702
              I+  A+++IL SLPDL+ Q+ +HP+RIYLR+QS+ LPLT CAA AIV+H+PINY LV V
Sbjct  205   GIAAVAETYILASLPDLVLQAFIHPVRIYLRAQSINLPLTVCAALAIVIHLPINYVLVTV  264

Query  703   LNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGV-SWECFKGYKSLLNLAIPSC  879
             L LGI+GVA +SV  N N++  LV Y+LF  V+K+T G + S E F+G+  L++LA+PSC
Sbjct  265   LGLGIRGVAFASVLANLNLLLFLVAYILFKSVHKRTGGFLLSRESFRGWGELVSLALPSC  324

Query  880   ASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELG  1059
              SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTTSLIYIFPSSLSFGVSTRV NELG
Sbjct  325   VSVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTSLIYIFPSSLSFGVSTRVSNELG  384

Query  1060  AGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLC  1239
             A RP  A  AA VGL   F  G  A  F   VRNVWAS+FT D  I+ALTA+VLPI+GLC
Sbjct  385   ANRPEEASRAAAVGLMLGFAFGGLASAFAFLVRNVWASMFTADPAIIALTASVLPILGLC  444

Query  1240  ELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaa  1419
             ELGNCPQTTGCG LRG+ARPK  A INLR FY VG PVA  L F+  +DF+GLWLGLLAA
Sbjct  445   ELGNCPQTTGCGVLRGSARPKDAASINLRSFYLVGTPVALVLAFWLHYDFKGLWLGLLAA  504

Query  1420  qaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDDD  1539
             QA+C + MLLV+GRTDW  +A+R+++LT    LV +D DD
Sbjct  505   QATCMVRMLLVIGRTDWACEAKRSRQLTG--GLVAEDSDD  542



>ref|XP_006364986.1| PREDICTED: MATE efflux family protein 5-like [Solanum tuberosum]
Length=551

 Score =   530 bits (1364),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 297/496 (60%), Positives = 372/496 (75%), Gaps = 9/496 (2%)
 Frame = +1

Query  43    NPLFFLPFAFISACKEKMEAPLISEENP-----KEEDHNHNQTHLSLAAKEAKCISDIAL  207
             NP    P +F+S   EK+    ++   P      EE+        S A +E K I  IA 
Sbjct  3     NPKPSSPSSFVS--NEKVH--FVNSNKPIDVQVDEEEQLRKWPTPSEAFEEMKEIGKIAG  58

Query  208   PMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQA  387
             P  +TGL+LY RSMISMLFLG LG+L LAGGSL+IGFANITGYS++SGLAMGMEPICGQA
Sbjct  59    PTALTGLVLYSRSMISMLFLGYLGELELAGGSLSIGFANITGYSVISGLAMGMEPICGQA  118

Query  388   FGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLP  567
             +GAK+ KL+G++LQRT++LLL TSIPI+ +W NM+RIL+ C QD +IS  A +FI++++P
Sbjct  119   YGAKQMKLLGITLQRTVLLLLSTSIPISFMWLNMKRILLWCGQDEDISNMAHTFIVFAIP  178

Query  568   DLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWC  747
             DL   SLLHPLRIYLR+Q++TLPLT+C+A ++++HVP+N+ LV   +LGI GVAL+ V  
Sbjct  179   DLFFLSLLHPLRIYLRTQNITLPLTYCSAISVLLHVPLNFLLVRYCDLGIAGVALAMVLT  238

Query  748   NFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILL  927
             N N    L  +V FSGVYK +W   S +C +G+ SLL LAIP+C SVCLEWWWYE MILL
Sbjct  239   NLNFFLLLCSFVYFSGVYKDSWVAPSMDCVRGWSSLLALAIPTCVSVCLEWWWYEFMILL  298

Query  928   CGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLC  1107
             CGLLANP+AT+ASMG+LIQTTSL+Y+FPSSLS GVSTRVGNELGA RPGRA+++ IV L 
Sbjct  299   CGLLANPKATIASMGILIQTTSLVYVFPSSLSLGVSTRVGNELGANRPGRARISMIVSLF  358

Query  1108  ASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRG  1287
              +  LGL A+ F   +R+ W   FT+D EI+ LT+  LPI+GLCELGNCPQTTGCG LRG
Sbjct  359   CAMALGLGAMLFTTLMRHKWGGFFTKDVEILKLTSIALPIVGLCELGNCPQTTGCGVLRG  418

Query  1288  TARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTD  1467
             +ARP +GA INL  FYFVG+PVA  +GF     F GLW+GLLAAQASCA+ ML VL +TD
Sbjct  419   SARPTIGANINLGSFYFVGMPVAILVGFLLKKGFGGLWIGLLAAQASCAILMLYVLCKTD  478

Query  1468  WNDQARRAKELTATIS  1515
             W  Q  R+K+LT + S
Sbjct  479   WKVQVERSKQLTQSTS  494



>ref|XP_006647679.1| PREDICTED: MATE efflux family protein 9-like [Oryza brachyantha]
Length=552

 Score =   529 bits (1363),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 299/492 (61%), Positives = 368/492 (75%), Gaps = 11/492 (2%)
 Frame = +1

Query  58    LPFAFISACKEKMEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLY  237
             LP  F+ A KE    P      P     +        A  EA+ I ++ALPMI+TGLLLY
Sbjct  55    LPGRFVRAVKEAWSVPF-----PMMRSMSAGA-----AGAEARSILELALPMILTGLLLY  104

Query  238   CRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMG  417
              RSMISMLFLGRLG L+LAGGSLAIGFANITGYS+LSGLAMGMEPICGQAFGA  + L+G
Sbjct  105   LRSMISMLFLGRLGGLALAGGSLAIGFANITGYSVLSGLAMGMEPICGQAFGAGHYDLLG  164

Query  418   LSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHP  597
             +++QRT++LL+  + PIA LW +M  +L+LC QD  I+  A+++IL SLPDL+ Q+ LHP
Sbjct  165   VTMQRTVLLLVAAAAPIAGLWVHMRPLLLLCGQDAAIAAVAETYILASLPDLLLQAFLHP  224

Query  598   LRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVV  777
             +RIYLR+QS+ LPLT CAA AI +H+PINY LV VL LGIKGVAL+SV  N N+V  L  
Sbjct  225   VRIYLRTQSINLPLTVCAALAIALHLPINYVLVSVLGLGIKGVALASVLANLNLVLFLFG  284

Query  778   YVLFSGVYKKTWG-GVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRA  954
             Y+   GV+K+T G  +S +C +G+  L++LA+PSC SVCLEWWWYE+MIL+CGLLANP+A
Sbjct  285   YIWLKGVHKRTGGFAISADCVRGWGELVSLALPSCVSVCLEWWWYEIMILMCGLLANPKA  344

Query  955   TVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAA  1134
             TVASMG+LIQTTSLIYIFPSSL +GVSTRV NELGA RP  A  AA VGL   F  G  A
Sbjct  345   TVASMGILIQTTSLIYIFPSSLGYGVSTRVSNELGASRPEHAGRAATVGLMLGFAFGGVA  404

Query  1135  LTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAK  1314
               F   VR  WA++FT D  I+ALTA+VLPI+G CELGNCPQT GCG LRG+ARPK  A 
Sbjct  405   SAFACLVRGSWATMFTTDPAIVALTASVLPILGACELGNCPQTAGCGVLRGSARPKDAAS  464

Query  1315  INLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAK  1494
             INLR FY VG PVA  L F+  +DF+GLWLGLLAAQA+C + MLLV+G+TDW+ +A+RA+
Sbjct  465   INLRSFYLVGTPVALILAFWCHYDFKGLWLGLLAAQATCVVCMLLVIGQTDWSAEAKRAQ  524

Query  1495  ELTATISLVDDD  1530
             +LT  + + +  
Sbjct  525   QLTGAVDIKESS  536



>ref|XP_004238041.1| PREDICTED: MATE efflux family protein 5 [Solanum lycopersicum]
Length=550

 Score =   529 bits (1363),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 296/497 (60%), Positives = 371/497 (75%), Gaps = 9/497 (2%)
 Frame = +1

Query  43    NPLFFLPFAFISACKEKMEAPLISEENP-----KEEDHNHNQTHLSLAAKEAKCISDIAL  207
             NP    P +F+S   EK+    ++   P      +E+  H     S A +E K I  IA 
Sbjct  3     NPKPSSPSSFVS--NEKVH--FVNSNKPIDVQVDDEEQLHKWPTPSEAFEEMKEIGKIAG  58

Query  208   PMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQA  387
             P  +TGL+LY RSMISMLFLG LG+L LAGGSL+IGFANITGYS++SGLAMGMEPICGQA
Sbjct  59    PTAITGLVLYSRSMISMLFLGYLGELELAGGSLSIGFANITGYSVISGLAMGMEPICGQA  118

Query  388   FGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLP  567
             +GAK+ KL+G++LQRT++LLL TSIPI+ +W NM+ IL+ C QD +IS  A +FIL+++P
Sbjct  119   YGAKQMKLLGITLQRTVLLLLSTSIPISFMWLNMKTILLWCGQDEDISNMAHTFILFAIP  178

Query  568   DLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWC  747
             DL   SLLHPLRIYLR+Q++TLPLT+C+A ++++HVP+N+ LV   +LGI GVAL+ V  
Sbjct  179   DLFFLSLLHPLRIYLRTQNITLPLTYCSAISVLLHVPLNFLLVRYCDLGIAGVALAMVLT  238

Query  748   NFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILL  927
             N N    L  +V FSGVYK +W   S +C +G+ SLL LAIP+C SVCLEWWWYE MILL
Sbjct  239   NLNFFLLLCSFVYFSGVYKDSWVAPSMDCVRGWSSLLALAIPTCVSVCLEWWWYEFMILL  298

Query  928   CGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLC  1107
             CGLL NP+AT+ASMG+LIQTTSL+Y+FPSSLS GVSTRVGNELGA RPGRA+++ IV L 
Sbjct  299   CGLLPNPKATIASMGILIQTTSLVYVFPSSLSLGVSTRVGNELGANRPGRARVSMIVSLV  358

Query  1108  ASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRG  1287
              +  LGL A+ F   +R+ W  +FT+D EI+ LT+  LPI+GLCELGNCPQTTGCG LRG
Sbjct  359   CAMALGLGAMLFATLMRHKWGGLFTKDVEILKLTSIALPIVGLCELGNCPQTTGCGVLRG  418

Query  1288  TARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTD  1467
             +ARP +GA INL  FY VG+PVA  +GF     F GLW+GLLAAQASCA+ ML VL +TD
Sbjct  419   SARPTIGANINLGSFYLVGMPVAILVGFILKKGFGGLWIGLLAAQASCAILMLYVLCKTD  478

Query  1468  WNDQARRAKELTATISL  1518
             W  Q  R+K+LT   SL
Sbjct  479   WKVQVERSKQLTQPTSL  495



>dbj|BAJ96265.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=491

 Score =   526 bits (1356),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 294/456 (64%), Positives = 360/456 (79%), Gaps = 1/456 (0%)
 Frame = +1

Query  175   KEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGL  354
             +EA+ I  +A PMI+TGLLLY RSMISMLFLGRLG L+LAGGSLAIGFANITGYS+LSGL
Sbjct  18    QEARSILGLAFPMILTGLLLYLRSMISMLFLGRLGGLALAGGSLAIGFANITGYSVLSGL  77

Query  355   AMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISM  534
             AMGMEPICGQAFGA  + L+GL++QRT++LL+  ++PI  LW +M  +L+LC QD  I+ 
Sbjct  78    AMGMEPICGQAFGAGNYSLIGLTVQRTVLLLIAAAVPIGGLWMHMRPLLLLCGQDAGIAA  137

Query  535   EAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLG  714
              A+++IL SLPDL+ Q+ LHP+RIYLR QSV LPLT CA  AI +H+PINY LV VL LG
Sbjct  138   VAETYILASLPDLLLQAFLHPVRIYLRMQSVNLPLTVCATLAIAIHLPINYVLVTVLGLG  197

Query  715   IKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWG-GVSWECFKGYKSLLNLAIPSCASVC  891
             +KGVA++SV  N N++  L+ Y+ F GV+K+T G  +S E F+G+  L++LA+PSC SVC
Sbjct  198   VKGVAMASVLANLNLLLLLLAYIFFKGVHKRTGGFALSAESFRGWGELISLALPSCVSVC  257

Query  892   LEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRP  1071
             LEWWWYE+MILLCGLL NP+ATVASMG+LIQTTSLIYIFPSSLSFGVSTRV NELGAG+P
Sbjct  258   LEWWWYEIMILLCGLLLNPQATVASMGILIQTTSLIYIFPSSLSFGVSTRVSNELGAGQP  317

Query  1072  GRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGN  1251
              +A  AA  G+   F  G  A  F   VR+VWAS+FT D  I+ALTA+VLPI+GLCELGN
Sbjct  318   EQASRAATAGIMLGFAFGALASAFAFLVRDVWASMFTADPAIIALTASVLPILGLCELGN  377

Query  1252  CPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSC  1431
             CPQTTGCG LRG+ARPK  A INLR FY VG PVA  L F+  +DF+GLW GLLAAQA+C
Sbjct  378   CPQTTGCGVLRGSARPKDAANINLRSFYLVGTPVALVLAFWFHYDFKGLWFGLLAAQATC  437

Query  1432  ALTMLLVLGRTDWNDQARRAKELTATISLVDDDDDD  1539
              + MLLV+GRTDW  +A+R+K+LT    +   D D+
Sbjct  438   MVRMLLVIGRTDWAAEAKRSKQLTGQDKVGAADGDE  473



>ref|XP_008663473.1| PREDICTED: MATE efflux family protein 5-like [Zea mays]
 gb|AFW59144.1| putative MATE efflux family protein [Zea mays]
Length=573

 Score =   530 bits (1364),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 300/459 (65%), Positives = 361/459 (79%), Gaps = 1/459 (0%)
 Frame = +1

Query  163   SLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSI  342
             S A  EA+ I  +ALPMI+TGLLLY RSMISMLFLGRLG L+LAGGSLAIGFANITGYS+
Sbjct  87    SEARGEARSILGLALPMILTGLLLYLRSMISMLFLGRLGGLALAGGSLAIGFANITGYSV  146

Query  343   LSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDR  522
             LSGLAMGMEPICGQAFGA  F L+G++ QRT++LL+  ++PI  LW +M  +L+LC QD 
Sbjct  147   LSGLAMGMEPICGQAFGAGNFPLLGVTTQRTVLLLVAAAVPIGGLWMHMRPLLLLCGQDT  206

Query  523   EISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVV  702
              I+  A+++IL SLPDL+ Q+ +HP+RIYLR+QS+ LPLT CAA AI +H+P+NY LV V
Sbjct  207   GIASVAETYILASLPDLVLQAFIHPVRIYLRAQSINLPLTVCAALAIAIHLPVNYVLVTV  266

Query  703   LNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGV-SWECFKGYKSLLNLAIPSC  879
             L LGI+GVA +SV  N N++  L+ Y+LF GV+++T G V S E F+G+  L++LA+PSC
Sbjct  267   LGLGIRGVAFASVLANLNLLLFLLAYILFRGVHRRTGGFVLSRESFRGWGELVSLALPSC  326

Query  880   ASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELG  1059
              SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTTSLIYIFPSSLSFGVSTRV NELG
Sbjct  327   VSVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTSLIYIFPSSLSFGVSTRVSNELG  386

Query  1060  AGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLC  1239
             A RP  A  AA VGL   F  G  A  F   VRNVWAS+FT D  I+ALTA+VLPI+GLC
Sbjct  387   ANRPEEASRAAAVGLVLGFASGGLASAFAFLVRNVWASMFTADPAIVALTASVLPILGLC  446

Query  1240  ELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaa  1419
             ELGNCPQTTGCG LRG+ARPK  A INLR FY VG PVA  L F+  +DF+GLW GLLAA
Sbjct  447   ELGNCPQTTGCGVLRGSARPKDAASINLRSFYLVGTPVALVLAFWLHYDFKGLWFGLLAA  506

Query  1420  qaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDD  1536
             QA+C + MLLV+GRTDW  +A+R++ELT     V  D D
Sbjct  507   QATCMVRMLLVIGRTDWACEAKRSRELTGAGGAVAKDSD  545



>ref|XP_011016948.1| PREDICTED: MATE efflux family protein 5 [Populus euphratica]
Length=555

 Score =   529 bits (1362),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 296/493 (60%), Positives = 368/493 (75%), Gaps = 4/493 (1%)
 Frame = +1

Query  43    NPLFFLPFAFISACKEKMEAPLISEENPKEEDHNHNQTHL----SLAAKEAKCISDIALP  210
             NP    P +F+   K +         +P  +D    Q H     S A +E K I  I+ P
Sbjct  3     NPTPAKPSSFLCPKKPQFSNKPNKTMDPYTDDDQEEQLHRWPTPSEALQEIKEIGKISGP  62

Query  211   MIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAF  390
             + +TGL+LY R+MISMLFLG LG+L LAGGSL+IGFANITGYS+LSGLAMGMEPICGQA+
Sbjct  63    IAMTGLVLYSRAMISMLFLGYLGELELAGGSLSIGFANITGYSVLSGLAMGMEPICGQAY  122

Query  391   GAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPD  570
             GAK +K++GL+LQRT++LLL TS+PI+ +W NM+ IL+ C QD+EIS  A +FIL+S+PD
Sbjct  123   GAKHWKILGLTLQRTVLLLLSTSVPISFMWLNMKSILLWCGQDKEISSVAHTFILFSIPD  182

Query  571   LIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCN  750
             L   SLLHPLRIYLR+QS+TLP+T+C+A ++++HVP+N+ LVV   +GI GVA + VW N
Sbjct  183   LFLLSLLHPLRIYLRTQSITLPITYCSAISVLLHVPLNFLLVVHFKMGIAGVATAMVWTN  242

Query  751   FNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLC  930
              N+  SL  ++ FSGVYK +W   S +C +G+ SLL LA+P+C SVCLEWWWYE MI+LC
Sbjct  243   LNLFLSLASFIYFSGVYKDSWVYPSMDCLRGWSSLLALAVPTCVSVCLEWWWYEFMIMLC  302

Query  931   GLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCA  1110
             GLL NP+ATVASMG+LIQTTSL+Y+FPSSLS GVSTRVGNELGA RP +A+++ IV L  
Sbjct  303   GLLINPKATVASMGILIQTTSLVYVFPSSLSLGVSTRVGNELGANRPAKARISMIVSLVC  362

Query  1111  SFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGT  1290
             +  LGL A+ F   +R+ W   FT DAEI+ LT+  LPI GLCELGNCPQTTGCG LRG+
Sbjct  363   AVALGLMAMLFTTLMRHQWGRFFTNDAEILELTSIALPIAGLCELGNCPQTTGCGVLRGS  422

Query  1291  ARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDW  1470
             ARP +GA INL  FY VG+PVA +LGF A   F GLWLGLLAAQASCAL ML VL  TDW
Sbjct  423   ARPTIGANINLGSFYLVGMPVAMFLGFVAKMGFAGLWLGLLAAQASCALLMLYVLCTTDW  482

Query  1471  NDQARRAKELTAT  1509
               Q  RA+ LT T
Sbjct  483   TVQIERARLLTET  495



>ref|XP_002446957.1| hypothetical protein SORBIDRAFT_06g025870 [Sorghum bicolor]
 gb|EES11285.1| hypothetical protein SORBIDRAFT_06g025870 [Sorghum bicolor]
Length=567

 Score =   529 bits (1363),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 299/459 (65%), Positives = 361/459 (79%), Gaps = 5/459 (1%)
 Frame = +1

Query  163   SLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSI  342
             S A  EA+ I  +ALPMI+TGLLLY RSMISMLFLGRLG L+LAGGSLAIGFANITGYS+
Sbjct  86    SDARGEARSILGLALPMILTGLLLYLRSMISMLFLGRLGGLALAGGSLAIGFANITGYSV  145

Query  343   LSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDR  522
             LSGLAMGMEPICGQAFGA  F L+G+++QRT++LL+  ++PI  LW +M  +L+LC QD 
Sbjct  146   LSGLAMGMEPICGQAFGAGNFSLLGITMQRTVLLLIAAAVPIGGLWMHMRPLLLLCGQDT  205

Query  523   EISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVV  702
              I+  A+++IL SLPDL+ Q+ +HP+RIYLR+QS+ LPLT CAA AI +H+PINY LV V
Sbjct  206   GIAAVAETYILASLPDLVLQAFIHPVRIYLRAQSINLPLTVCAALAIAIHLPINYVLVTV  265

Query  703   LNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGV-SWECFKGYKSLLNLAIPSC  879
             L LGI+GVA +SV  N N++  L+ Y+ F GV+++T G V S E F+G+  L +LA+PSC
Sbjct  266   LGLGIRGVAFASVLANLNLLLFLLGYIFFMGVHRRTGGFVLSRESFRGWGELASLALPSC  325

Query  880   ASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELG  1059
              SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTTSLIYIFPSSLSFGVSTRV NELG
Sbjct  326   VSVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTSLIYIFPSSLSFGVSTRVSNELG  385

Query  1060  AGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLC  1239
             A RP  A  AA VGL   F  G  A  F  AVRNVWAS+FT D  I+ALTA+VLP++GLC
Sbjct  386   ANRPEDASRAATVGLMLGFAFGGLASAFAFAVRNVWASMFTADPAIIALTASVLPVLGLC  445

Query  1240  ELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaa  1419
             ELGNCPQTTGCG LRG+ARPK  A INLR FY VG PVA  L F+  +DF+GLW GLLAA
Sbjct  446   ELGNCPQTTGCGVLRGSARPKDAASINLRSFYLVGTPVALVLAFWLHYDFKGLWFGLLAA  505

Query  1420  qaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDD  1536
             QA+C + MLLV+GRTDW  +A+R+++LT       D DD
Sbjct  506   QATCMVRMLLVIGRTDWASEAKRSRQLTGA----KDSDD  540



>ref|XP_008795373.1| PREDICTED: MATE efflux family protein 5-like [Phoenix dactylifera]
Length=554

 Score =   528 bits (1361),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 312/478 (65%), Positives = 373/478 (78%), Gaps = 7/478 (1%)
 Frame = +1

Query  94    MEAPLISEENPKEEDHN------HNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMIS  255
             + APL+ ++       +         T L+LA  EA  I  +ALPM ++GLL+Y RSMIS
Sbjct  25    LAAPLVQKQQTSTSPSDAPVLTPKPPTQLALAFVEANSILSLALPMALSGLLIYSRSMIS  84

Query  256   MLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRT  435
             MLFLGRLGDL LAGG+LAIGFANITGYS+LSGLAMGMEPICGQAFGAK+  L+GL+LQRT
Sbjct  85    MLFLGRLGDLPLAGGALAIGFANITGYSVLSGLAMGMEPICGQAFGAKKLPLLGLALQRT  144

Query  436   IVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLR  615
             I+LLL  SIPIA++W NM  +L+LC QD  I+  AQS+IL+SLPDL  QS LHPLRIYLR
Sbjct  145   ILLLLSASIPIALIWANMRPLLLLCGQDAGIAAAAQSYILFSLPDLFLQSFLHPLRIYLR  204

Query  616   SQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSG  795
             SQS+TLPL + A  A ++H+PINY LV +L+LGI GVAL+SVW N N++  L+ Y+  SG
Sbjct  205   SQSITLPLAYAATLAALLHLPINYLLVSILHLGIPGVALASVWTNLNLLLLLLAYLYLSG  264

Query  796   VYKKTWGGV-SWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMG  972
             V K T G + S E F G+ SLLNLA+PSC SVCLEWWWYE+MILLCGLL NP+ TVASMG
Sbjct  265   VSKSTGGIIPSAESFGGWSSLLNLALPSCVSVCLEWWWYEIMILLCGLLLNPKCTVASMG  324

Query  973   VLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVA  1152
             +LIQTTSLIYIFPSSLSFGVSTRV NELGA RP RA+ AA VGL +SF+LGL AL+F V+
Sbjct  325   ILIQTTSLIYIFPSSLSFGVSTRVSNELGANRPDRARRAAFVGLSSSFLLGLIALSFAVS  384

Query  1153  VRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCF  1332
             VR+VW+ +FT D  I  LT +VLPI+GLCELGNCPQTTGCG LRG+ARP+ GA +NL  F
Sbjct  385   VRHVWSRMFTADPAIAVLTTSVLPILGLCELGNCPQTTGCGVLRGSARPRAGANVNLSSF  444

Query  1333  YFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTA  1506
             Y VG PVA  L F+ G DF+GLWLGLLAAQA+C + ML V+ RTDW+ QA RA+ LT 
Sbjct  445   YLVGTPVAVGLAFWGGLDFKGLWLGLLAAQATCVVLMLAVIHRTDWDLQAERARRLTG  502



>ref|XP_007018359.1| Multidrug and toxin extrusion protein 1 [Theobroma cacao]
 gb|EOY15584.1| Multidrug and toxin extrusion protein 1 [Theobroma cacao]
Length=549

 Score =   528 bits (1360),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 287/463 (62%), Positives = 362/463 (78%), Gaps = 1/463 (0%)
 Frame = +1

Query  124   PKEEDHN-HNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslagg  300
             PK+++   H    LS A +E K I  I+ P  ++ LLLY R+MISMLFLG LG+L LAGG
Sbjct  28    PKDDEEQLHRLPTLSEAMEEIKAIGKISGPTAMSSLLLYSRAMISMLFLGYLGELELAGG  87

Query  301   slaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILW  480
             SL+IG ANITGYS++SGLAMGMEPICGQA+GAK++KL+GL+LQRT++LLL  SIPI+ +W
Sbjct  88    SLSIGVANITGYSVISGLAMGMEPICGQAYGAKQWKLLGLTLQRTVLLLLSASIPISFMW  147

Query  481   CNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFA  660
              NM+ IL+ C QD+EIS  A++FI++S+PDL   SLLHPLRIYLR+QS+TLP+T+C+A +
Sbjct  148   VNMKGILLWCGQDQEISSVARTFIIFSIPDLFFLSLLHPLRIYLRTQSITLPVTYCSAIS  207

Query  661   IVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFK  840
             +++HVP+N+ LVV   LG+ GVA++ VW N N+   L  +V FSGVYK +W   S +C +
Sbjct  208   VLLHVPLNFLLVVHFKLGVAGVAIAMVWTNLNLFLLLSSFVYFSGVYKDSWVTPSTDCLR  267

Query  841   GYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSL  1020
             G+ SLL LA+P+CASVCLEWWWYE+MILLCGLLANP+AT+ASMG+LIQTTSL+Y FPS+L
Sbjct  268   GWSSLLGLAVPTCASVCLEWWWYEIMILLCGLLANPKATIASMGILIQTTSLVYCFPSAL  327

Query  1021  SFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIM  1200
             S GVSTRVGNELGA RPG+A+++ IV L  +  +G+AA+ F   +R+ W  +FT DAEI+
Sbjct  328   SVGVSTRVGNELGAKRPGQARISMIVSLFCAVAIGVAAMLFATLMRHQWGKLFTNDAEIL  387

Query  1201  ALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAG  1380
              LTA  LPI GLCELGNCPQTTGCG LRG+ARP +GA INL  FY VG+PV+  +GF   
Sbjct  388   ELTAVALPIAGLCELGNCPQTTGCGVLRGSARPTIGANINLGSFYLVGMPVSLLMGFMTK  447

Query  1381  FDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTAT  1509
               F GLWLGLLAAQ SCA  ML+VL RTDW  QA RA  LT T
Sbjct  448   MGFAGLWLGLLAAQVSCAFFMLVVLCRTDWMLQAERASVLTQT  490



>ref|XP_002301101.2| MATE efflux family protein [Populus trichocarpa]
 gb|EEE80374.2| MATE efflux family protein [Populus trichocarpa]
Length=555

 Score =   528 bits (1360),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 295/493 (60%), Positives = 368/493 (75%), Gaps = 4/493 (1%)
 Frame = +1

Query  43    NPLFFLPFAFISACKEKMEAPLISEENPKEEDHNHNQTH----LSLAAKEAKCISDIALP  210
             NP    P +F+   K +         +P  +D    Q H     S A +E K I+ I+ P
Sbjct  3     NPTPAKPSSFLCPKKPQFGNKPNKTMDPYTDDDQEEQLHGWPTPSEALQEIKEIAKISGP  62

Query  211   MIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAF  390
               +TGL+LY R+MISMLFLG LG+L LAGGSL+IGFANITGYS+LSGLAMGMEPICGQA+
Sbjct  63    TAMTGLVLYSRAMISMLFLGYLGELELAGGSLSIGFANITGYSVLSGLAMGMEPICGQAY  122

Query  391   GAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPD  570
             GAK +K++GL+LQRT++LLL TS+PI+ +W NM+ IL+ C QD+EIS  A +FIL+S+PD
Sbjct  123   GAKHWKILGLTLQRTVLLLLSTSVPISFMWLNMKSILLWCGQDKEISSVAHTFILFSIPD  182

Query  571   LIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCN  750
             L   SLLHPLRIYLR+QS+TLP+T+C+A ++++HVP+N+ LVV   +GI GVA++ VW N
Sbjct  183   LFLLSLLHPLRIYLRTQSITLPITYCSAISVLLHVPLNFLLVVHFKMGIAGVAIAMVWTN  242

Query  751   FNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLC  930
              N+  SL  ++ FSGVYK +W   S +C +G+ SLL LA+P+C SVCLEWWWYE MI+LC
Sbjct  243   LNLFLSLASFIYFSGVYKDSWVSPSMDCLRGWSSLLTLAVPTCVSVCLEWWWYEFMIMLC  302

Query  931   GLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCA  1110
             GLL NP+ATVASMG+LIQTTSL+Y+FPSSLS GVSTRVGNELGA RP +A+++ IV L  
Sbjct  303   GLLINPKATVASMGILIQTTSLVYVFPSSLSLGVSTRVGNELGANRPAKARISMIVSLVC  362

Query  1111  SFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGT  1290
             +  LGL A+ F   +R+ W   FT DAEI+ LT+  LPI GLCELGNCPQTTGCG LRG+
Sbjct  363   AVALGLMAMLFTTLMRHQWGRFFTNDAEILELTSIALPIAGLCELGNCPQTTGCGVLRGS  422

Query  1291  ARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDW  1470
             ARP +GA INL  FY VG+PVA +LGF A   F GLWLGLLAAQASCAL ML  L  TDW
Sbjct  423   ARPTIGANINLGSFYLVGMPVAMFLGFVAKMGFAGLWLGLLAAQASCALLMLYALCTTDW  482

Query  1471  NDQARRAKELTAT  1509
               Q  RA+ LT T
Sbjct  483   MVQVERARLLTQT  495



>ref|XP_010268640.1| PREDICTED: MATE efflux family protein 5-like [Nelumbo nucifera]
Length=539

 Score =   527 bits (1357),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 283/443 (64%), Positives = 352/443 (79%), Gaps = 0/443 (0%)
 Frame = +1

Query  175   KEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGL  354
             +E K +  I+ P  +TGL++Y R+MISM+FLG LG L LAGGSL+IGFANITGYS++SGL
Sbjct  47    EEIKAMGKISSPTALTGLIMYSRAMISMIFLGHLGQLELAGGSLSIGFANITGYSVISGL  106

Query  355   AMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISM  534
             AMGMEPICGQA+GAK++KL+GL+LQRT++LLL TSIPI+ +W NM+RIL+ C QD EIS 
Sbjct  107   AMGMEPICGQAYGAKQWKLLGLTLQRTVLLLLSTSIPISAMWLNMKRILLWCGQDEEISS  166

Query  535   EAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLG  714
              A  FI++S+PDL   SLLHPLRIYLR+Q +TLPLT+C+A ++++HVP+N+ LVV   +G
Sbjct  167   MAHVFIVFSIPDLFFLSLLHPLRIYLRTQGITLPLTYCSAISVLLHVPLNFLLVVHFKMG  226

Query  715   IKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCL  894
             I GVA++ VW N N+   L  ++ FSGVYK +W   S +C +G+ SLL LA+P+C SVCL
Sbjct  227   IAGVAIAMVWTNLNLFLLLSAFIFFSGVYKDSWVAPSMDCLRGWSSLLGLAVPTCVSVCL  286

Query  895   EWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPG  1074
             EWWWYE MI+LCGLL NP+AT+ASMG+LIQTTSL+Y+FPSSLS GVSTRVGNELGA RP 
Sbjct  287   EWWWYEFMIMLCGLLVNPKATIASMGILIQTTSLVYVFPSSLSLGVSTRVGNELGANRPA  346

Query  1075  RAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNC  1254
             +A++A IV L  +  LGLAA+ F   VR+ W   FT DAEI+ LT+  LPI+GLCELGNC
Sbjct  347   KARIAMIVSLACAAALGLAAMLFTTLVRHRWGLFFTDDAEILELTSVALPIVGLCELGNC  406

Query  1255  PQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCA  1434
             PQTTGCG LRG+ARP  GA INL  FY VG+PVA ++GF A   F GLW+GLLAAQASCA
Sbjct  407   PQTTGCGVLRGSARPTTGANINLGSFYLVGMPVAIFMGFVAKMGFAGLWIGLLAAQASCA  466

Query  1435  LTMLLVLGRTDWNDQARRAKELT  1503
             + ML VLG TDW  QA RA+ELT
Sbjct  467   ILMLYVLGTTDWVVQAERARELT  489



>ref|XP_004976540.1| PREDICTED: MATE efflux family protein 9-like [Setaria italica]
Length=561

 Score =   527 bits (1358),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 294/446 (66%), Positives = 358/446 (80%), Gaps = 1/446 (0%)
 Frame = +1

Query  169   AAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILS  348
             A  EA+ I  +ALPMI+TGLLLY RSMISMLFLGRLG L+LAGGSLAIGFANITGYS+LS
Sbjct  82    ARGEARSILALALPMILTGLLLYLRSMISMLFLGRLGGLALAGGSLAIGFANITGYSVLS  141

Query  349   GLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREI  528
             GLAMGMEPICGQAFGA  + L+G+++QRT++LL+  ++PI  LW +M  +L+LC Q+  I
Sbjct  142   GLAMGMEPICGQAFGAGHYSLLGITMQRTVLLLIAAAVPIGGLWMHMRPLLLLCGQEASI  201

Query  529   SMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLN  708
             +  A+++IL SLPDL+ Q+ +HP+RIYLR+QS+ LPLT CAA AI +H+PINY LV VL 
Sbjct  202   AAAAETYILASLPDLVLQAFIHPVRIYLRTQSINLPLTVCAALAIAIHLPINYVLVTVLG  261

Query  709   LGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWG-GVSWECFKGYKSLLNLAIPSCAS  885
             LGIKGVA +SV  N N++  L+ Y+ F GV+K+T G   S E F+G+  L++LA+PSC S
Sbjct  262   LGIKGVAFASVLANLNLLLFLLAYIFFKGVHKRTGGFAFSRENFRGWGELVSLALPSCVS  321

Query  886   VCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAG  1065
             VCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTTSLIYIFPSSLSFGVSTRV NELGAG
Sbjct  322   VCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTSLIYIFPSSLSFGVSTRVSNELGAG  381

Query  1066  RPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCEL  1245
             +P  A  AA VGL   F  G  A  F   VRNVWAS+FT D  I+ALTA+VLPI+GLCEL
Sbjct  382   QPEEASRAATVGLMLGFAFGGFATAFAFLVRNVWASMFTADPAIIALTASVLPILGLCEL  441

Query  1246  GNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqa  1425
             GNCPQTTGCG LRG+ARPK  A INLR FY VG PVA  L F+  +DF+GLWLGLLAAQA
Sbjct  442   GNCPQTTGCGVLRGSARPKDAASINLRSFYLVGTPVALGLAFWFHYDFKGLWLGLLAAQA  501

Query  1426  SCALTMLLVLGRTDWNDQARRAKELT  1503
             +C + M+LV+GRTDW  +A+R+++LT
Sbjct  502   TCMVRMMLVIGRTDWASEAKRSRQLT  527



>ref|XP_002454487.1| hypothetical protein SORBIDRAFT_04g031980 [Sorghum bicolor]
 gb|EES07463.1| hypothetical protein SORBIDRAFT_04g031980 [Sorghum bicolor]
Length=567

 Score =   526 bits (1356),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 295/458 (64%), Positives = 360/458 (79%), Gaps = 1/458 (0%)
 Frame = +1

Query  169   AAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILS  348
             A  EA+ I  +ALPMI+TGLLLY RSMISMLFLGRLG L+LAGGSLAIGFANITGYS+LS
Sbjct  75    AGAEARSILGLALPMILTGLLLYLRSMISMLFLGRLGGLALAGGSLAIGFANITGYSVLS  134

Query  349   GLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREI  528
             GLAMGMEPICGQAFGA  ++L+G++ QR +++LL  ++PI  LW ++  +L+LC QD  I
Sbjct  135   GLAMGMEPICGQAFGAGHYELLGVTTQRAVLMLLAAAVPIGGLWVHIRPLLLLCGQDAGI  194

Query  529   SMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLN  708
             +  A+++IL SLPDL+ Q+ LHP+RIYLR+QS+ LPLT CAA AI +H+PINY LV VL 
Sbjct  195   AAVAETYILASLPDLLLQAFLHPVRIYLRTQSINLPLTLCAALAIALHLPINYVLVSVLG  254

Query  709   LGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWG-GVSWECFKGYKSLLNLAIPSCAS  885
             LGI GVAL+SV  N N++  L+ Y+LF GV+K+T G  +S E F+G+  L++LA+PSC S
Sbjct  255   LGISGVALASVLANLNLLLFLLAYILFKGVHKRTGGLALSAESFRGWGELVSLALPSCVS  314

Query  886   VCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAG  1065
             VCLEWWWYE+MILLCGLLANP+ATVASMG+LIQTTSLIYIFPSSL FGVSTRV NELGA 
Sbjct  315   VCLEWWWYEIMILLCGLLANPQATVASMGILIQTTSLIYIFPSSLGFGVSTRVSNELGAN  374

Query  1066  RPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCEL  1245
             RP  A  AA VGL   F  G  A  F   VR  WA++FT D  I+ALTA+VLPI+G CEL
Sbjct  375   RPDHAGRAATVGLMLGFAFGGVASAFAYLVRGAWATMFTADPAIVALTASVLPILGACEL  434

Query  1246  GNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqa  1425
             GNCPQTTGCG LRG+ARPK  A INLR FY VG PVA  L F+  +DFQGLWLGLLAAQA
Sbjct  435   GNCPQTTGCGVLRGSARPKDAASINLRSFYLVGTPVALVLAFWYHYDFQGLWLGLLAAQA  494

Query  1426  SCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDDD  1539
             +C + MLLV+GRTDW  +A+RA++LT   ++ +  D +
Sbjct  495   TCVVRMLLVIGRTDWAAEAKRAQQLTGAGTVEETKDKE  532



>ref|XP_008779545.1| PREDICTED: MATE efflux family protein 5-like [Phoenix dactylifera]
Length=554

 Score =   526 bits (1354),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 290/481 (60%), Positives = 362/481 (75%), Gaps = 4/481 (1%)
 Frame = +1

Query  61    PFAFISACKEKMEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYC  240
             P +F S  K  +  P     N   E+       LS   +E + I  I++P  VTGL+LY 
Sbjct  9     PLSFSSMKKSNLLIPC----NEHLEEDLQRWPTLSEVVEEMRAIGRISIPTAVTGLVLYS  64

Query  241   RSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGL  420
             R+MISMLFLG LGDL LAGGSL+IGFANITGYS+LSGLAMGMEPICGQA+GAK+ KL+GL
Sbjct  65    RAMISMLFLGYLGDLELAGGSLSIGFANITGYSVLSGLAMGMEPICGQAYGAKQRKLLGL  124

Query  421   SLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPL  600
             +LQRTI+LLL  S+PI+ LW NM+RIL+ C QD  IS  A +FI++++PDL+  S LHPL
Sbjct  125   TLQRTILLLLSASLPISFLWFNMKRILLWCGQDESISSTAHTFIIFAVPDLVFLSFLHPL  184

Query  601   RIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVY  780
             RIYLRSQ++TLP+T+C+  ++ +HVP+NY LVV L +GI GVAL+ VW N N+   L+++
Sbjct  185   RIYLRSQNITLPVTYCSFISVALHVPLNYLLVVHLRMGIAGVALAMVWTNLNLFLCLLLF  244

Query  781   VLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATV  960
             +L SGVY+ +W   S +C +G+ +LL LA+P+C SVCLEWWWYE MI+LCGLLANPRATV
Sbjct  245   ILVSGVYRDSWVSPSADCLRGWSALLRLAVPTCVSVCLEWWWYEFMIMLCGLLANPRATV  304

Query  961   ASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALT  1140
             ASMG+LIQTTSL+Y+FPS+LS GVSTRVGNELGA RP +A+ A IV L  + +LGL A+ 
Sbjct  305   ASMGILIQTTSLVYVFPSALSLGVSTRVGNELGANRPAKARRATIVSLACAAVLGLMAMA  364

Query  1141  FGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKIN  1320
             F  ++R+ W  +FT+D +I+ LTAA LPI GLCELGNCPQTTGCG LRG+ARP  GA IN
Sbjct  365   FTTSMRHRWGRLFTKDEDILELTAAALPIAGLCELGNCPQTTGCGVLRGSARPSTGANIN  424

Query  1321  LRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKEL  1500
             L  FY VG+PVA  +GF AG  F G+WLGLLAAQ SCA  M   L  TDW  +  RAKEL
Sbjct  425   LGSFYLVGMPVAILMGFVAGMGFAGMWLGLLAAQLSCATLMAYALIATDWAAEVERAKEL  484

Query  1501  T  1503
             T
Sbjct  485   T  485



>ref|XP_004501069.1| PREDICTED: MATE efflux family protein 5-like [Cicer arietinum]
Length=561

 Score =   526 bits (1354),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 283/469 (60%), Positives = 363/469 (77%), Gaps = 5/469 (1%)
 Frame = +1

Query  103   PLISEENPKEED-HNHNQTHL----SLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFl  267
             P +   NP +++  + N+ H     +   +E K I+ I+ P  +TGL+LY R+MISMLFL
Sbjct  25    PKLLINNPHDDEVQDQNELHRWPTPNEVIEEMKAIAKISCPTAITGLILYSRAMISMLFL  84

Query  268   grlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLL  447
             G LG+  LAGGSL+IGFANITGYS++SGLAMGMEPICGQA+GAK++K++GL+LQ+TI+LL
Sbjct  85    GYLGETELAGGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQWKILGLTLQKTILLL  144

Query  448   LFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSV  627
             L TSIPI++ W NM++IL+   QD EIS  AQ+FIL+S+PDL   S LHPLRIYLR+Q +
Sbjct  145   LSTSIPISLTWLNMKKILLFLGQDEEISSTAQTFILFSIPDLFFLSFLHPLRIYLRTQGI  204

Query  628   TLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKK  807
             TLPLT+ +A ++++HVP+N+ LV+   +G+ GV+++ +  N N++  L  +V FSGVYK+
Sbjct  205   TLPLTYSSAISVILHVPLNFLLVIHFKMGVVGVSIAMILTNLNLLIFLSSFVYFSGVYKE  264

Query  808   TWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQT  987
             +W  +S ECFKG+ SLL+L+IPSC SVCLEWWWYELMI+LCGLL NP+AT+ASMG+LIQT
Sbjct  265   SWVSISLECFKGWSSLLSLSIPSCVSVCLEWWWYELMIILCGLLVNPKATLASMGILIQT  324

Query  988   TSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVW  1167
             TSL+Y+FPSSLS GVSTRVGNELGA RP +A+ + IV L  +F LG+ A+ F   +RN W
Sbjct  325   TSLVYVFPSSLSLGVSTRVGNELGANRPSKARFSMIVSLFCAFGLGILAMLFTTLMRNQW  384

Query  1168  ASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGL  1347
               +FT D EI+ LTA VLPI+GLCE+GNCPQTTGCG LRG+ARP +GA INL  FY VG+
Sbjct  385   GRLFTNDVEILNLTAMVLPIVGLCEIGNCPQTTGCGVLRGSARPSVGANINLGSFYLVGM  444

Query  1348  PVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAK  1494
             PVA  LGF     F GLW+GLLAAQ SCA  ML VL  TDWNDQ  RAK
Sbjct  445   PVAIVLGFVFKMGFYGLWIGLLAAQVSCAALMLFVLCTTDWNDQVERAK  493



>ref|XP_010919223.1| PREDICTED: MATE efflux family protein 5-like [Elaeis guineensis]
Length=555

 Score =   525 bits (1353),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 315/471 (67%), Positives = 372/471 (79%), Gaps = 10/471 (2%)
 Frame = +1

Query  97    EAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrl  276
             +AP++  + P E  H         A  EAK I  +A+PM +TGLL+Y RSMISMLFLGRL
Sbjct  43    DAPILKPKPPTELAH---------AFVEAKSILSLAVPMALTGLLIYSRSMISMLFLGRL  93

Query  277   gdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFT  456
             G L LAGG+LAIGFANITGYS+LSGLAMGMEPICGQAFGAK+  L+GL+LQR+I+LLL  
Sbjct  94    GGLPLAGGALAIGFANITGYSVLSGLAMGMEPICGQAFGAKKLSLLGLALQRSILLLLSV  153

Query  457   SIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLP  636
             SIPIA LW NM  +L+LC QD  IS  AQS+IL+SLPDL   S LHPLRIYLRSQS+TLP
Sbjct  154   SIPIAFLWTNMRPLLLLCGQDAAISAAAQSYILFSLPDLFLLSFLHPLRIYLRSQSITLP  213

Query  637   LTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWG  816
             LT+ AA A ++H+PINY LV VL LGI GVAL+SVW N N++  LV YV  SG +K T G
Sbjct  214   LTYAAALAALLHLPINYLLVSVLRLGIPGVALASVWSNLNLLLLLVAYVYLSGTHKSTGG  273

Query  817   GV-SWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTS  993
              + S E F+G+ SLLNLA+PSC SVCLEWWWYE+MILLCGLL NP++TVASMG+LIQTTS
Sbjct  274   IIPSAESFRGWSSLLNLALPSCVSVCLEWWWYEIMILLCGLLLNPKSTVASMGILIQTTS  333

Query  994   LIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWAS  1173
             LIYIFPSSL FGVSTRVGNELGA RP RA+ AA VGL +SF+LGL AL+F V+VR+ WA 
Sbjct  334   LIYIFPSSLCFGVSTRVGNELGANRPHRARRAAYVGLSSSFLLGLIALSFAVSVRHAWAR  393

Query  1174  IFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPV  1353
             +FT D  I  LTA+VLPI+G+CELGNCPQTTGCG LRG+ARP+ GA INL  FY VG+PV
Sbjct  394   MFTDDPAIAVLTASVLPILGMCELGNCPQTTGCGVLRGSARPQAGANINLGSFYAVGMPV  453

Query  1354  AGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTA  1506
             A  L F+   DF+GLWLGLLAAQA+C + ML V+ RTDW+ QA RA++LT 
Sbjct  454   AVGLAFWGRLDFKGLWLGLLAAQATCVVLMLSVIHRTDWDLQADRAQKLTG  504



>ref|XP_011074298.1| PREDICTED: MATE efflux family protein 5 [Sesamum indicum]
Length=562

 Score =   525 bits (1353),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 293/478 (61%), Positives = 363/478 (76%), Gaps = 0/478 (0%)
 Frame = +1

Query  70    FISACKEKMEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSM  249
             FIS  K  +  P  + +   ++   H   + S A +E K I  I+ P  +TGL+LY R+M
Sbjct  13    FISTNKSHLLNPNKTMDLLIDDQELHRWPNPSEALEEIKEIGKISGPTAITGLILYSRAM  72

Query  250   ISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQ  429
             ISMLFLG LG+L LAGGSL+IG ANITGYS++SGLAMGMEPICGQA+GAK+ KL+GL+LQ
Sbjct  73    ISMLFLGYLGELELAGGSLSIGVANITGYSVISGLAMGMEPICGQAYGAKQMKLLGLALQ  132

Query  430   RTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIY  609
             RTI+LLL TSIPI+ +W NM+RIL+ C QD EIS  AQ+FIL+++PDL   SLLHPLRIY
Sbjct  133   RTILLLLTTSIPISFMWFNMKRILLWCNQDEEISSVAQTFILFAIPDLFFLSLLHPLRIY  192

Query  610   LRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLF  789
             LR+Q +TLPLT+C++ ++++HVP+N+ LV   N+GI GVAL+    N N+V  L  Y+ F
Sbjct  193   LRTQGITLPLTYCSSISVLLHVPLNFLLVKYFNMGIAGVALAMALTNLNLVLLLCSYIYF  252

Query  790   SGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASM  969
             SGVYK +W   S +C KG+ SLL+LAIP+C SVCLEWWWYELMI+LCGLL+NP+AT+ASM
Sbjct  253   SGVYKGSWVAPSLDCLKGWSSLLSLAIPTCISVCLEWWWYELMIMLCGLLSNPKATIASM  312

Query  970   GVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGV  1149
             G+LIQTTSL+Y+FPSSLS GVSTRV NELGA RP +A+++ IV L  +  LG+AA+ F  
Sbjct  313   GILIQTTSLVYVFPSSLSLGVSTRVSNELGARRPAKARISMIVSLFCAVALGVAAMLFTT  372

Query  1150  AVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRC  1329
              +R+ W   FT DAEI+ LT   LPI GLCELGNCPQTTGCG LRG+ARP +GA INL  
Sbjct  373   LMRHRWGRFFTGDAEILELTTVALPIAGLCELGNCPQTTGCGVLRGSARPTIGANINLGS  432

Query  1330  FYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
             FY VG+PVA ++GF     F GLWLGLLAAQ  CAL ML VL RTDW  Q  RAKELT
Sbjct  433   FYLVGMPVAFFMGFGLKLGFAGLWLGLLAAQGCCALLMLFVLCRTDWILQVERAKELT  490



>ref|XP_008785753.1| PREDICTED: MATE efflux family protein 5-like [Phoenix dactylifera]
Length=546

 Score =   523 bits (1347),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 291/489 (60%), Positives = 367/489 (75%), Gaps = 9/489 (2%)
 Frame = +1

Query  91    KMEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlg  270
             KM + L+      EED     T +S   +E   I  I++P  +TGL+LY R+MISMLFLG
Sbjct  16    KMSSLLVPRNEHLEEDLQRWPT-VSEVVEEMGAIGRISIPTALTGLVLYSRAMISMLFLG  74

Query  271   rlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLL  450
              LG+L LAGGSL+IGFANITGYS+LSGLAMGMEPICGQA+GAK++K++GL+LQRT++LLL
Sbjct  75    YLGELELAGGSLSIGFANITGYSVLSGLAMGMEPICGQAYGAKQWKVLGLTLQRTVLLLL  134

Query  451   FTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVT  630
               SIPI+ LW NM+RIL+ C QD +IS  A +FI +++PDL+  SLLHPLR+YLRSQ++T
Sbjct  135   SASIPISFLWLNMKRILLWCGQDEQISSTAHTFITFAIPDLVFLSLLHPLRVYLRSQNIT  194

Query  631   LPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKT  810
             LP+T+C+  ++++HVP+NY LVV   +GI G AL+ VW N N++  L+++VL SGVYK +
Sbjct  195   LPVTYCSCISVILHVPLNYLLVVHFGMGIAGAALAMVWTNLNLLLCLLLFVLVSGVYKDS  254

Query  811   WGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTT  990
             W   S +C KG+ +LL LAIP+CASVCLEWWWYE MI+LCGLL NP+ATVASMG+LIQTT
Sbjct  255   WVSPSADCLKGWSALLRLAIPTCASVCLEWWWYEFMIMLCGLLVNPKATVASMGILIQTT  314

Query  991   SLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWA  1170
             SL+Y+FPS+LS GVSTRVGNELGA RP +A+ A IV    + +LGL A+ F  ++R+ W 
Sbjct  315   SLVYVFPSALSLGVSTRVGNELGASRPAKARRATIVSQACAVVLGLMAMAFTTSMRHRWG  374

Query  1171  SIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLP  1350
              +FT D EI+ LTA  LPI GLCELGNCPQTTGCG LRG+ARP  GA INL  FY VG+P
Sbjct  375   RLFTNDEEILELTAVALPIAGLCELGNCPQTTGCGVLRGSARPNTGATINLGSFYLVGMP  434

Query  1351  VAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT--------A  1506
             VA ++ F AG  F GLWLGLLAAQASCA  M   L  TDW  +A RAKELT        A
Sbjct  435   VAIFMAFAAGMGFAGLWLGLLAAQASCATLMAYALVTTDWVVEAERAKELTKASNSSSIA  494

Query  1507  TISLVDDDD  1533
              + + +D D
Sbjct  495   ALPIANDSD  503



>ref|XP_010939303.1| PREDICTED: MATE efflux family protein 5-like [Elaeis guineensis]
Length=546

 Score =   523 bits (1347),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 285/465 (61%), Positives = 362/465 (78%), Gaps = 1/465 (0%)
 Frame = +1

Query  109   ISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdls  288
             +  +   EED     T LS   +E + I  I++P  +TGL+LY R+MISMLFLG LG+L 
Sbjct  22    VPHKEHSEEDLQRWPT-LSEVVEEMRAIGRISIPTALTGLVLYSRAMISMLFLGYLGELE  80

Query  289   laggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPI  468
             LAGGSL+IGFANITGYS+LSGLAMGMEPICGQA+GAK++KL+GL+LQRTI+LLL  S+PI
Sbjct  81    LAGGSLSIGFANITGYSVLSGLAMGMEPICGQAYGAKQWKLLGLTLQRTILLLLSASLPI  140

Query  469   AILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFC  648
             + LW NM+RIL+ C QD +IS  A +FI +++PDL+  SLLHPLRIYLRSQ++T+P+T+C
Sbjct  141   SFLWFNMKRILLWCGQDEQISSTAHTFITFAVPDLVFLSLLHPLRIYLRSQNITMPVTYC  200

Query  649   AAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSW  828
             +  ++++HVP+NY LVV   +GI GVAL+ VW N N++  L++++L SGV++ +W   S 
Sbjct  201   SFISVILHVPLNYLLVVRFKMGIAGVALAMVWTNLNLLLCLLLFILVSGVHEVSWVSPSV  260

Query  829   ECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIF  1008
             +C KG+ +LL LAIP+CASVCLEWWWYE MI+LCGLL NP+ TVASMG+LIQTTSL+Y+F
Sbjct  261   DCLKGWSALLRLAIPTCASVCLEWWWYEFMIMLCGLLVNPKTTVASMGILIQTTSLVYVF  320

Query  1009  PSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQD  1188
             PS+LS GVSTRVGNELGA RP  A+ A IV L  + ++GL A+ F  ++R+ W  +FT D
Sbjct  321   PSALSLGVSTRVGNELGADRPANARKATIVSLACAVVVGLMAMAFTTSMRHRWGRLFTSD  380

Query  1189  AEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLG  1368
             AEI+ LTA  LPI GLCELGNCPQTTGCG LRG+ARP  GA INL  FY VG+PVA  +G
Sbjct  381   AEILELTAVALPISGLCELGNCPQTTGCGVLRGSARPNTGANINLGSFYLVGMPVAILMG  440

Query  1369  FFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
             F AG  F GLWLGLLAAQASCA  M  V+  TDW  +A+RA+ELT
Sbjct  441   FAAGMGFAGLWLGLLAAQASCATLMAYVVVTTDWAVEAKRAQELT  485



>ref|XP_010536483.1| PREDICTED: MATE efflux family protein 5 [Tarenaya hassleriana]
Length=512

 Score =   520 bits (1339),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 300/487 (62%), Positives = 384/487 (79%), Gaps = 4/487 (1%)
 Frame = +1

Query  85    KEKMEAPLISEENPKEEDHNHN---QTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMIS  255
             K++   P  S++  + E+++ +   +  L+   KEA  I+ I++PM++TGLLLY RS++S
Sbjct  14    KKQFIVPKSSQKQQRTEEYSFSSSVRNGLAAETKEAIAIAKISVPMVLTGLLLYSRSLVS  73

Query  256   MLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRT  435
              LFLGRLGD SLAGGSLA+GFANITGYS+LSGLAMGMEPIC QAFGAKR  L+ L+L+RT
Sbjct  74    TLFLGRLGDSSLAGGSLALGFANITGYSVLSGLAMGMEPICSQAFGAKRHSLLDLALRRT  133

Query  436   IVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLR  615
             I+LLL +S+PI++LW N++ IL    QD  ++ EA+SF+LYS+PDL+AQS LHPLR YLR
Sbjct  134   ILLLLLSSLPISLLWFNIKTILEFLGQDAALASEARSFLLYSIPDLLAQSFLHPLRAYLR  193

Query  616   SQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSG  795
             +Q+ TLPL+ CAA A+V+HVPIN+FLV  L LG KGVAL  VW NFN+V  +++YV+FS 
Sbjct  194   TQAKTLPLSVCAAVAVVLHVPINFFLVSYLELGSKGVALGGVWTNFNIVALILLYVMFSD  253

Query  796   VYKK-TWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMG  972
             + K+ T+ G S + F G+  LL+LAIPSC SVCLEWW YE+MILLCG L NP++T+ASMG
Sbjct  254   IRKEETFRGFSDDSFAGWTKLLSLAIPSCVSVCLEWWCYEIMILLCGFLLNPKSTIASMG  313

Query  973   VLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVA  1152
             +LIQTTSLIYIFPSSLSFGVSTRVGNELG+  P +AK +AIVG+  S ILG  AL+F + 
Sbjct  314   ILIQTTSLIYIFPSSLSFGVSTRVGNELGSDEPEKAKRSAIVGIGISIILGFTALSFTLT  373

Query  1153  VRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCF  1332
             VRN+WA +FT D EI+ALT+  LPIIGLCELGNCPQTTGCG LRG+ARPK+GA +NL  F
Sbjct  374   VRNIWARLFTDDEEIIALTSMALPIIGLCELGNCPQTTGCGVLRGSARPKVGANVNLAAF  433

Query  1333  YFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATI  1512
             Y VG+PVA  L F  GF F+GLWLG+LAAQ SC + M++V  RTDW+ +A R+KELTA+ 
Sbjct  434   YGVGMPVAAALAFGLGFGFRGLWLGMLAAQGSCVVAMMVVTCRTDWHVEAERSKELTASA  493

Query  1513  SLVDDDD  1533
             +  D ++
Sbjct  494   NGGDVEE  500



>ref|XP_010548775.1| PREDICTED: MATE efflux family protein 5-like [Tarenaya hassleriana]
Length=514

 Score =   520 bits (1339),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 287/506 (57%), Positives = 369/506 (73%), Gaps = 4/506 (1%)
 Frame = +1

Query  19    DKRQSNTKNPLFF---LPFAFISACKEKMEAPLISEENPKEEDHNHNQTHLSLAAKEAKC  189
             + R S+  +P F      F+ +  C++          +    D +   T L    +E K 
Sbjct  3     NSRSSSPSDPFFTSNKTQFSKLETCEQNHPHDYSDSSHNDSLDLHRWPTFLE-GMEEVKE  61

Query  190   ISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGME  369
             I  I+ P  VTGLL+Y RSMISMLFLG LG+L LAGGSLAIGFANITGYS++SGLAMGME
Sbjct  62    IGKISGPTAVTGLLMYSRSMISMLFLGYLGELELAGGSLAIGFANITGYSVISGLAMGME  121

Query  370   PICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSF  549
             PICGQA+GA + KL+GL+LQRTI+LLL +S+PI+  W N+ RIL  C QD +IS  +Q+F
Sbjct  122   PICGQAYGANQMKLLGLTLQRTILLLLSSSVPISFFWLNVRRILSWCGQDEDISSVSQTF  181

Query  550   ILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVA  729
             +L+++PDL   SLLHPLRIYLR+QS+TLP+T+  A ++++H+P+N+ LV  L +GI GVA
Sbjct  182   LLFAIPDLFFLSLLHPLRIYLRTQSITLPVTYSTAVSVLLHIPLNFLLVTKLEMGIVGVA  241

Query  730   LSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWY  909
             ++ V  N N+V  L  +V F+GV++ TW  +S +C KG+ SLL+LAIP+C SVCLEWWWY
Sbjct  242   IAMVLTNLNLVILLSSFVYFTGVHRDTWVPLSADCLKGWSSLLSLAIPTCVSVCLEWWWY  301

Query  910   ELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLA  1089
             E MI+LCGLLANP+ TV+SMG+LIQTT+LIY+FPSSLS GVSTR+GNELGA RP +A+++
Sbjct  302   EFMIMLCGLLANPKTTVSSMGILIQTTALIYVFPSSLSLGVSTRIGNELGAKRPRKARIS  361

Query  1090  AIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTG  1269
              I+ L  +  LGL A+ F + VR+ W  +FT+DAEI+ LT+  LPI GLCELGNCPQTTG
Sbjct  362   MIISLFCALGLGLVAMVFTILVRHQWGRLFTKDAEILELTSIALPIAGLCELGNCPQTTG  421

Query  1270  CGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLL  1449
             C  LRG+ARP LGA INL  FY VG+PVA  LGF     F GLWLGLLAAQA+CA  ML 
Sbjct  422   CSVLRGSARPALGANINLGSFYLVGMPVAIILGFVLKLGFPGLWLGLLAAQATCAALMLC  481

Query  1450  VLGRTDWNDQARRAKELTATISLVDD  1527
              L +TDW  QA+RA+ELT+      D
Sbjct  482   ALWKTDWEVQAQRAEELTSNTQSESD  507



>ref|XP_006433714.1| hypothetical protein CICLE_v10000751mg [Citrus clementina]
 gb|ESR46954.1| hypothetical protein CICLE_v10000751mg [Citrus clementina]
 gb|KDO81340.1| hypothetical protein CISIN_1g008783mg [Citrus sinensis]
Length=553

 Score =   521 bits (1342),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 295/467 (63%), Positives = 364/467 (78%), Gaps = 3/467 (1%)
 Frame = +1

Query  109   ISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdls  288
             +  ++P+E    H +   S A +E K I  I+ P  +TGL+LY R+MISMLFLG LG+L 
Sbjct  29    LHTDDPEEL---HRRPTPSEALEEMKAIGKISGPTAMTGLILYSRAMISMLFLGYLGELE  85

Query  289   laggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPI  468
             LAGGSL+IGFANITGYS+LSGLAMGMEPICGQA+GAK++KL+G++LQRT++LLL TS+PI
Sbjct  86    LAGGSLSIGFANITGYSVLSGLAMGMEPICGQAYGAKQWKLLGITLQRTVLLLLSTSLPI  145

Query  469   AILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFC  648
             + +W NM+RIL+ C QD EIS  AQ+FIL+++PDL   SLLHPLR+YLRSQ +TLPLT+C
Sbjct  146   SFMWLNMKRILLWCGQDDEISSVAQTFILFAIPDLFFLSLLHPLRVYLRSQGITLPLTYC  205

Query  649   AAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSW  828
             +A ++++HVP+N+ LVV   +GI GVA++ VW N N+   L  +V FSGV+K +W   S 
Sbjct  206   SAISVLLHVPLNFLLVVHFKMGIAGVAIAMVWTNLNLFLLLSSFVYFSGVHKDSWVSPSM  265

Query  829   ECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIF  1008
             +C +G+ SLL LAIP+C SVCLEWWWYELMI++CGLL NP+A +ASMG+LIQ TSLIY+F
Sbjct  266   DCVRGWSSLLALAIPNCISVCLEWWWYELMIMICGLLINPKAAIASMGILIQITSLIYVF  325

Query  1009  PSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQD  1188
             PSSLS GVSTRVGNELGA RP +A+++ IV L  +  LGL A+ F   +R+ W   FT D
Sbjct  326   PSSLSLGVSTRVGNELGANRPSKARISMIVSLFCAVALGLMAVLFTTLMRHKWGRFFTND  385

Query  1189  AEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLG  1368
             AEI+ LTA  LPIIGLCELGNCPQTTGCG LRG+ARPK GA INL  FY VG+PVA  +G
Sbjct  386   AEILELTAIALPIIGLCELGNCPQTTGCGVLRGSARPKTGASINLGSFYLVGMPVAILMG  445

Query  1369  FFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTAT  1509
             F A   F GLWLGLLAAQASCAL ML VL RTDW  QA RAKELT T
Sbjct  446   FVAKMGFPGLWLGLLAAQASCALVMLHVLCRTDWMVQAERAKELTQT  492



>ref|XP_007141312.1| hypothetical protein PHAVU_008G185200g [Phaseolus vulgaris]
 gb|ESW13306.1| hypothetical protein PHAVU_008G185200g [Phaseolus vulgaris]
Length=558

 Score =   521 bits (1342),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 292/486 (60%), Positives = 367/486 (76%), Gaps = 1/486 (0%)
 Frame = +1

Query  43    NPLFFLPFAFISACKEKMEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVT  222
             NP      +F+S  K   +    S ++ + +D  H    L+ A  E K I  I+ P  +T
Sbjct  3     NPKPTSASSFLSPTKSHPKVVYPSSDD-QTQDELHRWPTLNEAIAEMKAIGKISGPTAIT  61

Query  223   GLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKR  402
             GL+LY R+MISM+FLG LG++ LAGGSL+IGFANITGYS++SGLAMGMEPICGQA+GAK+
Sbjct  62    GLVLYSRAMISMIFLGYLGEMELAGGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQ  121

Query  403   FKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQ  582
             +KL+GL+LQRT++LLL TSIPI+ +W NMERIL+   QD EI+  AQ+FI++S+PDL   
Sbjct  122   WKLLGLTLQRTVLLLLSTSIPISFMWLNMERILLWSGQDHEIASVAQTFIIFSIPDLFLL  181

Query  583   SLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVV  762
             SLLHPLRIYLR+Q +TLPLT+C+  ++++HVP+N+ LVV L +GI GVA + V  N N++
Sbjct  182   SLLHPLRIYLRTQRITLPLTYCSTISVLLHVPLNFLLVVHLKMGIAGVATAMVLTNLNLI  241

Query  763   GSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLA  942
               L  +V FSG YK +W   S +C KG+ SLL+LAIP+C SVCLEWWWYE MI+LCGLLA
Sbjct  242   LFLSSFVYFSGAYKASWVPPSVDCLKGWSSLLSLAIPTCVSVCLEWWWYEFMIMLCGLLA  301

Query  943   NPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFIL  1122
             NP+AT+ASMG+LIQTTSL+Y+FPSSLS GVSTR+GNELGA  PG+A+++ IV L  +  L
Sbjct  302   NPKATIASMGILIQTTSLVYVFPSSLSLGVSTRIGNELGANNPGKARVSMIVSLFCAVAL  361

Query  1123  GLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPK  1302
             GLAA+ F   +R+ W   FT D EI+ LT+ VLPI GLCELGNCPQTTGCG LRG+ARP 
Sbjct  362   GLAAMLFTTLMRHQWGRFFTNDHEILELTSLVLPIAGLCELGNCPQTTGCGVLRGSARPT  421

Query  1303  LGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQA  1482
             +GA INL  FY VG+PVA  LG  A   F GLWLGLLAAQ SCA  ML VL RTDWN + 
Sbjct  422   IGANINLGSFYLVGMPVAILLGVVAKMGFAGLWLGLLAAQVSCAGLMLYVLCRTDWNVEV  481

Query  1483  RRAKEL  1500
             +RAKEL
Sbjct  482   QRAKEL  487



>ref|XP_009387104.1| PREDICTED: MATE efflux family protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=531

 Score =   518 bits (1335),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 284/461 (62%), Positives = 348/461 (75%), Gaps = 1/461 (0%)
 Frame = +1

Query  121   NPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslagg  300
              P ++D  H    L+ AA+E + I  I++P  +TGL+LY R+MISMLFLG LG L LAGG
Sbjct  7     EPLDQDL-HRCPGLAEAAEEMRAIGKISIPTALTGLVLYSRAMISMLFLGGLGQLELAGG  65

Query  301   slaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILW  480
             SL+IGFANITGYS+L GLAMGMEPICGQAFGAK+ KL+GL+LQRTI+LLL  SIPIA LW
Sbjct  66    SLSIGFANITGYSVLFGLAMGMEPICGQAFGAKQRKLLGLTLQRTILLLLSASIPIAFLW  125

Query  481   CNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFA  660
              NM+RIL+ C QD  IS  A  FI +++PDL   S+LHPLRIYLRSQ++T P+T+C+  +
Sbjct  126   LNMKRILLWCGQDERISSTAHIFITFAIPDLFFLSVLHPLRIYLRSQNITFPVTYCSLVS  185

Query  661   IVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFK  840
             +V+H+P+NY LVV L +GI GVAL+ VW N N+   L+++VL SGV K +W   S +C +
Sbjct  186   VVLHLPLNYLLVVHLKMGIAGVALAMVWTNLNLFICLLLFVLCSGVCKDSWVRPSMDCLR  245

Query  841   GYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSL  1020
             G+ +LL LA PSC SVCLEWWWYE M+L  GLLANP+A VASMG+LIQTTSL+Y+FPS+L
Sbjct  246   GWSTLLKLAAPSCVSVCLEWWWYEFMVLFSGLLANPKAAVASMGILIQTTSLVYVFPSAL  305

Query  1021  SFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIM  1200
             S GVSTRVGNELGA RP +A+ AA+V L  + +LGLAA+ F  ++R+ W  +FT DAE +
Sbjct  306   SLGVSTRVGNELGANRPAKARTAAVVSLACAVLLGLAAMVFTTSMRHQWGRLFTNDAETL  365

Query  1201  ALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAG  1380
              LTA  LPI GLCELGNCPQTTGCG LRG+ARP  GA INL  FY +GLPVA  L F   
Sbjct  366   KLTALALPIAGLCELGNCPQTTGCGVLRGSARPTTGANINLGSFYLIGLPVAILLSFVGK  425

Query  1381  FDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
                 GLWLGLLAAQASCA  M  VL  TDW  +  RA+ELT
Sbjct  426   MGLPGLWLGLLAAQASCAAIMAYVLAGTDWRMEVERARELT  466



>gb|EYU36423.1| hypothetical protein MIMGU_mgv1a019568mg [Erythranthe guttata]
Length=557

 Score =   519 bits (1336),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 285/455 (63%), Positives = 357/455 (78%), Gaps = 0/455 (0%)
 Frame = +1

Query  145   HNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFAN  324
             H     S A +E K I  I+ P  +TGL+LY R+MISMLFLG LG+L LAGGSL+IG AN
Sbjct  39    HRWPSPSEALEEMKEIGKISGPTAITGLILYSRAMISMLFLGYLGELELAGGSLSIGVAN  98

Query  325   ITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILI  504
             ITGYS++SGLAMGM+PICGQA+GAK+ KL+GL+LQRT++LLL TSIPI+ +W NM+RIL+
Sbjct  99    ITGYSVISGLAMGMDPICGQAYGAKQMKLLGLTLQRTVLLLLTTSIPISFMWLNMKRILL  158

Query  505   LCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPIN  684
              C QD EIS  AQ+FI++++PDL   S LHPLRIYLR+Q VTLPLT C+  ++V+HVP+N
Sbjct  159   WCNQDEEISTVAQTFIVFAIPDLFFLSFLHPLRIYLRTQGVTLPLTCCSTVSVVLHVPLN  218

Query  685   YFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNL  864
             + LV    +G+ GVAL+    N N+V  L +YV FSGVY+++W   S +C +G+ +LL+L
Sbjct  219   FLLVRYFGMGVSGVALAMALTNLNLVVLLCLYVYFSGVYRESWVAPSGDCLRGWSALLSL  278

Query  865   AIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRV  1044
             A+P+C SVCLEWWWYELMI+LCGLLANPRAT+ASMG+LIQTTSL+Y+FPSSLS GVSTRV
Sbjct  279   AVPTCVSVCLEWWWYELMIMLCGLLANPRATIASMGILIQTTSLVYVFPSSLSLGVSTRV  338

Query  1045  GNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLP  1224
              NELGA RP RA+++ IV +  +  LG+ A+ F V +R+ W  +FT DA+I+ LT A LP
Sbjct  339   SNELGARRPARARVSMIVSMFCAAALGVGAMAFAVLMRHRWGRLFTADAQILELTTAALP  398

Query  1225  IIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwl  1404
             I GLCELGNCPQTTGCG LRG+ARP +GA INL  FY VG+PVA  +GF     F GLW+
Sbjct  399   IAGLCELGNCPQTTGCGVLRGSARPTIGANINLGSFYLVGMPVAFLMGFVLKMGFAGLWV  458

Query  1405  gllaaqaSCALTMLLVLGRTDWNDQARRAKELTAT  1509
             GLLAAQASCA+ ML+VL RTDW+ Q  RAKELTAT
Sbjct  459   GLLAAQASCAVLMLVVLCRTDWSVQVERAKELTAT  493



>ref|XP_010936249.1| PREDICTED: MATE efflux family protein 5-like [Elaeis guineensis]
Length=544

 Score =   518 bits (1334),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 293/501 (58%), Positives = 370/501 (74%), Gaps = 12/501 (2%)
 Frame = +1

Query  61    PFAFISACKEKMEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYC  240
             P A +S+  +K    L+  E+  EED     T L    +E + I  I++P   TGL+LY 
Sbjct  6     PSAPLSSSTKKTN--LLMHEH-SEEDLQRWPT-LREVVEEMRAIGKISIPTAATGLVLYS  61

Query  241   RSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGL  420
             R+MISMLFLG LGDL LAGGSL+IGFANITGYS+L+GLAMGMEPICGQA+GAK+ KL+GL
Sbjct  62    RAMISMLFLGYLGDLELAGGSLSIGFANITGYSVLAGLAMGMEPICGQAYGAKQRKLLGL  121

Query  421   SLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPL  600
             +LQRTI+LLL  S+PI+ LW NM+RIL+ C QD +IS  A +FI++++PDLI  S LHPL
Sbjct  122   TLQRTILLLLSASLPISFLWLNMKRILLWCGQDEKISSTAHTFIIFAVPDLILLSFLHPL  181

Query  601   RIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVY  780
             RIYLRSQ++TLP+T+C+  ++  HVP+NY LVV L +GI GVAL+ VW N N+   L+++
Sbjct  182   RIYLRSQNITLPVTYCSFISVFFHVPLNYLLVVHLRMGIAGVALAMVWTNLNLFLCLLLF  241

Query  781   VLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATV  960
             +L SGVY+ +W   S +C KG+ +LL LA+P+C SVCLEWWWYE MI+LCGLL NP+ATV
Sbjct  242   ILVSGVYRDSWVSPSADCLKGWSALLRLAVPTCVSVCLEWWWYEFMIMLCGLLVNPKATV  301

Query  961   ASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALT  1140
             ASMG+LIQTT+L+Y+FPS+LS GVSTRVGNELGA RP  A+ A IV L  + +LGL A+ 
Sbjct  302   ASMGILIQTTALVYVFPSALSLGVSTRVGNELGANRPANAQRATIVSLACALVLGLMAMA  361

Query  1141  FGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKIN  1320
             F  ++R+ W  +FT+D  I+ LTA  LPI GLCELGNCPQTTGCG LRG+ARP  GA IN
Sbjct  362   FTTSMRHRWGRLFTKDENILELTAVALPIAGLCELGNCPQTTGCGVLRGSARPTTGANIN  421

Query  1321  LRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKEL  1500
             L  FY VG+PVA  +GF AG  F GLWLGLLAAQASCA  M   L  TDW  +  RAKEL
Sbjct  422   LGSFYLVGMPVAILMGFVAGMGFAGLWLGLLAAQASCATLMAYALIMTDWKVEVERAKEL  481

Query  1501  --------TATISLVDDDDDD  1539
                     TAT+ + +D + +
Sbjct  482   TKASNSSSTATLPITNDSNGN  502



>ref|XP_010104547.1| MATE efflux family protein 5 [Morus notabilis]
 gb|EXC01148.1| MATE efflux family protein 5 [Morus notabilis]
Length=586

 Score =   519 bits (1337),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 286/455 (63%), Positives = 361/455 (79%), Gaps = 0/455 (0%)
 Frame = +1

Query  130   EEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggsla  309
             ++D  H     S A +E K I+ I+ P  +TGLLLY R+MISMLFLG LG+L LAGGSL+
Sbjct  27    DQDELHRWPTPSEAVEEIKAIAKISGPTAITGLLLYSRAMISMLFLGYLGELELAGGSLS  86

Query  310   igFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNM  489
             IGFANITGYS++SGLAMGMEPICGQAFGAK+ KL+GL+LQRT++LLL  S+PI+ +W NM
Sbjct  87    IGFANITGYSVISGLAMGMEPICGQAFGAKQRKLLGLTLQRTVLLLLSISVPISFMWLNM  146

Query  490   ERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVV  669
             + IL+ C QD+EIS  A +FIL+S+PDL   SLLHPLRIYLR+QS+TLPLT+C+A ++++
Sbjct  147   KTILLWCGQDQEISSMAHTFILFSIPDLFLLSLLHPLRIYLRTQSITLPLTYCSAVSVLL  206

Query  670   HVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYK  849
             HVP+N+ LVV L +GI GVA++ VW N N++  L+ +V FSGVY  +W   S +C KG+ 
Sbjct  207   HVPLNFLLVVKLKMGISGVAIAMVWTNLNLLLFLLAFVYFSGVYTDSWVSPSTDCLKGWS  266

Query  850   SLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFG  1029
             SLL+LA+P+C SVCLEWWWYELMI+LCGLLANP+ATVASMG+LIQTTSL+Y+FPSSLS G
Sbjct  267   SLLSLAVPNCISVCLEWWWYELMIMLCGLLANPKATVASMGILIQTTSLVYVFPSSLSLG  326

Query  1030  VSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALT  1209
             VS RVGNELGA RP +A+++ IV L  +  LGL A+ F  ++R++W  +FT DAE++ LT
Sbjct  327   VSARVGNELGANRPAKARVSMIVSLACAAGLGLLAMVFTTSMRHIWGRLFTNDAEVLELT  386

Query  1210  AAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDF  1389
             A  LPI+GLCELGNCPQTTGCG LRG+ARP +GA INL  FY VG+PVA  +GF A   F
Sbjct  387   AVALPIVGLCELGNCPQTTGCGVLRGSARPTIGANINLGSFYLVGMPVAILMGFVAKLGF  446

Query  1390  qglwlgllaaqaSCALTMLLVLGRTDWNDQARRAK  1494
              GLWLGLLAAQ +CAL M+ VL  TDW  Q +RA+
Sbjct  447   SGLWLGLLAAQGTCALLMVYVLSTTDWMVQVQRAR  481



>ref|XP_006472377.1| PREDICTED: MATE efflux family protein 5-like [Citrus sinensis]
Length=553

 Score =   518 bits (1333),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 294/467 (63%), Positives = 362/467 (78%), Gaps = 3/467 (1%)
 Frame = +1

Query  109   ISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdls  288
             +  ++P+E    H     S A +E K I  I+ P  +TGL+LY R+MISMLFLG LG+L 
Sbjct  29    LHTDDPEEL---HRWPTPSEALEEMKAIGKISGPTAMTGLILYSRAMISMLFLGYLGELE  85

Query  289   laggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPI  468
             LAGGSL+IGFANITGYS+LSGLAMGMEPICGQA+GAK++KL+G++LQRT++LLL TS+PI
Sbjct  86    LAGGSLSIGFANITGYSVLSGLAMGMEPICGQAYGAKQWKLLGITLQRTVLLLLSTSLPI  145

Query  469   AILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFC  648
             + +W NM+RIL+ C QD EIS  AQ+FIL+++PDL   SLLHPLR+YLRSQ +TLPLT+C
Sbjct  146   SFMWLNMKRILLWCGQDDEISSVAQTFILFAIPDLFFLSLLHPLRVYLRSQGITLPLTYC  205

Query  649   AAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSW  828
             +A ++++HVP+N+ LVV   +GI GVA++ VW N N+   L  +V FSGV+K +W   S 
Sbjct  206   SAISVLLHVPLNFLLVVHFKMGIAGVAIAMVWTNLNLFLLLSSFVYFSGVHKDSWVSPSM  265

Query  829   ECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIF  1008
             +C +G+ SLL LAIP+C SVCLEWWWYELMI++CGLL NP+A +ASMG+LIQ TSLIY+F
Sbjct  266   DCVRGWSSLLALAIPNCISVCLEWWWYELMIMICGLLINPKAAIASMGILIQITSLIYVF  325

Query  1009  PSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQD  1188
             PSSLS GVSTR GNELGA RP +A+++ IV L  +  LGL A+ F   +R+ W   FT D
Sbjct  326   PSSLSLGVSTRAGNELGANRPSKARISMIVSLFCAVALGLMAVLFTTLMRHKWGRFFTND  385

Query  1189  AEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLG  1368
             AEI+ LTA  LPIIGLCELGNCPQTTGCG LRG+ARPK GA INL  FY VG+PVA  +G
Sbjct  386   AEILELTAIALPIIGLCELGNCPQTTGCGVLRGSARPKTGASINLGSFYLVGMPVAILMG  445

Query  1369  FFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTAT  1509
             F A   F GLWLGLLAAQASCAL ML VL RTDW  QA RAKELT T
Sbjct  446   FVAKMGFPGLWLGLLAAQASCALVMLHVLCRTDWMVQAERAKELTQT  492



>ref|XP_006652664.1| PREDICTED: MATE efflux family protein 9-like [Oryza brachyantha]
Length=570

 Score =   518 bits (1334),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 296/460 (64%), Positives = 356/460 (77%), Gaps = 4/460 (1%)
 Frame = +1

Query  169   AAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaig---FANITGYS  339
             A  EA+ I  +A PMI+TGLLLY RSMISMLFLG LG L+LAGGSLAIG   FANI GYS
Sbjct  85    ARDEARSILGLAFPMILTGLLLYLRSMISMLFLGHLGGLALAGGSLAIGPFGFANIPGYS  144

Query  340   ILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQD  519
             +LSGLAMGMEPICGQAFGA  + L+G+++QRT++LL+  ++PI  LW  M  +L+ C QD
Sbjct  145   VLSGLAMGMEPICGQAFGAGNYALLGITMQRTVLLLIVAAVPIGGLWLQMRPLLLFCGQD  204

Query  520   REISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVV  699
               I+  A+++I  SLPDL+ Q+ LHP+RIYLR+QS+ LPLT CA  AIV+H+PINY LVV
Sbjct  205   AAIAAVAETYIFASLPDLVLQAFLHPVRIYLRTQSINLPLTVCAGLAIVIHLPINYVLVV  264

Query  700   VLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGV-SWECFKGYKSLLNLAIPS  876
              L LGIKGVAL+SV  N N+V  L+ Y+   GV+K+T G V S E F+G+  L++LA+PS
Sbjct  265   FLGLGIKGVALASVLANLNLVLLLLAYIFLKGVHKRTGGFVLSAESFRGWGELISLALPS  324

Query  877   CASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNEL  1056
             C SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTTSLIYIFPSSLSFGVSTRV NEL
Sbjct  325   CVSVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTSLIYIFPSSLSFGVSTRVSNEL  384

Query  1057  GAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGL  1236
             GAG+P  A  AA VGL   F  G  A  F   VRNVWAS+FT D  I+ALTAAVLPI+G+
Sbjct  385   GAGQPEEASRAATVGLMLGFAFGTFASAFAFLVRNVWASMFTADPAIVALTAAVLPILGM  444

Query  1237  CELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlglla  1416
             CELGNCPQTTGCG LRG+ARPK  A INLR FY VG PVA  + F+  FDF+GLW GLLA
Sbjct  445   CELGNCPQTTGCGVLRGSARPKDAASINLRSFYLVGTPVALVMAFWFHFDFKGLWFGLLA  504

Query  1417  aqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDD  1536
             AQA+C + MLLV+GRTDW  +A+R+K+LT   +   + DD
Sbjct  505   AQATCMVRMLLVIGRTDWAAEAKRSKQLTGAGAANMESDD  544



>ref|XP_008646051.1| PREDICTED: MATE efflux family protein 9-like [Zea mays]
 gb|AFW72788.1| putative MATE efflux family protein [Zea mays]
Length=568

 Score =   518 bits (1333),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 291/458 (64%), Positives = 355/458 (78%), Gaps = 1/458 (0%)
 Frame = +1

Query  169   AAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILS  348
             A  EA+ I  +ALPMI+TGLLLY RSMISMLFLGRL  L+LAGGSLAIGFANITGYS+LS
Sbjct  78    AGAEARSILSLALPMILTGLLLYLRSMISMLFLGRLSGLALAGGSLAIGFANITGYSVLS  137

Query  349   GLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREI  528
             GLAMGMEPICGQAFGA  ++L+G++ QR +++LL  ++PI  LW ++  +L+LC QD  I
Sbjct  138   GLAMGMEPICGQAFGAGHYELLGVTTQRGVLMLLAAAVPIGGLWVHIRPLLLLCGQDAGI  197

Query  529   SMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLN  708
             +  A+++IL SLPDL+ Q+ LHP+RIYLR+QS+ LPLT CA  AI +H+PINY LV VL 
Sbjct  198   AAVAETYILASLPDLLLQAFLHPVRIYLRTQSINLPLTLCATLAIALHLPINYVLVSVLG  257

Query  709   LGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWG-GVSWECFKGYKSLLNLAIPSCAS  885
             LGI+GVAL+SV  N N++  L  Y+LF GV+K+T G  +S E F+G+  L++LA+PSC S
Sbjct  258   LGIRGVALASVLANLNLLLFLFAYILFKGVHKRTGGFALSAESFRGWGELVSLALPSCVS  317

Query  886   VCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAG  1065
             VCLEWWWYE+MILLCGLLANP+ATVASMG+LIQTTSLIYIFPSSL  GVSTRV NELGA 
Sbjct  318   VCLEWWWYEIMILLCGLLANPQATVASMGILIQTTSLIYIFPSSLGLGVSTRVSNELGAN  377

Query  1066  RPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCEL  1245
             RP  A  AA VGL   F  G  A  F   VR  WA++FT D  I+ALTAAVLPI+G CEL
Sbjct  378   RPDHAGRAATVGLMLGFAFGGVASAFAYLVRGAWATMFTADPAIVALTAAVLPILGACEL  437

Query  1246  GNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqa  1425
             GNCPQTTGCG LRG+ARPK  A INLR FY VG PVA  L F+  +DFQGLWLGLLAAQA
Sbjct  438   GNCPQTTGCGVLRGSARPKDAASINLRSFYLVGTPVALVLAFWYHYDFQGLWLGLLAAQA  497

Query  1426  SCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDDD  1539
             +C + MLLV+G TDW  +A+RA++LT   ++ +  +  
Sbjct  498   TCVVRMLLVIGGTDWVAEAKRAQQLTGARTVEETKESS  535



>ref|XP_009398732.1| PREDICTED: MATE efflux family protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=518

 Score =   516 bits (1328),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 308/499 (62%), Positives = 381/499 (76%), Gaps = 16/499 (3%)
 Frame = +1

Query  85    KEKMEAPLIS------EENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRS  246
             KE++  PL+        E P+ E        ++ A  EA+ I  +A PM + GLLLY RS
Sbjct  7     KERLSEPLVEGKWASPTEAPRLEPKARKD--VTAAVVEARSILCLASPMALAGLLLYSRS  64

Query  247   MISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSL  426
             ++SM+FLGRLG L LAGG+LAIGFANITGYS+LSGLAMGMEPICGQAFGA+R  L+GL+L
Sbjct  65    LVSMIFLGRLGRLPLAGGALAIGFANITGYSVLSGLAMGMEPICGQAFGARRPALLGLAL  124

Query  427   QRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRI  606
              R ++LLL  S+P++ LW +M R+L+LC QD +I+  A +++L SLPDL+ QSLLHP+RI
Sbjct  125   HRAVLLLLAASLPVSALWVSMRRLLLLCGQDDDIAAAAHAYVLASLPDLLVQSLLHPIRI  184

Query  607   YLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVL  786
             YLRSQS+TLPLT+CAA A V H+P+NY LV VL LGI+GVAL+SV  N N++  L+VY+ 
Sbjct  185   YLRSQSITLPLTYCAAAAAVFHLPVNYVLVCVLRLGIRGVALASVCTNLNLLLLLLVYIY  244

Query  787   FSGVYKKTWG-GVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVA  963
              SGV+++T    ++ E F+G++SLLNLAIPSC SVCLEWWWYE+M+LLCGLL +P++TVA
Sbjct  245   HSGVHERTGALNITAESFRGWRSLLNLAIPSCISVCLEWWWYEIMVLLCGLLLDPKSTVA  304

Query  964   SMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTF  1143
             SMG+LIQTTSLIYIFPSSLSFGVSTRVGNELGA RP RA+ AA VGL     LGL A  F
Sbjct  305   SMGILIQTTSLIYIFPSSLSFGVSTRVGNELGANRPDRARRAATVGLACGAALGLLAFAF  364

Query  1144  GVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINL  1323
              VAVRN WA +FT D  I+ LTAAVLPI+G+CELGNCPQTTGCG LRG+ARP+ GA INL
Sbjct  365   AVAVRNAWARMFTSDGAIVGLTAAVLPIVGMCELGNCPQTTGCGVLRGSARPRTGANINL  424

Query  1324  RCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
               FY VG+PVA  L F+ G DF GLWLG+LAAQA+C   MLLV+ RTDW  QA+RA+ LT
Sbjct  425   GSFYGVGMPVAAALAFWGGLDFPGLWLGMLAAQATCVALMLLVIHRTDWQLQAQRAQRLT  484

Query  1504  -------ATISLVDDDDDD  1539
                    AT+ +V   D+D
Sbjct  485   GGPLNTDATVVVVVVQDND  503



>ref|XP_002981285.1| hypothetical protein SELMODRAFT_53188, partial [Selaginella moellendorffii]
 gb|EFJ17473.1| hypothetical protein SELMODRAFT_53188, partial [Selaginella moellendorffii]
Length=463

 Score =   512 bits (1319),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 278/443 (63%), Positives = 348/443 (79%), Gaps = 0/443 (0%)
 Frame = +1

Query  175   KEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGL  354
             +E K +S IA PM+V GLLLY RSMISMLFLG LG + LAGG+L++GFANITGYS+L+GL
Sbjct  21    EELKQMSGIAGPMVVMGLLLYARSMISMLFLGHLGKMELAGGALSMGFANITGYSVLAGL  80

Query  355   AMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISM  534
             AMGMEPICGQA GAKR+ LMG++LQRTI++LL   +PIA LW NM+RIL+ C QD  I+ 
Sbjct  81    AMGMEPICGQACGAKRWHLMGITLQRTILVLLCVCVPIASLWINMQRILLWCGQDEGITA  140

Query  535   EAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLG  714
              A ++IL+SLPDL+AQ++L+PLRIYLR+Q++T PLT+C+A A+ +HVPIN  LV+ L + 
Sbjct  141   MAGTYILFSLPDLLAQAILNPLRIYLRTQNITTPLTWCSALALALHVPINLLLVIHLKMR  200

Query  715   IKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCL  894
             I+GVALS+   +FN+V  LV Y+  SG YK+TW G S +  K ++ LLNLAIPSC SVCL
Sbjct  201   IRGVALSAALTDFNLVIFLVGYLRISGKYKRTWDGWSRDSLKDWRPLLNLAIPSCISVCL  260

Query  895   EWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPG  1074
             EWWWYE MI++ GLL N +A VASMG+LIQTT+L+YIFPSSLS  VSTRVGNELGA RP 
Sbjct  261   EWWWYEFMIIVSGLLTNAKAAVASMGILIQTTALVYIFPSSLSLAVSTRVGNELGANRPA  320

Query  1075  RAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNC  1254
             +A++A +V L  + ++ + A+TF   +R+VW  +FT+D  I++LT+ VLPI+GLCELGNC
Sbjct  321   KARIAMMVALACAGVVAVLAMTFTTTMRHVWGGMFTKDDSILSLTSLVLPIVGLCELGNC  380

Query  1255  PQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCA  1434
             PQTTGCG LRG ARP  GA INL  FYFVG+PVA  LGF     F GLWLGLLAAQ +CA
Sbjct  381   PQTTGCGVLRGCARPSTGANINLGSFYFVGMPVAMALGFLFNVGFPGLWLGLLAAQGTCA  440

Query  1435  LTMLLVLGRTDWNDQARRAKELT  1503
               M++VL RTDW  QA RAK LT
Sbjct  441   ALMMIVLMRTDWALQAERAKHLT  463



>ref|XP_009405972.1| PREDICTED: MATE efflux family protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=561

 Score =   516 bits (1328),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 284/480 (59%), Positives = 361/480 (75%), Gaps = 2/480 (0%)
 Frame = +1

Query  61    PFAFISACKEKMEAPLISEENPKEEDHNHNQ--THLSLAAKEAKCISDIALPMIVTGLLL  234
             P +F  + K  + A     E+P  +     Q     S   +E + I  I++P  +TGL++
Sbjct  9     PLSFSHSNKSHLFATNKLMEDPPLDPLQDLQRWPTPSQVVEEMRAIGKISIPTALTGLII  68

Query  235   YCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLM  414
             Y R+M+SMLFLG LG+L LA GSL+IGFANITGYS+LSGLAMGMEPICGQAFGAK+ K++
Sbjct  69    YSRAMVSMLFLGHLGELELAAGSLSIGFANITGYSVLSGLAMGMEPICGQAFGAKQRKIL  128

Query  415   GLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLH  594
             GL+LQRTI+LLL TS+P++ LW NM RIL+ C QD +IS  AQ+FI +++PDL+  S LH
Sbjct  129   GLTLQRTILLLLSTSVPVSFLWLNMRRILLWCGQDEQISSTAQTFIAFAIPDLLFLSFLH  188

Query  595   PLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLV  774
             P+RIYLRSQ++TLP+T+C+  ++V+HVP+NY LVV L +GI GVA++ VW N N+   L+
Sbjct  189   PIRIYLRSQNITLPVTYCSFVSVVLHVPLNYLLVVRLKMGIAGVAVAMVWTNLNLFVCLL  248

Query  775   VYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRA  954
             +++LFSGVYK +W   S +C +G+  LL LAIP+C SVCLEWWWYELMI++CG+L NPRA
Sbjct  249   LFILFSGVYKGSWVSPSTDCLRGWSQLLKLAIPTCVSVCLEWWWYELMIMMCGVLVNPRA  308

Query  955   TVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAA  1134
             TVASMG+LIQTTSL+Y+FPS+LS GVSTRVGNELGA RP RA+ A IV L  + +LGLAA
Sbjct  309   TVASMGILIQTTSLVYVFPSALSLGVSTRVGNELGANRPARARRATIVSLTVAVVLGLAA  368

Query  1135  LTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAK  1314
             + F  ++R+ W  +FT DAEI+ LTA  LPI GLCELGNCPQTTGCG LRG+ARP  GA 
Sbjct  369   MAFTTSMRHQWGRLFTDDAEILELTAVALPIAGLCELGNCPQTTGCGVLRGSARPTTGAN  428

Query  1315  INLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAK  1494
             INL  FY VG PVA  +GF  G  F GLWLGLLAAQASCA  M   + +TDW  +  RA+
Sbjct  429   INLGSFYLVGTPVAVVMGFVVGMGFPGLWLGLLAAQASCASLMAYAICKTDWMVEVERAR  488



>ref|XP_002969674.1| hypothetical protein SELMODRAFT_63250, partial [Selaginella moellendorffii]
 gb|EFJ28798.1| hypothetical protein SELMODRAFT_63250, partial [Selaginella moellendorffii]
Length=463

 Score =   512 bits (1319),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 278/443 (63%), Positives = 348/443 (79%), Gaps = 0/443 (0%)
 Frame = +1

Query  175   KEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGL  354
             +E K +S IA PM+V GLLLY RSMISMLFLG LG + LAGG+L++GFANITGYS+L+GL
Sbjct  21    EELKQMSGIAGPMVVMGLLLYARSMISMLFLGHLGKMELAGGALSMGFANITGYSVLAGL  80

Query  355   AMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISM  534
             AMGMEPICGQA GAKR+ LMG++LQRTI++LL   +PIA LW NM+RIL+ C QD  I+ 
Sbjct  81    AMGMEPICGQACGAKRWHLMGITLQRTILVLLCVCVPIASLWINMQRILLWCGQDEGITA  140

Query  535   EAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLG  714
              A ++IL+SLPDL+AQ++L+PLRIYLR+Q++T PLT+C+A A+ +HVPIN  LV+ L + 
Sbjct  141   MAGTYILFSLPDLLAQAILNPLRIYLRTQNITTPLTWCSALALALHVPINLLLVIHLKMR  200

Query  715   IKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCL  894
             I+GVALS+   +FN+V  LV Y+  SG YK+TW G S +  K ++ LLNLAIPSC SVCL
Sbjct  201   IRGVALSAALTDFNLVIFLVGYLRISGKYKRTWDGWSRDSLKDWRPLLNLAIPSCISVCL  260

Query  895   EWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPG  1074
             EWWWYE MI++ GLL N +A VASMG+LIQTT+L+YIFPSSLS  VSTRVGNELGA RP 
Sbjct  261   EWWWYEFMIIVSGLLTNAKAAVASMGILIQTTALVYIFPSSLSLAVSTRVGNELGANRPA  320

Query  1075  RAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNC  1254
             +A++A +V L  + ++ + A+TF   +R+VW  +FT+D  I++LT+ VLPI+GLCELGNC
Sbjct  321   KARIAMMVALACAGVVAVLAMTFTTTMRHVWGGMFTKDDSILSLTSLVLPIVGLCELGNC  380

Query  1255  PQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCA  1434
             PQTTGCG LRG ARP  GA INL  FYFVG+PVA  LGF     F GLWLGLLAAQ +CA
Sbjct  381   PQTTGCGVLRGCARPSTGANINLGSFYFVGMPVAMALGFLFNVGFPGLWLGLLAAQGTCA  440

Query  1435  LTMLLVLGRTDWNDQARRAKELT  1503
               M++VL RTDW  QA RAK LT
Sbjct  441   ALMMIVLMRTDWALQAERAKRLT  463



>gb|KHN39984.1| Multidrug and toxin extrusion protein 1 [Glycine soja]
Length=544

 Score =   515 bits (1326),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 285/465 (61%), Positives = 357/465 (77%), Gaps = 5/465 (1%)
 Frame = +1

Query  121   NPKEED----HNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdls  288
             NPK        +  ++H   A  E K I  I+ P  +TGL+LY R+MISM+FLG LG++ 
Sbjct  3     NPKPSSASPFRSPTKSHPK-AIAEMKAIGRISGPTAITGLILYSRAMISMIFLGYLGEME  61

Query  289   laggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPI  468
             LAGGSL+IGFANITGYS++SGLAMGMEPICGQA+GAK++K++GL+LQRT++LLL TSIPI
Sbjct  62    LAGGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQWKILGLTLQRTVLLLLSTSIPI  121

Query  469   AILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFC  648
             + +W NM RIL+   QD+EI+  AQ+FI +S+PDL   SLLHP+RIYLR+QS+TLPLT+C
Sbjct  122   SFMWLNMMRILLWSGQDQEIASVAQTFITFSIPDLFLLSLLHPIRIYLRTQSITLPLTYC  181

Query  649   AAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSW  828
             +A ++++HVP+N+ LVV L +GI GVA + V  N N++  +  +V FSG YK +W   S 
Sbjct  182   SAISVLLHVPLNFLLVVHLKMGIAGVATAMVLTNLNLILLISSFVYFSGAYKASWVPPSV  241

Query  829   ECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIF  1008
             +C KG+ SLL+LAIP+C SVCLEWWWYE MI+LCGLL +P+AT+ASMG+LIQTTSL+Y+F
Sbjct  242   DCIKGWSSLLSLAIPTCVSVCLEWWWYEFMIMLCGLLVSPKATIASMGILIQTTSLVYVF  301

Query  1009  PSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQD  1188
             PSSLS GVSTRVGNELGA  P +A+++ IV L  +  LGLAA+ F   +R+ W   FT D
Sbjct  302   PSSLSLGVSTRVGNELGANNPRKARVSMIVSLFCAVALGLAAMLFTTLMRHQWGRFFTND  361

Query  1189  AEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLG  1368
              EI+ +T+ VLPI GLCELGNCPQTTGCG LRG+ARP +GA INL  FY VG+PVA  LG
Sbjct  362   HEILEITSLVLPIAGLCELGNCPQTTGCGVLRGSARPTIGANINLGSFYLVGMPVAILLG  421

Query  1369  FFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
             F A   F GLWLGLLAAQASCA  ML VL  TDWN Q  RAKELT
Sbjct  422   FVAKMGFAGLWLGLLAAQASCAGLMLYVLCTTDWNVQVERAKELT  466



>ref|XP_008803288.1| PREDICTED: MATE efflux family protein 5-like [Phoenix dactylifera]
Length=483

 Score =   513 bits (1320),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 301/434 (69%), Positives = 356/434 (82%), Gaps = 3/434 (1%)
 Frame = +1

Query  211   MIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAF  390
             M +T LL+Y RSMISMLFLGRLG L LAGG+LAIGFANITGYS+LSGLAMGMEPICGQAF
Sbjct  1     MALTSLLIYSRSMISMLFLGRLGSLPLAGGALAIGFANITGYSVLSGLAMGMEPICGQAF  60

Query  391   GAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPD  570
             GAK+  L+GL+LQ+TI+LLL  SIP+A LW NM  +L+LC QD  IS  AQS+IL+SLPD
Sbjct  61    GAKKLPLLGLALQQTILLLLSVSIPVAFLWTNMRPLLLLCGQDPAISAAAQSYILFSLPD  120

Query  571   LIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCN  750
             L  QS LHPLR+YLRSQS+TLPLT+ AA A ++H+PINYFLV VL LGI GVAL+SVW N
Sbjct  121   LFLQSFLHPLRVYLRSQSITLPLTYAAALAALLHLPINYFLVSVLRLGIPGVALASVWTN  180

Query  751   FNVVGSLVVYVLFSGVYKKTWGGV--SWECFKGYKSLLNLAIPSCASVCLEWWWYELMIL  924
              N++  L+ Y+  +G+YK T GG+  S E F+G+ SLLNLA+PSC SVCLEWWWYE+MIL
Sbjct  181   LNLLLLLLAYLYLTGIYKST-GGIIPSAESFRGWSSLLNLALPSCVSVCLEWWWYEIMIL  239

Query  925   LCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGL  1104
             LCGLL NP++TVASMG+LIQTTSLIYIFPSSLSFGVSTRVGNELGA RP  A+ AA VGL
Sbjct  240   LCGLLLNPKSTVASMGILIQTTSLIYIFPSSLSFGVSTRVGNELGANRPDCARRAACVGL  299

Query  1105  CASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALR  1284
              +SF+LGL AL+F V+VR+ WA +FT D  I  +TAAVLPI+G+CELGNCPQTTGCG LR
Sbjct  300   SSSFLLGLIALSFAVSVRHAWARMFTDDPSIAVITAAVLPILGMCELGNCPQTTGCGVLR  359

Query  1285  GTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRT  1464
             G+ARP+  A INL  FY VG+PVA  L F+ G DF+GLWLGLLAAQA+C + ML V+ RT
Sbjct  360   GSARPRAAANINLSSFYAVGMPVAVGLAFWGGHDFKGLWLGLLAAQATCVVLMLAVIHRT  419

Query  1465  DWNDQARRAKELTA  1506
             DW+ QA RA+ LT 
Sbjct  420   DWDLQAERAQRLTG  433



>gb|EMS68526.1| MATE efflux family protein 9 [Triticum urartu]
Length=555

 Score =   514 bits (1324),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 295/463 (64%), Positives = 362/463 (78%), Gaps = 6/463 (1%)
 Frame = +1

Query  169   AAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILS  348
             A  EA+ I  +A PMI+TGLLLY RSMISMLFLGRLG L+LAGGSLAIGFANITGYS+LS
Sbjct  77    ARDEARSILGLAFPMILTGLLLYLRSMISMLFLGRLGGLALAGGSLAIGFANITGYSVLS  136

Query  349   GLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREI  528
             GLAMGMEPICGQAFGA  + L+G+++QRT++LL+  ++PI  LW +M  +L+LC QD  I
Sbjct  137   GLAMGMEPICGQAFGAGNYSLIGVTVQRTVLLLIAAAVPIGGLWMHMRPLLLLCGQDAGI  196

Query  529   SMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLN  708
             +  A+++IL SLPDL+ Q+ LHP+RIYLR QS+ LPLT CA  AI +H+PINY LV VL 
Sbjct  197   AAVAETYILASLPDLLLQAFLHPVRIYLRMQSINLPLTVCATLAIAIHLPINYVLVTVLG  256

Query  709   LGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWG-GVSWECFKGYKSLLNLAIPSCAS  885
             LG+KGVA++SV  N N++  L+ Y+ F GV+K+T G  +S E F+G+  L++LA+PSC S
Sbjct  257   LGVKGVAMASVLANLNLLLLLLAYIFFKGVHKRTGGFALSAESFRGWGELISLALPSCVS  316

Query  886   VCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAG  1065
             VCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTTSLIYIFPSSLSFGVSTRV NELGAG
Sbjct  317   VCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTSLIYIFPSSLSFGVSTRVSNELGAG  376

Query  1066  RPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCEL  1245
             +P +A  AA  G+   F  G  A  F   VRNVWAS+FT D  I+ALTA+VLPI+GLCEL
Sbjct  377   QPEQASRAATAGIMLGFAFGAFASAFAFLVRNVWASMFTADPAIIALTASVLPILGLCEL  436

Query  1246  GNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqa  1425
             GNCPQTTGCG LRG+ARPK  A INLR FY VG PVA  L F+  +DF+GLWLGLLAAQA
Sbjct  437   GNCPQTTGCGVLRGSARPKDAANINLRSFYLVGTPVALVLAFWFHYDFEGLWLGLLAAQA  496

Query  1426  SCALTMLLVLGRTDWNDQARRAKELTAT-----ISLVDDDDDD  1539
             +C + MLLV+GRTDW  +A+R+K+LT +     +   D D+  
Sbjct  497   TCMVRMLLVIGRTDWAAEAKRSKQLTGSDAQGKVGAADGDEKS  539



>ref|XP_009400058.1| PREDICTED: MATE efflux family protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=568

 Score =   514 bits (1323),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 293/493 (59%), Positives = 368/493 (75%), Gaps = 6/493 (1%)
 Frame = +1

Query  28    QSNTKNPLFFLPFAFISACKEKMEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIAL  207
             QSNT  P       F +  K   + P+    +P ++ H       S   +E + I  I++
Sbjct  17    QSNTSPPPSLNSHPFDTTDKLMKDPPI----DPLQDLHRWPTP--SEVVEEMRAIGKISI  70

Query  208   PMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQA  387
             P  +TGL++Y R+MISMLFLG LG+L LAGGSL+IGFANITGYS+LSGLAMGMEPICGQA
Sbjct  71    PTALTGLIIYLRAMISMLFLGYLGELELAGGSLSIGFANITGYSVLSGLAMGMEPICGQA  130

Query  388   FGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLP  567
             FGA++ KL+GL+LQRT++LLL TS+PI++LW NM RIL+ C QD +IS  AQ+FI +++P
Sbjct  131   FGARQRKLLGLTLQRTVLLLLCTSVPISLLWLNMRRILLWCGQDEQISSTAQTFIAFAIP  190

Query  568   DLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWC  747
             DL   S LHP+RIYLRSQ++T P+T+C+  ++V+HVP+NY LVV   +G+ GVAL+ VW 
Sbjct  191   DLFFLSFLHPMRIYLRSQNITFPVTYCSFVSVVLHVPLNYILVVHWKMGVAGVALAMVWT  250

Query  748   NFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILL  927
             N N+   L++++LFS VYK +W   S +C +G+  LL LAIP+C SVCLEWWWYELMI++
Sbjct  251   NLNLFICLLLFILFSRVYKDSWVSPSSDCLRGWSELLKLAIPTCVSVCLEWWWYELMIMM  310

Query  928   CGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLC  1107
             CGLL NP+ATVASMG+LIQTTSL+Y+FPS+LS GVSTRVGNELG  RP +A+ A IV L 
Sbjct  311   CGLLLNPKATVASMGILIQTTSLVYVFPSALSLGVSTRVGNELGGNRPAKARTATIVSLA  370

Query  1108  ASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRG  1287
             A+ +LGLAA+TF  ++R+ W  +FT DAEI+ LTA  LPI GLCELGNCPQTTGCG LRG
Sbjct  371   AAVLLGLAAMTFTTSIRHRWGRLFTDDAEILELTAVALPIAGLCELGNCPQTTGCGVLRG  430

Query  1288  TARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTD  1467
             +ARP  GA INL  FY VG PVA  LGF  G  F GLWLGLLAAQASCAL M   L  TD
Sbjct  431   SARPSTGANINLGSFYLVGAPVAILLGFVMGMGFPGLWLGLLAAQASCALLMAFALFNTD  490

Query  1468  WNDQARRAKELTA  1506
             W  +A +AK LTA
Sbjct  491   WMVEAEKAKALTA  503



>gb|EPS65920.1| hypothetical protein M569_08857 [Genlisea aurea]
Length=508

 Score =   512 bits (1318),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 277/462 (60%), Positives = 347/462 (75%), Gaps = 5/462 (1%)
 Frame = +1

Query  130   EEDHNHNQT-----HLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlsla  294
               D  H+ +      LS   +E K I  ++ P  VTGL+LY R+MISM+FLG LG+L LA
Sbjct  13    HNDDVHDPSLRAFPSLSQGIEEVKEIGKLSGPTAVTGLILYSRAMISMVFLGYLGELELA  72

Query  295   ggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAI  474
             GGSL+IG ANITGYS++SGLAMGMEPICGQAFGAK+ KL+GL+LQRTI+LLL  S PI++
Sbjct  73    GGSLSIGVANITGYSVISGLAMGMEPICGQAFGAKQMKLLGLTLQRTILLLLTASFPISL  132

Query  475   LWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAA  654
             +W NM+RIL+ C QD EIS  AQ+FI++++PDL   S LHPLRIYLR+Q +TLP+T+ ++
Sbjct  133   IWVNMKRILLWCNQDEEISTMAQNFIVFAVPDLFVLSFLHPLRIYLRTQGITLPVTYLSS  192

Query  655   FAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWEC  834
              ++++HVP+N  LV  L +G+ G+AL+    N N+V  +  YV FSGVYK +W   S +C
Sbjct  193   VSVLLHVPLNLILVRYLKMGVGGIALAMALTNLNLVLLMGFYVYFSGVYKPSWVAPSMDC  252

Query  835   FKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPS  1014
              +G+ +LL+LA+P+C SVCLEWWWYE+MI+L GLL NP AT++SMG+LIQTTSL+Y+FPS
Sbjct  253   LRGWTTLLSLAVPTCISVCLEWWWYEIMIMLSGLLPNPTATISSMGILIQTTSLVYVFPS  312

Query  1015  SLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAE  1194
             SLS GVSTRV NELGA RP RA+++AIV + A+  LG+ A+ F VA+R  W  +FT DAE
Sbjct  313   SLSLGVSTRVSNELGARRPARARVSAIVSMVAAAALGVIAMGFTVAIRKRWGRLFTSDAE  372

Query  1195  IMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFF  1374
             I+ LTAA LPI+GLCELGNCPQTTGCG LRGTARP LGA INL  FY VG+PVA   GF 
Sbjct  373   ILKLTAAALPIVGLCELGNCPQTTGCGVLRGTARPTLGANINLGSFYLVGMPVALLTGFV  432

Query  1375  AGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKEL  1500
                 F GLWLGLLAAQ  CA  M   L R DW  Q  RAKEL
Sbjct  433   FKLGFPGLWLGLLAAQGCCAAMMTAALYRIDWTAQVERAKEL  474



>ref|XP_008339010.1| PREDICTED: MATE efflux family protein 5-like [Malus domestica]
Length=551

 Score =   513 bits (1320),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 290/500 (58%), Positives = 363/500 (73%), Gaps = 17/500 (3%)
 Frame = +1

Query  43    NPLFFLPFAFISACKEKMEAPLISEENPKEEDHN-------------HNQTHLSLAAKEA  183
             NP    P +F+S  K      LI   N   +D +             H    LS A +E 
Sbjct  3     NPKPSSPSSFLSTNKTL----LIKTSNKTMDDLHSSDVFVDDDDQELHRWPTLSEAVQEI  58

Query  184   KCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMG  363
             K I  I+ P  +TGLLLY R+MISMLFLG LG+L LAGGSL+IGFANITGYS++SGLAMG
Sbjct  59    KAIGKISGPSTMTGLLLYSRAMISMLFLGYLGELQLAGGSLSIGFANITGYSVISGLAMG  118

Query  364   MEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQ  543
             MEPICGQA+GAK+ KL+GL+LQRT++LLL TS+PI+ +W NM+R+L+ C QD EIS  A 
Sbjct  119   MEPICGQAYGAKQLKLLGLTLQRTVLLLLSTSLPISFMWLNMKRVLLWCGQDEEISSVAH  178

Query  544   SFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKG  723
             +F L+S+PDL   SLLHPLRIYLR+Q++TLP+T+C+A ++++H+P+N+ LVV   +GI G
Sbjct  179   TFTLFSIPDLFFLSLLHPLRIYLRTQNITLPVTYCSAISVLLHIPLNFLLVVKFQMGISG  238

Query  724   VALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWW  903
             VA++ VW N N+   L  +  FS VYK TW   S +C +G+ SLL L+IP+C SVCLEWW
Sbjct  239   VAIAMVWTNLNLFILLFSFTYFSNVYKDTWVCPSADCLRGWSSLLALSIPTCISVCLEWW  298

Query  904   WYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAK  1083
             WYE MI+LCGLLANP+AT+ASMG+LIQTTSL+Y+FPSSLS GVSTRVGN LGA RP +A+
Sbjct  299   WYEFMIMLCGLLANPKATIASMGILIQTTSLVYVFPSSLSLGVSTRVGNLLGAKRPSKAR  358

Query  1084  LAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQT  1263
             ++ IV L  +  LGL A+ F   +R+ W   FT DAEI+ LTA  LPI GLCELGNCPQT
Sbjct  359   ISMIVSLVCAVALGLLAMLFTTLMRHQWGRFFTNDAEILKLTAIALPIAGLCELGNCPQT  418

Query  1264  TGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTM  1443
             T CG LRG+ARP +GA INL  FY VG+PVA  +GF     F GLWLGLLAAQ SCAL M
Sbjct  419   TACGVLRGSARPTVGANINLGSFYLVGMPVAMLMGFVVKMGFAGLWLGLLAAQGSCALLM  478

Query  1444  LLVLGRTDWNDQARRAKELT  1503
               V+  TDWN Q +R+K+LT
Sbjct  479   FYVVCTTDWNLQVKRSKDLT  498



>ref|XP_006857900.1| hypothetical protein AMTR_s00069p00129640 [Amborella trichopoda]
 gb|ERN19367.1| hypothetical protein AMTR_s00069p00129640 [Amborella trichopoda]
Length=523

 Score =   511 bits (1315),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 287/488 (59%), Positives = 369/488 (76%), Gaps = 0/488 (0%)
 Frame = +1

Query  70    FISACKEKMEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSM  249
             FI   K   E  +  +E  K     H       A +E + +  I+ PM++TGL+LY ++M
Sbjct  31    FIPQKKGSHEGSIKHKEEDKAFAQLHGWPTPKQALEELRQMGKISGPMVLTGLILYSKTM  90

Query  250   ISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQ  429
             ISMLFLG LG+L+LAGG+LAIG+ANITGYS+LSGLAMGMEPICGQAFGAKR  L+ L+LQ
Sbjct  91    ISMLFLGHLGELALAGGALAIGYANITGYSVLSGLAMGMEPICGQAFGAKRPHLLSLTLQ  150

Query  430   RTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIY  609
             RTI+LLL  S+PI++LW +M   L L  QD +I+  AQ++IL+SLPDL++ ++LHPLR+Y
Sbjct  151   RTILLLLSASLPISLLWLSMHTFLSLTGQDPDITSTAQTYILFSLPDLLSLAVLHPLRVY  210

Query  610   LRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLF  789
             LR+QS+T+PLT+C+  AI++H+PINY L+ V+ LG++GVAL+S   N N++ SL +Y+  
Sbjct  211   LRTQSITMPLTYCSLSAILLHIPINYLLINVMGLGVRGVALASCCTNLNILFSLSLYLYT  270

Query  790   SGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASM  969
             SG++K+ +G +S ECF+ + SLL+LAIPSC S CLEWWWYE+MI+LCGLL+NP ATVASM
Sbjct  271   SGLHKEAFGSLSLECFREWGSLLSLAIPSCVSTCLEWWWYEIMIILCGLLSNPSATVASM  330

Query  970   GVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGV  1149
             G+L+QTTSL+YIFPSSLSFGVSTRV NELGA RP +AK + IV +   F+LG  AL F +
Sbjct  331   GILMQTTSLLYIFPSSLSFGVSTRVSNELGANRPQKAKHSTIVAIFCGFLLGFFALGFSL  390

Query  1150  AVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRC  1329
              V+N WA +F+ D EI  LT+ VLPIIGLCELGNCPQT GCG LRGTARPK+GA +NL  
Sbjct  391   TVKNKWARLFSSDEEIWILTSRVLPIIGLCELGNCPQTIGCGVLRGTARPKVGANVNLGS  450

Query  1330  FYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTAT  1509
             FYFVG+PVA  LGFF+G  F GLW+GL AAQASC   M++V+ RTDW   A RA  LT  
Sbjct  451   FYFVGMPVAVGLGFFSGLGFGGLWMGLAAAQASCVGLMMVVIRRTDWGLMAERAMVLTGC  510

Query  1510  ISLVDDDD  1533
                 D + 
Sbjct  511   HQNQDREK  518



>ref|XP_008378671.1| PREDICTED: MATE efflux family protein 5-like [Malus domestica]
Length=547

 Score =   511 bits (1315),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 282/448 (63%), Positives = 347/448 (77%), Gaps = 0/448 (0%)
 Frame = +1

Query  160   LSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYS  339
             LS A +E K I  I+ P  +TGLLLY R+MISMLFLG LG+L LAGGSL+IGFANITGYS
Sbjct  51    LSEAVQEIKAIGKISGPSTMTGLLLYSRAMISMLFLGYLGELZLAGGSLSIGFANITGYS  110

Query  340   ILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQD  519
             ++SGLAMGMEPICGQA+GAK+ KL+GL+LQRT++LLL TS+PI+ +W NM+R+L+   QD
Sbjct  111   VISGLAMGMEPICGQAYGAKQMKLLGLTLQRTVLLLLSTSLPISFMWFNMKRVLLWFGQD  170

Query  520   REISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVV  699
              EIS  A +FIL+S PDL   SLLHPLRIYLR+Q++TLP+T+C+A ++++H+P+N+ LVV
Sbjct  171   EEISSVAHTFILFSTPDLFFLSLLHPLRIYLRTQNITLPVTYCSAISVLLHIPLNFLLVV  230

Query  700   VLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSC  879
                +GI GVA++ VW N N+   L  +  FS VYK +W   S +C +G+ SLL LAIP+C
Sbjct  231   KFQMGISGVAIAMVWTNLNLFILLFSFTYFSNVYKDSWVCPSADCLRGWSSLLALAIPTC  290

Query  880   ASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELG  1059
              SVCLEWWWYE MI+LCGLLANP+AT++SMG+LIQTTSL+Y+FPSSLS  VSTRVGNELG
Sbjct  291   ISVCLEWWWYEFMIMLCGLLANPKATISSMGILIQTTSLVYVFPSSLSLAVSTRVGNELG  350

Query  1060  AGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLC  1239
             A RP RA+++ IV L  S  LGL A+ F   +R+ W   FT DAEI+ LTA  LPI GLC
Sbjct  351   ANRPSRARISMIVSLGCSVALGLLAMLFTTFMRHQWGRFFTNDAEILKLTAIALPIAGLC  410

Query  1240  ELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaa  1419
             ELGNCPQTTGCG LRG+ARP +GA INL  FY VG+PVA  +GF     F GLWLGLLAA
Sbjct  411   ELGNCPQTTGCGVLRGSARPTIGANINLGSFYLVGMPVAMLMGFVVKMGFAGLWLGLLAA  470

Query  1420  qaSCALTMLLVLGRTDWNDQARRAKELT  1503
             Q SCAL M  VL  TDWN Q +RA +LT
Sbjct  471   QGSCALLMFYVLCTTDWNLQVKRANDLT  498



>ref|XP_004953434.1| PREDICTED: MATE efflux family protein 9-like [Setaria italica]
Length=562

 Score =   510 bits (1314),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 292/456 (64%), Positives = 356/456 (78%), Gaps = 1/456 (0%)
 Frame = +1

Query  169   AAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILS  348
             A  EA+ I  +ALPMI+TGLLLY RSMISMLFLGRLG L+LAGGSLAIGFANITGYS+LS
Sbjct  82    AGAEARSILGLALPMILTGLLLYLRSMISMLFLGRLGGLALAGGSLAIGFANITGYSVLS  141

Query  349   GLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREI  528
             GLAMGMEPICGQAFGA  ++L+G++ QRT+++LL  ++PI  LW +M  +L+LC QD  I
Sbjct  142   GLAMGMEPICGQAFGAGHYELLGVTTQRTVLMLLAAAVPIGGLWAHMRPLLLLCGQDAGI  201

Query  529   SMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLN  708
             +  A+++IL SLPDL+ Q+ LHP+RIYLR+QS+ LPLT CAA AI +H+PINY LV VL 
Sbjct  202   AAVAETYILASLPDLLLQAFLHPVRIYLRTQSINLPLTLCAALAIALHLPINYVLVSVLG  261

Query  709   LGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWG-GVSWECFKGYKSLLNLAIPSCAS  885
             LGI+GVAL+SV  N N++  L+ Y+LF GV+++T G  +S E F+G+  L  LA+PSC S
Sbjct  262   LGIRGVALASVLANLNLLLFLLAYILFKGVHRRTGGFALSAESFRGWGELAGLALPSCVS  321

Query  886   VCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAG  1065
             VCLEWWWYE+MILLCGLLA+P+ATVASMG+LIQTTSLIYIFPSSL FGVSTRV NELGA 
Sbjct  322   VCLEWWWYEIMILLCGLLADPQATVASMGILIQTTSLIYIFPSSLGFGVSTRVSNELGAN  381

Query  1066  RPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCEL  1245
             RP +A  AA  GL   F  G  A  F   VR  WA++FT D  I+ALTA+VLPI+G CEL
Sbjct  382   RPDQAGRAATAGLMLGFAFGGVASAFAWLVRGAWATMFTADPAIVALTASVLPILGACEL  441

Query  1246  GNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqa  1425
             GNCPQT GCG LRG+ARPK  A INLR FY VG PVA  L F+  +DFQGLWLGLLAAQA
Sbjct  442   GNCPQTAGCGVLRGSARPKDAASINLRSFYLVGTPVALVLAFWYHYDFQGLWLGLLAAQA  501

Query  1426  SCALTMLLVLGRTDWNDQARRAKELTATISLVDDDD  1533
             +C + MLLV+GRTDW  +A+RA++L      V+  +
Sbjct  502   ACVVRMLLVIGRTDWAAEAKRAQQLAGAAGAVETKE  537



>gb|EPS74212.1| hypothetical protein M569_00540, partial [Genlisea aurea]
Length=466

 Score =   507 bits (1305),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 275/455 (60%), Positives = 342/455 (75%), Gaps = 0/455 (0%)
 Frame = +1

Query  145   HNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFAN  324
             H    LS A  E K I  I+ P  +TGL+LYCR+MISMLFLG LG+L LAGGSL++G AN
Sbjct  9     HRYPTLSEAIAEMKEIVKISGPTAITGLILYCRAMISMLFLGHLGELELAGGSLSMGVAN  68

Query  325   ITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILI  504
             ITGYS++SGLAMGMEPICGQAFGAK+ K++GL+LQRTI+LLL TSIPI+ +W NM+RIL+
Sbjct  69    ITGYSVISGLAMGMEPICGQAFGAKQVKVLGLTLQRTILLLLTTSIPISFMWFNMKRILL  128

Query  505   LCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPIN  684
              C QD EIS  AQ FIL+ +PDL   S LHP+RIYLR+Q +TLPLT+ +  ++++H P+N
Sbjct  129   WCNQDEEISSMAQRFILWVIPDLFILSFLHPMRIYLRTQGITLPLTYLSLISVLLHAPLN  188

Query  685   YFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNL  864
             + LV  L +G++GV L+    N N+V SL  YV FSGV K +W   S +C +G+  LL+L
Sbjct  189   FLLVNYLKMGVEGVGLAMALTNLNLVISLCFYVYFSGVCKPSWVSPSGDCLRGWAGLLSL  248

Query  865   AIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRV  1044
             A+P+C SVCLEWWWYELMI+LCGLLANPRA++ASMG+LIQTTS +Y+FPSSLS GVSTRV
Sbjct  249   AVPTCVSVCLEWWWYELMIMLCGLLANPRASIASMGILIQTTSFVYVFPSSLSLGVSTRV  308

Query  1045  GNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLP  1224
             GNELGA RP RA+++ IV +  +  LG+ A+ F V +RN W  +FT D E++ LTAA LP
Sbjct  309   GNELGARRPARARVSMIVSMICAAALGVGAMAFAVMIRNRWGRLFTSDGEVLKLTAAALP  368

Query  1225  IIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwl  1404
             I GLCELGNCPQT GCG LRGTA+P +GA INL  FY VG+PV   +GF     F GLWL
Sbjct  369   IAGLCELGNCPQTAGCGVLRGTAQPTVGANINLGSFYLVGMPVGLVVGFVLKSGFPGLWL  428

Query  1405  gllaaqaSCALTMLLVLGRTDWNDQARRAKELTAT  1509
             GLLAAQ  CA  M + L R DW  +  RA+EL  T
Sbjct  429   GLLAAQGCCAGLMAVALYRIDWVAEVERARELCHT  463



>ref|NP_001053606.2| Os04g0571600 [Oryza sativa Japonica Group]
 emb|CAD41573.3| OSJNBa0088I22.5 [Oryza sativa Japonica Group]
 dbj|BAH01153.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF15520.2| Os04g0571600 [Oryza sativa Japonica Group]
Length=560

 Score =   509 bits (1311),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 301/500 (60%), Positives = 370/500 (74%), Gaps = 16/500 (3%)
 Frame = +1

Query  85    KEKMEAPLISEENPKEEDHNHNQT-HLSL--------------AAKEAKCISDIALPMIV  219
             +E+  AP+++ + P       N+   +SL              A  EA+ I  +A PMI+
Sbjct  35    EEQQPAPVLTSKPPGRLAKAVNEAWSVSLGVAFPVTPSMFTCSARGEARSILGLAFPMIL  94

Query  220   TGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAK  399
             TGLLLY RSMISMLFLG LG L+LAGGSLAIGFANITGYS+LSGLAMGMEPICGQAFGA 
Sbjct  95    TGLLLYLRSMISMLFLGHLGGLALAGGSLAIGFANITGYSVLSGLAMGMEPICGQAFGAG  154

Query  400   RFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIA  579
              + L+G+++QRT++LL+  +IPI  LW  M  +L+ C QD  I+  A+++I  SLPDL+ 
Sbjct  155   NYALLGVTMQRTVLLLIAAAIPIGGLWVQMRPLLLFCGQDAAIAAVAETYIFASLPDLVL  214

Query  580   QSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNV  759
             Q+ LHP+RIYLR+QS+ LPLT CA  AI +H+PINY LVVVL LG+K VAL+SV  N N+
Sbjct  215   QAFLHPVRIYLRTQSINLPLTVCAGLAIAIHLPINYVLVVVLGLGVKAVALASVLANLNL  274

Query  760   VGSLVVYVLFSGVYKKTWGGV-SWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGL  936
             V  L+ Y+   GV+K+T G + S E F+G+  L++LA+PSC SVCLEWWWYE+MILLCGL
Sbjct  275   VLFLLAYIFLKGVHKRTGGFLLSAESFRGWGELISLALPSCVSVCLEWWWYEIMILLCGL  334

Query  937   LANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASF  1116
             L NP+ATVASMG+LIQTTSLIYIFPSSLSFGVSTRV NELGAG+P  A  AA VGL   F
Sbjct  335   LLNPQATVASMGILIQTTSLIYIFPSSLSFGVSTRVSNELGAGQPEEASRAATVGLVLGF  394

Query  1117  ILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTAR  1296
               G  A  F   VRNVWAS+FT D  I+ALTA+VLPI+GLCELGNCPQTTGCG LRG+AR
Sbjct  395   GFGAFASAFAFLVRNVWASMFTADPAIVALTASVLPILGLCELGNCPQTTGCGVLRGSAR  454

Query  1297  PKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWND  1476
             PK  A INLR FY VG PVA  + F+   DF+GLW GLLAAQA+C + MLLV+GRTDW  
Sbjct  455   PKDAASINLRSFYLVGTPVALVMAFWFHLDFRGLWFGLLAAQATCTVRMLLVIGRTDWAA  514

Query  1477  QARRAKELTATISLVDDDDD  1536
             +A+R+K+LT   +   + DD
Sbjct  515   EAKRSKQLTGAGAANMESDD  534



>ref|XP_010555652.1| PREDICTED: MATE efflux family protein 9-like [Tarenaya hassleriana]
Length=517

 Score =   508 bits (1307),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 298/486 (61%), Positives = 373/486 (77%), Gaps = 12/486 (2%)
 Frame = +1

Query  85    KEKMEAPLISEENPKEEDHNHNQT----------HLSLAAKEAKCISDIALPMIVTGLLL  234
             +  +E P I  ++ K+       T            +L  KEA  I+ I++PM++TGLLL
Sbjct  10    EPSLETPFIVPKSSKKLQKTEQTTVKEYSVSVNNGFALEIKEAIAIAKISVPMVLTGLLL  69

Query  235   YCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLM  414
             Y RS++S LFLGRLGD +LAGGSLA+GFANITGYS+LSGLAMGMEPIC QAFGAKR  L+
Sbjct  70    YSRSLVSTLFLGRLGDSALAGGSLALGFANITGYSVLSGLAMGMEPICSQAFGAKRHSLL  129

Query  415   GLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLH  594
              L+L+RTI+LLL  S+PI++LW N++ IL    QD  ++ EAQ F++YS+PDL+AQS LH
Sbjct  130   DLALRRTILLLLLASLPISLLWFNIKAILQFLGQDVALASEAQVFLVYSIPDLLAQSFLH  189

Query  595   PLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLV  774
             PLR YLR+Q+ TLPL+ CAA  +V+HVPIN+FLV  L LG KGVAL+ VW NFN+V  L+
Sbjct  190   PLRAYLRTQAKTLPLSICAAVGVVLHVPINFFLVSYLQLGSKGVALAGVWTNFNIVLLLL  249

Query  775   VYVLFS--GVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANP  948
             ++V+FS   V ++T+ G S +   G++ LL LAIPSC SVCLEWW YE+MILLCG L NP
Sbjct  250   LHVIFSNKAVKEETFSGFSDDSSAGWRKLLTLAIPSCLSVCLEWWCYEIMILLCGFLLNP  309

Query  949   RATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGL  1128
             ++TVASMG+LIQTT+LIYIFPSSLSFGVSTRVGNELG+ +P +A+ AAIVGL  SF LG 
Sbjct  310   KSTVASMGILIQTTALIYIFPSSLSFGVSTRVGNELGSNQPDKARRAAIVGLGISFFLGF  369

Query  1129  AALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLG  1308
              AL+F  +VRN+WA +FT+D EI+ LT+  LPIIGLCELGNCPQTTGCG LRGTARPK+G
Sbjct  370   TALSFTFSVRNIWAKLFTEDEEIITLTSIALPIIGLCELGNCPQTTGCGVLRGTARPKVG  429

Query  1309  AKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARR  1488
             A +NL  FY VG+PVA  + F  GF F GLWLG+LAAQ+SC + M+LV  RTDW+ +A R
Sbjct  430   ANVNLVAFYAVGIPVAVAMSFGLGFGFIGLWLGMLAAQSSCVVAMMLVTCRTDWHVEAER  489

Query  1489  AKELTA  1506
             AKELTA
Sbjct  490   AKELTA  495



>ref|XP_003580355.1| PREDICTED: MATE efflux family protein 5-like [Brachypodium distachyon]
Length=580

 Score =   509 bits (1312),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 291/447 (65%), Positives = 351/447 (79%), Gaps = 2/447 (0%)
 Frame = +1

Query  169   AAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILS  348
             A  EA+ I  +A PMI+TGLLLY RSMISMLFLGRLG L+LAGGSLAIGFANITGYS+LS
Sbjct  88    ARDEARSILGLAFPMILTGLLLYLRSMISMLFLGRLGGLALAGGSLAIGFANITGYSVLS  147

Query  349   GLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREI  528
             GLAMGMEPICGQAFGA  + L+G+++QRT++LL+  ++PI  LW +M  +L+LC QD  I
Sbjct  148   GLAMGMEPICGQAFGAGNYALIGVTVQRTVLLLIAAAVPIGGLWMHMRPLLLLCGQDAAI  207

Query  529   SMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLN  708
             +  A+++IL SLPDL+ Q+ LHP+RIYLR QS+ LPLT CA  AI +H+PINY LV VL 
Sbjct  208   AAVAETYILASLPDLLLQAFLHPVRIYLRMQSINLPLTVCATLAIAIHLPINYALVTVLG  267

Query  709   LGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWG--GVSWECFKGYKSLLNLAIPSCA  882
             LGI+GVA++SV  N N++  L+ Y+ F GV+K+T     +S E F+G+  L+ LA+PSC 
Sbjct  268   LGIRGVAMASVLANLNLLLLLLAYIFFKGVHKRTGSFFMLSMESFRGWGELITLALPSCV  327

Query  883   SVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGA  1062
             SVCLEWWWYE+MILLCGLL NP+ATVASMG+LIQTTSLIYIFPSSLSFGVSTRV NELGA
Sbjct  328   SVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTSLIYIFPSSLSFGVSTRVSNELGA  387

Query  1063  GRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCE  1242
             GR   A  AA  G+      G  A  F   VRNVWAS+FT D  I+ALTA+VLPI+GLCE
Sbjct  388   GRTQEASRAATAGIMLGLAFGAFASAFAFLVRNVWASMFTADPAIIALTASVLPILGLCE  447

Query  1243  LGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaq  1422
             LGNCPQTTGCG LRG+ARPK  A INLR FY VG PVA  L F+  FDF+GLW GLLAAQ
Sbjct  448   LGNCPQTTGCGVLRGSARPKDAASINLRSFYLVGTPVALVLAFWFHFDFKGLWFGLLAAQ  507

Query  1423  aSCALTMLLVLGRTDWNDQARRAKELT  1503
             A+C + MLLV+GRTDW  +A+R+K+LT
Sbjct  508   ATCMVRMLLVIGRTDWAAEAKRSKQLT  534



>ref|XP_009335488.1| PREDICTED: MATE efflux family protein 5-like [Pyrus x bretschneideri]
Length=547

 Score =   508 bits (1309),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 286/479 (60%), Positives = 360/479 (75%), Gaps = 1/479 (0%)
 Frame = +1

Query  70    FISACKEKMEAPLISEENPKEEDHNHNQ-THLSLAAKEAKCISDIALPMIVTGLLLYCRS  246
             FI    + ++    S+   +++D    +   LS A +E K I  I+ P  +TGLLLY R+
Sbjct  20    FIETSNKTIDDLHCSDVFVEDDDKELRRWPTLSEAVREIKAIGKISGPSTMTGLLLYSRA  79

Query  247   MISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSL  426
             MISMLFLG LG+L LAGGSL+IGFANITGYS++SGLAMGMEPICGQA+GAK+ KL+GL+L
Sbjct  80    MISMLFLGYLGELELAGGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQMKLLGLTL  139

Query  427   QRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRI  606
             QRT++LLL TS+PI+++W NM+R+L+   QD EIS  A +FIL+S PDL   SLLHPLRI
Sbjct  140   QRTVLLLLSTSLPISLMWFNMKRVLLWFGQDEEISSVAHTFILFSTPDLFFLSLLHPLRI  199

Query  607   YLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVL  786
             YLR+Q++TLP+T+C+A ++++H+P+N+ LVV   +GI GVA++ VW N N+   L  +  
Sbjct  200   YLRTQNITLPVTYCSAISVLLHIPLNFLLVVKFQMGISGVAIAMVWTNLNLFILLFSFTY  259

Query  787   FSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVAS  966
             FS VYK +W   S +C +G+ SLL LAIP+C SVCLEWWWYE MI+LCGLLANP+AT++S
Sbjct  260   FSNVYKDSWVCPSADCLRGWSSLLALAIPTCISVCLEWWWYEFMIMLCGLLANPKATISS  319

Query  967   MGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFG  1146
             MG+LIQTTSL+Y+FPSSLS GVSTRVGNELGA RP RA+++ IV L  S  LGL A+ F 
Sbjct  320   MGILIQTTSLVYVFPSSLSLGVSTRVGNELGANRPSRARISMIVSLGCSVALGLLAMLFT  379

Query  1147  VAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLR  1326
               +R+ W   FT DAEI+ LTA  LPI GLCELGNCPQTTGCG LRG+ARP +GA INL 
Sbjct  380   TLMRHQWGRFFTNDAEILKLTATALPIAGLCELGNCPQTTGCGVLRGSARPTIGANINLG  439

Query  1327  CFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
              FY VG+PVA  +GF     F GLWLGLLAAQ  CAL M  VL  TDWN Q +RA +LT
Sbjct  440   SFYLVGMPVAMLMGFVMKMGFAGLWLGLLAAQGFCALLMFYVLCTTDWNLQVKRANDLT  498



>gb|EAZ31690.1| hypothetical protein OsJ_15838 [Oryza sativa Japonica Group]
Length=560

 Score =   508 bits (1307),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 300/500 (60%), Positives = 369/500 (74%), Gaps = 16/500 (3%)
 Frame = +1

Query  85    KEKMEAPLISEENPKEEDHNHNQT-HLSL--------------AAKEAKCISDIALPMIV  219
             +E+  AP+++ + P       N+   +SL              A  EA+ I  +A PMI+
Sbjct  35    EEQQPAPVLTSKPPGRLAKAVNEAWSVSLGVAFPVTPSMFTCSARGEARSILGLAFPMIL  94

Query  220   TGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAK  399
             TGLLLY RSMISMLFLG LG L+LAGGSLAIGFANITGYS+LSGLAMGMEPICGQAFGA 
Sbjct  95    TGLLLYLRSMISMLFLGHLGGLALAGGSLAIGFANITGYSVLSGLAMGMEPICGQAFGAG  154

Query  400   RFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIA  579
              + L+G+++QRT++LL+  +IPI  LW  M  +L+ C QD  I+  A+++I  SLPDL+ 
Sbjct  155   NYALLGVTMQRTVLLLIAAAIPIGGLWVQMRPLLLFCGQDAAIAAVAETYIFASLPDLVL  214

Query  580   QSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNV  759
             Q+ LHP+RIYLR+QS+ LPLT CA  AI +H+PINY LVVVL LG+K VAL+SV  N N+
Sbjct  215   QAFLHPVRIYLRTQSINLPLTVCAGLAIAIHLPINYVLVVVLGLGVKAVALASVLANLNL  274

Query  760   VGSLVVYVLFSGVYKKTWGGV-SWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGL  936
             V  L+ Y+   GV+K+T G + S E F+G+  L++LA+PSC SVCLEWWWYE+MILLCGL
Sbjct  275   VLFLLAYIFLKGVHKRTGGFLLSAESFRGWGELISLALPSCVSVCLEWWWYEIMILLCGL  334

Query  937   LANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASF  1116
             L NP+ATVASMG+LIQTTSLIYIFPSSLSFGVSTRV NELG G+P  A  AA VGL   F
Sbjct  335   LLNPQATVASMGILIQTTSLIYIFPSSLSFGVSTRVSNELGGGQPEEASRAATVGLVLGF  394

Query  1117  ILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTAR  1296
               G  A  F   VRNVWAS+FT D  I+ALTA+VLPI+GLCELGNCPQTTGCG LRG+AR
Sbjct  395   GFGAFASAFAFLVRNVWASMFTADPAIVALTASVLPILGLCELGNCPQTTGCGVLRGSAR  454

Query  1297  PKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWND  1476
             PK  A INLR FY VG PVA  + F+   DF+GLW GLLAAQA+C + MLLV+GRTDW  
Sbjct  455   PKDAASINLRSFYLVGTPVALVMAFWFHLDFRGLWFGLLAAQATCTVRMLLVIGRTDWAA  514

Query  1477  QARRAKELTATISLVDDDDD  1536
             +A+R+K+LT   +   + DD
Sbjct  515   EAKRSKQLTGAGAANMESDD  534



>ref|XP_006852723.1| hypothetical protein AMTR_s00033p00071400 [Amborella trichopoda]
 gb|ERN14190.1| hypothetical protein AMTR_s00033p00071400 [Amborella trichopoda]
Length=489

 Score =   503 bits (1296),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 280/464 (60%), Positives = 361/464 (78%), Gaps = 0/464 (0%)
 Frame = +1

Query  145   HNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFAN  324
             H     S   +E K I  I+ P ++TGLLLY R+MISMLFLG LG+L L+GG+LAIGFAN
Sbjct  9     HRWPSSSEVKEELKAIFKISGPTVLTGLLLYSRAMISMLFLGFLGELELSGGALAIGFAN  68

Query  325   ITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILI  504
             ITGYS++SGLAMGMEPIC QAFGAK++KLMGL+LQRTI+LLL +S+PI++ W NM++IL+
Sbjct  69    ITGYSVMSGLAMGMEPICAQAFGAKQYKLMGLALQRTILLLLTSSLPISVFWFNMKKILL  128

Query  505   LCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPIN  684
             LC QD  IS  A +FIL+SLPDL++ S LHPLR YLR+Q++TLPLT+C+A ++++H+P+N
Sbjct  129   LCGQDEAISSMANTFILFSLPDLVSLSFLHPLRNYLRTQNITLPLTYCSAISVLLHIPVN  188

Query  685   YFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNL  864
             + LV  L +GI GVAL+SVW NF +V  L+ Y+L SG YK +W   S +CF+G+ +L+ L
Sbjct  189   FLLVTCLKMGIGGVALASVWTNFILVLLLLFYLLVSGAYKSSWASPSTDCFRGWGTLMGL  248

Query  865   AIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRV  1044
             A+P+C SVCLEWWWYELMI+LCGL  NPRATVASMG++IQTT+L+Y+FPS+LS GVS RV
Sbjct  249   ALPTCISVCLEWWWYELMIILCGLFVNPRATVASMGIMIQTTALVYVFPSALSLGVSARV  308

Query  1045  GNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLP  1224
             G+ELGA RP  A+++ +VGL  +  +G+ A+ F  +VR+ W  +F+ D E++ LTA VLP
Sbjct  309   GHELGADRPSHARISMLVGLTFAGFMGVMAMGFAFSVRHWWGRMFSTDPEVLKLTAMVLP  368

Query  1225  IIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwl  1404
             I GLCELGNCPQTTGCG LRG+ARP  GA INL CFY VGLPVA  LGF+  F+F GLW+
Sbjct  369   IAGLCELGNCPQTTGCGVLRGSARPAAGANINLCCFYCVGLPVALALGFWMKFEFLGLWV  428

Query  1405  gllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDD  1536
             GLLAAQ  CA+ ML VL RTDW  Q  +A+ LT +  +   D D
Sbjct  429   GLLAAQGCCAVVMLFVLARTDWVAQVDKARRLTDSKPVAVCDHD  472



>ref|XP_009357241.1| PREDICTED: MATE efflux family protein 5-like [Pyrus x bretschneideri]
Length=547

 Score =   505 bits (1301),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 287/499 (58%), Positives = 360/499 (72%), Gaps = 17/499 (3%)
 Frame = +1

Query  43    NPLFFLPFAFISACKEKMEAPLISEENPKEEDHN-------------HNQTHLSLAAKEA  183
             NP    P +F+S  K      LI   N   +D +             H    LS A +E 
Sbjct  3     NPKPSSPSSFLSTNKTL----LIKTSNKTMDDLHSSDVFVDDDDQELHRWPTLSEAVQEF  58

Query  184   KCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMG  363
             K I  I+ P  +TGLLLY R+MISMLFLG LG+L LAGGSL+IGFANITGYS++SGLAMG
Sbjct  59    KAIGKISGPSTMTGLLLYSRAMISMLFLGYLGELQLAGGSLSIGFANITGYSVISGLAMG  118

Query  364   MEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQ  543
             MEPICGQA+GAK+ KL+GL+LQRT++LLL  S+PI+ +W NM+R+L+ C QD EIS  A 
Sbjct  119   MEPICGQAYGAKQLKLLGLTLQRTVLLLLSISLPISFMWLNMKRVLLWCGQDEEISSVAH  178

Query  544   SFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKG  723
             +F L+S+PDL   SLLHPLRIYLR+Q++TLP+T+C+A ++++H+P+N+ LVV   +GI G
Sbjct  179   TFTLFSIPDLFFLSLLHPLRIYLRTQNITLPVTYCSAISVLLHIPLNFLLVVKFQMGISG  238

Query  724   VALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWW  903
             VA++ VW N N+   L  +  FS VYK TW   S +C +G+ SLL L IP+C SVCLEWW
Sbjct  239   VAIAMVWTNLNLFILLFSFTYFSNVYKDTWVCPSADCLRGWSSLLALCIPTCISVCLEWW  298

Query  904   WYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAK  1083
             WYE MI+LCGLLANP+AT+ASMG+LIQTTSL+Y+FPSSLS GVSTRVGN LGA RP +A+
Sbjct  299   WYEFMIMLCGLLANPKATIASMGILIQTTSLVYVFPSSLSLGVSTRVGNLLGANRPSKAR  358

Query  1084  LAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQT  1263
             ++ IV +  +  LGL A+ F   +R+ W   FT DAEI+ LTA  LPI GLCELGNCPQT
Sbjct  359   ISMIVSVVCAVALGLLAMLFTTLMRHQWGRFFTNDAEILKLTAIALPIAGLCELGNCPQT  418

Query  1264  TGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTM  1443
             T CG LRG+ARP +GA INL  FY VG+PVA  +GF     F GLWLGLLAAQ SCAL M
Sbjct  419   TACGVLRGSARPTVGANINLGSFYLVGMPVAMLMGFVVKMGFAGLWLGLLAAQGSCALLM  478

Query  1444  LLVLGRTDWNDQARRAKEL  1500
               V+  TDWN Q +R+K+L
Sbjct  479   FYVVCTTDWNLQVKRSKDL  497



>ref|XP_007137291.1| hypothetical protein PHAVU_009G114900g [Phaseolus vulgaris]
 gb|ESW09285.1| hypothetical protein PHAVU_009G114900g [Phaseolus vulgaris]
Length=548

 Score =   505 bits (1300),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 289/471 (61%), Positives = 361/471 (77%), Gaps = 4/471 (1%)
 Frame = +1

Query  115   EENPKEEDHNHNQTHLSLAAKEA----KCISDIALPMIVTGLLLYCRSMISMLFlgrlgd  282
             + +P   D   ++ H     KE     K +  ++ P  VTGLLLY R+MISM+FLG LGD
Sbjct  28    KNHPPVHDQLQDELHRWPTPKEVIGEMKALGKVSGPTAVTGLLLYSRAMISMVFLGYLGD  87

Query  283   lslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSI  462
             + LAGGSL+IGFANITGYS++SGLAMGMEPICGQA+GAK+FK +GL+LQRT++LLL TSI
Sbjct  88    MELAGGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQFKTLGLTLQRTVLLLLSTSI  147

Query  463   PIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLT  642
             PI++ W NM+ IL+ C QD +IS  AQ+FIL+S+PDL   SLLHPLRIYLR+QS+TLPLT
Sbjct  148   PISLAWLNMKSILLWCGQDHQISSTAQTFILFSIPDLFLLSLLHPLRIYLRTQSITLPLT  207

Query  643   FCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGV  822
             +C+A ++++H+P+N+ LVV   +G+ GVA++ VW N N+   L  +V FSGVYK +W   
Sbjct  208   YCSALSLLLHLPLNFLLVVHFKMGVSGVAIAMVWTNLNLFLFLSSFVYFSGVYKDSWVPP  267

Query  823   SWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIY  1002
             S +C +G+ SLL LA+P+C SVCLEWWWYELMI+LCGLL NP+AT+ASMG+LIQTTSL+Y
Sbjct  268   SSDCLRGWSSLLALAVPTCVSVCLEWWWYELMIILCGLLLNPKATIASMGILIQTTSLVY  327

Query  1003  IFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFT  1182
             +FPSSLS GVSTRVGNELGA RP RA+++ IV L  +  LGLAA+ F   +R+ W   FT
Sbjct  328   VFPSSLSLGVSTRVGNELGANRPARARISMIVSLACAVALGLAAIVFTTLMRHQWGRFFT  387

Query  1183  QDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGW  1362
              D EI+ LTA+VLPI+GLCELGNCPQTTGCG LRG+ARP +GA INL  FY VG+PVA  
Sbjct  388   ADTEILDLTASVLPIVGLCELGNCPQTTGCGVLRGSARPTVGANINLASFYLVGMPVAVL  447

Query  1363  LGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATIS  1515
             LGF     F GLWLGLLAAQASCA  M+ VL  TDWN Q +RA +LT   S
Sbjct  448   LGFVVKMGFPGLWLGLLAAQASCASLMIFVLCTTDWNAQVQRANDLTTANS  498



>ref|XP_010553670.1| PREDICTED: MATE efflux family protein 5-like [Tarenaya hassleriana]
Length=532

 Score =   504 bits (1299),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 277/444 (62%), Positives = 351/444 (79%), Gaps = 0/444 (0%)
 Frame = +1

Query  175   KEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGL  354
             +E K +  I+ P  +TGLL+Y R+MISMLFLG LG+L LAGGSLAIGFANITGYS++SGL
Sbjct  57    EEVKEMGKISGPTAITGLLMYTRAMISMLFLGYLGELDLAGGSLAIGFANITGYSVISGL  116

Query  355   AMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISM  534
             AMGMEPICGQA+GAK+ KL+GL+LQRTI+LLL +SIPI+  W N+ RIL+ C QD EIS 
Sbjct  117   AMGMEPICGQAYGAKQMKLLGLTLQRTILLLLSSSIPISFFWLNVRRILLWCGQDEEISS  176

Query  535   EAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLG  714
              AQ+F+L+++PDL   SLLHPLRIYLR+QS+TLP+T+  A +I++H+P+N+ LV    +G
Sbjct  177   VAQTFLLFAIPDLFFLSLLHPLRIYLRTQSITLPVTYSTAVSILLHIPLNFLLVTKFEMG  236

Query  715   IKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCL  894
             I GVA++ V  N N+V  L  +V F+GV++ TW  +S +C KG+ SLL+LAIP+C SVCL
Sbjct  237   IVGVAIAMVLTNLNLVVLLSSFVYFTGVHRDTWVPLSVDCLKGWSSLLSLAIPTCVSVCL  296

Query  895   EWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPG  1074
             EWWWYE MI++CGLLANP+ATVASMG+LIQTT+L+Y+FPSSLS GVSTR+GNELGA RP 
Sbjct  297   EWWWYEFMIMMCGLLANPKATVASMGILIQTTALVYVFPSSLSLGVSTRIGNELGAKRPR  356

Query  1075  RAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNC  1254
             +A+++ I+ L  +  LG+ A+ F + VR+ W  +FT DAEI+ LT+  LPI GLCELGNC
Sbjct  357   KARISVIISLFCAVGLGIMAMAFTILVRHKWGRLFTTDAEILELTSMALPIAGLCELGNC  416

Query  1255  PQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCA  1434
             PQTTGCG LRG+ARP LGA INL  FY VG+PVA  LGF     F GLWLGLLAAQA+CA
Sbjct  417   PQTTGCGVLRGSARPTLGANINLGSFYLVGMPVAILLGFVLKLGFPGLWLGLLAAQATCA  476

Query  1435  LTMLLVLGRTDWNDQARRAKELTA  1506
               M   L +TDW  QA+RA+ELT+
Sbjct  477   TLMFCALWKTDWEVQAQRAEELTS  500



>gb|EMT29118.1| Multidrug and toxin extrusion protein 1 [Aegilops tauschii]
Length=572

 Score =   506 bits (1302),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 306/530 (58%), Positives = 384/530 (72%), Gaps = 21/530 (4%)
 Frame = +1

Query  4     AYKYGDKRQSNTKNPLFFLPFAFISACKEKMEAPLISEENPKEEDHNHNQT---HLSLA-  171
             +Y+YG+        PL  LP A +    E++  P+++ + P        +     LSLA 
Sbjct  12    SYRYGEHAGDGITAPL--LPKAEVVVPMEELP-PVLTCKLPGRLARAVKEAWSVSLSLAF  68

Query  172   -----------AKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigF  318
                         +EA+ I  +A+PMI+TGLLLY RSMISMLFLGRLG L+LAGGSLAIGF
Sbjct  69    PMLPSMSAAAAGEEARSILGLAMPMILTGLLLYLRSMISMLFLGRLGGLALAGGSLAIGF  128

Query  319   ANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERI  498
             ANITGYS+LSGLAMGMEPICGQAFGA  ++L+G+++QRT++LL+  ++P+  LW +M  +
Sbjct  129   ANITGYSVLSGLAMGMEPICGQAFGAGHYELLGVTMQRTVLLLVAAAVPVGGLWMHMRPL  188

Query  499   LILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVP  678
             L+LC QD  I+  A+++IL SLPDL+ Q+ LHP+RIYLR+QS+ LPLT CAA AI +H+P
Sbjct  189   LLLCGQDVGIAAVAETYILSSLPDLLLQAFLHPVRIYLRTQSINLPLTVCAALAIALHLP  248

Query  679   INYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGV-SWECFKGYKSL  855
             INY LV VL  GI+GVA +SV  N N +  L+ Y+L  GV+K+T G V S E F+G+  L
Sbjct  249   INYVLVSVLGHGIRGVAFASVLANLNFLLLLLGYILVKGVHKRTRGFVFSAESFRGWGEL  308

Query  856   LNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVS  1035
             ++LA+PSC SVCLEWWWYE+MIL+CGLLANP+ATVASMG+LIQTTSLIYIFPSSL FGVS
Sbjct  309   VSLALPSCVSVCLEWWWYEIMILMCGLLANPQATVASMGILIQTTSLIYIFPSSLGFGVS  368

Query  1036  TRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAA  1215
             TRV NELGA R  RA  AA VGL   F  G AA  F   VR  WA++FT D  I+ LTA+
Sbjct  369   TRVSNELGANRAERAGRAATVGLMLGFAFGGAASAFAYLVRGSWAAMFTADPAIITLTAS  428

Query  1216  VLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqg  1395
             VLPI+G CELGNCPQT GCG LRG+ARPK  A INLR FY VG PVA  L F+  +DFQG
Sbjct  429   VLPILGACELGNCPQTAGCGVLRGSARPKAAASINLRSFYLVGTPVALILAFWYHYDFQG  488

Query  1396  lwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT--ATISLVDDDDDD  1539
             LWLGLLAAQA+C + MLLV+GRTDW  +A+RA++LT   T+++  D    
Sbjct  489   LWLGLLAAQAACMVRMLLVIGRTDWAAEAKRAQQLTGAGTVTVAVDTKPS  538



>emb|CDY65506.1| BnaCnng47370D [Brassica napus]
Length=510

 Score =   502 bits (1293),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 277/484 (57%), Positives = 359/484 (74%), Gaps = 7/484 (1%)
 Frame = +1

Query  76    SACKEKMEAPLISEENPKEEDH-NHNQTH-LSLAAKEAKCISDIALPMIVTGLLLYCRSM  249
             S+ +++   PL+ + +P E+ H N N +  L+  A EA  I+ I+LP++ TGLLLY RS 
Sbjct  5     SSVRDEGTIPLLQKLSPHEKLHLNKNYSAPLTHFANEAISIAKISLPLVFTGLLLYFRSF  64

Query  250   ISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQ  429
             +S+ FLG LG  +LAGGSLA+ FANITGYS+ SGL MG+E IC QAFGAKR+ L+  +++
Sbjct  65    VSLFFLGGLGRPTLAGGSLALAFANITGYSLFSGLTMGVESICSQAFGAKRYNLVTATIR  124

Query  430   RTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIY  609
             R IVLLL TS+P+++LW N+E+IL + +QD +++ EA  F+LYS+PDL+AQS LHPLR+Y
Sbjct  125   RGIVLLLLTSLPVSLLWINIEKILQMLKQDEDLASEAHIFLLYSVPDLVAQSFLHPLRVY  184

Query  610   LRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLF  789
             LR+Q+ TLPL+ C A A V+H+PI +  V  L  GIKG+ALS V  NFN+V  L +Y+ F
Sbjct  185   LRTQAKTLPLSVCTAVASVLHLPITFLFVSYLGFGIKGIALSGVLSNFNLVVFLFIYIRF  244

Query  790   -----SGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRA  954
                  S   +        +  + +K L++LA+PSC SVCLEWW YE+MILLCG L NP+A
Sbjct  245   VEHKVSINEEVLVEEEVEDSMREWKKLISLAVPSCVSVCLEWWCYEIMILLCGFLINPKA  304

Query  955   TVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAA  1134
             TVASMG+LIQ TSL+YIFPSSLSFGVSTRVGNELG+ RP RA+ AA+VGL  S  LG  A
Sbjct  305   TVASMGILIQITSLVYIFPSSLSFGVSTRVGNELGSDRPMRARRAAVVGLGLSIALGFTA  364

Query  1135  LTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAK  1314
             LTF V+VRN+WA +FT D EI+ LT+ VLPI+GLCELGNCPQTTGCG LRG+ARP++GA 
Sbjct  365   LTFTVSVRNMWARLFTDDEEIIKLTSMVLPIVGLCELGNCPQTTGCGVLRGSARPRIGAN  424

Query  1315  INLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAK  1494
             +N+  FY VG+PV   L F+ GF F+GLWLG+LAAQ SC   M++    TDW  +A RAK
Sbjct  425   VNMAAFYVVGMPVGMVLAFWFGFGFKGLWLGMLAAQMSCVGGMMVATCGTDWELEAVRAK  484

Query  1495  ELTA  1506
             ELTA
Sbjct  485   ELTA  488



>emb|CDX91621.1| BnaC02g15390D [Brassica napus]
Length=508

 Score =   502 bits (1293),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 281/497 (57%), Positives = 360/497 (72%), Gaps = 8/497 (2%)
 Frame = +1

Query  73    ISACKEKMEAPLISEENPKEEDH--NHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRS  246
             ++  + ++  PL+ + + +E+ H   +  T LSL A EA  ++ I+LP++ TGLLLY RS
Sbjct  4     LNRVRNEVTIPLLPKISHQEKLHVLPNYTTPLSLFANEAISVARISLPLVFTGLLLYFRS  63

Query  247   MISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSL  426
              +S+ FLG LGD +LAGGSLA+ FANITGYS  SGL MG+E IC QAFGAKR+ L+  ++
Sbjct  64    FVSLFFLGGLGDHTLAGGSLALAFANITGYSFFSGLTMGVESICSQAFGAKRYNLVMATI  123

Query  427   QRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRI  606
             +R   LLLFTS+P+ +LW N++++L   +QD E+  EA +F+LYS+PDLIAQS LHPLR+
Sbjct  124   KRGTALLLFTSLPVFLLWINIDKVLKALKQDEELVSEAHTFLLYSVPDLIAQSFLHPLRV  183

Query  607   YLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVL  786
             YLR+QS TLPL+ C A A V+H+PI +FLV  L LGIKG+ALS V  N N+V  L +Y+ 
Sbjct  184   YLRTQSKTLPLSICTAVASVLHLPITFFLVSYLGLGIKGIALSGVASNINLVAFLFIYIA  243

Query  787   F--SGVYKKTWGGVSWEC----FKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANP  948
             F    V     G VS E      + +K LL LAIPSC SVCLEWW YE+MI+LCGLL NP
Sbjct  244   FLEDKVRSDEEGEVSEESCGDSVREWKKLLGLAIPSCVSVCLEWWCYEIMIVLCGLLVNP  303

Query  949   RATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGL  1128
             +AT+ASMG+LIQ TSLIYIFP+SLSFGVSTRVGNELG+ +P RA+ AAIVGL  S  LG 
Sbjct  304   KATIASMGILIQITSLIYIFPNSLSFGVSTRVGNELGSNQPQRARRAAIVGLGLSIALGF  363

Query  1129  AALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLG  1308
              A  F V+VRN+WA +FT D EI+ LT  VLPI+GLCELGNCPQTTGCG LRG+ARP++G
Sbjct  364   TAFAFTVSVRNMWARLFTDDEEIIKLTLMVLPIVGLCELGNCPQTTGCGVLRGSARPRIG  423

Query  1309  AKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARR  1488
             A IN+  FY VG+P+   + F+ GF F+GLWLG+LAAQ  C   M++   RT+W  +A R
Sbjct  424   ANINMAAFYVVGMPMGMVMTFWFGFGFRGLWLGMLAAQIVCVSGMMVATCRTNWEVEAAR  483

Query  1489  AKELTATISLVDDDDDD  1539
             A+ELTA       DD D
Sbjct  484   ARELTAVYGGRGGDDKD  500



>emb|CAH67053.1| OSIGBa0127A14.5 [Oryza sativa Indica Group]
 gb|EAY95222.1| hypothetical protein OsI_17039 [Oryza sativa Indica Group]
Length=560

 Score =   504 bits (1298),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 302/500 (60%), Positives = 371/500 (74%), Gaps = 16/500 (3%)
 Frame = +1

Query  85    KEKMEAPLISEENPKEEDHNHNQT-HLSL--------------AAKEAKCISDIALPMIV  219
             +E+  AP+++ + P       N+   +SL              A  EA+ I  +A PMI+
Sbjct  35    EEQQPAPVLTSKPPGRLAKAVNEAWSVSLGVAFPVTPSMFTCSARGEARSILGLAFPMIL  94

Query  220   TGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAK  399
             TGLLLY RSMISMLFLG LG L+LAGGSLAIGFANITGYS+LSGLAMGMEPICGQAFGA 
Sbjct  95    TGLLLYLRSMISMLFLGHLGGLALAGGSLAIGFANITGYSVLSGLAMGMEPICGQAFGAG  154

Query  400   RFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIA  579
              + L+G+++QRT++LL+  +IPI  LW  M  +L+ C QD  I+  A+++I  SLPDL+ 
Sbjct  155   NYALLGVTMQRTVLLLIAAAIPIGGLWVQMRPLLLFCGQDAAIAAVAETYIFASLPDLVL  214

Query  580   QSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNV  759
             Q+ LHP+RIYLR+QS+ LPLT CA  AI +H+PINY LVVVL LG+KGVAL+SV  N N+
Sbjct  215   QAFLHPVRIYLRTQSINLPLTVCAGLAIAIHLPINYVLVVVLGLGVKGVALASVLANLNL  274

Query  760   VGSLVVYVLFSGVYKKTWGGV-SWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGL  936
             V  L+ Y+   GV+K+T G + S E F+G+  L++LA+PSC SVCLEWWWYE+MILLCGL
Sbjct  275   VLFLLAYIFLKGVHKRTGGFLLSAESFRGWGELISLALPSCVSVCLEWWWYEIMILLCGL  334

Query  937   LANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASF  1116
             L NP+ATVASMG+LIQTTSLIYIFPSSLSFGVSTRV NELGAG+P  A  AA VGL   F
Sbjct  335   LLNPQATVASMGILIQTTSLIYIFPSSLSFGVSTRVSNELGAGQPEEASRAATVGLVLGF  394

Query  1117  ILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTAR  1296
               G  A  F   VRNVWAS+FT D  I+ALTA+VLPI+GLCELGNCPQTTGCG LRG+AR
Sbjct  395   GFGAFASAFAFLVRNVWASMFTADPAIVALTASVLPILGLCELGNCPQTTGCGVLRGSAR  454

Query  1297  PKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWND  1476
             PK  A INLR FY VG PVA  + F+   DF+GLW GLLAAQA+C + MLLV+GRTDW  
Sbjct  455   PKDAASINLRSFYLVGTPVALVMAFWFHLDFRGLWFGLLAAQATCTVRMLLVIGRTDWAA  514

Query  1477  QARRAKELTATISLVDDDDD  1536
             +A+R+K+LT   +   + DD
Sbjct  515   EAKRSKQLTGAGAANMESDD  534



>ref|XP_006859062.1| hypothetical protein AMTR_s00068p00197570 [Amborella trichopoda]
 gb|ERN20529.1| hypothetical protein AMTR_s00068p00197570 [Amborella trichopoda]
Length=493

 Score =   500 bits (1288),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 268/443 (60%), Positives = 343/443 (77%), Gaps = 0/443 (0%)
 Frame = +1

Query  175   KEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGL  354
             +E K +S I+ PMI+TG+L+Y RS+ISMLFLGRLG+ +LA GSL+IGFANITGYSI+ GL
Sbjct  35    EELKLLSRISYPMILTGILVYVRSLISMLFLGRLGEAALAAGSLSIGFANITGYSIIFGL  94

Query  355   AMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISM  534
             A GMEPICGQA+GA+ + ++G +L RTIV L+ +S+PI++LW +M+ IL+L  Q+  I  
Sbjct  95    ATGMEPICGQAYGAQNWSILGPALIRTIVFLIISSLPISLLWLHMDHILLLLGQEATIIH  154

Query  535   EAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLG  714
              A+++IL+SLPDL AQ+LLHPLRIYLRSQ++T P+  C+  A + H+PIN  LV  L+LG
Sbjct  155   MAKTYILFSLPDLFAQALLHPLRIYLRSQNITFPIAICSGIATLFHLPINLLLVQTLDLG  214

Query  715   IKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCL  894
             IKGVAL  V+ NFN+V  L++Y+ +SGVY+ +W G S EC   +KS L LAIPSC S+CL
Sbjct  215   IKGVALGVVFTNFNLVFLLLIYIYYSGVYQMSWKGFSQECLHEWKSFLTLAIPSCVSICL  274

Query  895   EWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPG  1074
             EWWWYE MI+LCGLL NP A VA+MGVLIQ TSLIY+FPSSLS GVSTRV NELGA  P 
Sbjct  275   EWWWYEFMIILCGLLLNPEAKVAAMGVLIQFTSLIYVFPSSLSMGVSTRVANELGAREPA  334

Query  1075  RAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNC  1254
             +AK AA+VG   + ++GL AL+F   +RN W  +FT+D +I+ LT   LPI+GLCELGNC
Sbjct  335   KAKRAAMVGSGLAIVMGLGALSFATLLRNYWGMMFTKDYDILRLTKIALPILGLCELGNC  394

Query  1255  PQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCA  1434
             PQTT CG LRG+ARP +GA +NL  FYF+G+PVA  L F     F GLWLGLL AQ SCA
Sbjct  395   PQTTMCGVLRGSARPNIGANVNLGAFYFIGMPVALVLAFKVKIGFSGLWLGLLVAQISCA  454

Query  1435  LTMLLVLGRTDWNDQARRAKELT  1503
             +T+ +V+ RT+W  QA+RA+ELT
Sbjct  455   VTLGVVVIRTNWVVQAQRAEELT  477



>ref|XP_008781774.1| PREDICTED: MATE efflux family protein DTX1-like [Phoenix dactylifera]
Length=541

 Score =   502 bits (1292),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 273/491 (56%), Positives = 355/491 (72%), Gaps = 9/491 (2%)
 Frame = +1

Query  76    SACKEKMEAPLI----SEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCR  243
             S  KEK E P +    SE  P+E+      T      +E   +S I+ P   +GLL Y R
Sbjct  40    SLVKEKEELPSVHHQLSETVPREDS-----TFFREIVEEIPALSRISAPATASGLLYYAR  94

Query  244   SMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLS  423
             S+ISMLFLG LG + LA G+L++ FANITGYSI SGLAMGMEP CGQA+GA+++ L+ L+
Sbjct  95    SLISMLFLGHLGHVELAAGALSVSFANITGYSIFSGLAMGMEPTCGQAYGAQKWSLLSLT  154

Query  424   LQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLR  603
             L RTI  LL  SIPI++LW N ++IL+   QD  I+  A++++LYSLPDLIAQS++HPLR
Sbjct  155   LHRTIAFLLLISIPISLLWLNADQILLCLGQDPTITKVARTYLLYSLPDLIAQSIIHPLR  214

Query  604   IYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYV  783
             IYLR+Q+VT P+ F A  A ++H+P+NY+LV+VL  GIKGVA + V  NFN++  LV Y+
Sbjct  215   IYLRTQNVTHPVAFAAVVASLIHIPLNYYLVIVLKTGIKGVATAVVLTNFNIILLLVCYI  274

Query  784   LFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVA  963
              FSGV  KTW  VS ECFK + S ++LAIPSC SVCLEWWWYE MI+LCGLL NP  TV+
Sbjct  275   YFSGVCSKTWTRVSMECFKEWGSFISLAIPSCISVCLEWWWYEFMIILCGLLKNPEETVS  334

Query  964   SMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTF  1143
             ++G+LIQ T+L+Y+FPSSLS+GVSTRV +ELGA +PGRA+ AA +G      +G+AA+ F
Sbjct  335   AIGILIQMTALVYVFPSSLSYGVSTRVAHELGAEQPGRARRAATMGTACGAFIGVAAMAF  394

Query  1144  GVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINL  1323
              +  R  W ++FT+   ++ L A  LPI+GLCELGNCPQT  CGALRG+AR  +GA++NL
Sbjct  395   NIWARGWWGAMFTERTGVLKLVAKALPIVGLCELGNCPQTAMCGALRGSARADVGAQVNL  454

Query  1324  RCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
               FY VGLPVA +LGF+ G  F GLWLGLLAAQASC L + +VL RT+W  Q + AKELT
Sbjct  455   GAFYGVGLPVALFLGFWVGLGFVGLWLGLLAAQASCTLMLGVVLVRTNWAKQVKLAKELT  514

Query  1504  ATISLVDDDDD  1536
             +   +V  D+ 
Sbjct  515   SAGEVVKGDES  525



>ref|XP_010925990.1| PREDICTED: MATE efflux family protein 6-like, partial [Elaeis 
guineensis]
Length=476

 Score =   499 bits (1285),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 266/454 (59%), Positives = 341/454 (75%), Gaps = 0/454 (0%)
 Frame = +1

Query  175   KEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGL  354
             +E   +S I+ P   TGLL Y R++ISMLFLG LG + LA G+L++GFANITGYSI SGL
Sbjct  7     EEIPALSRISAPTTATGLLYYARNLISMLFLGHLGHVELAAGALSVGFANITGYSIFSGL  66

Query  355   AMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISM  534
             +MGMEPICGQA+GA+++ L+ L+L RTI  LL  SIPI++LW N ++IL+   QD  I+ 
Sbjct  67    SMGMEPICGQAYGAQQWSLLSLTLHRTIAFLLLISIPISLLWLNADQILLYIGQDPTITK  126

Query  535   EAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLG  714
              A++++LY+LPDLIAQS++HPLRIYLR+Q+VT P+ F AA A ++H+P+NY+LV+VL  G
Sbjct  127   VAKTYLLYTLPDLIAQSIIHPLRIYLRTQNVTHPVAFVAAIASLIHIPLNYYLVIVLKTG  186

Query  715   IKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCL  894
             IKGVA++ V  NFN++  LV Y+ FSGV  KTW  VS +CFK + S ++LAIPSC SVCL
Sbjct  187   IKGVAIAVVLTNFNIILLLVCYIYFSGVCSKTWTSVSMDCFKEWGSFISLAIPSCISVCL  246

Query  895   EWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPG  1074
             EWWWYE MI+LCGLL NP  TV+++G+LIQ T+L+Y+FPSSL +GVSTRV  ELGA +PG
Sbjct  247   EWWWYEFMIILCGLLRNPEETVSAIGILIQMTALVYVFPSSLGYGVSTRVAQELGAEQPG  306

Query  1075  RAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNC  1254
             RA+ AA +G      +G+AA+ F +  R  W  +FT    ++ L AA LPI+GLCELGNC
Sbjct  307   RARRAAAMGTACGAFIGVAAMAFNIWARGWWGVMFTNRTGVLKLVAAALPILGLCELGNC  366

Query  1255  PQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCA  1434
             PQT  CG LRG+AR  +GAK+NL  FY VGLPVA  LGF+ G  F GLWLGLLAAQASCA
Sbjct  367   PQTAMCGVLRGSARAGIGAKVNLGAFYGVGLPVALLLGFWVGLGFVGLWLGLLAAQASCA  426

Query  1435  LTMLLVLGRTDWNDQARRAKELTATISLVDDDDD  1536
             L + +VL RTDW  Q +RAKELT    +V  DD 
Sbjct  427   LVLGVVLIRTDWAKQVKRAKELTGGGEVVKGDDS  460



>ref|XP_003572811.1| PREDICTED: MATE efflux family protein 9-like [Brachypodium distachyon]
Length=582

 Score =   502 bits (1293),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 291/448 (65%), Positives = 356/448 (79%), Gaps = 2/448 (0%)
 Frame = +1

Query  169   AAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILS  348
             A +EA+ I  +A+PMI+TGLLLY RSMISMLFLGRLG L+LAGGSLAIGFANITGYS+LS
Sbjct  86    AGEEARSILGLAMPMILTGLLLYLRSMISMLFLGRLGGLALAGGSLAIGFANITGYSVLS  145

Query  349   GLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREI  528
             GLAMGMEPICGQAFGA  ++L+G+++QRT++LL+  ++PI  LW +M  +L+LC QD  I
Sbjct  146   GLAMGMEPICGQAFGAGHYELLGVTMQRTVLLLVAAAVPIGGLWMHMRPLLLLCGQDVGI  205

Query  529   SMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLN  708
             +  A+++IL SLPDL+ Q+ LHP+RIYLR+QS+ LPLT CAA AI +H+PINY LV VL 
Sbjct  206   AAVAETYILASLPDLLLQAFLHPVRIYLRTQSINLPLTVCAALAIALHLPINYVLVSVLG  265

Query  709   LGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWG--GVSWECFKGYKSLLNLAIPSCA  882
              GI+GVAL+SV  N N +  L+ Y+L  GV+++T     +S + F+G+  L++LA+PSC 
Sbjct  266   HGIRGVALASVLANLNFLLLLLGYILCKGVHRRTGSFFALSADSFRGWGELVSLALPSCV  325

Query  883   SVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGA  1062
              VCLEWWWYE+MILLCGLLANP+ATVASMG+LIQTTSLIYIFPSSL FGVSTRV NELGA
Sbjct  326   GVCLEWWWYEIMILLCGLLANPQATVASMGILIQTTSLIYIFPSSLGFGVSTRVSNELGA  385

Query  1063  GRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCE  1242
              R  RA  AA VGL   F  G AA  F  AVR  WA++FT D  I+ALTA+VLPI+G CE
Sbjct  386   NRAERAGRAATVGLMLGFAFGGAASAFAYAVRGSWAAMFTADPAIVALTASVLPILGACE  445

Query  1243  LGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaq  1422
             LGNCPQT GCG LRG+ARPK  A INLR FY VG PVA  L F+  +DFQGLWLGLLAAQ
Sbjct  446   LGNCPQTAGCGVLRGSARPKDAASINLRSFYLVGTPVALVLAFWFRYDFQGLWLGLLAAQ  505

Query  1423  aSCALTMLLVLGRTDWNDQARRAKELTA  1506
             A+C + MLLV+GRTDW  +A+RA++LTA
Sbjct  506   AACVVRMLLVIGRTDWEAEAKRAQQLTA  533



>ref|XP_010511083.1| PREDICTED: MATE efflux family protein 7-like [Camelina sativa]
Length=533

 Score =   499 bits (1285),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 286/490 (58%), Positives = 362/490 (74%), Gaps = 14/490 (3%)
 Frame = +1

Query  82    CKEKMEAPLISE---ENPKEEDHNHNQT---------HLSLAAKEAKCISDIALPMIVTG  225
             CK+K     +     +NP   +  +N +         H  L  +E K I  I+ P  +TG
Sbjct  17    CKDKTRFSKLETCDTDNPHYSEFTNNDSLDLKRWPTFHEGL--EEVKAIGRISGPTAMTG  74

Query  226   LLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRF  405
             LL+Y R+MISMLFLG LG+L LAGGSL+IGFANITGYS++SGL+MGMEPICGQA+GAK+ 
Sbjct  75    LLMYSRAMISMLFLGYLGELELAGGSLSIGFANITGYSVISGLSMGMEPICGQAYGAKQM  134

Query  406   KLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQS  585
             KL+GL+LQRT++LLL  S+PI+  W +M RIL+ C QD EIS  AQ F+L+++PDL   S
Sbjct  135   KLLGLTLQRTVLLLLSCSVPISFSWLSMRRILLWCGQDEEISSVAQKFLLFAIPDLFLLS  194

Query  586   LLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVG  765
             LLHPLRIYLR+Q++TLP+T+  A +++VHVP+N+ LVV L +G+ GVA++ V  N N+V 
Sbjct  195   LLHPLRIYLRTQNITLPVTYSTAVSVLVHVPLNFLLVVKLEMGVAGVAIAMVLTNLNLVV  254

Query  766   SLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLAN  945
              L  +V F+ V+  TW  ++ +  KG+ SLL+LAIP+C SVCLEWWWYE MI+LCGLLAN
Sbjct  255   VLSSFVYFTSVHSDTWVPLTIDSLKGWSSLLSLAIPTCVSVCLEWWWYEFMIILCGLLAN  314

Query  946   PRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILG  1125
             PRATVASMG+LIQTT+L+Y+FPSSLS GVSTR+ NELGA RP +A+++ IV L  +  LG
Sbjct  315   PRATVASMGILIQTTALVYVFPSSLSLGVSTRISNELGAKRPAKARISMIVSLFCAAALG  374

Query  1126  LAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKL  1305
             L A+ F V +R+ W  +FT DAEI+ LT+  LPI+GLCELGNCPQTTGCG LRG ARP L
Sbjct  375   LMAMVFAVLIRHRWGRLFTTDAEILELTSIALPIVGLCELGNCPQTTGCGVLRGCARPTL  434

Query  1306  GAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQAR  1485
             GA INL  FYFVG+PVA   GF     F GLWLGLLAAQA+CA  ML  L RTDW  QA 
Sbjct  435   GANINLGSFYFVGMPVAVLFGFVFKQGFPGLWLGLLAAQATCASLMLCALLRTDWAVQAE  494

Query  1486  RAKELTATIS  1515
             RA+ELT+  S
Sbjct  495   RAEELTSETS  504



>ref|XP_008450787.1| PREDICTED: MATE efflux family protein 5-like [Cucumis melo]
Length=532

 Score =   498 bits (1281),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 272/465 (58%), Positives = 345/465 (74%), Gaps = 6/465 (1%)
 Frame = +1

Query  130   EEDHNHNQTHLSLAA------KEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlsl  291
             E+   H  T L L +       EAK +  +A P+++T L+LY RS++SMLFLG LGDL L
Sbjct  34    EDPDRHKNTPLLLRSSVIEIINEAKSLFSLAFPIVLTALILYSRSILSMLFLGHLGDLEL  93

Query  292   aggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIA  471
             A GSLAI FANITGYS+LSGLA+GMEP+C QAFGA R KL+ L+L R+++ LL +S+PI+
Sbjct  94    AAGSLAIAFANITGYSVLSGLALGMEPLCSQAFGAHRPKLLCLTLHRSVIFLLVSSLPIS  153

Query  472   ILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCA  651
             ILW N+ +IL+   QD  I+  A ++++ SLPDL+  S +HP+RIYLR+Q +T PLT  +
Sbjct  154   ILWLNISKILLFLHQDPTITKLAHTYLILSLPDLLCNSFIHPIRIYLRAQGITHPLTLAS  213

Query  652   AFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWE  831
                 + H+PIN  LV    LGI GVA +S   NF V+  L++Y++ SG++  TW   + E
Sbjct  214   LAGTIFHLPINLLLVSHFRLGIAGVAAASAATNFVVLFFLILYIVASGIFVPTWSPPTRE  273

Query  832   CFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFP  1011
             C  G+  LL LA PSC SVCLEWWWYE+MI+LCGLLANP+ATVASMGVLIQTTSLIYIFP
Sbjct  274   CLTGWTPLLKLAAPSCVSVCLEWWWYEIMIILCGLLANPKATVASMGVLIQTTSLIYIFP  333

Query  1012  SSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDA  1191
             SSL F VSTRVGNELGA RPG+AKL+A+V +  + I+G++A TF V++RN+WA IFT D 
Sbjct  334   SSLGFAVSTRVGNELGANRPGKAKLSAVVAVFLAGIMGVSATTFAVSMRNIWARIFTNDL  393

Query  1192  EIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGF  1371
             EI+ LT+  LPI+GLCE+GNCPQT GCG LRG+ARP   A+INL  FY VG+PVA  LG 
Sbjct  394   EILRLTSTALPILGLCEIGNCPQTVGCGVLRGSARPSTAARINLSAFYLVGMPVAVGLGL  453

Query  1372  FAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTA  1506
             F G  F GLWLGLL+AQ SCA  ML V+G TDW+ QA R+KELT+
Sbjct  454   FLGVGFSGLWLGLLSAQVSCAGLMLYVIGSTDWDSQAERSKELTS  498



>ref|XP_010242557.1| PREDICTED: MATE efflux family protein 6-like [Nelumbo nucifera]
Length=492

 Score =   496 bits (1276),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 267/453 (59%), Positives = 346/453 (76%), Gaps = 4/453 (1%)
 Frame = +1

Query  175   KEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGL  354
              E K +S I+ P  +TG++LY R+MI+MLF+G LG+L LA  SL+IGFANITGYSI++GL
Sbjct  28    DEVKSLSKISGPTALTGVVLYSRAMITMLFIGYLGELELAAVSLSIGFANITGYSIITGL  87

Query  355   AMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISM  534
             +MGMEPICGQAFGAKR+ L+ ++LQRT+V+LLF+ +P+  LW +MER+L+ C QD  ++ 
Sbjct  88    SMGMEPICGQAFGAKRWSLLVVTLQRTVVILLFSCLPLIFLWLSMERLLLWCGQDPMVTS  147

Query  535   EAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLG  714
              A +++ YS+PDL AQSLLHPLRIYLR+Q +TLPL  CA  A+++H+PIN+ LV+ +N+G
Sbjct  148   MASTYLAYSIPDLFAQSLLHPLRIYLRTQGITLPLATCATIALILHIPINFVLVISMNMG  207

Query  715   IKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCL  894
             IKG AL+SVW ++N+V  L +YV F G +K T+ GV+ EC  G+K++L LAIPSC SVCL
Sbjct  208   IKGAALASVWTSYNLVLMLFLYVCFWGSHKMTFRGVTLECLTGWKTILGLAIPSCFSVCL  267

Query  895   EWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPG  1074
             EWWWYE MI+LCGLL++P+  VA+MGVLIQTTSL+YI PSS+SFGVSTRV NELGA  P 
Sbjct  268   EWWWYEFMIILCGLLSDPKPKVAAMGVLIQTTSLLYIMPSSISFGVSTRVSNELGANMPW  327

Query  1075  RAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNC  1254
             +A+   IV L  S   G  ++TF   V ++W  +FT D+EI+ LT+ VLPIIGLCEL NC
Sbjct  328   KARRVMIVALLLSSFFGFLSMTFATGVSSIWGKMFTDDSEILDLTSTVLPIIGLCELFNC  387

Query  1255  PQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCA  1434
             PQTTGCG LRG ARP+LGA IN   FY +G+P+A  L F  GF F GLWLGLLAA+A C 
Sbjct  388   PQTTGCGVLRGCARPRLGANINFAAFYLLGMPLAILLAFRLGFGFLGLWLGLLAAEACCL  447

Query  1435  LTMLLVLGRTDWNDQARRAKELTATISLVDDDD  1533
             L+M+  L +TDW  +A RA +LT     VDDD 
Sbjct  448   LSMVYFLLQTDWFQEADRAWKLTG----VDDDH  476



>ref|XP_008657622.1| PREDICTED: MATE efflux family protein 5 [Zea mays]
Length=495

 Score =   495 bits (1275),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 293/466 (63%), Positives = 357/466 (77%), Gaps = 9/466 (2%)
 Frame = +1

Query  169   AAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILS  348
             AA EA  I  ++LPMI+TGL+LY R MISMLFLGRLG+L+LAGGSLAIGFANITGYS+LS
Sbjct  3     AASEAASILSLSLPMIMTGLILYVRPMISMLFLGRLGELALAGGSLAIGFANITGYSVLS  62

Query  349   GLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREI  528
             GLAMGMEP+CGQA GA    L+G ++QR ++LLL  S+P+A LW +ME +L+LC QD  I
Sbjct  63    GLAMGMEPVCGQAVGASNLPLVGATMQRMVLLLLALSVPVAFLWAHMEPLLLLCGQDAAI  122

Query  529   SMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLN  708
             S  AQ +IL  LPDL+ QS LHPLRIYLR+QS+  PLT CA  A+ +H+P+NY LV VL 
Sbjct  123   SAAAQRYILLCLPDLLFQSFLHPLRIYLRTQSINFPLTVCAVLAVAMHLPVNYLLVSVLG  182

Query  709   LGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWG-GVSWECFK---GYKSLLNLAIPS  876
             LG++GVAL+S   N N+V  L+ Y+ FSGV++ T G  +S + FK   G+  L  LA+ S
Sbjct  183   LGVEGVALASALANLNLVVLLLAYIYFSGVHRATGGFTLSEKLFKDVTGWMRLARLAVES  242

Query  877   CASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNEL  1056
             CASVCLEWWWYE+MILLCG+LA+P+A+VASMGVLIQTTSL+YIFPSSLSFGVSTRV NEL
Sbjct  243   CASVCLEWWWYEIMILLCGILADPKASVASMGVLIQTTSLLYIFPSSLSFGVSTRVSNEL  302

Query  1057  GAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGL  1236
             GA RPG A+ AA  GL  S + GLA+  F V+VR+VWA +FT DA I+ALTA+VLPI+GL
Sbjct  303   GANRPGAARAAARAGLALSVLQGLASFLFAVSVRDVWARMFTSDASILALTASVLPILGL  362

Query  1237  CELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlglla  1416
             CELGNCPQTTGCG LRG+ARPK GA INL  FY VG PVA  L F+ G  F+GLW GLLA
Sbjct  363   CELGNCPQTTGCGVLRGSARPKDGAHINLGAFYGVGTPVAVALAFWVGQGFRGLWFGLLA  422

Query  1417  aqaSCALTMLLVLGRTDWNDQARRAKELTATI-----SLVDDDDDD  1539
             AQA+C   ML+V+ RTDW  QA  A+ L   +     ++V+ DDD 
Sbjct  423   AQAACVTIMLVVISRTDWVKQAELAQVLAGVVAPGADAVVNGDDDS  468



>ref|XP_009127259.1| PREDICTED: MATE efflux family protein DTX1-like [Brassica rapa]
Length=508

 Score =   495 bits (1275),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 278/486 (57%), Positives = 357/486 (73%), Gaps = 8/486 (2%)
 Frame = +1

Query  73    ISACKEKMEAPLISEENPKEEDH--NHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRS  246
             ++  + ++  PL+ + + +E+ H   +  T LSL A EA  I+ I+LP++ TGLLLY RS
Sbjct  4     LNRVRNEVTIPLLPKISHQEKLHVLPNYTTPLSLFANEAILIARISLPLVFTGLLLYFRS  63

Query  247   MISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSL  426
              +S+ FLG LGD +LAGGSLA+ FANITGYS  SGL MG+E IC QAFGAKR+ L+  ++
Sbjct  64    FVSLFFLGGLGDHTLAGGSLALAFANITGYSFFSGLTMGVESICSQAFGAKRYNLVMATI  123

Query  427   QRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRI  606
             +R I LLLFTS+P+ +LW N++++L   +QD E+  EA +F+LYS+PDLIAQS LHPLR+
Sbjct  124   KRGIALLLFTSLPVFLLWINIDKVLKKLKQDEELVSEAHTFLLYSVPDLIAQSFLHPLRV  183

Query  607   YLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVL  786
             YLR+QS TLPL+ C A A V+H PI + LV  L LGIKG+ALS V  N N+V  L +Y+ 
Sbjct  184   YLRTQSKTLPLSICTAVASVLHFPITFLLVSYLGLGIKGIALSGVVSNINLVVFLFIYIA  243

Query  787   F--SGVYKKTWGGVSWEC----FKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANP  948
             F    + K   G VS E      + +K LL LAIPSC SVCLEWW YE+MI+LCGLL NP
Sbjct  244   FLEDKLSKDEEGEVSEESCGDSVREWKKLLGLAIPSCVSVCLEWWCYEIMIVLCGLLVNP  303

Query  949   RATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGL  1128
             +AT+ASMG+LIQ TSL+YIFP+SLSFGVSTRVGNELG+ +P RA+ AAIVGL  S  LG 
Sbjct  304   KATIASMGILIQITSLVYIFPNSLSFGVSTRVGNELGSNQPQRARRAAIVGLGLSIALGF  363

Query  1129  AALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLG  1308
              A  F V+VRN+WA +FT D EI+ LT  VLPI+GLCELGNCPQTTGCG LRG+ARP++G
Sbjct  364   TAFAFTVSVRNMWARLFTDDEEIIKLTLMVLPIVGLCELGNCPQTTGCGVLRGSARPRIG  423

Query  1309  AKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARR  1488
             A IN+  FY VG+P+   + F+ GF F+GLWLG+LAAQ  C   M++   RT+W  +A R
Sbjct  424   ANINMAAFYVVGMPMGMVMTFWFGFGFKGLWLGMLAAQIVCVSGMMVATCRTNWELEAAR  483

Query  1489  AKELTA  1506
             A+ELTA
Sbjct  484   ARELTA  489



>ref|XP_010444324.1| PREDICTED: MATE efflux family protein 5-like [Camelina sativa]
Length=510

 Score =   495 bits (1274),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 272/489 (56%), Positives = 346/489 (71%), Gaps = 22/489 (4%)
 Frame = +1

Query  124   PKEEDHNHNQTHL--------SLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlg  279
             P  +  +H + H         S+   EA  I  I+ P+++TGL LY RS +S+ FLG LG
Sbjct  14    PLLQKSSHQKLHFLKDYSSVPSVYINEAISIGKISYPLVLTGLFLYVRSFVSLSFLGGLG  73

Query  280   dlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTS  459
             D +LAGGSLA  FANITGYS+ SGL MG+E IC QAFGA+R+  +  +++R I+LLL TS
Sbjct  74    DATLAGGSLAAAFANITGYSLFSGLTMGVESICSQAFGARRYNHVSATIRRGIILLLVTS  133

Query  460   IPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPL  639
             +P+A+LW NME+IL++ +QD++++ EA  F+LYS+PDL+AQS LHPLR+YLR+QS TLPL
Sbjct  134   LPVALLWMNMEKILLILKQDKKLASEAHIFLLYSVPDLVAQSFLHPLRVYLRTQSKTLPL  193

Query  640   TFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLF----------  789
             + C   A  +H+P+ + LV  L LGIKG+ALS V  NFN+V  L +Y+ F          
Sbjct  194   SICTVVASFLHLPVTFLLVSYLGLGIKGIALSGVVSNFNLVAFLFIYICFLEEKLSVDED  253

Query  790   SGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASM  969
               V ++T+     +  + +K LL LAIPSC SVCLEWW YE+MILLCG L +P+A+VASM
Sbjct  254   EKVTEETYE----DSVREWKKLLCLAIPSCISVCLEWWCYEIMILLCGFLIDPKASVASM  309

Query  970   GVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGV  1149
             G+LIQ TSL+YIFP+SLS GVSTRVGNELG+ +P RAK AAIVGL  S  LG  A TF V
Sbjct  310   GILIQITSLVYIFPNSLSLGVSTRVGNELGSNQPQRAKRAAIVGLGLSIALGFTAFTFTV  369

Query  1150  AVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRC  1329
             +VRN WA  FT D EIM LTA  LPI+GLCELGNCPQTTGCG LRG+ARPK+GA IN   
Sbjct  370   SVRNTWAMFFTDDKEIMKLTAMALPIVGLCELGNCPQTTGCGVLRGSARPKIGANINGVA  429

Query  1330  FYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTAT  1509
             FY VG+PV   + F+ GF F+GLWLG+LAAQ +C + M+    RTDW  +A RAKELT  
Sbjct  430   FYAVGIPVGAVMAFWFGFGFKGLWLGMLAAQITCVIGMMAATCRTDWELEAERAKELTTA  489

Query  1510  ISLVDDDDD  1536
             +     DDD
Sbjct  490   VDSGSSDDD  498



>ref|XP_010442727.1| PREDICTED: multidrug and toxin extrusion protein 2-like isoform 
X2 [Camelina sativa]
Length=505

 Score =   494 bits (1272),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 270/481 (56%), Positives = 345/481 (72%), Gaps = 17/481 (4%)
 Frame = +1

Query  133   EDHNHNQTH--------LSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdls  288
             +  +H + H        LS+   EA  I  I+ P+++TGL LY RS +S+ FLG LGD +
Sbjct  17    QKSSHQKLHFLKDYSSVLSVFINEAISIGKISYPLVLTGLFLYVRSFVSLSFLGGLGDAT  76

Query  289   laggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPI  468
             LAGGSLA  FANITGYS+ SGL MG+E IC QAFGA+R+  +  +++R ++LLL TS+P+
Sbjct  77    LAGGSLAAAFANITGYSLFSGLTMGVESICSQAFGARRYNHVSATIRRGVILLLVTSLPV  136

Query  469   AILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFC  648
             A+LW NME+IL++ +QD++++ EA  F+LYS+PDL+AQS LHPLR+YLR+QS TLPL+ C
Sbjct  137   ALLWMNMEKILLILKQDKKLASEAHIFLLYSVPDLVAQSFLHPLRVYLRTQSKTLPLSVC  196

Query  649   AAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLF-----SGVYKKTW  813
                A  +H+P+ + LV  L LGI+G+ALS V  NFN+V  L +Y+ F     S V ++T+
Sbjct  197   TVVASFLHLPVTFLLVSYLGLGIRGIALSGVVSNFNLVAFLFLYICFLEEKLSKVTEETY  256

Query  814   GGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTS  993
                  +  + +K LL LAIPSC SVCLEWW YE+MILLCG L +P+A+VASMG+LIQ TS
Sbjct  257   E----DSVREWKKLLCLAIPSCLSVCLEWWCYEIMILLCGFLIDPKASVASMGILIQITS  312

Query  994   LIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWAS  1173
             L+YIFP SLS GVSTRVGNELG+ +P RAK AAIVGL  S  LG  A TF V+VRN WA 
Sbjct  313   LVYIFPHSLSLGVSTRVGNELGSNQPQRAKRAAIVGLGLSIALGFTAFTFTVSVRNTWAM  372

Query  1174  IFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPV  1353
              FT D EIM LTA  LPI+GLCELGNCPQT GCG LRG+ARPK+GA IN   FY VG+PV
Sbjct  373   FFTDDKEIMKLTAMALPIVGLCELGNCPQTAGCGVLRGSARPKIGANINGVAFYAVGIPV  432

Query  1354  AGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDD  1533
                + F+ GF F+GLWLG+LAAQ +C + M+    RTDW  +A RAKELT  +     DD
Sbjct  433   GAVMAFWFGFGFKGLWLGMLAAQITCVIGMMAATCRTDWELEAERAKELTTAVDSGSSDD  492

Query  1534  D  1536
             D
Sbjct  493   D  493



>ref|XP_002984600.1| hypothetical protein SELMODRAFT_120748, partial [Selaginella 
moellendorffii]
 gb|EFJ14245.1| hypothetical protein SELMODRAFT_120748, partial [Selaginella 
moellendorffii]
Length=506

 Score =   493 bits (1269),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 274/443 (62%), Positives = 343/443 (77%), Gaps = 0/443 (0%)
 Frame = +1

Query  178   EAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLA  357
             E K +  IA P +VTG+L+Y RS+ISMLFLG LG+L LAGGSLAIGFANITGYS+LSGLA
Sbjct  1     ELKQMGSIACPTVVTGILVYLRSLISMLFLGHLGELELAGGSLAIGFANITGYSVLSGLA  60

Query  358   MGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISME  537
             MGMEPICGQAFGA ++KLMGL+LQR++V L  + +PIA+LW NM RIL  C QD  ++  
Sbjct  61    MGMEPICGQAFGAHKWKLMGLTLQRSVVFLSCSCLPIALLWLNMNRILNFCGQDPAVTAM  120

Query  538   AQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGI  717
             A +++L+SLPDL+ Q+LL+P+R+YLR+Q +TLP++  AA AI  HVP N  LV  L LGI
Sbjct  121   AHNYLLFSLPDLLIQALLNPIRVYLRTQKITLPISIAAAVAICFHVPANLLLVSHLGLGI  180

Query  718   KGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLE  897
             +GVAL++V  N  +V  L++YV+ SG+YK +W G+S +C + ++ LL LAIPS  SVCLE
Sbjct  181   RGVALAAVATNLTLVLVLLLYVIASGIYKLSWPGISRDCLRDWRPLLALAIPSAISVCLE  240

Query  898   WWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGR  1077
             WWWYELMI+  GLL N RA VA+MGVLIQTT+L+YIFPSSL   VSTRVGNELGA  P  
Sbjct  241   WWWYELMIIFSGLLVNARAAVATMGVLIQTTALVYIFPSSLGLAVSTRVGNELGANNPRG  300

Query  1078  AKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCP  1257
             A+ AA V LC + +LG+AA++F V +R+VW S+FT+DA I+ L AA +P++G+CE+GNCP
Sbjct  301   ARTAAHVALCCAGVLGVAAMSFTVGMRHVWGSLFTRDAAILKLVAAAMPVVGMCEIGNCP  360

Query  1258  QTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCAL  1437
             QTTGCG LRG+ARP LGA INL  FYFVG+PVA  LGF     F GLW GLLAAQ SC +
Sbjct  361   QTTGCGVLRGSARPTLGANINLGSFYFVGMPVAMLLGFALDVGFVGLWFGLLAAQGSCLV  420

Query  1438  TMLLVLGRTDWNDQARRAKELTA  1506
              ML  +GRTDW  QA RA+ELT 
Sbjct  421   LMLFAVGRTDWELQAFRAQELTG  443



>tpg|DAA46004.1| TPA: putative MATE efflux family protein [Zea mays]
Length=561

 Score =   495 bits (1274),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 301/519 (58%), Positives = 370/519 (71%), Gaps = 11/519 (2%)
 Frame = +1

Query  10    KYGDKRQSNTKNPLFFLPFAFISACKEKMEAPLISEENPKEEDHNHNQTHLSLAAKEAKC  189
             K G     +    +   P   +    E       +E  P   D   + T    AA EA  
Sbjct  18    KDGGVGDGHRPRAVVLSPDVAVVVLNETTTLTTCTEPPPLLADRRPSLTMG--AASEAAS  75

Query  190   ISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGME  369
             I  ++LPMI+TGL+LY R MISMLFLGRLG+L+LAGGSLAIGFANITGYS+LSGLAMGME
Sbjct  76    ILSLSLPMIMTGLILYVRPMISMLFLGRLGELALAGGSLAIGFANITGYSVLSGLAMGME  135

Query  370   PICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSF  549
             P+CGQA GA    L+G ++QR ++LLL  S+P+A LW +ME +L+LC QD  IS  AQ +
Sbjct  136   PVCGQAVGASNLPLVGATMQRMVLLLLALSVPVAFLWAHMEPLLLLCGQDAAISAAAQRY  195

Query  550   ILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVA  729
             IL  LPDL+ QS LHPLRIYLR+QS+  PLT CA  A+ +H+P+NY LV VL LG++GVA
Sbjct  196   ILLCLPDLLFQSFLHPLRIYLRTQSINFPLTVCAVLAVAMHLPVNYLLVSVLGLGVEGVA  255

Query  730   LSSVWCNFNVVGSLVVYVLFSGVYKKTWG-GVSWECFK---GYKSLLNLAIPSCASVCLE  897
             L+S   N N+V  L+ Y+ FSGV++ T G  +S + FK   G+  L  LA+ SCASVCLE
Sbjct  256   LASALANLNLVVLLLAYIYFSGVHRATGGFTLSEKLFKDVTGWMRLARLAVESCASVCLE  315

Query  898   WWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGR  1077
             WWWYE+MILLCG+LA+P+A+VASMGVLIQTTSL+YIFPSSLSFGVSTRV NELGA RPG 
Sbjct  316   WWWYEIMILLCGILADPKASVASMGVLIQTTSLLYIFPSSLSFGVSTRVSNELGANRPGA  375

Query  1078  AKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCP  1257
             A+ AA  GL  S + GLA+  F V+VR+VWA +FT DA I+ALTA+VLPI+GLCELGNCP
Sbjct  376   ARAAARAGLALSVLQGLASFLFAVSVRDVWARMFTSDASILALTASVLPILGLCELGNCP  435

Query  1258  QTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCAL  1437
             QTTGCG LRG+ARPK GA INL  FY VG PVA  L F+ G  F+GLW GLLAAQA+C  
Sbjct  436   QTTGCGVLRGSARPKDGAHINLGAFYGVGTPVAVALAFWVGQGFRGLWFGLLAAQAACVT  495

Query  1438  TMLLVLGRTDWNDQARRAKELTATI-----SLVDDDDDD  1539
              ML+V+ RTDW  QA  A+ L   +     ++V+ DDD 
Sbjct  496   IMLVVISRTDWVKQAELAQVLAGVVAPGADAVVNGDDDS  534



>gb|KHN19255.1| MATE efflux family protein DTX1 [Glycine soja]
Length=549

 Score =   494 bits (1273),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 281/444 (63%), Positives = 349/444 (79%), Gaps = 0/444 (0%)
 Frame = +1

Query  169   AAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILS  348
             A +E K I  I+ P  +TGL+LY R+MISM+FLG LG++ LAGGSL+IGFANITGYS++S
Sbjct  22    AMEEIKAIGRISCPTAITGLILYSRAMISMIFLGYLGEMELAGGSLSIGFANITGYSVIS  81

Query  349   GLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREI  528
             GLAMGMEPICGQA+GAK++K++GL+LQRT++LLL TSIPI+ +W NM+RIL+   QD+EI
Sbjct  82    GLAMGMEPICGQAYGAKQWKILGLTLQRTVLLLLSTSIPISFMWLNMKRILLWSGQDQEI  141

Query  529   SMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLN  708
             +  AQ+FI +S+PDL   SLLHPLRIYLR+QS+TLPLT+C+A ++++HVP+N+ LVV L 
Sbjct  142   ASVAQTFITFSIPDLFLLSLLHPLRIYLRTQSITLPLTYCSAISVLLHVPLNFLLVVHLK  201

Query  709   LGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASV  888
             +GI GVA + V  N N++  +  +V FSG YK +W   S +C KG+ SLL+LAIP+C SV
Sbjct  202   MGIAGVATAMVLTNLNLILFISSFVYFSGAYKASWVSPSVDCIKGWSSLLSLAIPTCVSV  261

Query  889   CLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGR  1068
             CLEWWWYE MI+LCGLL NP+AT+ASMG+LIQTTSL+Y+FPSSLS GVSTRVGNELGA  
Sbjct  262   CLEWWWYEFMIMLCGLLVNPKATIASMGILIQTTSLVYVFPSSLSLGVSTRVGNELGAKN  321

Query  1069  PGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELG  1248
             P +A+++ IV L  +  LGLAA+ F   +R+ W   FT D EI+ LT+ VLPI GLCELG
Sbjct  322   PRKARVSMIVSLFCALALGLAAMLFTTLMRHQWGRFFTNDHEILELTSLVLPIAGLCELG  381

Query  1249  NCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaS  1428
             NCPQTTGCG LRG+ARP +GA INL  FY VG+PVA  L F A   F GLWLGLLAAQAS
Sbjct  382   NCPQTTGCGVLRGSARPTIGANINLGSFYLVGMPVAILLSFVAKMGFPGLWLGLLAAQAS  441

Query  1429  CALTMLLVLGRTDWNDQARRAKEL  1500
             CA  M  VL  TDWN Q  RAKEL
Sbjct  442   CAGLMFYVLCTTDWNVQVERAKEL  465



>ref|XP_002864149.1| hypothetical protein ARALYDRAFT_495276 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40408.1| hypothetical protein ARALYDRAFT_495276 [Arabidopsis lyrata subsp. 
lyrata]
Length=500

 Score =   493 bits (1268),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 267/479 (56%), Positives = 341/479 (71%), Gaps = 6/479 (1%)
 Frame = +1

Query  121   NPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslagg  300
              P  +  +H + H S+   EA  I  I+ P+++TGL LY RS +S+ FLG LGD +LAGG
Sbjct  13    TPLLQKSSHLKNHSSVFINEAISIGKISYPLVLTGLFLYVRSFVSLSFLGGLGDATLAGG  72

Query  301   slaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILW  480
             SLA  FANITGYS+ SGL MG+E IC QAFGA+R+  +  +++R I+LLL TS+P+ +LW
Sbjct  73    SLAAAFANITGYSLFSGLTMGVESICSQAFGARRYNYVRATIKRGIILLLVTSLPVTLLW  132

Query  481   CNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFA  660
              NME+IL++ +QD++++ EA  F+LYS+PDL+AQS LHPLR+YLR+QS TLPL+ C   A
Sbjct  133   MNMEKILLILKQDKKLASEAHIFLLYSVPDLVAQSFLHPLRVYLRTQSKTLPLSICTVIA  192

Query  661   IVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLF------SGVYKKTWGGV  822
               +H+PI +F V  L LGIKG+ALS V  NFN+V  L +Y+ F          +K     
Sbjct  193   SFLHLPITFFFVSYLGLGIKGIALSGVVSNFNLVAFLFLYICFFEDKLSINEEEKITEET  252

Query  823   SWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIY  1002
             + +  + +K LL LAIPSC SVCLEWW YE+MILLCG L +P+A+VASMG+LIQ TSL+Y
Sbjct  253   NEDSVREWKKLLCLAIPSCISVCLEWWCYEIMILLCGFLLDPKASVASMGILIQITSLVY  312

Query  1003  IFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFT  1182
             IFP SLS GVSTRVGNELG+ +P +A+ AAIVGL  S  LG  A  F V+VRN WA  FT
Sbjct  313   IFPHSLSLGVSTRVGNELGSNQPKKARRAAIVGLGLSIALGFTAFMFTVSVRNTWAMFFT  372

Query  1183  QDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGW  1362
              D EIM LTA  LPI+GLCELGNCPQTTGCG LRG+ARPK+GA IN   FY VG+PV   
Sbjct  373   DDKEIMKLTAMALPIVGLCELGNCPQTTGCGVLRGSARPKIGANINGVAFYVVGIPVGAV  432

Query  1363  LGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDDD  1539
             + F+ GF F+GLWLG+LAAQ +C + M+    RTDW  +A RAKELT  +     DD +
Sbjct  433   MAFWFGFGFKGLWLGMLAAQITCVIGMMAATCRTDWELEAERAKELTTAVDCGSSDDKE  491



>ref|XP_002978667.1| hypothetical protein SELMODRAFT_109192, partial [Selaginella 
moellendorffii]
 gb|EFJ20114.1| hypothetical protein SELMODRAFT_109192, partial [Selaginella 
moellendorffii]
Length=506

 Score =   493 bits (1268),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 274/443 (62%), Positives = 342/443 (77%), Gaps = 0/443 (0%)
 Frame = +1

Query  178   EAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLA  357
             E K +  IA P +VTG+L+Y RS+ISMLFLG LG+L LAGGSLAIGFANITGYS+LSGLA
Sbjct  1     ELKQMGSIACPTVVTGILVYLRSLISMLFLGHLGELELAGGSLAIGFANITGYSVLSGLA  60

Query  358   MGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISME  537
             MGMEPICGQAFGA ++KLMGL+LQR++V L  + +PIA+LW NM RIL  C QD  ++  
Sbjct  61    MGMEPICGQAFGAHKWKLMGLTLQRSVVFLSCSCLPIALLWLNMNRILNFCGQDPAVTAM  120

Query  538   AQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGI  717
             A +++L+SLPDL+ Q+LL+P+R+YLR+Q +TLP++  AA AI  HVP N  LV  L LGI
Sbjct  121   AHNYLLFSLPDLLIQALLNPIRVYLRTQKITLPISIAAAVAICFHVPANLLLVSHLGLGI  180

Query  718   KGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLE  897
             +GVAL++V  N  +V  L++YV+ SG+YK +W G+S +C + ++ LL LAIPS  SVCLE
Sbjct  181   RGVALAAVATNLTLVLVLLLYVIASGIYKLSWPGISRDCLRDWRPLLALAIPSAISVCLE  240

Query  898   WWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGR  1077
             WWWYELMI+  GLL N RA VA+MGVLIQTT+L+YIFPSSL   VSTRVGNELGA  P  
Sbjct  241   WWWYELMIIFSGLLVNARAAVATMGVLIQTTALVYIFPSSLGLAVSTRVGNELGANNPRG  300

Query  1078  AKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCP  1257
             A+ AA V LC + +LGL A++F V +R+VW S+FT+DA I+ L AA +P++G+CE+GNCP
Sbjct  301   ARTAAHVALCCAGVLGLVAMSFTVGMRHVWGSLFTRDAAILKLVAAAMPVVGMCEIGNCP  360

Query  1258  QTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCAL  1437
             QTTGCG LRG+ARP LGA INL  FYFVG+PVA  LGF     F GLW GLLAAQ SC +
Sbjct  361   QTTGCGVLRGSARPTLGANINLGSFYFVGMPVAMLLGFALDVGFVGLWFGLLAAQGSCLV  420

Query  1438  TMLLVLGRTDWNDQARRAKELTA  1506
              ML  +GRTDW  QA RA+ELT 
Sbjct  421   LMLFAVGRTDWELQAFRAQELTG  443



>ref|XP_003527862.1| PREDICTED: MATE efflux family protein 5-like [Glycine max]
Length=548

 Score =   493 bits (1270),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 277/471 (59%), Positives = 356/471 (76%), Gaps = 4/471 (1%)
 Frame = +1

Query  103   PLISEENPKEEDHNHNQTHL----SLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlg  270
             P +    P  +D   ++ H     +    E K I  I+ P  +TGL++Y R+MISM+FLG
Sbjct  26    PKLINHPPPVDDQLQDELHRWPTPNEIVAEMKAIGKISGPTALTGLIIYSRAMISMVFLG  85

Query  271   rlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLL  450
              LG++ LAGGSL+IGFANITGYS++SGLAMGMEPICGQA+GAK+ K +GL+LQRT++LLL
Sbjct  86    YLGEMELAGGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQLKTLGLTLQRTVLLLL  145

Query  451   FTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVT  630
              +S+PI++ W NM+ IL+ C QD EIS  AQ+FIL+S+PDL   SLLHPLRIYLR+QS+T
Sbjct  146   SSSLPISLTWLNMKNILLWCGQDHEISSTAQTFILFSIPDLFLLSLLHPLRIYLRTQSIT  205

Query  631   LPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKT  810
             LPLT+C+A ++++HVP+N+ LVV L +G+ GVA++ VW N N+   L  ++ FSGVYK +
Sbjct  206   LPLTYCSAVSVLLHVPLNFLLVVHLKMGVSGVAIAMVWTNLNLFLFLSSFIYFSGVYKDS  265

Query  811   WGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTT  990
             W   S +C +G+ SLL L++P+C SVCLEWWWYELMI+LCGLL NP+AT+ASMG+LIQTT
Sbjct  266   WVPPSTDCLRGWSSLLALSVPTCVSVCLEWWWYELMIILCGLLLNPKATIASMGILIQTT  325

Query  991   SLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWA  1170
             SL+Y+FPSSLS  VSTRVGNELGA RP +A+++ IV L  +  LG+ A+ F   +R+ W 
Sbjct  326   SLVYVFPSSLSLAVSTRVGNELGANRPAKARISMIVSLACAVALGVTAMLFTTLMRHRWG  385

Query  1171  SIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLP  1350
               FT D +I+ LT+  LPI+GLCELGNCPQTTGCG LRG+ARP +GA INL  FY VG+P
Sbjct  386   RFFTSDQQILHLTSIALPIVGLCELGNCPQTTGCGVLRGSARPTVGANINLGSFYLVGMP  445

Query  1351  VAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
             VA  LGF     F GLWLGLLAAQ SCA  M+ VL  TDWN Q +RA ELT
Sbjct  446   VAVLLGFVGKMGFPGLWLGLLAAQGSCAALMIFVLCTTDWNAQVQRANELT  496



>ref|XP_010482557.1| PREDICTED: MATE efflux family protein 5-like [Camelina sativa]
Length=510

 Score =   492 bits (1266),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 269/495 (54%), Positives = 354/495 (72%), Gaps = 15/495 (3%)
 Frame = +1

Query  85    KEKMEAPLISEENPKEEDHNHNQTH-LSLAAKEAKCISDIALPMIVTGLLLYCRSMISML  261
             ++++  PL+ + + ++     + +  LS+   EA  I  I+ P+++TGL LY RS +S+ 
Sbjct  8     RDEVTIPLLQKSSHQKLHFPKDYSSVLSVFINEAISIGKISYPLVLTGLFLYVRSFVSLS  67

Query  262   FlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIV  441
             FLG LGD +LAGGSLA  FANITGYS+ SGL MG+E IC QAFGA+R+  +  +++R I+
Sbjct  68    FLGGLGDATLAGGSLAAAFANITGYSLFSGLTMGVESICSQAFGARRYNHVSATIRRGII  127

Query  442   LLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQ  621
             LLL TS+P+A+LW NME+IL++ +QD++++ EA  F+LYS+PDL+AQS LHPLR+YLR+Q
Sbjct  128   LLLVTSLPVALLWMNMEKILLILKQDKKLASEAHIFLLYSVPDLVAQSFLHPLRVYLRTQ  187

Query  622   SVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLF----  789
             S TLPL+ C   A  +H+P+ + LV  L LGIKG+ALS V  NFN+V  L +Y+ F    
Sbjct  188   SKTLPLSVCTVAASFLHLPVTFLLVSYLGLGIKGIALSGVVSNFNLVAFLFLYICFLEEK  247

Query  790   ------SGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPR  951
                     V ++T+     +  + +K LL LAIPSC SVCLEWW YE+MILLCG L +P+
Sbjct  248   LSVDEDEKVTEETYE----DSVREWKKLLCLAIPSCISVCLEWWCYEIMILLCGFLIDPK  303

Query  952   ATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLA  1131
             A+VASMG++IQ TSL+YIFP+SLS GVSTRVGNELG+ +P RAK AAIVGL  S  LG  
Sbjct  304   ASVASMGIVIQITSLVYIFPNSLSLGVSTRVGNELGSNQPQRAKRAAIVGLGLSIALGFT  363

Query  1132  ALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGA  1311
             A TF V+VRN WA  FT D EIM LTA  LPI+GLCELGNCPQTTGCG +RG+ARPK+GA
Sbjct  364   AFTFTVSVRNTWAMFFTDDKEIMKLTAMALPIVGLCELGNCPQTTGCGVIRGSARPKIGA  423

Query  1312  KINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRA  1491
              IN   FY +G+PV   + F+ GF F+GLWLG+LAAQ +C + M+    RTDW  +A RA
Sbjct  424   NINGVAFYAIGIPVGAVMAFWFGFGFKGLWLGMLAAQITCVIGMMAATCRTDWELEAERA  483

Query  1492  KELTATISLVDDDDD  1536
             KELT  +     DDD
Sbjct  484   KELTTAVDSGSSDDD  498



>ref|XP_009400053.1| PREDICTED: MATE efflux family protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=526

 Score =   491 bits (1265),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 297/477 (62%), Positives = 363/477 (76%), Gaps = 8/477 (2%)
 Frame = +1

Query  94    MEAPLISEENPKEEDHNHN-----QTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISM  258
             +  PLI  E P   +           H+S A  EAK I  +A PM +TGLLLY RS++SM
Sbjct  3     LTEPLIKREWPSPTESPPRLKPEWPKHVSAALVEAKSILSLASPMALTGLLLYSRSLVSM  62

Query  259   LFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTI  438
             LFLGRLG L LAGG+LAIGFANITGYS+LSGLAMGMEPICGQAFGA+R  L+G  L R +
Sbjct  63    LFLGRLGRLPLAGGALAIGFANITGYSVLSGLAMGMEPICGQAFGARRPALLGPVLHRAV  122

Query  439   VLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRS  618
             +LLL  S+PIA LW +M  +L+L  QD +I+  AQ+++L SLPDL+ QS LHP+RIYLRS
Sbjct  123   LLLLAASLPIAALWASMRSLLLLSGQDDDIAAVAQAYVLASLPDLLLQSFLHPIRIYLRS  182

Query  619   QSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGV  798
             Q +TLP T+CAA A ++H+P+NY LV VL LGI+GVAL+SV  N N++  L+VY+  SGV
Sbjct  183   QFITLPFTYCAAAAALLHLPVNYVLVSVLRLGIRGVALASVCTNLNLLFLLLVYICSSGV  242

Query  799   YKKTWGGVSW--ECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMG  972
             ++ T G +++  EC   ++SLLNLAIPSC  VCLEWWWYE+M+LLCGLL +P++TVASMG
Sbjct  243   HQHT-GALNFTAECLGNWRSLLNLAIPSCIGVCLEWWWYEIMVLLCGLLLDPKSTVASMG  301

Query  973   VLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVA  1152
             +LIQTTSLIYIFPSSLSFGVSTRVGNELGA RP RA+ AA VG+     LG+ A  F VA
Sbjct  302   ILIQTTSLIYIFPSSLSFGVSTRVGNELGANRPDRARRAATVGVACGAALGVLAFAFAVA  361

Query  1153  VRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCF  1332
             VRN WA +FT DA I+ALTAAVLPI+G+CELGNCPQT GCG LRG+ARP+ GA IN+  F
Sbjct  362   VRNAWARMFTADASILALTAAVLPIVGMCELGNCPQTAGCGVLRGSARPRTGANINMWSF  421

Query  1333  YFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
             Y VG+PVA  L F+   DF GLWLG+LAAQ +C   ML+V+ RTDWN QA RA+ LT
Sbjct  422   YGVGMPVAAGLAFWGRLDFPGLWLGMLAAQGTCVALMLVVVRRTDWNLQAERAQRLT  478



>ref|XP_010442726.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Camelina 
sativa]
Length=510

 Score =   490 bits (1262),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 269/486 (55%), Positives = 344/486 (71%), Gaps = 22/486 (5%)
 Frame = +1

Query  133   EDHNHNQTH--------LSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdls  288
             +  +H + H        LS+   EA  I  I+ P+++TGL LY RS +S+ FLG LGD +
Sbjct  17    QKSSHQKLHFLKDYSSVLSVFINEAISIGKISYPLVLTGLFLYVRSFVSLSFLGGLGDAT  76

Query  289   laggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPI  468
             LAGGSLA  FANITGYS+ SGL MG+E IC QAFGA+R+  +  +++R ++LLL TS+P+
Sbjct  77    LAGGSLAAAFANITGYSLFSGLTMGVESICSQAFGARRYNHVSATIRRGVILLLVTSLPV  136

Query  469   AILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFC  648
             A+LW NME+IL++ +QD++++ EA  F+LYS+PDL+AQS LHPLR+YLR+QS TLPL+ C
Sbjct  137   ALLWMNMEKILLILKQDKKLASEAHIFLLYSVPDLVAQSFLHPLRVYLRTQSKTLPLSVC  196

Query  649   AAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLF----------SGV  798
                A  +H+P+ + LV  L LGI+G+ALS V  NFN+V  L +Y+ F            V
Sbjct  197   TVVASFLHLPVTFLLVSYLGLGIRGIALSGVVSNFNLVAFLFLYICFLEEKLSVDEDEKV  256

Query  799   YKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVL  978
              ++T+     +  + +K LL LAIPSC SVCLEWW YE+MILLCG L +P+A+VASMG+L
Sbjct  257   TEETYE----DSVREWKKLLCLAIPSCLSVCLEWWCYEIMILLCGFLIDPKASVASMGIL  312

Query  979   IQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVR  1158
             IQ TSL+YIFP SLS GVSTRVGNELG+ +P RAK AAIVGL  S  LG  A TF V+VR
Sbjct  313   IQITSLVYIFPHSLSLGVSTRVGNELGSNQPQRAKRAAIVGLGLSIALGFTAFTFTVSVR  372

Query  1159  NVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYF  1338
             N WA  FT D EIM LTA  LPI+GLCELGNCPQT GCG LRG+ARPK+GA IN   FY 
Sbjct  373   NTWAMFFTDDKEIMKLTAMALPIVGLCELGNCPQTAGCGVLRGSARPKIGANINGVAFYA  432

Query  1339  VGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISL  1518
             VG+PV   + F+ GF F+GLWLG+LAAQ +C + M+    RTDW  +A RAKELT  +  
Sbjct  433   VGIPVGAVMAFWFGFGFKGLWLGMLAAQITCVIGMMAATCRTDWELEAERAKELTTAVDS  492

Query  1519  VDDDDD  1536
                DDD
Sbjct  493   GSSDDD  498



>gb|KFK29476.1| hypothetical protein AALP_AA7G138700 [Arabis alpina]
Length=537

 Score =   491 bits (1264),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 268/471 (57%), Positives = 340/471 (72%), Gaps = 1/471 (0%)
 Frame = +1

Query  118   ENPKEEDHNH-NQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlsla  294
             E P + +  H      S   +EAK +  +A P+ VT L+LY RS +SM FLGRLGDL LA
Sbjct  38    EQPTKRNLRHCENKRESPLVQEAKSLFTLAFPIAVTALILYLRSAVSMFFLGRLGDLELA  97

Query  295   ggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAI  474
              GSLAI FANITGYS+LSGLA+GMEP+C QAFGA R+KL+ L+L RT+V LL   +PI++
Sbjct  98    AGSLAIAFANITGYSVLSGLALGMEPLCSQAFGAHRYKLLSLTLHRTVVFLLVCCVPISV  157

Query  475   LWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAA  654
             LW N+ RI +   QD +I+  AQ+++++SLPDLI  +LLHP+RIYLR+Q++  P+T  + 
Sbjct  158   LWFNVGRISVYLHQDPDIAGLAQTYLIFSLPDLITNTLLHPIRIYLRAQAIIHPVTLASL  217

Query  655   FAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWEC  834
                + H+P N FLV  L LG+ GVA++S   N  VV  L+ YV  SG++  TW   + +C
Sbjct  218   SGALFHLPANLFLVSYLRLGLTGVAVASSVTNIFVVAFLICYVWASGLHAPTWTDPTRDC  277

Query  835   FKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPS  1014
             F+G+  LL LA PSC SVCLEWWWYE+MI+LCGLL NPR+TVA+MGVLIQTTS +Y+FPS
Sbjct  278   FRGWAPLLRLAAPSCVSVCLEWWWYEIMIVLCGLLVNPRSTVAAMGVLIQTTSFLYVFPS  337

Query  1015  SLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAE  1194
             SLSF VSTRVGNELGA RP  AKL+A V +  S + G+ A  F  +VRN W  IFT D E
Sbjct  338   SLSFAVSTRVGNELGANRPNTAKLSATVAVIFSAVTGITAAAFAYSVRNAWGRIFTGDEE  397

Query  1195  IMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFF  1374
             I+ LTAA LPI+GLCE+GNCPQT GCG +RGTARP   A +NL  FY VG+PVA  LGF+
Sbjct  398   ILRLTAAALPILGLCEIGNCPQTVGCGVVRGTARPSTAANVNLGAFYLVGMPVAIGLGFW  457

Query  1375  AGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDD  1527
             AG  F GLWLGLLAAQ SCA  M+ V+G TDW  +AR+A+ LT   ++ +D
Sbjct  458   AGIGFNGLWLGLLAAQVSCAGLMMYVVGTTDWESEARKAQSLTCADTVEND  508



>ref|XP_006339903.1| PREDICTED: multidrug and toxin extrusion protein 2-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006339904.1| PREDICTED: multidrug and toxin extrusion protein 2-like isoform 
X2 [Solanum tuberosum]
Length=504

 Score =   490 bits (1261),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 267/463 (58%), Positives = 341/463 (74%), Gaps = 0/463 (0%)
 Frame = +1

Query  112   SEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlsl  291
             S  NP E+D  H +   S   +E K +  IA P+I  GLL+Y +SMISMLF+GRLG  +L
Sbjct  26    STTNPDEQDQTHQRPTSSEVVEEVKLLYSIAFPIIAAGLLVYGKSMISMLFMGRLGKEAL  85

Query  292   aggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIA  471
             AGGSL+IG ANITG+S+LSGLAMGME I  QA GAK++ LMG +LQRTI++LLF+SIPI+
Sbjct  86    AGGSLSIGIANITGFSVLSGLAMGMEAISSQACGAKQWPLMGQTLQRTILILLFSSIPIS  145

Query  472   ILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCA  651
             +LW  +E +L+ C QD  IS  A +++ + LP+L  QS+++PL+IYLR+Q+VT P+TF A
Sbjct  146   LLWIKIEPLLLFCGQDPTISSIASTYLSFCLPNLFFQSIINPLKIYLRTQNVTFPVTFSA  205

Query  652   AFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWE  831
             AF++ +H PINYFL+  L LGIKGVA++ V  +FN++G L +YV FSGV++K+W G S E
Sbjct  206   AFSLALHAPINYFLIYHLGLGIKGVAMAVVIADFNLLGVLFLYVSFSGVHRKSWQGWSTE  265

Query  832   CFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFP  1011
             CF+G+K +L LA+PSC SVCLEWWWYELMILL G+L N    V++MG+L+Q TSL YIFP
Sbjct  266   CFEGWKPILILAVPSCISVCLEWWWYELMILLSGVLFNAAEAVSTMGILLQATSLAYIFP  325

Query  1012  SSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDA  1191
             S+LS  VSTRVGNELGA RP +AK +  V +  + +  L A+ F   +RN W   FT D 
Sbjct  326   SALSLAVSTRVGNELGANRPNKAKTSCHVAILCATLTSLLAMIFMTTLRNAWGKAFTDDE  385

Query  1192  EIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGF  1371
              I+ LTAA +P++GLCELGNCPQTTGCGALRG+ARP L   INL  FY VGLP+A  LGF
Sbjct  386   SILWLTAAAMPVVGLCELGNCPQTTGCGALRGSARPALAVHINLGSFYGVGLPLAIVLGF  445

Query  1372  FAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKEL  1500
                    GL LGLLAAQ  CA  M+ VL RTDW  QA+RA+EL
Sbjct  446   VMKMGLLGLCLGLLAAQGVCACLMVFVLSRTDWMIQAQRAREL  488



>ref|NP_200018.1| MATE efflux family protein [Arabidopsis thaliana]
 dbj|BAB11053.1| integral membrane protein-like [Arabidopsis thaliana]
 gb|AED96166.1| MATE efflux family protein [Arabidopsis thaliana]
Length=505

 Score =   489 bits (1260),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 272/480 (57%), Positives = 341/480 (71%), Gaps = 9/480 (2%)
 Frame = +1

Query  124   PKEEDHNHNQTH---LSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlsla  294
             P  +  +H + H   LS+   EA  I  I+ P+++TGL LY RS +S+ FLG LGD +LA
Sbjct  14    PLLQKTSHLKNHSSVLSVFLNEAISICKISYPLVLTGLFLYVRSFVSLSFLGGLGDATLA  73

Query  295   ggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAI  474
             GGSLA  FANITGYS+ SGL MG+E IC QAFGA+R+  +  S++R I+LLL TS+P+ +
Sbjct  74    GGSLAAAFANITGYSLFSGLTMGVESICSQAFGARRYNYVCASVKRGIILLLVTSLPVTL  133

Query  475   LWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAA  654
             LW NME+IL++ +QD++++ EA  F+LYS+PDL+AQS LHPLR+YLR+QS TLPL+ C  
Sbjct  134   LWMNMEKILLILKQDKKLASEAHIFLLYSVPDLVAQSFLHPLRVYLRTQSKTLPLSICTV  193

Query  655   FAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLF------SGVYKKTWG  816
              A  +H+PI +FLV  L LGIKG+ALS V  NFN+V  L +Y+ F          +K   
Sbjct  194   IASFLHLPITFFLVSYLGLGIKGIALSGVVSNFNLVAFLFLYICFFEDKLSVNEDEKITE  253

Query  817   GVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSL  996
                 +  + +K LL LAIPSC SVCLEWW YE+MILLCG L +P+A+VASMG+LIQ TSL
Sbjct  254   ETCEDSVREWKKLLCLAIPSCISVCLEWWCYEIMILLCGFLLDPKASVASMGILIQITSL  313

Query  997   IYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASI  1176
             +YIFP SLS GVSTRVGNELG+ +P RA+ AAIVGL  S  LG  A  F V+VRN WA  
Sbjct  314   VYIFPHSLSLGVSTRVGNELGSNQPKRARRAAIVGLGLSIALGFTAFAFTVSVRNTWAMF  373

Query  1177  FTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVA  1356
             FT D EIM LTA  LPI+GLCELGNCPQTTGCG LRG+ARPK+GA IN   FY VG+PV 
Sbjct  374   FTDDKEIMKLTAMALPIVGLCELGNCPQTTGCGVLRGSARPKIGANINGVAFYAVGIPVG  433

Query  1357  GWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDD  1536
               L F+ GF F+GLWLG+LAAQ +C + M+    RTDW  +A RAK LT  +     DDD
Sbjct  434   AVLAFWFGFGFKGLWLGMLAAQITCVIGMMAATCRTDWELEAERAKVLTTAVDCGSSDDD  493



>ref|XP_010470264.1| PREDICTED: MATE efflux family protein 7-like [Camelina sativa]
Length=538

 Score =   490 bits (1262),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 288/489 (59%), Positives = 363/489 (74%), Gaps = 11/489 (2%)
 Frame = +1

Query  82    CKEKME-APLISEENPKEEDHNHNQTHLSLAAK----------EAKCISDIALPMIVTGL  228
             CK K   + L + +N  +  ++    + SL  K          E K I  I+ P  +TGL
Sbjct  21    CKHKTHFSKLETCDNTDDPHYSEFTNNDSLDLKRWPTFHEGLEEVKAIGRISGPTAMTGL  80

Query  229   LLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFK  408
             L+Y R+MISMLFLG LG+L LAGGSL+IGFANITGYS++SGL+MGMEPICGQA+GAK+ K
Sbjct  81    LMYSRAMISMLFLGYLGELELAGGSLSIGFANITGYSVISGLSMGMEPICGQAYGAKQMK  140

Query  409   LMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSL  588
             L+GL+LQRT++LLL  S+PI+  W NM RIL+ C QD EIS  AQ F+L+++PDL   SL
Sbjct  141   LLGLTLQRTVLLLLSCSVPISFSWLNMRRILLWCGQDEEISSVAQKFLLFAIPDLFLLSL  200

Query  589   LHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGS  768
             LHPLRIYLR+Q++TLP+T+  A +++VHVP+N+ LVV L +G+ GVA++ V  N N+V  
Sbjct  201   LHPLRIYLRTQNITLPVTYSTAVSVLVHVPLNFLLVVKLEMGVAGVAIAMVLTNLNLVVL  260

Query  769   LVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANP  948
             L  +V F+ V+  TW  ++ +  KG+ SLL+LAIP+C SVCLEWWWYE MI+LCGLLANP
Sbjct  261   LSSFVYFTSVHSDTWAPLTIDALKGWSSLLSLAIPTCVSVCLEWWWYEFMIILCGLLANP  320

Query  949   RATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGL  1128
             RATVASMG+LIQTT+L+Y+FPSSLS GVSTR+ NELGA RPG+A+++ IV L  +  LGL
Sbjct  321   RATVASMGILIQTTALVYVFPSSLSLGVSTRISNELGAKRPGKARISMIVSLFCATALGL  380

Query  1129  AALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLG  1308
              A+ F V +R+ W  +FT DAEI+ LT+  LPI+GLCELGNCPQTTGCG LRG ARP LG
Sbjct  381   MAMMFAVLIRHRWGRLFTTDAEILELTSIALPIVGLCELGNCPQTTGCGVLRGCARPTLG  440

Query  1309  AKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARR  1488
             A INL  FYFVG+PVA   GF     F GLWLGLLAAQA+CA  ML  L RTDW  QA R
Sbjct  441   ANINLGSFYFVGMPVAILFGFVFKQGFPGLWLGLLAAQATCASLMLCALLRTDWAVQAER  500

Query  1489  AKELTATIS  1515
             A+ELT+  S
Sbjct  501   AEELTSETS  509



>ref|XP_010536256.1| PREDICTED: multidrug and toxin extrusion protein 2-like [Tarenaya 
hassleriana]
Length=506

 Score =   489 bits (1259),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 268/492 (54%), Positives = 345/492 (70%), Gaps = 18/492 (4%)
 Frame = +1

Query  118   ENPKEEDHNHNQT---------------HLSLAAKEAKCISDIALPMIVTGLLLYCRSMI  252
             ENP   DH ++ T                +S    E + +  IA P I+  L+LY RS I
Sbjct  2     ENPNISDHKNSSTGPDPESEPDQTRIFPSISQIISEGESLFSIAFPTILAALILYVRSAI  61

Query  253   SMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQR  432
             SM+FLG LG+L LAGGSLAI FANITGYS+LSGLA+GM+P+C QAFGA++ KL+ L+LQR
Sbjct  62    SMIFLGHLGELELAGGSLAIAFANITGYSVLSGLALGMDPLCSQAFGAEKPKLLSLTLQR  121

Query  433   TIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYL  612
             T++ LL  S+ I +LW N+E+I+I   QD  IS  AQ ++L S+PDL+  S+LHPLRIYL
Sbjct  122   TVLFLLACSVGILVLWLNLEKIMIFLHQDPTISSLAQVYVLCSIPDLVTNSVLHPLRIYL  181

Query  613   RSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFS  792
             R+Q +T PLT       + H+PIN+FLV  L +G+ GVA+++   NF V+  LV Y+ F+
Sbjct  182   RAQGITHPLTLATLAGTIFHIPINFFLVSYLQMGLVGVAMAASASNFFVLMFLVFYIWFT  241

Query  793   GVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMG  972
             G+++ TW   S ECFK +  L++LA PSC SVCLEWWWYE+M +LCGLLANP+A +A+MG
Sbjct  242   GLHRATWTNPSSECFKDWGPLIHLAAPSCVSVCLEWWWYEIMTVLCGLLANPKAPIAAMG  301

Query  973   VLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVA  1152
             +LIQTTSL+YIFPSSL F +STRVGNELG+ RP  A+LAA V +  + ++GL A  F   
Sbjct  302   ILIQTTSLLYIFPSSLGFAISTRVGNELGSNRPHNARLAATVAVAFAGLMGLTAFAFAWG  361

Query  1153  VRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCF  1332
             V N+W  +FT+D EI+ LTA VLPI+GLCE+GNCPQT GCG LRG+ARP   A INL  F
Sbjct  362   VSNIWGKMFTRDIEIINLTALVLPILGLCEIGNCPQTVGCGVLRGSARPSTAANINLGAF  421

Query  1333  YFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTAT-  1509
             Y VG+PVA  L F  G  F GLWLGLLAAQ SCA+ ML ++G TDW  +A+RAK LT T 
Sbjct  422   YLVGMPVAVGLAFRTGIGFCGLWLGLLAAQISCAVMMLYIVGSTDWEGEAKRAKVLTCTG  481

Query  1510  --ISLVDDDDDD  1539
               + +   D DD
Sbjct  482   VDVVITAQDSDD  493



>ref|XP_004157307.1| PREDICTED: multidrug and toxin extrusion protein 2-like [Cucumis 
sativus]
 gb|KGN66182.1| hypothetical protein Csa_1G574980 [Cucumis sativus]
Length=538

 Score =   490 bits (1261),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 264/489 (54%), Positives = 341/489 (70%), Gaps = 32/489 (7%)
 Frame = +1

Query  130   EEDHNHNQTHLSLAA------KEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlsl  291
             E+   H  + L L +       EAK +  +A P+++T L+LY RS++SMLFLG LGDL L
Sbjct  42    EDPVRHKNSPLLLRSSVIEIFNEAKSLFSLAFPIVLTALILYSRSILSMLFLGHLGDLEL  101

Query  292   aggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIA  471
             A GSLAI FANITGYS+LSGLA+GMEP+C QAFGA R KL+ L+L R+++ LL +S+PI+
Sbjct  102   AAGSLAIAFANITGYSVLSGLALGMEPLCSQAFGAHRPKLLCLTLHRSVIFLLVSSLPIS  161

Query  472   ILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCA  651
             ILW N+ +IL+   QD  I+  A +++++SLPDL+  S +HP+RIYLR+Q +T PLT  +
Sbjct  162   ILWLNISKILLFLHQDPTITKLAHTYLIFSLPDLLCNSFIHPIRIYLRAQGITHPLTLAS  221

Query  652   AFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWE  831
                 + H+PIN  LV     GI GVA +S   NF V+  L++Y++ SG++  TW   + E
Sbjct  222   LAGTIFHLPINLLLVSHFRFGIAGVAAASAATNFVVLLFLILYIVASGIFVPTWSPPTRE  281

Query  832   CFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFP  1011
             C  G+  LL LA PSC SVCLEWWWYE+MI+LCGLLANP+ATVASMGVLIQTTSLIYIFP
Sbjct  282   CLTGWTPLLKLAAPSCVSVCLEWWWYEIMIILCGLLANPKATVASMGVLIQTTSLIYIFP  341

Query  1012  SSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDA  1191
             SSL F VSTRVGNELGA RPG+AKL+A+V +  + I+G++A TF V++RN+WA IFT D 
Sbjct  342   SSLGFAVSTRVGNELGANRPGKAKLSAVVAVFLAGIMGVSATTFAVSMRNIWARIFTNDL  401

Query  1192  EIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVA-----  1356
             EI+ LT+  LPI+GLCE+GNCPQT GCG LRG+ARP   A+INL  FY VG+PVA     
Sbjct  402   EILRLTSTALPILGLCEIGNCPQTVGCGVLRGSARPSTAARINLSAFYLVGMPVAVGLGL  461

Query  1357  --------GWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATI  1512
                      WLG  +              Q SCA  ML V+G TDW+ QA R+KELT+ +
Sbjct  462   LLGVGFSGLWLGLLSA-------------QVSCAGLMLYVIGSTDWDLQAERSKELTSDV  508

Query  1513  SLVDDDDDD  1539
                + DDDD
Sbjct  509   VFGNVDDDD  517



>ref|XP_009412273.1| PREDICTED: MATE efflux family protein 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412274.1| PREDICTED: MATE efflux family protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=521

 Score =   489 bits (1258),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 275/455 (60%), Positives = 337/455 (74%), Gaps = 0/455 (0%)
 Frame = +1

Query  145   HNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFAN  324
             H     S   +E + I  I++P  +TGL+LY R+M+S LFLG LG+L LA GSL+IGFAN
Sbjct  14    HRCPTASEVVEEMRAIGAISVPAALTGLVLYSRAMVSTLFLGYLGELELASGSLSIGFAN  73

Query  325   ITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILI  504
             ITGYS+LSGLAMGMEPICGQAFGAK+ KL+GL+LQR I+LLL  S+PI+ LW NM RIL 
Sbjct  74    ITGYSVLSGLAMGMEPICGQAFGAKQRKLLGLTLQRAILLLLSASVPISFLWRNMRRILS  133

Query  505   LCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPIN  684
              C QD +I+  A  FI +++PDL   S LHPLR+YLRSQ+VT P+T C+  ++V+H+P+N
Sbjct  134   WCGQDEQIASAAHVFITFAIPDLFLLSFLHPLRVYLRSQNVTFPVTCCSVVSVVLHIPLN  193

Query  685   YFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNL  864
             Y LVV L +GI GVAL+ VW N N+   L+++VL SG  K +W   S  C +G+ +LL L
Sbjct  194   YLLVVRLRMGIAGVALAMVWTNLNLFVCLLLFVLCSGACKDSWVRPSMTCLRGWSALLKL  253

Query  865   AIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRV  1044
             A+PSC SVCLEWWWYELMILL GLL NP+A VASMG+LIQTTSL+Y+FPS+LSFGVS RV
Sbjct  254   AVPSCVSVCLEWWWYELMILLSGLLPNPKAAVASMGILIQTTSLVYVFPSALSFGVSARV  313

Query  1045  GNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLP  1224
             GN LGA  P +A+ A +V L  + +LGL A+ F  ++R+ W  +FT DAEI+ LT   LP
Sbjct  314   GNVLGANHPAKARTATMVSLACALVLGLTAMAFTTSMRHRWGRLFTDDAEILKLTTLALP  373

Query  1225  IIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwl  1404
             I GLCELGNCPQTTGCG LRG+ARP  GA INL  FY VG PVA  LGFF    F GLWL
Sbjct  374   IAGLCELGNCPQTTGCGVLRGSARPTTGANINLGSFYLVGTPVAVLLGFFRRMGFPGLWL  433

Query  1405  gllaaqaSCALTMLLVLGRTDWNDQARRAKELTAT  1509
             GLLAAQASCA  M   L RTDW  +A +A+ELT T
Sbjct  434   GLLAAQASCATLMAYALARTDWMVEAEKARELTKT  468



>ref|XP_006280325.1| hypothetical protein CARUB_v10026248mg [Capsella rubella]
 gb|EOA13223.1| hypothetical protein CARUB_v10026248mg [Capsella rubella]
Length=511

 Score =   488 bits (1256),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 272/492 (55%), Positives = 349/492 (71%), Gaps = 7/492 (1%)
 Frame = +1

Query  85    KEKMEAPLISEENPKEEDHNHNQTH-LSLAAKEAKCISDIALPMIVTGLLLYCRSMISML  261
             +++   PL+ + + ++     N +  LS+   EA  I  I+ P+++TGL LY RS +S+ 
Sbjct  8     RDEHTIPLLQKSSLQKLHFLKNYSSVLSVFVYEAISICKISYPLVLTGLFLYVRSFVSLS  67

Query  262   FlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIV  441
             FLG LGD +LAGGSLA  FANITGYS+ SGL MG+E IC QAFGA+R+  +  +++R I+
Sbjct  68    FLGGLGDATLAGGSLAAAFANITGYSLFSGLTMGVESICSQAFGARRYSYVRETIRRGII  127

Query  442   LLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQ  621
             LLL TS+P+ +LW NME+IL++ +QD++++ EA  F+LYS+PDL+AQS LHPLR+YLR+Q
Sbjct  128   LLLVTSLPVTLLWMNMEKILLMLKQDKKLASEAHIFLLYSVPDLVAQSFLHPLRVYLRTQ  187

Query  622   SVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLF----  789
             S TLPL+ C   A  +H+P+ +  V  L LGIKGVALS V  NFN+V  L +Y+ F    
Sbjct  188   SKTLPLSICTVIASFLHLPVTFLFVSYLGLGIKGVALSGVVSNFNLVVFLFLYIYFLEDK  247

Query  790   -SGVYKKTWGGVSWE-CFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVA  963
              S    +     S+E   + +K LL LAIPSC SVCLEWW YE+MILLCG L NP+A+VA
Sbjct  248   LSVDEDEKVTEESYEDSVREWKKLLCLAIPSCISVCLEWWCYEIMILLCGFLLNPKASVA  307

Query  964   SMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTF  1143
             SMG+LIQ TSL+YIFP SLS GVSTRVGNELG+ +P +AK AAIVGL  S  LG  A TF
Sbjct  308   SMGILIQITSLVYIFPHSLSLGVSTRVGNELGSNQPQKAKKAAIVGLGLSIALGFTAFTF  367

Query  1144  GVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINL  1323
              V+VRN WA  FT D EIM LTA  LPI+GLCELGNCPQTTGCG LRG+ARPK+GA IN 
Sbjct  368   TVSVRNTWAMFFTDDKEIMKLTAMALPIVGLCELGNCPQTTGCGVLRGSARPKIGANING  427

Query  1324  RCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELT  1503
               FY VG+PV   + F+ G  F+GLWLG+LAAQ +C + M+    RTDW  +A+RAKELT
Sbjct  428   VAFYAVGIPVGAVMAFWFGLGFKGLWLGMLAAQITCVIGMMAATCRTDWELEAKRAKELT  487

Query  1504  ATISLVDDDDDD  1539
               +     DDD 
Sbjct  488   TAVDSGSSDDDK  499



>ref|XP_009109050.1| PREDICTED: MATE efflux family protein 5-like [Brassica rapa]
Length=537

 Score =   489 bits (1258),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 264/473 (56%), Positives = 342/473 (72%), Gaps = 2/473 (0%)
 Frame = +1

Query  115   EENPKEEDHNHNQTH--LSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdls  288
             ++  +   H  N+T   +S A  EAK +  +A P+ +T L+LY RS +SM FLGRLGDL 
Sbjct  37    QQTKRSLLHCQNRTSPLMSEAVTEAKSLLTLAFPIALTALVLYLRSAVSMFFLGRLGDLE  96

Query  289   laggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPI  468
             LA GSLAI FANI+GYS+LSGLA+GMEP+C QAFGA R+KL+ L+L RT+V LL  S+P+
Sbjct  97    LAAGSLAIAFANISGYSVLSGLALGMEPLCSQAFGAHRYKLLSLTLHRTVVFLLVCSVPV  156

Query  469   AILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFC  648
             ++LW N+ +I +   QD +I+  AQ+++++SLPDLI  +LLHP+R YLR+Q++  P+T  
Sbjct  157   SVLWLNVGKISVYLHQDHDIAELAQTYLIFSLPDLITNTLLHPIRTYLRAQAIIHPVTLA  216

Query  649   AAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSW  828
               F  V H+P N FLV  L LG+ GVA++S   N  VV  L+ YV  SG++  TW   +W
Sbjct  217   TLFGAVFHLPANLFLVSYLRLGLIGVAVASSVTNLLVVTFLICYVWASGLHVPTWTNPTW  276

Query  829   ECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIF  1008
             +CF+G+  LL LA PSC SVCLEWWWYE+MI+LCGLL NPR+TVA+MGVLIQTTS +Y+F
Sbjct  277   DCFRGWAPLLRLAGPSCVSVCLEWWWYEIMIVLCGLLVNPRSTVAAMGVLIQTTSFLYVF  336

Query  1009  PSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQD  1188
             PSSLSF VSTRVGNELGA RP  AKL+A V +  + + G+ A  F  +VRN W  +FT D
Sbjct  337   PSSLSFAVSTRVGNELGANRPKTAKLSATVAVFFAAVTGVIAAAFAYSVRNAWGRVFTGD  396

Query  1189  AEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLG  1368
              EI+ LTAA LP++GLCE+GNCPQT GCG +RGTARP   A +NL  FY VG+PVA  LG
Sbjct  397   DEILRLTAAALPLLGLCEIGNCPQTVGCGVVRGTARPSTAANVNLGAFYLVGMPVALGLG  456

Query  1369  FFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDD  1527
             F+AG  F GLWLGLLAAQ SC   M+ V+G TDW  +A++A+ LT   S+  D
Sbjct  457   FWAGVGFNGLWLGLLAAQVSCVGLMMYVVGTTDWETEAKKAQTLTCAESVESD  509



>ref|XP_006842445.1| hypothetical protein AMTR_s00077p00047440 [Amborella trichopoda]
 gb|ERN04120.1| hypothetical protein AMTR_s00077p00047440 [Amborella trichopoda]
Length=505

 Score =   487 bits (1254),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 268/493 (54%), Positives = 354/493 (72%), Gaps = 12/493 (2%)
 Frame = +1

Query  85    KEKMEAPLISEEN----PKEEDHNHNQTHLSLAA--------KEAKCISDIALPMIVTGL  228
             K   + PL S  +     KE+   + +     AA        +E + +  IA PM++T L
Sbjct  5     KSHEDEPLFSSISISLTTKEKGREYREKTEDAAAWPSPREVVEELRSLGGIAGPMVMTSL  64

Query  229   LLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFK  408
             LLY RS+ISMLFLG LG+  LAG SL++GFANITGYS++SGLA+GMEPICGQA+GAKR  
Sbjct  65    LLYSRSVISMLFLGHLGETELAGASLSMGFANITGYSVISGLALGMEPICGQAYGAKRCS  124

Query  409   LMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSL  588
             L+ L+LQRT +LLL  +IPI+ILW NME IL+   QD  I+  A +FI +SLPDL+AQ+ 
Sbjct  125   LLSLALQRTFLLLLIATIPISILWLNMEPILLWLGQDHTITGIASTFIAFSLPDLLAQAF  184

Query  589   LHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGS  768
             L PLRI+LR+Q++  PL   A FA+++H+P NYFLV+ L LGI+GVAL++   +FN+V  
Sbjct  185   LQPLRIFLRTQNLIKPLIHGATFALILHIPTNYFLVIYLKLGIRGVALAASSGSFNMVFY  244

Query  769   LVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANP  948
             L+ Y+ F+    K W  ++ EC +G+K LL L++PS ASVCLEWWWYELMI+LCGLL+NP
Sbjct  245   LLAYLAFTKSALKPWENLTRECLQGWKPLLYLSLPSAASVCLEWWWYELMIILCGLLSNP  304

Query  949   RATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGL  1128
             RA+VASMG+LIQTT+LIY+FPSS+S  VSTRVG+ELGA +P +A+ A +V + +  ++G 
Sbjct  305   RASVASMGILIQTTALIYVFPSSISLAVSTRVGHELGANQPDKARRATVVAMVSGAMMGF  364

Query  1129  AALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLG  1308
              AL F +++ + WA +FT DAEI+ LT+  LPI+GLCELGNCPQTTGCG LRG+ARP +G
Sbjct  365   LALLFTLSMSHFWAKMFTNDAEILLLTSITLPIVGLCELGNCPQTTGCGVLRGSARPSIG  424

Query  1309  AKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARR  1488
             A INL  FY +G+PV+  +GF     F GLWLGL AAQ SC   ML  +  TDW  QA+R
Sbjct  425   ANINLGSFYLIGMPVSILMGFGFKLGFVGLWLGLAAAQGSCVALMLYTVFNTDWKCQAKR  484

Query  1489  AKELTATISLVDD  1527
             AK L A   + +D
Sbjct  485   AKLLIAEDGVAND  497



>ref|XP_010414741.1| PREDICTED: MATE efflux family protein 7-like [Camelina sativa]
Length=535

 Score =   488 bits (1256),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 286/489 (58%), Positives = 363/489 (74%), Gaps = 11/489 (2%)
 Frame = +1

Query  82    CKEKME-APLISEENPKEEDHNHNQTHLSLAAK----------EAKCISDIALPMIVTGL  228
             CK K   + L + +N  +  ++    + SL  K          E K I  I+ P  +TGL
Sbjct  18    CKHKTHFSKLETGDNTDDPHYSEFTNNDSLDLKRWPTFHEGLEEVKAIGRISGPTAMTGL  77

Query  229   LLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFK  408
             L+Y R+MISMLFLG LG+L LAGGSL+IGFANITGYS++SGL+MGMEPICGQA+GAK+ K
Sbjct  78    LMYSRAMISMLFLGYLGELELAGGSLSIGFANITGYSVISGLSMGMEPICGQAYGAKQMK  137

Query  409   LMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSL  588
             L+GL+LQRT++LLL  S+PI+  W NM RIL+ C QD EIS  AQ F+L+++PDL   SL
Sbjct  138   LLGLTLQRTVLLLLSCSVPISFSWLNMRRILLWCGQDEEISSVAQKFLLFAIPDLFLLSL  197

Query  589   LHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGS  768
             LHPLRIYLR+Q+VTLP+T+  A +++VHVP+N+ LVV L +G+ GVA++ V  N N+V  
Sbjct  198   LHPLRIYLRTQNVTLPVTYSTAVSVLVHVPLNFLLVVKLEMGVAGVAIAMVLTNLNLVVL  257

Query  769   LVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANP  948
             L  +V F+ V+  TW  ++ +  KG+ SLL+LAIP+C SVCLEWWWYE MI+LCGLLANP
Sbjct  258   LSSFVYFTSVHSDTWVPLTIDSLKGWSSLLSLAIPTCVSVCLEWWWYEFMIILCGLLANP  317

Query  949   RATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGL  1128
             RATVASMG+LIQTT+L+Y+FPSSLS GVSTR+ NELGA RP +A+++ I+ L  +  LGL
Sbjct  318   RATVASMGILIQTTALVYVFPSSLSLGVSTRISNELGAKRPAKARISMIISLFCATALGL  377

Query  1129  AALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLG  1308
              A+ F + +R+ W  +FT DAEI+ LT+  LPI+GLCELGNCPQTTGCG LRG ARP LG
Sbjct  378   MAMMFAMLIRHRWGRLFTTDAEILELTSIALPIVGLCELGNCPQTTGCGVLRGCARPTLG  437

Query  1309  AKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARR  1488
             A INL  FYFVG+PVA   GF     F GLWLGLLAAQA+CA  ML  L RTDW  QA+R
Sbjct  438   ANINLGSFYFVGMPVAILFGFVFKQGFPGLWLGLLAAQATCASLMLCALLRTDWAVQAKR  497

Query  1489  AKELTATIS  1515
             A+ELT+  S
Sbjct  498   AEELTSETS  506



>dbj|BAC42620.2| putative integral membrane protein [Arabidopsis thaliana]
Length=505

 Score =   486 bits (1251),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 271/480 (56%), Positives = 340/480 (71%), Gaps = 9/480 (2%)
 Frame = +1

Query  124   PKEEDHNHNQTH---LSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlsla  294
             P  +  +H + H   LS+   EA  I  I+ P+++TGL LY RS +S+ FLG LGD +LA
Sbjct  14    PLLQKTSHLKNHSSVLSVFLNEAISICKISYPLVLTGLFLYVRSFVSLSFLGGLGDATLA  73

Query  295   ggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAI  474
             GGSLA  FANITGYS+ SGL MG+E IC QAFGA+R+  +  S++R I+LLL TS+P+ +
Sbjct  74    GGSLAAAFANITGYSLFSGLTMGVESICSQAFGARRYNYVCASVKRGIILLLVTSLPVTL  133

Query  475   LWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAA  654
             LW NME+IL++ +QD++++ EA  F+LYS+PDL+AQS LHPLR+YLR+QS TLPL+ C  
Sbjct  134   LWMNMEKILLILKQDKKLASEAHIFLLYSVPDLVAQSFLHPLRVYLRTQSKTLPLSICTV  193

Query  655   FAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLF------SGVYKKTWG  816
              A  +H+PI +FLV  L LGIKG+ALS V  NFN+V  L +Y+ F          +K   
Sbjct  194   IASFLHLPITFFLVSYLGLGIKGIALSGVVSNFNLVAFLFLYICFFEDKLSVNEDEKITE  253

Query  817   GVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSL  996
                 +  + +K LL LAIPSC SVCLEWW YE+MILLCG L +P+A+VASMG+LIQ TSL
Sbjct  254   ETCEDSVREWKKLLCLAIPSCISVCLEWWCYEIMILLCGFLLDPKASVASMGILIQITSL  313

Query  997   IYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASI  1176
             +YIFP SLS GVSTRVGNELG+ +P RA+ AAIV L  S  LG  A  F V+VRN WA  
Sbjct  314   VYIFPHSLSLGVSTRVGNELGSNQPKRARRAAIVVLGLSIALGFTAFAFTVSVRNTWAMF  373

Query  1177  FTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVA  1356
             FT D EIM LTA  LPI+GLCELGNCPQTTGCG LRG+ARPK+GA IN   FY VG+PV 
Sbjct  374   FTDDKEIMKLTAMALPIVGLCELGNCPQTTGCGVLRGSARPKIGANINGVAFYAVGIPVG  433

Query  1357  GWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDD  1536
               L F+ GF F+GLWLG+LAAQ +C + M+    RTDW  +A RAK LT  +     DDD
Sbjct  434   AVLAFWFGFGFKGLWLGMLAAQITCVIGMMAATCRTDWELEAERAKVLTTAVDCGSSDDD  493



>ref|XP_010438335.1| PREDICTED: MATE efflux family protein 5-like [Camelina sativa]
Length=533

 Score =   487 bits (1253),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 265/477 (56%), Positives = 345/477 (72%), Gaps = 4/477 (1%)
 Frame = +1

Query  109   ISEENPKEEDHNHNQTH----LSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrl  276
             I+   P + +  H +      ++ A  EAK +  +A P+ VT L+LY RS +SM FLGRL
Sbjct  28    INSYEPTKRNLRHCENRGSPLMAEAVTEAKTLFTLAFPIAVTALVLYLRSAVSMFFLGRL  87

Query  277   gdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFT  456
             GDL LA GSLAI FANITGYS+LSGLA+GMEP+C QAFGA RFKL+ L+L RT+V LL  
Sbjct  88    GDLKLAAGSLAIAFANITGYSVLSGLALGMEPLCSQAFGAHRFKLLSLTLHRTVVFLLVC  147

Query  457   SIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLP  636
              +PI++LW N+ +I +   QD +I+  AQ+++++SLPDL++ +LLHP+RIYLR+Q +  P
Sbjct  148   CVPISVLWFNVGKISVYLHQDPDIAKLAQTYLIFSLPDLLSNTLLHPIRIYLRAQGIIHP  207

Query  637   LTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWG  816
             +T  +    + H+P N FLV  L LG+ GVA++S   N  VV  LV YV  SG++  TW 
Sbjct  208   VTLASLSGALFHLPANLFLVSYLRLGLTGVAVASSLTNLFVVAFLVCYVWASGLHAPTWT  267

Query  817   GVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSL  996
               + +CF+G+  LL LA PSC SVCLEWWWYE+MI+LCGLL NPR+TVA+MGVLIQTTS 
Sbjct  268   DPTRDCFRGWAPLLRLAGPSCVSVCLEWWWYEIMIVLCGLLVNPRSTVAAMGVLIQTTSF  327

Query  997   IYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASI  1176
             +Y+FPSSLSF VSTRVGNELGA RP  AKL+A+V +  + + G+ A  F  +VRN W  I
Sbjct  328   LYVFPSSLSFAVSTRVGNELGANRPRTAKLSAMVSIVFAAVTGITAAAFAYSVRNAWGRI  387

Query  1177  FTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVA  1356
             FT D EI+ LTAA LPI+GLCE+GNCPQT GCG +RGTARP   A +NL  FY VG+PVA
Sbjct  388   FTGDEEILRLTAAALPILGLCEIGNCPQTVGCGVVRGTARPSTAANVNLGAFYLVGMPVA  447

Query  1357  GWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDD  1527
               LGF+AG  F GLWLGLLAAQ SCA  M+ V+G TDW+ +A++++ LT   ++ +D
Sbjct  448   VGLGFWAGIGFNGLWLGLLAAQISCAGLMMYVVGTTDWDSEAKKSQTLTCAETVEND  504



>ref|NP_194643.1| putative MATE transport protein ADS1 [Arabidopsis thaliana]
 emb|CAB43928.1| putative protein [Arabidopsis thaliana]
 emb|CAB79672.1| putative protein [Arabidopsis thaliana]
 gb|AAM03452.1| putative transporter NIC4 [Arabidopsis thaliana]
 gb|AEE85591.1| putative MATE transport protein ADS1 [Arabidopsis thaliana]
Length=532

 Score =   487 bits (1253),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 265/477 (56%), Positives = 341/477 (71%), Gaps = 4/477 (1%)
 Frame = +1

Query  109   ISEENPKEEDHNHNQTH----LSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrl  276
             I+   P + +  H +      ++ A  EAK +  +A P+ VT L+LY RS +SM FLG+L
Sbjct  29    INSFEPTKRNLRHCENRGSPLMAEAVTEAKSLFTLAFPIAVTALVLYLRSAVSMFFLGQL  88

Query  277   gdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFT  456
             GDL LA GSLAI FANITGYS+LSGLA+GMEP+C QAFGA RFKL+ L+L RT+V LL  
Sbjct  89    GDLELAAGSLAIAFANITGYSVLSGLALGMEPLCSQAFGAHRFKLLSLTLHRTVVFLLVC  148

Query  457   SIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLP  636
              +PI++LW N+ +I +   QD +I+  AQ+++++SLPDL+  +LLHP+RIYLR+Q +  P
Sbjct  149   CVPISVLWFNVGKISVYLHQDPDIAKLAQTYLIFSLPDLLTNTLLHPIRIYLRAQGIIHP  208

Query  637   LTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWG  816
             +T  +    V H+P N FLV  L LG+ GVA++S   N  VV  LV YV  SG++  TW 
Sbjct  209   VTLASLSGAVFHLPANLFLVSYLRLGLTGVAVASSITNIFVVAFLVCYVWASGLHAPTWT  268

Query  817   GVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSL  996
               + +CF+G+  LL LA PSC SVCLEWWWYE+MI+LCGLL NPR+TVA+MGVLIQTTS 
Sbjct  269   DPTRDCFRGWAPLLRLAGPSCVSVCLEWWWYEIMIVLCGLLVNPRSTVAAMGVLIQTTSF  328

Query  997   IYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASI  1176
             +Y+FPSSLSF VSTRVGNELGA RP  AKL A V +  + + G+ A  F  +VRN W  I
Sbjct  329   LYVFPSSLSFAVSTRVGNELGANRPKTAKLTATVAIVFAAVTGIIAAAFAYSVRNAWGRI  388

Query  1177  FTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVA  1356
             FT D EI+ LTAA LPI+GLCE+GNCPQT GCG +RGTARP   A +NL  FY VG+PVA
Sbjct  389   FTGDKEILQLTAAALPILGLCEIGNCPQTVGCGVVRGTARPSTAANVNLGAFYLVGMPVA  448

Query  1357  GWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDD  1527
               LGF+AG  F GLW+GLLAAQ SCA  M+ V+G TDW  +A++A+ LT   ++ +D
Sbjct  449   VGLGFWAGIGFNGLWVGLLAAQISCAGLMMYVVGTTDWESEAKKAQTLTCAETVEND  505



>ref|NP_564731.1| MATE family protein ZRIZ1 [Arabidopsis thaliana]
 gb|AAF82254.1|AC008051_5 Identical to gene ZF14 from Arabidopsis thaliana gb|AB028198 
and is a member of an uncharacterized integral membrane protein 
UPF PF|01554 family [Arabidopsis thaliana]
 dbj|BAA87939.1| ZF14 [Arabidopsis thaliana]
 gb|AEE33537.1| MATE efflux family protein [Arabidopsis thaliana]
Length=532

 Score =   487 bits (1253),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 276/444 (62%), Positives = 346/444 (78%), Gaps = 0/444 (0%)
 Frame = +1

Query  175   KEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGL  354
             +E K I  I+ P  +TGLL+Y R+MISMLFLG LG+L LAGGSL+IGFANITGYS++SGL
Sbjct  57    EEVKAIGKISGPTAMTGLLMYSRAMISMLFLGYLGELELAGGSLSIGFANITGYSVISGL  116

Query  355   AMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISM  534
             +MGMEPICGQA+GAK+ KL+GL+LQRT++LLL  S+PI+  W NM RIL+ C QD EIS 
Sbjct  117   SMGMEPICGQAYGAKQMKLLGLTLQRTVLLLLSCSVPISFSWLNMRRILLWCGQDEEISS  176

Query  535   EAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLG  714
              AQ F+L+++PDL   SLLHPLRIYLR+Q++TLP+T+  A ++++HVP+NY LVV L +G
Sbjct  177   VAQQFLLFAIPDLFLLSLLHPLRIYLRTQNITLPVTYSTAVSVLLHVPLNYLLVVKLEMG  236

Query  715   IKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCL  894
             + GVA++ V  N N+V  L  +V F+ V+  TW  ++ +  KG+ +LL+LAIP+C SVCL
Sbjct  237   VAGVAIAMVLTNLNLVVLLSSFVYFTSVHSDTWVPITIDSLKGWSALLSLAIPTCVSVCL  296

Query  895   EWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPG  1074
             EWWWYE MI+LCGLLANPRATVASMG+LIQTT+L+Y+FPSSLS GVSTR+ NELGA RP 
Sbjct  297   EWWWYEFMIILCGLLANPRATVASMGILIQTTALVYVFPSSLSLGVSTRISNELGAKRPA  356

Query  1075  RAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNC  1254
             +A+++ I+ L  +  LGL A+ F V VR+ W  +FT DAEI+ LT+  LPI+GLCELGNC
Sbjct  357   KARVSMIISLFCAIALGLMAMVFAVLVRHHWGRLFTTDAEILQLTSIALPIVGLCELGNC  416

Query  1255  PQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCA  1434
             PQTTGCG LRG ARP LGA INL  FYFVG+PVA   GF     F GLW GLLAAQA+CA
Sbjct  417   PQTTGCGVLRGCARPTLGANINLGSFYFVGMPVAILFGFVFKQGFPGLWFGLLAAQATCA  476

Query  1435  LTMLLVLGRTDWNDQARRAKELTA  1506
               ML  L RTDW  QA RA+ELT+
Sbjct  477   SLMLCALLRTDWKVQAERAEELTS  500



>ref|XP_002869450.1| hypothetical protein ARALYDRAFT_913597 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45709.1| hypothetical protein ARALYDRAFT_913597 [Arabidopsis lyrata subsp. 
lyrata]
Length=533

 Score =   486 bits (1252),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 265/477 (56%), Positives = 341/477 (71%), Gaps = 4/477 (1%)
 Frame = +1

Query  109   ISEENPKEEDHNHNQTH----LSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrl  276
             I+   P + +  H +      ++ A  EAK +  +A P+ VT L+LY RS +SM FLGRL
Sbjct  28    INSFEPTKRNLRHCENRGSPLMAEAVTEAKSLFTLAFPIAVTALVLYLRSAVSMFFLGRL  87

Query  277   gdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFT  456
             GDL LA GSLAI FANITGYS+LSGL++GMEP+C QAFGA RFKL+ L+L RT+V LL  
Sbjct  88    GDLELAAGSLAIAFANITGYSVLSGLSLGMEPLCSQAFGAHRFKLLSLTLHRTVVFLLVC  147

Query  457   SIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLP  636
              +PI++LW N+ +I +   QD +I+  AQ+++++SLPDL+  +LLHP+RIYLR+Q +  P
Sbjct  148   CVPISVLWLNVGKISVYLHQDPDIAKLAQTYLIFSLPDLLTNTLLHPIRIYLRAQGIIHP  207

Query  637   LTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWG  816
             +T  +    V H+P N FLV  L LG+ GVA++S   N  VV  LV YV  SG++  TW 
Sbjct  208   VTLASLSGAVFHLPANLFLVSYLRLGLTGVAVASSITNIFVVAFLVCYVWASGLHAPTWT  267

Query  817   GVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSL  996
               + +CF+G+  LL LA PSC SVCLEWWWYE+MI+LCGLL NPR+TVA+MGVLIQTTS 
Sbjct  268   DPTRDCFRGWAPLLRLAGPSCVSVCLEWWWYEIMIVLCGLLVNPRSTVAAMGVLIQTTSF  327

Query  997   IYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASI  1176
             +Y+FPSSLSF VSTRVGNELGA RP  AKL A V +  + + G+ A  F  +VRN W  I
Sbjct  328   LYVFPSSLSFAVSTRVGNELGANRPKTAKLTATVAIVFAAVTGITAAAFAYSVRNAWGRI  387

Query  1177  FTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVA  1356
             FT D EI+ LTAA LPI+GLCE+GNCPQT GCG +RGTARP   A +NL  FY VG+PVA
Sbjct  388   FTGDKEILQLTAAALPILGLCEIGNCPQTVGCGVVRGTARPSTAANVNLGAFYLVGMPVA  447

Query  1357  GWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDD  1527
               LGF+AG  F GLW+GLLAAQ SCA  M+ V+G TDW  +A++A+ LT   ++ +D
Sbjct  448   VGLGFWAGIGFSGLWVGLLAAQISCAGLMMYVVGTTDWESEAKKAQTLTCAETVEND  504



>emb|CDY14218.1| BnaA08g13490D [Brassica napus]
Length=536

 Score =   487 bits (1253),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 269/503 (53%), Positives = 352/503 (70%), Gaps = 10/503 (2%)
 Frame = +1

Query  19    DKRQSNTKNPLFFLPFAFISACKEKMEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISD  198
             + +QS T     FL    +   +++ +  L+  +N +          +S A  EAK +  
Sbjct  16    ENQQSQTGT---FLDLFSVKTFQQQTKRSLLHCQNRRSP-------LMSEAVTEAKSLLT  65

Query  199   IALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPIC  378
             +A P+ +T L+LY RS +SM FLGRLGDL LA GSLAI FANITGYS+LSGLA+GMEP+C
Sbjct  66    LAFPIALTALVLYLRSAVSMFFLGRLGDLELAAGSLAIAFANITGYSVLSGLALGMEPLC  125

Query  379   GQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILY  558
              QAFGA R+KL+ L+L RT+V LL  S+P+++LW N+ +I +   QD +I+  AQ+++++
Sbjct  126   SQAFGAHRYKLLSLTLHRTVVFLLVCSVPVSVLWLNVGKISVYLHQDHDIAELAQTYLIF  185

Query  559   SLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSS  738
             SLPDLI  +LLHP+R YLR+Q++  P+T    F  V H+P N FLV  L LG+ GVA++S
Sbjct  186   SLPDLITNTLLHPIRTYLRAQAIIHPVTLATLFGAVFHLPANLFLVSYLRLGLIGVAVAS  245

Query  739   VWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELM  918
                N  VV  L+ YV  SG++  TW   +W+CF+G+  LL LA PSC SVCLEWWWYE+M
Sbjct  246   SVTNLLVVTFLICYVWASGLHVPTWTNPTWDCFRGWAPLLRLAGPSCVSVCLEWWWYEIM  305

Query  919   ILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIV  1098
             I+LCGLL NPR+TVA+MGVLIQTTS +Y+FPSSLSF VSTRVGNELGA RP  AKL+A V
Sbjct  306   IVLCGLLVNPRSTVAAMGVLIQTTSFLYVFPSSLSFAVSTRVGNELGANRPKTAKLSATV  365

Query  1099  GLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGA  1278
              +  + + G+ A  F  +VRN W  +FT D EI+ LTAA LP++GLCE+GNCPQT GCG 
Sbjct  366   AVFFAAVTGVIAAAFAYSVRNAWGRVFTGDDEILRLTAAALPLLGLCEIGNCPQTVGCGV  425

Query  1279  LRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLG  1458
             +RGTARP   A +NL  FY VG+PVA  LGF+A   F GLWLGLLAAQ SCA  M+ V+G
Sbjct  426   VRGTARPSTAANVNLGAFYLVGMPVALGLGFWARVGFNGLWLGLLAAQVSCAGLMMYVVG  485

Query  1459  RTDWNDQARRAKELTATISLVDD  1527
              TDW  +A++A+ LT   S+  D
Sbjct  486   TTDWETEAKKAQTLTCAESVESD  508



>ref|XP_006401870.1| hypothetical protein EUTSA_v10015455mg [Eutrema salsugineum]
 gb|ESQ43323.1| hypothetical protein EUTSA_v10015455mg [Eutrema salsugineum]
Length=514

 Score =   486 bits (1250),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 271/487 (56%), Positives = 345/487 (71%), Gaps = 10/487 (2%)
 Frame = +1

Query  73    ISACKEKMEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMI  252
             IS  K+++  P++ +   K +        LS+   EA  I  I+LP++ TGLLLY RS I
Sbjct  4     ISPLKDEVRVPIL-QNISKSQKLQKYSAPLSIFTNEAISIGKISLPLVFTGLLLYIRSFI  62

Query  253   SMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQR  432
             SM FL  +G  +L+GGSLA+ FANITGYS+ SGL MG+E IC QAFGAKR KL   ++QR
Sbjct  63    SMYFLAGIGGATLSGGSLALAFANITGYSLFSGLNMGVETICAQAFGAKRHKLFRATIQR  122

Query  433   TIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYL  612
              I+ LL  SIP+A+LW N+ +IL + +QD+++  EA +F++YS+PDL AQS LHPLR  L
Sbjct  123   GIIQLLSASIPVALLWMNINKILEMLKQDKDLVSEAHTFLIYSVPDLFAQSFLHPLRASL  182

Query  613   RSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLF-  789
             R+QS T+PL+ C A A  +H PI   LVV L++GIKG+A S    NFN+V  L +Y+ F 
Sbjct  183   RTQSKTIPLSICTAIASGLHFPITKILVVYLDMGIKGLAFSGFVSNFNLVAFLYLYIRFF  242

Query  790   ----SGVYKKTWGGVSWECF----KGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLAN  945
                 S    +       E F    + +K L+ L++PSC SVCLEWW YE+MI+LCG L N
Sbjct  243   KEKLSSDEAEEEDDSKVESFEDRVREWKKLVALSLPSCVSVCLEWWCYEIMIVLCGYLIN  302

Query  946   PRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILG  1125
             P ATVASMG+LIQ TSL+YIFPSSLSFGVSTRVGNELG+ +P RA+ AAIVGL  S  LG
Sbjct  303   PEATVASMGILIQITSLVYIFPSSLSFGVSTRVGNELGSNQPQRARRAAIVGLGLSIALG  362

Query  1126  LAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKL  1305
               AL F V+VRN WA +FT+D +I+ LT   LPI+GLCELGNCPQTTGCG LRG+ARPK+
Sbjct  363   FTALAFTVSVRNRWAKVFTEDEKIIKLTLMALPIVGLCELGNCPQTTGCGVLRGSARPKI  422

Query  1306  GAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQAR  1485
             G+KINL  FY VGLPV G L F+ G  F+GLWLG+LAAQ SC + M++   RT+W+ +A 
Sbjct  423   GSKINLAAFYLVGLPVGGALAFWFGLGFKGLWLGMLAAQISCVIGMMVATCRTNWDLEAA  482

Query  1486  RAKELTA  1506
             RAKELTA
Sbjct  483   RAKELTA  489



>ref|XP_010433131.1| PREDICTED: MATE efflux family protein 5-like [Camelina sativa]
Length=533

 Score =   486 bits (1252),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 265/477 (56%), Positives = 345/477 (72%), Gaps = 4/477 (1%)
 Frame = +1

Query  109   ISEENPKEEDHNHNQTH----LSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrl  276
             I+   P + +  H +      ++ A  EAK +  +A P+ VT L+LY RS +SM FLGRL
Sbjct  28    INSYEPSKRNLRHCENRGSPLMAEAVTEAKSLFTLAFPIAVTALVLYLRSAVSMFFLGRL  87

Query  277   gdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFT  456
             GDL LA GSLAI FANITGYS+LSGLA+GMEP+C QAFGA RFKL+ L+L RT+V LL  
Sbjct  88    GDLELAAGSLAIAFANITGYSVLSGLALGMEPLCSQAFGAHRFKLLSLTLHRTVVFLLVC  147

Query  457   SIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLP  636
              +PI++LW N+ +I +   QD +I+  AQ+++++SLPDL++ +LLHP+RIYLR+Q +  P
Sbjct  148   CVPISVLWFNVGKISVYLHQDPDIAKLAQTYLIFSLPDLLSNTLLHPIRIYLRAQGIIHP  207

Query  637   LTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWG  816
             +T  +    + H+P N FLV  L LG+ GVA++S   N  VV  LV YV  SG++  TW 
Sbjct  208   VTLASLSGALFHLPANLFLVSYLRLGLTGVAVASSLTNLFVVAFLVCYVWASGLHAPTWT  267

Query  817   GVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSL  996
               + +CF+G+  LL LA PSC SVCLEWWWYE+MI+LCGLL NPR+TVA+MGVLIQTTS 
Sbjct  268   DPTRDCFRGWAPLLRLAGPSCVSVCLEWWWYEIMIVLCGLLVNPRSTVAAMGVLIQTTSF  327

Query  997   IYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASI  1176
             +Y+FPSSLSF VSTRVGNELGA RP  AKL+A+V +  + + G+ A  F  +VRN W  I
Sbjct  328   LYVFPSSLSFAVSTRVGNELGANRPRTAKLSAMVSIVFAAVTGITAAAFAYSVRNAWGRI  387

Query  1177  FTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVA  1356
             FT D EI+ LTAA LPI+GLCE+GNCPQT GCG +RGTARP   A +NL  FY VG+PVA
Sbjct  388   FTVDEEILRLTAAALPILGLCEIGNCPQTVGCGVVRGTARPSTAANVNLGAFYLVGMPVA  447

Query  1357  GWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDD  1527
               LGF+AG  F GLWLGLLAAQ SCA  M+ V+G TDW+ +A++++ LT   ++ +D
Sbjct  448   VGLGFWAGIGFNGLWLGLLAAQISCAGLMMYVVGTTDWDSEAKKSQTLTCAETVEND  504



>ref|XP_007013017.1| Multidrug and toxin extrusion protein 2 [Theobroma cacao]
 gb|EOY30636.1| Multidrug and toxin extrusion protein 2 [Theobroma cacao]
Length=532

 Score =   486 bits (1252),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 266/475 (56%), Positives = 341/475 (72%), Gaps = 0/475 (0%)
 Frame = +1

Query  115   EENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlsla  294
             E + K E+  +    +S    E K + ++A P+ +TGL+LY RS+ISMLFLG LGD+ LA
Sbjct  40    EMHQKAEEPEYLHPSISEIITETKSLFNLAFPIALTGLILYSRSIISMLFLGHLGDIQLA  99

Query  295   ggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAI  474
              GSLAI FANITGYS+LSGLA+GMEP+C QAFGA+R KL+ L+L R ++ LLFTSI I+ 
Sbjct  100   AGSLAIAFANITGYSVLSGLALGMEPLCSQAFGAQRPKLLSLTLHRYVIFLLFTSILISF  159

Query  475   LWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAA  654
             LW NM  IL+   QD  I+   Q+++L+SLPDL   S +HP+RIYLR+Q +T PLT    
Sbjct  160   LWINMFNILVYLYQDPNITRIGQTYLLFSLPDLFTNSFIHPIRIYLRAQGITHPLTLATL  219

Query  655   FAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWEC  834
              A ++H+PIN  LV   N G+ GVA S+   NF V+ SLV  +  SG+++ TW   S EC
Sbjct  220   IATILHLPINLLLVSHFNFGVAGVAASASISNFFVLISLVAGIWASGLHEPTWEKPSLEC  279

Query  835   FKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPS  1014
               G+K LL LA PSC SVCLEWWWYE+MI+LCGLL NP+ +VASMG+LIQTTSLIY+FPS
Sbjct  280   LTGWKPLLKLAGPSCVSVCLEWWWYEIMIVLCGLLVNPKWSVASMGILIQTTSLIYVFPS  339

Query  1015  SLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAE  1194
             SL F VSTRVGNELGA RP +A+L+A+V +  S ++GL+A  F   +R+ WA +FT D+E
Sbjct  340   SLGFAVSTRVGNELGANRPYKARLSAVVAVFVSAMMGLSASMFASGMRDKWARMFTSDSE  399

Query  1195  IMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFF  1374
             I+ LT+  LPI+GLCELGNCPQT GCG LRG+ARP   A +NL  FY VG+PVA  LGF+
Sbjct  400   ILRLTSIALPILGLCELGNCPQTVGCGVLRGSARPSTAANVNLGAFYLVGMPVAIGLGFY  459

Query  1375  AGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDDD  1539
              G  F GLWLGLL+AQ  CA  ML V+G TDW  QA+RA+ LT   +   +D ++
Sbjct  460   LGVGFAGLWLGLLSAQVCCAGLMLYVVGSTDWELQAKRAQMLTYVDTRQPEDCNN  514



>ref|XP_003523763.1| PREDICTED: MATE efflux family protein 5-like [Glycine max]
Length=537

 Score =   486 bits (1252),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 282/484 (58%), Positives = 361/484 (75%), Gaps = 6/484 (1%)
 Frame = +1

Query  70    FISACKEKMEAP---LISEENPKEE---DHNHNQTHLSLAAKEAKCISDIALPMIVTGLL  231
             F+   K  +  P   LI+   P ++   D  H     +    E K I  I+ P  +TGL+
Sbjct  12    FLCPTKNHIITPDPKLINHPPPVDDQLKDELHRWPTPNEVIAEMKAIGKISGPTALTGLI  71

Query  232   LYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKL  411
             LY R+MISM+FLG LG++ LAGGSL+IGFANITGYS++SGLAMGMEPICGQA+GAK+ K 
Sbjct  72    LYSRAMISMVFLGYLGEMELAGGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQLKT  131

Query  412   MGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLL  591
             +GL+LQRT++LLL TS+PI++ W NM+ IL+ C QD++IS  AQ+FI++S+PDL   SLL
Sbjct  132   LGLTLQRTVLLLLSTSLPISLTWLNMKNILLWCGQDQQISSTAQTFIIFSIPDLFLLSLL  191

Query  592   HPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSL  771
             HPLRIYLR+QS+TLPLT+C+A ++++HVP+N+ LVV   +G+ GVA++ VW N N+   L
Sbjct  192   HPLRIYLRTQSITLPLTYCSAISVLLHVPLNFLLVVHFKMGVSGVAIAMVWTNLNLFIFL  251

Query  772   VVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPR  951
               +V FS VYK +W   S +C +G+ SLL LA+P+C SVCLEWWWYELMI+LCGLL NP+
Sbjct  252   SSFVYFSRVYKDSWVPPSTDCLRGWSSLLALAVPNCVSVCLEWWWYELMIILCGLLLNPK  311

Query  952   ATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLA  1131
             +T+ASMG+LIQTT+L+Y+FPSSLS  VSTRVGNELGA RP +A+++ IV L  +  LG+A
Sbjct  312   STIASMGILIQTTALVYVFPSSLSLAVSTRVGNELGANRPAKARISMIVSLACAVALGVA  371

Query  1132  ALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGA  1311
             A+ F   +R+     FT D EI+ LT+  LPI+GLCELGNCPQTTGCG LRG+ARP +GA
Sbjct  372   AMLFTTLMRHRLGRFFTSDREILHLTSIALPIVGLCELGNCPQTTGCGVLRGSARPTVGA  431

Query  1312  KINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRA  1491
              INL  FY VG+PVA  LGF     F GLWLGLLAAQASCA  M+ VL  TDWN Q RRA
Sbjct  432   NINLGSFYLVGMPVAVLLGFVGKMGFPGLWLGLLAAQASCASLMIFVLCTTDWNAQVRRA  491

Query  1492  KELT  1503
              ELT
Sbjct  492   NELT  495



>ref|XP_002888219.1| hypothetical protein ARALYDRAFT_893660 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64478.1| hypothetical protein ARALYDRAFT_893660 [Arabidopsis lyrata subsp. 
lyrata]
Length=532

 Score =   486 bits (1251),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 284/486 (58%), Positives = 360/486 (74%), Gaps = 12/486 (2%)
 Frame = +1

Query  82    CKEKMEAPLISE---ENPKEEDHNHNQTHLSL--------AAKEAKCISDIALPMIVTGL  228
             CK+K     +     +NP   D   N + L L          +E K I  I+ P  +TGL
Sbjct  16    CKDKTHFSKLETCDTDNPHYSDFTDNDS-LDLKRWPTFLEGLEEVKAIGRISGPTAMTGL  74

Query  229   LLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFK  408
             L+Y R+MISMLFLG LG+L LAGGSL+IGFANITGYS++SGL+MGMEPICGQA+GAK+ K
Sbjct  75    LMYSRAMISMLFLGYLGELELAGGSLSIGFANITGYSVISGLSMGMEPICGQAYGAKQMK  134

Query  409   LMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSL  588
             L+GL+LQRT++LLL  S+PI+  W NM RIL+ C QD +I+  AQ F+L+++PDL   SL
Sbjct  135   LLGLTLQRTVLLLLSCSVPISFSWLNMRRILLWCGQDEDIASVAQKFLLFAIPDLFLLSL  194

Query  589   LHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGS  768
             LHPLRIYLR+Q++TLP+T+  A ++++HVP+NY LVV L +G+ GVA++ V  N N+V  
Sbjct  195   LHPLRIYLRTQNITLPVTYSTAVSVLLHVPLNYLLVVKLEMGVAGVAIAMVLTNLNLVVL  254

Query  769   LVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANP  948
             L  +V F+ V+  TW  ++ +  KG+ SLL+LAIP+C SVCLEWWWYE MI+LCGLLANP
Sbjct  255   LSSFVYFTSVHSDTWVPITIDSLKGWSSLLSLAIPTCVSVCLEWWWYEFMIILCGLLANP  314

Query  949   RATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGL  1128
             RATVASMG+LIQTT+L+Y+FPSSLS GVSTR+ NELGA RP +A+++ I+ L  +  LGL
Sbjct  315   RATVASMGILIQTTALVYVFPSSLSLGVSTRISNELGAKRPAKARVSMIISLFCAITLGL  374

Query  1129  AALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLG  1308
              A+ F V VR+ W  +F+ DAEI+ LT+  LPI+GLCELGNCPQTTGCG LRG ARP LG
Sbjct  375   MAMVFAVLVRHHWGRMFSTDAEILQLTSIALPIVGLCELGNCPQTTGCGVLRGCARPTLG  434

Query  1309  AKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARR  1488
             A INL  FYFVG+PVA   GF     F GLWLGLLAAQA+CA  ML  L RTDW  QA R
Sbjct  435   ANINLGSFYFVGMPVAILFGFVFKQGFPGLWLGLLAAQATCASLMLCALLRTDWAVQAER  494

Query  1489  AKELTA  1506
             A+ELT+
Sbjct  495   AEELTS  500



>dbj|BAD43969.1| putative protein [Arabidopsis thaliana]
 dbj|BAD44089.1| putative protein [Arabidopsis thaliana]
Length=532

 Score =   486 bits (1250),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 276/444 (62%), Positives = 345/444 (78%), Gaps = 0/444 (0%)
 Frame = +1

Query  175   KEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggslaigFANITGYSILSGL  354
             +E K I  I  P  +TGLL+Y R+MISMLFLG LG+L LAGGSL+IGFANITGYS++SGL
Sbjct  57    EEVKAIGKIPGPTAMTGLLMYSRAMISMLFLGYLGELELAGGSLSIGFANITGYSVISGL  116

Query  355   AMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDREISM  534
             +MGMEPICGQA+GAK+ KL+GL+LQRT++LLL  S+PI+  W NM RIL+ C QD EIS 
Sbjct  117   SMGMEPICGQAYGAKQMKLLGLTLQRTVLLLLSCSVPISFSWLNMRRILLWCGQDEEISS  176

Query  535   EAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLG  714
              AQ F+L+++PDL   SLLHPLRIYLR+Q++TLP+T+  A ++++HVP+NY LVV L +G
Sbjct  177   VAQQFLLFAIPDLFLLSLLHPLRIYLRTQNITLPVTYSTAVSVLLHVPLNYLLVVKLEMG  236

Query  715   IKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCL  894
             + GVA++ V  N N+V  L  +V F+ V+  TW  ++ +  KG+ +LL+LAIP+C SVCL
Sbjct  237   VAGVAIAMVLTNLNLVVLLSSFVYFTSVHSDTWVPITIDSLKGWSALLSLAIPTCVSVCL  296

Query  895   EWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPG  1074
             EWWWYE MI+LCGLLANPRATVASMG+LIQTT+L+Y+FPSSLS GVSTR+ NELGA RP 
Sbjct  297   EWWWYEFMIILCGLLANPRATVASMGILIQTTALVYVFPSSLSLGVSTRISNELGAKRPA  356

Query  1075  RAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNC  1254
             +A+++ I+ L  +  LGL A+ F V VR+ W  +FT DAEI+ LT+  LPI+GLCELGNC
Sbjct  357   KARVSMIISLFCAIALGLMAMVFAVLVRHHWGRLFTTDAEILQLTSIALPIVGLCELGNC  416

Query  1255  PQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCA  1434
             PQTTGCG LRG ARP LGA INL  FYFVG+PVA   GF     F GLW GLLAAQA+CA
Sbjct  417   PQTTGCGVLRGCARPTLGANINLGSFYFVGMPVAILFGFVFKQGFPGLWFGLLAAQATCA  476

Query  1435  LTMLLVLGRTDWNDQARRAKELTA  1506
               ML  L RTDW  QA RA+ELT+
Sbjct  477   SLMLCALLRTDWKVQAERAEELTS  500



>ref|XP_004135806.1| PREDICTED: multidrug and toxin extrusion protein 2-like, partial 
[Cucumis sativus]
Length=490

 Score =   484 bits (1246),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 260/471 (55%), Positives = 334/471 (71%), Gaps = 29/471 (6%)
 Frame = +1

Query  175   KEAKCISDIALPMIVTGLL---LYCRSMISMLFlgrlgdlslaggslaigFANITGYSIL  345
              EAK +  +A P+++T L+   LY RS++SMLFLG LGDL LA GSLAI FANITGYS+L
Sbjct  12    NEAKSLFSLAFPIVLTALMALILYSRSILSMLFLGHLGDLELAAGSLAIAFANITGYSVL  71

Query  346   SGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNMERILILCRQDRE  525
             SGLA+GMEP+C QAFGA R KL+ L+L R+++ LL +S+PI+ILW N+ +IL+   QD  
Sbjct  72    SGLALGMEPLCSQAFGAHRPKLLCLTLHRSVIFLLVSSLPISILWLNISKILLFLHQDPT  131

Query  526   ISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVVHVPINYFLVVVL  705
             I+  A +++++SLPDL+  S +HP+RIYLR+Q +T PLT  +    + H+PIN  LV   
Sbjct  132   ITKLAHTYLIFSLPDLLCNSFIHPIRIYLRAQGITHPLTLASLAGTIFHLPINLLLVSHF  191

Query  706   NLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYKSLLNLAIPSCAS  885
               GI GVA +S   NF V+  L++Y++ SG++  TW   + EC  G+  LL LA PSC S
Sbjct  192   RFGIAGVAAASAATNFVVLLFLILYIVASGIFVPTWSPPTRECLTGWTPLLKLAAPSCVS  251

Query  886   VCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFGVSTRVGNELGAG  1065
             VCLEWWWYE+MI+LCGLLANP+ATVASMGVLIQTTSLIYIFPSSL F VSTRVGNELGA 
Sbjct  252   VCLEWWWYEIMIILCGLLANPKATVASMGVLIQTTSLIYIFPSSLGFAVSTRVGNELGAN  311

Query  1066  RPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALTAAVLPIIGLCEL  1245
             RPG+AKL+A+V +  + I+G++A TF V++RN+WA IFT D EI+ LT+  LPI+GLCE+
Sbjct  312   RPGKAKLSAVVAVFLAGIMGVSATTFAVSMRNIWARIFTNDLEILRLTSTALPILGLCEI  371

Query  1246  GNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVA-------------GWLGFFAGFD  1386
             GNCPQT GCG LRG+ARP   A+INL  FY VG+PVA              WLG  +   
Sbjct  372   GNCPQTVGCGVLRGSARPSTAARINLSAFYLVGMPVAVGLGLLLGVGFSGLWLGLLSA--  429

Query  1387  FqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDDD  1539
                        Q SCA  ML V+G TDW+ QA R+KELT+ +   + DDDD
Sbjct  430   -----------QVSCAGLMLYVIGSTDWDLQAERSKELTSDVVFGNVDDDD  469



>ref|XP_006412876.1| hypothetical protein EUTSA_v10024865mg [Eutrema salsugineum]
 dbj|BAJ34287.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ54329.1| hypothetical protein EUTSA_v10024865mg [Eutrema salsugineum]
Length=540

 Score =   486 bits (1250),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 265/474 (56%), Positives = 340/474 (72%), Gaps = 4/474 (1%)
 Frame = +1

Query  118   ENPKEEDHNHNQTH----LSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdl  285
             E P + +  H +      +S A  EAK +  +A P+ VT L+LY RS +SM FLGRLGDL
Sbjct  39    EQPTKRNIRHCENRGSPLMSEAVTEAKSLFTLAFPIAVTALVLYLRSAVSMFFLGRLGDL  98

Query  286   slaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIP  465
              LA GSLAI FANITGYS+LSGLA+GMEP+C QAFGA+RFKL+ L+L R +V LL   +P
Sbjct  99    ELAAGSLAIAFANITGYSVLSGLALGMEPLCSQAFGARRFKLLSLTLHRAVVFLLVCCVP  158

Query  466   IAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTF  645
             I++LW N+ +I +   QD +I+  AQ+++++SLPDL+  +LLHP+RIYLR+Q +  P+T 
Sbjct  159   ISVLWLNVAKISVYLHQDPDIAKLAQTYLIFSLPDLLTNTLLHPIRIYLRAQGIIHPVTL  218

Query  646   CAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVS  825
              +    V H+P N FLV  L LG+ GVA++S   N  VV  L++YV  SG++  TW   +
Sbjct  219   ASLSGAVFHLPANLFLVSYLRLGLTGVAIASSVTNLFVVLFLIIYVWASGLHAPTWTDPT  278

Query  826   WECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYI  1005
              +CF+G+  LL LA PSC SVCLEWWWYE+MI+LCGLL NPR+TVA+MGVLIQTTS +Y+
Sbjct  279   RDCFRGWAPLLRLAGPSCVSVCLEWWWYEIMIVLCGLLVNPRSTVAAMGVLIQTTSFLYV  338

Query  1006  FPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQ  1185
             FPSSLSF VSTRVGNELGA RP  AKL+A V +  + + G+ A  F  +VRN W  +FT 
Sbjct  339   FPSSLSFAVSTRVGNELGANRPKTAKLSATVAIVFAVVTGITASAFAYSVRNAWGRVFTG  398

Query  1186  DAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWL  1365
             D EI+ LTAA LPI+GLCE+GNCPQT GCG +RGTARP   A +NL  FY VG+PVA  L
Sbjct  399   DDEILRLTAAALPILGLCEIGNCPQTVGCGVVRGTARPSTAANVNLGAFYLVGMPVAVGL  458

Query  1366  GFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDD  1527
             GF+AG  F GLWLGLLAAQ SCA  M+ V+G TDW  +A +A+ LT   ++  D
Sbjct  459   GFWAGIGFNGLWLGLLAAQISCAGLMMYVVGTTDWELEANKAQTLTCAETVETD  512



>gb|KFK26810.1| hypothetical protein AALP_AA8G296500 [Arabis alpina]
Length=496

 Score =   484 bits (1246),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 282/490 (58%), Positives = 353/490 (72%), Gaps = 6/490 (1%)
 Frame = +1

Query  73    ISACKEKMEAPLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMI  252
             ++  ++++  PL+ +  PK     +    LSL A EA  I+ I+LP+++TGLLLY RS +
Sbjct  4     LNRVRDELTKPLLPKHLPK-----NYSVPLSLFAIEAISIAKISLPLVLTGLLLYFRSFV  58

Query  253   SMLFlgrlgdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQR  432
             S+ FLGRLGD +LAGGSLA  F+NITGYS+ SGL MG+E IC Q FGAKR  L   +++R
Sbjct  59    SLFFLGRLGDATLAGGSLAFAFSNITGYSVFSGLTMGVESICSQTFGAKRHNLFHATIRR  118

Query  433   TIVLLLFTSIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYL  612
              I+LLLFTS+P+ +LW N+E+IL +  QD+++  EA +F+LYS+PDLIAQS LHPLR+YL
Sbjct  119   GIILLLFTSLPVTLLWINIEKILKMMGQDKDLVFEAHTFLLYSVPDLIAQSFLHPLRVYL  178

Query  613   RSQSVTLPLTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVY-VLF  789
             R+QS TL L+ C   A V+H+PI +  V  L LGIKGVALS V  NFN+V  L +Y V F
Sbjct  179   RTQSKTLSLSICTFIASVLHLPITFLFVSYLGLGIKGVALSGVVSNFNIVVFLFIYIVFF  238

Query  790   SGVYKKTWGGVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASM  969
                          +C + +K LL LA+PSC SVCLEWW YE+MIL CG L NP ATVASM
Sbjct  239   KEKLSSEEEISEEDCVREWKKLLVLALPSCLSVCLEWWLYEIMILFCGFLLNPEATVASM  298

Query  970   GVLIQTTSLIYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGV  1149
             G+LIQ TSL+YIFPSSLSFGVSTRVGNELG+ +P RA+ AAIVGL  S  LG  AL F V
Sbjct  299   GILIQITSLVYIFPSSLSFGVSTRVGNELGSNQPQRARRAAIVGLGLSIALGFTALFFTV  358

Query  1150  AVRNVWASIFTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRC  1329
             +VRNVWA +FT D EI+ LT+  LPI+GLCELGNCPQTTGCG LRG ARPK+GA INL  
Sbjct  359   SVRNVWAKLFTNDTEIIWLTSMALPIVGLCELGNCPQTTGCGVLRGCARPKIGANINLAA  418

Query  1330  FYFVGLPVAGWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTAT  1509
             FY VG+PV   + F+ GF F+GLWLG+LAAQ SC   M++ + RT+W  +A RAK LTA 
Sbjct  419   FYAVGMPVGAGMAFWFGFGFKGLWLGMLAAQVSCVSGMMVAMCRTNWELEAERAKVLTAV  478

Query  1510  ISLVDDDDDD  1539
              S  D D +D
Sbjct  479   DSGRDSDGED  488



>ref|XP_009603911.1| PREDICTED: multidrug and toxin extrusion protein 2-like [Nicotiana 
tomentosiformis]
Length=501

 Score =   484 bits (1246),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 266/478 (56%), Positives = 344/478 (72%), Gaps = 4/478 (1%)
 Frame = +1

Query  103   PLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgd  282
             P +   +  +E    ++  +S   +E K +  IALP+I  GLL+Y +SMISMLF+GRLG 
Sbjct  16    PRLKATHAGDEQEQKHRPTISEVVEEIKLLYSIALPIIAAGLLIYGKSMISMLFMGRLGK  75

Query  283   lslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSI  462
              +LAGGSL+IG ANITGYS+LSGLAMGME I  QA GAK++ LMG +LQRTI++LLF+SI
Sbjct  76    EALAGGSLSIGIANITGYSVLSGLAMGMEAISSQACGAKQWPLMGQALQRTILILLFSSI  135

Query  463   PIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLT  642
             PI++LW  +E +L+LC QD  IS  A +++ + LPDL  QSL++PL+IYLR+Q+VT PLT
Sbjct  136   PISLLWLKIEPLLLLCGQDPTISSIASTYLSFCLPDLFFQSLINPLKIYLRTQNVTFPLT  195

Query  643   FCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGV  822
             F AAF++ +H PINYFL+  L LGIKGVA++    +FN++  L +YV  SGV++K+W G 
Sbjct  196   FSAAFSLALHAPINYFLIYHLGLGIKGVAMAVAIADFNLLIVLFLYVSLSGVHRKSWQGW  255

Query  823   SWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIY  1002
             S ECF G++ +L+LAIPSC SVCLEWWWYELMILL G+L N    V++MG+L+Q TSL Y
Sbjct  256   SAECFDGWRPILSLAIPSCISVCLEWWWYELMILLSGVLFNAAEAVSTMGILLQATSLAY  315

Query  1003  IFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFT  1182
             IFPS+LS  VS RVGNELGA RP +AK +  V +  +      A+ F   +RN W  +FT
Sbjct  316   IFPSALSLAVSARVGNELGANRPSKAKTSCHVAVLCAIFTSFVAMLFMTTLRNAWGKVFT  375

Query  1183  QDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGW  1362
              D  I++LTAA +P++GLCELGNCPQTTGCGALRG+ARP L   INL  FY VGLP+A  
Sbjct  376   DDEAILSLTAAAMPVVGLCELGNCPQTTGCGALRGSARPALAVHINLGSFYGVGLPLAIV  435

Query  1363  LGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDD  1536
             LGF       GL +GLLAAQA CA  M+ VL RTDW  QA RA+EL      +D++D 
Sbjct  436   LGFVMKMGLLGLCMGLLAAQAVCAFLMIFVLSRTDWLMQAERARELIG----MDEEDK  489



>gb|KFK40898.1| hypothetical protein AALP_AA2G057700 [Arabis alpina]
Length=528

 Score =   485 bits (1248),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 281/470 (60%), Positives = 354/470 (75%), Gaps = 6/470 (1%)
 Frame = +1

Query  112   SEENPKEEDH-----NHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrl  276
                NP   D+     N   T L    +E K I  I+ P  +TGLL+Y R+MISMLFLG L
Sbjct  28    DSNNPHYSDNDFPDLNRWPTFLE-GLEEVKAIGRISGPTAMTGLLMYSRAMISMLFLGYL  86

Query  277   gdlslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFT  456
             G+L LAGGSL+IGFANITGYS++SGL+MGMEPICGQA+GAK+ KL+GL+LQRT++LLL  
Sbjct  87    GELELAGGSLSIGFANITGYSVISGLSMGMEPICGQAYGAKQMKLLGLTLQRTVLLLLSC  146

Query  457   SIPIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLP  636
             S+PI+  W NM RIL+ C QD EIS  AQ+F+L+++PDL   SLLHPLR+YLR+Q++TLP
Sbjct  147   SVPISFSWLNMRRILLWCGQDEEISSVAQNFLLFAIPDLFLLSLLHPLRVYLRTQNITLP  206

Query  637   LTFCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWG  816
             +T+  A ++++H P+N+ LVV L +G+ GVA++ V  N N+V  L  +V F+ V+  TW 
Sbjct  207   VTYSTAVSVLLHFPLNFLLVVKLEMGVAGVAIAMVLTNLNLVVLLSSFVYFTSVHSDTWV  266

Query  817   GVSWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSL  996
              ++ +  KG+ SLL+LAIP+C SVCLEWWWYE MI+LCGLLANPRATVASMG+LIQTT+L
Sbjct  267   PLTVDSLKGWSSLLSLAIPTCISVCLEWWWYEFMIILCGLLANPRATVASMGILIQTTAL  326

Query  997   IYIFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASI  1176
             +Y+FPSSLS GVSTR+ NELGA RP +A+++ I+ L  +  LGL A+ F V VR+ W  +
Sbjct  327   VYVFPSSLSLGVSTRISNELGAKRPAKARVSMIISLFCATALGLMAMVFTVVVRHCWGRL  386

Query  1177  FTQDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVA  1356
             FT DAEI+ LT+  LPIIGLCELGNCPQTTGCG LRG ARP LGA INL  FYFVG+PVA
Sbjct  387   FTTDAEILELTSIALPIIGLCELGNCPQTTGCGVLRGCARPTLGANINLGSFYFVGMPVA  446

Query  1357  GWLGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTA  1506
               LGF     F G WLGLLAAQA+CA  M   L RTDW  QA+RA+ELT+
Sbjct  447   ILLGFIFKIGFPGFWLGLLAAQATCATLMFCALLRTDWAVQAQRAEELTS  496



>gb|KHN15680.1| Multidrug and toxin extrusion protein 1 [Glycine soja]
Length=517

 Score =   484 bits (1245),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 284/476 (60%), Positives = 351/476 (74%), Gaps = 44/476 (9%)
 Frame = +1

Query  121   NPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslagg  300
             + ++ D    QTH  +  KE   I  IA PMI+TGLLLYCRSMISMLFLGRLG+L+LAGG
Sbjct  48    HEEKNDPRTMQTHHHVL-KELISICKIAFPMILTGLLLYCRSMISMLFLGRLGELALAGG  106

Query  301   slaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILW  480
             SLA+GFANI+GY +                  +  +  G+ L+ ++              
Sbjct  107   SLAVGFANISGYPL------------------RPRRRNGIHLRTSL--------------  134

Query  481   CNMERILILCRQDREISMEAQSFI-LYSLPDL--IAQSLLHP-LRIYLRSQSVTLPLTFC  648
                +++L      R +  +  S   L+  P+L  +A    +P + IYLRSQS+TLPLT C
Sbjct  135   -RCQKVL----PPRPLLTKNHSLAPLHLYPNLSPLALHEAYPSIIIYLRSQSITLPLTLC  189

Query  649   AAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSW  828
             A F+I++H+PINY LV  LN GIKGVALS VW N N+V SL++Y++FSG +KKTWGG S+
Sbjct  190   ATFSILLHIPINYLLVSHLNWGIKGVALSGVWTNLNLVASLILYIVFSGTHKKTWGGFSF  249

Query  829   ECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIF  1008
             ECF  +KSLLNLAIPSC SVCLEWWWYE+MILLCGLL NPRATVASMG+LIQTTSL+YIF
Sbjct  250   ECFTQWKSLLNLAIPSCISVCLEWWWYEIMILLCGLLVNPRATVASMGILIQTTSLLYIF  309

Query  1009  PSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQD  1188
             PSS+SF VSTRVGN+LGA +P +AK ++IVGL  SF+LG+ AL F + VRN+WA++FTQD
Sbjct  310   PSSISFSVSTRVGNKLGAQKPSKAKFSSIVGLSCSFMLGVFALVFTILVRNIWANMFTQD  369

Query  1189  AEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLG  1368
              EI+ LT+ VLP+IGLCELGNCPQTTGCG LRGTARPK+GA INL CFY VG+PVA WLG
Sbjct  370   KEIITLTSFVLPVIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGMPVAVWLG  429

Query  1369  FFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDD  1536
             FFAGFDFQGLWLGLLAAQ SCA+TML+VL RTDW+ +A RAK+LT+ +  VDD  +
Sbjct  430   FFAGFDFQGLWLGLLAAQGSCAVTMLVVLSRTDWDAEALRAKKLTSVV--VDDSKE  483



>ref|XP_009774724.1| PREDICTED: multidrug and toxin extrusion protein 2-like [Nicotiana 
sylvestris]
Length=498

 Score =   482 bits (1240),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 265/479 (55%), Positives = 343/479 (72%), Gaps = 4/479 (1%)
 Frame = +1

Query  103   PLISEENPKEEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgd  282
             P +   +  +E    ++  +S   +E K +  IALP+I  GLL+Y +SMISMLF+GRLG 
Sbjct  16    PRLKATHAGDEQGQKHRPTISEVVEEIKLLYSIALPIIAAGLLIYGKSMISMLFMGRLGK  75

Query  283   lslaggslaigFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSI  462
              +LAGGSL+IG ANITGYS+LSGLAMGME I  QA GAK++ LMG +LQRTI++LLF+SI
Sbjct  76    EALAGGSLSIGIANITGYSVLSGLAMGMEAISSQACGAKQWPLMGQALQRTILILLFSSI  135

Query  463   PIAILWCNMERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLT  642
             PI++LW  ME +L+ C QD  IS  A +++ + LPDL  QSL++PL+IYLR+Q+VT PLT
Sbjct  136   PISLLWLKMEPLLLFCGQDPTISSIASTYLSFCLPDLFFQSLINPLKIYLRTQNVTFPLT  195

Query  643   FCAAFAIVVHVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGV  822
             F AAF++ +H PINYFL+  L LGIKGVA++    +FN++  L +YV+ S V++K+W G 
Sbjct  196   FSAAFSLALHAPINYFLIYHLGLGIKGVAMAVAIADFNLLIVLFLYVILSDVHRKSWQGW  255

Query  823   SWECFKGYKSLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIY  1002
             S ECF G++ +L+LAIPSC SVCLEWWWYELMILL G+L N    V++MG+L+Q TSL Y
Sbjct  256   SAECFDGWRPILSLAIPSCISVCLEWWWYELMILLSGVLFNAAEAVSTMGILLQATSLAY  315

Query  1003  IFPSSLSFGVSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFT  1182
             IFPS+LS  VSTRVGNELGA RP +AK +  V +  +      A+ F   +RN W  +FT
Sbjct  316   IFPSALSLAVSTRVGNELGANRPNKAKTSCHVAVLCAIFTSFIAMLFMTTLRNAWGKVFT  375

Query  1183  QDAEIMALTAAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGW  1362
              D  I++LTA  +P++GLCELGNCPQTTGCGALRG+ARP L   INL  FY VGLP+A  
Sbjct  376   DDEAILSLTAVAMPVVGLCELGNCPQTTGCGALRGSARPALAVHINLGSFYGVGLPLAIV  435

Query  1363  LGFFAGFDFqglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTATISLVDDDDDD  1539
             LGF       GL +GLLAAQA CA  M+ VL RTDW  QA RA+EL      +D  +D+
Sbjct  436   LGFVMKMGLLGLCMGLLAAQAVCAFLMIFVLSRTDWLMQAERARELIG----MDKTEDE  490



>ref|XP_009113320.1| PREDICTED: MATE efflux family protein 5 [Brassica rapa]
 emb|CDY48840.1| BnaA09g14730D [Brassica napus]
Length=532

 Score =   483 bits (1243),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 277/459 (60%), Positives = 349/459 (76%), Gaps = 1/459 (0%)
 Frame = +1

Query  130   EEDHNHNQTHLSLAAKEAKCISDIALPMIVTGLLLYCRSMISMLFlgrlgdlslaggsla  309
               D N   T L    +E K I  I+ P  +TGLL+Y R+MISMLFLG LG+L LAGGSL+
Sbjct  43    SRDLNRWPTFLE-GLEEVKAIGRISGPTAMTGLLMYSRAMISMLFLGYLGELELAGGSLS  101

Query  310   igFANITGYSILSGLAMGMEPICGQAFGAKRFKLMGLSLQRTIVLLLFTSIPIAILWCNM  489
             IGFANITGYS++SGL+MGMEPICGQA+GAK+ KL+GL+LQRT++LLL  S+PI+  W NM
Sbjct  102   IGFANITGYSVISGLSMGMEPICGQAYGAKQMKLLGLTLQRTVLLLLSCSVPISFSWLNM  161

Query  490   ERILILCRQDREISMEAQSFILYSLPDLIAQSLLHPLRIYLRSQSVTLPLTFCAAFAIVV  669
              +IL+ C QD EIS  AQ F+L+++PDL   SLLHPLR+YLR+Q++TLP+T+  A ++++
Sbjct  162   RQILLWCGQDEEISSVAQKFLLFAIPDLFLLSLLHPLRVYLRTQNITLPVTYSTAVSVLL  221

Query  670   HVPINYFLVVVLNLGIKGVALSSVWCNFNVVGSLVVYVLFSGVYKKTWGGVSWECFKGYK  849
             HVP+N+  VV L +G+ GVA++ V  N N+V  L  +V F+ V+  TW  ++ +  KG+ 
Sbjct  222   HVPLNFLFVVKLEMGVAGVAIAMVLTNLNLVVLLSSFVYFTSVHSDTWVPLTVDSLKGWS  281

Query  850   SLLNLAIPSCASVCLEWWWYELMILLCGLLANPRATVASMGVLIQTTSLIYIFPSSLSFG  1029
             SLL+LAIP+C SVCLEWWWYE MI+LCGLL NPRATVASMG+LIQTT+L+Y+FPSSLS G
Sbjct  282   SLLSLAIPTCVSVCLEWWWYEFMIILCGLLVNPRATVASMGILIQTTALVYVFPSSLSLG  341

Query  1030  VSTRVGNELGAGRPGRAKLAAIVGLCASFILGLAALTFGVAVRNVWASIFTQDAEIMALT  1209
             VSTR+ NELGA RP +A+++ I+ L  +  LGL A+ F V VR+ W  +FT D EI+ LT
Sbjct  342   VSTRISNELGAKRPAKARVSMIISLFCATALGLMAMVFTVLVRHRWGRLFTTDVEILELT  401

Query  1210  AAVLPIIGLCELGNCPQTTGCGALRGTARPKLGAKINLRCFYFVGLPVAGWLGFFAGFDF  1389
             +  LPI+GLCELGNCPQTTGCG LRG ARP LGA INL  FYFVG+PVA  LGFF    F
Sbjct  402   SIALPIVGLCELGNCPQTTGCGVLRGCARPTLGANINLGSFYFVGMPVAILLGFFFKLGF  461

Query  1390  qglwlgllaaqaSCALTMLLVLGRTDWNDQARRAKELTA  1506
              GLW GLLAAQA+CA  ML  L RTDW  QA RA+ELT+
Sbjct  462   PGLWFGLLAAQATCASLMLFALLRTDWAVQAERAEELTS  500



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4247309536456