BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25553_g1_i2 len=568 path=[3642:0-66 93:67-110 10248:111-151
3487:152-187 3523:188-223 3773:224-304 10358:305-340 9558:341-383
6792:384-474 8700:475-567]

Length=568
                                                                      Score     E

ref|XP_009771130.1|  PREDICTED: serine carboxypeptidase-like 13 i...    206   1e-60   
ref|XP_009771129.1|  PREDICTED: serine carboxypeptidase-like 13 i...    205   2e-60   
ref|XP_009771128.1|  PREDICTED: serine carboxypeptidase-like 13 i...    205   5e-60   
ref|XP_009784016.1|  PREDICTED: serine carboxypeptidase-like 11 i...    197   5e-57   
ref|XP_009626153.1|  PREDICTED: serine carboxypeptidase-like 13         196   1e-56   
ref|XP_006342726.1|  PREDICTED: serine carboxypeptidase-like 11-like    193   1e-55   
gb|AAG52139.1|AC010556_21  putative serine carboxypeptidase; 1519...    192   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177470.4|  serine carboxypeptidase-like 6                        192   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010428248.1|  PREDICTED: serine carboxypeptidase-like 2 is...    191   3e-55   
ref|XP_010428244.1|  PREDICTED: serine carboxypeptidase-like 2 is...    191   5e-55   
ref|NP_177471.1|  serine carboxypeptidase-like 3                        190   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009612197.1|  PREDICTED: serine carboxypeptidase-like 11 i...    191   2e-54   
ref|XP_002888921.1|  hypothetical protein ARALYDRAFT_476459             189   2e-54   
gb|AAG30990.1|AC012396_26  serine carboxypeptidase, putative            187   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177473.1|  serine carboxypeptidase-like 2                        188   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010416123.1|  PREDICTED: serine carboxypeptidase-like 2          188   1e-53   
ref|NP_177474.1|  serine carboxypeptidase-like 4                        187   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010314600.1|  PREDICTED: serine carboxypeptidase-like 11         188   2e-53   
ref|XP_006390568.1|  hypothetical protein EUTSA_v10018572mg             186   5e-53   
ref|NP_001031402.1|  serine carboxypeptidase-like 13                    185   6e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878649.1|  hypothetical protein ARALYDRAFT_481165             185   7e-53   
ref|NP_001077947.1|  serine carboxypeptidase-like 13                    185   8e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301868.1|  hypothetical protein CARUB_v10022339mg             186   8e-53   
ref|NP_179881.3|  serine carboxypeptidase-like 13                       185   9e-53   Arabidopsis thaliana [mouse-ear cress]
sp|Q9CAU2.2|SCP5_ARATH  RecName: Full=Serine carboxypeptidase-lik...    185   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031401.1|  serine carboxypeptidase-like 11                    182   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177472.1|  serine carboxypeptidase-like 5                        185   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878643.1|  SCPL12                                             184   1e-52   
ref|NP_850033.1|  serine carboxypeptidase-like 12                       184   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179876.1|  serine carboxypeptidase-like 12                       185   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009104817.1|  PREDICTED: serine carboxypeptidase-like 2 is...    184   2e-52   
emb|CDP17658.1|  unnamed protein product                                185   2e-52   
ref|XP_009104821.1|  PREDICTED: serine carboxypeptidase-like 2 is...    185   2e-52   
ref|XP_009104820.1|  PREDICTED: serine carboxypeptidase-like 2 is...    184   2e-52   
ref|XP_010464720.1|  PREDICTED: serine carboxypeptidase-like 7          184   3e-52   
ref|XP_010314652.1|  PREDICTED: serine carboxypeptidase-like 11         187   3e-52   
emb|CDY09545.1|  BnaC05g23740D                                          184   3e-52   
ref|XP_010320198.1|  PREDICTED: serine carboxypeptidase-like 17         185   3e-52   
gb|AAN60354.1|  unknown                                                 183   4e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010555479.1|  PREDICTED: serine carboxypeptidase-like 7          184   4e-52   
ref|XP_006404748.1|  hypothetical protein EUTSA_v10000461mg             182   5e-52   
ref|NP_198467.2|  serine carboxypeptidase-like 1                        183   6e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484310.1|  PREDICTED: serine carboxypeptidase-like 7          183   7e-52   
ref|NP_001077945.1|  serine carboxypeptidase-like 11                    183   7e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010555764.1|  PREDICTED: serine carboxypeptidase-like 18         186   8e-52   
ref|XP_006407566.1|  hypothetical protein EUTSA_v10020743mg             183   8e-52   
ref|XP_010471386.1|  PREDICTED: serine carboxypeptidase-like 2          183   9e-52   
ref|XP_006303239.1|  hypothetical protein CARUB_v10012575mg             183   9e-52   
ref|NP_179880.1|  serine carboxypeptidase-like 11                       182   1e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006356866.1|  PREDICTED: uncharacterized protein LOC102592829    188   1e-51   
dbj|BAA96893.1|  serine carboxypeptidase                                184   1e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509544.1|  PREDICTED: serine carboxypeptidase-like 9 is...    181   1e-51   
ref|XP_009115052.1|  PREDICTED: serine carboxypeptidase-like 14         182   1e-51   
emb|CDY02322.1|  BnaA09g25800D                                          182   2e-51   
ref|XP_006415270.1|  hypothetical protein EUTSA_v10009366mg             182   2e-51   
ref|XP_006345611.1|  PREDICTED: serine carboxypeptidase-like 19-like    181   2e-51   
ref|XP_009761854.1|  PREDICTED: serine carboxypeptidase-like 18         182   2e-51   
ref|NP_187656.1|  serine carboxypeptidase-like 7                        182   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297701.1|  hypothetical protein CARUB_v10013730mg             182   2e-51   
gb|AAM64902.1|  serine carboxypeptidase, putative                       176   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010426467.1|  PREDICTED: serine carboxypeptidase-like 7          182   2e-51   
emb|CDY11114.1|  BnaC06g23660D                                          181   3e-51   
ref|XP_006342727.1|  PREDICTED: uncharacterized protein LOC102585123    187   3e-51   
ref|XP_010461188.1|  PREDICTED: serine carboxypeptidase-like 18         182   3e-51   
ref|XP_009146838.1|  PREDICTED: serine carboxypeptidase-like 7 is...    181   3e-51   
ref|XP_009104816.1|  PREDICTED: serine carboxypeptidase-like 2          181   3e-51   
emb|CDY08603.1|  BnaA05g28390D                                          181   3e-51   
emb|CDY00943.1|  BnaC05g42570D                                          181   4e-51   
ref|XP_006297708.1|  hypothetical protein CARUB_v10013737mg             181   4e-51   
ref|XP_006345532.1|  PREDICTED: serine carboxypeptidase-like 18-l...    178   5e-51   
ref|XP_006356850.1|  PREDICTED: serine carboxypeptidase-like 18-like    181   6e-51   
ref|XP_009131551.1|  PREDICTED: serine carboxypeptidase-like 7 is...    181   6e-51   
ref|XP_010509542.1|  PREDICTED: serine carboxypeptidase-like 9 is...    181   6e-51   
emb|CDY68040.1|  BnaAnng25990D                                          180   7e-51   
ref|XP_010509543.1|  PREDICTED: serine carboxypeptidase-like 9 is...    181   7e-51   
ref|XP_006407354.1|  hypothetical protein EUTSA_v10022069mg             180   7e-51   
ref|XP_009131550.1|  PREDICTED: serine carboxypeptidase-like 7 is...    181   7e-51   
ref|XP_009104819.1|  PREDICTED: serine carboxypeptidase-like 2 is...    179   7e-51   
ref|NP_001077946.1|  serine carboxypeptidase-like 13                    180   7e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009104818.1|  PREDICTED: serine carboxypeptidase-like 2 is...    179   8e-51   
ref|XP_010498752.1|  PREDICTED: serine carboxypeptidase-like 16         180   9e-51   
ref|XP_010464977.1|  PREDICTED: serine carboxypeptidase-like 16         180   9e-51   
emb|CDX83199.1|  BnaA03g23070D                                          174   1e-50   
ref|XP_006345531.1|  PREDICTED: serine carboxypeptidase-like 18-l...    179   1e-50   
emb|CDX78700.1|  BnaA03g06120D                                          180   1e-50   
ref|XP_009120840.1|  PREDICTED: serine carboxypeptidase-like 15         180   1e-50   
gb|KFK38432.1|  hypothetical protein AALP_AA3G112600                    180   1e-50   
emb|CDX68232.1|  BnaA07g22720D                                          180   1e-50   
ref|XP_006415429.1|  hypothetical protein EUTSA_v10007675mg             179   1e-50   
ref|XP_009768014.1|  PREDICTED: serine carboxypeptidase-like 17         180   1e-50   
ref|XP_002878648.1|  SCPL11                                             179   1e-50   
ref|NP_973517.1|  serine carboxypeptidase-like 9                        179   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415266.1|  hypothetical protein EUTSA_v10007559mg             180   2e-50   
ref|NP_179884.1|  serine carboxypeptidase-like 9                        179   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297707.1|  hypothetical protein CARUB_v10013735mg             179   2e-50   
ref|XP_009114926.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    180   2e-50   
gb|KFK38585.1|  hypothetical protein AALP_AA3G132800                    179   2e-50   
ref|XP_006404766.1|  hypothetical protein EUTSA_v10000651mg             179   2e-50   
ref|XP_006415268.1|  hypothetical protein EUTSA_v10007570mg             180   2e-50   
ref|XP_006401830.1|  hypothetical protein EUTSA_v10015511mg             178   2e-50   
ref|XP_010464978.1|  PREDICTED: serine carboxypeptidase-like 14         179   2e-50   
ref|XP_010515304.1|  PREDICTED: serine carboxypeptidase-like 7          179   3e-50   
ref|XP_004238557.1|  PREDICTED: uncharacterized protein LOC101252581    184   3e-50   
ref|XP_002882669.1|  hypothetical protein ARALYDRAFT_478377             179   3e-50   
ref|XP_009102688.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    179   3e-50   
emb|CDY30277.1|  BnaC04g31880D                                          179   4e-50   
ref|XP_006296383.1|  hypothetical protein CARUB_v10025556mg             178   4e-50   
ref|XP_010472296.1|  PREDICTED: serine carboxypeptidase-like 11 i...    178   4e-50   
gb|KFK27800.1|  hypothetical protein AALP_AA8G430800                    185   4e-50   
ref|XP_006294236.1|  hypothetical protein CARUB_v10023233mg             178   5e-50   
gb|KFK27799.1|  hypothetical protein AALP_AA8G430800                    184   5e-50   
ref|NP_174619.1|  serine carboxypeptidase-like 18                       178   5e-50   Arabidopsis thaliana [mouse-ear cress]
gb|KFK27798.1|  hypothetical protein AALP_AA8G430800                    184   5e-50   
ref|NP_566414.3|  serine carboxypeptidase-like 16                       178   5e-50   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44962.1|  hypothetical protein AALP_AA1G326200                    179   5e-50   
ref|XP_010503611.1|  PREDICTED: serine carboxypeptidase-like 7          178   6e-50   
sp|Q9C7Z9.2|SCP18_ARATH  RecName: Full=Serine carboxypeptidase-li...    178   6e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884894.1|  hypothetical protein ARALYDRAFT_897434             178   6e-50   
ref|XP_010486655.1|  PREDICTED: serine carboxypeptidase-like 7 is...    178   7e-50   
ref|XP_010320345.1|  PREDICTED: serine carboxypeptidase-like 10 i...    176   9e-50   
emb|CDX70702.1|  BnaC03g07860D                                          177   1e-49   
emb|CDX68234.1|  BnaA07g22740D                                          177   1e-49   
ref|XP_006403279.1|  hypothetical protein EUTSA_v10003211mg             176   1e-49   
ref|XP_002283413.1|  PREDICTED: serine carboxypeptidase-like 2          178   1e-49   Vitis vinifera
ref|XP_010429230.1|  PREDICTED: serine carboxypeptidase-like 11 i...    177   1e-49   
ref|XP_006295774.1|  hypothetical protein CARUB_v10024896mg             177   1e-49   
emb|CDX77573.1|  BnaA07g07110D                                          177   1e-49   
emb|CDY53115.1|  BnaCnng24430D                                          177   1e-49   
ref|XP_010505113.1|  PREDICTED: serine carboxypeptidase-like 9 is...    177   1e-49   
ref|XP_010505114.1|  PREDICTED: serine carboxypeptidase-like 9 is...    177   1e-49   
ref|XP_010505112.1|  PREDICTED: serine carboxypeptidase-like 9 is...    177   1e-49   
emb|CBI19380.3|  unnamed protein product                                178   1e-49   
gb|KFK39469.1|  hypothetical protein AALP_AA3G248300                    177   1e-49   
ref|XP_009601001.1|  PREDICTED: serine carboxypeptidase-like 7 is...    177   1e-49   
ref|XP_009600999.1|  PREDICTED: serine carboxypeptidase-like 7 is...    177   1e-49   
ref|XP_006299183.1|  hypothetical protein CARUB_v10015328mg             177   1e-49   
gb|KFK39468.1|  hypothetical protein AALP_AA3G248300                    177   2e-49   
ref|XP_009139974.1|  PREDICTED: serine carboxypeptidase-like 13 i...    175   2e-49   
ref|XP_006296372.1|  hypothetical protein CARUB_v10025545mg             176   2e-49   
ref|XP_006403280.1|  hypothetical protein EUTSA_v10003211mg             176   2e-49   
ref|XP_010417053.1|  PREDICTED: serine carboxypeptidase-like 9          176   2e-49   
emb|CDY44586.1|  BnaA04g10040D                                          177   3e-49   
ref|XP_006403281.1|  hypothetical protein EUTSA_v10003211mg             176   3e-49   
emb|CDY52617.1|  BnaCnng22960D                                          181   3e-49   
ref|XP_010509548.1|  PREDICTED: serine carboxypeptidase-like 9 is...    176   4e-49   
ref|XP_010509547.1|  PREDICTED: serine carboxypeptidase-like 9 is...    176   4e-49   
ref|NP_187831.1|  serine carboxypeptidase-like 14                       176   4e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187828.1|  serine carboxypeptidase-like 17                       176   4e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010321496.1|  PREDICTED: serine carboxypeptidase-like 13 i...    176   4e-49   
gb|KFK25893.1|  hypothetical protein AALP_AA8G176200                    174   4e-49   
emb|CDP17360.1|  unnamed protein product                                177   4e-49   
ref|XP_010321495.1|  PREDICTED: serine carboxypeptidase-like 13 i...    176   4e-49   
dbj|BAB03132.1|  serine carboxypeptidase                                176   4e-49   Arabidopsis thaliana [mouse-ear cress]
emb|CDY50563.1|  BnaA01g30770D                                          180   5e-49   
ref|XP_010417054.1|  PREDICTED: serine carboxypeptidase-like 9          176   5e-49   
emb|CDX69437.1|  BnaA10g17860D                                          176   5e-49   
ref|XP_006299292.1|  hypothetical protein CARUB_v10015451mg             176   5e-49   
gb|KDO81469.1|  hypothetical protein CISIN_1g012276mg                   173   5e-49   
ref|XP_010484511.1|  PREDICTED: serine carboxypeptidase-like 7          170   6e-49   
ref|XP_010429238.1|  PREDICTED: serine carboxypeptidase-like 9          175   6e-49   
ref|XP_010472299.1|  PREDICTED: serine carboxypeptidase-like 10 i...    175   6e-49   
ref|XP_009139971.1|  PREDICTED: serine carboxypeptidase-like 13 i...    175   6e-49   
ref|XP_010320342.1|  PREDICTED: serine carboxypeptidase-like 10 i...    176   6e-49   
emb|CDP01265.1|  unnamed protein product                                176   7e-49   
ref|XP_010320337.1|  PREDICTED: serine carboxypeptidase-like 13 i...    176   7e-49   
ref|XP_009139927.1|  PREDICTED: serine carboxypeptidase-like 7 is...    175   7e-49   
ref|XP_009139928.1|  PREDICTED: serine carboxypeptidase-like 7 is...    175   7e-49   
ref|XP_010472298.1|  PREDICTED: serine carboxypeptidase-like 10 i...    175   7e-49   
ref|XP_009121469.1|  PREDICTED: serine carboxypeptidase-like 7          176   7e-49   
ref|XP_009140442.1|  PREDICTED: serine carboxypeptidase-like 13 i...    175   8e-49   
ref|XP_010474419.1|  PREDICTED: serine carboxypeptidase-like 9          175   9e-49   
emb|CDX89533.1|  BnaC04g35520D                                          176   9e-49   
ref|XP_009139930.1|  PREDICTED: serine carboxypeptidase-like 7 is...    176   1e-48   
ref|XP_009140440.1|  PREDICTED: serine carboxypeptidase-like 13 i...    174   1e-48   
emb|CDY38920.1|  BnaA04g13410D                                          175   1e-48   
ref|XP_006294243.1|  hypothetical protein CARUB_v10023242mg             174   1e-48   
ref|XP_010556471.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    174   1e-48   
ref|XP_011006024.1|  PREDICTED: serine carboxypeptidase-like 3 is...    175   1e-48   
emb|CDY49438.1|  BnaA09g42290D                                          174   2e-48   
ref|XP_006472320.1|  PREDICTED: serine carboxypeptidase-like 18-l...    175   2e-48   
ref|XP_010429242.1|  PREDICTED: serine carboxypeptidase-like 10 i...    174   2e-48   
ref|XP_010465794.1|  PREDICTED: serine carboxypeptidase-like 16         174   2e-48   
ref|XP_011006023.1|  PREDICTED: serine carboxypeptidase-like 3 is...    175   2e-48   
emb|CDP21040.1|  unnamed protein product                                175   2e-48   
ref|XP_010429240.1|  PREDICTED: serine carboxypeptidase-like 10 i...    174   2e-48   
ref|XP_007018461.1|  Serine carboxypeptidase-like 7, putative           174   2e-48   
ref|XP_006376417.1|  serine carboxypeptidase S10 family protein         174   2e-48   
ref|XP_010429239.1|  PREDICTED: serine carboxypeptidase-like 10 i...    174   2e-48   
emb|CDP21038.1|  unnamed protein product                                174   3e-48   
ref|XP_002893774.1|  hypothetical protein ARALYDRAFT_890934             174   3e-48   
ref|XP_003604930.1|  Serine carboxypeptidase family protein             179   3e-48   
ref|XP_009103431.1|  PREDICTED: serine carboxypeptidase-like 10         173   3e-48   
emb|CDY59210.1|  BnaA09g54030D                                          174   3e-48   
ref|XP_006415267.1|  hypothetical protein EUTSA_v10007571mg             174   4e-48   
ref|XP_009365383.1|  PREDICTED: serine carboxypeptidase-like 13         174   4e-48   
ref|XP_010486652.1|  PREDICTED: serine carboxypeptidase-like 7 is...    173   4e-48   
emb|CDX72978.1|  BnaC06g34260D                                          173   5e-48   
ref|XP_006433655.1|  hypothetical protein CICLE_v10001060mg             173   5e-48   
ref|XP_004238067.1|  PREDICTED: uncharacterized protein LOC101252078    177   5e-48   
emb|CDX76889.1|  BnaC08g34750D                                          173   5e-48   
gb|KDO81468.1|  hypothetical protein CISIN_1g012276mg                   173   5e-48   
emb|CDY49647.1|  BnaC09g41250D                                          172   6e-48   
ref|XP_010419275.1|  PREDICTED: serine carboxypeptidase-like 10         174   6e-48   
ref|XP_006294237.1|  hypothetical protein CARUB_v10023234mg             172   7e-48   
ref|XP_010472301.1|  PREDICTED: serine carboxypeptidase-like 9 is...    174   7e-48   
ref|XP_010472300.1|  PREDICTED: serine carboxypeptidase-like 9 is...    173   7e-48   
ref|XP_010464718.1|  PREDICTED: serine carboxypeptidase-like 7 is...    172   7e-48   
gb|AAG51076.1|AC069472_16  serine carboxypeptidase, putative; 295...    172   9e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009105992.1|  PREDICTED: serine carboxypeptidase-like 2 is...    172   9e-48   
ref|XP_004292764.1|  PREDICTED: serine carboxypeptidase-like 18-like    173   9e-48   
ref|XP_003604932.1|  Serine carboxypeptidase                            172   9e-48   
ref|XP_007018464.1|  Serine carboxypeptidase-like 2, putative           171   1e-47   
ref|NP_187832.2|  serine carboxypeptidase-like 15                       172   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009120797.1|  PREDICTED: serine carboxypeptidase-like 15 i...    172   1e-47   
ref|XP_006343161.1|  PREDICTED: serine carboxypeptidase-like 18-l...    172   1e-47   
emb|CDX96466.1|  BnaA07g30770D                                          172   1e-47   
gb|KFK44963.1|  hypothetical protein AALP_AA1G326300                    172   1e-47   
ref|XP_003604934.1|  Serine carboxypeptidase-like protein               168   1e-47   
ref|XP_009105991.1|  PREDICTED: serine carboxypeptidase-like 2 is...    172   1e-47   
ref|XP_009120828.1|  PREDICTED: serine carboxypeptidase-like 15 i...    171   1e-47   
ref|XP_009120791.1|  PREDICTED: serine carboxypeptidase-like 15 i...    172   1e-47   
ref|XP_010464717.1|  PREDICTED: serine carboxypeptidase-like 7 is...    172   1e-47   
ref|XP_009117322.1|  PREDICTED: serine carboxypeptidase-like 8 is...    170   2e-47   
gb|KDP41600.1|  hypothetical protein JCGZ_16007                         172   2e-47   
ref|XP_010499905.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    172   2e-47   
gb|KCW68631.1|  hypothetical protein EUGRSUZ_F02236                     172   2e-47   
ref|XP_009764359.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    172   2e-47   
ref|XP_006294239.1|  hypothetical protein CARUB_v10023237mg             171   2e-47   
ref|XP_006401829.1|  hypothetical protein EUTSA_v10013495mg             172   2e-47   
ref|XP_006343160.1|  PREDICTED: serine carboxypeptidase-like 18-l...    172   2e-47   
gb|AAK32769.1|AF361601_1  T20K9.20/T20K9.20                             167   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429234.1|  PREDICTED: serine carboxypeptidase-like 12 i...    171   2e-47   
emb|CDX85493.1|  BnaA02g03200D                                          171   2e-47   
emb|CDY52618.1|  BnaCnng22970D                                          171   2e-47   
ref|XP_010556479.1|  PREDICTED: serine carboxypeptidase-like 19         171   2e-47   
ref|XP_003604931.1|  Serine carboxypeptidase                            172   2e-47   
ref|XP_009126130.1|  PREDICTED: serine carboxypeptidase-like 12 i...    171   2e-47   
gb|KFK41349.1|  hypothetical protein AALP_AA2G118800                    171   2e-47   
ref|XP_009120822.1|  PREDICTED: serine carboxypeptidase-like 15 i...    171   2e-47   
ref|XP_010321497.1|  PREDICTED: serine carboxypeptidase-like 12         171   2e-47   
gb|KFK41348.1|  hypothetical protein AALP_AA2G118800                    171   3e-47   
ref|XP_004163541.1|  PREDICTED: serine carboxypeptidase-like 19-like    171   3e-47   
emb|CDX73832.1|  BnaA03g32150D                                          171   3e-47   
ref|XP_010061646.1|  PREDICTED: serine carboxypeptidase-like 2          171   3e-47   
gb|AFK49380.1|  unknown                                                 171   3e-47   
ref|XP_009135217.1|  PREDICTED: serine carboxypeptidase-like 14         171   3e-47   
gb|KFK25883.1|  hypothetical protein AALP_AA8G174700                    171   4e-47   
ref|XP_009117321.1|  PREDICTED: serine carboxypeptidase-like 10 i...    170   5e-47   
emb|CDY50564.1|  BnaA01g30780D                                          170   5e-47   
gb|KFK38584.1|  hypothetical protein AALP_AA3G132700                    175   6e-47   
ref|NP_179883.1|  sinapoylglucose:anthocyanin sinapoyltransferase       170   7e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CDP01266.1|  unnamed protein product                                170   8e-47   
ref|XP_009133994.1|  PREDICTED: serine carboxypeptidase-like 10 i...    169   9e-47   
ref|XP_006354895.1|  PREDICTED: serine carboxypeptidase-like 18-like    170   9e-47   
ref|XP_009133997.1|  PREDICTED: serine carboxypeptidase-like 10 i...    170   1e-46   
ref|XP_010040883.1|  PREDICTED: serine carboxypeptidase-like 18         169   1e-46   
ref|XP_009135216.1|  PREDICTED: serine carboxypeptidase-like 15         169   1e-46   
ref|XP_010108032.1|  Serine carboxypeptidase-like 7                     172   1e-46   
gb|KDP32094.1|  hypothetical protein JCGZ_12555                         170   1e-46   
ref|XP_006356867.1|  PREDICTED: serine carboxypeptidase-like 19-like    173   2e-46   
ref|XP_006296360.1|  hypothetical protein CARUB_v10025532mg             168   2e-46   
emb|CDP20999.1|  unnamed protein product                                167   2e-46   
emb|CDY22581.1|  BnaC05g24190D                                          169   2e-46   
ref|NP_850036.1|  sinapoylglucose:malate sinapoyltransferase            168   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878650.1|  hypothetical protein ARALYDRAFT_481168             168   3e-46   
gb|AES87127.2|  1-O-acylglucose:anthocyanin acyltransferase             169   3e-46   
emb|CDP06925.1|  unnamed protein product                                168   3e-46   
emb|CDP06922.1|  unnamed protein product                                166   3e-46   
emb|CDP06920.1|  unnamed protein product                                165   3e-46   
emb|CDP01267.1|  unnamed protein product                                168   4e-46   
ref|NP_850034.1|  sinapoylglucose:malate sinapoyltransferase            167   5e-46   Arabidopsis thaliana [mouse-ear cress]
gb|KEH29044.1|  1-O-acylglucose:anthocyanin acyltransferase             168   5e-46   
gb|AAC17816.2|  putative serine carboxypeptidase I                      167   5e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006433653.1|  hypothetical protein CICLE_v10001059mg             168   5e-46   
ref|NP_850035.1|  sinapoylglucose:malate sinapoyltransferase            168   6e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002510077.1|  serine carboxypeptidase, putative                  168   7e-46   Ricinus communis
ref|XP_008452664.1|  PREDICTED: serine carboxypeptidase-like 2          168   7e-46   
ref|XP_004252000.2|  PREDICTED: serine carboxypeptidase-like 7          168   9e-46   
ref|XP_002878651.1|  hypothetical protein ARALYDRAFT_900758             167   1e-45   
ref|XP_010028345.1|  PREDICTED: serine carboxypeptidase-like 18         167   1e-45   
ref|XP_003593859.1|  Serine carboxypeptidase-like protein               167   1e-45   
ref|XP_010472297.1|  PREDICTED: serine carboxypeptidase-like 11 i...    166   1e-45   
ref|XP_004165535.1|  PREDICTED: serine carboxypeptidase-like 1-like     167   1e-45   
ref|XP_003593858.1|  Serine carboxypeptidase-like protein               167   1e-45   
ref|XP_004141409.1|  PREDICTED: serine carboxypeptidase-like 1-like     167   1e-45   
gb|KGN55284.1|  hypothetical protein Csa_4G644120                       167   2e-45   
ref|XP_002878652.1|  hypothetical protein ARALYDRAFT_481172             166   2e-45   
ref|XP_010527656.1|  PREDICTED: serine carboxypeptidase-like 2          166   2e-45   
gb|KDO81474.1|  hypothetical protein CISIN_1g012236mg                   166   3e-45   
ref|XP_010277008.1|  PREDICTED: serine carboxypeptidase-like 18 i...    166   3e-45   
ref|XP_009382032.1|  PREDICTED: serine carboxypeptidase-like 7          166   3e-45   
ref|XP_010429231.1|  PREDICTED: serine carboxypeptidase-like 11 i...    165   3e-45   
ref|XP_010277006.1|  PREDICTED: serine carboxypeptidase-like 1 is...    166   4e-45   
ref|XP_002522137.1|  serine carboxypeptidase, putative                  166   4e-45   
dbj|BAF99695.1|  1-O-acylglucose:anthocyanin-O-acyltransferase          166   4e-45   
ref|XP_004165533.1|  PREDICTED: serine carboxypeptidase-like 7-like     164   5e-45   
ref|XP_010556480.1|  PREDICTED: serine carboxypeptidase-like 1          165   5e-45   
emb|CDY00759.1|  BnaC03g37430D                                          159   5e-45   
ref|XP_011006039.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    162   5e-45   
ref|XP_003593861.1|  Serine carboxypeptidase family protein             165   6e-45   
ref|XP_010028339.1|  PREDICTED: serine carboxypeptidase-like 18         165   7e-45   
gb|KEH29042.1|  1-O-acylglucose:anthocyanin acyltransferase             169   7e-45   
emb|CDP18838.1|  unnamed protein product                                164   7e-45   
gb|AES87126.2|  1-O-acylglucose:anthocyanin acyltransferase             169   7e-45   
ref|XP_010320341.1|  PREDICTED: serine carboxypeptidase-like 18 i...    164   8e-45   
ref|XP_003604929.1|  Serine carboxypeptidase                            169   8e-45   
ref|XP_009784017.1|  PREDICTED: serine carboxypeptidase-like 7 is...    165   8e-45   
ref|XP_007159376.1|  hypothetical protein PHAVU_002G233100g             165   8e-45   
ref|XP_010556477.1|  PREDICTED: serine carboxypeptidase-like 18         164   1e-44   
gb|KDO81473.1|  hypothetical protein CISIN_1g012205mg                   163   1e-44   
emb|CDY68233.1|  BnaAnng26570D                                          157   1e-44   
ref|XP_003604927.1|  Serine carboxypeptidase                            166   1e-44   
ref|XP_008452667.1|  PREDICTED: serine carboxypeptidase-like 7 is...    162   2e-44   
gb|KDO81472.1|  hypothetical protein CISIN_1g012205mg                   163   2e-44   
ref|XP_010486651.1|  PREDICTED: serine carboxypeptidase-like 7 is...    164   2e-44   
ref|XP_010320340.1|  PREDICTED: serine carboxypeptidase-like 13 i...    164   2e-44   
ref|XP_003604928.1|  Serine carboxypeptidase                            164   2e-44   
dbj|BAF99696.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    164   2e-44   
ref|XP_006472317.1|  PREDICTED: serine carboxypeptidase-like 18-l...    163   3e-44   
ref|XP_006433654.1|  hypothetical protein CICLE_v10001055mg             163   3e-44   
gb|KDO81471.1|  hypothetical protein CISIN_1g012205mg                   163   3e-44   
gb|KHN45449.1|  Serine carboxypeptidase-like 11                         162   3e-44   
ref|XP_007201135.1|  hypothetical protein PRUPE_ppa016992mg             163   3e-44   
ref|XP_006472315.1|  PREDICTED: serine carboxypeptidase-like 18-l...    163   4e-44   
ref|XP_011100016.1|  PREDICTED: serine carboxypeptidase-like 18 i...    162   4e-44   
ref|XP_008669340.1|  PREDICTED: serine carboxypeptidase-like 7          163   4e-44   
ref|XP_003520964.1|  PREDICTED: serine carboxypeptidase-like 11-like    163   4e-44   
ref|XP_004151544.1|  PREDICTED: serine carboxypeptidase-like 7-like     163   4e-44   
ref|XP_008777952.1|  PREDICTED: serine carboxypeptidase-like 18 i...    157   4e-44   
ref|XP_008452665.1|  PREDICTED: serine carboxypeptidase-like 7 is...    162   5e-44   
ref|XP_010028346.1|  PREDICTED: serine carboxypeptidase-like 18         163   5e-44   
ref|XP_008452666.1|  PREDICTED: serine carboxypeptidase-like 7 is...    162   5e-44   
ref|XP_006472316.1|  PREDICTED: serine carboxypeptidase-like 18-l...    162   5e-44   
emb|CDY38096.1|  BnaC02g06770D                                          163   5e-44   
gb|KDP41601.1|  hypothetical protein JCGZ_16008                         163   6e-44   
ref|XP_004288266.1|  PREDICTED: serine carboxypeptidase-like 18-like    163   6e-44   
gb|AES87130.2|  1-O-acylglucose:anthocyanin acyltransferase             162   6e-44   
ref|XP_006350186.1|  PREDICTED: serine carboxypeptidase-like 18-l...    161   7e-44   
ref|XP_008777951.1|  PREDICTED: serine carboxypeptidase-like 18 i...    157   7e-44   
gb|KGN55283.1|  hypothetical protein Csa_4G643620                       162   7e-44   
ref|XP_011100015.1|  PREDICTED: serine carboxypeptidase-like 7 is...    162   7e-44   
ref|XP_008236294.1|  PREDICTED: serine carboxypeptidase-like 14         162   7e-44   
ref|XP_003604933.1|  Serine carboxypeptidase                            162   7e-44   
ref|XP_006594522.1|  PREDICTED: serine carboxypeptidase-like 12-like    162   8e-44   
ref|XP_011100014.1|  PREDICTED: serine carboxypeptidase-like 18 i...    161   9e-44   
ref|XP_004165534.1|  PREDICTED: serine carboxypeptidase-like 7-like     161   1e-43   
ref|XP_010108033.1|  Serine carboxypeptidase-like 7                     160   2e-43   
ref|XP_007134008.1|  hypothetical protein PHAVU_010G011400g             161   2e-43   
ref|XP_011100013.1|  PREDICTED: serine carboxypeptidase-like 13 i...    161   2e-43   
emb|CBI22421.3|  unnamed protein product                                162   2e-43   
ref|XP_006472322.1|  PREDICTED: serine carboxypeptidase-like 18-like    161   2e-43   
ref|XP_008452662.1|  PREDICTED: serine carboxypeptidase-like 13         161   2e-43   
gb|KCW55082.1|  hypothetical protein EUGRSUZ_I01044                     160   3e-43   
ref|XP_004983497.1|  PREDICTED: serine carboxypeptidase-like 18-like    161   3e-43   
ref|XP_006597032.1|  PREDICTED: uncharacterized protein LOC100794...    160   3e-43   
ref|XP_006399445.1|  hypothetical protein EUTSA_v10015495mg             160   4e-43   
ref|XP_006350185.1|  PREDICTED: serine carboxypeptidase-like 18-l...    160   4e-43   
ref|NP_001242803.1|  uncharacterized protein LOC100794342               160   4e-43   
dbj|BAF56655.1|  serine carboxypeptitase-like protein 1                 160   4e-43   
ref|XP_008452668.1|  PREDICTED: serine carboxypeptidase-like 7          160   5e-43   
ref|XP_011100017.1|  PREDICTED: serine carboxypeptidase-like 13         160   6e-43   
ref|XP_010687793.1|  PREDICTED: serine carboxypeptidase-like 18         154   6e-43   
ref|XP_011088733.1|  PREDICTED: serine carboxypeptidase-like 7          160   6e-43   
emb|CAB89366.1|  carboxypeptidase-like protein                          158   7e-43   
ref|XP_004163543.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    160   7e-43   
ref|XP_002871383.1|  hypothetical protein ARALYDRAFT_487780             160   7e-43   
ref|XP_010028347.1|  PREDICTED: serine carboxypeptidase-like 18         160   7e-43   
ref|XP_010028343.1|  PREDICTED: serine carboxypeptidase-like 18 i...    159   8e-43   
gb|EPS64042.1|  hypothetical protein M569_10739                         152   8e-43   
emb|CDY21591.1|  BnaC09g47010D                                          159   9e-43   
ref|XP_010028342.1|  PREDICTED: serine carboxypeptidase-like 18 i...    159   9e-43   
ref|XP_010030617.1|  PREDICTED: serine carboxypeptidase-like 18         159   9e-43   
gb|KCW55058.1|  hypothetical protein EUGRSUZ_I01033                     158   1e-42   
ref|XP_002269439.1|  PREDICTED: serine carboxypeptidase-like 7          159   1e-42   
ref|XP_006376415.1|  serine carboxypeptidase S10 family protein         159   1e-42   
emb|CBI22419.3|  unnamed protein product                                159   1e-42   
gb|EAY93240.1|  hypothetical protein OsI_15047                          159   1e-42   
ref|XP_008790306.1|  PREDICTED: uncharacterized protein LOC103707552    163   1e-42   
gb|KCW63578.1|  hypothetical protein EUGRSUZ_G01202                     158   1e-42   
gb|KCW63567.1|  hypothetical protein EUGRSUZ_G01195                     158   1e-42   
dbj|BAB09519.1|  serine carboxypeptidase                                158   1e-42   
ref|XP_006399444.1|  hypothetical protein EUTSA_v10016050mg             159   1e-42   
ref|NP_001052165.1|  Os04g0176400                                       159   2e-42   
ref|XP_010028341.1|  PREDICTED: serine carboxypeptidase-like 18 i...    159   2e-42   
gb|AAK52316.1|  sinapoylglucose:choline sinapoyltransferase             159   2e-42   
ref|XP_010647903.1|  PREDICTED: serine carboxypeptidase-like 13         159   2e-42   
ref|XP_009122530.1|  PREDICTED: serine carboxypeptidase-like 19         158   2e-42   
ref|NP_568215.2|  serine carboxypeptidase-like 19                       158   2e-42   
tpg|DAA39922.1|  TPA: hypothetical protein ZEAMMB73_827985              155   2e-42   
ref|XP_010065872.1|  PREDICTED: serine carboxypeptidase-like 2          158   2e-42   
gb|EYU37560.1|  hypothetical protein MIMGU_mgv1a005845mg                158   2e-42   
dbj|BAF99694.1|  1-O-acylglucose:anthocyanin-O-acyltransferase          158   2e-42   
ref|XP_010939018.1|  PREDICTED: serine carboxypeptidase-like 18 i...    157   2e-42   
ref|XP_006399443.1|  hypothetical protein EUTSA_v10015958mg             158   3e-42   
ref|XP_006369725.1|  hypothetical protein POPTR_0001s29900g             157   3e-42   
emb|CDP22282.1|  unnamed protein product                                151   3e-42   
ref|XP_006653168.1|  PREDICTED: serine carboxypeptidase-like 18-like    157   3e-42   
ref|XP_011030311.1|  PREDICTED: serine carboxypeptidase-like 18 i...    157   3e-42   
gb|KCW63576.1|  hypothetical protein EUGRSUZ_G01200                     157   3e-42   
ref|XP_002450678.1|  hypothetical protein SORBIDRAFT_05g009960          156   3e-42   
emb|CDX69895.1|  BnaA10g22440D                                          159   3e-42   
ref|XP_010936153.1|  PREDICTED: serine carboxypeptidase-like 18 i...    157   4e-42   
ref|XP_008452663.1|  PREDICTED: serine carboxypeptidase-like 13         157   4e-42   
ref|XP_011030309.1|  PREDICTED: serine carboxypeptidase-like 18 i...    157   4e-42   
ref|XP_010065865.1|  PREDICTED: serine carboxypeptidase-like 2 is...    157   4e-42   
ref|XP_008452659.1|  PREDICTED: serine carboxypeptidase-like 18 i...    155   4e-42   
emb|CDY11116.1|  BnaC06g23680D                                          160   4e-42   
ref|XP_011030308.1|  PREDICTED: serine carboxypeptidase-like 18 i...    157   5e-42   
ref|XP_010065864.1|  PREDICTED: serine carboxypeptidase-like 2 is...    157   5e-42   
gb|EPS59025.1|  hypothetical protein M569_15786                         150   5e-42   
ref|XP_010936152.1|  PREDICTED: serine carboxypeptidase-like 18 i...    157   5e-42   
ref|XP_008644916.1|  PREDICTED: serine carboxypeptidase-like 18 i...    157   6e-42   
dbj|BAO04183.1|  putative acyl-glucose-dependent anthocyanin acyl...    157   6e-42   
ref|XP_007138067.1|  hypothetical protein PHAVU_009G177800g             157   6e-42   
ref|XP_008644915.1|  PREDICTED: serine carboxypeptidase-like 2 is...    157   6e-42   
ref|XP_011030310.1|  PREDICTED: serine carboxypeptidase-like 18 i...    157   6e-42   
ref|XP_010936150.1|  PREDICTED: serine carboxypeptidase-like 18 i...    157   7e-42   
dbj|BAH89272.1|  putative serine carboxypeptidase-like acyltransf...    157   7e-42   
ref|XP_002298786.2|  hypothetical protein POPTR_0001s29870g             157   7e-42   
gb|EYU37561.1|  hypothetical protein MIMGU_mgv1a005963mg                157   8e-42   
ref|XP_009384628.1|  PREDICTED: serine carboxypeptidase-like 18         157   8e-42   
ref|XP_006369726.1|  hypothetical protein POPTR_0001s29910g             154   8e-42   
ref|XP_011030307.1|  PREDICTED: serine carboxypeptidase-like 18 i...    157   8e-42   
ref|XP_003633199.2|  PREDICTED: serine carboxypeptidase-like 13 i...    156   9e-42   
ref|XP_008452658.1|  PREDICTED: serine carboxypeptidase-like 18 i...    155   1e-41   
ref|XP_010452962.1|  PREDICTED: serine carboxypeptidase-like 19         156   1e-41   
ref|XP_010936155.1|  PREDICTED: serine carboxypeptidase-like 18         156   1e-41   
emb|CDP20368.1|  unnamed protein product                                156   1e-41   
ref|XP_010065879.1|  PREDICTED: serine carboxypeptidase-like 13         156   1e-41   
ref|XP_010491604.1|  PREDICTED: serine carboxypeptidase-like 19         156   1e-41   
ref|XP_010939016.1|  PREDICTED: serine carboxypeptidase-like 18 i...    156   1e-41   
dbj|BAD94430.1|  putative glucose acyltransferase                       152   1e-41   
ref|XP_004975754.1|  PREDICTED: serine carboxypeptidase-like 7-like     156   2e-41   
ref|XP_002265842.1|  PREDICTED: serine carboxypeptidase-like 18         156   2e-41   
ref|XP_010065870.1|  PREDICTED: serine carboxypeptidase-like 13 i...    155   2e-41   
ref|XP_008452657.1|  PREDICTED: serine carboxypeptidase-like 13 i...    155   2e-41   
gb|KCW63573.1|  hypothetical protein EUGRSUZ_G01198                     155   2e-41   
emb|CBI22424.3|  unnamed protein product                                156   2e-41   
ref|XP_010065873.1|  PREDICTED: serine carboxypeptidase-like 2          156   2e-41   
ref|XP_009122528.1|  PREDICTED: serine carboxypeptidase-like 19         155   2e-41   
ref|XP_006486895.1|  PREDICTED: serine carboxypeptidase-like 18-like    156   2e-41   
gb|KEH29043.1|  1-O-acylglucose:anthocyanin acyltransferase             155   2e-41   
gb|KCW63574.1|  hypothetical protein EUGRSUZ_G01198                     155   2e-41   
gb|KCW63571.1|  hypothetical protein EUGRSUZ_G01198                     155   2e-41   
emb|CBI17848.3|  unnamed protein product                                157   2e-41   
ref|XP_010694009.1|  PREDICTED: serine carboxypeptidase-like 7          155   2e-41   
ref|XP_008452656.1|  PREDICTED: serine carboxypeptidase-like 13 i...    155   2e-41   
gb|KCW63570.1|  hypothetical protein EUGRSUZ_G01197                     155   2e-41   
ref|XP_010939014.1|  PREDICTED: serine carboxypeptidase-like 17 i...    155   2e-41   
ref|XP_004486284.1|  PREDICTED: serine carboxypeptidase-like 12-like    155   2e-41   
emb|CAN74923.1|  hypothetical protein VITISV_038590                     156   2e-41   
gb|KDP44530.1|  hypothetical protein JCGZ_16363                         155   2e-41   
ref|XP_010694002.1|  PREDICTED: serine carboxypeptidase-like 10 i...    154   2e-41   
ref|XP_010939015.1|  PREDICTED: serine carboxypeptidase-like 18 i...    155   2e-41   
gb|KHN06942.1|  Serine carboxypeptidase-like 19                         155   3e-41   
ref|XP_010065869.1|  PREDICTED: serine carboxypeptidase-like 2 is...    155   3e-41   
ref|XP_008452655.1|  PREDICTED: serine carboxypeptidase-like 13 i...    155   3e-41   
ref|XP_010065871.1|  PREDICTED: serine carboxypeptidase-like 2 is...    155   3e-41   
ref|XP_010939013.1|  PREDICTED: serine carboxypeptidase-like 18 i...    155   3e-41   
gb|KCW63569.1|  hypothetical protein EUGRSUZ_G01197                     155   3e-41   
ref|XP_010939012.1|  PREDICTED: serine carboxypeptidase-like 17 i...    155   3e-41   
tpg|DAA39921.1|  TPA: Serine carboxypeptidase 1                         155   3e-41   
ref|NP_001151152.1|  serine carboxypeptidase 1 precursor                155   4e-41   
ref|XP_010556476.1|  PREDICTED: serine carboxypeptidase-like 18 i...    154   4e-41   
ref|XP_008790304.1|  PREDICTED: uncharacterized protein LOC103707550    159   4e-41   
emb|CDY11113.1|  BnaC06g23650D                                          154   4e-41   
ref|XP_010556475.1|  PREDICTED: serine carboxypeptidase-like 18 i...    154   4e-41   
ref|XP_010556474.1|  PREDICTED: serine carboxypeptidase-like 18 i...    154   5e-41   
ref|XP_010556473.1|  PREDICTED: serine carboxypeptidase-like 18 i...    154   5e-41   
ref|XP_010694008.1|  PREDICTED: serine carboxypeptidase-like 7 is...    154   6e-41   
ref|XP_010656845.1|  PREDICTED: serine carboxypeptidase-like 13         154   6e-41   
ref|XP_010556472.1|  PREDICTED: serine carboxypeptidase-like 18 i...    154   6e-41   
ref|XP_006651780.1|  PREDICTED: serine carboxypeptidase-like 18-like    154   6e-41   
ref|XP_008790305.1|  PREDICTED: serine carboxypeptidase-like 18         157   7e-41   
ref|XP_010694001.1|  PREDICTED: serine carboxypeptidase-like 10 i...    154   7e-41   
ref|XP_010694007.1|  PREDICTED: serine carboxypeptidase-like 7 is...    154   8e-41   
ref|XP_008236346.1|  PREDICTED: serine carboxypeptidase-like 18         154   8e-41   
ref|XP_010694006.1|  PREDICTED: serine carboxypeptidase-like 7 is...    154   9e-41   
emb|CBI17847.3|  unnamed protein product                                155   9e-41   
ref|XP_003579296.2|  PREDICTED: serine carboxypeptidase-like 2          154   1e-40   
emb|CDY21592.1|  BnaC09g47000D                                          154   1e-40   
ref|XP_010694004.1|  PREDICTED: serine carboxypeptidase-like 7 is...    153   1e-40   
ref|XP_002266354.2|  PREDICTED: serine carboxypeptidase-like 18         154   1e-40   
ref|XP_010048542.1|  PREDICTED: serine carboxypeptidase-like 13         154   1e-40   
ref|XP_010694003.1|  PREDICTED: serine carboxypeptidase-like 7 is...    154   1e-40   
ref|XP_002460078.1|  hypothetical protein SORBIDRAFT_02g022430          153   1e-40   
emb|CBI22420.3|  unnamed protein product                                154   1e-40   
ref|XP_009614132.1|  PREDICTED: serine carboxypeptidase-like 18 i...    153   2e-40   
emb|CDP06914.1|  unnamed protein product                                153   2e-40   
ref|XP_006290031.1|  hypothetical protein CARUB_v10003665mg             153   2e-40   
ref|XP_006422780.1|  hypothetical protein CICLE_v10028349mg             153   2e-40   
ref|XP_008237699.1|  PREDICTED: serine carboxypeptidase-like 2          153   2e-40   
ref|XP_010429235.1|  PREDICTED: serine carboxypeptidase-like 12 i...    152   2e-40   
emb|CDP08178.1|  unnamed protein product                                154   2e-40   
gb|KDP35359.1|  hypothetical protein JCGZ_10343                         147   2e-40   
tpg|DAA37592.1|  TPA: hypothetical protein ZEAMMB73_449749              152   2e-40   
ref|XP_010106919.1|  Serine carboxypeptidase-like 18                    153   2e-40   
ref|XP_007047573.1|  Serine carboxypeptidase-like 2, putative iso...    153   2e-40   
ref|NP_001030669.1|  serine carboxypeptidase-like 7                     152   2e-40   
ref|XP_010422959.1|  PREDICTED: serine carboxypeptidase-like 19         153   2e-40   



>ref|XP_009771130.1| PREDICTED: serine carboxypeptidase-like 13 isoform X3 [Nicotiana 
sylvestris]
Length=411

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 125/162 (77%), Gaps = 2/162 (1%)
 Frame = -3

Query  482  VGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPL  303
            V V P+H  ++ S V+ LPGFEGPLPFHLETGYIGVGE EE+QLFYYF+KSE+ P  DP+
Sbjct  21   VVVLPQHAAASHSTVEFLPGFEGPLPFHLETGYIGVGEYEEVQLFYYFLKSESEPTKDPI  80

Query  302  ILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIG  123
            ++W+SG  GCSS T L+Y+IGPL+F+   YNG+LP L  N  S TK A+IIFLDQ  N G
Sbjct  81   LIWLSGGPGCSSFTALVYQIGPLYFEPNEYNGSLPKLTLNPNSWTKVANIIFLDQPVNSG  140

Query  122  FSYSTNTTT--NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            FSY+T +TT  +TD++A  ++Y+FL+KW  ++Q+F+ NP +I
Sbjct  141  FSYATTSTTFKSTDLQACHHIYQFLRKWLIKHQEFIRNPMYI  182



>ref|XP_009771129.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Nicotiana 
sylvestris]
Length=437

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 125/162 (77%), Gaps = 2/162 (1%)
 Frame = -3

Query  482  VGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPL  303
            V V P+H  ++ S V+ LPGFEGPLPFHLETGYIGVGE EE+QLFYYF+KSE+ P  DP+
Sbjct  21   VVVLPQHAAASHSTVEFLPGFEGPLPFHLETGYIGVGEYEEVQLFYYFLKSESEPTKDPI  80

Query  302  ILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIG  123
            ++W+SG  GCSS T L+Y+IGPL+F+   YNG+LP L  N  S TK A+IIFLDQ  N G
Sbjct  81   LIWLSGGPGCSSFTALVYQIGPLYFEPNEYNGSLPKLTLNPNSWTKVANIIFLDQPVNSG  140

Query  122  FSYSTNTTT--NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            FSY+T +TT  +TD++A  ++Y+FL+KW  ++Q+F+ NP +I
Sbjct  141  FSYATTSTTFKSTDLQACHHIYQFLRKWLIKHQEFIRNPMYI  182



>ref|XP_009771128.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Nicotiana 
sylvestris]
Length=467

 Score =   205 bits (522),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 125/162 (77%), Gaps = 2/162 (1%)
 Frame = -3

Query  482  VGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPL  303
            V V P+H  ++ S V+ LPGFEGPLPFHLETGYIGVGE EE+QLFYYF+KSE+ P  DP+
Sbjct  21   VVVLPQHAAASHSTVEFLPGFEGPLPFHLETGYIGVGEYEEVQLFYYFLKSESEPTKDPI  80

Query  302  ILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIG  123
            ++W+SG  GCSS T L+Y+IGPL+F+   YNG+LP L  N  S TK A+IIFLDQ  N G
Sbjct  81   LIWLSGGPGCSSFTALVYQIGPLYFEPNEYNGSLPKLTLNPNSWTKVANIIFLDQPVNSG  140

Query  122  FSYSTNTTT--NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            FSY+T +TT  +TD++A  ++Y+FL+KW  ++Q+F+ NP +I
Sbjct  141  FSYATTSTTFKSTDLQACHHIYQFLRKWLIKHQEFIRNPMYI  182



>ref|XP_009784016.1| PREDICTED: serine carboxypeptidase-like 11 isoform X1 [Nicotiana 
sylvestris]
Length=474

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 121/151 (80%), Gaps = 2/151 (1%)
 Frame = -3

Query  449  GSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGCS  270
            GS V+ LPGF+GPLPF+LETGYIGVG+SEE+QLFYYFVKSE++P+ DPL+LW++G  GCS
Sbjct  30   GSIVEFLPGFDGPLPFYLETGYIGVGKSEEVQLFYYFVKSESDPRKDPLLLWLTGGPGCS  89

Query  269  SLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN-  93
            S TG+ YE+GPL F  K YNG+LP L+    S TK ASI+FL+Q  N GFSY+T +  + 
Sbjct  90   SFTGVAYEVGPLAFGQKAYNGSLPILVSTPYSWTKFASILFLEQPVNTGFSYATTSAASK  149

Query  92   -TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             TD++A  +VYEFL KWF+ +Q+F+SNPF++
Sbjct  150  CTDLQACDHVYEFLCKWFNNHQEFISNPFYV  180



>ref|XP_009626153.1| PREDICTED: serine carboxypeptidase-like 13 [Nicotiana tomentosiformis]
Length=466

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 127/174 (73%), Gaps = 2/174 (1%)
 Frame = -3

Query  518  LNHFVILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYF  339
            +N F++  +   V + P+H  ++ S V  LPGFEG LPFHLETGYIGVGE EE+QLFYYF
Sbjct  12   INLFLLPLLFYGVVLLPQHTAASHSTVQFLPGFEGRLPFHLETGYIGVGEYEEVQLFYYF  71

Query  338  VKSETNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNA  159
            +KSE+ P  DP+++W+SG  GCSS T L+Y+IGPL+F+   YNG+LP L  N  S TK A
Sbjct  72   LKSESEPTKDPVLVWLSGGPGCSSFTALVYQIGPLYFEPNKYNGSLPKLTLNPNSWTKVA  131

Query  158  SIIFLDQLPNIGFSYSTNTTT--NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            +IIFLDQ  N GFSY+T +TT  +TD++A  ++Y FL+KW  ++ +F+ NP +I
Sbjct  132  NIIFLDQPVNSGFSYATTSTTFKSTDLQACDHIYLFLRKWLIKHPEFIRNPMYI  185



>ref|XP_006342726.1| PREDICTED: serine carboxypeptidase-like 11-like [Solanum tuberosum]
Length=466

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 125/168 (74%), Gaps = 2/168 (1%)
 Frame = -3

Query  500  LAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETN  321
            L  +A + V  + V    S V+ LPGF+GPLPF+LETGYIGV +SEE+QLFYYFVKSE++
Sbjct  4    LLFVATLFVHVQSVPQNSSIVEYLPGFDGPLPFYLETGYIGVAKSEEVQLFYYFVKSESD  63

Query  320  PKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLD  141
            PK DP++LWISG  GCSS TGL+YE+GPL F  K YNG+LP L+    S TK ASIIFLD
Sbjct  64   PKKDPILLWISGGPGCSSFTGLVYEVGPLAFGQKAYNGSLPFLVSRPYSWTKFASIIFLD  123

Query  140  QLPNIGFSYSTNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            +  N GFSY+T +T +  TD++A   VYEFL+KWF  + +F+SN F++
Sbjct  124  EPLNTGFSYATTSTGHNYTDLQACGQVYEFLRKWFINHPEFISNSFYV  171



>gb|AAG52139.1|AC010556_21 putative serine carboxypeptidase; 15190-18301 [Arabidopsis thaliana]
Length=441

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 117/157 (75%), Gaps = 2/157 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H + + S V  LPGFEGPLPF LETGYIGVGE EE+QLFYYF+KSE NPK+DPL+LW++
Sbjct  24   QHHVDSASVVKSLPGFEGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLT  83

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCS+++GL+YE GPL     VYNGTLP+L+    S TKN+S+IFLDQ    GFSYS 
Sbjct  84   GGPGCSAISGLLYENGPLTMKLDVYNGTLPSLVSTTYSWTKNSSMIFLDQPVGTGFSYSR  143

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                N  +D   +K ++EFLQKW  ++Q+F SNPF++
Sbjct  144  TELFNKPSDTGEAKRIHEFLQKWLGKHQEFSSNPFYV  180



>ref|NP_177470.4| serine carboxypeptidase-like 6 [Arabidopsis thaliana]
 sp|Q9CAU0.2|SCP6_ARATH RecName: Full=Serine carboxypeptidase-like 6; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE35436.1| serine carboxypeptidase-like 6 [Arabidopsis thaliana]
Length=452

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 117/157 (75%), Gaps = 2/157 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H + + S V  LPGFEGPLPF LETGYIGVGE EE+QLFYYF+KSE NPK+DPL+LW++
Sbjct  24   QHHVDSASVVKSLPGFEGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLT  83

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCS+++GL+YE GPL     VYNGTLP+L+    S TKN+S+IFLDQ    GFSYS 
Sbjct  84   GGPGCSAISGLLYENGPLTMKLDVYNGTLPSLVSTTYSWTKNSSMIFLDQPVGTGFSYSR  143

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                N  +D   +K ++EFLQKW  ++Q+F SNPF++
Sbjct  144  TELFNKPSDTGEAKRIHEFLQKWLGKHQEFSSNPFYV  180



>ref|XP_010428248.1| PREDICTED: serine carboxypeptidase-like 2 isoform X2 [Camelina 
sativa]
Length=419

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 118/157 (75%), Gaps = 2/157 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +  +++ S V  LPGFEGPLPF LETGYIG+GE EE+QLFYYF+KSE NP++DPL+LW+S
Sbjct  25   QQNVNSASIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSERNPEEDPLLLWLS  84

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS++GL+YE GPL     VYNGTLP+L+    S TK +SIIFLDQ    GFSYS 
Sbjct  85   GGPGCSSISGLLYENGPLKMKLDVYNGTLPSLVSTTYSWTKTSSIIFLDQPVGTGFSYSR  144

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             T +N  +D   +K ++EFLQKW  ++Q+F SNPF++
Sbjct  145  TTQSNKPSDSGEAKRIHEFLQKWLGKHQEFSSNPFYV  181



>ref|XP_010428244.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Camelina 
sativa]
 ref|XP_010428245.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Camelina 
sativa]
 ref|XP_010428246.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Camelina 
sativa]
 ref|XP_010428247.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Camelina 
sativa]
Length=442

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 118/157 (75%), Gaps = 2/157 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +  +++ S V  LPGFEGPLPF LETGYIG+GE EE+QLFYYF+KSE NP++DPL+LW+S
Sbjct  25   QQNVNSASIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSERNPEEDPLLLWLS  84

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS++GL+YE GPL     VYNGTLP+L+    S TK +SIIFLDQ    GFSYS 
Sbjct  85   GGPGCSSISGLLYENGPLKMKLDVYNGTLPSLVSTTYSWTKTSSIIFLDQPVGTGFSYSR  144

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             T +N  +D   +K ++EFLQKW  ++Q+F SNPF++
Sbjct  145  TTQSNKPSDSGEAKRIHEFLQKWLGKHQEFSSNPFYV  181



>ref|NP_177471.1| serine carboxypeptidase-like 3 [Arabidopsis thaliana]
 sp|Q9CAU1.1|SCP3_ARATH RecName: Full=Serine carboxypeptidase-like 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG52138.1|AC010556_20 putative serine carboxypeptidase; 12385-14737 [Arabidopsis thaliana]
 gb|AEE35437.1| serine carboxypeptidase-like 3 [Arabidopsis thaliana]
Length=441

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 117/157 (75%), Gaps = 2/157 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H +S+ + +  LPGFEGPLPF LETGYIGVGE EE+QLFYYF+KSE NPK+DPL+LW+S
Sbjct  24   QHHVSSATIIKSLPGFEGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLS  83

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS++GL++E GPL     VYNGTLP+L+    S TK +S+IFLDQ    GFSYS 
Sbjct  84   GGPGCSSISGLLFENGPLAMKLDVYNGTLPSLVSTTYSWTKASSMIFLDQPVGAGFSYSR  143

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                N  +D   +K ++EFLQKW  ++Q+F SNPF++
Sbjct  144  TQLLNKPSDSGEAKRIHEFLQKWLGKHQEFSSNPFYV  180



>ref|XP_009612197.1| PREDICTED: serine carboxypeptidase-like 11 isoform X1 [Nicotiana 
tomentosiformis]
Length=474

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 117/150 (78%), Gaps = 2/150 (1%)
 Frame = -3

Query  446  SKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGCSS  267
            S V+ LPGF+G LPF+LETGYIGVG+SEE+QLFYYFVKSE+NPK DPL+LW++G  GCSS
Sbjct  31   STVEFLPGFDGALPFYLETGYIGVGKSEEVQLFYYFVKSESNPKKDPLLLWLTGGPGCSS  90

Query  266  LTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN--  93
             TG+ YE+GPL F  K YNG+LP L+    S TK ASI+FL+Q  N GFSY+T +  +  
Sbjct  91   FTGVAYEVGPLAFGQKAYNGSLPILVSTPYSWTKFASILFLEQPVNTGFSYATTSAASKC  150

Query  92   TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            TD++A   VYEFL KWF+ + +F+SNPF++
Sbjct  151  TDLQACDQVYEFLLKWFNNHPEFISNPFYV  180



>ref|XP_002888921.1| hypothetical protein ARALYDRAFT_476459 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65180.1| hypothetical protein ARALYDRAFT_476459 [Arabidopsis lyrata subsp. 
lyrata]
Length=427

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 122/176 (69%), Gaps = 11/176 (6%)
 Frame = -3

Query  524  LSLNHFVILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFY  345
            L L HFV L+         +  + + S V  LPGFEGPLPF LETGYIGVGE EE+QLFY
Sbjct  1    LLLLHFVFLS---------KQYVDSASIVKFLPGFEGPLPFELETGYIGVGEEEEVQLFY  51

Query  344  YFVKSETNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTK  165
            YF+KSE NPK+DPL+LW++G  GCS+++GL+YE GPL     VYNGTLP+L+    S TK
Sbjct  52   YFIKSERNPKEDPLLLWLTGGPGCSAISGLLYENGPLAMKLDVYNGTLPSLVSTTYSWTK  111

Query  164  NASIIFLDQLPNIGFSYSTNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             +SIIFLDQ    GFSYS     N  +D   +K ++EFLQKW  ++Q+F SNPF++
Sbjct  112  TSSIIFLDQPVGTGFSYSRTQLFNKPSDTGEAKRIHEFLQKWLGKHQEFSSNPFYV  167



>gb|AAG30990.1|AC012396_26 serine carboxypeptidase, putative [Arabidopsis thaliana]
Length=415

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 117/157 (75%), Gaps = 3/157 (2%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +HV SA S V  LPGFEGPLPF LETGYIGVGE EE+QLFYYF+KSE NPK+DPL+LW++
Sbjct  25   QHVDSA-SIVKFLPGFEGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLT  83

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCS+++GL+Y+ GPL     VYNGTLP+L+    S TK +S+IFLDQ    GFSYS 
Sbjct  84   GGPGCSAISGLLYQNGPLAMKLDVYNGTLPSLVSTTYSWTKTSSMIFLDQPVGTGFSYSR  143

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                N  +D   +K ++EFLQKW  ++Q+F SNPF++
Sbjct  144  TQLFNKPSDTGEAKRIHEFLQKWLGKHQEFSSNPFYV  180



>ref|NP_177473.1| serine carboxypeptidase-like 2 [Arabidopsis thaliana]
 sp|Q9CAU3.1|SCP2_ARATH RecName: Full=Serine carboxypeptidase-like 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG52135.1|AC010556_17 putative serine carboxypeptidase; 5659-8034 [Arabidopsis thaliana]
 gb|AEE35439.1| serine carboxypeptidase-like 2 [Arabidopsis thaliana]
Length=441

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 117/157 (75%), Gaps = 3/157 (2%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +HV SA S V  LPGFEGPLPF LETGYIG+GE EE+QLFYYF+KSE NPK+DPLILW++
Sbjct  25   QHVDSA-SIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSERNPKEDPLILWLT  83

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS++GL++E GPL     VYNGTLP+L+    S TK +S+IFLDQ    GFSYS 
Sbjct  84   GGPGCSSISGLLFENGPLTMKLDVYNGTLPSLVSTTYSWTKTSSMIFLDQPVGTGFSYSR  143

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                N  +D   +K ++EFLQKW  ++Q+F SNPF++
Sbjct  144  TQQFNKPSDSGEAKRIHEFLQKWLGKHQEFSSNPFYV  180



>ref|XP_010416123.1| PREDICTED: serine carboxypeptidase-like 2 [Camelina sativa]
Length=444

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S V  LPGFEGPLPF LETGYIG+G+ EE+QLFYYF+KSE NP++DPL+LW+SG  GC
Sbjct  32   SASTVKFLPGFEGPLPFELETGYIGIGKEEELQLFYYFIKSERNPEEDPLLLWLSGGPGC  91

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS++GL+YE GPL     VYNGTLP+L+    S TK +SIIFLDQ    GFSYS  T  N
Sbjct  92   SSISGLLYENGPLMMKLDVYNGTLPSLVNTTYSWTKTSSIIFLDQPVGTGFSYSRTTQFN  151

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D   +K ++EFLQKW  ++Q+F SNPF++
Sbjct  152  KPSDSGEAKRIHEFLQKWLGKHQEFSSNPFYV  183



>ref|NP_177474.1| serine carboxypeptidase-like 4 [Arabidopsis thaliana]
 sp|Q9CAU4.1|SCP4_ARATH RecName: Full=Serine carboxypeptidase-like 4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG52126.1|AC010556_8 putative serine carboxypeptidase; 2530-4892 [Arabidopsis thaliana]
 gb|AEE35440.1| serine carboxypeptidase-like 4 [Arabidopsis thaliana]
Length=441

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 117/157 (75%), Gaps = 3/157 (2%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +HV SA S V  LPGFEGPLPF LETGYIGVGE EE+QLFYYF+KSE NPK+DPL+LW++
Sbjct  25   QHVDSA-SIVKFLPGFEGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLT  83

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCS+++GL+Y+ GPL     VYNGTLP+L+    S TK +S+IFLDQ    GFSYS 
Sbjct  84   GGPGCSAISGLLYQNGPLAMKLDVYNGTLPSLVSTTYSWTKTSSMIFLDQPVGTGFSYSR  143

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                N  +D   +K ++EFLQKW  ++Q+F SNPF++
Sbjct  144  TQLFNKPSDTGEAKRIHEFLQKWLGKHQEFSSNPFYV  180



>ref|XP_010314600.1| PREDICTED: serine carboxypeptidase-like 11 [Solanum lycopersicum]
Length=463

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 125/171 (73%), Gaps = 2/171 (1%)
 Frame = -3

Query  509  FVILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKS  330
            F +  ++ +   + + V    S V+ LPGF+GPLPF+LETGYIG+G+SEE+QLFYYFVKS
Sbjct  2    FYLFFLVTLFVQYVQSVPQNSSIVEYLPGFDGPLPFYLETGYIGIGKSEEVQLFYYFVKS  61

Query  329  ETNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASII  150
            E++P+ DPL+LW++G  GCSS TGL YE+GPL F  K YNG+LP L+ +  S TK ASI+
Sbjct  62   ESDPRKDPLVLWLTGGPGCSSFTGLAYEVGPLDFGQKAYNGSLPILISSPYSWTKFASIL  121

Query  149  FLDQLPNIGFSYSTNTTT--NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            FL+Q  N GFSY+T +     TD++A  +VYEFL+KW   + +F+ NPF++
Sbjct  122  FLEQPVNTGFSYATTSEAYKCTDLQACDHVYEFLRKWLVNHPEFILNPFYV  172



>ref|XP_006390568.1| hypothetical protein EUTSA_v10018572mg [Eutrema salsugineum]
 gb|ESQ27854.1| hypothetical protein EUTSA_v10018572mg [Eutrema salsugineum]
Length=438

 Score =   186 bits (472),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 116/157 (74%), Gaps = 3/157 (2%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H  SA S V  LPGF+GPLPF LETGYIGVGE EE+Q FYYF+KSE NP++DPL+LW+S
Sbjct  22   QHAESA-SIVKFLPGFDGPLPFELETGYIGVGEEEEVQSFYYFIKSERNPQEDPLLLWLS  80

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS++GL++E GPL     VYNGTLP+L+    S TK +SIIFLDQ    GFSYS 
Sbjct  81   GGPGCSSISGLLFENGPLTMKLDVYNGTLPSLVSTTYSWTKTSSIIFLDQPVRTGFSYSR  140

Query  107  N--TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               TT  +D   +K ++EFLQKW  ++Q+F SNPF+I
Sbjct  141  THLTTKPSDSGEAKRIHEFLQKWLGKHQEFSSNPFYI  177



>ref|NP_001031402.1| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
 gb|AEC07386.1| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
Length=411

 Score =   185 bits (470),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 114/156 (73%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   +GS V  LPGFEGPLPF LETGYIG+GE EE+QLFYYF+KSE NP++DPL+LW+SG
Sbjct  18   HHAHSGSIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSEKNPEEDPLLLWLSG  77

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSSLTGL++E GP+    +VYNG++P+L+    S TK A+IIFLDQ    GFSYS  
Sbjct  78   GPGCSSLTGLLFENGPVALKFEVYNGSVPSLVSTTYSWTKMANIIFLDQPVGSGFSYSRT  137

Query  104  TTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               +  +D    K +YEFLQKW  ++Q F SNPF++
Sbjct  138  PLVDKISDTGEVKRIYEFLQKWLSKHQQFFSNPFYV  173



>ref|XP_002878649.1| hypothetical protein ARALYDRAFT_481165 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54908.1| hypothetical protein ARALYDRAFT_481165 [Arabidopsis lyrata subsp. 
lyrata]
Length=411

 Score =   185 bits (469),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            +GS V  LPGFEGPLPF LETGYIG+GE EE+QLFYYF+KSE NPK+DPL+LW++G  GC
Sbjct  22   SGSIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSEKNPKEDPLLLWLTGGPGC  81

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SSLTGL++E GP+    +VYNG++P+L+    S TK A+IIFLDQ    GFSYS     +
Sbjct  82   SSLTGLLFENGPVALKFEVYNGSVPSLVSTTYSWTKMANIIFLDQPVGAGFSYSRTPLVH  141

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D    K +YEFLQKW  ++Q F SNPF++
Sbjct  142  KISDTGEVKRIYEFLQKWLSKHQQFFSNPFYV  173



>ref|NP_001077947.1| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
 gb|AEC07388.1| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
Length=433

 Score =   185 bits (470),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 114/156 (73%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   +GS V  LPGFEGPLPF LETGYIG+GE EE+QLFYYF+KSE NP++DPL+LW+SG
Sbjct  18   HHAHSGSIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSEKNPEEDPLLLWLSG  77

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSSLTGL++E GP+    +VYNG++P+L+    S TK A+IIFLDQ    GFSYS  
Sbjct  78   GPGCSSLTGLLFENGPVALKFEVYNGSVPSLVSTTYSWTKMANIIFLDQPVGSGFSYSRT  137

Query  104  TTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               +  +D    K +YEFLQKW  ++Q F SNPF++
Sbjct  138  PLVDKISDTGEVKRIYEFLQKWLSKHQQFFSNPFYV  173



>ref|XP_006301868.1| hypothetical protein CARUB_v10022339mg [Capsella rubella]
 gb|EOA34766.1| hypothetical protein CARUB_v10022339mg [Capsella rubella]
Length=439

 Score =   186 bits (471),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 115/157 (73%), Gaps = 2/157 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +  + + S V  LPGFEGPLPF LETGYIG+GE EE+QLFYYF+KSE NP++DPL+LW+S
Sbjct  22   QRNVDSASIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSERNPEEDPLLLWLS  81

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS++GL+YE GPL     VYNGTLP+L+    S TK +SIIFLDQ    GFSYS 
Sbjct  82   GGPGCSSISGLLYENGPLKMKLDVYNGTLPSLVSTNYSWTKTSSIIFLDQPVGTGFSYSR  141

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                N  +D   +K ++EF+QKW  ++Q+F SNPF++
Sbjct  142  THQFNKPSDSGEAKRIHEFVQKWLGKHQEFSSNPFYV  178



>ref|NP_179881.3| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
 sp|Q8H780.2|SCP13_ARATH RecName: Full=Serine carboxypeptidase-like 13; AltName: Full=Sinapoylglucose--sinapoylglucose 
O-sinapoyltransferase; AltName: 
Full=Sinapoylglucose--sinapoylglucose acyltransferase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC17815.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AAM15008.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AEC07385.1| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
Length=430

 Score =   185 bits (470),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 114/156 (73%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   +GS V  LPGFEGPLPF LETGYIG+GE EE+QLFYYF+KSE NP++DPL+LW+SG
Sbjct  18   HHAHSGSIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSEKNPEEDPLLLWLSG  77

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSSLTGL++E GP+    +VYNG++P+L+    S TK A+IIFLDQ    GFSYS  
Sbjct  78   GPGCSSLTGLLFENGPVALKFEVYNGSVPSLVSTTYSWTKMANIIFLDQPVGSGFSYSRT  137

Query  104  TTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               +  +D    K +YEFLQKW  ++Q F SNPF++
Sbjct  138  PLVDKISDTGEVKRIYEFLQKWLSKHQQFFSNPFYV  173



>sp|Q9CAU2.2|SCP5_ARATH RecName: Full=Serine carboxypeptidase-like 5; Flags: Precursor 
[Arabidopsis thaliana]
Length=438

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 116/157 (74%), Gaps = 3/157 (2%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +HV SA S V  LPGFEG LPF LETGYIG+GE EE+QLFYYF+KSE NPK+DPL+LW+S
Sbjct  24   QHVDSA-SIVKFLPGFEGSLPFELETGYIGIGEEEEVQLFYYFIKSERNPKEDPLLLWLS  82

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS++GL++E GPL     VYNGTLP+L+    S TK +S+IFLDQ    GFSYS 
Sbjct  83   GGPGCSSISGLLFENGPLAMKLDVYNGTLPSLVPTTYSWTKTSSMIFLDQPVGTGFSYSR  142

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                N  +D   +K ++EFLQKW  ++Q+F SNPF++
Sbjct  143  TQQYNKPSDSGEAKRIHEFLQKWLSKHQEFSSNPFYV  179



>ref|NP_001031401.1| serine carboxypeptidase-like 11 [Arabidopsis thaliana]
 gb|AEC07383.1| serine carboxypeptidase-like 11 [Arabidopsis thaliana]
Length=320

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 113/155 (73%), Gaps = 2/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H + +GS V  LPGFEGPLPF LETGYIG+GE EE+QLFYYF+KSE NPK+DPL+LW+SG
Sbjct  17   HHVGSGSIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSERNPKEDPLLLWLSG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSS+TGL+++ GPL   ++VYNG++P+L+    S TK A+IIFLDQ    GFSYS  
Sbjct  77   GPGCSSITGLLFQNGPLALKSEVYNGSVPSLVSTTYSWTKTANIIFLDQPVGAGFSYSRA  136

Query  104  --TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
                T TD    K ++EFLQKW  ++  F SN F+
Sbjct  137  PLIDTPTDTGEVKRIHEFLQKWLSKHPQFSSNHFY  171



>ref|NP_177472.1| serine carboxypeptidase-like 5 [Arabidopsis thaliana]
 gb|AAG52136.1|AC010556_18 putative serine carboxypeptidase; 8937-11310 [Arabidopsis thaliana]
 gb|AEE35438.1| serine carboxypeptidase-like 5 [Arabidopsis thaliana]
Length=438

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 116/157 (74%), Gaps = 3/157 (2%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +HV SA S V  LPGFEG LPF LETGYIG+GE EE+QLFYYF+KSE NPK+DPL+LW+S
Sbjct  24   QHVDSA-SIVKFLPGFEGSLPFELETGYIGIGEEEEVQLFYYFIKSERNPKEDPLLLWLS  82

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS++GL++E GPL     VYNGTLP+L+    S TK +S+IFLDQ    GFSYS 
Sbjct  83   GGPGCSSISGLLFENGPLAMKLDVYNGTLPSLVPTTYSWTKTSSMIFLDQPVGTGFSYSR  142

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                N  +D   +K ++EFLQKW  ++Q+F SNPF++
Sbjct  143  TQQYNKPSDSGEAKRIHEFLQKWLSKHQEFSSNPFYV  179



>ref|XP_002878643.1| SCPL12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54902.1| SCPL12 [Arabidopsis lyrata subsp. lyrata]
Length=405

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 113/155 (73%), Gaps = 2/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H + +GS V  LPGFEGPLPF LETGYIG+GE EE+Q FYYF+KSE NPK+DPL+LW+SG
Sbjct  17   HHVDSGSIVKFLPGFEGPLPFELETGYIGIGEKEEVQSFYYFIKSENNPKEDPLLLWLSG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSS+TGL++E GPL   ++VYNG++P+L+    S TK A+IIFLDQ    GFSYS  
Sbjct  77   GPGCSSITGLLFENGPLALKSEVYNGSVPSLVSTTYSWTKTANIIFLDQPIGAGFSYSRT  136

Query  104  --TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
                T TD    K ++EFLQKW  ++  F SNPF+
Sbjct  137  PLIDTPTDTGEVKNIHEFLQKWLSKHPQFSSNPFY  171



>ref|NP_850033.1| serine carboxypeptidase-like 12 [Arabidopsis thaliana]
 gb|AEC07374.1| serine carboxypeptidase-like 12 [Arabidopsis thaliana]
Length=408

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H + +GS V  LPGFEGPLPF LETGYIG+GE E++QLFYYF+KSE NPK+DPL+LW+SG
Sbjct  17   HHVDSGSIVKFLPGFEGPLPFELETGYIGIGEEEDVQLFYYFIKSERNPKEDPLLLWLSG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSS+TGL++E GPL   +KVYNG++P+L+    S TK A+IIFLDQ    GFSYS  
Sbjct  77   GPGCSSITGLLFENGPLALKSKVYNGSVPSLVSTTYSWTKTANIIFLDQPIGAGFSYSRI  136

Query  104  TTTNT--DVEASKYVYEFLQKWFDQNQDFVSNPFF  6
               +T  D    K ++EFLQKW  ++  F SNPF+
Sbjct  137  PLIDTPSDTGEVKNIHEFLQKWLSKHPQFSSNPFY  171



>ref|NP_179876.1| serine carboxypeptidase-like 12 [Arabidopsis thaliana]
 sp|O81009.1|SCP12_ARATH RecName: Full=Serine carboxypeptidase-like 12; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC32439.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AEC07373.1| serine carboxypeptidase-like 12 [Arabidopsis thaliana]
Length=435

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H + +GS V  LPGFEGPLPF LETGYIG+GE E++QLFYYF+KSE NPK+DPL+LW+SG
Sbjct  17   HHVDSGSIVKFLPGFEGPLPFELETGYIGIGEEEDVQLFYYFIKSERNPKEDPLLLWLSG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSS+TGL++E GPL   +KVYNG++P+L+    S TK A+IIFLDQ    GFSYS  
Sbjct  77   GPGCSSITGLLFENGPLALKSKVYNGSVPSLVSTTYSWTKTANIIFLDQPIGAGFSYSRI  136

Query  104  TTTNT--DVEASKYVYEFLQKWFDQNQDFVSNPFF  6
               +T  D    K ++EFLQKW  ++  F SNPF+
Sbjct  137  PLIDTPSDTGEVKNIHEFLQKWLSKHPQFSSNPFY  171



>ref|XP_009104817.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Brassica 
rapa]
Length=411

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H  ++ S V  LPGFEGPLPF LETGYIGVGE EE+QLFYYF+KSE NPK+DPL+LW+S
Sbjct  24   QHQSASASIVKFLPGFEGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLS  83

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS+ GL++E GPL    + YNGTLP+L+    S TK  SIIFLDQ    GFSYS 
Sbjct  84   GGPGCSSIHGLLFENGPLTMKLEEYNGTLPSLVSTTYSWTKTTSIIFLDQPVGTGFSYSR  143

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                +  +D   +K V+EFLQKW  ++++F+SNP ++
Sbjct  144  TQLVDKPSDSGEAKRVHEFLQKWLGKHEEFISNPLYV  180



>emb|CDP17658.1| unnamed protein product [Coffea canephora]
Length=457

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 122/166 (73%), Gaps = 3/166 (2%)
 Frame = -3

Query  494  IIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPK  315
            +  +V V P   + AGS V  LPGFE PLPF LETGYIGVGESE++QLFYYFVKSE+NP+
Sbjct  18   LFVLVSVRPNLAV-AGSVVKFLPGFESPLPFVLETGYIGVGESEDVQLFYYFVKSESNPQ  76

Query  314  DDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQL  135
             DPL++W++G  GCSS++GL YEIGP+ F   +Y+GTLP L+ N  S TK ASIIFLD  
Sbjct  77   IDPLLIWLTGGPGCSSISGLAYEIGPVKFQRVLYDGTLPKLMTNPYSWTKLASIIFLDSP  136

Query  134  PNIGFSYS--TNTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               GFSY+     + ++D++AS++ YEFL+KW   N +++SN F+I
Sbjct  137  VGTGFSYARTAKASQSSDLQASEHTYEFLRKWLHDNPEYMSNSFYI  182



>ref|XP_009104821.1| PREDICTED: serine carboxypeptidase-like 2 isoform X5 [Brassica 
rapa]
Length=443

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H  ++ S V  LPGFEGPLPF LETGYIGVGE EE+QLFYYF+KSE NPK+DPL+LW+S
Sbjct  24   QHQSASASIVKFLPGFEGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLS  83

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS+ GL++E GPL    + YNGTLP+L+    S TK  SIIFLDQ    GFSYS 
Sbjct  84   GGPGCSSIHGLLFENGPLTMKLEEYNGTLPSLVSTTYSWTKTTSIIFLDQPVGTGFSYSR  143

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                +  +D   +K V+EFLQKW  ++++F+SNP ++
Sbjct  144  TQLVDKPSDSGEAKRVHEFLQKWLGKHEEFISNPLYV  180



>ref|XP_009104820.1| PREDICTED: serine carboxypeptidase-like 2 isoform X4 [Brassica 
rapa]
Length=441

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H  ++ S V  LPGFEGPLPF LETGYIGVGE EE+QLFYYF+KSE NPK+DPL+LW+S
Sbjct  24   QHQSASASIVKFLPGFEGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLS  83

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS+ GL++E GPL    + YNGTLP+L+    S TK  SIIFLDQ    GFSYS 
Sbjct  84   GGPGCSSIHGLLFENGPLTMKLEEYNGTLPSLVSTTYSWTKTTSIIFLDQPVGTGFSYSR  143

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                +  +D   +K V+EFLQKW  ++++F+SNP ++
Sbjct  144  TQLVDKPSDSGEAKRVHEFLQKWLGKHEEFISNPLYV  180



>ref|XP_010464720.1| PREDICTED: serine carboxypeptidase-like 7 [Camelina sativa]
Length=443

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S V+ LPGF+GPLPF LETGYIGVGE EE+QLFYYF+KSE NPK+DPL+LW+SG  GC
Sbjct  28   SASIVESLPGFDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLSGGPGC  87

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS++GL+YE GPL    +VYNGTLP+L+    S TK +SII+LDQ    GFSYS     +
Sbjct  88   SSISGLLYENGPLTVKLEVYNGTLPSLVSTTYSWTKVSSIIYLDQPVGTGFSYSRTQLVD  147

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D   +K ++EFL KW  ++Q+F+SNPF++
Sbjct  148  KPSDSGEAKRIHEFLHKWLGKHQEFLSNPFYV  179



>ref|XP_010314652.1| PREDICTED: serine carboxypeptidase-like 11 [Solanum lycopersicum]
Length=677

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 120/157 (76%), Gaps = 2/157 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            + V    S V+ LPGF+GPLPF+L+TGYIGVG+SEE+QLFYYFVKSE++PK DP++LW++
Sbjct  15   QSVPQNSSIVEFLPGFDGPLPFYLQTGYIGVGKSEEVQLFYYFVKSESDPKKDPILLWLT  74

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS +GL YEIGPL F  K YNG+LP L+ +  S TK ASI+FL+Q  N GFS++ 
Sbjct  75   GGPGCSSFSGLAYEIGPLEFGQKAYNGSLPILVSSPHSWTKFASILFLEQPVNTGFSHAI  134

Query  107  NTTT--NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             +     TD++A  +VYEFL+KWF  + +F+SNPF++
Sbjct  135  TSEAYKCTDLQACDHVYEFLRKWFVNHSEFISNPFYV  171


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 7/77 (9%)
 Frame = -3

Query  386  YIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGCSSLTGLIYEIG---PLFFDAKV  216
            YIGV +SEE+QLFYYFVKSE  P++   +   SG     +   +++ IG   PL F  K 
Sbjct  457  YIGVAKSEEVQLFYYFVKSEIRPEERSDLAMGSGR----TRLLILHRIGVRSPLAFGQKA  512

Query  215  YNGTLPTLLFNEQSLTK  165
            YNG+LP L+    S TK
Sbjct  513  YNGSLPFLVSRPYSWTK  529



>emb|CDY09545.1| BnaC05g23740D [Brassica napus]
Length=436

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 124/178 (70%), Gaps = 10/178 (6%)
 Frame = -3

Query  530  MKLSLNHFVILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQL  351
            +K  L   +I+ II         +  A S +  LPGFEGPLPF LETGYIGVGE+EE Q+
Sbjct  6    LKFLLPQLLIVLII--------QLADASSVIKYLPGFEGPLPFELETGYIGVGEAEEDQM  57

Query  350  FYYFVKSETNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSL  171
            FYYF+KSE NP++DPL++W+SG  GCSSLTGL YE GPL F+ + YNG++P+L+    S 
Sbjct  58   FYYFIKSERNPEEDPLLVWLSGGPGCSSLTGLFYENGPLAFNVEPYNGSIPSLVSTTYSW  117

Query  170  TKNASIIFLDQLPNIGFSYSTNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            TK A+II+LDQ    GFSYS N   +  +D  A+K V EFL++W D++ ++ SNPF++
Sbjct  118  TKVANIIYLDQPVGTGFSYSRNPFADRPSDTRAAKRVNEFLRRWLDKHPEYFSNPFYV  175



>ref|XP_010320198.1| PREDICTED: serine carboxypeptidase-like 17 [Solanum lycopersicum]
Length=476

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 124/178 (70%), Gaps = 10/178 (6%)
 Frame = -3

Query  506  VILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSE  327
            + L ++A +  FPE V +AGS V  LPGF+GPLPF LETGYIGVG+S+++QLFYYFVKSE
Sbjct  16   IFLFLLAEIIHFPECVKAAGSPVKFLPGFQGPLPFELETGYIGVGDSDDVQLFYYFVKSE  75

Query  326  TNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFD--------AKVYNGTLPTLLFNEQSL  171
            +NPK DPLILW++G  GCS+L+GL++EIGP+ F+           YNG+ P+L+ N  + 
Sbjct  76   SNPKSDPLILWLTGGPGCSALSGLLFEIGPITFEPVEYGDFKPAEYNGSFPSLVLNPHTW  135

Query  170  TKNASIIFLDQLPNIGFSYSTNTTTNT--DVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            TK AS IFLD     GFSY+  +      D+ AS + Y+FL KWF+ + +F  NPF++
Sbjct  136  TKVASFIFLDLPVCTGFSYARTSVARQSDDLLASDHAYQFLHKWFNDHPEFFRNPFYV  193



>gb|AAN60354.1| unknown [Arabidopsis thaliana]
Length=411

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 112/156 (72%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   +GS V  LPGFEGPL F LETGYIG+GE EE+QLFYYF+KSE NP++DPL+LW+SG
Sbjct  18   HHAHSGSIVKFLPGFEGPLSFELETGYIGIGEEEEVQLFYYFIKSEKNPEEDPLLLWLSG  77

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSSLTGL++E GP+    +VYNG++P+L+    S TK A+IIFLDQ    GFSYS  
Sbjct  78   GPGCSSLTGLLFENGPVALKFEVYNGSVPSLVSTAYSWTKMANIIFLDQPVGAGFSYSRT  137

Query  104  --TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                  +D    K +YEFLQKW  ++Q F SNPF++
Sbjct  138  PLVDKTSDTGEVKRIYEFLQKWLSKHQQFFSNPFYV  173



>ref|XP_010555479.1| PREDICTED: serine carboxypeptidase-like 7 [Tarenaya hassleriana]
Length=461

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 122/175 (70%), Gaps = 11/175 (6%)
 Frame = -3

Query  518  LNHFVILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVG-ESEEIQLFYY  342
            LN  ++L +I  VG        +GS V  LPGFEGPLPF LETGY+GVG E+EE+QLFYY
Sbjct  10   LNSILLLVMIRHVG--------SGSVVKSLPGFEGPLPFELETGYVGVGGEAEEVQLFYY  61

Query  341  FVKSETNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKN  162
            FVKSETNP++DPL++W+SG  GC+SL+GL YEIGPL F    Y+G +P+L     S TK 
Sbjct  62   FVKSETNPEEDPLLVWLSGGPGCTSLSGLAYEIGPLAFKVDDYDGGVPSLASTSYSWTKI  121

Query  161  ASIIFLDQLPNIGFSYSTNTTTNT--DVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            ASIIFLDQ    GFSYS     NT  D   ++ V+EF++KW   + +FVSNPF++
Sbjct  122  ASIIFLDQPVGTGFSYSRTPPANTPSDTRQAEQVHEFVRKWLVDHPEFVSNPFYV  176



>ref|XP_006404748.1| hypothetical protein EUTSA_v10000461mg, partial [Eutrema salsugineum]
 gb|ESQ46201.1| hypothetical protein EUTSA_v10000461mg, partial [Eutrema salsugineum]
Length=359

 Score =   182 bits (461),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 111/155 (72%), Gaps = 1/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H + + S V  LPGFEGPLPF LETGYIG+GE EE+QLFYYF+KSE NP++DPL++W++G
Sbjct  18   HHVESSSVVKFLPGFEGPLPFELETGYIGLGEEEEVQLFYYFIKSERNPQEDPLLIWLTG  77

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSSL GL++E GP+    KVYNGT+P+L+    S TK A+IIFLDQ    GFSYST 
Sbjct  78   GPGCSSLVGLLFENGPVALKVKVYNGTVPSLVSTTYSWTKMANIIFLDQPVGAGFSYSTT  137

Query  104  TTTNT-DVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                T D    K ++EFLQKW  ++  F SNP ++
Sbjct  138  PLDKTSDTNEVKNIHEFLQKWLSKHPQFYSNPLYV  172



>ref|NP_198467.2| serine carboxypeptidase-like 1 [Arabidopsis thaliana]
 sp|Q8RWJ6.1|SCP1_ARATH RecName: Full=Serine carboxypeptidase-like 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM13043.1| serine carboxypeptidase [Arabidopsis thaliana]
 gb|AAM91325.1| serine carboxypeptidase [Arabidopsis thaliana]
 gb|AED94054.1| serine carboxypeptidase-like 1 [Arabidopsis thaliana]
Length=441

 Score =   183 bits (465),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 115/157 (73%), Gaps = 3/157 (2%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +HV SA S V  LPGFEG LPF LETGYIGVGE EE+QLFYYF+KSE NPK+DPLILW++
Sbjct  25   QHVDSA-SIVKSLPGFEGQLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLILWLT  83

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCS+++GL++E GPL     VYNGTLP+L+    S TK +SIIFLDQ    GFSYS 
Sbjct  84   GGPGCSAISGLLFENGPLTMKLDVYNGTLPSLVSTTYSWTKTSSIIFLDQPVGTGFSYSR  143

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                N  +D   +K ++EFLQKW  ++Q F SNPF++
Sbjct  144  TQQFNKPSDSGEAKRIHEFLQKWLGKHQVFSSNPFYV  180



>ref|XP_010484310.1| PREDICTED: serine carboxypeptidase-like 7 [Camelina sativa]
Length=440

 Score =   183 bits (464),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S V  LPGF+GPLPF LETGYIGVGE EE+QLFYYF+KSE NPK+DPL+LW+SG  GC
Sbjct  25   SASIVKFLPGFDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLSGGPGC  84

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS++GL+YE GPL    +VYNGTLP+L+    S TK +SII+LDQ    GFSYS     +
Sbjct  85   SSISGLLYENGPLTVKLEVYNGTLPSLVSTTYSWTKVSSIIYLDQPVGTGFSYSRTQLVD  144

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D   +K ++EFL KW  ++Q+F+SNPF++
Sbjct  145  KPSDSGEAKRIHEFLHKWLGKHQEFLSNPFYV  176



>ref|NP_001077945.1| serine carboxypeptidase-like 11 [Arabidopsis thaliana]
 gb|AEC07384.1| serine carboxypeptidase-like 11 [Arabidopsis thaliana]
Length=443

 Score =   183 bits (465),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 113/155 (73%), Gaps = 2/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H + +GS V  LPGFEGPLPF LETGYIG+GE EE+QLFYYF+KSE NPK+DPL+LW+SG
Sbjct  17   HHVGSGSIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSERNPKEDPLLLWLSG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSS+TGL+++ GPL   ++VYNG++P+L+    S TK A+IIFLDQ    GFSYS  
Sbjct  77   GPGCSSITGLLFQNGPLALKSEVYNGSVPSLVSTTYSWTKTANIIFLDQPVGAGFSYSRA  136

Query  104  --TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
                T TD    K ++EFLQKW  ++  F SN F+
Sbjct  137  PLIDTPTDTGEVKRIHEFLQKWLSKHPQFSSNHFY  171



>ref|XP_010555764.1| PREDICTED: serine carboxypeptidase-like 18 [Tarenaya hassleriana]
Length=620

 Score =   186 bits (472),  Expect = 8e-52, Method: Composition-based stats.
 Identities = 87/152 (57%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            +GS V  LPGF+GPLPF LETGY+GVGE++E QLFYYFVKSE NP++DPL++W+SG  GC
Sbjct  49   SGSTVRRLPGFQGPLPFELETGYVGVGEADEAQLFYYFVKSERNPREDPLMVWLSGGPGC  108

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            +SL+GL YEIGP+ F  + YNG++P L+    S TK ASIIFLDQ    GFSY+     N
Sbjct  109  TSLSGLAYEIGPVTFKVEEYNGSVPKLVSTTYSWTKVASIIFLDQPVGSGFSYARTPLGN  168

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D + +KYV +FL+KW   +Q+F+SN F+I
Sbjct  169  HPSDTKEAKYVNQFLRKWLLDHQEFMSNHFYI  200



>ref|XP_006407566.1| hypothetical protein EUTSA_v10020743mg [Eutrema salsugineum]
 gb|ESQ49019.1| hypothetical protein EUTSA_v10020743mg [Eutrema salsugineum]
Length=441

 Score =   183 bits (464),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 113/156 (72%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            +   + S V  LPGFEGPLPF LETGYIGVGE EE+QLFYYF+KSE NP++DPL++W+SG
Sbjct  22   NAADSASTVKYLPGFEGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPEEDPLLIWLSG  81

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSSL+GL+YE GP+   ++VYNGT P+L+    S TK  SII+LDQ    GFSYS  
Sbjct  82   GPGCSSLSGLLYENGPVTLKSEVYNGTRPSLVSTTYSWTKTTSIIYLDQPVGTGFSYSRT  141

Query  104  TTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                  +D   +K ++EFL KW +++Q+F SNPF++
Sbjct  142  QLAEKPSDSGEAKRIHEFLHKWLNKHQEFFSNPFYV  177



>ref|XP_010471386.1| PREDICTED: serine carboxypeptidase-like 2 [Camelina sativa]
Length=444

 Score =   183 bits (464),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S V  LPGFEGPL F LETGYIG+G+ EE+QLFYYF+KSE NP++DPL+LW+SG  GC
Sbjct  32   SASTVKFLPGFEGPLLFELETGYIGIGKEEELQLFYYFIKSERNPEEDPLLLWLSGGPGC  91

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS++GL+YE GPL     VYNGTLP+L+    S TK +SIIFLDQ    GFSYS  T  N
Sbjct  92   SSISGLLYENGPLKMKLDVYNGTLPSLVSTTYSWTKTSSIIFLDQPVGTGFSYSRTTQFN  151

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D   +K ++EFLQKW  ++Q+F SNPF++
Sbjct  152  KPSDSGEAKRIHEFLQKWLGKHQEFSSNPFYV  183



>ref|XP_006303239.1| hypothetical protein CARUB_v10012575mg [Capsella rubella]
 gb|EOA36137.1| hypothetical protein CARUB_v10012575mg [Capsella rubella]
Length=449

 Score =   183 bits (464),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 112/155 (72%), Gaps = 2/155 (1%)
 Frame = -3

Query  461  VISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGE  282
            V S+ S V  LPGF G LPFHLETGYIGVGE E++QLFYYF+KSE NP++DP+ILW++G 
Sbjct  24   VDSSASLVRYLPGFNGLLPFHLETGYIGVGEEEQVQLFYYFIKSENNPEEDPVILWLTGG  83

Query  281  QGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNT  102
              CS L+ L +EIGPL F  + YNG LP+LL    S TK ASIIFLDQ    GFSYSTN 
Sbjct  84   PACSVLSALAFEIGPLTFKNEGYNGGLPSLLSTSYSWTKVASIIFLDQPAGAGFSYSTNP  143

Query  101  TTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +  +D   +K+ YEFLQKW  +N +F SNPF++
Sbjct  144  LAHKPSDTGETKHAYEFLQKWLVENPEFASNPFYV  178



>ref|NP_179880.1| serine carboxypeptidase-like 11 [Arabidopsis thaliana]
 sp|Q2V465.2|SCP11_ARATH RecName: Full=Serine carboxypeptidase-like 11; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC17814.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAK62651.1| T20K9.18/T20K9.18 [Arabidopsis thaliana]
 gb|AAM15007.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM47382.1| At2g22970/T20K9.18 [Arabidopsis thaliana]
 gb|AAN31888.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEC07382.1| serine carboxypeptidase-like 11 [Arabidopsis thaliana]
Length=433

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 113/155 (73%), Gaps = 2/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H + +GS V  LPGFEGPLPF LETGYIG+GE EE+QLFYYF+KSE NPK+DPL+LW+SG
Sbjct  17   HHVGSGSIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSERNPKEDPLLLWLSG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSS+TGL+++ GPL   ++VYNG++P+L+    S TK A+IIFLDQ    GFSYS  
Sbjct  77   GPGCSSITGLLFQNGPLALKSEVYNGSVPSLVSTTYSWTKTANIIFLDQPVGAGFSYSRA  136

Query  104  --TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
                T TD    K ++EFLQKW  ++  F SN F+
Sbjct  137  PLIDTPTDTGEVKRIHEFLQKWLSKHPQFSSNHFY  171



>ref|XP_006356866.1| PREDICTED: uncharacterized protein LOC102592829 [Solanum tuberosum]
Length=1021

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 129/177 (73%), Gaps = 8/177 (5%)
 Frame = -3

Query  527  KLSLNHFVILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLF  348
            K+ L +++ L ++       EH  +AGS+V  LPGF+GPLPF LETGY+GVG+SE++QLF
Sbjct  3    KIQLCYYLFLLLVVA-----EHA-AAGSQVKFLPGFQGPLPFQLETGYVGVGDSEDVQLF  56

Query  347  YYFVKSETNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLT  168
            YYF +SET+P  DPL+LWI+G  GCS+L+GL+YEIGP+ F+A  YNG+ P ++ N  S T
Sbjct  57   YYFTESETDPDSDPLMLWITGGPGCSALSGLLYEIGPITFEAVEYNGSFPKMILNPYSWT  116

Query  167  KNASIIFLDQLPNIGFSYSTN--TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            K +SIIFLD     GFSY+T      ++D++AS + Y+FL+KWF  + +F+ NPF++
Sbjct  117  KVSSIIFLDLPVGTGFSYATTPAARQSSDLQASDHAYQFLRKWFVDHPEFLKNPFYV  173


 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 122/165 (74%), Gaps = 5/165 (3%)
 Frame = -3

Query  485  VVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDP  306
            ++ V  EH  +AGS V  LPGF+G LPF LETGY+GVG+SE +QLFYYF++SE+ P  DP
Sbjct  571  LLRVVAEHA-TAGSTVKFLPGFQGQLPFELETGYVGVGDSENVQLFYYFIESESEPDSDP  629

Query  305  LILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTK--NASIIFLDQLP  132
            L+LWI+G  GCS+L+GLIYEIGP+ F+A  YNG+ PT++ N  S TK   +SIIFLD   
Sbjct  630  LMLWITGGPGCSALSGLIYEIGPITFEAVEYNGSFPTMILNPYSWTKVRVSSIIFLDLPV  689

Query  131  NIGFSYST--NTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              GFSY+T      ++D++AS++ Y+FL KWF  +Q+F+ NPF++
Sbjct  690  GTGFSYATIPAALQSSDLQASEHAYQFLHKWFVDHQEFLENPFYV  734



>dbj|BAA96893.1| serine carboxypeptidase [Arabidopsis thaliana]
Length=512

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 115/157 (73%), Gaps = 3/157 (2%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +HV SA S V  LPGFEG LPF LETGYIGVGE EE+QLFYYF+KSE NPK+DPLILW++
Sbjct  25   QHVDSA-SIVKSLPGFEGQLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLILWLT  83

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCS+++GL++E GPL     VYNGTLP+L+    S TK +SIIFLDQ    GFSYS 
Sbjct  84   GGPGCSAISGLLFENGPLTMKLDVYNGTLPSLVSTTYSWTKTSSIIFLDQPVGTGFSYSR  143

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                N  +D   +K ++EFLQKW  ++Q F SNPF++
Sbjct  144  TQQFNKPSDSGEAKRIHEFLQKWLGKHQVFSSNPFYV  180



>ref|XP_010509544.1| PREDICTED: serine carboxypeptidase-like 9 isoform X3 [Camelina 
sativa]
Length=376

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 112/154 (73%), Gaps = 1/154 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   +GS +  LPGF+GPLPF LETGYIG+GE EE QLFYYF+KSE NPK+DPL+LW++G
Sbjct  17   HHAYSGSIIKFLPGFDGPLPFELETGYIGIGEEEEAQLFYYFIKSENNPKEDPLLLWLNG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-T  108
              GCSSLT L+ EIGP+   ++VYNG++P++     S TK A+IIFLDQ    GFSYS T
Sbjct  77   GPGCSSLTALLSEIGPVALKSEVYNGSVPSMFSTTYSWTKVANIIFLDQPVGAGFSYSRT  136

Query  107  NTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
            +    +D    K ++EFLQKW  ++  F+SNPF+
Sbjct  137  SLDKTSDTNEVKMIHEFLQKWLSKHPQFISNPFY  170



>ref|XP_009115052.1| PREDICTED: serine carboxypeptidase-like 14 [Brassica rapa]
Length=436

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 123/178 (69%), Gaps = 10/178 (6%)
 Frame = -3

Query  530  MKLSLNHFVILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQL  351
            +K  L   +I+ II         +  A S +  LPGFEGPLPF LETGYIGVGE+EE Q+
Sbjct  6    LKFLLPQLLIVLII--------QLADASSVIKYLPGFEGPLPFELETGYIGVGEAEEDQM  57

Query  350  FYYFVKSETNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSL  171
            FYYF+KSE NP++DPL++W+SG  GCSSLTGL YE GPL F+ + YNG++P+L+    S 
Sbjct  58   FYYFIKSERNPEEDPLLVWLSGGPGCSSLTGLFYENGPLAFNVEPYNGSIPSLVSTTYSW  117

Query  170  TKNASIIFLDQLPNIGFSYSTN--TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            TK A+II+LDQ    GFSY+ N  +   +D  A+K V EFL++W D + ++ SNPF++
Sbjct  118  TKVANIIYLDQPVGTGFSYTRNPFSDRTSDTRAAKRVNEFLRQWLDNHPEYFSNPFYV  175



>emb|CDY02322.1| BnaA09g25800D [Brassica napus]
Length=436

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 124/178 (70%), Gaps = 10/178 (6%)
 Frame = -3

Query  530  MKLSLNHFVILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQL  351
            +K  L   +I+ II +          A S +  LPGFEGPLPF LETGYIGVGE+EE Q+
Sbjct  6    LKFLLPQLLIVLIIELA--------DASSVIKYLPGFEGPLPFELETGYIGVGEAEEDQM  57

Query  350  FYYFVKSETNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSL  171
            FYYF+KSE NP++DPL++W+SG  GCSSLTGL YE GPL F+ + YNG++P+L+    S 
Sbjct  58   FYYFIKSERNPEEDPLLVWLSGGPGCSSLTGLFYENGPLAFNVEPYNGSIPSLVSTTYSW  117

Query  170  TKNASIIFLDQLPNIGFSYSTN--TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            TK A+II+LDQ    GFSY+ N  +   +D  A+K V EFL++W D++ ++ SNPF++
Sbjct  118  TKVANIIYLDQPVGTGFSYTGNPFSDRTSDTRAAKRVNEFLRQWLDKHPEYFSNPFYV  175



>ref|XP_006415270.1| hypothetical protein EUTSA_v10009366mg [Eutrema salsugineum]
 gb|ESQ33623.1| hypothetical protein EUTSA_v10009366mg [Eutrema salsugineum]
Length=440

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H +++ S +  LPGFEGPLPFHLETGYIGVGE E++QLFYYF+KSE NP++DPL+LW++
Sbjct  21   QHGVNSASVISYLPGFEGPLPFHLETGYIGVGEEEKVQLFYYFIKSEKNPEEDPLLLWLT  80

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G   C++L+ L +E GPL F  + YNG+LP+L+    S TK A+IIFLDQ    GFSYST
Sbjct  81   GGPACTALSALAFENGPLTFKTEGYNGSLPSLISTSYSWTKVANIIFLDQPVGTGFSYST  140

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                   +D    K  YEFLQKW  +  +FVSNPF++
Sbjct  141  TPLAEKPSDTREVKQTYEFLQKWLVERPEFVSNPFYV  177



>ref|XP_006345611.1| PREDICTED: serine carboxypeptidase-like 19-like [Solanum tuberosum]
Length=388

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 128/179 (72%), Gaps = 5/179 (3%)
 Frame = -3

Query  533  EMKLSLNHFVILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQ  354
            +MK SL+  V+L I  +  ++P  V+ AGS V  LPGFEGPLPF LETGYIGVGE+ E+Q
Sbjct  5    KMKCSLH--VVLLIFVIFEIYPFFVL-AGSPVKYLPGFEGPLPFQLETGYIGVGEANEVQ  61

Query  353  LFYYFVKSETNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQS  174
            LFYYF+KS++N K DPLI W +G  GCS L+ +++E+GP+  D + YNG+LPTL  N  +
Sbjct  62   LFYYFIKSQSNSKIDPLIYWFTGGPGCSPLSAILFELGPITMDIRAYNGSLPTLSLNPYA  121

Query  173  LTKNASIIFLDQLPNIGFSYSTNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             TK A++IF+D     G+SY+T    N   D++++ + YEFL+KW  ++Q +++NPF++
Sbjct  122  YTKVANMIFVDLPVGSGYSYATTQKANYSDDLQSADHAYEFLRKWLIEHQVYLNNPFYV  180



>ref|XP_009761854.1| PREDICTED: serine carboxypeptidase-like 18 [Nicotiana sylvestris]
Length=429

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            AGS V +LPGF+GPLPF LETGYIGVG+SE++QLFYYF+KSE+NP+ DPL+LWI+G  GC
Sbjct  25   AGSPVKLLPGFKGPLPFELETGYIGVGDSEDVQLFYYFIKSESNPESDPLLLWITGGPGC  84

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTT-  96
            S+L+GLIY+IGP+ F+   YNG++PT+  N  S TK ASIIFLD     GFSY+      
Sbjct  85   SALSGLIYDIGPITFEPVEYNGSVPTMKLNPYSWTKVASIIFLDLPVGTGFSYARTPAAL  144

Query  95   -NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             +++++AS   YEFL KWF  + +F+ NP ++
Sbjct  145  QSSNLQASDQAYEFLYKWFLDHPEFLKNPLYV  176



>ref|NP_187656.1| serine carboxypeptidase-like 7 [Arabidopsis thaliana]
 sp|Q9SQX6.1|SCP7_ARATH RecName: Full=Serine carboxypeptidase-like 7; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG51371.1|AC011560_3 putative glucose acyltransferase; 97813-95037 [Arabidopsis thaliana]
 gb|AAF76347.1| glucose acyltransferase, putative [Arabidopsis thaliana]
 gb|AAM67067.1| putative glucose acyltransferase [Arabidopsis thaliana]
 gb|AEE74908.1| serine carboxypeptidase-like 7 [Arabidopsis thaliana]
Length=437

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S V  LPGF+GPLPF LETGYIGVGE EE+QLFYYF+KSE NP++DPL+LW+SG  GC
Sbjct  25   SASIVKSLPGFDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPQEDPLLLWLSGGPGC  84

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS++GL+YE GP+    +VYNGTLP+L+    S TK +SII+LDQ    GFSYS     N
Sbjct  85   SSISGLLYENGPVNVKIEVYNGTLPSLVSTTYSWTKVSSIIYLDQPVGTGFSYSRTKLVN  144

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D   +K ++EFL KW  ++Q+F SNPF++
Sbjct  145  KPSDSGEAKRIHEFLHKWLGKHQEFSSNPFYV  176



>ref|XP_006297701.1| hypothetical protein CARUB_v10013730mg [Capsella rubella]
 gb|EOA30599.1| hypothetical protein CARUB_v10013730mg [Capsella rubella]
Length=438

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = -3

Query  473  FPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILW  294
            F      + S V  LPGF+GPLPF LETGYIGVGE EE+QLFYYF+KSE NP++DPL+LW
Sbjct  19   FYSECTCSASIVKFLPGFDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPEEDPLLLW  78

Query  293  ISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSY  114
            +SG  GCSS++GL+YE GP+    +VYNGTLP+L+    S TK +SII+LDQ    GFSY
Sbjct  79   LSGGPGCSSISGLLYENGPMTVKHEVYNGTLPSLVSATYSWTKISSIIYLDQPVGTGFSY  138

Query  113  STNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
            S     N  +D    K ++EFL KW  ++Q+F+SNPF+
Sbjct  139  SRTQLVNKASDTGEVKRIHEFLHKWLGKHQEFLSNPFY  176



>gb|AAM64902.1| serine carboxypeptidase, putative [Arabidopsis thaliana]
Length=223

 Score =   176 bits (446),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 111/151 (74%), Gaps = 2/151 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S +  LPGFEGPLPF LETGYIGVGE +E Q+FYYF+KSE+NP+ DPL+LW+SG  GC
Sbjct  23   SSSIIKYLPGFEGPLPFELETGYIGVGEEDEDQMFYYFIKSESNPETDPLLLWLSGGPGC  82

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS TGLIYE GPL F  + YNG++PTL+    S TK A+II+LDQ    GFSYS N   +
Sbjct  83   SSFTGLIYENGPLGFKVEAYNGSIPTLVSTTYSWTKVANIIYLDQPVGTGFSYSRNPLAD  142

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
              +D  ++K V EFL+KW  ++ ++ SNPF+
Sbjct  143  IPSDTGSAKRVDEFLRKWLTKHPEYFSNPFY  173



>ref|XP_010426467.1| PREDICTED: serine carboxypeptidase-like 7 [Camelina sativa]
Length=441

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S V  LPGF+GPLPF LETGYIGVGE EE+QLFYYF+KSE NP++DPL+LW+SG  GC
Sbjct  29   SASIVKFLPGFDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPEEDPLLLWLSGGPGC  88

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS++GL+YE GP+    +VYNGTLP+L+    S TK +SII+LDQ    GFSYS     N
Sbjct  89   SSISGLLYENGPVTVKREVYNGTLPSLVSTTYSWTKVSSIIYLDQPVGTGFSYSRTQLVN  148

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D   +K ++EFL KW  ++Q+F+SNPF++
Sbjct  149  KPSDSGEAKRIHEFLYKWLGKHQEFLSNPFYV  180



>emb|CDY11114.1| BnaC06g23660D [Brassica napus]
Length=439

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 113/155 (73%), Gaps = 2/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   + S V  LPGF+GPLPF LETGYIGVGE EE+QLFYYF+KSE NP++DPL+LW+SG
Sbjct  24   HDADSASTVKFLPGFDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPEEDPLLLWLSG  83

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSS++GL++E GPL      YNG+LP+L+    S TK ++IIFLDQ    GFSYS  
Sbjct  84   GPGCSSISGLLFENGPLTMKLDAYNGSLPSLVSTTYSWTKLSNIIFLDQPVGTGFSYSRT  143

Query  104  TTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
            +  N  +D   ++ ++EFLQKW  ++Q+F SNPF+
Sbjct  144  SLHNKPSDSGEARRIHEFLQKWLGKHQEFTSNPFY  178



>ref|XP_006342727.1| PREDICTED: uncharacterized protein LOC102585123 [Solanum tuberosum]
Length=913

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 119/156 (76%), Gaps = 1/156 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            + V    S V+ LPGF+GPLPF+L+TGYIGVG+SEE+QLFYYFVKSE++P  DP +LW++
Sbjct  473  QSVPQNSSIVEFLPGFDGPLPFYLQTGYIGVGKSEEVQLFYYFVKSESDPSQDPFLLWLT  532

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS +GL YE+GPL F  K YNG+LP L+ +  S TK ASI+FL+Q  N GFSY+T
Sbjct  533  GGPGCSSFSGLAYEVGPLEFGQKAYNGSLPILVSSPYSWTKFASILFLEQPVNTGFSYAT  592

Query  107  NTT-TNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             +    TD++A  +VYEFL+KWF  + +F+SNPF++
Sbjct  593  TSAYKCTDLQACDHVYEFLRKWFVNHPEFISNPFYV  628


 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 121/168 (72%), Gaps = 2/168 (1%)
 Frame = -3

Query  500  LAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETN  321
            L  +  + V  + V    S V+ LPGF+GPLPF+LETGYIG+G+SEE+QLFYYF+KSE++
Sbjct  4    LLFLVTLFVHVQSVPQNSSIVEYLPGFDGPLPFYLETGYIGIGKSEEVQLFYYFIKSESD  63

Query  320  PKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLD  141
            P+ DPL+LW++G  GCSS TGL YE+GPL F  K YNG+LP L+ +  S TK ASI+FLD
Sbjct  64   PRKDPLLLWLTGGPGCSSFTGLAYEVGPLDFGQKAYNGSLPILVSSSYSWTKFASILFLD  123

Query  140  QLPNIGFSYSTNT--TTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            Q  N GFSY+T +     TD++A    YEFL+KW   + +F+ NPF++
Sbjct  124  QPANTGFSYATTSEACKCTDLQACDQAYEFLRKWLINHPEFILNPFYV  171



>ref|XP_010461188.1| PREDICTED: serine carboxypeptidase-like 18 [Camelina sativa]
Length=464

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 112/156 (72%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H + + S V  LPGF+G LPFHLETGYIGVGE E +QL+YYF+KSE NP++DP+ILW++G
Sbjct  21   HEVDSASVVSYLPGFDGLLPFHLETGYIGVGEEENVQLYYYFIKSENNPEEDPVILWLTG  80

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
               CS L+ L +EIGPL F  + YNG LP+L+    S TK ASIIFLDQ    GFSYSTN
Sbjct  81   GPACSVLSALAFEIGPLTFKTEGYNGGLPSLVSTSYSWTKVASIIFLDQPAGAGFSYSTN  140

Query  104  TTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               +  +D   +K+ YEFLQKW  +N +FVSNP ++
Sbjct  141  PLAHKPSDTGEAKHAYEFLQKWLVENPEFVSNPLYV  176



>ref|XP_009146838.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Brassica 
rapa]
Length=443

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 117/158 (74%), Gaps = 3/158 (2%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
             + + + S +  LPGFEGPLPF LETGYIGVGE E++QLFYYF+KSE NP++DP++LW+S
Sbjct  22   RNAVDSASIIKYLPGFEGPLPFELETGYIGVGEEEQVQLFYYFIKSEGNPEEDPILLWLS  81

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS++GL+YE GP+    +VYNGT+P+L+    S  K +SII+LDQ    GFSYS 
Sbjct  82   GGPGCSSISGLLYENGPMTVKLEVYNGTVPSLVSTTYSWAKISSIIYLDQPVGTGFSYSK  141

Query  107  N---TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                 +  +D+  +K ++EFL KW +++QDF+SNPF++
Sbjct  142  TQKLASKPSDLGEAKRIHEFLHKWLNKHQDFLSNPFYV  179



>ref|XP_009104816.1| PREDICTED: serine carboxypeptidase-like 2 [Brassica rapa]
Length=439

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 116/155 (75%), Gaps = 1/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   + S V  LPGFEGPLPF LETGYIGVGE EE+QLFYYF+KSE NP++DPL +W++G
Sbjct  24   HDADSASIVKFLPGFEGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPEEDPLFIWLNG  83

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST-  108
              GCSS++GL++E GPL    +VYNGTLP+L+    S TK +SII+LDQ    GFS+ST 
Sbjct  84   GPGCSSISGLLFENGPLTMKLEVYNGTLPSLVSTTYSWTKTSSIIYLDQPVGTGFSFSTQ  143

Query  107  NTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            +  T +D   ++ ++EFLQKW  ++++F+ NPF++
Sbjct  144  HVDTPSDSGEARRIHEFLQKWLAKHEEFIPNPFYV  178



>emb|CDY08603.1| BnaA05g28390D [Brassica napus]
Length=443

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 118/158 (75%), Gaps = 3/158 (2%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
             + + + S +  LPGFEGPLPF LETGYIGVGE E++QLFYYF+KSE NP++DP++LW+S
Sbjct  22   RNAVGSASIIKYLPGFEGPLPFELETGYIGVGEEEQVQLFYYFIKSEGNPEEDPILLWLS  81

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS++GL+YE GP+    +VYNGT+P+L+    S TK +SII+LDQ    GFSYS 
Sbjct  82   GGPGCSSISGLLYENGPMTVKLEVYNGTVPSLVSTTYSWTKISSIIYLDQPVGTGFSYSK  141

Query  107  N---TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                 +  +D+  +K ++EFL KW +++Q+F+SNPF++
Sbjct  142  TQKLASKPSDLGEAKRIHEFLHKWLNKHQEFLSNPFYV  179



>emb|CDY00943.1| BnaC05g42570D [Brassica napus]
Length=443

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 117/158 (74%), Gaps = 3/158 (2%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
             + + + S +  LPGFEGPLPF LETGYIGVGE E++QLFYYF+KSE NP++DP++LW+S
Sbjct  22   RNAVGSASIIKYLPGFEGPLPFELETGYIGVGEEEQVQLFYYFIKSEGNPEEDPILLWLS  81

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS++GL+YE GP+    +VYNGT+P+L+    S TK +SII+LDQ    GFSYS 
Sbjct  82   GGPGCSSISGLLYENGPMTMRLEVYNGTVPSLVSTTYSWTKISSIIYLDQPVGTGFSYSR  141

Query  107  N---TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                 +  +D+  +K ++EFL KW  ++Q+F+SNPF++
Sbjct  142  THKLASKPSDLGEAKRIHEFLHKWLKKHQEFLSNPFYV  179



>ref|XP_006297708.1| hypothetical protein CARUB_v10013737mg [Capsella rubella]
 gb|EOA30606.1| hypothetical protein CARUB_v10013737mg [Capsella rubella]
Length=437

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S V  LPGF+GPLPF LETGYIGVGE EE+QLFYYF+KSE NP++DPL+LW+SG  GC
Sbjct  25   SASTVKFLPGFDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPEEDPLLLWLSGGPGC  84

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS++GL+YE GP+    +VYNGTLP+L+    S TK +SI++LDQ    GFSYS     N
Sbjct  85   SSISGLLYENGPVTVKHEVYNGTLPSLVSTTYSWTKISSILYLDQPVGTGFSYSRTPFVN  144

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D   +K ++EFL KW  ++Q+F+SNPF++
Sbjct  145  KPSDSGEAKRIHEFLHKWLGRHQEFLSNPFYV  176



>ref|XP_006345532.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Solanum 
tuberosum]
Length=338

 Score =   178 bits (452),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 117/169 (69%), Gaps = 2/169 (1%)
 Frame = -3

Query  503  ILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSET  324
            IL +I    +       AG  V  LPGFE PLPF LETGYIGVGE++E+QLFYYF+KS++
Sbjct  6    ILILIVAFEIICLQPALAGLSVKYLPGFERPLPFQLETGYIGVGEADEVQLFYYFIKSQS  65

Query  323  NPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFL  144
            NPK DPLI W +G  GCS L+G+ +E GP+  D + YNG+LPTL  N  + TK AS+IF+
Sbjct  66   NPKVDPLIYWFTGGPGCSPLSGIFFEFGPITLDTRAYNGSLPTLSLNPHAYTKVASMIFV  125

Query  143  DQLPNIGFSYSTNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            D     GFSY+T    N   D++++ + YEFL+KW  ++Q++++NPF++
Sbjct  126  DLPVGTGFSYATTQKANYSDDLQSANHAYEFLRKWLIEHQEYLNNPFYV  174



>ref|XP_006356850.1| PREDICTED: serine carboxypeptidase-like 18-like [Solanum tuberosum]
Length=481

 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = -3

Query  458  ISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQ  279
            + A + V  LPGF+GPLPFHLETGY+GVG+ E+ QLFYYF+KSE++P +DPLILW++G  
Sbjct  37   VQAAATVKFLPGFDGPLPFHLETGYVGVGKEEKHQLFYYFIKSESDPGNDPLILWLTGGP  96

Query  278  GCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTT  99
            GCSS  G++YEIGPL++  K YNG+LPTL     S TK A+IIFL+Q  N GFSY+T   
Sbjct  97   GCSSFNGVVYEIGPLYYKQKKYNGSLPTLGVTPNSWTKVANIIFLEQPVNTGFSYATTPE  156

Query  98   TN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                 DV+A K+VYEFL KW   + +F SN F++
Sbjct  157  AMHVIDVDACKHVYEFLLKWLVDHPEFSSNNFYL  190



>ref|XP_009131551.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Brassica 
rapa]
Length=447

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 115/153 (75%), Gaps = 2/153 (1%)
 Frame = -3

Query  455  SAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQG  276
            + GS V  LPGFEGPLPF LETGYIGVG+ E++QLFYYF+KSE NPK+DPL++W++G  G
Sbjct  19   NCGSIVKFLPGFEGPLPFQLETGYIGVGDEEQVQLFYYFIKSEKNPKEDPLLIWLTGGPG  78

Query  275  CSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTT  96
            CSS+TGL++E GP+ F  + YNG  PTLL    S TK A+IIFLDQ    GFSY+T    
Sbjct  79   CSSITGLLFENGPVTFKVEDYNGGTPTLLSTTYSWTKVANIIFLDQPVGSGFSYATTQIL  138

Query  95   NT--DVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            +T  D   +K ++EF++KW  ++++F+SNPF++
Sbjct  139  DTPSDSGEAKRIHEFIRKWLSEHKEFISNPFYV  171



>ref|XP_010509542.1| PREDICTED: serine carboxypeptidase-like 9 isoform X1 [Camelina 
sativa]
Length=443

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 112/154 (73%), Gaps = 1/154 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   +GS +  LPGF+GPLPF LETGYIG+GE EE QLFYYF+KSE NPK+DPL+LW++G
Sbjct  17   HHAYSGSIIKFLPGFDGPLPFELETGYIGIGEEEEAQLFYYFIKSENNPKEDPLLLWLNG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-T  108
              GCSSLT L+ EIGP+   ++VYNG++P++     S TK A+IIFLDQ    GFSYS T
Sbjct  77   GPGCSSLTALLSEIGPVALKSEVYNGSVPSMFSTTYSWTKVANIIFLDQPVGAGFSYSRT  136

Query  107  NTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
            +    +D    K ++EFLQKW  ++  F+SNPF+
Sbjct  137  SLDKTSDTNEVKMIHEFLQKWLSKHPQFISNPFY  170



>emb|CDY68040.1| BnaAnng25990D [Brassica napus]
Length=435

 Score =   180 bits (457),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            A S +  LPGFEGPLPF LETGYIGVGE+EE Q+FYYF+KSE NP++DPL++W++G  GC
Sbjct  23   ASSIIKYLPGFEGPLPFQLETGYIGVGEAEEDQMFYYFIKSERNPEEDPLLVWLTGGPGC  82

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS +GL+YE GPL F  + YNG++PTL+    S TK A+II+LDQ    GFSYS N   +
Sbjct  83   SSFSGLVYENGPLAFKVEAYNGSIPTLVSTTYSWTKVANIIYLDQPVGTGFSYSRNPLAD  142

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D  ++K V EFL+KW D++ ++ SNPF++
Sbjct  143  IPSDTGSAKRVDEFLRKWLDKHPEYFSNPFYV  174



>ref|XP_010509543.1| PREDICTED: serine carboxypeptidase-like 9 isoform X2 [Camelina 
sativa]
Length=437

 Score =   181 bits (458),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 112/154 (73%), Gaps = 1/154 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   +GS +  LPGF+GPLPF LETGYIG+GE EE QLFYYF+KSE NPK+DPL+LW++G
Sbjct  17   HHAYSGSIIKFLPGFDGPLPFELETGYIGIGEEEEAQLFYYFIKSENNPKEDPLLLWLNG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-T  108
              GCSSLT L+ EIGP+   ++VYNG++P++     S TK A+IIFLDQ    GFSYS T
Sbjct  77   GPGCSSLTALLSEIGPVALKSEVYNGSVPSMFSTTYSWTKVANIIFLDQPVGAGFSYSRT  136

Query  107  NTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
            +    +D    K ++EFLQKW  ++  F+SNPF+
Sbjct  137  SLDKTSDTNEVKMIHEFLQKWLSKHPQFISNPFY  170



>ref|XP_006407354.1| hypothetical protein EUTSA_v10022069mg [Eutrema salsugineum]
 gb|ESQ48807.1| hypothetical protein EUTSA_v10022069mg [Eutrema salsugineum]
Length=435

 Score =   180 bits (457),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 115/156 (74%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   +GS V  LPG+EGPLPF LETGYIGVGE+EE Q+FYYF+KSE NP++DPL++W++G
Sbjct  19   HHADSGSVVRYLPGYEGPLPFELETGYIGVGEAEEDQMFYYFIKSERNPEEDPLLVWLTG  78

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSS +GL+YE GPL F  + YNG++P+L+    S TK A+II+LDQ    GFSYS N
Sbjct  79   GPGCSSFSGLVYENGPLAFKVEAYNGSIPSLVSTTYSWTKVANIIYLDQPVGTGFSYSRN  138

Query  104  TTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               +  +D  A+K V+EFL KW  ++ ++ SNPF++
Sbjct  139  PFADLPSDTGAAKRVHEFLGKWLAKHPEYFSNPFYV  174



>ref|XP_009131550.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Brassica 
rapa]
Length=449

 Score =   181 bits (458),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 115/153 (75%), Gaps = 2/153 (1%)
 Frame = -3

Query  455  SAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQG  276
            + GS V  LPGFEGPLPF LETGYIGVG+ E++QLFYYF+KSE NPK+DPL++W++G  G
Sbjct  19   NCGSIVKFLPGFEGPLPFQLETGYIGVGDEEQVQLFYYFIKSEKNPKEDPLLIWLTGGPG  78

Query  275  CSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTT  96
            CSS+TGL++E GP+ F  + YNG  PTLL    S TK A+IIFLDQ    GFSY+T    
Sbjct  79   CSSITGLLFENGPVTFKVEDYNGGTPTLLSTTYSWTKVANIIFLDQPVGSGFSYATTQIL  138

Query  95   NT--DVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            +T  D   +K ++EF++KW  ++++F+SNPF++
Sbjct  139  DTPSDSGEAKRIHEFIRKWLSEHKEFISNPFYV  171



>ref|XP_009104819.1| PREDICTED: serine carboxypeptidase-like 2 isoform X3 [Brassica 
rapa]
Length=399

 Score =   179 bits (455),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 111/156 (71%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   + S V  LPGFEGPLPF LETGYIGVGE EE+QLFYYF+KSE NP++DPL LW+SG
Sbjct  24   HDADSASIVKFLPGFEGPLPFELETGYIGVGEEEEMQLFYYFIKSERNPEEDPLFLWLSG  83

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSS+ GL++E GPL    + YNGTLP+L+    S TK  SIIFLDQ    GFSYS  
Sbjct  84   GPGCSSIHGLLFENGPLTMKLEEYNGTLPSLVSTTYSWTKTTSIIFLDQPVGTGFSYSRT  143

Query  104  TTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               +  +D   +K V+EFLQKW  ++++F+SNP ++
Sbjct  144  QLVDKPSDSGEAKRVHEFLQKWLGKHEEFISNPLYV  179



>ref|NP_001077946.1| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
 gb|AEC07387.1| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
Length=432

 Score =   180 bits (457),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 114/158 (72%), Gaps = 4/158 (3%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   +GS V  LPGFEGPLPF LETGYIG+GE EE+QLFYYF+KSE NP++DPL+LW+SG
Sbjct  18   HHAHSGSIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSEKNPEEDPLLLWLSG  77

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLT--KNASIIFLDQLPNIGFSYS  111
              GCSSLTGL++E GP+    +VYNG++P+L+    S T  K A+IIFLDQ    GFSYS
Sbjct  78   GPGCSSLTGLLFENGPVALKFEVYNGSVPSLVSTTYSWTKVKMANIIFLDQPVGSGFSYS  137

Query  110  TNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                 +  +D    K +YEFLQKW  ++Q F SNPF++
Sbjct  138  RTPLVDKISDTGEVKRIYEFLQKWLSKHQQFFSNPFYV  175



>ref|XP_009104818.1| PREDICTED: serine carboxypeptidase-like 2 isoform X2 [Brassica 
rapa]
Length=410

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 111/156 (71%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   + S V  LPGFEGPLPF LETGYIGVGE EE+QLFYYF+KSE NP++DPL LW+SG
Sbjct  24   HDADSASIVKFLPGFEGPLPFELETGYIGVGEEEEMQLFYYFIKSERNPEEDPLFLWLSG  83

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSS+ GL++E GPL    + YNGTLP+L+    S TK  SIIFLDQ    GFSYS  
Sbjct  84   GPGCSSIHGLLFENGPLTMKLEEYNGTLPSLVSTTYSWTKTTSIIFLDQPVGTGFSYSRT  143

Query  104  TTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               +  +D   +K V+EFLQKW  ++++F+SNP ++
Sbjct  144  QLVDKPSDSGEAKRVHEFLQKWLGKHEEFISNPLYV  179



>ref|XP_010498752.1| PREDICTED: serine carboxypeptidase-like 16 [Camelina sativa]
Length=435

 Score =   180 bits (457),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 113/151 (75%), Gaps = 2/151 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S V  LPGF+GPLPF LETGYIGVGE+EE Q+FYYF+KSE NP+ DPL+LW+SG  GC
Sbjct  23   SSSIVRYLPGFDGPLPFELETGYIGVGEAEEDQMFYYFIKSERNPEQDPLLLWLSGGPGC  82

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS TGLIYE GPL F  + YNG++PTL+    S TK A+II+LDQ    GFSYSTN   +
Sbjct  83   SSFTGLIYENGPLGFKVEAYNGSVPTLVSTTYSWTKFANIIYLDQPVGTGFSYSTNPVAD  142

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
              +D  ++K V EFL+KW  ++ ++++NPF+
Sbjct  143  IPSDTRSAKRVDEFLRKWLAKHPEYLTNPFY  173



>ref|XP_010464977.1| PREDICTED: serine carboxypeptidase-like 16 [Camelina sativa]
Length=436

 Score =   180 bits (457),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 113/151 (75%), Gaps = 2/151 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S V  LPGF+GPLPF LETGYIGVGE+EE Q+FYYF+KSE NP+ DPL+LW+SG  GC
Sbjct  24   SSSIVRYLPGFDGPLPFELETGYIGVGEAEEDQMFYYFIKSERNPEQDPLLLWLSGGPGC  83

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS TGLIYE GPL F  + YNG++PTL+    S TK A+II+LDQ    GFSYSTN   +
Sbjct  84   SSFTGLIYENGPLGFKVEAYNGSVPTLVSTTYSWTKVANIIYLDQPVGTGFSYSTNPLAD  143

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
              +D  ++K V EFL+KW  ++ ++++NPF+
Sbjct  144  IPSDTRSAKRVDEFLRKWLAKHPEYLTNPFY  174



>emb|CDX83199.1| BnaA03g23070D [Brassica napus]
Length=222

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 110/154 (71%), Gaps = 1/154 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   +GS V  LPGFEGPLPF LETGYIG+GE E +QLFYYF+KSE NPK+DPL+LW++G
Sbjct  15   HHADSGSIVKFLPGFEGPLPFELETGYIGIGEEENLQLFYYFIKSEKNPKEDPLLLWLNG  74

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-T  108
              GCSSL GL++E GP+    +VYNG+L +L+    S T+ A+II+LDQ    GFSYS T
Sbjct  75   GPGCSSLEGLLFENGPVAVKVEVYNGSLVSLVSTPYSWTQMANIIYLDQPIGAGFSYSRT  134

Query  107  NTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
                 +D   +K ++EFLQKW  ++  F SNPF+
Sbjct  135  PLGKTSDTNEAKMIHEFLQKWLSKHPQFFSNPFY  168



>ref|XP_006345531.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Solanum 
tuberosum]
Length=389

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 117/169 (69%), Gaps = 2/169 (1%)
 Frame = -3

Query  503  ILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSET  324
            IL +I    +       AG  V  LPGFE PLPF LETGYIGVGE++E+QLFYYF+KS++
Sbjct  6    ILILIVAFEIICLQPALAGLSVKYLPGFERPLPFQLETGYIGVGEADEVQLFYYFIKSQS  65

Query  323  NPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFL  144
            NPK DPLI W +G  GCS L+G+ +E GP+  D + YNG+LPTL  N  + TK AS+IF+
Sbjct  66   NPKVDPLIYWFTGGPGCSPLSGIFFEFGPITLDTRAYNGSLPTLSLNPHAYTKVASMIFV  125

Query  143  DQLPNIGFSYSTNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            D     GFSY+T    N   D++++ + YEFL+KW  ++Q++++NPF++
Sbjct  126  DLPVGTGFSYATTQKANYSDDLQSANHAYEFLRKWLIEHQEYLNNPFYV  174



>emb|CDX78700.1| BnaA03g06120D [Brassica napus]
Length=456

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 115/153 (75%), Gaps = 2/153 (1%)
 Frame = -3

Query  455  SAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQG  276
            + GS V  LPGFEGPLPF LETGYIGVG+ E++QLFYYF+KSE NPK+DPL++W++G  G
Sbjct  19   NCGSIVKFLPGFEGPLPFQLETGYIGVGDEEQVQLFYYFIKSEKNPKEDPLLIWLTGGPG  78

Query  275  CSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNT--  102
            CSS+TGL++E GP+ F  + YNG  PTLL    S TK A+IIFLDQ    GFSY+T    
Sbjct  79   CSSITGLLFENGPVTFKVEDYNGGTPTLLSTTYSWTKVANIIFLDQPVGSGFSYATTQFL  138

Query  101  TTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             T +D   +K ++EF++KW  ++++F+SNPF++
Sbjct  139  DTPSDSGEAKRIHEFIRKWLSEHKEFISNPFYV  171



>ref|XP_009120840.1| PREDICTED: serine carboxypeptidase-like 15 [Brassica rapa]
Length=436

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
             GS V  LPGFEGPLPF LETGYIGVGE E+ QLFYYF+KSE NP++DPL++W++G  GC
Sbjct  24   GGSIVRYLPGFEGPLPFQLETGYIGVGEGEKDQLFYYFIKSERNPEEDPLLVWLAGGPGC  83

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS +GL+YE GPL F  + YNG++P+L+    S TK A+II+LDQ    GFSYS N  ++
Sbjct  84   SSFSGLVYENGPLAFKVETYNGSVPSLVSTTYSWTKVANIIYLDQPVGTGFSYSRNQLSD  143

Query  92   T--DVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            T  D E +K V EFL+KW  ++ +++SNP ++
Sbjct  144  TPSDTEVAKRVNEFLRKWLAKHPEYLSNPLYV  175



>gb|KFK38432.1| hypothetical protein AALP_AA3G112600 [Arabis alpina]
Length=441

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 112/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  455  SAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQG  276
            S+ S V  LPGF+GPLPF LETGYIG+GE EE+QLFYYF+KSE NP+ DPL+LW+SG  G
Sbjct  28   SSTSIVKFLPGFDGPLPFELETGYIGIGEKEEVQLFYYFIKSERNPEQDPLLLWLSGGPG  87

Query  275  CSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTT  96
            CS ++GL++E GPL      YNGTLP+L+    S TK +SII+LDQ    GFSYS     
Sbjct  88   CSCISGLLFENGPLTVKLDAYNGTLPSLVSTTYSWTKVSSIIYLDQPVGTGFSYSRTQLV  147

Query  95   N--TDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
            +  +D   +K ++EFLQKW D++Q+F+SNPF+
Sbjct  148  DKPSDSGEAKRIHEFLQKWLDKHQEFLSNPFY  179



>emb|CDX68232.1| BnaA07g22720D [Brassica napus]
Length=440

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 115/157 (73%), Gaps = 2/157 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H  ++ S V  LPGFEGPLPF LETGYIGVGE EE+QLFYYF+KSE NPK+DPL+LW+S
Sbjct  24   QHQSASASIVKFLPGFEGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLS  83

Query  287  GEQGCSSLTGLIYE-IGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS  111
            G  GCSS+ GL++E  GPL    +VYNGTLP+L+    S TK  SIIFLDQ    GFS++
Sbjct  84   GGPGCSSIHGLLFENAGPLTLKHEVYNGTLPSLISTTYSWTKTTSIIFLDQPVGTGFSFA  143

Query  110  TNTT-TNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            T    T +D   ++ ++EFL KW  ++++++ NPF++
Sbjct  144  TQVVDTPSDSGEAERIHEFLHKWLGKHEEYIPNPFYV  180



>ref|XP_006415429.1| hypothetical protein EUTSA_v10007675mg [Eutrema salsugineum]
 gb|ESQ33782.1| hypothetical protein EUTSA_v10007675mg [Eutrema salsugineum]
Length=435

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 118/157 (75%), Gaps = 3/157 (2%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H  S+ S +  LPGFEGPLPF LETGYIGVGE+EE Q+FYYF+KSE NPK+DPL++W++
Sbjct  19   QHADSS-SIIRYLPGFEGPLPFELETGYIGVGEAEEDQMFYYFIKSERNPKEDPLLVWLT  77

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS +GL+YE GPL F  + YNG++P+L+    S TK A+II+LDQ    GFSYS 
Sbjct  78   GGPGCSSFSGLVYENGPLAFKVEPYNGSIPSLVSTTYSWTKVANIIYLDQPVGTGFSYSR  137

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            N   +  +D  ++K V+EF++KW D++ ++ SNPF++
Sbjct  138  NPLADIPSDTGSAKRVHEFVRKWLDKHPEYFSNPFYV  174



>ref|XP_009768014.1| PREDICTED: serine carboxypeptidase-like 17 [Nicotiana sylvestris]
Length=477

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 126/173 (73%), Gaps = 4/173 (2%)
 Frame = -3

Query  512  HFVILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVK  333
            ++ +L    V+ +FP+ V+ AGS V  LPGFEGPLPF LETGYIGVGE++E+QL+YYFVK
Sbjct  14   YYTVLFCFLVLAIFPQLVV-AGSPVKYLPGFEGPLPFELETGYIGVGEADEVQLYYYFVK  72

Query  332  SETNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASI  153
            S++NPK DPLILW +G  GCS+L  +  E+GP+ FD + YNG+LPTL  N  + TK A+I
Sbjct  73   SQSNPKIDPLILWFTGGPGCSTLNAVALELGPMMFDDREYNGSLPTLSSNPFAYTKVANI  132

Query  152  IFLDQLPNIGFSYSTNTTTN--TDVEASKYVYEFLQKW-FDQNQDFVSNPFFI  3
            IF+D     GFSY+T   +N   +++A  + Y+FL+KW   ++ ++++NPF++
Sbjct  133  IFVDFPVGTGFSYATTVKSNHSNNLQAGDHAYQFLRKWLLTEHPEYINNPFYV  185



>ref|XP_002878648.1| SCPL11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54907.1| SCPL11 [Arabidopsis lyrata subsp. lyrata]
Length=429

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 110/155 (71%), Gaps = 2/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H + +GS V  LPGFEGPLPF LETGYIG+GE EE QLFYYF+KSE NPK+DPL+LW++G
Sbjct  17   HHVDSGSIVKFLPGFEGPLPFELETGYIGIGEEEESQLFYYFIKSENNPKEDPLLLWLNG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSS+TGL +E GPL    +VYNG++P+L+    S TK A+IIFLDQ    GFSYS  
Sbjct  77   GPGCSSITGLFFENGPLALKLEVYNGSVPSLISTTYSWTKMANIIFLDQPVGTGFSYSRT  136

Query  104  TTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
               +  +D    K + EFLQKW  ++  F SNPF+
Sbjct  137  PLIDKPSDTSEVKRIREFLQKWLSKHPQFSSNPFY  171



>ref|NP_973517.1| serine carboxypeptidase-like 9 [Arabidopsis thaliana]
 gb|AEC07396.1| serine carboxypeptidase-like 9 [Arabidopsis thaliana]
Length=437

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 118/169 (70%), Gaps = 1/169 (1%)
 Frame = -3

Query  506  VILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSE  327
            +IL  + ++ +   H + +GS V  LPGF+GPLPF LETGYIG+GE E +Q FYYF+KS+
Sbjct  3    LILKFMLLILLVSSHHVRSGSIVKFLPGFKGPLPFELETGYIGIGEEENVQFFYYFIKSD  62

Query  326  TNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIF  147
             NP++DPLI+W++G  GCS L+GL +E GPL    KVYNG++P+L+    S TK A+IIF
Sbjct  63   KNPQEDPLIIWLNGGPGCSCLSGLFFENGPLALKNKVYNGSVPSLVSTTYSWTKTANIIF  122

Query  146  LDQLPNIGFSYS-TNTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            LDQ    GFSYS T     +D    K ++EFLQKW  ++  F+SNPF++
Sbjct  123  LDQPVGSGFSYSKTPIERTSDTSEVKKIHEFLQKWLIKHPQFLSNPFYV  171



>ref|XP_006415266.1| hypothetical protein EUTSA_v10007559mg [Eutrema salsugineum]
 gb|ESQ33619.1| hypothetical protein EUTSA_v10007559mg [Eutrema salsugineum]
Length=465

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 116/157 (74%), Gaps = 2/157 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H +++ S +  LPGFEGPLPFHLETGYIGVGE E++QLFYYFVKSE NP++DPL++W+S
Sbjct  21   QHGVNSASVISHLPGFEGPLPFHLETGYIGVGEGEKVQLFYYFVKSENNPEEDPLLIWLS  80

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G   CSS++ L +EIGPL F+ +  +G LP+L+    S TK ASIIFLDQ    GFSYST
Sbjct  81   GGPACSSISALAFEIGPLTFNTEGNSGGLPSLVSTSYSWTKIASIIFLDQPVGTGFSYST  140

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            N   +  +D   +K  YEFLQKW  ++ +FVSN F++
Sbjct  141  NPLVDKPSDTGEAKQTYEFLQKWLVEHPEFVSNHFYV  177



>ref|NP_179884.1| serine carboxypeptidase-like 9 [Arabidopsis thaliana]
 sp|O64811.1|SCP9_ARATH RecName: Full=Serine carboxypeptidase-like 9; AltName: Full=Sinapoylglucose--sinapoylglucose 
O-sinapoyltransferase; Short=SST; 
AltName: Full=Sinapoylglucose--sinapoylglucose acyltransferase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC17818.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AEC07397.1| serine carboxypeptidase-like 9 [Arabidopsis thaliana]
Length=437

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 118/169 (70%), Gaps = 1/169 (1%)
 Frame = -3

Query  506  VILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSE  327
            +IL  + ++ +   H + +GS V  LPGF+GPLPF LETGYIG+GE E +Q FYYF+KS+
Sbjct  3    LILKFMLLILLVSSHHVRSGSIVKFLPGFKGPLPFELETGYIGIGEEENVQFFYYFIKSD  62

Query  326  TNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIF  147
             NP++DPLI+W++G  GCS L+GL +E GPL    KVYNG++P+L+    S TK A+IIF
Sbjct  63   KNPQEDPLIIWLNGGPGCSCLSGLFFENGPLALKNKVYNGSVPSLVSTTYSWTKTANIIF  122

Query  146  LDQLPNIGFSYS-TNTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            LDQ    GFSYS T     +D    K ++EFLQKW  ++  F+SNPF++
Sbjct  123  LDQPVGSGFSYSKTPIERTSDTSEVKKIHEFLQKWLIKHPQFLSNPFYV  171



>ref|XP_006297707.1| hypothetical protein CARUB_v10013735mg [Capsella rubella]
 gb|EOA30605.1| hypothetical protein CARUB_v10013735mg [Capsella rubella]
Length=437

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 112/151 (74%), Gaps = 2/151 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S +  LPG++GPLPF LETGYIGVGE EE Q+FYYF+KSE+NP+ DPL+LW+SG  GC
Sbjct  25   SSSIIRYLPGYDGPLPFELETGYIGVGEEEEEQMFYYFIKSESNPEKDPLLLWLSGGPGC  84

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS TGLIYE GPL F  + YNG++PTL+    S TK A+II+LDQ    GFSYSTN   +
Sbjct  85   SSFTGLIYENGPLGFKVEAYNGSIPTLVSTTYSWTKAANIIYLDQPVGTGFSYSTNPLAD  144

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
              +D  ++K V EFL+KW  ++ ++ SNPF+
Sbjct  145  IPSDTRSAKRVDEFLRKWLAKHPEYFSNPFY  175



>ref|XP_009114926.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
18 [Brassica rapa]
Length=468

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H +   S +  LPGFEGPLPFHLETGYIGVGE E++QLFYYF+KSE  P++DPL++W++
Sbjct  24   QHGVDTASVISHLPGFEGPLPFHLETGYIGVGEEEKVQLFYYFIKSENKPEEDPLLIWLT  83

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G   C++L+ L +EIGPL F  + YNG LP+L+    S TK ASIIFLDQ    GFSYST
Sbjct  84   GGPACTALSALAFEIGPLTFKTEGYNGGLPSLVSTSYSWTKVASIIFLDQPVGTGFSYST  143

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                +  +D   +K  YEFLQKW  ++ +FVSNP ++
Sbjct  144  TPLADKPSDTGEAKQTYEFLQKWLVEHPEFVSNPLYV  180



>gb|KFK38585.1| hypothetical protein AALP_AA3G132800 [Arabis alpina]
Length=435

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 116/156 (74%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   +GS +  LPG+EGPLPF LETGYIGVG++EE QLFYYF+KSE+NPK+DPL++W++G
Sbjct  19   HHGDSGSIIKYLPGYEGPLPFELETGYIGVGDAEEDQLFYYFIKSESNPKEDPLLVWLTG  78

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSS +GL+YE GPL F  + YNG++PTLL    S TK A+II+LDQ    GFSYSTN
Sbjct  79   GPGCSSFSGLVYENGPLAFKVETYNGSVPTLLSTTYSWTKVANIIYLDQPVGAGFSYSTN  138

Query  104  TTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               +  +D  + K V EF++KW  ++ ++ SNPF++
Sbjct  139  PFADRPSDKGSVKRVDEFVRKWLAEHPEYYSNPFYV  174



>ref|XP_006404766.1| hypothetical protein EUTSA_v10000651mg [Eutrema salsugineum]
 gb|ESQ46219.1| hypothetical protein EUTSA_v10000651mg [Eutrema salsugineum]
Length=435

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 113/156 (72%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H + +GS V  LPGFEGPLPF LETGYIG+GE EE+QLFYYF+KSE NP++DPL++W++G
Sbjct  18   HHVDSGSVVKFLPGFEGPLPFELETGYIGLGEEEEVQLFYYFIKSEKNPQEDPLLIWLTG  77

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSSL  L++E GPL    +VYNG+LP+L+    S TK A+IIFLDQ    GFSYS  
Sbjct  78   GPGCSSLFALLFENGPLALKFEVYNGSLPSLVSTSYSWTKMANIIFLDQPVGGGFSYSKT  137

Query  104  TTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               N  +D    K ++EFLQKW  ++ +F SNPF++
Sbjct  138  PLANKVSDTGEVKIIHEFLQKWLSKHPEFFSNPFYV  173



>ref|XP_006415268.1| hypothetical protein EUTSA_v10007570mg [Eutrema salsugineum]
 gb|ESQ33621.1| hypothetical protein EUTSA_v10007570mg [Eutrema salsugineum]
Length=464

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H ++  S +  LPGFEGPLPFHLETGYIGVGE E++QLFYYF+KSE NP++DPL++W++
Sbjct  21   QHGVNPASVISHLPGFEGPLPFHLETGYIGVGEEEKVQLFYYFIKSENNPEEDPLLIWLT  80

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G   C++L+ L +EIGPL F  + YNG+LP+L+    S TK A+IIFLDQ    GFSYST
Sbjct  81   GGPACTALSALAFEIGPLTFKTEGYNGSLPSLISTSYSWTKVANIIFLDQPVGTGFSYST  140

Query  107  NTTT--NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               T   +D   +K  Y+FLQKW  +  +FVSNP ++
Sbjct  141  TRLTYKPSDTGEAKQTYQFLQKWLVEYPEFVSNPLYV  177



>ref|XP_006401830.1| hypothetical protein EUTSA_v10015511mg [Eutrema salsugineum]
 gb|ESQ43283.1| hypothetical protein EUTSA_v10015511mg [Eutrema salsugineum]
Length=405

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 113/153 (74%), Gaps = 3/153 (2%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S +  LPGFEGPLPF LETGYIGVGE+EE+QLFYYF+KSE NP++DPL+LW+SG  GC
Sbjct  21   SASIIRSLPGFEGPLPFELETGYIGVGEAEEVQLFYYFIKSERNPEEDPLLLWLSGGPGC  80

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SSL+GL+YE GP+      Y+G +P+L+    S TK A++I+LDQ    GFSYS     +
Sbjct  81   SSLSGLLYENGPVTIKMDGYSGGIPSLVSTTYSWTKIANMIYLDQPVGSGFSYSKTPLLD  140

Query  92   ---TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               +D   +K V+EFLQKW D++ DFVSNPF++
Sbjct  141  DIPSDTGEAKRVHEFLQKWLDKHPDFVSNPFYV  173



>ref|XP_010464978.1| PREDICTED: serine carboxypeptidase-like 14 [Camelina sativa]
Length=435

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            +GS +  LPGFEGPLPF LETGYIGVGE++E QLFYYF+KSE+NP+ DPL++W++G  GC
Sbjct  23   SGSTITSLPGFEGPLPFELETGYIGVGEADEDQLFYYFIKSESNPEQDPLLVWLTGGPGC  82

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS +GL+YE GPL F  + YNG++PTL+    S TK A+II+LDQ    GFSYSTN   +
Sbjct  83   SSFSGLVYENGPLAFKVETYNGSVPTLVSTTYSWTKVANIIYLDQPVCTGFSYSTNPLAD  142

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D  ++K V EF++KW  ++ ++ SNPF++
Sbjct  143  IPSDTGSAKRVNEFVRKWLAKHPEYFSNPFYV  174



>ref|XP_010515304.1| PREDICTED: serine carboxypeptidase-like 7 [Camelina sativa]
Length=442

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S V  LPGF+G LPF LETGYIGVGE EE+QLFYYF+KSE NP++DPL+LW+SG  GC
Sbjct  30   SASIVKSLPGFDGLLPFELETGYIGVGEEEEVQLFYYFIKSERNPEEDPLLLWLSGGPGC  89

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS++GL+YE GPL    +VYNGTLP+L+    S TK +SII+LDQ    GFSYS     N
Sbjct  90   SSISGLLYENGPLTVKREVYNGTLPSLVSTTYSWTKVSSIIYLDQPVGTGFSYSRTQLVN  149

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D   +K ++EFL KW  ++Q+F+SNPF++
Sbjct  150  KPSDSGEAKRIHEFLYKWLGKHQEFLSNPFYV  181



>ref|XP_004238557.1| PREDICTED: uncharacterized protein LOC101252581 [Solanum lycopersicum]
Length=921

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 119/160 (74%), Gaps = 2/160 (1%)
 Frame = -3

Query  476  VFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLIL  297
            V  E   + GS V  LPGF+G LPF LETGY+GVG+SE +QLFYYF++SE+ P  DPL+L
Sbjct  478  VVAELAAATGSTVKFLPGFQGQLPFELETGYVGVGDSENVQLFYYFIESESEPDSDPLML  537

Query  296  WISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFS  117
            WI+G  GCS+L+GL+YE+GP+ F+A  YNG+ PT++ N  S TK +SIIFLD     GFS
Sbjct  538  WITGGPGCSALSGLVYEMGPITFEAVEYNGSFPTMILNPYSWTKVSSIIFLDLPVGTGFS  597

Query  116  YSTNTTT--NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            Y+T      ++D++AS++ Y+FL+KWF  +Q+F+ NPF++
Sbjct  598  YATTPAALQSSDLQASEHAYQFLRKWFVDHQEFLENPFYV  637


 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 127/177 (72%), Gaps = 8/177 (5%)
 Frame = -3

Query  527  KLSLNHFVILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLF  348
            K+ L +++ L ++       +H  +A ++V  LPGFEGPLPF LETGY+GVG+SE +QLF
Sbjct  6    KIQLYYYLFLLVVVA-----DHA-AASTQVKFLPGFEGPLPFQLETGYVGVGDSEIVQLF  59

Query  347  YYFVKSETNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLT  168
            YYF++SE++P  DPL+LWI+G  GCS+L+GLIYEIGP+ F+   YNG+ P ++ N  S T
Sbjct  60   YYFIESESDPDSDPLMLWITGGPGCSALSGLIYEIGPITFEPVEYNGSFPKMILNPYSWT  119

Query  167  KNASIIFLDQLPNIGFSYSTN--TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            K +SIIFLD     GFSY+T      ++D++AS + Y+FL+KWF  + +F+ NPF++
Sbjct  120  KVSSIIFLDLSVGTGFSYATTLAARQSSDLQASDHAYQFLRKWFVDHPEFLKNPFYV  176



>ref|XP_002882669.1| hypothetical protein ARALYDRAFT_478377 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58928.1| hypothetical protein ARALYDRAFT_478377 [Arabidopsis lyrata subsp. 
lyrata]
Length=437

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S V  LPGF+GPLPF LETGYIGVG+ EE+QLFYYF+KSE +P++DPL+LW+SG  GC
Sbjct  25   SSSIVKSLPGFDGPLPFELETGYIGVGKEEEVQLFYYFIKSERSPQEDPLLLWLSGGPGC  84

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS++GL+YE GP+    +VYNGTLP+L+    S TK +SII+LDQ    GFSYS     N
Sbjct  85   SSISGLLYENGPVTVKLEVYNGTLPSLVATTYSWTKVSSIIYLDQPVGTGFSYSRTQLVN  144

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D   +K ++EFL KW  ++Q+F SNPF++
Sbjct  145  KPSDSGEAKRIHEFLHKWLGKHQEFSSNPFYV  176



>ref|XP_009102688.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
15 [Brassica rapa]
Length=435

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            A S +  LPGFEGPLPF LETGYIGVGE+EE Q+FYYF+KSE NP++DPL++W++G  GC
Sbjct  23   ASSIIKYLPGFEGPLPFQLETGYIGVGEAEEDQMFYYFIKSERNPEEDPLLVWLTGGPGC  82

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS +GL+YE GPL F  + Y+G++PTL+    S TK A+II+LDQ    GFSYS N   +
Sbjct  83   SSFSGLVYENGPLAFKVEAYDGSIPTLVSTTYSWTKVANIIYLDQPVGTGFSYSRNPLAD  142

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D  ++K V EFL+KW D++ ++ SNPF++
Sbjct  143  IPSDTGSAKRVDEFLRKWLDKHPEYFSNPFYV  174



>emb|CDY30277.1| BnaC04g31880D [Brassica napus]
Length=439

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            + + + S +  LPGFEGPLPF  ETGYIGVGE E++QLFYYF+KSE NP++DPL+LW+SG
Sbjct  22   NAVDSTSIIKYLPGFEGPLPFEFETGYIGVGEEEQVQLFYYFIKSERNPEEDPLLLWLSG  81

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSS++GL+YE GP+    +VYNGTLP+L+    S TK +SII+LDQ    GFSYS  
Sbjct  82   GPGCSSISGLLYENGPVTVKFEVYNGTLPSLIATTYSWTKISSIIYLDQPVGTGFSYSRT  141

Query  104  --TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
               +  +D    K ++EFLQKW ++ Q+F+SNPF+
Sbjct  142  QLASKPSDSGEVKLIHEFLQKWLNKRQEFLSNPFY  176



>ref|XP_006296383.1| hypothetical protein CARUB_v10025556mg [Capsella rubella]
 gb|EOA29281.1| hypothetical protein CARUB_v10025556mg [Capsella rubella]
Length=439

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 110/152 (72%), Gaps = 1/152 (1%)
 Frame = -3

Query  458  ISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQ  279
            + AGS V  LPGFEGPLPF LETGYIG+GE EE+QLFYYFVKSE NPK+DPL++W+SG  
Sbjct  21   VDAGSIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFVKSENNPKEDPLLVWLSGGP  80

Query  278  GCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTT  99
            G SSLT L+ EIGPL   ++ YNGT+P+L  +  S TK A+IIFLDQ    GFSYS    
Sbjct  81   GSSSLTALVSEIGPLVLKSEFYNGTVPSLFSSTYSWTKVANIIFLDQPVGAGFSYSKTPL  140

Query  98   TNT-DVEASKYVYEFLQKWFDQNQDFVSNPFF  6
              T D    + ++EFLQKW  ++  ++SNPF+
Sbjct  141  GKTGDTNEIQMIHEFLQKWLHKHPQYISNPFY  172



>ref|XP_010472296.1| PREDICTED: serine carboxypeptidase-like 11 isoform X1 [Camelina 
sativa]
Length=432

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 111/153 (73%), Gaps = 2/153 (1%)
 Frame = -3

Query  458  ISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQ  279
            + +GS V  LPGFEGPLPF LETGYIG+GE EE+QLFYYF+KSE NPK+DPL+LW++G  
Sbjct  18   VDSGSIVKFLPGFEGPLPFELETGYIGIGEKEEMQLFYYFIKSENNPKEDPLLLWLNGGP  77

Query  278  GCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTT  99
            GCSS TGL +E GPL F ++VYNG++P+L+    S TK  +IIFLDQ    GFSYS    
Sbjct  78   GCSSNTGLFFENGPLAFKSEVYNGSVPSLVSTTYSWTKMVNIIFLDQPVRTGFSYSRTPL  137

Query  98   TN--TDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
             +  +D    K + EFLQKW +++  F SNPF+
Sbjct  138  IDKPSDTGEVKRIREFLQKWLNKHPQFSSNPFY  170



>gb|KFK27800.1| hypothetical protein AALP_AA8G430800 [Arabis alpina]
Length=1257

 Score =   185 bits (469),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 86/160 (54%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = -3

Query  476  VFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLIL  297
            VF  H   +GS V  LPGFEGPLPF LETGYIGVGE EE+QLFYYF+KSE NP++DPL++
Sbjct  13   VFSHHA-DSGSIVKFLPGFEGPLPFELETGYIGVGEEEELQLFYYFIKSENNPQEDPLLI  71

Query  296  WISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFS  117
            W++G  GCSS+ G +YEIGPL    + Y+G +P+L+    S TK A+I+FLDQ    GFS
Sbjct  72   WMTGGPGCSSVNGFLYEIGPLTIKIEAYDGNIPSLVPTTYSWTKLANILFLDQPVGSGFS  131

Query  116  YSTNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            Y     T+  +D      V+EFL+KW D++ +F SNPF++
Sbjct  132  YKRTPITDKSSDTLEVVRVHEFLRKWLDKHPEFFSNPFYV  171



>ref|XP_006294236.1| hypothetical protein CARUB_v10023233mg [Capsella rubella]
 gb|EOA27134.1| hypothetical protein CARUB_v10023233mg [Capsella rubella]
Length=439

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 108/147 (73%), Gaps = 1/147 (1%)
 Frame = -3

Query  440  VDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGCSSLT  261
            V  LPGFEGPLPF LETGYIG+GE EE+QLFYYF+KSE NPK+DPL+LW+ G  G SS+T
Sbjct  27   VKFLPGFEGPLPFELETGYIGIGEDEEVQLFYYFIKSENNPKEDPLLLWLDGGPGTSSVT  86

Query  260  GLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-TNTTTNTDV  84
            GL  EIGPL   ++VYNG++P+L+    S TK A+IIFLDQ    GFSYS T     +D 
Sbjct  87   GLTVEIGPLTLKSEVYNGSVPSLVSTTYSWTKMANIIFLDQPVGSGFSYSKTPPNKTSDT  146

Query  83   EASKYVYEFLQKWFDQNQDFVSNPFFI  3
               K ++EFLQKW  ++Q F SNPF++
Sbjct  147  NEVKNIHEFLQKWLSKHQQFYSNPFYV  173



>gb|KFK27799.1| hypothetical protein AALP_AA8G430800 [Arabis alpina]
Length=1234

 Score =   184 bits (468),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 86/160 (54%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = -3

Query  476  VFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLIL  297
            VF  H   +GS V  LPGFEGPLPF LETGYIGVGE EE+QLFYYF+KSE NP++DPL++
Sbjct  13   VFSHHA-DSGSIVKFLPGFEGPLPFELETGYIGVGEEEELQLFYYFIKSENNPQEDPLLI  71

Query  296  WISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFS  117
            W++G  GCSS+ G +YEIGPL    + Y+G +P+L+    S TK A+I+FLDQ    GFS
Sbjct  72   WMTGGPGCSSVNGFLYEIGPLTIKIEAYDGNIPSLVPTTYSWTKLANILFLDQPVGSGFS  131

Query  116  YSTNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            Y     T+  +D      V+EFL+KW D++ +F SNPF++
Sbjct  132  YKRTPITDKSSDTLEVVRVHEFLRKWLDKHPEFFSNPFYV  171



>ref|NP_174619.1| serine carboxypeptidase-like 18 [Arabidopsis thaliana]
 gb|AAG51208.1|AC051630_5 serine carboxypeptidase, putative; 88458-86107 [Arabidopsis thaliana]
 gb|AEE31604.1| serine carboxypeptidase-like 18 [Arabidopsis thaliana]
Length=446

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H + + S +  LPGFEG LPFHLETGYIGVGE E++QLFYYF+KSE NP++DPLI+W++
Sbjct  20   QHDVDSASVISYLPGFEGLLPFHLETGYIGVGEGEKVQLFYYFIKSENNPEEDPLIIWLT  79

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G   C++L+ L +EIGPL F  + YNG LP+L+    S TK ASIIFLDQ    G+SYST
Sbjct  80   GGPACTALSALAFEIGPLTFKTEGYNGGLPSLVSTSYSWTKVASIIFLDQPVGTGYSYST  139

Query  107  N--TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               +   +D   +K  YEFLQKW  +N  FVSNP ++
Sbjct  140  TPLSYKPSDTGEAKQTYEFLQKWLVENPQFVSNPIYV  176



>gb|KFK27798.1| hypothetical protein AALP_AA8G430800 [Arabis alpina]
Length=1250

 Score =   184 bits (468),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 86/160 (54%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = -3

Query  476  VFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLIL  297
            VF  H   +GS V  LPGFEGPLPF LETGYIGVGE EE+QLFYYF+KSE NP++DPL++
Sbjct  13   VFSHHA-DSGSIVKFLPGFEGPLPFELETGYIGVGEEEELQLFYYFIKSENNPQEDPLLI  71

Query  296  WISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFS  117
            W++G  GCSS+ G +YEIGPL    + Y+G +P+L+    S TK A+I+FLDQ    GFS
Sbjct  72   WMTGGPGCSSVNGFLYEIGPLTIKIEAYDGNIPSLVPTTYSWTKLANILFLDQPVGSGFS  131

Query  116  YSTNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            Y     T+  +D      V+EFL+KW D++ +F SNPF++
Sbjct  132  YKRTPITDKSSDTLEVVRVHEFLRKWLDKHPEFFSNPFYV  171



>ref|NP_566414.3| serine carboxypeptidase-like 16 [Arabidopsis thaliana]
 sp|Q9C7D4.1|SCP16_ARATH RecName: Full=Serine carboxypeptidase-like 16; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG51080.1|AC069472_20 serine carboxypeptidase, putative; 23596-21212 [Arabidopsis thaliana]
 gb|AEE75169.1| serine carboxypeptidase-like 16 [Arabidopsis thaliana]
Length=435

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 114/156 (73%), Gaps = 3/156 (2%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H  S+ S +  LPGFEGPLPF LETGYIGVGE +E Q+FYYF+KSE+NPK DPL+LW+S
Sbjct  19   KHADSS-SIIKYLPGFEGPLPFELETGYIGVGEEDEDQMFYYFIKSESNPKTDPLLLWLS  77

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS TGLIYE GPL F  + YNG++PTL+    S TK A+II+LDQ    GFSYS 
Sbjct  78   GGPGCSSFTGLIYENGPLGFKVEAYNGSIPTLVSTTYSWTKVANIIYLDQPVGTGFSYSR  137

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
            N   +  +D  ++K V EFL+KW  ++ ++ SNPF+
Sbjct  138  NPLADIPSDTGSAKRVDEFLRKWLTKHPEYFSNPFY  173



>gb|KFK44962.1| hypothetical protein AALP_AA1G326200 [Arabis alpina]
Length=463

 Score =   179 bits (453),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 109/154 (71%), Gaps = 2/154 (1%)
 Frame = -3

Query  458  ISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQ  279
            + + S +  LPGFEGPLPFHLETGYIGVGE E ++LFYYF+KSE NP+ DPL++W++G  
Sbjct  24   VESASVISYLPGFEGPLPFHLETGYIGVGEGERVKLFYYFIKSENNPEKDPLLIWLTGGP  83

Query  278  GCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTT  99
            GCSSL+ L +EIGPL    + YNG LP+L+    S TK A+IIFLDQ    GFSYST   
Sbjct  84   GCSSLSALAFEIGPLSLKNEGYNGGLPSLISTPYSWTKEANIIFLDQPVGTGFSYSTTPL  143

Query  98   TN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             +  +D   +K  YEFLQKW  +  +F SNPF+I
Sbjct  144  ADKPSDTGEAKQAYEFLQKWLVKYPEFASNPFYI  177



>ref|XP_010503611.1| PREDICTED: serine carboxypeptidase-like 7 [Camelina sativa]
Length=440

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S V  LPGF+GPLPF LETGYIGVGE EE+QLFYYF+KSE NP++ PL+LW+SG  GC
Sbjct  28   SASIVKFLPGFDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPEEVPLLLWLSGGPGC  87

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS++GL+YE GP+    +VYNGTLP+L+    S TK +SII+LDQ    GFSYS     N
Sbjct  88   SSISGLLYENGPVTVKREVYNGTLPSLVSTTYSWTKVSSIIYLDQPVGTGFSYSRTQLVN  147

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D   +K ++EFL KW  ++Q+F+SNPF++
Sbjct  148  KPSDSGEAKRIHEFLYKWLGKHQEFLSNPFYV  179



>sp|Q9C7Z9.2|SCP18_ARATH RecName: Full=Serine carboxypeptidase-like 18; Flags: Precursor 
[Arabidopsis thaliana]
Length=464

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H + + S +  LPGFEG LPFHLETGYIGVGE E++QLFYYF+KSE NP++DPLI+W++
Sbjct  20   QHDVDSASVISYLPGFEGLLPFHLETGYIGVGEGEKVQLFYYFIKSENNPEEDPLIIWLT  79

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G   C++L+ L +EIGPL F  + YNG LP+L+    S TK ASIIFLDQ    G+SYST
Sbjct  80   GGPACTALSALAFEIGPLTFKTEGYNGGLPSLVSTSYSWTKVASIIFLDQPVGTGYSYST  139

Query  107  N--TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               +   +D   +K  YEFLQKW  +N  FVSNP ++
Sbjct  140  TPLSYKPSDTGEAKQTYEFLQKWLVENPQFVSNPIYV  176



>ref|XP_002884894.1| hypothetical protein ARALYDRAFT_897434 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61153.1| hypothetical protein ARALYDRAFT_897434 [Arabidopsis lyrata subsp. 
lyrata]
Length=435

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            +GS +  LPGFEGPLPF LETGYIGVGE +E Q+FYYF+KSE+NP +DPL++W++G  GC
Sbjct  23   SGSIIRYLPGFEGPLPFELETGYIGVGEEDEDQMFYYFIKSESNPDEDPLLVWLTGGPGC  82

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS +GL+YE GPL F  + YNG++PTL+    S TK A+II+LDQ    GFSYSTN   +
Sbjct  83   SSFSGLVYENGPLAFKVETYNGSIPTLVSTTYSWTKVANIIYLDQPVGTGFSYSTNPLAD  142

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D  ++K V EF++KW  ++ ++ SNPF++
Sbjct  143  IPSDTGSAKRVNEFVRKWLAKHPEYFSNPFYV  174



>ref|XP_010486655.1| PREDICTED: serine carboxypeptidase-like 7 isoform X5 [Camelina 
sativa]
Length=446

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 114/159 (72%), Gaps = 5/159 (3%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETG---YIGVGESEEIQLFYYFVKSETNPKDDPLILW  294
            H   + S V+ LPG +GPLPF LETG   YIGVGE EE+QLFYYF+KSE NPK+DPL+LW
Sbjct  24   HRTDSASVVEFLPGLDGPLPFELETGVVTYIGVGEEEEVQLFYYFIKSERNPKEDPLLLW  83

Query  293  ISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSY  114
            +SG  GCSS++GL+YE GPL    +VYNGTLP+L+    S TK +SII+LDQ    GFSY
Sbjct  84   LSGGPGCSSISGLLYENGPLTVKFEVYNGTLPSLVSTTYSWTKVSSIIYLDQPVGTGFSY  143

Query  113  STNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            S     N  +D   +K ++EFL KW  ++Q+F+ NPF++
Sbjct  144  SKTQLVNKPSDSGEAKRIHEFLHKWLGKHQEFLPNPFYV  182



>ref|XP_010320345.1| PREDICTED: serine carboxypeptidase-like 10 isoform X4 [Solanum 
lycopersicum]
Length=387

 Score =   176 bits (447),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 116/157 (74%), Gaps = 3/157 (2%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +  +++ S V+ LPG +G LPFHLETGY+G+G+  E+Q FYYF+ SE+ P  +PL++W++
Sbjct  17   QQEVTSHSLVEYLPGLQGRLPFHLETGYVGIGKDNELQHFYYFLASESEPTTNPLLIWLT  76

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSSL+ ++ EIGPL F A++YNG+LPT   N  +LTK AS+IFLDQ  N GFSY+T
Sbjct  77   GGPGCSSLSAIVNEIGPLRF-AELYNGSLPTFELNPHALTKIASVIFLDQPVNTGFSYAT  135

Query  107  NTTT--NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            N      TD++A +YV EFL+KW D +  F+SNPF++
Sbjct  136  NDAAYKYTDIQACEYVDEFLRKWLDDHPQFISNPFYV  172



>emb|CDX70702.1| BnaC03g07860D [Brassica napus]
Length=432

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 114/153 (75%), Gaps = 2/153 (1%)
 Frame = -3

Query  455  SAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQG  276
            + GS V  LPGFEGPLPF LETGYIGVG+ E++QLFYYF+KSE NP +DPL++W++G  G
Sbjct  19   NCGSIVKFLPGFEGPLPFQLETGYIGVGDQEQVQLFYYFIKSEKNPTEDPLLIWLTGGPG  78

Query  275  CSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNT--  102
            CSS+TGL++E GP+ F  + YNG  PTLL    S TK A+IIFLDQ    GFSY+T    
Sbjct  79   CSSITGLLFENGPVTFKVEGYNGGTPTLLSTTYSWTKVANIIFLDQPVGSGFSYATTQFL  138

Query  101  TTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             + +D   +K ++EF++KW  ++++F+SNPF++
Sbjct  139  DSPSDSGEAKRIHEFIRKWLSEHKEFISNPFYV  171



>emb|CDX68234.1| BnaA07g22740D [Brassica napus]
Length=440

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 117/156 (75%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   + S V  LPGFEGPLPF LETGYIGVGE EE+QLFYYF+KSE+NP++DPL +W++G
Sbjct  24   HDADSASIVKFLPGFEGPLPFELETGYIGVGEEEEVQLFYYFIKSESNPEEDPLFIWLNG  83

Query  284  EQGCSSLTGLIYE-IGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
              GCSS++GL++E  GPL    +VYNGTLP+L+    S TK +SII+LDQ    GFS+ST
Sbjct  84   GPGCSSISGLLFENEGPLTMKLEVYNGTLPSLVSTTYSWTKTSSIIYLDQPVGTGFSFST  143

Query  107  -NTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             +  T +D   ++ ++EFLQKW  ++++F+ NPF++
Sbjct  144  QHVDTPSDSGEARRIHEFLQKWLAKHEEFIPNPFYV  179



>ref|XP_006403279.1| hypothetical protein EUTSA_v10003211mg [Eutrema salsugineum]
 gb|ESQ44732.1| hypothetical protein EUTSA_v10003211mg [Eutrema salsugineum]
Length=370

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  458  ISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQ  279
            +++ S +  LPGF+GPLPF LETGYIGVGE+EE QLFYYF+KSE+NP++DPL++W+SG  
Sbjct  19   VNSKSTIRYLPGFQGPLPFKLETGYIGVGEAEEEQLFYYFIKSESNPEEDPLLIWLSGGP  78

Query  278  GCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTT  99
            GCSSL+GL++E GPL F  + Y+G   +L+    S TK ASII+LDQ    GFSYS N  
Sbjct  79   GCSSLSGLLFENGPLAFKVESYDGDTLSLVSTTYSWTKVASIIYLDQPVGTGFSYSRNPL  138

Query  98   TN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             +  +D  A+K V+EFL+KW  ++ +F SNPF++
Sbjct  139  ADKPSDTRAAKRVHEFLRKWLAKHPEFFSNPFYV  172



>ref|XP_002283413.1| PREDICTED: serine carboxypeptidase-like 2 [Vitis vinifera]
Length=469

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = -3

Query  461  VISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGE  282
            V ++ S V  LPGFEGPLPF LETGY+GVGESEE+QLFYYFVKSE NP +DPL+LW++G 
Sbjct  24   VAASHSPVKFLPGFEGPLPFELETGYVGVGESEEVQLFYYFVKSENNPTEDPLLLWLTGG  83

Query  281  QGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNT  102
             GCS+ + L YEIGPL+F++  Y+G+LPTL  N  S T+ ++IIFLD     GFSY+T +
Sbjct  84   PGCSAFSALFYEIGPLYFESVPYHGSLPTLELNPHSWTQVSNIIFLDAPVGTGFSYATTS  143

Query  101  TTNT--DVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +   D +A+   +EFL+KW   + +F+SNP ++
Sbjct  144  RASHSGDFQATHQAHEFLRKWLIDHPEFLSNPVYV  178



>ref|XP_010429230.1| PREDICTED: serine carboxypeptidase-like 11 isoform X1 [Camelina 
sativa]
Length=432

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 111/153 (73%), Gaps = 2/153 (1%)
 Frame = -3

Query  458  ISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQ  279
            + +GS V  LPGFEGPLPF LETGYIG+GE EE+QLFYYF+KSE NPK+DPL+LW++G  
Sbjct  18   VDSGSIVKFLPGFEGPLPFELETGYIGIGEKEEMQLFYYFIKSENNPKEDPLLLWLNGGP  77

Query  278  GCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTT  99
            GCSS TGL +E GPL   ++VYNG++P+L+    S TK A+II+LDQ    GFSYS    
Sbjct  78   GCSSNTGLFFENGPLALKSEVYNGSVPSLVSTTYSWTKMANIIYLDQPVRTGFSYSRTPL  137

Query  98   TN--TDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
             +  +D    K + EFLQKW +++  F SNPF+
Sbjct  138  IDKPSDTGEVKRIREFLQKWLNKHPQFSSNPFY  170



>ref|XP_006295774.1| hypothetical protein CARUB_v10024896mg [Capsella rubella]
 gb|EOA28672.1| hypothetical protein CARUB_v10024896mg [Capsella rubella]
Length=436

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
             HV S G+ V  LPGFEGPLPF LETGY+G+GE E++Q+FYYF+KSE NPK+DPL+LW+ 
Sbjct  15   HHVDSFGTIVKFLPGFEGPLPFELETGYVGIGEEEDVQVFYYFIKSEKNPKEDPLLLWLD  74

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-  111
            G  GCSSL GL++E GPL   +KVYNG+ P+L+    S TK A+II+LDQ    GFSYS 
Sbjct  75   GGPGCSSLGGLLFENGPLALKSKVYNGSTPSLVSTPYSWTKMANIIYLDQPVGAGFSYSR  134

Query  110  TNTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            T     +D    K +++FLQKW  ++  F+SN F++
Sbjct  135  TPLGKTSDTSEVKRIHKFLQKWLSKHPQFMSNSFYV  170



>emb|CDX77573.1| BnaA07g07110D [Brassica napus]
Length=435

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            A S +  LPGFEGPLPF LETGYIGVGE EE Q+FYYF+KSE NP++DPL++W++G  GC
Sbjct  23   ASSIIKYLPGFEGPLPFQLETGYIGVGEVEEDQMFYYFIKSERNPEEDPLLVWLTGGPGC  82

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS +GL+YE GPL F  + Y+G++PTL+    S TK A+II+LDQ    GFSYS N   +
Sbjct  83   SSFSGLVYENGPLAFKVEAYDGSIPTLVSTTYSWTKVANIIYLDQPVGTGFSYSRNPLAD  142

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D  ++K V EFL+KW D++ ++ SNPF++
Sbjct  143  IPSDTGSAKRVDEFLRKWLDKHPEYFSNPFYV  174



>emb|CDY53115.1| BnaCnng24430D [Brassica napus]
Length=436

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 124/178 (70%), Gaps = 6/178 (3%)
 Frame = -3

Query  530  MKLSLNHFVILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQL  351
            M++ L   +++ ++ V+  F +    + S V +LPGFEGPLPF LETGYIG+GE EEIQ+
Sbjct  1    MRMRLTLKLLIPVLLVLRYFAD----SASVVKLLPGFEGPLPFELETGYIGLGEEEEIQM  56

Query  350  FYYFVKSETNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSL  171
            FYYF+KSE NP++DPL++W++G  GCSS+ GL++E GPL    +VYNG++P+L+    S 
Sbjct  57   FYYFIKSENNPREDPLLIWLTGGPGCSSIFGLLFENGPLALKFEVYNGSIPSLVSTTYSW  116

Query  170  TKNASIIFLDQLPNIGFSYSTNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            TK A+IIFLDQ    GFSYS     +  +D    K ++EFLQKW  ++  F +NPF++
Sbjct  117  TKMANIIFLDQPVGSGFSYSRTPLVDKISDTGEVKRIHEFLQKWLSKHPKFYANPFYV  174



>ref|XP_010505113.1| PREDICTED: serine carboxypeptidase-like 9 isoform X2 [Camelina 
sativa]
Length=438

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = -3

Query  449  GSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGCS  270
            GS +  LPGFEGPLPF LETGYIG+GE EE QLFYYF+KSE NPK+DPL+LW++G  GCS
Sbjct  23   GSIIKFLPGFEGPLPFELETGYIGIGEEEEAQLFYYFIKSENNPKEDPLLLWLNGGPGCS  82

Query  269  SLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTNT  90
            SLT L+ EIGP+   ++VYNG++P++     S TK A+IIFLDQ    GFSYS      T
Sbjct  83   SLTALLSEIGPVALKSEVYNGSVPSMFSTTYSWTKVANIIFLDQPVGAGFSYSRAPLDKT  142

Query  89   -DVEASKYVYEFLQKWFDQNQDFVSNPFF  6
             D    K ++EFLQKW  ++  F SNPF+
Sbjct  143  SDTNEVKMIHEFLQKWLSKHPQFFSNPFY  171



>ref|XP_010505114.1| PREDICTED: serine carboxypeptidase-like 9 isoform X3 [Camelina 
sativa]
Length=450

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = -3

Query  449  GSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGCS  270
            GS +  LPGFEGPLPF LETGYIG+GE EE QLFYYF+KSE NPK+DPL+LW++G  GCS
Sbjct  23   GSIIKFLPGFEGPLPFELETGYIGIGEEEEAQLFYYFIKSENNPKEDPLLLWLNGGPGCS  82

Query  269  SLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTNT  90
            SLT L+ EIGP+   ++VYNG++P++     S TK A+IIFLDQ    GFSYS      T
Sbjct  83   SLTALLSEIGPVALKSEVYNGSVPSMFSTTYSWTKVANIIFLDQPVGAGFSYSRAPLDKT  142

Query  89   -DVEASKYVYEFLQKWFDQNQDFVSNPFF  6
             D    K ++EFLQKW  ++  F SNPF+
Sbjct  143  SDTNEVKMIHEFLQKWLSKHPQFFSNPFY  171



>ref|XP_010505112.1| PREDICTED: serine carboxypeptidase-like 9 isoform X1 [Camelina 
sativa]
Length=444

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = -3

Query  449  GSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGCS  270
            GS +  LPGFEGPLPF LETGYIG+GE EE QLFYYF+KSE NPK+DPL+LW++G  GCS
Sbjct  23   GSIIKFLPGFEGPLPFELETGYIGIGEEEEAQLFYYFIKSENNPKEDPLLLWLNGGPGCS  82

Query  269  SLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTNT  90
            SLT L+ EIGP+   ++VYNG++P++     S TK A+IIFLDQ    GFSYS      T
Sbjct  83   SLTALLSEIGPVALKSEVYNGSVPSMFSTTYSWTKVANIIFLDQPVGAGFSYSRAPLDKT  142

Query  89   -DVEASKYVYEFLQKWFDQNQDFVSNPFF  6
             D    K ++EFLQKW  ++  F SNPF+
Sbjct  143  SDTNEVKMIHEFLQKWLSKHPQFFSNPFY  171



>emb|CBI19380.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = -3

Query  461  VISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGE  282
            V ++ S V  LPGFEGPLPF LETGY+GVGESEE+QLFYYFVKSE NP +DPL+LW++G 
Sbjct  58   VAASHSPVKFLPGFEGPLPFELETGYVGVGESEEVQLFYYFVKSENNPTEDPLLLWLTGG  117

Query  281  QGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNT  102
             GCS+ + L YEIGPL+F++  Y+G+LPTL  N  S T+ ++IIFLD     GFSY+T +
Sbjct  118  PGCSAFSALFYEIGPLYFESVPYHGSLPTLELNPHSWTQVSNIIFLDAPVGTGFSYATTS  177

Query  101  TTNT--DVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +   D +A+   +EFL+KW   + +F+SNP ++
Sbjct  178  RASHSGDFQATHQAHEFLRKWLIDHPEFLSNPVYV  212



>gb|KFK39469.1| hypothetical protein AALP_AA3G248300 [Arabis alpina]
Length=421

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S V  LPGF+GPLPF LETGYIGVGE EE+QLFYYF+KSE NPK+DPL+LW++G   C
Sbjct  30   SASIVKFLPGFDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLTGGPAC  89

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS++GL++E GPL     VYNGTLP+L+    S TK +SI+FLDQ    GFSYS     N
Sbjct  90   SSISGLLFENGPLTIKLDVYNGTLPSLVSTSYSWTKTSSILFLDQPVGTGFSYSKTKIFN  149

Query  92   T--DVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            T  D+   K + EF  KW  ++Q+F SNPF++
Sbjct  150  TPSDLGEVKRINEFFHKWLGKHQEFSSNPFYV  181



>ref|XP_009601001.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Nicotiana 
tomentosiformis]
Length=464

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            A S V +LPGF+GPLPF LETGYIGV +SE+ QLFYYF+KSE+NP+ DP++LWI+G  GC
Sbjct  25   AASPVKLLPGFKGPLPFELETGYIGVDDSEDTQLFYYFIKSESNPESDPILLWITGGPGC  84

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTT-  96
            S+L+GLIYEIGP+ F+   YNG+LPT++ N  S TK ASIIFLD     GFSY+      
Sbjct  85   SALSGLIYEIGPITFEPVEYNGSLPTMILNPYSWTKVASIIFLDLPVGTGFSYARTPAAL  144

Query  95   -NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             +++++AS   YEFL +WF  + +F+ NP ++
Sbjct  145  QSSNLQASDQAYEFLYRWFLDHPEFLKNPLYV  176



>ref|XP_009600999.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Nicotiana 
tomentosiformis]
Length=465

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            A S V +LPGF+GPLPF LETGYIGV +SE+ QLFYYF+KSE+NP+ DP++LWI+G  GC
Sbjct  25   AASPVKLLPGFKGPLPFELETGYIGVDDSEDTQLFYYFIKSESNPESDPILLWITGGPGC  84

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTT-  96
            S+L+GLIYEIGP+ F+   YNG+LPT++ N  S TK ASIIFLD     GFSY+      
Sbjct  85   SALSGLIYEIGPITFEPVEYNGSLPTMILNPYSWTKVASIIFLDLPVGTGFSYARTPAAL  144

Query  95   -NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             +++++AS   YEFL +WF  + +F+ NP ++
Sbjct  145  QSSNLQASDQAYEFLYRWFLDHPEFLKNPLYV  176



>ref|XP_006299183.1| hypothetical protein CARUB_v10015328mg [Capsella rubella]
 gb|EOA32081.1| hypothetical protein CARUB_v10015328mg [Capsella rubella]
Length=435

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            +GS +  LPGFEGPLPF LETGYIGVGE+EE Q+FYYFVKSE+NP +DPL++W++G  GC
Sbjct  23   SGSIIRSLPGFEGPLPFELETGYIGVGEAEEDQMFYYFVKSESNPIEDPLLVWLTGGPGC  82

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS +GL+YE GPL F  + YNG++PTL+    S TK A+II+LDQ    GFSYS N   +
Sbjct  83   SSFSGLVYENGPLAFKVETYNGSVPTLVSTTYSWTKVANIIYLDQPVGTGFSYSRNPLAD  142

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D  ++K V EFL+ W  ++ ++ SNPF++
Sbjct  143  IPSDTGSAKRVNEFLRNWLAKHPEYFSNPFYV  174



>gb|KFK39468.1| hypothetical protein AALP_AA3G248300 [Arabis alpina]
Length=444

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S V  LPGF+GPLPF LETGYIGVGE EE+QLFYYF+KSE NPK+DPL+LW++G   C
Sbjct  30   SASIVKFLPGFDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLTGGPAC  89

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS++GL++E GPL     VYNGTLP+L+    S TK +SI+FLDQ    GFSYS     N
Sbjct  90   SSISGLLFENGPLTIKLDVYNGTLPSLVSTSYSWTKTSSILFLDQPVGTGFSYSKTKIFN  149

Query  92   T--DVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            T  D+   K + EF  KW  ++Q+F SNPF++
Sbjct  150  TPSDLGEVKRINEFFHKWLGKHQEFSSNPFYV  181



>ref|XP_009139974.1| PREDICTED: serine carboxypeptidase-like 13 isoform X3 [Brassica 
rapa]
Length=367

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 123/178 (69%), Gaps = 6/178 (3%)
 Frame = -3

Query  530  MKLSLNHFVILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQL  351
            M++ L   +++ ++ V+  F +    + S V  LPGFEGPLPF LETGYIG+GE EE+Q+
Sbjct  1    MRMRLALKLLIPVLLVLRYFAD----SASVVKFLPGFEGPLPFELETGYIGLGEEEELQM  56

Query  350  FYYFVKSETNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSL  171
            FYYF+KSE NP++DPL++W++G  GCSS+ GL++E GPL    +VYNG+LP+L+    S 
Sbjct  57   FYYFIKSENNPQEDPLLIWLTGGPGCSSIFGLLFENGPLALKFEVYNGSLPSLVSTTYSW  116

Query  170  TKNASIIFLDQLPNIGFSYSTNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            TK A+IIFLDQ    GFSYS     +  +D    K ++EFLQKW  ++  F +NPF++
Sbjct  117  TKMANIIFLDQPVGSGFSYSRTPLVDKISDTGEVKRIHEFLQKWLSKHPQFYANPFYV  174



>ref|XP_006296372.1| hypothetical protein CARUB_v10025545mg [Capsella rubella]
 gb|EOA29270.1| hypothetical protein CARUB_v10025545mg [Capsella rubella]
Length=439

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 110/155 (71%), Gaps = 1/155 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
             H   + S V  LPGFEGPLPF LETGYIG+GE EE QLFYYF+KSE NP++DPL+LW++
Sbjct  18   HHHADSSSIVKFLPGFEGPLPFELETGYIGIGEEEEAQLFYYFIKSENNPEEDPLLLWLN  77

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-  111
            G  GCSS TGL+ EIGP+   ++VYNG++P+L+    S TK ASIIFLDQ    GFSYS 
Sbjct  78   GGPGCSSNTGLLLEIGPVALTSEVYNGSVPSLVSTTYSWTKVASIIFLDQPVGAGFSYSK  137

Query  110  TNTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
            T     +D    K ++EFLQKW  ++  + SNPF+
Sbjct  138  TPLGKTSDTNEVKMIHEFLQKWLSKHPQYYSNPFY  172



>ref|XP_006403280.1| hypothetical protein EUTSA_v10003211mg [Eutrema salsugineum]
 gb|ESQ44733.1| hypothetical protein EUTSA_v10003211mg [Eutrema salsugineum]
Length=419

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  458  ISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQ  279
            +++ S +  LPGF+GPLPF LETGYIGVGE+EE QLFYYF+KSE+NP++DPL++W+SG  
Sbjct  19   VNSKSTIRYLPGFQGPLPFKLETGYIGVGEAEEEQLFYYFIKSESNPEEDPLLIWLSGGP  78

Query  278  GCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTT  99
            GCSSL+GL++E GPL F  + Y+G   +L+    S TK ASII+LDQ    GFSYS N  
Sbjct  79   GCSSLSGLLFENGPLAFKVESYDGDTLSLVSTTYSWTKVASIIYLDQPVGTGFSYSRNPL  138

Query  98   TN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             +  +D  A+K V+EFL+KW  ++ +F SNPF++
Sbjct  139  ADKPSDTRAAKRVHEFLRKWLAKHPEFFSNPFYV  172



>ref|XP_010417053.1| PREDICTED: serine carboxypeptidase-like 9 [Camelina sativa]
Length=439

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 108/150 (72%), Gaps = 1/150 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            +GS V  LPGFEGPLPF LETGYIG+G+ EE QLFYYF+KSE NP++DPL+LW+ G  G 
Sbjct  21   SGSLVKFLPGFEGPLPFELETGYIGIGKKEEEQLFYYFIKSENNPEEDPLLLWLEGGPGS  80

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-TNTTT  96
            SSL GL+ EIGPL   ++VYNGT+P+L+    S TK ASIIFLDQ    GFSYS T    
Sbjct  81   SSLNGLLMEIGPLNLKSEVYNGTVPSLVSTTYSWTKMASIIFLDQPVGAGFSYSRTPLNK  140

Query  95   NTDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
             TD      +YEFLQKW  ++  ++SNPF+
Sbjct  141  TTDANEVNIIYEFLQKWLSKHPQYLSNPFY  170



>emb|CDY44586.1| BnaA04g10040D [Brassica napus]
Length=464

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 123/178 (69%), Gaps = 6/178 (3%)
 Frame = -3

Query  530  MKLSLNHFVILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQL  351
            M++ L   +++ ++ V+  F +    + S V  LPGFEGPLPF LETGYIG+GE EE+Q+
Sbjct  1    MRMRLTLKLLIPVLLVLRYFAD----SASVVKFLPGFEGPLPFELETGYIGLGEEEELQM  56

Query  350  FYYFVKSETNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSL  171
            FYYF+KSE NP++DPL++W++G  GCSSL GL++E GPL    +VYNG+LP+L+    S 
Sbjct  57   FYYFIKSENNPQEDPLLIWLTGGPGCSSLFGLVFENGPLALKFEVYNGSLPSLVSTTYSW  116

Query  170  TKNASIIFLDQLPNIGFSYSTNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            TK A++IFLDQ    GFSYS     +  +D    K ++EFLQKW  ++  F +NPF++
Sbjct  117  TKMANMIFLDQPVGSGFSYSRTPLVDKVSDTGEVKRIHEFLQKWLSKHPQFYANPFYV  174



>ref|XP_006403281.1| hypothetical protein EUTSA_v10003211mg [Eutrema salsugineum]
 gb|ESQ44734.1| hypothetical protein EUTSA_v10003211mg [Eutrema salsugineum]
Length=439

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  458  ISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQ  279
            +++ S +  LPGF+GPLPF LETGYIGVGE+EE QLFYYF+KSE+NP++DPL++W+SG  
Sbjct  19   VNSKSTIRYLPGFQGPLPFKLETGYIGVGEAEEEQLFYYFIKSESNPEEDPLLIWLSGGP  78

Query  278  GCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTT  99
            GCSSL+GL++E GPL F  + Y+G   +L+    S TK ASII+LDQ    GFSYS N  
Sbjct  79   GCSSLSGLLFENGPLAFKVESYDGDTLSLVSTTYSWTKVASIIYLDQPVGTGFSYSRNPL  138

Query  98   TN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             +  +D  A+K V+EFL+KW  ++ +F SNPF++
Sbjct  139  ADKPSDTRAAKRVHEFLRKWLAKHPEFFSNPFYV  172



>emb|CDY52617.1| BnaCnng22960D [Brassica napus]
Length=864

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
             GS V  LPGFEGPLPF +ETGYIGVGE EE QLFYYF+KSE NP++DPL++W++G  GC
Sbjct  437  GGSIVRYLPGFEGPLPFQIETGYIGVGEGEEDQLFYYFIKSERNPEEDPLLVWLAGGPGC  496

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS +GL+YE GPL F  + YNG++P+L+    S TK A+II+LDQ    GFSYS N  ++
Sbjct  497  SSFSGLVYENGPLGFKVETYNGSIPSLVSTTYSWTKVANIIYLDQPVGTGFSYSRNQLSD  556

Query  92   T--DVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            T  D EA+K V EFL+KW  ++ ++ SNP ++
Sbjct  557  TPSDTEAAKRVNEFLRKWLVKHPEYFSNPLYV  588


 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 104/162 (64%), Gaps = 12/162 (7%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   A S +  LPGFEGPLPF LETGYIGV +++E QLFYYF+KSE NPK DPL++W++G
Sbjct  12   HHADASSIIRYLPGFEGPLPFELETGYIGVSDAKEDQLFYYFIKSENNPKTDPLLVWLTG  71

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASI----IFLDQLPN---I  126
              GCSS +GL+YE GPL F  + YNG++P+L+    S TK  +I    IF  Q+ +   +
Sbjct  72   GPGCSSFSGLVYENGPLAFKVETYNGSIPSLVSTTYSWTKVTTISCISIFHLQVKHFLSV  131

Query  125  GFSYSTNT-TTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               Y  N  + + D  + K V EF+ K    + ++ SNPF++
Sbjct  132  NMFYQKNMLSISCDTGSVKRVDEFIPK----HPEYSSNPFYV  169



>ref|XP_010509548.1| PREDICTED: serine carboxypeptidase-like 9 isoform X2 [Camelina 
sativa]
Length=449

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 109/154 (71%), Gaps = 1/154 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   +G+ +  LPGFEGPLPF LETGYIG+GE EE QLFYYF+KSE NPK+DPL+LW+SG
Sbjct  21   HHAYSGTIIKFLPGFEGPLPFELETGYIGIGEEEEAQLFYYFIKSENNPKEDPLLLWLSG  80

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-T  108
              G SSLTGLI EIGP+   ++VYNG+ P++     S TK A+IIFLDQ    GFSYS T
Sbjct  81   GPGSSSLTGLISEIGPVALKSEVYNGSAPSMFSTTYSWTKVANIIFLDQPVGAGFSYSRT  140

Query  107  NTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
                 +D    K ++EFLQKW  ++  F+SN F+
Sbjct  141  PLDKTSDTNEVKMIHEFLQKWLSKHPQFISNQFY  174



>ref|XP_010509547.1| PREDICTED: serine carboxypeptidase-like 9 isoform X1 [Camelina 
sativa]
Length=441

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 109/154 (71%), Gaps = 1/154 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   +G+ +  LPGFEGPLPF LETGYIG+GE EE QLFYYF+KSE NPK+DPL+LW+SG
Sbjct  21   HHAYSGTIIKFLPGFEGPLPFELETGYIGIGEEEEAQLFYYFIKSENNPKEDPLLLWLSG  80

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-T  108
              G SSLTGLI EIGP+   ++VYNG+ P++     S TK A+IIFLDQ    GFSYS T
Sbjct  81   GPGSSSLTGLISEIGPVALKSEVYNGSAPSMFSTTYSWTKVANIIFLDQPVGAGFSYSRT  140

Query  107  NTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
                 +D    K ++EFLQKW  ++  F+SN F+
Sbjct  141  PLDKTSDTNEVKMIHEFLQKWLSKHPQFISNQFY  174



>ref|NP_187831.1| serine carboxypeptidase-like 14 [Arabidopsis thaliana]
 sp|Q9C7D3.1|SCP14_ARATH RecName: Full=Serine carboxypeptidase-like 14; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG51078.1|AC069472_18 serine carboxypeptidase, putative; 26560-24112 [Arabidopsis thaliana]
 gb|AEE75170.1| serine carboxypeptidase-like 14 [Arabidopsis thaliana]
Length=435

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S +  LPGFEGPLPF LETGYIGVG+ +E Q+FYYF+KSE+NP++DPL++W+SG  GC
Sbjct  23   SSSIIKYLPGFEGPLPFELETGYIGVGDEDEDQMFYYFIKSESNPEEDPLLVWLSGGPGC  82

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS TGL+YE GPL F  + YNG++PTL+    S TK A+II+LDQ    GFSYS N   +
Sbjct  83   SSFTGLVYENGPLGFKVEAYNGSIPTLVSTTYSWTKVANIIYLDQPVGAGFSYSRNPFAD  142

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D  ++K V EF++KW  ++ D+ SNPF++
Sbjct  143  RPSDTGSAKLVNEFVRKWLAKHPDYFSNPFYV  174



>ref|NP_187828.1| serine carboxypeptidase-like 17 [Arabidopsis thaliana]
 sp|Q9C7D6.1|SCP17_ARATH RecName: Full=Serine carboxypeptidase-like 17; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG51061.1|AC069472_1 serine carboxypeptidase, putative; 18637-16038 [Arabidopsis thaliana]
 gb|AAS99709.1| At3g12203 [Arabidopsis thaliana]
 gb|AEE75166.1| serine carboxypeptidase-like 17 [Arabidopsis thaliana]
Length=437

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 114/156 (73%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
             ++ +GS +  LPGF+GPLPF LETGYIGVGE+E+ Q+FYYF+KSE+NP+ DPL+LW+SG
Sbjct  22   QLVDSGSTIRFLPGFQGPLPFELETGYIGVGEAEKDQMFYYFIKSESNPEKDPLLLWLSG  81

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
               CSS T LIYE GP+ F A+ YNG++P+L+    + TK ASI++LDQ    GFSYS N
Sbjct  82   GPFCSSFTALIYENGPIAFKAEEYNGSIPSLVSTTYAWTKVASILYLDQPVGTGFSYSRN  141

Query  104  TTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               +  +D   +K V EFL KW D++ +F+SNP ++
Sbjct  142  PLADIPSDTGVAKPVNEFLHKWLDKHPEFLSNPLYV  177



>ref|XP_010321496.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Solanum 
lycopersicum]
Length=454

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 123/168 (73%), Gaps = 3/168 (2%)
 Frame = -3

Query  500  LAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETN  321
            L ++ ++ V+P  V+ AGS V  LPGFEGPLPF LETGYIGVGE+ E+QLFYYF+KS++N
Sbjct  5    LYVVLIIFVYPLFVL-AGSPVKYLPGFEGPLPFQLETGYIGVGEANEVQLFYYFIKSQSN  63

Query  320  PKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLD  141
             K DPL+ W +G  GCS L+ ++YE+GP+  D + YNG+LPTL  N  + TK A++IF+D
Sbjct  64   YKIDPLVYWFTGGPGCSPLSAILYELGPITVDIRAYNGSLPTLSLNPYAYTKVANMIFVD  123

Query  140  QLPNIGFSYSTNTTT--NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                 GFSY+T      + D++A+ + YEF++KW  +++++++NPF++
Sbjct  124  LPVGSGFSYATTQKAIYSDDLQAADHAYEFIRKWLIEHKEYLNNPFYV  171



>gb|KFK25893.1| hypothetical protein AALP_AA8G176200 [Arabis alpina]
Length=390

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 109/151 (72%), Gaps = 2/151 (1%)
 Frame = -3

Query  449  GSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGCS  270
            GS V  LPGFEGPLPF LETGYIGVGE EE+QLFYYF+KSE NP++DPL++WISG  GCS
Sbjct  25   GSIVKFLPGFEGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPEEDPLLIWISGGPGCS  84

Query  269  SLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN-  93
            SL G ++E GP+ F  + Y G  PTL+    S TK ASIIFLDQ   +GFSY+T    + 
Sbjct  85   SLNGFLFENGPVTFKTEGYKGGRPTLVSTTYSWTKVASIIFLDQPVGVGFSYTTTQLLDS  144

Query  92   -TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             TD   +K + EFL+KW  ++  ++SNPF++
Sbjct  145  PTDTGEAKQMDEFLRKWLSKHIKYISNPFYV  175



>emb|CDP17360.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 117/165 (71%), Gaps = 3/165 (2%)
 Frame = -3

Query  491  IAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKD  312
            + +V V P   + AGS V  LPGFEGPLPF LETGYIGVGESE++QLFY+FVKSE+NP+ 
Sbjct  19   LVLVSVRPNLAV-AGSVVKFLPGFEGPLPFELETGYIGVGESEDVQLFYHFVKSESNPQT  77

Query  311  DPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLP  132
            DPL++W++G  GCSS  GL   IGP+ F   + NGTL  L+ N  S TK ASIIFLD   
Sbjct  78   DPLLIWLTGGPGCSSFGGLTSGIGPVKFQPVLCNGTLTALVTNPYSWTKVASIIFLDSPV  137

Query  131  NIGFSYS--TNTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              GFSY+     + +TD++AS++ YEFL+KW   N +++SN F+I
Sbjct  138  GAGFSYARTAKASQSTDLQASEHNYEFLRKWLHDNPEYISNSFYI  182



>ref|XP_010321495.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Solanum 
lycopersicum]
Length=457

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 123/168 (73%), Gaps = 3/168 (2%)
 Frame = -3

Query  500  LAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETN  321
            L ++ ++ V+P  V+ AGS V  LPGFEGPLPF LETGYIGVGE+ E+QLFYYF+KS++N
Sbjct  5    LYVVLIIFVYPLFVL-AGSPVKYLPGFEGPLPFQLETGYIGVGEANEVQLFYYFIKSQSN  63

Query  320  PKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLD  141
             K DPL+ W +G  GCS L+ ++YE+GP+  D + YNG+LPTL  N  + TK A++IF+D
Sbjct  64   YKIDPLVYWFTGGPGCSPLSAILYELGPITVDIRAYNGSLPTLSLNPYAYTKVANMIFVD  123

Query  140  QLPNIGFSYSTNTTT--NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                 GFSY+T      + D++A+ + YEF++KW  +++++++NPF++
Sbjct  124  LPVGSGFSYATTQKAIYSDDLQAADHAYEFIRKWLIEHKEYLNNPFYV  171



>dbj|BAB03132.1| serine carboxypeptidase [Arabidopsis thaliana]
Length=441

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S +  LPGFEGPLPF LETGYIGVG+ +E Q+FYYF+KSE+NP++DPL++W+SG  GC
Sbjct  23   SSSIIKYLPGFEGPLPFELETGYIGVGDEDEDQMFYYFIKSESNPEEDPLLVWLSGGPGC  82

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS TGL+YE GPL F  + YNG++PTL+    S TK A+II+LDQ    GFSYS N   +
Sbjct  83   SSFTGLVYENGPLGFKVEAYNGSIPTLVSTTYSWTKVANIIYLDQPVGAGFSYSRNPFAD  142

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D  ++K V EF++KW  ++ D+ SNPF++
Sbjct  143  RPSDTGSAKLVNEFVRKWLAKHPDYFSNPFYV  174



>emb|CDY50563.1| BnaA01g30770D [Brassica napus]
Length=886

 Score =   180 bits (457),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 112/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
             GS V  LPGFEGPLPF LETGYIGVGE EE QLFYYF+KSE NP++DPL++W++G  GC
Sbjct  468  GGSIVRYLPGFEGPLPFELETGYIGVGEGEEDQLFYYFIKSERNPEEDPLLVWLAGGPGC  527

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS +GL+YE GPL F  + YNG++P+L+    S TK A+II+LDQ    GFSYS N  ++
Sbjct  528  SSFSGLVYENGPLAFKVETYNGSVPSLVSTTYSWTKVANIIYLDQPVGTGFSYSRNQLSD  587

Query  92   T--DVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            T  D E +K V EFL+KW  ++ ++ SNP ++
Sbjct  588  TPSDTEVAKRVNEFLRKWLAKHPEYFSNPLYV  619


 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H   A S +  LPGFEGPLPF LETGYIGV E+EE QLFYYF+KSE NPK DPL++W++
Sbjct  19   QHHADASSIIRYLPGFEGPLPFELETGYIGVSEAEEDQLFYYFIKSENNPKTDPLLVWLT  78

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS +GL+YE GPL F  ++YNG++P+L+    S TK A+II+LDQ    GFSYS 
Sbjct  79   GGPGCSSFSGLVYENGPLAFKVEIYNGSIPSLVSTTYSWTKVANIIYLDQPVGAGFSYSR  138

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            N   +  +D  + K V EF++KW  ++ ++ SNPF++
Sbjct  139  NLYADIPSDTGSVKRVDEFVRKWLAKHPEYSSNPFYV  175



>ref|XP_010417054.1| PREDICTED: serine carboxypeptidase-like 9 [Camelina sativa]
Length=440

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 110/155 (71%), Gaps = 2/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   +GS V  LPGFEGPLPF LETGYIG+GE EE QLFYYF+KSE NP++DPL+LW+ G
Sbjct  17   HHAESGSIVKFLPGFEGPLPFELETGYIGIGEKEEDQLFYYFIKSENNPEEDPLLLWLEG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              G SSL+GL+ EIGPL    + YNG++P+L+    S TK ASIIFLDQ    GFSYS+ 
Sbjct  77   APGSSSLSGLLMEIGPLTVKTERYNGSVPSLVSTTYSWTKAASIIFLDQPVGSGFSYSSK  136

Query  104  T--TTNTDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
            T    +TD      ++EFLQKW  ++  ++SNPF+
Sbjct  137  TPLDNSTDTIEVNKIHEFLQKWLSKHPQYLSNPFY  171



>emb|CDX69437.1| BnaA10g17860D [Brassica napus]
Length=433

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 113/153 (74%), Gaps = 2/153 (1%)
 Frame = -3

Query  455  SAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQG  276
            ++GS V  LPGFEGPLPF LETGYIGVG+ E++QLFYYF+KSE NPK+DPL+LW++G  G
Sbjct  19   NSGSIVKYLPGFEGPLPFELETGYIGVGKEEQLQLFYYFIKSERNPKEDPLLLWLTGGPG  78

Query  275  CSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNT--  102
            CS+++ L++E GP+ F  + YNG  PTLL    S TK ASII+LDQ    GFSYS     
Sbjct  79   CSAVSALLFENGPVKFRVEGYNGGTPTLLSTTYSWTKIASIIYLDQPVGTGFSYSKTQLL  138

Query  101  TTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             T +D   +K ++EFL KW D++ +F+SNPF++
Sbjct  139  DTPSDSGEAKRIHEFLLKWLDKHIEFISNPFYV  171



>ref|XP_006299292.1| hypothetical protein CARUB_v10015451mg [Capsella rubella]
 gb|EOA32190.1| hypothetical protein CARUB_v10015451mg [Capsella rubella]
Length=437

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 112/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S V  LPGFEGPLPF LETGYIGVGE++E Q+FYYF+KSE+NP++DPL++W++G  GC
Sbjct  25   SSSIVRYLPGFEGPLPFELETGYIGVGEADEDQMFYYFIKSESNPEEDPLLVWLTGGPGC  84

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS  GL+YE GPL F  K YNG++PTL     S TK A+II+LDQ    GFSYS N   +
Sbjct  85   SSFFGLVYENGPLAFKVKAYNGSIPTLFSTTYSWTKVANIIYLDQPVGTGFSYSKNPLAD  144

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D  ++K V EFL+KW  ++ ++ SNPF++
Sbjct  145  IPSDTGSAKRVDEFLRKWLAKHPEYFSNPFYV  176



>gb|KDO81469.1| hypothetical protein CISIN_1g012276mg [Citrus sinensis]
Length=348

 Score =   173 bits (439),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 111/153 (73%), Gaps = 2/153 (1%)
 Frame = -3

Query  455  SAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQG  276
            ++ S V  LPGF+GPLPF LETGY+GVGESEE QLFYYFVKS+ NPK+DPL+LW++G  G
Sbjct  22   ASHSTVKFLPGFQGPLPFELETGYVGVGESEEAQLFYYFVKSDKNPKEDPLLLWLTGGPG  81

Query  275  CSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST--NT  102
            CS+ +GL YEIGP+ F+   YNG+LPTL  N  S TK ASI+F+D     GFSY+   + 
Sbjct  82   CSAFSGLAYEIGPVNFNTVEYNGSLPTLRLNPYSWTKEASILFVDSPVGTGFSYARTPHA  141

Query  101  TTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            +   D +   ++ +FL+KW   + +F+SNPF++
Sbjct  142  SQTGDFKQVHHLDQFLRKWLMDHPEFISNPFYV  174



>ref|XP_010484511.1| PREDICTED: serine carboxypeptidase-like 7 [Camelina sativa]
Length=237

 Score =   170 bits (431),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S V  LPGF+G LPF LETGYIGVGE EE+QLFYYF+KSE NPK+DPL+LW++G  GC
Sbjct  25   SASIVKFLPGFDGHLPFELETGYIGVGEEEELQLFYYFIKSERNPKEDPLLLWLTGGPGC  84

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS++ L+YE GP+    +VYNG+LP+L+    S TK +SII+LDQ    GFSYS     +
Sbjct  85   SSISALLYENGPVTVKHEVYNGSLPSLVSTTHSWTKVSSIIYLDQPVGTGFSYSKTQLVD  144

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D   +K ++EFL KW  ++Q F SN F++
Sbjct  145  KPSDSGETKRIHEFLHKWLGKHQQFSSNYFYV  176



>ref|XP_010429238.1| PREDICTED: serine carboxypeptidase-like 9 [Camelina sativa]
Length=440

 Score =   175 bits (444),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 110/155 (71%), Gaps = 2/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   +GS V  LPGFEGPLPF LETGYIG+GE EE QLFYYF+KSE NP++DPL+LW+ G
Sbjct  17   HHAESGSIVKFLPGFEGPLPFELETGYIGMGEKEEDQLFYYFIKSENNPEEDPLLLWLEG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              G SSL+GL+ EIGPL    + YNG++P+L+    S TK ASIIFLDQ    GFSYS+ 
Sbjct  77   APGSSSLSGLLMEIGPLTMKTERYNGSVPSLVSTTYSWTKMASIIFLDQPVGSGFSYSSK  136

Query  104  T--TTNTDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
            T    +TD      ++EFLQKW  ++  ++SNPF+
Sbjct  137  TPLDNSTDTIEVNKIHEFLQKWLSKHPQYLSNPFY  171



>ref|XP_010472299.1| PREDICTED: serine carboxypeptidase-like 10 isoform X2 [Camelina 
sativa]
Length=422

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 110/155 (71%), Gaps = 1/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H + +G+ V  LPGFEGPLPF LETGYIG+GE E IQ+FYYF+KSE NPK+DPL+LW+ G
Sbjct  15   HHVDSGTTVKFLPGFEGPLPFELETGYIGIGEEENIQVFYYFIKSEKNPKEDPLLLWLDG  74

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-T  108
              GCSSL GL++E GPL   ++VYNG  P+L+    S TK A+II+LDQ    GFSYS T
Sbjct  75   GPGCSSLGGLLFENGPLALKSEVYNGITPSLVSTTYSWTKMANIIYLDQPVGAGFSYSRT  134

Query  107  NTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                 +D    K +++FLQKW  ++  F+SN F++
Sbjct  135  PIGKTSDTIEVKRIHDFLQKWLSKHPQFISNSFYV  169



>ref|XP_009139971.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Brassica 
rapa]
Length=436

 Score =   175 bits (444),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 123/178 (69%), Gaps = 6/178 (3%)
 Frame = -3

Query  530  MKLSLNHFVILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQL  351
            M++ L   +++ ++ V+  F +    + S V  LPGFEGPLPF LETGYIG+GE EE+Q+
Sbjct  1    MRMRLALKLLIPVLLVLRYFAD----SASVVKFLPGFEGPLPFELETGYIGLGEEEELQM  56

Query  350  FYYFVKSETNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSL  171
            FYYF+KSE NP++DPL++W++G  GCSS+ GL++E GPL    +VYNG+LP+L+    S 
Sbjct  57   FYYFIKSENNPQEDPLLIWLTGGPGCSSIFGLLFENGPLALKFEVYNGSLPSLVSTTYSW  116

Query  170  TKNASIIFLDQLPNIGFSYSTNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            TK A+IIFLDQ    GFSYS     +  +D    K ++EFLQKW  ++  F +NPF++
Sbjct  117  TKMANIIFLDQPVGSGFSYSRTPLVDKISDTGEVKRIHEFLQKWLSKHPQFYANPFYV  174



>ref|XP_010320342.1| PREDICTED: serine carboxypeptidase-like 10 isoform X1 [Solanum 
lycopersicum]
Length=458

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 116/157 (74%), Gaps = 3/157 (2%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +  +++ S V+ LPG +G LPFHLETGY+G+G+  E+Q FYYF+ SE+ P  +PL++W++
Sbjct  17   QQEVTSHSLVEYLPGLQGRLPFHLETGYVGIGKDNELQHFYYFLASESEPTTNPLLIWLT  76

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSSL+ ++ EIGPL F A++YNG+LPT   N  +LTK AS+IFLDQ  N GFSY+T
Sbjct  77   GGPGCSSLSAIVNEIGPLRF-AELYNGSLPTFELNPHALTKIASVIFLDQPVNTGFSYAT  135

Query  107  NTTT--NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            N      TD++A +YV EFL+KW D +  F+SNPF++
Sbjct  136  NDAAYKYTDIQACEYVDEFLRKWLDDHPQFISNPFYV  172



>emb|CDP01265.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   176 bits (447),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 114/156 (73%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            ++ SAGS V  LPGFEGPLPF LETGYIGV ESE++QLFYYFVKSE++P+ DPL+LW+SG
Sbjct  38   NLASAGSPVKFLPGFEGPLPFELETGYIGVDESEDVQLFYYFVKSESSPETDPLVLWLSG  97

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS--  111
               C+S +GL YEIGP+ F+  +Y+GTLP LL N  S TK ASIIF+D     GFSY+  
Sbjct  98   GNCCTSFSGLAYEIGPIKFEQVLYHGTLPKLLLNPYSWTKVASIIFVDLPVASGFSYART  157

Query  110  TNTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               + +T ++A    YEFL+KW   + +F+S+P +I
Sbjct  158  AKASQSTVLQACNQAYEFLRKWLVDHPEFISSPVYI  193



>ref|XP_010320337.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Solanum 
lycopersicum]
Length=468

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = -3

Query  446  SKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGCSS  267
            S V+ LPG++G LPF LETGY+GVG+ E +QLFYYF++SET P  DPL++W+SG  GCSS
Sbjct  26   STVEYLPGWQGRLPFPLETGYVGVGKDEAVQLFYYFLESETEPTTDPLLVWLSGGPGCSS  85

Query  266  LTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTT--N  93
            +  ++ EIGP+ F  +VYNG++P+   N  + TK A++IFLDQ  N GFSY+TN+     
Sbjct  86   VIAIVDEIGPIRFVEQVYNGSMPSFELNPHAWTKIANVIFLDQPVNTGFSYATNSAAYKY  145

Query  92   TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            TDV+A +YVYEFL+KW + +  F+SNPF++
Sbjct  146  TDVQACEYVYEFLRKWLNDHPQFISNPFYV  175



>ref|XP_009139927.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Brassica 
rapa]
Length=441

 Score =   175 bits (444),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 115/157 (73%), Gaps = 4/157 (3%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVG--ESEEIQLFYYFVKSETNPKDDPLILWI  291
            + + + S V  LPGFEGPLPF LETGY+GVG  E E++QLFYYF+KSE NP+ DPL+LW+
Sbjct  22   NAVDSTSIVKYLPGFEGPLPFELETGYVGVGVGEEEQVQLFYYFIKSERNPEKDPLLLWL  81

Query  290  SGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS  111
            SG  GCSS++GL+YE GP+    +VYNGTLP+L+    S TK +SII+LDQ    GFSYS
Sbjct  82   SGGPGCSSISGLLYENGPVTVKFEVYNGTLPSLIATTYSWTKISSIIYLDQPVGTGFSYS  141

Query  110  TN--TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
                 +  +D    K V+EFLQKW +++Q+F+SNPF+
Sbjct  142  RTHLASKPSDSGEVKLVHEFLQKWLNKHQEFLSNPFY  178



>ref|XP_009139928.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Brassica 
rapa]
Length=436

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 115/157 (73%), Gaps = 4/157 (3%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVG--ESEEIQLFYYFVKSETNPKDDPLILWI  291
            + + + S V  LPGFEGPLPF LETGY+GVG  E E++QLFYYF+KSE NP+ DPL+LW+
Sbjct  17   NAVDSTSIVKYLPGFEGPLPFELETGYVGVGVGEEEQVQLFYYFIKSERNPEKDPLLLWL  76

Query  290  SGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS  111
            SG  GCSS++GL+YE GP+    +VYNGTLP+L+    S TK +SII+LDQ    GFSYS
Sbjct  77   SGGPGCSSISGLLYENGPVTVKFEVYNGTLPSLIATTYSWTKISSIIYLDQPVGTGFSYS  136

Query  110  TN--TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
                 +  +D    K V+EFLQKW +++Q+F+SNPF+
Sbjct  137  RTHLASKPSDSGEVKLVHEFLQKWLNKHQEFLSNPFY  173



>ref|XP_010472298.1| PREDICTED: serine carboxypeptidase-like 10 isoform X1 [Camelina 
sativa]
Length=435

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 110/155 (71%), Gaps = 1/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H + +G+ V  LPGFEGPLPF LETGYIG+GE E IQ+FYYF+KSE NPK+DPL+LW+ G
Sbjct  15   HHVDSGTTVKFLPGFEGPLPFELETGYIGIGEEENIQVFYYFIKSEKNPKEDPLLLWLDG  74

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-T  108
              GCSSL GL++E GPL   ++VYNG  P+L+    S TK A+II+LDQ    GFSYS T
Sbjct  75   GPGCSSLGGLLFENGPLALKSEVYNGITPSLVSTTYSWTKMANIIYLDQPVGAGFSYSRT  134

Query  107  NTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                 +D    K +++FLQKW  ++  F+SN F++
Sbjct  135  PIGKTSDTIEVKRIHDFLQKWLSKHPQFISNSFYV  169



>ref|XP_009121469.1| PREDICTED: serine carboxypeptidase-like 7 [Brassica rapa]
Length=459

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 113/153 (74%), Gaps = 2/153 (1%)
 Frame = -3

Query  455  SAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQG  276
            ++GS V  LPGFEGPLPF LETGYIGVG+ E++QLFYYF+KSE NPK+DPL+LW++G  G
Sbjct  19   NSGSIVKYLPGFEGPLPFELETGYIGVGKEEQLQLFYYFIKSERNPKEDPLLLWLTGGPG  78

Query  275  CSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTT  96
            CS+++ L++E GP+ F  + YNG  PTLL    S TK ASII+LDQ    GFSYS     
Sbjct  79   CSAVSALLFENGPVKFRVEGYNGGTPTLLSTTYSWTKIASIIYLDQPVGTGFSYSKTQLL  138

Query  95   NT--DVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            +T  D   +K ++EFL KW D++ +F+SNPF++
Sbjct  139  DTPSDSGEAKRIHEFLLKWLDKHIEFISNPFYV  171



>ref|XP_009140442.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Brassica 
rapa]
Length=440

 Score =   175 bits (444),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 112/156 (72%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   +GS V  LPGFEGPLPF LETGYIGVG+ E++Q+FYYFVKSE NP++DPL++W++G
Sbjct  17   HHAESGSIVKFLPGFEGPLPFELETGYIGVGDKEDLQMFYYFVKSENNPQEDPLLIWLTG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSSL  +++E GPL    ++YNGTLP+L+    S TK A+I+FLDQ    GFSYS  
Sbjct  77   GPGCSSLFAILFENGPLALKFELYNGTLPSLVTTTYSWTKMANIVFLDQPVGAGFSYSRT  136

Query  104  TTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               N  +D    K ++EFLQKW  ++ +F SNPF++
Sbjct  137  PLLNKVSDTGEVKVIHEFLQKWLSKHPEFYSNPFYV  172



>ref|XP_010474419.1| PREDICTED: serine carboxypeptidase-like 9 [Camelina sativa]
Length=440

 Score =   175 bits (443),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 110/155 (71%), Gaps = 2/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   +GS V  LPGFEGPLPF LETGYIG+GE EE QLFYYF+KSE NP++DPL+LW+ G
Sbjct  17   HHAESGSIVKFLPGFEGPLPFELETGYIGMGEKEEDQLFYYFIKSENNPEEDPLLLWLEG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              G SSL+GL+ EIGPL    + YNG++P+L+    S TK ASIIFLDQ    GFSYS+ 
Sbjct  77   APGSSSLSGLLMEIGPLTVKTERYNGSVPSLVSTTYSWTKMASIIFLDQPVGSGFSYSSK  136

Query  104  T--TTNTDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
            T    +TD      ++EFLQKW  ++  ++SNPF+
Sbjct  137  TPLDNSTDTIEVNKIHEFLQKWLSKHPQYLSNPFY  171



>emb|CDX89533.1| BnaC04g35520D [Brassica napus]
Length=472

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 112/156 (72%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   +GS V  LPGFEGPLPF LETGYIGVG+ E++Q+FYYFVKSE NP++DPL++W++G
Sbjct  17   HHAESGSIVKFLPGFEGPLPFELETGYIGVGDKEDLQMFYYFVKSENNPQEDPLLIWLTG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSSL  +++E GPL    ++YNGTLP+L+    S TK A+I+FLDQ    GFSYS  
Sbjct  77   GPGCSSLFAILFENGPLALKFELYNGTLPSLVTTTYSWTKMANIVFLDQPVGAGFSYSRT  136

Query  104  TTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               N  +D    K ++EFLQKW  ++ +F SNPF++
Sbjct  137  PLLNKVSDTGEVKVIHEFLQKWLSKHPEFYSNPFYV  172



>ref|XP_009139930.1| PREDICTED: serine carboxypeptidase-like 7 isoform X4 [Brassica 
rapa]
Length=489

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 115/157 (73%), Gaps = 4/157 (3%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVG--ESEEIQLFYYFVKSETNPKDDPLILWI  291
            + + + S V  LPGFEGPLPF LETGY+GVG  E E++QLFYYF+KSE NP+ DPL+LW+
Sbjct  22   NAVDSTSIVKYLPGFEGPLPFELETGYVGVGVGEEEQVQLFYYFIKSERNPEKDPLLLWL  81

Query  290  SGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS  111
            SG  GCSS++GL+YE GP+    +VYNGTLP+L+    S TK +SII+LDQ    GFSYS
Sbjct  82   SGGPGCSSISGLLYENGPVTVKFEVYNGTLPSLIATTYSWTKISSIIYLDQPVGTGFSYS  141

Query  110  TN--TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
                 +  +D    K V+EFLQKW +++Q+F+SNPF+
Sbjct  142  RTHLASKPSDSGEVKLVHEFLQKWLNKHQEFLSNPFY  178



>ref|XP_009140440.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Brassica 
rapa]
Length=434

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 112/156 (72%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   +GS V  LPGFEGPLPF LETGYIGVG+ E++Q+FYYFVKSE NP++DPL++W++G
Sbjct  17   HHAESGSIVKFLPGFEGPLPFELETGYIGVGDKEDLQMFYYFVKSENNPQEDPLLIWLTG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSSL  +++E GPL    ++YNGTLP+L+    S TK A+I+FLDQ    GFSYS  
Sbjct  77   GPGCSSLFAILFENGPLALKFELYNGTLPSLVTTTYSWTKMANIVFLDQPVGAGFSYSRT  136

Query  104  TTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               N  +D    K ++EFLQKW  ++ +F SNPF++
Sbjct  137  PLLNKVSDTGEVKVIHEFLQKWLSKHPEFYSNPFYV  172



>emb|CDY38920.1| BnaA04g13410D [Brassica napus]
Length=464

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 112/156 (72%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   +GS V  LPGFEGPLPF LETGYIGVG+ E++Q+FYYFVKSE NP++DPL++W++G
Sbjct  17   HHAESGSIVKFLPGFEGPLPFELETGYIGVGDKEDLQMFYYFVKSENNPQEDPLLIWLTG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSSL  +++E GPL    ++YNGTLP+L+    S TK A+I+FLDQ    GFSYS  
Sbjct  77   GPGCSSLFAILFENGPLALKFELYNGTLPSLVTTTYSWTKMANIVFLDQPVGAGFSYSRT  136

Query  104  TTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               N  +D    K ++EFLQKW  ++ +F SNPF++
Sbjct  137  PLLNKVSDTGEVKVIHEFLQKWLSKHPEFYSNPFYV  172



>ref|XP_006294243.1| hypothetical protein CARUB_v10023242mg [Capsella rubella]
 gb|EOA27141.1| hypothetical protein CARUB_v10023242mg [Capsella rubella]
Length=437

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 109/151 (72%), Gaps = 1/151 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            +GS V  LPGFEGPLPF LETGYIG+ E E +Q FYYF+KS+ NPK+DPL++W++G  GC
Sbjct  21   SGSIVKFLPGFEGPLPFELETGYIGIDEEENVQFFYYFIKSDKNPKEDPLLIWLNGGPGC  80

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-TNTTT  96
            S L+GL +E GPL F ++VYNG++P+L+    S TK A+IIFLDQ    GFSYS T    
Sbjct  81   SCLSGLFFENGPLAFKSEVYNGSVPSLVSTTYSWTKTANIIFLDQPVGSGFSYSRTPIGK  140

Query  95   NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             +D    K ++EFLQKW  ++  F SNPF++
Sbjct  141  TSDTHEVKRIHEFLQKWLRKHPQFSSNPFYV  171



>ref|XP_010556471.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
7 [Tarenaya hassleriana]
Length=432

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 113/156 (72%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   +GS V  LPGFEGPLPF LETGY+GVGESE+ QLFYYF+KSE NP++DPL++ ++G
Sbjct  21   HQADSGSIVRFLPGFEGPLPFELETGYVGVGESEDAQLFYYFIKSEGNPREDPLLVSLTG  80

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSSLT  +YEIGPL F  + Y G +P+L+    S TK ASIIFLDQ    GFSYS N
Sbjct  81   GPGCSSLTAFLYEIGPLAFKLEDYYGGMPSLVSTTYSWTKFASIIFLDQPVGTGFSYSRN  140

Query  104  TTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               N  +D  ++K VYEF++K+   + +F+SNPF++
Sbjct  141  PRANRRSDTISAKQVYEFVRKFLIDHPEFISNPFYV  176



>ref|XP_011006024.1| PREDICTED: serine carboxypeptidase-like 3 isoform X2 [Populus 
euphratica]
Length=463

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 111/153 (73%), Gaps = 2/153 (1%)
 Frame = -3

Query  455  SAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQG  276
            +A S V  LPG +GPLPFHLETGY+GV E+E++QLFYYF+KS+ NPKDDPL+LW++G  G
Sbjct  20   AARSIVKFLPGLKGPLPFHLETGYVGVDEAEDVQLFYYFIKSQRNPKDDPLLLWLTGGPG  79

Query  275  CSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN--T  102
            CS+  GL++EIGP+ F+ K YNG+LPTL+ N  S T+ +SIIFLD     GFSY+     
Sbjct  80   CSAFCGLVFEIGPISFEVKEYNGSLPTLVLNPYSWTQVSSIIFLDLPAGTGFSYARTPLA  139

Query  101  TTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               +D +   +  +FL+KW   +Q+F++NP +I
Sbjct  140  LQRSDFKQVSHAEQFLRKWLMDHQEFLANPIYI  172



>emb|CDY49438.1| BnaA09g42290D [Brassica napus]
Length=438

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 113/155 (73%), Gaps = 1/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H +  GS V  LPGFEGPLPF L+TGYIG+GE EE+QLFYYF+KSE NPK+DPL++W++G
Sbjct  17   HHVDCGSIVKFLPGFEGPLPFELQTGYIGIGEEEEVQLFYYFIKSEKNPKEDPLLIWLNG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-T  108
              GCSSL GL +E GP+    +VYNG+L +L+ +  S T+ A+II+LDQ    GFSYS T
Sbjct  77   GPGCSSLEGLFFENGPVGLKFEVYNGSLVSLVSSTYSWTQVANIIYLDQPVGAGFSYSRT  136

Query  107  NTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                 +D   +K +++FLQKW  ++  F+SNPF++
Sbjct  137  PLDKTSDTNEAKMIHQFLQKWLSKHPQFLSNPFYV  171



>ref|XP_006472320.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472321.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Citrus 
sinensis]
Length=467

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 111/153 (73%), Gaps = 2/153 (1%)
 Frame = -3

Query  455  SAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQG  276
            ++ S V  LPGF+GPLPF LETGY+GVGESEE QLFYYFVKSE NPK+DPL+LW++G  G
Sbjct  22   ASHSTVKFLPGFQGPLPFELETGYVGVGESEEAQLFYYFVKSEKNPKEDPLLLWLTGGPG  81

Query  275  CSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST--NT  102
            CS+ +GL YEIGP+ F+   YNG+LPTL  N  S TK ASI+F+D     GFSY+   + 
Sbjct  82   CSAFSGLAYEIGPVNFNTVEYNGSLPTLRLNPYSWTKEASILFVDSPVGTGFSYARTPHA  141

Query  101  TTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            +   D +   ++ +FL+KW   + +F+SNPF++
Sbjct  142  SQTGDFKQVHHLDQFLRKWLMDHPEFISNPFYV  174



>ref|XP_010429242.1| PREDICTED: serine carboxypeptidase-like 10 isoform X4 [Camelina 
sativa]
Length=449

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 111/155 (72%), Gaps = 1/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H + +G+ V  LPGFEGPLPF LETGYIG+GE E++Q+FYYF+KSE NPK+DPL+LW+ G
Sbjct  15   HHVDSGTIVKFLPGFEGPLPFELETGYIGIGEEEDMQVFYYFIKSEKNPKEDPLLLWLDG  74

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-T  108
              GCSSL GL++E GPL   ++VYNG  P+L+    S TK A+II+LDQ    GFSYS T
Sbjct  75   GPGCSSLGGLLFENGPLALKSEVYNGITPSLVSTTYSWTKMANIIYLDQPVGAGFSYSRT  134

Query  107  NTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                 +D    K +++FLQKW  ++  F+SN F++
Sbjct  135  PIGKTSDTIEVKRIHDFLQKWLSKHPQFISNSFYV  169



>ref|XP_010465794.1| PREDICTED: serine carboxypeptidase-like 16 [Camelina sativa]
Length=437

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S +  LPGF+GPLPF LETGYIGVG+++E Q+FYYF+KSE+NPK+DPL+LW++G  GC
Sbjct  24   SSSIIRSLPGFDGPLPFELETGYIGVGDADEDQMFYYFIKSESNPKEDPLLLWLTGGPGC  83

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS  GL+YE GP+ F  K YNG++PTL+    S TK +++I+LDQ    GFSYS N   +
Sbjct  84   SSFFGLVYENGPIAFKVKAYNGSIPTLVSTTYSWTKFSNVIYLDQPVGTGFSYSKNPLAD  143

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D  ++K V EFL+KW  Q+ ++ SNPF++
Sbjct  144  IPSDTGSTKRVDEFLRKWLAQHPEYSSNPFYV  175



>ref|XP_011006023.1| PREDICTED: serine carboxypeptidase-like 3 isoform X1 [Populus 
euphratica]
Length=487

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 111/153 (73%), Gaps = 2/153 (1%)
 Frame = -3

Query  455  SAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQG  276
            +A S V  LPG +GPLPFHLETGY+GV E+E++QLFYYF+KS+ NPKDDPL+LW++G  G
Sbjct  20   AARSIVKFLPGLKGPLPFHLETGYVGVDEAEDVQLFYYFIKSQRNPKDDPLLLWLTGGPG  79

Query  275  CSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN--T  102
            CS+  GL++EIGP+ F+ K YNG+LPTL+ N  S T+ +SIIFLD     GFSY+     
Sbjct  80   CSAFCGLVFEIGPISFEVKEYNGSLPTLVLNPYSWTQVSSIIFLDLPAGTGFSYARTPLA  139

Query  101  TTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               +D +   +  +FL+KW   +Q+F++NP +I
Sbjct  140  LQRSDFKQVSHAEQFLRKWLMDHQEFLANPIYI  172



>emb|CDP21040.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 125/178 (70%), Gaps = 4/178 (2%)
 Frame = -3

Query  530  MKLSLNHFVILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQL  351
            ++ SL  ++IL ++ V      ++ SAGS V  LPGFEGPLPF LETGYIGV ESE++QL
Sbjct  18   IRSSLFSYLILPLVLVQ--LCSNLASAGSPVKFLPGFEGPLPFELETGYIGVDESEDVQL  75

Query  350  FYYFVKSETNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSL  171
            FYYFVKSE++P+ DPL+LW++G   C+S +GL +EIGP+ F+  +Y+GTLP LL N  S 
Sbjct  76   FYYFVKSESSPETDPLVLWLTGGNCCTSFSGLAFEIGPIKFEQVLYHGTLPKLLSNPYSW  135

Query  170  TKNASIIFLDQLPNIGFSYS--TNTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            TK ASIIF+D     GFSY+     + +T ++A    YEFL+KW   + +F+S+P +I
Sbjct  136  TKVASIIFVDLPVASGFSYARTAKASQSTVLQACNQAYEFLRKWLVDHPEFISSPVYI  193



>ref|XP_010429240.1| PREDICTED: serine carboxypeptidase-like 10 isoform X2 [Camelina 
sativa]
Length=422

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 111/155 (72%), Gaps = 1/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H + +G+ V  LPGFEGPLPF LETGYIG+GE E++Q+FYYF+KSE NPK+DPL+LW+ G
Sbjct  15   HHVDSGTIVKFLPGFEGPLPFELETGYIGIGEEEDMQVFYYFIKSEKNPKEDPLLLWLDG  74

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-T  108
              GCSSL GL++E GPL   ++VYNG  P+L+    S TK A+II+LDQ    GFSYS T
Sbjct  75   GPGCSSLGGLLFENGPLALKSEVYNGITPSLVSTTYSWTKMANIIYLDQPVGAGFSYSRT  134

Query  107  NTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                 +D    K +++FLQKW  ++  F+SN F++
Sbjct  135  PIGKTSDTIEVKRIHDFLQKWLSKHPQFISNSFYV  169



>ref|XP_007018461.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
 gb|EOY15686.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
Length=473

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 113/153 (74%), Gaps = 3/153 (2%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            A S V  LPGFEGPLPF LETGY+GVG+SE++QLFYYFVKSE NP++DPL+LW++G  GC
Sbjct  26   AHSAVKFLPGFEGPLPFELETGYVGVGDSEDVQLFYYFVKSERNPEEDPLLLWLTGGPGC  85

Query  272  SSLTGLIYEIGPLFFDAKV-YNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN--T  102
            S+ +GL++EIGPL F A V YNG+LPTL+ N  S TK ++IIF+D     GFSY+ N   
Sbjct  86   SAFSGLVFEIGPLNFKADVEYNGSLPTLVLNPYSWTKVSNIIFVDSPVGTGFSYARNNLA  145

Query  101  TTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                D + +  +++FL+KW   + DF+S+P ++
Sbjct  146  ALTGDFKQANQLHQFLRKWLKDHPDFISSPVYV  178



>ref|XP_006376417.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|ERP54214.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=433

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 112/153 (73%), Gaps = 2/153 (1%)
 Frame = -3

Query  455  SAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQG  276
            SA S V  LPGF+G LPFHLETGY+GV E+E++QLFYYF+KS+ NPKDDPL+LW++G  G
Sbjct  20   SAHSIVKFLPGFQGALPFHLETGYVGVDEAEDVQLFYYFIKSQRNPKDDPLLLWLTGGPG  79

Query  275  CSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN--T  102
            CS+ +GL +EIGP+ F+ K YNG+LPTL+FN  S T+ +SIIFLD   + GFSY+     
Sbjct  80   CSAFSGLAFEIGPIRFEEKEYNGSLPTLVFNPYSWTQVSSIIFLDLPVSTGFSYARAPLA  139

Query  101  TTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               +D +      +FL+KW   +Q+F+SNP +I
Sbjct  140  LQRSDFKQVSQAEQFLRKWLMDHQEFLSNPVYI  172



>ref|XP_010429239.1| PREDICTED: serine carboxypeptidase-like 10 isoform X1 [Camelina 
sativa]
Length=435

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 111/155 (72%), Gaps = 1/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H + +G+ V  LPGFEGPLPF LETGYIG+GE E++Q+FYYF+KSE NPK+DPL+LW+ G
Sbjct  15   HHVDSGTIVKFLPGFEGPLPFELETGYIGIGEEEDMQVFYYFIKSEKNPKEDPLLLWLDG  74

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-T  108
              GCSSL GL++E GPL   ++VYNG  P+L+    S TK A+II+LDQ    GFSYS T
Sbjct  75   GPGCSSLGGLLFENGPLALKSEVYNGITPSLVSTTYSWTKMANIIYLDQPVGAGFSYSRT  134

Query  107  NTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                 +D    K +++FLQKW  ++  F+SN F++
Sbjct  135  PIGKTSDTIEVKRIHDFLQKWLSKHPQFISNSFYV  169



>emb|CDP21038.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 123/178 (69%), Gaps = 4/178 (2%)
 Frame = -3

Query  530  MKLSLNHFVILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQL  351
            M+ SL +++IL ++ +      ++ +AGS V  LPGFEGPLPF LETGYIGV ESE++QL
Sbjct  1    MRSSLFYYLILPLVLLQ--ICSNLATAGSTVRFLPGFEGPLPFELETGYIGVEESEDVQL  58

Query  350  FYYFVKSETNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSL  171
            FYYFVKSE+ P+ DPL+LW+SG   C+S +GL Y+IGP+ F+  +YNGTLP LL N  S 
Sbjct  59   FYYFVKSESIPETDPLVLWLSGGNCCTSFSGLAYQIGPIKFEEVLYNGTLPKLLLNPYSW  118

Query  170  TKNASIIFLDQLPNIGFSYS--TNTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            TK  SIIF+D     GFSY+     + +T  +A    YEFL+KW   + +F+S+P +I
Sbjct  119  TKLVSIIFVDLPVASGFSYARTAKASQSTVSQACNQAYEFLRKWLVDHPEFISSPVYI  176



>ref|XP_002893774.1| hypothetical protein ARALYDRAFT_890934 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70033.1| hypothetical protein ARALYDRAFT_890934 [Arabidopsis lyrata subsp. 
lyrata]
Length=441

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 112/164 (68%), Gaps = 9/164 (5%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H + + S +  LPGFEG LPFHLETGYIGVGE E++QLFYYF+KSE NP++DPLILW++
Sbjct  20   QHDVDSASVISYLPGFEGLLPFHLETGYIGVGEGEKVQLFYYFIKSENNPEEDPLILWLT  79

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G   C++L+ L  EIGPL F  + YNG  P+L+    S TK ASIIFLDQ    GFSYST
Sbjct  80   GGPACTALSALALEIGPLTFKTEGYNGGSPSLVSTSYSWTKVASIIFLDQPVGTGFSYST  139

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQD-------FVSNPFFI  3
               ++  +D   +K  YEFLQKW  +N D        VSNPF++
Sbjct  140  TPLSDKPSDTGETKQTYEFLQKWLVENPDRNKQTLQHVSNPFYV  183



>ref|XP_003604930.1| Serine carboxypeptidase family protein [Medicago truncatula]
Length=981

 Score =   179 bits (453),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 81/151 (54%), Positives = 114/151 (75%), Gaps = 2/151 (1%)
 Frame = -3

Query  449  GSKVDVLPGFEGPLPFHLETGYIGVGES-EEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            GSKV+ LPGF+GPLPF LETGY+G+G+S +++Q+FYYFVKSE NP+ DPL+LW++G  GC
Sbjct  121  GSKVEHLPGFQGPLPFELETGYVGLGDSNDDMQVFYYFVKSENNPQKDPLMLWLTGGPGC  180

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS +GL+YEIGP  F+ K YNG++P+L+   QS TK ++IIF+D     GFSY+ N T +
Sbjct  181  SSFSGLVYEIGPFAFEIKEYNGSVPSLVLRPQSWTKLSNIIFVDLPLGTGFSYAKNVTYH  240

Query  92   -TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             +D +     Y+FL+KW   + +F+SN F+I
Sbjct  241  RSDWKLVHNTYQFLRKWLIDHPEFLSNEFYI  271



>ref|XP_009103431.1| PREDICTED: serine carboxypeptidase-like 10 [Brassica rapa]
Length=440

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = -3

Query  476  VFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLIL  297
            V+ +HV  +GS V  LPGFEGPLPF LETGYIG+GE E+IQLFYYF+KSE NP +DPL++
Sbjct  16   VWSQHV-DSGSIVKFLPGFEGPLPFELETGYIGIGEKEDIQLFYYFIKSEKNPIEDPLLI  74

Query  296  WISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFS  117
            W++G  GCSSL GL++E GPL F  +VYNG L +L     S T+ A+I+FLDQ    GFS
Sbjct  75   WLNGGPGCSSLLGLLFENGPLAFKFEVYNGNLASLFSTTYSWTQVANILFLDQPVGSGFS  134

Query  116  YS-TNTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            YS T     +D    K ++EFLQKW  ++  F SNPF++
Sbjct  135  YSRTPLDKTSDTNEVKMIHEFLQKWLSKHPQFFSNPFYV  173



>emb|CDY59210.1| BnaA09g54030D [Brassica napus]
Length=468

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 112/158 (71%), Gaps = 3/158 (2%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H +   S +  LPGFEGPLPFHLETGYIGVGE E+++LFYYF+KSE  P++DPL++W++
Sbjct  24   QHGVDTASVISHLPGFEGPLPFHLETGYIGVGEEEKVKLFYYFIKSENKPEEDPLLIWLT  83

Query  287  GEQGCSSLTGLIYEIG-PLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS  111
            G   C++L+ L +EIG PL F  + YNG LP+L+    S TK ASIIFLDQ    GFSYS
Sbjct  84   GGPACTALSALAFEIGRPLTFKTEGYNGGLPSLVSTSYSWTKVASIIFLDQPVGTGFSYS  143

Query  110  TNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            T    +  +D   +K  YEFLQKW  ++ +FVSNP ++
Sbjct  144  TTPLADKPSDTGEAKQTYEFLQKWLVEHPEFVSNPLYV  181



>ref|XP_006415267.1| hypothetical protein EUTSA_v10007571mg [Eutrema salsugineum]
 gb|ESQ33620.1| hypothetical protein EUTSA_v10007571mg [Eutrema salsugineum]
Length=464

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -3

Query  458  ISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQ  279
            +++ S +  LPGFEGPLPFHLETGYI VGE E+++LFYYF+KSE NP++DPL++W+SG  
Sbjct  23   VNSASVISYLPGFEGPLPFHLETGYIAVGEEEKVKLFYYFIKSENNPEEDPLLIWLSGGP  82

Query  278  GCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTT  99
            GC+SL+ L +EIGPL F  +  NG L +L+    S TK ASIIFLDQ    GFSYST   
Sbjct  83   GCTSLSALAFEIGPLTFKTEGNNGGLTSLVSTSYSWTKVASIIFLDQPVGTGFSYSTTPL  142

Query  98   TN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             +  +D   +K  YEFL+KW   + +FVSNPF++
Sbjct  143  ADKPSDTGEAKQTYEFLRKWLVDHPEFVSNPFYV  176



>ref|XP_009365383.1| PREDICTED: serine carboxypeptidase-like 13 [Pyrus x bretschneideri]
Length=473

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -3

Query  458  ISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQ  279
            +S    V  LPGF+GPLPF LETGY+GVGE EE+QLFYYFVK+E  P++DPL+LW++G  
Sbjct  38   VSNSQLVKFLPGFQGPLPFELETGYVGVGEEEEVQLFYYFVKTERKPEEDPLMLWLTGGP  97

Query  278  GCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNT-  102
            GCSSLT L+YEIGPL F+ + YNG+LPTL  N  + TK +SIIF+D     GFSY+  + 
Sbjct  98   GCSSLTALLYEIGPLNFNIEQYNGSLPTLTLNPYAWTKVSSIIFVDSPVGTGFSYARGSF  157

Query  101  -TTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             +  +D E   +  +FL+KW   + +F+SNPFF+
Sbjct  158  ASQPSDSEQVGHALQFLRKWLVDHPEFMSNPFFL  191



>ref|XP_010486652.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Camelina 
sativa]
Length=440

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 120/176 (68%), Gaps = 2/176 (1%)
 Frame = -3

Query  524  LSLNHFVILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFY  345
            ++ ++F    ++ +   F      + S V+ LPGF+G LPF LETGYIGVGE EE+QLFY
Sbjct  1    MAKDYFSSSVLLILFIFFYSQRTDSASIVEFLPGFDGRLPFELETGYIGVGEEEEVQLFY  60

Query  344  YFVKSETNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTK  165
            YF+KSE  P++DP++LW+SG  GCSS++GL YE GP+    +VYNGT+P+L+    S TK
Sbjct  61   YFIKSERIPEEDPILLWLSGGPGCSSISGLFYENGPVTVKLEVYNGTIPSLVSTPYSWTK  120

Query  164  NASIIFLDQLPNIGFSYSTNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             +SII+LDQ    GFSYS     N  +D   +K ++EFL KW  ++Q+F SNPF++
Sbjct  121  VSSIIYLDQPVGTGFSYSRTQRVNKPSDSGEAKRIHEFLHKWLGKHQEFSSNPFYV  176



>emb|CDX72978.1| BnaC06g34260D [Brassica napus]
Length=440

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 109/151 (72%), Gaps = 2/151 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S V  LPGF+GPLPF LETGYIG+GE EE+Q FYYF+KSE NP++DP++LW+SG  GC
Sbjct  28   SASIVKYLPGFDGPLPFELETGYIGIGEKEEVQSFYYFIKSERNPEEDPVLLWLSGGPGC  87

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            S+++GL+ E GPL     VYNGT+P L+    S TK +SI++LDQ    GFSYS     N
Sbjct  88   SAISGLLLENGPLAMKLDVYNGTVPPLVSTTYSWTKTSSILYLDQPVGTGFSYSRTHLVN  147

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
              +D   +K ++EFLQKW  ++Q+F SNPF+
Sbjct  148  KPSDSGEAKRIHEFLQKWLGKHQEFSSNPFY  178



>ref|XP_006433655.1| hypothetical protein CICLE_v10001060mg [Citrus clementina]
 gb|ESR46895.1| hypothetical protein CICLE_v10001060mg [Citrus clementina]
Length=467

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 111/153 (73%), Gaps = 2/153 (1%)
 Frame = -3

Query  455  SAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQG  276
            ++ S V  LPGF+GPLPF LETGY+GVGESEE QLFYYFVKS+ NPK+DPL+LW++G  G
Sbjct  22   ASHSTVKFLPGFQGPLPFELETGYVGVGESEEAQLFYYFVKSDKNPKEDPLLLWLTGGPG  81

Query  275  CSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST--NT  102
            CS+ +GL YEIGP+ F+   YNG+LPTL  N  S TK ASI+F+D     GFSY+   + 
Sbjct  82   CSAFSGLAYEIGPVNFNTVEYNGSLPTLRLNPYSWTKEASILFVDSPVGTGFSYARTPHA  141

Query  101  TTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            +   D +   ++ +FL+KW   + +F+SNPF++
Sbjct  142  SQTGDFKQVHHLDQFLRKWLMDHPEFISNPFYV  174



>ref|XP_004238067.1| PREDICTED: uncharacterized protein LOC101252078 [Solanum lycopersicum]
Length=907

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 112/154 (73%), Gaps = 2/154 (1%)
 Frame = -3

Query  458  ISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQ  279
            + A + V  LPGF+GPLPFHLETGY+GVG+ E+ QLFYYF+KSE++P +DPLILW++G  
Sbjct  463  VQAAATVKFLPGFDGPLPFHLETGYVGVGKEEKHQLFYYFIKSESDPGNDPLILWLTGGP  522

Query  278  GCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTT  99
            GCSS  G++YEIGPL++  K YNG+LPTL     S TK A+IIFL+Q  N GFSY+T   
Sbjct  523  GCSSFNGVVYEIGPLYYKQKKYNGSLPTLGVTPNSWTKVANIIFLEQPVNTGFSYATTPE  582

Query  98   TN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                 DV+A  +VY+FL KW   + +F SN F++
Sbjct  583  AMHVIDVDACTHVYQFLLKWLVDHPEFSSNNFYL  616


 Score =   177 bits (449),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 120/169 (71%), Gaps = 4/169 (2%)
 Frame = -3

Query  500  LAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETN  321
            L  + +V V  E  I AGS V  LPGF+GPLPF LETGY+GVG+SE++QLFYYF++SE+ 
Sbjct  6    LCYLFLVLVVAEPAI-AGSPVKFLPGFKGPLPFQLETGYVGVGDSEDVQLFYYFIESESG  64

Query  320  -PKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFL  144
             P  DPL+LWI+G  GCS+L+GLIYEIGP+ F A  YNG+LPT++ N  S TK +SIIFL
Sbjct  65   YPDSDPLMLWITGGPGCSALSGLIYEIGPITFGAVEYNGSLPTMILNPYSWTKVSSIIFL  124

Query  143  DQLPNIGFSYSTNTTT--NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            D     GFSY+T       +D++ S + Y+FL+KWF  +  F+ NP +I
Sbjct  125  DLPVGTGFSYATTPAALQTSDLQTSDHAYQFLRKWFVDHPTFLKNPLYI  173



>emb|CDX76889.1| BnaC08g34750D [Brassica napus]
Length=438

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 112/155 (72%), Gaps = 1/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H +  GS V  LPGFEGPLPF LETGYIG+GE EE+QLFYYF+KS+ NPK+DPL++W++G
Sbjct  17   HHVDCGSIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSKKNPKEDPLLIWLNG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-T  108
              GCSSL GL +E GP+    +VYNG+L +L+ +  S T+  +II+LDQ    GFSYS T
Sbjct  77   GPGCSSLEGLFFENGPVGLKFEVYNGSLVSLVSSTYSWTQVVNIIYLDQPVGAGFSYSRT  136

Query  107  NTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                 +D   +K ++EFLQKW  ++  F+SNPF++
Sbjct  137  PLDKTSDTNEAKMIHEFLQKWLSKHPQFLSNPFYV  171



>gb|KDO81468.1| hypothetical protein CISIN_1g012276mg [Citrus sinensis]
Length=467

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 111/153 (73%), Gaps = 2/153 (1%)
 Frame = -3

Query  455  SAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQG  276
            ++ S V  LPGF+GPLPF LETGY+GVGESEE QLFYYFVKS+ NPK+DPL+LW++G  G
Sbjct  22   ASHSTVKFLPGFQGPLPFELETGYVGVGESEEAQLFYYFVKSDKNPKEDPLLLWLTGGPG  81

Query  275  CSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST--NT  102
            CS+ +GL YEIGP+ F+   YNG+LPTL  N  S TK ASI+F+D     GFSY+   + 
Sbjct  82   CSAFSGLAYEIGPVNFNTVEYNGSLPTLRLNPYSWTKEASILFVDSPVGTGFSYARTPHA  141

Query  101  TTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            +   D +   ++ +FL+KW   + +F+SNPF++
Sbjct  142  SQTGDFKQVHHLDQFLRKWLMDHPEFISNPFYV  174



>emb|CDY49647.1| BnaC09g41250D [Brassica napus]
Length=433

 Score =   172 bits (437),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 112/153 (73%), Gaps = 2/153 (1%)
 Frame = -3

Query  455  SAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQG  276
            ++GS V  LPGFEGPLPF LETGYI VGE+E++QLFYYF+KSE NPK+DPL+LW++G  G
Sbjct  19   NSGSIVKYLPGFEGPLPFELETGYIRVGEAEQVQLFYYFIKSERNPKEDPLLLWLTGGPG  78

Query  275  CSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNT--  102
            CS+++ L++E GP+ F  + YNG  PTLL    S T+ ASII+LDQ    GFSYS     
Sbjct  79   CSAVSALLFENGPVKFRVEGYNGGTPTLLSTTYSWTQIASIIYLDQPVGTGFSYSKTQLL  138

Query  101  TTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             T +D   +K ++EFL KW  +++ F+SNPF++
Sbjct  139  DTPSDSGEAKRIHEFLLKWLAKHEKFISNPFYV  171



>ref|XP_010419275.1| PREDICTED: serine carboxypeptidase-like 10 [Camelina sativa]
Length=527

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 110/156 (71%), Gaps = 1/156 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
             H + +G+ V  LPGFEGPLPF LETGYIG+GE E IQ+FYYF+KSE NPK+DPL+LW+ 
Sbjct  14   SHHVYSGTIVKFLPGFEGPLPFELETGYIGIGEEENIQVFYYFIKSEKNPKEDPLLLWLD  73

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-  111
            G  GCSSL GL++E GPL   ++VYNG  P+L+    S TK A+II+LDQ    GFSYS 
Sbjct  74   GGPGCSSLGGLLFENGPLALKSEVYNGITPSLVSTTYSWTKMANIIYLDQPVGAGFSYSR  133

Query  110  TNTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            T     +D    K +++FLQKW  ++  F+SN F++
Sbjct  134  TPIGKTSDTIEVKRIHDFLQKWLSKHPQFISNSFYV  169



>ref|XP_006294237.1| hypothetical protein CARUB_v10023234mg [Capsella rubella]
 gb|EOA27135.1| hypothetical protein CARUB_v10023234mg [Capsella rubella]
Length=439

 Score =   172 bits (437),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 108/146 (74%), Gaps = 1/146 (1%)
 Frame = -3

Query  440  VDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGCSSLT  261
            V  LPGFEGPLPF LETGYIG+GE EE QLFYYF+KSE NP++DPL+LW++G  GCSS+T
Sbjct  27   VKFLPGFEGPLPFELETGYIGIGEEEEAQLFYYFIKSENNPEEDPLLLWLNGGPGCSSIT  86

Query  260  GLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-TNTTTNTDV  84
             L+ EIGP+   ++ YNG++P+L+    S TK A+IIFLDQ   +GFSYS T     +D 
Sbjct  87   ALLLEIGPVALKSEAYNGSVPSLVTTTYSWTKVANIIFLDQPIGVGFSYSKTPLGETSDT  146

Query  83   EASKYVYEFLQKWFDQNQDFVSNPFF  6
               K ++EFLQKW +++  + SNPF+
Sbjct  147  NEVKMIHEFLQKWLNKHPQYYSNPFY  172



>ref|XP_010472301.1| PREDICTED: serine carboxypeptidase-like 9 isoform X2 [Camelina 
sativa]
Length=492

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 108/155 (70%), Gaps = 1/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H + +GS V  LPGFEGPLPF LETGYIG+ + E +Q FYYF+KSE NPK+DPLI+W++G
Sbjct  57   HYVDSGSIVKFLPGFEGPLPFELETGYIGIDKEENVQFFYYFIKSEKNPKEDPLIIWLNG  116

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-T  108
              GCS L+GL +E GPL   ++VYNG++P+L+    S TK  +IIFLDQ    GFSYS T
Sbjct  117  GPGCSCLSGLFFENGPLALKSEVYNGSVPSLVSTTYSWTKTTNIIFLDQPVGSGFSYSRT  176

Query  107  NTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                 +D    K ++EFLQKW  ++  F SNP ++
Sbjct  177  PIEKTSDTNEVKRIHEFLQKWLRKHPQFSSNPLYV  211



>ref|XP_010472300.1| PREDICTED: serine carboxypeptidase-like 9 isoform X1 [Camelina 
sativa]
Length=478

 Score =   173 bits (439),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 108/155 (70%), Gaps = 1/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H + +GS V  LPGFEGPLPF LETGYIG+ + E +Q FYYF+KSE NPK+DPLI+W++G
Sbjct  57   HYVDSGSIVKFLPGFEGPLPFELETGYIGIDKEENVQFFYYFIKSEKNPKEDPLIIWLNG  116

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-T  108
              GCS L+GL +E GPL   ++VYNG++P+L+    S TK  +IIFLDQ    GFSYS T
Sbjct  117  GPGCSCLSGLFFENGPLALKSEVYNGSVPSLVSTTYSWTKTTNIIFLDQPVGSGFSYSRT  176

Query  107  NTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                 +D    K ++EFLQKW  ++  F SNP ++
Sbjct  177  PIEKTSDTNEVKRIHEFLQKWLRKHPQFSSNPLYV  211



>ref|XP_010464718.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Camelina 
sativa]
Length=406

 Score =   172 bits (435),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 110/152 (72%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S V+ LPGF+GPLPF LETGYIGVGE EE+QLFYYF+KSE NPK+ PL+LW+SG  GC
Sbjct  25   SASIVEFLPGFDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEVPLLLWLSGGPGC  84

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS++GL YE GP+    +V NGT+P+L+    S TK +SII+LDQ    GFSYS     N
Sbjct  85   SSISGLFYENGPVTVKLEVNNGTIPSLVSTPYSWTKVSSIIYLDQPVGTGFSYSRTQLVN  144

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D   +K ++EFL KW  ++Q+F SN F++
Sbjct  145  KPSDSGEAKRIHEFLHKWLGKHQEFSSNSFYV  176



>gb|AAG51076.1|AC069472_16 serine carboxypeptidase, putative; 29599-27172 [Arabidopsis thaliana]
Length=449

 Score =   172 bits (437),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 111/152 (73%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S +  LPGFEGPLPF LETGYIGVG+ EE QLFYYF+KSE NP++DPL++W++G  GC
Sbjct  24   SSSIIRYLPGFEGPLPFELETGYIGVGQKEEDQLFYYFIKSENNPEEDPLLVWLTGGPGC  83

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS +GL+YE GPL F  + YNG++PTL+    S TK A+II+LDQ    GFSYS N   +
Sbjct  84   SSFSGLVYENGPLAFKVETYNGSVPTLVSTTYSWTKVANIIYLDQPVGTGFSYSRNPFAD  143

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D  + K V EF++KW  ++ ++ SNPF++
Sbjct  144  IPSDTGSVKRVNEFVRKWLAKHPEYFSNPFYV  175



>ref|XP_009105992.1| PREDICTED: serine carboxypeptidase-like 2 isoform X2 [Brassica 
rapa]
Length=445

 Score =   172 bits (436),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 112/156 (72%), Gaps = 2/156 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H   + S V  LPGF+GPLPF LETGYIG+GE +E+QLFYYF+KSE NP++DPL+LW+S
Sbjct  24   QHRAYSASIVKYLPGFDGPLPFELETGYIGIGEKDEVQLFYYFIKSEGNPEEDPLLLWLS  83

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCS+++GL+ E GPL     VYNGT+P L+    S TK++SI++LDQ    GFSYS 
Sbjct  84   GGPGCSAISGLLLENGPLAMKLDVYNGTVPPLVSTTYSWTKSSSILYLDQPVGTGFSYSR  143

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
                N  +D+  +K ++EFLQKW  ++ +F SN F+
Sbjct  144  THLVNKPSDLGEAKQIHEFLQKWLGKHPEFSSNSFY  179



>ref|XP_004292764.1| PREDICTED: serine carboxypeptidase-like 18-like [Fragaria vesca 
subsp. vesca]
Length=473

 Score =   173 bits (438),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = -3

Query  458  ISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQ  279
            +S  S V  LPG +GPLPF LETGY+GVGESEE+QLFYYFVKSE NP+ DPL+LW++G  
Sbjct  27   LSHSSLVKFLPGLQGPLPFELETGYVGVGESEELQLFYYFVKSERNPEKDPLMLWLTGGP  86

Query  278  GCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNT-  102
            GCS+++ L +EIGPL F  + YNG+LPTL+ N  S TK  SIIF+D     GFSY+  + 
Sbjct  87   GCSAVSALFFEIGPLNFKVEQYNGSLPTLVLNPHSWTKVCSIIFIDSPVGTGFSYARTSF  146

Query  101  -TTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             +   D+E  ++  +FL++W   +  F+SNPF+I
Sbjct  147  ASQPGDLEQVQHALQFLRRWLVDHPSFMSNPFYI  180



>ref|XP_003604932.1| Serine carboxypeptidase [Medicago truncatula]
 gb|AES87129.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=428

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 115/151 (76%), Gaps = 2/151 (1%)
 Frame = -3

Query  449  GSKVDVLPGFEGPLPFHLETGYIGVGES-EEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            GSKV+ LPGF+GPLPF LETGY+G+GES +++Q+FYYF+KSE NP+ DPL+LW++G  GC
Sbjct  37   GSKVEHLPGFQGPLPFQLETGYVGLGESNDDMQVFYYFIKSENNPQKDPLMLWLTGGPGC  96

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS +GL+Y+IGP  F+ K YNG++P+L+   QS TK +SIIF+D     GFSY+ N T +
Sbjct  97   SSFSGLVYQIGPFVFEIKEYNGSVPSLVSRPQSWTKRSSIIFVDLPLGTGFSYAKNVTAH  156

Query  92   -TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             +D +   + ++FL+KW   + +F+SN F+I
Sbjct  157  RSDWKLVHHAHQFLRKWLIDHPEFLSNEFYI  187



>ref|XP_007018464.1| Serine carboxypeptidase-like 2, putative [Theobroma cacao]
 gb|EOY15689.1| Serine carboxypeptidase-like 2, putative [Theobroma cacao]
Length=406

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 112/156 (72%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H+  + S V  LPGFEGPLPF LETGY+GVGES+++QLFYYF+KSE NP +DPL+LW++G
Sbjct  21   HLAMSHSLVKFLPGFEGPLPFELETGYVGVGESDDVQLFYYFIKSERNPGEDPLLLWLTG  80

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCS L+GL+YEIGPL F    YNG+LPTL+ N  S TK +SIIF+D     GF Y+TN
Sbjct  81   GPGCSGLSGLVYEIGPLNFKVVEYNGSLPTLVLNPYSWTKISSIIFVDSSVGTGFFYATN  140

Query  104  --TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                 ++D +   ++++ LQK    + +F+SNP +I
Sbjct  141  QHAAQSSDFKQVHHLHQLLQKCLMDHPEFLSNPVYI  176



>ref|NP_187832.2| serine carboxypeptidase-like 15 [Arabidopsis thaliana]
 sp|Q9C7D2.2|SCP15_ARATH RecName: Full=Serine carboxypeptidase-like 15; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB03133.1| serine carboxypeptidase [Arabidopsis thaliana]
 gb|AEE75171.1| serine carboxypeptidase-like 15 [Arabidopsis thaliana]
Length=436

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 114/157 (73%), Gaps = 3/157 (2%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H  S+ S +  LPGFEGPLPF LETGYIGVG+ EE QLFYYF+KSE NP++DPL++W++
Sbjct  20   QHADSS-SIIRYLPGFEGPLPFELETGYIGVGQKEEDQLFYYFIKSENNPEEDPLLVWLT  78

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS +GL+YE GPL F  + YNG++PTL+    S TK A+II+LDQ    GFSYS 
Sbjct  79   GGPGCSSFSGLVYENGPLAFKVETYNGSVPTLVSTTYSWTKVANIIYLDQPVGTGFSYSR  138

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            N   +  +D  + K V EF++KW  ++ ++ SNPF++
Sbjct  139  NPFADIPSDTGSVKRVNEFVRKWLAKHPEYFSNPFYV  175



>ref|XP_009120797.1| PREDICTED: serine carboxypeptidase-like 15 isoform X2 [Brassica 
rapa]
Length=416

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 111/157 (71%), Gaps = 2/157 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H   A S +  LPGFEGPLPF LETGYIGV E+EE QLFYYF+KSE NPK DPL++W++
Sbjct  19   QHHADASSIIRYLPGFEGPLPFELETGYIGVSEAEEDQLFYYFIKSENNPKTDPLLVWLT  78

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS +GL+YE GPL F  + YNG++P+L+    S TK A+II+LDQ    GFSYS 
Sbjct  79   GGPGCSSFSGLVYENGPLAFKVETYNGSVPSLVSTTYSWTKVANIIYLDQPVGAGFSYSR  138

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            N   +  +D  + K V EF++KW  ++ ++ SN F++
Sbjct  139  NPYADIPSDTGSVKRVDEFVRKWLAKHPEYSSNSFYV  175



>ref|XP_006343161.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Solanum 
tuberosum]
Length=449

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 107/158 (68%), Gaps = 3/158 (2%)
 Frame = -3

Query  470  PEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWI  291
            P H   + S V  LPGF G LPF L+TGYIGVGE EE+QLFYYFVKSE++P+ DPLILWI
Sbjct  34   PPHFDVSTSSVKYLPGF-GFLPFQLDTGYIGVGEGEEVQLFYYFVKSESDPETDPLILWI  92

Query  290  SGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS  111
            +G  GCSSL GL  E GPL FD   YNG+LPTL  N  S TK ASIIFLD     GFSY+
Sbjct  93   TGGPGCSSLEGLTMEFGPLHFDDMEYNGSLPTLSLNTHSWTKVASIIFLDLPVKTGFSYA  152

Query  110  TNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            T    N   +++  ++ Y+FLQKW   +  F+ NP +I
Sbjct  153  TTEKANQTNNLQTGEHAYQFLQKWLANHSKFLQNPIYI  190



>emb|CDX96466.1| BnaA07g30770D [Brassica napus]
Length=441

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 112/156 (72%), Gaps = 2/156 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H   + S V  LPGF+GPLPF LETGYIG+GE +E+QLFYYF+KSE NP++DPL+LW+S
Sbjct  24   QHRAYSASIVKYLPGFDGPLPFELETGYIGIGEKDEVQLFYYFIKSEGNPEEDPLLLWLS  83

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCS+++GL+ E GPL     VYNGT+P L+    S TK++SI++LDQ    GFSYS 
Sbjct  84   GGPGCSAISGLLLENGPLAMKLDVYNGTVPPLVSTTYSWTKSSSILYLDQPVGTGFSYSR  143

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
                N  +D+  +K ++EFLQKW  ++ +F SN F+
Sbjct  144  THLVNKPSDLGEAKQIHEFLQKWLGKHPEFSSNSFY  179



>gb|KFK44963.1| hypothetical protein AALP_AA1G326300 [Arabis alpina]
Length=435

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 109/156 (70%), Gaps = 2/156 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H + + S +  LPGFEGPLPFHLETGYIGVGE E+++LFYYF+KSE NP++DPL++W+S
Sbjct  7    QHSVESASVISHLPGFEGPLPFHLETGYIGVGEGEKVKLFYYFIKSENNPEEDPLLIWLS  66

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G   C++ + L +EIGPL F  + YNG +P+L+    S TK ASIIFLDQ   +GFSYST
Sbjct  67   GGPFCTAFSALAFEIGPLNFKTEGYNGGVPSLVSTSYSWTKEASIIFLDQPVGVGFSYST  126

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
               +   +D       YEFLQKW  +  +F +NP +
Sbjct  127  TPLSEKPSDTREVNQTYEFLQKWLVEYPEFATNPLY  162



>ref|XP_003604934.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=291

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 115/153 (75%), Gaps = 2/153 (1%)
 Frame = -3

Query  455  SAGSKVDVLPGFEGPLPFHLETGYIGVGESEE-IQLFYYFVKSETNPKDDPLILWISGEQ  279
            ++GS+V+ LPGF+GPLPF LETGY+G+GE+++ +Q+FYYFVKSE NP+ DPL+LW+SG  
Sbjct  31   ASGSRVEHLPGFQGPLPFELETGYLGLGETDDDMQVFYYFVKSENNPQKDPLMLWLSGGP  90

Query  278  GCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTT  99
            GCSS +GL YEIGP  F+ K Y+G++P+L+   QS TK  SIIF+D     GFSY+ N T
Sbjct  91   GCSSFSGLAYEIGPFAFEIKEYDGSVPSLVLRPQSWTKICSIIFVDLPLGTGFSYAKNVT  150

Query  98   TN-TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             + +D +   + ++FL+KW   + +F+SN F+I
Sbjct  151  DHRSDWKLVYHTHQFLRKWLIDHPEFLSNEFYI  183



>ref|XP_009105991.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Brassica 
rapa]
Length=441

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 112/156 (72%), Gaps = 2/156 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H   + S V  LPGF+GPLPF LETGYIG+GE +E+QLFYYF+KSE NP++DPL+LW+S
Sbjct  24   QHRAYSASIVKYLPGFDGPLPFELETGYIGIGEKDEVQLFYYFIKSEGNPEEDPLLLWLS  83

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCS+++GL+ E GPL     VYNGT+P L+    S TK++SI++LDQ    GFSYS 
Sbjct  84   GGPGCSAISGLLLENGPLAMKLDVYNGTVPPLVSTTYSWTKSSSILYLDQPVGTGFSYSR  143

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
                N  +D+  +K ++EFLQKW  ++ +F SN F+
Sbjct  144  THLVNKPSDLGEAKQIHEFLQKWLGKHPEFSSNSFY  179



>ref|XP_009120828.1| PREDICTED: serine carboxypeptidase-like 15 isoform X2 [Brassica 
rapa]
Length=407

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 115/160 (72%), Gaps = 3/160 (2%)
 Frame = -3

Query  476  VFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLIL  297
             F +H  S  S V  LPGF+GPLPF LETGYIGVGE+EE QLFYYF+KSE NP++DPL++
Sbjct  17   AFIKHACSR-STVRYLPGFQGPLPFELETGYIGVGEAEEDQLFYYFIKSERNPEEDPLLI  75

Query  296  WISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFS  117
            W+SG  GCSSL+GL++E GPL F+ +  NG +P+L+    S TK A+II+LDQ    GFS
Sbjct  76   WLSGGPGCSSLSGLLFENGPLSFNIESDNGDIPSLVSTTYSWTKVANIIYLDQPAGTGFS  135

Query  116  YSTNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            YS N   +  +D+ ++K V EF+  W  ++ ++ SNPF++
Sbjct  136  YSRNPLADIPSDLRSAKLVNEFVHNWLAKHPEYYSNPFYV  175



>ref|XP_009120791.1| PREDICTED: serine carboxypeptidase-like 15 isoform X1 [Brassica 
rapa]
Length=439

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 111/157 (71%), Gaps = 2/157 (1%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H   A S +  LPGFEGPLPF LETGYIGV E+EE QLFYYF+KSE NPK DPL++W++
Sbjct  19   QHHADASSIIRYLPGFEGPLPFELETGYIGVSEAEEDQLFYYFIKSENNPKTDPLLVWLT  78

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS +GL+YE GPL F  + YNG++P+L+    S TK A+II+LDQ    GFSYS 
Sbjct  79   GGPGCSSFSGLVYENGPLAFKVETYNGSVPSLVSTTYSWTKVANIIYLDQPVGAGFSYSR  138

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            N   +  +D  + K V EF++KW  ++ ++ SN F++
Sbjct  139  NPYADIPSDTGSVKRVDEFVRKWLAKHPEYSSNSFYV  175



>ref|XP_010464717.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Camelina 
sativa]
Length=440

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 110/152 (72%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            + S V+ LPGF+GPLPF LETGYIGVGE EE+QLFYYF+KSE NPK+ PL+LW+SG  GC
Sbjct  25   SASIVEFLPGFDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEVPLLLWLSGGPGC  84

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS++GL YE GP+    +V NGT+P+L+    S TK +SII+LDQ    GFSYS     N
Sbjct  85   SSISGLFYENGPVTVKLEVNNGTIPSLVSTPYSWTKVSSIIYLDQPVGTGFSYSRTQLVN  144

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D   +K ++EFL KW  ++Q+F SN F++
Sbjct  145  KPSDSGEAKRIHEFLHKWLGKHQEFSSNSFYV  176



>ref|XP_009117322.1| PREDICTED: serine carboxypeptidase-like 8 isoform X2 [Brassica 
rapa]
Length=380

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 111/155 (72%), Gaps = 1/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H +   S V  LPGFEGPLPF LETGYIG+GE EE+QLFYYF+KSE NPK+DPL++W++G
Sbjct  17   HHVDCASIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSEKNPKEDPLLIWLNG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-T  108
              GCSSL GL +E GP+    +VYNG+L +L+ +  S T+ A+II+LDQ    GFSYS T
Sbjct  77   GPGCSSLEGLFFENGPVGLKFEVYNGSLVSLVSSTYSWTQVANIIYLDQPVGAGFSYSRT  136

Query  107  NTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                 +D   +K +++FLQKW  ++  F+SN F++
Sbjct  137  PLDKTSDTNEAKMIHQFLQKWLSKHPQFLSNSFYV  171



>gb|KDP41600.1| hypothetical protein JCGZ_16007 [Jatropha curcas]
Length=472

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 118/174 (68%), Gaps = 3/174 (2%)
 Frame = -3

Query  518  LNHFVILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYF  339
            L    IL ++ ++  + +  +S  SKV+ LPGF GPLPF LETGYIGVGESE++QLFYYF
Sbjct  7    LCDLCILFLVVLLQCWSQVAVSH-SKVEFLPGFNGPLPFELETGYIGVGESEDVQLFYYF  65

Query  338  VKSETNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNA  159
            V+S+ N + DPL+LW++G  GCS+L+G IYEIGPL+F+   YNG+LPTL  N  S TK A
Sbjct  66   VRSQGNAEKDPLLLWLTGGPGCSALSGFIYEIGPLYFEVVEYNGSLPTLFLNPNSWTKVA  125

Query  158  SIIFLDQLPNIGFSYSTN--TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            SIIF+D     GFSY      + + D        +FL+KW + + +F+SNP ++
Sbjct  126  SIIFIDSPVGTGFSYPRTPLASVSGDFIQINQTEQFLRKWLNDHPEFLSNPVYV  179



>ref|XP_010499905.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
18 [Camelina sativa]
Length=467

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 114/160 (71%), Gaps = 5/160 (3%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +H + + S V  LPGF+G LPFHLETGYIGVGE E++QLFYYF+KSE +P++DPLILW++
Sbjct  20   QHEVDSASVVSYLPGFDGLLPFHLETGYIGVGEEEQVQLFYYFIKSENHPEEDPLILWLT  79

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLL---FNEQSLTKNASIIFLDQLPNIGFS  117
            G   CS+L+ L++EIGPL F  + YNG LP+L+   ++ + +T    IIFLDQ    GFS
Sbjct  80   GGPACSALSALVFEIGPLTFKTEGYNGGLPSLVSTSYSWRKVTIIKQIIFLDQPVGTGFS  139

Query  116  YSTNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            YSTN   +  +D   +K  YEF QKW  +N +FVSNP ++
Sbjct  140  YSTNPLVHKPSDTGEAKQTYEFFQKWLVENPEFVSNPLYV  179



>gb|KCW68631.1| hypothetical protein EUGRSUZ_F02236 [Eucalyptus grandis]
Length=461

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 108/153 (71%), Gaps = 2/153 (1%)
 Frame = -3

Query  455  SAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQG  276
              GS++  LPGFEGPLPFHLETGY+ VGESEEIQLFYYF +SE N K+D L LW++G  G
Sbjct  36   CCGSRLAFLPGFEGPLPFHLETGYVAVGESEEIQLFYYFAESERNSKEDALFLWLTGGPG  95

Query  275  CSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTT  96
            CS+L+GLIYEIGPL F+ K Y+ +LP  + N  S TK +SIIF+D     GFSY+ N   
Sbjct  96   CSALSGLIYEIGPLNFNIKAYDRSLPEFVLNPYSWTKASSIIFVDSPVGTGFSYAENPLA  155

Query  95   --NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                D    +++++FL++W   + +F+SNP +I
Sbjct  156  YETGDFRQVQHLHQFLRRWLISHPEFISNPVYI  188



>ref|XP_009764359.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
7 [Nicotiana sylvestris]
Length=461

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 111/152 (73%), Gaps = 5/152 (3%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            A S V +LPGF+GPLPF LETGYIGVG+SE++QLF    KSE+NP+ DPL+LWI+G  GC
Sbjct  25   AASPVKLLPGFKGPLPFELETGYIGVGDSEDVQLF---XKSESNPESDPLLLWITGGPGC  81

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTT-  96
            S+L+GLIYEIGP+ F+   YNG+LPT+  N  S TK ASIIFLD     GFSY+   T  
Sbjct  82   SALSGLIYEIGPITFEPVEYNGSLPTMKLNPYSWTKVASIIFLDLPVGTGFSYARTPTAL  141

Query  95   -NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             ++D++AS   YEFL KWF  + +F+ NP ++
Sbjct  142  QSSDLQASDQAYEFLYKWFLDHPEFLKNPLYV  173



>ref|XP_006294239.1| hypothetical protein CARUB_v10023237mg [Capsella rubella]
 gb|EOA27137.1| hypothetical protein CARUB_v10023237mg [Capsella rubella]
Length=437

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 108/151 (72%), Gaps = 1/151 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            +GS V  LPGFEGPLPF LETGYIG+ E E +Q FYYF+KS+ NPK+DPL++W++G  GC
Sbjct  21   SGSIVKFLPGFEGPLPFELETGYIGIDEEENVQFFYYFIKSDNNPKEDPLLIWLNGGPGC  80

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-TNTTT  96
            S LTGL +  GPL F ++VYNG++P+L+    S TK A+IIFLDQ    GFSYS T    
Sbjct  81   SCLTGLFFGNGPLAFKSEVYNGSVPSLVSTTYSWTKTANIIFLDQPVGSGFSYSRTPIGK  140

Query  95   NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             +D    K ++EFLQKW  ++  F SNPF++
Sbjct  141  TSDTYEVKRIHEFLQKWLRKHPQFSSNPFYL  171



>ref|XP_006401829.1| hypothetical protein EUTSA_v10013495mg [Eutrema salsugineum]
 gb|ESQ43282.1| hypothetical protein EUTSA_v10013495mg [Eutrema salsugineum]
Length=457

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 107/149 (72%), Gaps = 3/149 (2%)
 Frame = -3

Query  440  VDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGCSSLT  261
            +  LPGFEGPLPF LETGYIGVGE EEIQLFYYF+KSE NP++DPL+LW++G  GCSSL 
Sbjct  48   IRSLPGFEGPLPFELETGYIGVGEVEEIQLFYYFIKSERNPEEDPLVLWLTGGPGCSSLN  107

Query  260  GLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN---T  90
             L++E GPL      YNG +P+L+    S TK A++I+LDQ    GFSYS     +   +
Sbjct  108  ALLFENGPLTIKMDGYNGGIPSLVSTTYSWTKIANMIYLDQPVGSGFSYSKTPLLDDVPS  167

Query  89   DVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            D   +K V+EFLQKW  ++ DFVSNPF++
Sbjct  168  DTGEAKRVHEFLQKWLGKHPDFVSNPFYV  196



>ref|XP_006343160.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Solanum 
tuberosum]
Length=480

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 107/158 (68%), Gaps = 3/158 (2%)
 Frame = -3

Query  470  PEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWI  291
            P H   + S V  LPGF G LPF L+TGYIGVGE EE+QLFYYFVKSE++P+ DPLILWI
Sbjct  34   PPHFDVSTSSVKYLPGF-GFLPFQLDTGYIGVGEGEEVQLFYYFVKSESDPETDPLILWI  92

Query  290  SGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS  111
            +G  GCSSL GL  E GPL FD   YNG+LPTL  N  S TK ASIIFLD     GFSY+
Sbjct  93   TGGPGCSSLEGLTMEFGPLHFDDMEYNGSLPTLSLNTHSWTKVASIIFLDLPVKTGFSYA  152

Query  110  TNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            T    N   +++  ++ Y+FLQKW   +  F+ NP +I
Sbjct  153  TTEKANQTNNLQTGEHAYQFLQKWLANHSKFLQNPIYI  190



>gb|AAK32769.1|AF361601_1 T20K9.20/T20K9.20 [Arabidopsis thaliana]
 gb|AAN28819.1| At2g22990/T20K9.20 [Arabidopsis thaliana]
Length=259

 Score =   167 bits (422),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 105/155 (68%), Gaps = 1/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H + + S V  LPGFEGPLPF LETGYIG+GE E +Q FYYF+KSE NPK+DPL++W++G
Sbjct  15   HHVDSASIVKFLPGFEGPLPFELETGYIGIGEDENVQFFYYFIKSENNPKEDPLLIWLNG  74

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCS L G+I+E GP+    +V+NG+ P+L     S TK A+IIFLDQ    GFSYS  
Sbjct  75   GPGCSCLGGIIFENGPVGLKFEVFNGSAPSLFSTTYSWTKMANIIFLDQPVGSGFSYSKT  134

Query  104  TTTNT-DVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                T D+   K  +EFLQKW  ++  + SNP ++
Sbjct  135  PIDKTGDISEVKRTHEFLQKWLSRHPQYFSNPLYV  169



>ref|XP_010429234.1| PREDICTED: serine carboxypeptidase-like 12 isoform X1 [Camelina 
sativa]
Length=433

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 108/155 (70%), Gaps = 2/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H   + S V  LPGFEGPLPF LETGYIG+GE EEIQLFYYF+KSE NP +DPL+LW++G
Sbjct  17   HHAESSSIVKFLPGFEGPLPFELETGYIGIGEKEEIQLFYYFIKSENNPDEDPLLLWLTG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSS TGL  E GPL F ++VYNG++P+L+    S TK A+IIFLDQ    GFSYS  
Sbjct  77   GPGCSSNTGLFLENGPLAFKSEVYNGSVPSLVSTTYSWTKMANIIFLDQPVRTGFSYSRT  136

Query  104  TTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFF  6
               +  +D    + + EFL KW +++  F SNPF+
Sbjct  137  PLIDKPSDTGEVERIREFLLKWLNKHPTFSSNPFY  171



>emb|CDX85493.1| BnaA02g03200D [Brassica napus]
Length=452

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 113/155 (73%), Gaps = 4/155 (3%)
 Frame = -3

Query  455  SAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQG  276
             +GS V  LPGFEGPLPF LETGYIGVGE E++QLFYYF+KSE NPK+DPL++W+SG  G
Sbjct  19   CSGSIVKFLPGFEGPLPFELETGYIGVGEEEQVQLFYYFIKSEKNPKEDPLLIWLSGGPG  78

Query  275  CSSLTGLIYEIGPLFFDAKV-YN-GTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNT  102
            CSS TGL +E GP+ F+ +  YN G+ P LL    S TK A+IIFLDQ    GFSY+T  
Sbjct  79   CSSATGLFFENGPVTFNVEEGYNEGSGPALLSTTHSWTKVANIIFLDQPVGTGFSYATTQ  138

Query  101  TTNT--DVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +T  D   +K ++EF++KW  ++ +F+SNPF++
Sbjct  139  LLDTPSDSGEAKQIHEFIRKWLSKHTEFISNPFYV  173



>emb|CDY52618.1| BnaCnng22970D [Brassica napus]
Length=439

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 115/160 (72%), Gaps = 3/160 (2%)
 Frame = -3

Query  476  VFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLIL  297
             F +H  S  S V  LPGF+GPLPF LETGYIGVGE+EE QLFYYF+KSE NP++DPL++
Sbjct  17   AFIKHACSR-STVRYLPGFQGPLPFELETGYIGVGEAEEDQLFYYFIKSERNPEEDPLLI  75

Query  296  WISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFS  117
            W+SG  GCSSL+GL++E GPL F+ +  NG +P+L+    S TK A+II+LDQ    GFS
Sbjct  76   WLSGGPGCSSLSGLLFENGPLSFNIESDNGDIPSLVSTTYSWTKVANIIYLDQPVGTGFS  135

Query  116  YSTNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            YS N   +  +D+ ++K V EF+  W  ++ ++ SNPF++
Sbjct  136  YSRNPLADIPSDIRSAKLVNEFVHNWLAKHPEYYSNPFYV  175



>ref|XP_010556479.1| PREDICTED: serine carboxypeptidase-like 19 [Tarenaya hassleriana]
Length=456

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 119/171 (70%), Gaps = 11/171 (6%)
 Frame = -3

Query  509  FVILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKS  330
            FVIL  + VV         +GS V  LPGF+GPLPF LETGY+GVGES+++QLFYYF+KS
Sbjct  10   FVILFHVLVV---------SGSVVKHLPGFDGPLPFELETGYVGVGESDDVQLFYYFIKS  60

Query  329  ETNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASII  150
            E NP+DDPL++W++G   CSS+ G+++E GPL F  + YNG++PTL+    S TK ASII
Sbjct  61   ERNPQDDPLMIWLTGGPACSSICGMLFENGPLAFKGEEYNGSVPTLVKTSFSWTKVASII  120

Query  149  FLDQLPNIGFSYSTNTTT--NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            +LD     G+SY+  T    ++D +  + + +FL+KW   + +FVSNPF++
Sbjct  121  YLDSPAGSGYSYARTTRAFESSDTKQMRQIDQFLRKWLTDHLEFVSNPFYV  171



>ref|XP_003604931.1| Serine carboxypeptidase [Medicago truncatula]
 gb|AES87128.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=470

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 115/151 (76%), Gaps = 2/151 (1%)
 Frame = -3

Query  449  GSKVDVLPGFEGPLPFHLETGYIGVGES-EEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            GSKV+ LPGF+GPLPF LETGY+G+GES +++Q+FYYF+KSE NP+ DPL+LW++G  GC
Sbjct  37   GSKVEHLPGFQGPLPFQLETGYVGLGESNDDMQVFYYFIKSENNPQKDPLMLWLTGGPGC  96

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS +GL+Y+IGP  F+ K YNG++P+L+   QS TK +SIIF+D     GFSY+ N T +
Sbjct  97   SSFSGLVYQIGPFVFEIKEYNGSVPSLVSRPQSWTKRSSIIFVDLPLGTGFSYAKNVTAH  156

Query  92   -TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
             +D +   + ++FL+KW   + +F+SN F+I
Sbjct  157  RSDWKLVHHAHQFLRKWLIDHPEFLSNEFYI  187



>ref|XP_009126130.1| PREDICTED: serine carboxypeptidase-like 12 isoform X1 [Brassica 
rapa]
Length=452

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 113/155 (73%), Gaps = 4/155 (3%)
 Frame = -3

Query  455  SAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQG  276
             +GS V  LPGFEGPLPF LETGYIGVGE E++QLFYYF+KSE NPK+DPL++W+SG  G
Sbjct  19   CSGSIVKFLPGFEGPLPFELETGYIGVGEEEQVQLFYYFIKSEKNPKEDPLLIWLSGGPG  78

Query  275  CSSLTGLIYEIGPLFFDAKV-YN-GTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNT  102
            CSS TGL +E GP+ F+ +  YN G+ P LL    S TK A+IIFLDQ    GFSY+T  
Sbjct  79   CSSATGLFFENGPVTFNVEEGYNEGSGPALLSTTHSWTKVANIIFLDQPVGTGFSYATTQ  138

Query  101  TTNT--DVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +T  D   +K ++EF++KW  ++ +F+SNPF++
Sbjct  139  LLDTPSDSGEAKQIHEFIRKWLSKHTEFISNPFYV  173



>gb|KFK41349.1| hypothetical protein AALP_AA2G118800 [Arabis alpina]
Length=440

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 114/160 (71%), Gaps = 3/160 (2%)
 Frame = -3

Query  476  VFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLIL  297
            VF  H  ++GS V  LPGFEGPLPF LETGYIGVGE EE+QLFYYF+KSE NP++DPL++
Sbjct  14   VFSHHA-NSGSIVKFLPGFEGPLPFELETGYIGVGEEEELQLFYYFIKSENNPQEDPLLI  72

Query  296  WISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFS  117
            W++G  GCSS+ G +YEIGPL    + Y+G +P+L+ +  S TK A+I+FLDQ    GFS
Sbjct  73   WMNGGPGCSSVYGFLYEIGPLTIKIEAYDGNIPSLVPSTYSWTKMANILFLDQPVGSGFS  132

Query  116  YSTN--TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            Y     T  ++D      V+EFL+KW D++ +F SN F++
Sbjct  133  YKRTPITDKSSDTLEVVRVHEFLRKWLDKHPEFFSNLFYV  172



>ref|XP_009120822.1| PREDICTED: serine carboxypeptidase-like 15 isoform X1 [Brassica 
rapa]
Length=441

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 115/160 (72%), Gaps = 3/160 (2%)
 Frame = -3

Query  476  VFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLIL  297
             F +H  S  S V  LPGF+GPLPF LETGYIGVGE+EE QLFYYF+KSE NP++DPL++
Sbjct  17   AFIKHACSR-STVRYLPGFQGPLPFELETGYIGVGEAEEDQLFYYFIKSERNPEEDPLLI  75

Query  296  WISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFS  117
            W+SG  GCSSL+GL++E GPL F+ +  NG +P+L+    S TK A+II+LDQ    GFS
Sbjct  76   WLSGGPGCSSLSGLLFENGPLSFNIESDNGDIPSLVSTTYSWTKVANIIYLDQPAGTGFS  135

Query  116  YSTNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            YS N   +  +D+ ++K V EF+  W  ++ ++ SNPF++
Sbjct  136  YSRNPLADIPSDLRSAKLVNEFVHNWLAKHPEYYSNPFYV  175



>ref|XP_010321497.1| PREDICTED: serine carboxypeptidase-like 12 [Solanum lycopersicum]
Length=459

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 116/169 (69%), Gaps = 2/169 (1%)
 Frame = -3

Query  503  ILAIIAVVGVFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSET  324
            IL +I    +  +    AG  V  LPGFEG L F LETGYIGVGE++E+Q+FYYF+KSE+
Sbjct  6    ILMLIVAFEIICQQPALAGLSVKYLPGFEGQLAFQLETGYIGVGEADEVQVFYYFIKSES  65

Query  323  NPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFL  144
            NPK DPLI W +G  GCS+L+ + +E GP+  D + YNG+LPTL  N  + TK ASIIF+
Sbjct  66   NPKVDPLIYWFTGGPGCSALSAIFFEFGPITLDTRAYNGSLPTLSLNPYAYTKVASIIFV  125

Query  143  DQLPNIGFSYSTNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            D     GFSY+T    N   ++ ++ + YEF++KW  ++Q++++NPF++
Sbjct  126  DLPVGTGFSYATTQKANYSDNLLSADHAYEFIRKWLIEHQEYLNNPFYV  174



>gb|KFK41348.1| hypothetical protein AALP_AA2G118800 [Arabis alpina]
Length=445

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 114/160 (71%), Gaps = 3/160 (2%)
 Frame = -3

Query  476  VFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLIL  297
            VF  H  ++GS V  LPGFEGPLPF LETGYIGVGE EE+QLFYYF+KSE NP++DPL++
Sbjct  14   VFSHHA-NSGSIVKFLPGFEGPLPFELETGYIGVGEEEELQLFYYFIKSENNPQEDPLLI  72

Query  296  WISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFS  117
            W++G  GCSS+ G +YEIGPL    + Y+G +P+L+ +  S TK A+I+FLDQ    GFS
Sbjct  73   WMNGGPGCSSVYGFLYEIGPLTIKIEAYDGNIPSLVPSTYSWTKMANILFLDQPVGSGFS  132

Query  116  YSTN--TTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            Y     T  ++D      V+EFL+KW D++ +F SN F++
Sbjct  133  YKRTPITDKSSDTLEVVRVHEFLRKWLDKHPEFFSNLFYV  172



>ref|XP_004163541.1| PREDICTED: serine carboxypeptidase-like 19-like [Cucumis sativus]
Length=467

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 109/155 (70%), Gaps = 2/155 (1%)
 Frame = -3

Query  461  VISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGE  282
            V  + S V  LPGF GPLPF LETGY+GVGE EEIQLFYYFVKSE NP+ DPLI+W++G 
Sbjct  23   VYGSSSPVKFLPGFSGPLPFSLETGYVGVGEREEIQLFYYFVKSEGNPQKDPLIVWLTGG  82

Query  281  QGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSY-STN  105
             GCSS++G  +E GPL F  + YNG+LP L  N  S TKN SIIFLD     GFSY  T 
Sbjct  83   PGCSSISGFAFENGPLNFKIEEYNGSLPQLHLNPYSWTKNCSIIFLDSPVGSGFSYGKTL  142

Query  104  TTTNT-DVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               NT DV    ++++FL+KW  ++ +F+SNPF++
Sbjct  143  QAFNTGDVTQVHHIHQFLRKWLVEHPEFISNPFYV  177



>emb|CDX73832.1| BnaA03g32150D [Brassica napus]
Length=436

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 111/156 (71%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H  S  S V  LPGF+GPLPF LETGYIGVGE+EE QLFYYF+KSE NP +DP ++W++G
Sbjct  18   HAYSGESTVRYLPGFQGPLPFELETGYIGVGEAEEDQLFYYFIKSERNPSEDPFLIWLTG  77

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSSL+GLI E GPL F+ +  +G +P+L+    S TK A+II+LDQ    GFSYS N
Sbjct  78   GPGCSSLSGLILENGPLAFNIESDSGNIPSLVSTTYSWTKVANIIYLDQPVGTGFSYSRN  137

Query  104  TTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               N  +D  ++K V+EF++ W  ++ ++ SNPF++
Sbjct  138  RLANIPSDTGSAKRVHEFVRNWLAKHPEYFSNPFYV  173



>ref|XP_010061646.1| PREDICTED: serine carboxypeptidase-like 2 [Eucalyptus grandis]
 gb|KCW68630.1| hypothetical protein EUGRSUZ_F02236 [Eucalyptus grandis]
Length=477

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 108/153 (71%), Gaps = 2/153 (1%)
 Frame = -3

Query  455  SAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQG  276
              GS++  LPGFEGPLPFHLETGY+ VGESEEIQLFYYF +SE N K+D L LW++G  G
Sbjct  36   CCGSRLAFLPGFEGPLPFHLETGYVAVGESEEIQLFYYFAESERNSKEDALFLWLTGGPG  95

Query  275  CSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTT  96
            CS+L+GLIYEIGPL F+ K Y+ +LP  + N  S TK +SIIF+D     GFSY+ N   
Sbjct  96   CSALSGLIYEIGPLNFNIKAYDRSLPEFVLNPYSWTKASSIIFVDSPVGTGFSYAENPLA  155

Query  95   --NTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                D    +++++FL++W   + +F+SNP +I
Sbjct  156  YETGDFRQVQHLHQFLRRWLISHPEFISNPVYI  188



>gb|AFK49380.1| unknown [Medicago truncatula]
Length=470

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 114/151 (75%), Gaps = 2/151 (1%)
 Frame = -3

Query  449  GSKVDVLPGFEGPLPFHLETGYIGVGES-EEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            GSKV+ LPGF+GPLPF LETGY+G+GES +++Q+FYYF+KSE NP+ DPL+LW++G  GC
Sbjct  37   GSKVEHLPGFQGPLPFQLETGYVGLGESNDDMQVFYYFIKSENNPQKDPLMLWLTGGPGC  96

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS +GL+Y+IGP  F+ K YNG++P+L+   QS TK +SIIF+D     GFSY+ N T +
Sbjct  97   SSFSGLVYQIGPFVFEIKEYNGSVPSLVSRPQSWTKRSSIIFVDLPLGTGFSYAKNVTAH  156

Query  92   -TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              D +   + ++FL+KW   + +F+SN F+I
Sbjct  157  RNDWKLVHHAHQFLRKWLIDHPEFLSNEFYI  187



>ref|XP_009135217.1| PREDICTED: serine carboxypeptidase-like 14 [Brassica rapa]
Length=438

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 111/156 (71%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H  S  S V  LPG+ GPLPF LETGYIGVGE+EE Q FYYF+KSE NP++DPL++W+SG
Sbjct  17   HAYSGISTVRYLPGYHGPLPFELETGYIGVGEAEESQFFYYFIKSERNPEEDPLLIWLSG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTN  105
              GCSS TGL +E GPL F+ +  +G +P+L+    S +K A+II+LDQ  + GFSYS N
Sbjct  77   GPGCSSATGLFFENGPLAFNTESDSGNIPSLVSTTYSWSKVANIIYLDQPVDTGFSYSRN  136

Query  104  TTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
               N  +D  ++K V+EF+ KW  ++ ++ SNPF++
Sbjct  137  PLANIPSDTRSAKLVHEFVHKWLAKHPEYFSNPFYV  172



>gb|KFK25883.1| hypothetical protein AALP_AA8G174700 [Arabis alpina]
Length=454

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            AGS V  LPGF+ PLPF LETGYIGVGE EE++LFYYF+KSE NP++DPL++WISG  GC
Sbjct  16   AGSTVKFLPGFDDPLPFELETGYIGVGEGEEVKLFYYFIKSEKNPEEDPLLVWISGGPGC  75

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS+ GL++  GPL F    YNG  PTL+    S TK ASIIFLDQ   +GFSY+T    +
Sbjct  76   SSINGLLFGNGPLTFKTDGYNGGNPTLVSTTYSWTKVASIIFLDQPVGVGFSYATTQLLD  135

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D   +K + EFL+KW  ++ +++SNP ++
Sbjct  136  SPSDTGEAKRMDEFLRKWLSKHTEYISNPIYV  167



>ref|XP_009117321.1| PREDICTED: serine carboxypeptidase-like 10 isoform X1 [Brassica 
rapa]
Length=438

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 111/155 (72%), Gaps = 1/155 (1%)
 Frame = -3

Query  464  HVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISG  285
            H +   S V  LPGFEGPLPF LETGYIG+GE EE+QLFYYF+KSE NPK+DPL++W++G
Sbjct  17   HHVDCASIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSEKNPKEDPLLIWLNG  76

Query  284  EQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYS-T  108
              GCSSL GL +E GP+    +VYNG+L +L+ +  S T+ A+II+LDQ    GFSYS T
Sbjct  77   GPGCSSLEGLFFENGPVGLKFEVYNGSLVSLVSSTYSWTQVANIIYLDQPVGAGFSYSRT  136

Query  107  NTTTNTDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
                 +D   +K +++FLQKW  ++  F+SN F++
Sbjct  137  PLDKTSDTNEAKMIHQFLQKWLSKHPQFLSNSFYV  171



>emb|CDY50564.1| BnaA01g30780D [Brassica napus]
Length=439

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 115/160 (72%), Gaps = 3/160 (2%)
 Frame = -3

Query  476  VFPEHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLIL  297
             F +H  S  S V  LPGF+GPLPF LETGYIGVGE+EE QLFYYF+KSE NP++DPL++
Sbjct  17   AFIKHACSR-STVRYLPGFQGPLPFELETGYIGVGEAEEDQLFYYFIKSERNPEEDPLLI  75

Query  296  WISGEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFS  117
            W+SG  GC+SL+GL++E GPL F+ +  NG +P+L+    S TK A+II+LDQ    GFS
Sbjct  76   WLSGGPGCTSLSGLLFENGPLSFNIESDNGDIPSLVSTTYSWTKVANIIYLDQPAGTGFS  135

Query  116  YSTNTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            YS N   +  +D+ ++K V EF+  W  ++ ++ SNPF++
Sbjct  136  YSRNPLADIPSDLRSAKLVNEFVHNWLAKHPEYYSNPFYV  175



>gb|KFK38584.1| hypothetical protein AALP_AA3G132700 [Arabis alpina]
Length=987

 Score =   175 bits (444),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -3

Query  452  AGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGC  273
            +GS +  LPG+EGPLPF LETGYIGVG++EE QLFYYF+KSE+ PK+DPL++W++G  GC
Sbjct  5    SGSIIKYLPGYEGPLPFELETGYIGVGDAEEDQLFYYFIKSESKPKEDPLLVWLTGGPGC  64

Query  272  SSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN  93
            SS +GL+YE GPL F A+ YNG++P+L+    S TK A+II+LDQ    GFSYSTN   +
Sbjct  65   SSFSGLVYENGPLAFKAEAYNGSIPSLVSTTYSWTKVANIIYLDQPVGAGFSYSTNPFAD  124

Query  92   --TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
              +D    K V EF++KW  ++ ++ SNPF++
Sbjct  125  IPSDKGTVKRVDEFVRKWLAKHPEYFSNPFYV  156


 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 113/157 (72%), Gaps = 3/157 (2%)
 Frame = -3

Query  467  EHVISAGSKVDVLPGFEGPLPFHLETGYIGVGESEEIQLFYYFVKSETNPKDDPLILWIS  288
            +HV S  + V  LPGF+GPLPF LETGYIGVGE EE Q+FYYF+KSE+NPK+DPL+++++
Sbjct  573  QHVDSR-TTVRYLPGFDGPLPFELETGYIGVGEGEEEQMFYYFIKSESNPKEDPLLIYLN  631

Query  287  GEQGCSSLTGLIYEIGPLFFDAKVYNGTLPTLLFNEQSLTKNASIIFLDQLPNIGFSYST  108
            G  GCSS++GL+ E GP+ F  + YNGT+P+L+    S TK ASII+LDQ    GFSYS 
Sbjct  632  GGPGCSSISGLLLESGPVTFKIETYNGTVPSLVSTTYSWTKVASIIYLDQPVGTGFSYSR  691

Query  107  NTTTN--TDVEASKYVYEFLQKWFDQNQDFVSNPFFI  3
            N   +  +D  + K V EF+  W  ++ +F SNPF++
Sbjct  692  NPLLDPPSDTSSIKRVTEFIHNWLTKHPEFFSNPFYV  728


 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 97/130 (75%), Gaps = 2/130 (2%)
 Frame = -3

Query  386  YIGVGESEEIQLFYYFVKSETNPKDDPLILWISGEQGCSSLTGLIYEIGPLFFDAKVYNG  207
            YIGVG++EE QLFYYFVKS++NPK+DPL++W++G  GCSS +GL+YE GPL F  K YNG
Sbjct  319  YIGVGDAEEDQLFYYFVKSQSNPKEDPLLVWLTGGPGCSSFSGLVYENGPLTFKVKAYNG  378

Query  206  TLPTLLFNEQSLTKNASIIFLDQLPNIGFSYSTNTTTN--TDVEASKYVYEFLQKWFDQN  33
            ++P+L+    + TK A+II+LDQ    GFSYSTN   N  +D  + K + EF++KW  ++
Sbjct  379  SIPSLVSTTYAWTKVANIIYLDQPVGAGFSYSTNPFANRPSDKGSVKRLDEFVRKWLAKH  438

Query  32   QDFVSNPFFI  3
             ++ SNPF++
Sbjct  439  PEYFSNPFYV  448



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 619402163716