BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25548_g2_i2 len=926 path=[25:0-246 271:247-337 362:338-361
12695:362-561 17053:562-579 17071:580-581 5342:582-630 5391:631-634
5395:635-701 5462:702-722 5483:723-925]

Length=926
                                                                      Score     E

gb|ABR26167.1|  cytosol aminopeptidase                                75.5    2e-13   Oryza sativa Indica Group [Indian rice]
dbj|BAF02023.1|  leucyl aminopeptidase like protein                   74.3    3e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CDP16585.1|  unnamed protein product                              79.3    4e-13   
emb|CDP10235.1|  unnamed protein product                              79.0    5e-13   
gb|KHG23887.1|  hypothetical protein F383_01434                       79.0    5e-13   
ref|XP_010047106.1|  PREDICTED: leucine aminopeptidase 1-like         79.0    6e-13   
ref|XP_007011931.1|  Cytosol aminopeptidase family protein            78.2    8e-13   
ref|XP_011079411.1|  PREDICTED: leucine aminopeptidase 2, chlorop...  78.2    8e-13   
gb|EYU34348.1|  hypothetical protein MIMGU_mgv1a003554mg              77.4    1e-12   
ref|XP_010687715.1|  PREDICTED: leucine aminopeptidase 1-like         77.4    2e-12   
gb|EMT02487.1|  Formin-like protein 7                                 77.8    2e-12   
emb|CAA68143.1|  cytosol aminopeptidase                               75.9    2e-12   Petroselinum crispum
ref|NP_001048379.1|  Os02g0794700                                     76.3    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006857233.1|  hypothetical protein AMTR_s00065p00209640        77.4    2e-12   
ref|XP_011083971.1|  PREDICTED: leucine aminopeptidase 2, chlorop...  77.4    2e-12   
gb|KHG14578.1|  hypothetical protein F383_10344                       77.0    2e-12   
ref|XP_008794352.1|  PREDICTED: leucine aminopeptidase 2, chlorop...  77.0    2e-12   
ref|XP_011018033.1|  PREDICTED: leucine aminopeptidase 1-like         77.0    2e-12   
ref|XP_002325134.2|  leucine aminopeptidase family protein            77.0    2e-12   Populus trichocarpa [western balsam poplar]
emb|CAN66364.1|  hypothetical protein VITISV_029979                   77.0    2e-12   Vitis vinifera
ref|XP_003610319.1|  Leucine aminopeptidase                           77.0    2e-12   
ref|XP_002994538.1|  hypothetical protein SELMODRAFT_138786           71.2    2e-12   
ref|XP_002276114.1|  PREDICTED: leucine aminopeptidase 1              77.0    2e-12   Vitis vinifera
emb|CBI36527.3|  unnamed protein product                              76.6    2e-12   
ref|XP_002965081.1|  hypothetical protein SELMODRAFT_82608            71.2    3e-12   
gb|KEH38070.1|  leucine aminopeptidase (cytosol aminopeptidase), ...  74.3    3e-12   
gb|EMS53149.1|  Leucine aminopeptidase 2, chloroplastic               76.6    3e-12   
ref|XP_002454700.1|  hypothetical protein SORBIDRAFT_04g035840        76.3    4e-12   Sorghum bicolor [broomcorn]
ref|XP_004144797.1|  PREDICTED: leucine aminopeptidase 2, chlorop...  74.3    4e-12   
ref|XP_004954212.1|  PREDICTED: leucine aminopeptidase 2, chlorop...  76.3    4e-12   
ref|XP_008242990.1|  PREDICTED: leucine aminopeptidase 1              76.3    4e-12   
gb|KHG12351.1|  Leucine aminopeptidase 1 -like protein                76.3    4e-12   
ref|XP_004954213.1|  PREDICTED: leucine aminopeptidase 2, chlorop...  76.3    4e-12   
sp|Q6K669.1|AMPL2_ORYSJ  RecName: Full=Leucine aminopeptidase 2, ...  76.3    4e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007204206.1|  hypothetical protein PRUPE_ppa003434mg           75.9    5e-12   
ref|XP_010942088.1|  PREDICTED: leucine aminopeptidase 2, chlorop...  75.9    5e-12   
ref|XP_008803712.1|  PREDICTED: leucine aminopeptidase 2, chlorop...  75.9    5e-12   
ref|XP_009795110.1|  PREDICTED: leucine aminopeptidase 2, chlorop...  75.9    6e-12   
gb|AGW47884.1|  leucine aminopeptidase                                75.9    6e-12   
ref|XP_010236855.1|  PREDICTED: formin-like protein 7                 76.3    6e-12   
ref|XP_009614630.1|  PREDICTED: leucine aminopeptidase 2, chlorop...  75.5    6e-12   
ref|XP_006649129.1|  PREDICTED: leucine aminopeptidase 2, chlorop...  75.5    8e-12   
ref|XP_010103674.1|  Leucine aminopeptidase 3                         75.5    8e-12   
ref|XP_004514667.1|  PREDICTED: leucine aminopeptidase 2, chlorop...  75.1    9e-12   
ref|XP_010929163.1|  PREDICTED: leucine aminopeptidase 1-like         75.1    9e-12   
ref|XP_006453614.1|  hypothetical protein CICLE_v10007834mg           75.1    1e-11   
ref|XP_006350101.1|  PREDICTED: leucine aminopeptidase 2, chlorop...  75.1    1e-11   
ref|XP_006474000.1|  PREDICTED: leucine aminopeptidase 3, chlorop...  75.1    1e-11   
ref|XP_004144796.1|  PREDICTED: leucine aminopeptidase 1-like         74.7    1e-11   
gb|KGN61047.1|  hypothetical protein Csa_2G035470                     74.7    1e-11   
ref|XP_009127424.1|  PREDICTED: leucine aminopeptidase 3, chlorop...  74.7    1e-11   
emb|CDX68703.1|  BnaC01g07500D                                        74.7    1e-11   
ref|XP_010447643.1|  PREDICTED: leucine aminopeptidase 3, chlorop...  74.7    1e-11   
ref|NP_194821.1|  leucine aminopeptidase 2                            74.7    1e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CAA18201.1|  leucyl aminopeptidase-like protein                   74.7    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010265583.1|  PREDICTED: leucine aminopeptidase 3, chlorop...  74.7    1e-11   
ref|XP_010432926.1|  PREDICTED: leucine aminopeptidase 3, chlorop...  74.7    1e-11   
ref|XP_008452840.1|  PREDICTED: leucine aminopeptidase 1-like         74.7    1e-11   
ref|XP_009415506.1|  PREDICTED: leucine aminopeptidase 1-like         74.7    1e-11   
ref|XP_004158743.1|  PREDICTED: leucine aminopeptidase 1-like         74.3    1e-11   
ref|XP_004144730.1|  PREDICTED: leucine aminopeptidase 1-like         74.3    2e-11   
gb|KDP38679.1|  hypothetical protein JCGZ_04032                       74.3    2e-11   
ref|XP_006600543.1|  PREDICTED: leucine aminopeptidase 3, chlorop...  74.3    2e-11   
ref|XP_003518220.1|  PREDICTED: leucine aminopeptidase 3, chlorop...  74.3    2e-11   
gb|KGN61046.1|  hypothetical protein Csa_2G035460                     74.3    2e-11   
ref|XP_004507738.1|  PREDICTED: leucine aminopeptidase 3, chlorop...  74.3    2e-11   
ref|XP_008384407.1|  PREDICTED: leucine aminopeptidase 1-like         74.3    2e-11   
gb|KHN42824.1|  Leucine aminopeptidase 3, chloroplastic               74.3    2e-11   
gb|EMT23101.1|  Leucine aminopeptidase 2, chloroplastic               73.9    2e-11   
ref|XP_008452859.1|  PREDICTED: leucine aminopeptidase 2, chlorop...  72.0    2e-11   
ref|XP_002308402.1|  leucine aminopeptidase family protein            73.6    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_003553879.1|  PREDICTED: leucine aminopeptidase 3, chlorop...  73.9    3e-11   
gb|AAL11627.1|AF424634_1  AT4g30920/F6I18_170                         73.9    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001168170.1|  uncharacterized protein LOC100381923             72.0    3e-11   Zea mays [maize]
ref|XP_006664532.1|  PREDICTED: putative leucine aminopeptidase 1...  73.6    3e-11   
ref|XP_010275823.1|  PREDICTED: leucine aminopeptidase 1-like         73.6    3e-11   
dbj|BAD94641.1|  putative leucine aminopeptidase                      70.9    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011033404.1|  PREDICTED: leucine aminopeptidase 1              73.6    3e-11   
ref|XP_002529380.1|  leucine aminopeptidase, putative                 73.6    3e-11   Ricinus communis
gb|EMS51906.1|  Leucine aminopeptidase 2, chloroplastic               73.2    3e-11   
ref|XP_010234597.1|  PREDICTED: leucine aminopeptidase 2, chlorop...  73.6    3e-11   
ref|XP_008643980.1|  PREDICTED: uncharacterized protein LOC100381...  73.9    4e-11   
ref|XP_004287132.1|  PREDICTED: leucine aminopeptidase 3, chlorop...  73.6    4e-11   
dbj|BAJ92683.1|  predicted protein                                    73.2    4e-11   
ref|NP_001233884.1|  leucine aminopeptidase 2, chloroplastic          73.2    4e-11   
dbj|BAK00954.1|  predicted protein                                    73.2    4e-11   
ref|XP_009358438.1|  PREDICTED: leucine aminopeptidase 1-like         73.2    4e-11   
gb|AAO15916.1|  neutral leucine aminopeptidase preprotein             73.2    4e-11   Solanum lycopersicum
gb|EYU35326.1|  hypothetical protein MIMGU_mgv1a003455mg              73.2    4e-11   
ref|XP_010438109.1|  PREDICTED: leucine aminopeptidase 3, chlorop...  73.2    4e-11   
ref|XP_009410189.1|  PREDICTED: leucine aminopeptidase 2, chlorop...  72.8    5e-11   
ref|XP_007138276.1|  hypothetical protein PHAVU_009G195000g           72.8    6e-11   
gb|KFK29676.1|  hypothetical protein AALP_AA7G164200                  72.8    6e-11   
dbj|BAJ85842.1|  predicted protein                                    72.4    7e-11   
ref|XP_009366178.1|  PREDICTED: leucine aminopeptidase 1-like         72.4    7e-11   
ref|XP_008367747.1|  PREDICTED: leucine aminopeptidase 1-like         72.4    7e-11   
ref|XP_002867321.1|  cytosol aminopeptidase family protein            72.4    7e-11   
gb|ABK24447.1|  unknown                                               72.4    7e-11   Picea sitchensis
ref|XP_006412653.1|  hypothetical protein EUTSA_v10024754mg           72.4    8e-11   
gb|AFW73857.1|  hypothetical protein ZEAMMB73_599286                  72.0    9e-11   
gb|AFK42034.1|  unknown                                               71.6    1e-10   
gb|ACJ85545.1|  unknown                                               71.6    1e-10   Medicago truncatula
sp|P31427.2|AMPL_SOLTU  RecName: Full=Leucine aminopeptidase, chl...  72.0    1e-10   Solanum tuberosum [potatoes]
emb|CAA48038.1|  leucine aminopeptidase                               72.0    1e-10   Solanum tuberosum [potatoes]
ref|XP_002965045.1|  hypothetical protein SELMODRAFT_167050           71.6    1e-10   
ref|XP_002962141.1|  hypothetical protein SELMODRAFT_140664           71.6    1e-10   
ref|XP_002867322.1|  predicted protein                                71.6    1e-10   
ref|XP_006350102.1|  PREDICTED: leucine aminopeptidase, chloropla...  71.6    1e-10   
ref|XP_007154883.1|  hypothetical protein PHAVU_003G156100g           71.6    2e-10   
ref|XP_010525807.1|  PREDICTED: leucine aminopeptidase 1              71.2    2e-10   
ref|NP_001189587.1|  aminopeptidase family protein                    71.2    2e-10   
ref|XP_002880560.1|  cytosol aminopeptidase                           71.2    2e-10   
ref|NP_179997.1|  aminopeptidase family protein                       71.2    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472421.1|  PREDICTED: leucine aminopeptidase 1-like         70.9    2e-10   
emb|CDY20284.1|  BnaC04g36720D                                        70.5    3e-10   
gb|EAY82956.1|  hypothetical protein OsI_38175                        70.1    4e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010429381.1|  PREDICTED: leucine aminopeptidase 1              70.1    4e-10   
ref|XP_010526298.1|  PREDICTED: leucine aminopeptidase 1-like         70.1    5e-10   
pir||A48788  leucyl aminopeptidase (EC 3.4.11.1) DR57 - tomato        69.7    6e-10
pdb|4KSI|A  Chain A, Crystal Structure Analysis Of The Acidic Leu...  69.7    6e-10   
gb|AAA80498.1|  leucine aminopeptidase                                69.7    6e-10   Solanum lycopersicum
gb|EEE53139.1|  hypothetical protein OsJ_35947                        69.7    6e-10   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066684.1|  Os12g0434400                                     69.7    6e-10   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001233862.1|  leucine aminopeptidase 1, chloroplastic          69.7    7e-10   
gb|AAC49457.1|  leucine aminopeptidase                                69.3    7e-10   Solanum lycopersicum
emb|CAA69614.1|  lap17.1a                                             69.3    7e-10   Solanum lycopersicum
ref|XP_008352214.1|  PREDICTED: LOW QUALITY PROTEIN: leucine amin...  69.3    8e-10   
emb|CDX76828.1|  BnaC08g34140D                                        68.9    1e-09   
ref|XP_009117239.1|  PREDICTED: leucine aminopeptidase 1              68.9    1e-09   
ref|XP_006404921.1|  hypothetical protein EUTSA_v10000127mg           68.9    1e-09   
emb|CDY34790.1|  BnaA09g41570D                                        68.9    1e-09   
ref|XP_009140523.1|  PREDICTED: leucine aminopeptidase 1              68.9    1e-09   
emb|CDY39696.1|  BnaA04g14130D                                        68.6    1e-09   
ref|XP_008337029.1|  PREDICTED: leucine aminopeptidase 2, chlorop...  68.2    2e-09   
gb|KFK32675.1|  hypothetical protein AALP_AA6G274200                  67.4    3e-09   
ref|NP_194820.1|  cytosol aminopeptidase family protein               66.6    7e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CAA18202.1|  leucyl aminopeptidase-like protein (partial)         66.6    7e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AFW71516.1|  hypothetical protein ZEAMMB73_883672                  64.3    2e-08   
ref|XP_002453876.1|  hypothetical protein SORBIDRAFT_04g020460        64.7    3e-08   Sorghum bicolor [broomcorn]
gb|AFW71513.1|  hypothetical protein ZEAMMB73_883672                  64.3    4e-08   
ref|XP_008645704.1|  PREDICTED: LOW QUALITY PROTEIN: leucine amin...  64.3    4e-08   
emb|CEF97939.1|  Leucine aminopeptidase/peptidase B                   63.5    6e-08   
ref|XP_008376006.1|  PREDICTED: LOW QUALITY PROTEIN: leucine amin...  62.0    2e-07   
ref|XP_001417730.1|  predicted protein                                57.0    8e-06   Ostreococcus lucimarinus CCE9901
ref|XP_001758543.1|  predicted protein                                57.0    1e-05   
gb|EWM21808.1|  leucyl aminopeptidase                                 53.9    9e-05   
ref|XP_001700276.1|  predicted protein                                52.4    2e-04   Chlamydomonas reinhardtii
ref|XP_005644543.1|  hypothetical protein COCSUDRAFT_54513            52.4    3e-04   
ref|XP_003057064.1|  predicted protein                                51.6    5e-04   
gb|KFM27752.1|  Leucine aminopeptidase 2, chloroplastic               50.8    6e-04   
ref|XP_005851577.1|  hypothetical protein CHLNCDRAFT_33905            50.8    8e-04   
ref|WP_038553352.1|  aminopeptidase A                                 50.8    8e-04   



>gb|ABR26167.1| cytosol aminopeptidase [Oryza sativa Indica Group]
Length=134

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KK+ ATGFG+ST+VEWVLK+SS
Sbjct  92   QFVDEKVQWMHIDMAGPVWNDKKRAATGFGVSTLVEWVLKNSS  134



>dbj|BAF02023.1| leucyl aminopeptidase like protein [Arabidopsis thaliana]
Length=91

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E+VEW+HID+AGPV++EKKK ATGFG++T+VEWV  HSS
Sbjct  48   QFVSEDVEWMHIDMAGPVWNEKKKAATGFGVATLVEWVQNHSS  90



>emb|CDP16585.1| unnamed protein product [Coffea canephora]
Length=526

 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV++EKKK ATGFGIST+VEWVLK+SS
Sbjct  484  QFVDEKVQWMHIDMAGPVWNEKKKSATGFGISTLVEWVLKNSS  526



>emb|CDP10235.1| unnamed protein product [Coffea canephora]
Length=526

 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV++EKKK ATGFGIST+VEWVLK+SS
Sbjct  484  QFVDEKVQWMHIDMAGPVWNEKKKGATGFGISTLVEWVLKNSS  526



>gb|KHG23887.1| hypothetical protein F383_01434 [Gossypium arboreum]
Length=580

 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV++EKK++ATGFG+ST+VEWVLK+SS
Sbjct  538  QFVDEKVQWMHIDLAGPVWNEKKRVATGFGVSTLVEWVLKNSS  580



>ref|XP_010047106.1| PREDICTED: leucine aminopeptidase 1-like [Eucalyptus grandis]
 gb|KCW78900.1| hypothetical protein EUGRSUZ_C00345 [Eucalyptus grandis]
Length=576

 Score = 79.0 bits (193),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            Q+VDE+V+W+HID+AGPV++EKKK ATGFGIST+VEWVLK+SS
Sbjct  534  QYVDEKVQWMHIDMAGPVWNEKKKAATGFGISTLVEWVLKNSS  576



>ref|XP_007011931.1| Cytosol aminopeptidase family protein [Theobroma cacao]
 gb|EOY29550.1| Cytosol aminopeptidase family protein [Theobroma cacao]
Length=580

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KK++ATGFGIST+VEWVLK+SS
Sbjct  538  QFVDEKVQWMHIDLAGPVWNDKKRVATGFGISTLVEWVLKNSS  580



>ref|XP_011079411.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Sesamum 
indicum]
Length=583

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HIDIAGPV+++KKK ATGFGIST+VEWVLK+SS
Sbjct  541  QFVDEKVQWMHIDIAGPVWNDKKKNATGFGISTLVEWVLKNSS  583



>gb|EYU34348.1| hypothetical protein MIMGU_mgv1a003554mg [Erythranthe guttata]
Length=578

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KKK ATGFGIST+VEWVLK+SS
Sbjct  536  QFVDEKVQWMHIDMAGPVWNDKKKNATGFGISTLVEWVLKNSS  578



>ref|XP_010687715.1| PREDICTED: leucine aminopeptidase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=582

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV++EKK+ ATGFG+ST+VEWVLK+SS
Sbjct  540  QFVDEKVQWMHIDMAGPVWNEKKRSATGFGVSTLVEWVLKNSS  582



>gb|EMT02487.1| Formin-like protein 7 [Aegilops tauschii]
Length=1819

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563   QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
             QFVDE+V+W+HID+AGPV+++KK+ ATGFG+ST+VEWVLK+SS
Sbjct  1776  QFVDEKVQWMHIDMAGPVWNDKKRAATGFGVSTLVEWVLKNSS  1818



>emb|CAA68143.1| cytosol aminopeptidase [Petroselinum crispum]
Length=295

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+WLHID+AGPV+ +KKK ATGFG+ST+VEWV+K+SS
Sbjct  252  QFVDEKVQWLHIDMAGPVWSDKKKAATGFGVSTLVEWVVKNSS  294



>ref|NP_001048379.1| Os02g0794700 [Oryza sativa Japonica Group]
 dbj|BAF10293.1| Os02g0794700, partial [Oryza sativa Japonica Group]
Length=316

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KK+ ATGFG+ST+VEWVLK+SS
Sbjct  274  QFVDEKVQWMHIDMAGPVWNDKKRAATGFGVSTLVEWVLKNSS  316



>ref|XP_006857233.1| hypothetical protein AMTR_s00065p00209640 [Amborella trichopoda]
 gb|ERN18700.1| hypothetical protein AMTR_s00065p00209640 [Amborella trichopoda]
Length=525

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+WLHID+AGPV++EKKK  TGFG+ST+VEWVLK+SS
Sbjct  482  QFVDEKVQWLHIDMAGPVWNEKKKGGTGFGVSTLVEWVLKNSS  524



>ref|XP_011083971.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Sesamum 
indicum]
Length=584

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KKK ATGFGIST+VEWVLK+SS
Sbjct  542  QFVDEKVQWMHIDMAGPVWNDKKKNATGFGISTLVEWVLKNSS  584



>gb|KHG14578.1| hypothetical protein F383_10344 [Gossypium arboreum]
Length=521

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KK++ATGFGI+T+VEWVLK+SS
Sbjct  479  QFVDEKVQWMHIDLAGPVWNDKKRVATGFGIATLVEWVLKNSS  521



>ref|XP_008794352.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Phoenix 
dactylifera]
Length=584

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+WLHID+AGPV+++KK+ ATGFG+ST+VEWVLK+SS
Sbjct  542  QFVDEKVQWLHIDMAGPVWNDKKRAATGFGVSTLVEWVLKNSS  584



>ref|XP_011018033.1| PREDICTED: leucine aminopeptidase 1-like [Populus euphratica]
Length=582

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HIDIAGPV++EKK+ ATGFGI T+VEWV +HSS
Sbjct  540  QFVDEKVQWMHIDIAGPVWNEKKRAATGFGIQTLVEWVQQHSS  582



>ref|XP_002325134.2| leucine aminopeptidase family protein [Populus trichocarpa]
 gb|EEF03699.2| leucine aminopeptidase family protein [Populus trichocarpa]
Length=582

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HIDIAGPV++EKK+ ATGFGI T+VEWV +HSS
Sbjct  540  QFVDEKVQWMHIDIAGPVWNEKKRTATGFGIQTLVEWVQQHSS  582



>emb|CAN66364.1| hypothetical protein VITISV_029979 [Vitis vinifera]
Length=583

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KK+ ATGFGIST+VEWVLK+SS
Sbjct  541  QFVDEKVQWMHIDMAGPVWNDKKRAATGFGISTLVEWVLKNSS  583



>ref|XP_003610319.1| Leucine aminopeptidase [Medicago truncatula]
 gb|AES92516.1| cytosol aminopeptidase family protein [Medicago truncatula]
Length=567

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+WLHID+AGPV+++KK+ ATGFG+ST+VEWVLK+SS
Sbjct  525  QFVDEKVQWLHIDMAGPVWNDKKRSATGFGVSTLVEWVLKNSS  567



>ref|XP_002994538.1| hypothetical protein SELMODRAFT_138786 [Selaginella moellendorffii]
 gb|EFJ04395.1| hypothetical protein SELMODRAFT_138786 [Selaginella moellendorffii]
Length=72

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE++ W H+DIAGPV++EKKK+ATGF + T+VEWV KH+S
Sbjct  28   QFVDEKIPWAHLDIAGPVWNEKKKMATGFAVGTLVEWVSKHAS  70



>ref|XP_002276114.1| PREDICTED: leucine aminopeptidase 1 [Vitis vinifera]
Length=583

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KK+ ATGFGIST+VEWVLK+SS
Sbjct  541  QFVDEKVQWMHIDMAGPVWNDKKRAATGFGISTLVEWVLKNSS  583



>emb|CBI36527.3| unnamed protein product [Vitis vinifera]
Length=528

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KK+ ATGFGIST+VEWVLK+SS
Sbjct  486  QFVDEKVQWMHIDMAGPVWNDKKRAATGFGISTLVEWVLKNSS  528



>ref|XP_002965081.1| hypothetical protein SELMODRAFT_82608 [Selaginella moellendorffii]
 gb|EFJ33919.1| hypothetical protein SELMODRAFT_82608 [Selaginella moellendorffii]
Length=72

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE++ W H+DIAGPV++EKKK+ATGF + T+VEWV KH+S
Sbjct  28   QFVDEKIPWAHLDIAGPVWNEKKKMATGFAVGTLVEWVSKHAS  70



>gb|KEH38070.1| leucine aminopeptidase (cytosol aminopeptidase), putative [Medicago 
truncatula]
Length=246

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV++EK++ ATGFG+ST+VEWVL+++S
Sbjct  204  QFVDEKVQWMHIDLAGPVWNEKQRCATGFGVSTLVEWVLRNAS  246



>gb|EMS53149.1| Leucine aminopeptidase 2, chloroplastic [Triticum urartu]
Length=533

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KK+ ATGFG+ST+VEWVLK+SS
Sbjct  489  QFVDEKVQWMHIDMAGPVWNDKKRAATGFGVSTLVEWVLKNSS  531



>ref|XP_002454700.1| hypothetical protein SORBIDRAFT_04g035840 [Sorghum bicolor]
 gb|EES07676.1| hypothetical protein SORBIDRAFT_04g035840 [Sorghum bicolor]
Length=594

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KK+ ATGFG+ST+VEWVLK+SS
Sbjct  551  QFVDEKVQWMHIDMAGPVWNDKKRAATGFGVSTLVEWVLKNSS  593



>ref|XP_004144797.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Cucumis 
sativus]
Length=261

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE V+W+H+DIAGPV++ KK +ATGFG+ST+VEWVLK++S
Sbjct  219  QFVDENVQWMHLDIAGPVWNTKKSVATGFGVSTLVEWVLKNAS  261



>ref|XP_004954212.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like isoform 
X1 [Setaria italica]
Length=601

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KK+ ATGFG+ST+VEWVLK+SS
Sbjct  558  QFVDEKVQWMHIDMAGPVWNDKKRAATGFGVSTLVEWVLKNSS  600



>ref|XP_008242990.1| PREDICTED: leucine aminopeptidase 1 [Prunus mume]
Length=574

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+VEW+HID+AGPV+ +KK+ ATGFG+ST+VEWVLK+S+
Sbjct  532  QFVDEKVEWMHIDMAGPVWSDKKRTATGFGVSTLVEWVLKNSA  574



>gb|KHG12351.1| Leucine aminopeptidase 1 -like protein [Gossypium arboreum]
Length=522

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV ++KK +ATGFGIST+VEWVLK+SS
Sbjct  479  QFVDEKVKWMHIDMAGPVLNDKKHVATGFGISTLVEWVLKNSS  521



>ref|XP_004954213.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like isoform 
X2 [Setaria italica]
Length=592

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KK+ ATGFG+ST+VEWVLK+SS
Sbjct  549  QFVDEKVQWMHIDMAGPVWNDKKRAATGFGVSTLVEWVLKNSS  591



>sp|Q6K669.1|AMPL2_ORYSJ RecName: Full=Leucine aminopeptidase 2, chloroplastic; AltName: 
Full=Leucyl aminopeptidase 2; Short=LAP 2; AltName: Full=Proline 
aminopeptidase 2; AltName: Full=Prolyl aminopeptidase 
2; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD19264.1| putative leucine aminopeptidase [Oryza sativa Japonica Group]
 dbj|BAD19673.1| putative leucine aminopeptidase [Oryza sativa Japonica Group]
 gb|EAY87845.1| hypothetical protein OsI_09267 [Oryza sativa Indica Group]
 gb|EAZ24923.1| hypothetical protein OsJ_08704 [Oryza sativa Japonica Group]
Length=598

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KK+ ATGFG+ST+VEWVLK+SS
Sbjct  556  QFVDEKVQWMHIDMAGPVWNDKKRAATGFGVSTLVEWVLKNSS  598



>ref|XP_007204206.1| hypothetical protein PRUPE_ppa003434mg [Prunus persica]
 gb|EMJ05405.1| hypothetical protein PRUPE_ppa003434mg [Prunus persica]
Length=574

 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+VEW+HID+AGPV+ +KK+ ATGFG+ST+VEWVLK+S+
Sbjct  532  QFVDEKVEWMHIDMAGPVWSDKKRTATGFGVSTLVEWVLKNSA  574



>ref|XP_010942088.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Elaeis 
guineensis]
Length=530

 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+WLHID+AGPV+ +KK+ ATGFG+ST+VEWVLK+SS
Sbjct  488  QFVDEKVQWLHIDMAGPVWSDKKRAATGFGVSTLVEWVLKNSS  530



>ref|XP_008803712.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=530

 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+WLHID+AGPV++++K+ ATGFG+ST+VEWVLK+SS
Sbjct  488  QFVDEKVQWLHIDMAGPVWNDRKRAATGFGVSTLVEWVLKNSS  530



>ref|XP_009795110.1| PREDICTED: leucine aminopeptidase 2, chloroplastic [Nicotiana 
sylvestris]
Length=576

 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KKK ATGFG+ST+VEWVLK+S+
Sbjct  533  QFVDEKVQWMHIDLAGPVWNDKKKNATGFGVSTLVEWVLKNST  575



>gb|AGW47884.1| leucine aminopeptidase [Nicotiana tabacum]
Length=527

 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KKK ATGFG+ST+VEWVLK+S+
Sbjct  484  QFVDEKVQWMHIDLAGPVWNDKKKNATGFGVSTLVEWVLKNST  526



>ref|XP_010236855.1| PREDICTED: formin-like protein 7 [Brachypodium distachyon]
Length=2049

 Score = 76.3 bits (186),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563   QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
             QFVDE+V+W+HID+AGPV+++KK+ ATGFG+ST+VEWVLK+SS
Sbjct  2007  QFVDEKVQWMHIDMAGPVWNDKKRAATGFGVSTLVEWVLKNSS  2049



>ref|XP_009614630.1| PREDICTED: leucine aminopeptidase 2, chloroplastic [Nicotiana 
tomentosiformis]
Length=579

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KKK ATGFG+ST+VEWVLK+S+
Sbjct  536  QFVDEKVQWMHIDLAGPVWNDKKKNATGFGVSTLVEWVLKNST  578



>ref|XP_006649129.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Oryza 
brachyantha]
Length=529

 Score = 75.5 bits (184),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KK+ ATGFG+ST+VEWVLK+SS
Sbjct  487  QFVDEKVQWMHIDMAGPVWNDKKRGATGFGVSTLVEWVLKNSS  529



>ref|XP_010103674.1| Leucine aminopeptidase 3 [Morus notabilis]
 gb|EXB96617.1| Leucine aminopeptidase 3 [Morus notabilis]
Length=579

 Score = 75.5 bits (184),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KK+ ATGFGIST+VEWV+K+SS
Sbjct  537  QFVDEKVQWMHIDMAGPVWNDKKRSATGFGISTLVEWVVKNSS  579



>ref|XP_004514667.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Cicer 
arietinum]
Length=575

 Score = 75.1 bits (183),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV++EK++ ATGFG+ST+VEWVL+++S
Sbjct  533  QFVDEKVQWMHIDLAGPVWNEKQRCATGFGVSTLVEWVLRNAS  575



>ref|XP_010929163.1| PREDICTED: leucine aminopeptidase 1-like [Elaeis guineensis]
Length=604

 Score = 75.1 bits (183),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV+E+V+WLHID+AGPV+++KK+ ATGFG+ST+VEWVLK+SS
Sbjct  562  QFVEEKVQWLHIDMAGPVWNDKKRAATGFGVSTLVEWVLKNSS  604



>ref|XP_006453614.1| hypothetical protein CICLE_v10007834mg [Citrus clementina]
 gb|ESR66854.1| hypothetical protein CICLE_v10007834mg [Citrus clementina]
 gb|KDO59458.1| hypothetical protein CISIN_1g007947mg [Citrus sinensis]
Length=583

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHS  688
            Q+VDE+V+W+HIDIAGPV+ EK + ATGFGISTMVEWVLK+S
Sbjct  541  QYVDEKVQWMHIDIAGPVWSEKMRSATGFGISTMVEWVLKNS  582



>ref|XP_006350101.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Solanum 
tuberosum]
Length=577

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+ +KKK ATGFG+ST+VEWVLK+S+
Sbjct  534  QFVDEKVQWMHIDLAGPVWSDKKKNATGFGVSTLVEWVLKNST  576



>ref|XP_006474000.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Citrus 
sinensis]
Length=583

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHS  688
            Q+VDE+V+W+HIDIAGPV+ EK + ATGFGISTMVEWVLK+S
Sbjct  541  QYVDEKVQWMHIDIAGPVWSEKMRSATGFGISTMVEWVLKNS  582



>ref|XP_004144796.1| PREDICTED: leucine aminopeptidase 1-like [Cucumis sativus]
Length=526

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE V+W+H+DIAGPV++ KK +ATGFG+ST+VEWVLK++S
Sbjct  484  QFVDENVQWMHLDIAGPVWNTKKSIATGFGVSTLVEWVLKNAS  526



>gb|KGN61047.1| hypothetical protein Csa_2G035470 [Cucumis sativus]
Length=526

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE V+W+H+DIAGPV++ KK +ATGFG+ST+VEWVLK++S
Sbjct  484  QFVDENVQWMHLDIAGPVWNTKKSIATGFGVSTLVEWVLKNAS  526



>ref|XP_009127424.1| PREDICTED: leucine aminopeptidase 3, chloroplastic [Brassica 
rapa]
 emb|CDY28227.1| BnaA01g06220D [Brassica napus]
Length=583

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+VEW+HID+AGPV++EKKK ATGFG++T+VEWV  +SS
Sbjct  540  QFVDEKVEWMHIDMAGPVWNEKKKAATGFGVATLVEWVQNNSS  582



>emb|CDX68703.1| BnaC01g07500D [Brassica napus]
Length=582

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+VEW+HID+AGPV++EKKK ATGFG++T+VEWV  +SS
Sbjct  539  QFVDEKVEWMHIDMAGPVWNEKKKAATGFGVATLVEWVQNNSS  581



>ref|XP_010447643.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Camelina 
sativa]
Length=579

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+VEW+HID+AGPV++EKKK ATGFG++T+VEWV  +SS
Sbjct  536  QFVDEKVEWMHIDMAGPVWNEKKKTATGFGVATLVEWVQNNSS  578



>ref|NP_194821.1| leucine aminopeptidase 2 [Arabidopsis thaliana]
 sp|Q944P7.2|AMPL3_ARATH RecName: Full=Leucine aminopeptidase 3, chloroplastic; AltName: 
Full=Leucyl aminopeptidase 3; Short=LAP 3; AltName: Full=Proline 
aminopeptidase 3; AltName: Full=Prolyl aminopeptidase 
3; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE85830.1| leucine aminopeptidase 2 [Arabidopsis thaliana]
Length=583

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E+VEW+HID+AGPV++EKKK ATGFG++T+VEWV  HSS
Sbjct  540  QFVSEDVEWMHIDMAGPVWNEKKKAATGFGVATLVEWVQNHSS  582



>emb|CAA18201.1| leucyl aminopeptidase-like protein [Arabidopsis thaliana]
 emb|CAB79810.1| leucyl aminopeptidase-like protein [Arabidopsis thaliana]
Length=525

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E+VEW+HID+AGPV++EKKK ATGFG++T+VEWV  HSS
Sbjct  482  QFVSEDVEWMHIDMAGPVWNEKKKAATGFGVATLVEWVQNHSS  524



>ref|XP_010265583.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Nelumbo 
nucifera]
Length=528

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV+E+V+W+HIDIAGP ++EKK+ ATGFGIST+VEWVL +SS
Sbjct  486  QFVNEKVQWMHIDIAGPAWNEKKRTATGFGISTLVEWVLSNSS  528



>ref|XP_010432926.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Camelina 
sativa]
Length=584

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+VEW+HID+AGPV++EKKK ATGFG++T+VEWV  +SS
Sbjct  541  QFVDEKVEWMHIDMAGPVWNEKKKTATGFGVATLVEWVQNNSS  583



>ref|XP_008452840.1| PREDICTED: leucine aminopeptidase 1-like [Cucumis melo]
Length=585

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPVF +KK+ ATGFG++T+VEWV K++S
Sbjct  543  QFVDEKVQWMHIDVAGPVFSDKKRTATGFGVATLVEWVQKNAS  585



>ref|XP_009415506.1| PREDICTED: leucine aminopeptidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=591

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHS  688
            QFVDE+V+WLHID+AGPV+++KK+ ATGFG+ST++EWVLK+S
Sbjct  549  QFVDEKVQWLHIDMAGPVWNDKKRAATGFGVSTLIEWVLKNS  590



>ref|XP_004158743.1| PREDICTED: leucine aminopeptidase 1-like [Cucumis sativus]
Length=503

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE V+W+H+DIAGPV++ KK +ATGFG+ST+VEWVLK++S
Sbjct  461  QFVDENVQWMHLDIAGPVWNTKKSVATGFGVSTLVEWVLKNAS  503



>ref|XP_004144730.1| PREDICTED: leucine aminopeptidase 1-like [Cucumis sativus]
 ref|XP_004168114.1| PREDICTED: leucine aminopeptidase 1-like [Cucumis sativus]
 gb|KGN61048.1| hypothetical protein Csa_2G035480 [Cucumis sativus]
Length=585

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPVF +KK+ ATGFG++T+VEWV K++S
Sbjct  543  QFVDEKVQWMHIDVAGPVFSDKKRTATGFGVATLVEWVQKNAS  585



>gb|KDP38679.1| hypothetical protein JCGZ_04032 [Jatropha curcas]
Length=587

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QF++E V+W+HID+AGPV+ EKK+ ATGFGIST+VEWVL++SS
Sbjct  545  QFINENVQWMHIDMAGPVWSEKKRCATGFGISTLVEWVLQNSS  587



>ref|XP_006600543.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Glycine 
max]
Length=570

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KK+ ATGFGI+T+VEWVLK++S
Sbjct  525  QFVDEKVQWMHIDMAGPVWNDKKRSATGFGIATLVEWVLKNAS  567



>ref|XP_003518220.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Glycine 
max]
Length=570

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KK+ ATGFGI+T+VEWVLK++S
Sbjct  525  QFVDEKVQWMHIDMAGPVWNDKKRSATGFGIATLVEWVLKNAS  567



>gb|KGN61046.1| hypothetical protein Csa_2G035460 [Cucumis sativus]
Length=482

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE V+W+H+DIAGPV++ KK +ATGFG+ST+VEWVLK++S
Sbjct  440  QFVDENVQWMHLDIAGPVWNTKKSVATGFGVSTLVEWVLKNAS  482



>ref|XP_004507738.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Cicer 
arietinum]
Length=570

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KK+ ATGFGI+T+VEWVLK++S
Sbjct  528  QFVDEKVQWMHIDMAGPVWNDKKRSATGFGIATLVEWVLKNAS  570



>ref|XP_008384407.1| PREDICTED: leucine aminopeptidase 1-like [Malus domestica]
Length=575

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KK+ ATGFG+ST+VEWV K+SS
Sbjct  533  QFVDEKVQWMHIDMAGPVWNDKKRTATGFGVSTLVEWVQKNSS  575



>gb|KHN42824.1| Leucine aminopeptidase 3, chloroplastic [Glycine soja]
Length=541

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KK+ ATGFGI+T+VEWVLK++S
Sbjct  496  QFVDEKVQWMHIDMAGPVWNDKKRSATGFGIATLVEWVLKNAS  538



>gb|EMT23101.1| Leucine aminopeptidase 2, chloroplastic [Aegilops tauschii]
Length=530

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+  K + ATGFG+STMVEWVLK+SS
Sbjct  473  QFVDEKVQWMHIDVAGPVWSHKNRSATGFGVSTMVEWVLKNSS  515



>ref|XP_008452859.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Cucumis 
melo]
Length=272

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE ++W+H+DIAGPV++ KK + TGFG+ST+VEWVLK++S
Sbjct  230  QFVDENIQWMHLDIAGPVWNTKKSVGTGFGVSTLVEWVLKNAS  272



>ref|XP_002308402.1| leucine aminopeptidase family protein [Populus trichocarpa]
 gb|EEE91925.1| leucine aminopeptidase family protein [Populus trichocarpa]
Length=478

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV  EKK+ ATGFGI T+VEWV +HSS
Sbjct  436  QFVDEKVQWMHIDMAGPVSSEKKRTATGFGILTLVEWVQQHSS  478



>ref|XP_003553879.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like isoform 
1 [Glycine max]
Length=582

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV++EK++ ATGFG++T+VEWVL+++S
Sbjct  540  QFVDEKVQWMHIDMAGPVWNEKQRCATGFGVATLVEWVLRNAS  582



>gb|AAL11627.1|AF424634_1 AT4g30920/F6I18_170 [Arabidopsis thaliana]
 gb|AAO11568.1| At4g30920/F6I18_170 [Arabidopsis thaliana]
Length=583

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E VEW+HID+AGPV++EKKK ATGFG++T+VEWV  HSS
Sbjct  540  QFVSEGVEWMHIDMAGPVWNEKKKAATGFGVATLVEWVQNHSS  582



>ref|NP_001168170.1| uncharacterized protein LOC100381923 [Zea mays]
 gb|ACN27317.1| unknown [Zea mays]
Length=271

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVD++V+W+HID+AGPV+ +KK+ ATGFG+ST+VEWVL +SS
Sbjct  227  QFVDDKVQWMHIDMAGPVWSDKKRAATGFGVSTLVEWVLNNSS  269



>ref|XP_006664532.1| PREDICTED: putative leucine aminopeptidase 1-like [Oryza brachyantha]
Length=568

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDEEV+W+HID+AGPV++ KKK ATGFG+ST+VEWVL +SS
Sbjct  526  QFVDEEVQWMHIDMAGPVWNYKKKEATGFGVSTLVEWVLMNSS  568



>ref|XP_010275823.1| PREDICTED: leucine aminopeptidase 1-like [Nelumbo nucifera]
Length=574

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV++EKK+ ATGFG+ST+VEWV  +SS
Sbjct  532  QFVDEKVQWMHIDMAGPVWNEKKRTATGFGVSTLVEWVQANSS  574



>dbj|BAD94641.1| putative leucine aminopeptidase [Arabidopsis thaliana]
Length=211

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E+V+W+HID+AGPV++EKKK  TGFG++T+VEWV K+SS
Sbjct  168  QFVSEKVQWMHIDMAGPVWNEKKKSGTGFGVATLVEWVQKNSS  210



>ref|XP_011033404.1| PREDICTED: leucine aminopeptidase 1 [Populus euphratica]
Length=582

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV  EKK+ ATGFGI T+VEWV +HSS
Sbjct  540  QFVDEKVQWMHIDMAGPVSSEKKRTATGFGILTLVEWVQQHSS  582



>ref|XP_002529380.1| leucine aminopeptidase, putative [Ricinus communis]
 gb|EEF32976.1| leucine aminopeptidase, putative [Ricinus communis]
Length=587

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QF++E+V+W+HID+AGPV++EKK+ ATGFGIST+VEW+L +SS
Sbjct  545  QFINEKVQWMHIDMAGPVWNEKKRTATGFGISTLVEWILHNSS  587



>gb|EMS51906.1| Leucine aminopeptidase 2, chloroplastic [Triticum urartu]
Length=422

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+H+DIAGPV+  K + ATGFG+STMVEWVLK+SS
Sbjct  380  QFVDEKVQWMHMDIAGPVWSHKNRSATGFGVSTMVEWVLKNSS  422



>ref|XP_010234597.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Brachypodium 
distachyon]
Length=526

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            +FVDE+V+W+HIDIAGPV+  K + ATGFG+STMVEWVLK+SS
Sbjct  484  KFVDEKVQWMHIDIAGPVWSHKNRSATGFGVSTMVEWVLKNSS  526



>ref|XP_008643980.1| PREDICTED: uncharacterized protein LOC100381923 isoform X1 [Zea 
mays]
Length=2086

 Score = 73.9 bits (180),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563   QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
             QFVD++V+W+HID+AGPV+ +KK+ ATGFG+ST+VEWVL +SS
Sbjct  2042  QFVDDKVQWMHIDMAGPVWSDKKRAATGFGVSTLVEWVLNNSS  2084



>ref|XP_004287132.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=575

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+ +KK+ ATGF +ST+VEWVLK+SS
Sbjct  533  QFVDEKVQWMHIDMAGPVWSDKKRAATGFAVSTLVEWVLKNSS  575



>dbj|BAJ92683.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=538

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKH  685
            QFVDE+V+W+HID+AGPV+++KK+ ATGFG+ST+VEWVLK+
Sbjct  492  QFVDEKVQWMHIDMAGPVWNDKKRAATGFGVSTLVEWVLKN  532



>ref|NP_001233884.1| leucine aminopeptidase 2, chloroplastic [Solanum lycopersicum]
 sp|Q42876.1|AMPL2_SOLLC RecName: Full=Leucine aminopeptidase 2, chloroplastic; AltName: 
Full=Leucyl aminopeptidase 2; Short=LAP 2; AltName: Full=Proline 
aminopeptidase 2; AltName: Full=Prolyl aminopeptidase 
2; Flags: Precursor [Solanum lycopersicum]
 gb|AAA80499.1| leucine aminopeptidase [Solanum lycopersicum]
Length=569

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV+E+V+W+HID+AGPV+ +KKK ATGFG+ST+VEWVLK+S+
Sbjct  526  QFVNEKVQWMHIDLAGPVWSDKKKNATGFGVSTLVEWVLKNST  568



>dbj|BAK00954.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00974.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04996.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=538

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKH  685
            QFVDE+V+W+HID+AGPV+++KK+ ATGFG+ST+VEWVLK+
Sbjct  492  QFVDEKVQWMHIDMAGPVWNDKKRAATGFGVSTLVEWVLKN  532



>ref|XP_009358438.1| PREDICTED: leucine aminopeptidase 1-like [Pyrus x bretschneideri]
Length=575

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+WLHID+AGPV+ +KK+ ATGFGIST+VEWV  +SS
Sbjct  533  QFVDEKVQWLHIDMAGPVWSDKKRTATGFGISTLVEWVRNNSS  575



>gb|AAO15916.1| neutral leucine aminopeptidase preprotein [Solanum lycopersicum]
Length=577

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV+E+V+W+HID+AGPV+ +KKK ATGFG+ST+VEWVLK+S+
Sbjct  534  QFVNEKVQWMHIDLAGPVWSDKKKNATGFGVSTLVEWVLKNST  576



>gb|EYU35326.1| hypothetical protein MIMGU_mgv1a003455mg [Erythranthe guttata]
Length=584

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+ +KKK ATGFG+ST+VEWVL +SS
Sbjct  542  QFVDEKVQWMHIDMAGPVWSDKKKNATGFGVSTLVEWVLHNSS  584



>ref|XP_010438109.1| PREDICTED: leucine aminopeptidase 3, chloroplastic [Camelina 
sativa]
Length=583

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVD++VEW+HID+AGPV++EKKK ATGFG++T+VEWV  +SS
Sbjct  540  QFVDDKVEWMHIDMAGPVWNEKKKTATGFGVATLVEWVQNNSS  582



>ref|XP_009410189.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=530

 Score = 72.8 bits (177),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHS  688
            QFV+E+V+WLHID+AGPV+++KK+ ATGFG+ST+VEWV+K+S
Sbjct  489  QFVNEKVQWLHIDMAGPVWNDKKRAATGFGVSTLVEWVMKNS  530



>ref|XP_007138276.1| hypothetical protein PHAVU_009G195000g [Phaseolus vulgaris]
 gb|ESW10270.1| hypothetical protein PHAVU_009G195000g [Phaseolus vulgaris]
Length=577

 Score = 72.8 bits (177),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV++EK++ ATGFG++T+V+WVL+++S
Sbjct  535  QFVDEKVQWMHIDMAGPVWNEKQRCATGFGVATLVQWVLRNAS  577



>gb|KFK29676.1| hypothetical protein AALP_AA7G164200 [Arabis alpina]
Length=588

 Score = 72.8 bits (177),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV+E+VEW+HID+AGPV++EKKK ATGFG++T+VEWV  +SS
Sbjct  544  QFVNEKVEWMHIDMAGPVWNEKKKAATGFGVATLVEWVQNNSS  586



>dbj|BAJ85842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=529

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QF+D++V+W+HIDIAGPV+  K + ATGFG+STMVEWVLK+SS
Sbjct  487  QFIDKKVQWMHIDIAGPVWSHKNRSATGFGVSTMVEWVLKNSS  529



>ref|XP_009366178.1| PREDICTED: leucine aminopeptidase 1-like [Pyrus x bretschneideri]
Length=575

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV++++K+ ATGFG+ST+VEWV K+SS
Sbjct  533  QFVDEKVQWMHIDMAGPVWNDEKRTATGFGVSTLVEWVQKNSS  575



>ref|XP_008367747.1| PREDICTED: leucine aminopeptidase 1-like [Malus domestica]
Length=573

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+WLHID+AGPV+ +KK+ ATGFG+ST+VEWV  +SS
Sbjct  531  QFVDEKVQWLHIDMAGPVWSDKKRTATGFGVSTLVEWVQNNSS  573



>ref|XP_002867321.1| cytosol aminopeptidase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43580.1| cytosol aminopeptidase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=583

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV+E VEW+HID+AGPV++EKKK ATGFG++T+VEWV  +SS
Sbjct  540  QFVNENVEWMHIDMAGPVWNEKKKAATGFGVATLVEWVQNNSS  582



>gb|ABK24447.1| unknown [Picea sitchensis]
Length=613

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE V+WLHID+AGPV+ EKK+ ATGF +ST+VEWVL++SS
Sbjct  571  QFVDENVQWLHIDMAGPVWSEKKRGATGFAVSTLVEWVLENSS  613



>ref|XP_006412653.1| hypothetical protein EUTSA_v10024754mg [Eutrema salsugineum]
 gb|ESQ54106.1| hypothetical protein EUTSA_v10024754mg [Eutrema salsugineum]
Length=587

 Score = 72.4 bits (176),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E+VEW+HID+AGPV++EKKK ATGFG++T+VEWV  +SS
Sbjct  543  QFVSEKVEWMHIDMAGPVWNEKKKAATGFGVATLVEWVQNNSS  585



>gb|AFW73857.1| hypothetical protein ZEAMMB73_599286 [Zea mays]
Length=596

 Score = 72.0 bits (175),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVD++V+W+HID+AGPV+ +KK+ ATGFG+ST+VEWVL +SS
Sbjct  552  QFVDDKVQWMHIDMAGPVWSDKKRAATGFGVSTLVEWVLNNSS  594



>gb|AFK42034.1| unknown [Medicago truncatula]
Length=392

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHS  688
            QFVDE+V+WLHID+AGPV+++KK+ ATGFG+ T+VEWVLK+S
Sbjct  350  QFVDEKVQWLHIDMAGPVWNDKKRSATGFGVFTLVEWVLKNS  391



>gb|ACJ85545.1| unknown [Medicago truncatula]
Length=392

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHS  688
            QFVDE+V+WLHID+AGPV+++KK+ ATGFG+ T+VEWVLK+S
Sbjct  350  QFVDEKVQWLHIDMAGPVWNDKKRSATGFGVFTLVEWVLKNS  391



>sp|P31427.2|AMPL_SOLTU RecName: Full=Leucine aminopeptidase, chloroplastic; AltName: 
Full=Leucyl aminopeptidase; Short=LAP; AltName: Full=Proline 
aminopeptidase; AltName: Full=Prolyl aminopeptidase; Flags: 
Precursor [Solanum tuberosum]
 emb|CAA54314.1| leucine aminopeptidase [Solanum tuberosum]
Length=573

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHS  688
            QFVDE+V+WLH+DIAGPV+ ++KK ATG+G+ST+VEWVL++S
Sbjct  531  QFVDEKVQWLHLDIAGPVWSDEKKNATGYGVSTLVEWVLRNS  572



>emb|CAA48038.1| leucine aminopeptidase [Solanum tuberosum]
Length=554

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHS  688
            QFVDE+V+WLH+DIAGPV+ ++KK ATG+G+ST+VEWVL++S
Sbjct  512  QFVDEKVQWLHLDIAGPVWSDEKKNATGYGVSTLVEWVLRNS  553



>ref|XP_002965045.1| hypothetical protein SELMODRAFT_167050 [Selaginella moellendorffii]
 gb|EFJ33883.1| hypothetical protein SELMODRAFT_167050 [Selaginella moellendorffii]
Length=538

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE++ W H+DIAGPV++EKKK+ATGF + T+VEWV KH+S
Sbjct  494  QFVDEKIPWAHLDIAGPVWNEKKKMATGFAVGTLVEWVSKHAS  536



>ref|XP_002962141.1| hypothetical protein SELMODRAFT_140664 [Selaginella moellendorffii]
 gb|EFJ37401.1| hypothetical protein SELMODRAFT_140664 [Selaginella moellendorffii]
Length=538

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE++ W H+DIAGPV++EKKK+ATGF + T+VEWV KH+S
Sbjct  494  QFVDEKIPWAHLDIAGPVWNEKKKMATGFAVGTLVEWVSKHAS  536



>ref|XP_002867322.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43581.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=582

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E VEW+HID+AGPV++EKKK ATGFG++T+VEWV  +SS
Sbjct  540  QFVSENVEWMHIDMAGPVWNEKKKAATGFGVATLVEWVQNNSS  582



>ref|XP_006350102.1| PREDICTED: leucine aminopeptidase, chloroplastic-like [Solanum 
tuberosum]
Length=574

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHS  688
            QFVDE+V+WLH+DIAGPV+ ++KK ATG+G+ST+VEWVL++S
Sbjct  532  QFVDEKVQWLHLDIAGPVWSDEKKNATGYGVSTLVEWVLRNS  573



>ref|XP_007154883.1| hypothetical protein PHAVU_003G156100g [Phaseolus vulgaris]
 gb|ESW26877.1| hypothetical protein PHAVU_003G156100g [Phaseolus vulgaris]
Length=570

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+HID+AGPV+++KK+  TGFG++T+VEW+LK+ S
Sbjct  525  QFVDEKVQWMHIDMAGPVWNDKKRSGTGFGVATLVEWILKNGS  567



>ref|XP_010525807.1| PREDICTED: leucine aminopeptidase 1 [Tarenaya hassleriana]
Length=588

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E+V+W+HID+AGPV+++KKK ATGFG++T+VEWV K+SS
Sbjct  545  QFVSEKVQWMHIDMAGPVWNDKKKAATGFGVATLVEWVQKNSS  587



>ref|NP_001189587.1| aminopeptidase family protein [Arabidopsis thaliana]
 gb|AEC07541.1| aminopeptidase family protein [Arabidopsis thaliana]
Length=484

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E+V+W+HID+AGPV++EKKK  TGFG++T+VEWV K+SS
Sbjct  441  QFVSEKVQWMHIDMAGPVWNEKKKSGTGFGVATLVEWVQKNSS  483



>ref|XP_002880560.1| cytosol aminopeptidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56819.1| cytosol aminopeptidase [Arabidopsis lyrata subsp. lyrata]
Length=520

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E+V+W+HID+AGPV++EKKK  TGFG++T+VEWV K+SS
Sbjct  477  QFVSEKVQWMHIDMAGPVWNEKKKSGTGFGVATLVEWVQKNSS  519



>ref|NP_179997.1| aminopeptidase family protein [Arabidopsis thaliana]
 ref|NP_001118375.1| aminopeptidase family protein [Arabidopsis thaliana]
 sp|P30184.1|AMPL1_ARATH RecName: Full=Leucine aminopeptidase 1; AltName: Full=Leucyl 
aminopeptidase 1; Short=LAP 1; AltName: Full=Proline aminopeptidase 
1; AltName: Full=Prolyl aminopeptidase 1 [Arabidopsis 
thaliana]
 emb|CAA45040.1| leucine aminopeptidase [Arabidopsis thaliana]
 gb|AAD03381.1| putative leucine aminopeptidase [Arabidopsis thaliana]
 gb|AAL32980.1| At2g24200/F27D4.11 [Arabidopsis thaliana]
 gb|AAP21153.1| At2g24200/F27D4.11 [Arabidopsis thaliana]
 gb|AEC07539.1| aminopeptidase family protein [Arabidopsis thaliana]
 gb|AEC07540.1| aminopeptidase family protein [Arabidopsis thaliana]
Length=520

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E+V+W+HID+AGPV++EKKK  TGFG++T+VEWV K+SS
Sbjct  477  QFVSEKVQWMHIDMAGPVWNEKKKSGTGFGVATLVEWVQKNSS  519



>ref|XP_010472421.1| PREDICTED: leucine aminopeptidase 1-like [Camelina sativa]
Length=518

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E+V+W+HID+AGPV++EKKK  TGFG++T+VEWV K+SS
Sbjct  475  QFVSEKVQWMHIDMAGPVWNEKKKSGTGFGVATLVEWVQKNSS  517



>emb|CDY20284.1| BnaC04g36720D [Brassica napus]
Length=521

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E+V+W+HID+AGPV++EKKK  TGFG+ST+VEWV  +SS
Sbjct  478  QFVSEQVQWMHIDMAGPVWNEKKKSGTGFGVSTLVEWVQTNSS  520



>gb|EAY82956.1| hypothetical protein OsI_38175 [Oryza sativa Indica Group]
Length=525

 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+H+D+AGPV++ KK+ ATGFG+ST+VEWVL +SS
Sbjct  483  QFVDEKVQWMHVDMAGPVWNYKKQEATGFGVSTLVEWVLINSS  525



>ref|XP_010429381.1| PREDICTED: leucine aminopeptidase 1 [Camelina sativa]
Length=518

 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E+V+W+HID+AGPV+ EKKK  TGFG++T+VEWV K+SS
Sbjct  475  QFVSEKVQWMHIDMAGPVWSEKKKSGTGFGVATLVEWVQKNSS  517



>ref|XP_010526298.1| PREDICTED: leucine aminopeptidase 1-like [Tarenaya hassleriana]
Length=594

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E+V+W+HID+AGPV+++KKK  TGFG++T+VEWV K+SS
Sbjct  551  QFVSEKVQWMHIDMAGPVWNDKKKAGTGFGVATLVEWVQKNSS  593



>pir||A48788 leucyl aminopeptidase (EC 3.4.11.1) DR57 - tomato
 gb|AAB28717.1| leucine aminopeptidase, LAP=DR57 product {EC 3.4.11.1} [Lycopersicon 
esculentum=tomatoes, Peto 238R, leaves, Peptide, 469 
aa]
Length=469

 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKH  685
            QFVDE+V+WLH+D+AGPV+ ++KK ATG+G+ST+VEWVL++
Sbjct  429  QFVDEKVQWLHLDVAGPVWSDEKKNATGYGVSTLVEWVLRN  469



>pdb|4KSI|A Chain A, Crystal Structure Analysis Of The Acidic Leucine Aminopeptidase 
Of Tomato
Length=529

 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKH  685
            QFVDE+V+WLH+D+AGPV+ ++KK ATG+G+ST+VEWVL++
Sbjct  489  QFVDEKVQWLHLDVAGPVWSDEKKNATGYGVSTLVEWVLRN  529



>gb|AAA80498.1| leucine aminopeptidase, partial [Solanum lycopersicum]
Length=523

 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKH  685
            QFVDE+V+WLH+D+AGPV+ ++KK ATG+G+ST+VEWVL++
Sbjct  483  QFVDEKVQWLHLDVAGPVWSDEKKNATGYGVSTLVEWVLRN  523



>gb|EEE53139.1| hypothetical protein OsJ_35947 [Oryza sativa Japonica Group]
Length=554

 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+H+D+AGPV++ KK+ ATGFG+ST+VEWVL +SS
Sbjct  512  QFVDEKVKWMHVDMAGPVWNYKKQEATGFGVSTLVEWVLINSS  554



>ref|NP_001066684.1| Os12g0434400 [Oryza sativa Japonica Group]
 sp|Q2QSB9.2|AMPL1_ORYSJ RecName: Full=Putative leucine aminopeptidase 1; AltName: Full=Leucyl 
aminopeptidase 1; Short=LAP 1; AltName: Full=Proline 
aminopeptidase 1; AltName: Full=Prolyl aminopeptidase 1 [Oryza 
sativa Japonica Group]
 gb|ABA97701.2| Aminopeptidase, chloroplast precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29703.1| Os12g0434400 [Oryza sativa Japonica Group]
Length=542

 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+W+H+D+AGPV++ KK+ ATGFG+ST+VEWVL +SS
Sbjct  500  QFVDEKVKWMHVDMAGPVWNYKKQEATGFGVSTLVEWVLINSS  542



>ref|NP_001233862.1| leucine aminopeptidase 1, chloroplastic [Solanum lycopersicum]
 sp|Q10712.1|AMPL1_SOLLC RecName: Full=Leucine aminopeptidase 1, chloroplastic; AltName: 
Full=DR57; AltName: Full=Leucyl aminopeptidase 1; Short=LAP 
1; AltName: Full=Proline aminopeptidase 1; AltName: Full=Prolyl 
aminopeptidase 1; Flags: Precursor [Solanum lycopersicum]
 gb|AAC49456.1| leucine aminopeptidase [Solanum lycopersicum]
Length=571

 Score = 69.7 bits (169),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKH  685
            QFVDE+V+WLH+D+AGPV+ ++KK ATG+G+ST+VEWVL++
Sbjct  531  QFVDEKVQWLHLDVAGPVWSDEKKNATGYGVSTLVEWVLRN  571



>gb|AAC49457.1| leucine aminopeptidase, partial [Solanum lycopersicum]
Length=566

 Score = 69.3 bits (168),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKH  685
            QFVDE+V+WLH+D+AGPV+ ++KK ATG+G+ST+VEWVL++
Sbjct  526  QFVDEKVQWLHLDVAGPVWSDEKKNATGYGVSTLVEWVLRN  566



>emb|CAA69614.1| lap17.1a [Solanum lycopersicum]
Length=571

 Score = 69.3 bits (168),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKH  685
            QFVDE+V+WLH+D+AGPV+ ++KK ATG+G+ST+VEWVL++
Sbjct  531  QFVDEKVQWLHLDVAGPVWSDEKKNATGYGVSTLVEWVLRN  571



>ref|XP_008352214.1| PREDICTED: LOW QUALITY PROTEIN: leucine aminopeptidase 1-like 
[Malus domestica]
Length=439

 Score = 69.3 bits (168),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV+E+V+WLHID+AGPV+ +KK+ ATG G+ST+VEWV  +SS
Sbjct  397  QFVBEKVQWLHIDMAGPVWSDKKRTATGXGVSTLVEWVQNNSS  439



>emb|CDX76828.1| BnaC08g34140D [Brassica napus]
Length=519

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E+V+W+HID+AGPV++EKKK  TGFG++T+VEWV  +SS
Sbjct  476  QFVSEKVQWMHIDMAGPVWNEKKKSGTGFGVATLVEWVQTNSS  518



>ref|XP_009117239.1| PREDICTED: leucine aminopeptidase 1 [Brassica rapa]
Length=515

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E+V+W+HID+AGPV++EKKK  TGFG++T+VEWV  +SS
Sbjct  472  QFVSEKVQWMHIDMAGPVWNEKKKSGTGFGVATLVEWVQTNSS  514



>ref|XP_006404921.1| hypothetical protein EUTSA_v10000127mg [Eutrema salsugineum]
 dbj|BAJ33647.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46374.1| hypothetical protein EUTSA_v10000127mg [Eutrema salsugineum]
Length=520

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E+V+W+HID+AGPV++EKKK  TGFG++T+VEWV  +SS
Sbjct  477  QFVSEKVQWMHIDMAGPVWNEKKKSGTGFGVATLVEWVQTNSS  519



>emb|CDY34790.1| BnaA09g41570D [Brassica napus]
Length=515

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E+V+W+HID+AGPV++EKKK  TGFG++T+VEWV  +SS
Sbjct  472  QFVSEKVQWMHIDMAGPVWNEKKKSGTGFGVATLVEWVQTNSS  514



>ref|XP_009140523.1| PREDICTED: leucine aminopeptidase 1 [Brassica rapa]
Length=521

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E+V+W+HID+AGPV++EKKK  TGFG++T+VEWV  +SS
Sbjct  478  QFVSEKVQWMHIDMAGPVWNEKKKSGTGFGVATLVEWVQTNSS  520



>emb|CDY39696.1| BnaA04g14130D [Brassica napus]
Length=522

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E+V+W+HID+AGPV++EKKK  TGFG++T+VEWV  +SS
Sbjct  479  QFVSEKVQWMHIDMAGPVWNEKKKSGTGFGVATLVEWVQTNSS  521



>ref|XP_008337029.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Malus 
domestica]
Length=378

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 44/58 (76%), Gaps = 3/58 (5%)
 Frame = +2

Query  527  GNKNLRFLTIVL---QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            G +    +T+ L   QF+DE+V+WLHID+AGPV+ +KK+ ATGF +ST+VEWV  +SS
Sbjct  321  GARQGGSITVALFLKQFIDEKVQWLHIDMAGPVWSDKKRTATGFVVSTLVEWVQNNSS  378



>gb|KFK32675.1| hypothetical protein AALP_AA6G274200 [Arabis alpina]
Length=523

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFV E+V+W+HID+AGPV+++KKK  TGFG++T+VEWV  +SS
Sbjct  480  QFVSEKVQWMHIDMAGPVWNDKKKSGTGFGVATLVEWVQTNSS  522



>ref|NP_194820.1| cytosol aminopeptidase family protein [Arabidopsis thaliana]
 sp|Q8RX72.1|AMPL2_ARATH RecName: Full=Leucine aminopeptidase 2, chloroplastic; AltName: 
Full=Leucyl aminopeptidase 2; Short=LAP 2; AltName: Full=Proline 
aminopeptidase 2; AltName: Full=Prolyl aminopeptidase 
2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL91252.1| AT4g30910/F6I18_180 [Arabidopsis thaliana]
 gb|AAM78047.1| AT4g30910/F6I18_180 [Arabidopsis thaliana]
 gb|AEE85829.1| cytosol aminopeptidase family protein [Arabidopsis thaliana]
Length=581

 Score = 66.6 bits (161),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            +FV E VEWLHID+AG V++EKKK ATGFG++T+VEWV  +SS
Sbjct  539  RFVSENVEWLHIDMAGRVWNEKKKAATGFGVATLVEWVQNNSS  581



>emb|CAA18202.1| leucyl aminopeptidase-like protein (partial) [Arabidopsis thaliana]
 emb|CAB79809.1| leucyl aminopeptidase-like protein (partial) [Arabidopsis thaliana]
Length=505

 Score = 66.6 bits (161),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            +FV E VEWLHID+AG V++EKKK ATGFG++T+VEWV  +SS
Sbjct  463  RFVSENVEWLHIDMAGRVWNEKKKAATGFGVATLVEWVQNNSS  505



>gb|AFW71516.1| hypothetical protein ZEAMMB73_883672 [Zea mays]
Length=321

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
             FVD++V+W+HIDIAG V+  KK+  TGFG++T+VEWVL +SS
Sbjct  278  HFVDDKVQWMHIDIAGTVWSNKKRAGTGFGVTTLVEWVLSNSS  320



>ref|XP_002453876.1| hypothetical protein SORBIDRAFT_04g020460 [Sorghum bicolor]
 gb|EES06852.1| hypothetical protein SORBIDRAFT_04g020460 [Sorghum bicolor]
Length=537

 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  566  FVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            FVDE+V+W+HID+AG V+  KK+  TGFG++T+VEWVL +SS
Sbjct  495  FVDEKVQWMHIDMAGTVWSNKKRAGTGFGVTTLVEWVLNNSS  536



>gb|AFW71513.1| hypothetical protein ZEAMMB73_883672 [Zea mays]
Length=538

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  566  FVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            FVD++V+W+HIDIAG V+  KK+  TGFG++T+VEWVL +SS
Sbjct  496  FVDDKVQWMHIDIAGTVWSNKKRAGTGFGVTTLVEWVLSNSS  537



>ref|XP_008645704.1| PREDICTED: LOW QUALITY PROTEIN: leucine aminopeptidase 2, chloroplastic-like 
[Zea mays]
Length=559

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  566  FVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            FVD++V+W+HIDIAG V+  KK+  TGFG++T+VEWVL +SS
Sbjct  517  FVDDKVQWMHIDIAGTVWSNKKRAGTGFGVTTLVEWVLSNSS  558



>emb|CEF97939.1| Leucine aminopeptidase/peptidase B [Ostreococcus tauri]
Length=506

 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  527  GNKNLRFLTIVLQFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHS  688
            G  ++     + QFVDE VEW H+D+AGPV+++KK  ATG+G +T  EWV  H 
Sbjct  452  GGGSITAALFLKQFVDESVEWSHVDLAGPVWNDKKGGATGYGAATFAEWVASHG  505



>ref|XP_008376006.1| PREDICTED: LOW QUALITY PROTEIN: leucine aminopeptidase 1-like 
[Malus domestica]
Length=426

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            QFVDE+V+ LHID+  PV+ +KK+ ATGFG+ST+VEWV  +SS
Sbjct  384  QFVDEKVQXLHIDMVEPVWSDKKRTATGFGVSTLVEWVQNNSS  426



>ref|XP_001417730.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO96023.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=445

 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  527  GNKNLRFLTIVLQFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWV  676
            G  ++     + QFVDE VEW H+D+AGPV+D+KK  ATG+G +    WV
Sbjct  396  GGGSITAALFLKQFVDESVEWSHVDLAGPVWDDKKGGATGYGAALFAAWV  445



>ref|XP_001758543.1| predicted protein [Physcomitrella patens]
 gb|EDQ76521.1| predicted protein [Physcomitrella patens]
Length=524

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKH  685
            QFVDE + W H+DIAGPV+ +K    TGF ++T+VEWV+KH
Sbjct  481  QFVDENIPWAHLDIAGPVWKDKTG-GTGFAVATLVEWVVKH  520



>gb|EWM21808.1| leucyl aminopeptidase [Nannochloropsis gaditana]
Length=600

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHS  688
            +FV +   W H+DIAGPV++ KK  ATGFG  T+ EWVL  +
Sbjct  557  EFVSKTTPWAHLDIAGPVWNPKKGGATGFGARTLAEWVLSQA  598



>ref|XP_001700276.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO98243.1| predicted protein [Chlamydomonas reinhardtii]
Length=439

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKKLATGFGISTMVEW  673
            QFV+E VEW H+D+AGPV+++K  L TG+G + + EW
Sbjct  391  QFVNEGVEWAHVDVAGPVWNDKLGLPTGYGAALLSEW  427



>ref|XP_005644543.1| hypothetical protein COCSUDRAFT_54513 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19999.1| hypothetical protein COCSUDRAFT_54513 [Coccomyxa subellipsoidea 
C-169]
Length=531

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = +2

Query  563  QFVD-EEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            +FVD ++VEW H+DIAGP +DEK   ATGFG  T+ +W     S
Sbjct  487  EFVDTDKVEWAHVDIAGPAWDEKAGGATGFGALTLAQWAAAQGS  530



>ref|XP_003057064.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58709.1| predicted protein [Micromonas pusilla CCMP1545]
Length=486

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = +2

Query  527  GNKNLRFLTIVLQFVD-EEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWV  676
            G  ++     + +FV+ E+ +W H+DIAGPV+D+KK  ATGFG +T+  W+
Sbjct  431  GGGSITAALFLRRFVESEDAKWAHLDIAGPVWDDKKGGATGFGAATLASWI  481



>gb|KFM27752.1| Leucine aminopeptidase 2, chloroplastic [Auxenochlorella protothecoides]
Length=263

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 1/44 (2%)
 Frame = +2

Query  563  QFVD-EEVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHSS  691
            +FVD E V W+H+D A PVF +K   ATGFG  T+ +WVL  + 
Sbjct  217  EFVDTERVAWVHLDAAAPVFSDKDGSATGFGAQTLAQWVLGEAG  260



>ref|XP_005851577.1| hypothetical protein CHLNCDRAFT_33905 [Chlorella variabilis]
 gb|EFN59475.1| hypothetical protein CHLNCDRAFT_33905 [Chlorella variabilis]
Length=339

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 1/43 (2%)
 Frame = +2

Query  563  QFVDE-EVEWLHIDIAGPVFDEKKKLATGFGISTMVEWVLKHS  688
            +FVD  +V+W H+DIAGPV+ EK+  ATGFG  T+ EW     
Sbjct  296  EFVDTGKVQWCHLDIAGPVWQEKQGGATGFGAQTLAEWAAAQG  338



>ref|WP_038553352.1| aminopeptidase A [Synechococcus sp. KORDI-52]
 gb|AII48602.1| aminopeptidase A [Synechococcus sp. KORDI-52]
Length=491

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 5/47 (11%)
 Frame = +2

Query  563  QFVDEEVEWLHIDIAGPVFDEKKK-----LATGFGISTMVEWVLKHS  688
            +FV ++  W HIDIAGPV+ +K K      ATG+G+ T+V WVL  S
Sbjct  445  EFVAQDTAWAHIDIAGPVWSDKGKGVNPAGATGYGVRTLVNWVLAQS  491



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1948488333440