BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25548_g1_i6 len=1723 path=[9219:0-336 16403:337-344 16411:345-345
9564:346-382 6296:383-431 9649:432-464 16027:465-498 15842:499-555
9773:556-569 9787:570-593 14429:594-617 16529:618-678 16575:679-700
9915:701-714 5869:715-762 9975:763-764 6924:765-777 5702:778-837
4972:838-876 10086:877-905 10114:906-908 10117:909-940 16688:941-941
10148:942-953 6733:954-1040 3587:1041-1062 3609:1063-1136
3892:1137-1287 3834:1288-1311 4066:1312-1396 4151:1397-1431
4186:1432-1447 16954:1448-1456 13268:1457-1536 6226:1537-1722]

Length=1723
                                                                      Score     E

ref|XP_009795110.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    697   0.0      
ref|XP_011079411.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    697   0.0      
ref|XP_009614630.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    695   0.0      
emb|CDP10235.1|  unnamed protein product                                693   0.0      
gb|AGW47884.1|  leucine aminopeptidase                                  691   0.0      
ref|XP_011083971.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    681   0.0      
emb|CDP16585.1|  unnamed protein product                                676   0.0      
ref|XP_010103674.1|  Leucine aminopeptidase 3                           674   0.0      
gb|EYU34348.1|  hypothetical protein MIMGU_mgv1a003554mg                672   0.0      
emb|CBI36527.3|  unnamed protein product                                667   0.0      
ref|XP_002276114.1|  PREDICTED: leucine aminopeptidase 1                669   0.0      Vitis vinifera
emb|CAN66364.1|  hypothetical protein VITISV_029979                     666   0.0      Vitis vinifera
ref|XP_006350101.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    664   0.0      
ref|XP_010265583.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    662   0.0      
gb|KHG14578.1|  hypothetical protein F383_10344                         661   0.0      
gb|AAO15916.1|  neutral leucine aminopeptidase preprotein               662   0.0      Solanum lycopersicum
gb|EYU35326.1|  hypothetical protein MIMGU_mgv1a003455mg                660   0.0      
ref|NP_001233884.1|  leucine aminopeptidase 2, chloroplastic            658   0.0      
ref|XP_006600543.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    656   0.0      
ref|XP_011018033.1|  PREDICTED: leucine aminopeptidase 1-like           655   0.0      
ref|XP_010275823.1|  PREDICTED: leucine aminopeptidase 1-like           655   0.0      
ref|XP_002529380.1|  leucine aminopeptidase, putative                   655   0.0      Ricinus communis
ref|XP_006453614.1|  hypothetical protein CICLE_v10007834mg             655   0.0      
ref|XP_003518220.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    654   0.0      
gb|KHG23887.1|  hypothetical protein F383_01434                         655   0.0      
ref|XP_006474000.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    654   0.0      
ref|XP_010047106.1|  PREDICTED: leucine aminopeptidase 1-like           653   0.0      
gb|KDP38679.1|  hypothetical protein JCGZ_04032                         653   0.0      
ref|XP_004507738.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    652   0.0      
ref|XP_007154883.1|  hypothetical protein PHAVU_003G156100g             652   0.0      
gb|KFK29676.1|  hypothetical protein AALP_AA7G164200                    652   0.0      
ref|XP_002325134.2|  leucine aminopeptidase family protein              652   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002867321.1|  cytosol aminopeptidase family protein              649   0.0      
ref|XP_010525807.1|  PREDICTED: leucine aminopeptidase 1                648   0.0      
ref|XP_007011931.1|  Cytosol aminopeptidase family protein              647   0.0      
ref|XP_011033404.1|  PREDICTED: leucine aminopeptidase 1                645   0.0      
ref|NP_194821.1|  leucine aminopeptidase 2                              643   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009127424.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    642   0.0      
ref|XP_006412653.1|  hypothetical protein EUTSA_v10024754mg             642   0.0      
ref|XP_008367747.1|  PREDICTED: leucine aminopeptidase 1-like           641   0.0      
ref|XP_009358438.1|  PREDICTED: leucine aminopeptidase 1-like           641   0.0      
ref|XP_004287132.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    640   0.0      
gb|AAL11627.1|AF424634_1  AT4g30920/F6I18_170                           638   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008242990.1|  PREDICTED: leucine aminopeptidase 1                637   0.0      
ref|XP_010432926.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    637   0.0      
emb|CDX68703.1|  BnaC01g07500D                                          637   0.0      
ref|XP_007204206.1|  hypothetical protein PRUPE_ppa003434mg             637   0.0      
ref|XP_010438109.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    637   0.0      
ref|XP_010929163.1|  PREDICTED: leucine aminopeptidase 1-like           637   0.0      
ref|XP_007138276.1|  hypothetical protein PHAVU_009G195000g             635   0.0      
gb|KHG12351.1|  Leucine aminopeptidase 1 -like protein                  632   0.0      
ref|XP_004144730.1|  PREDICTED: leucine aminopeptidase 1-like           634   0.0      
ref|XP_008384407.1|  PREDICTED: leucine aminopeptidase 1-like           632   0.0      
ref|XP_009415506.1|  PREDICTED: leucine aminopeptidase 1-like           632   0.0      
ref|XP_003610319.1|  Leucine aminopeptidase                             630   0.0      
ref|XP_002867322.1|  predicted protein                                  630   0.0      
emb|CAA48038.1|  leucine aminopeptidase                                 629   0.0      Solanum tuberosum [potatoes]
ref|XP_010687715.1|  PREDICTED: leucine aminopeptidase 1-like           630   0.0      
sp|P31427.2|AMPL_SOLTU  RecName: Full=Leucine aminopeptidase, chl...    629   0.0      Solanum tuberosum [potatoes]
ref|XP_008794352.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    630   0.0      
ref|XP_010526298.1|  PREDICTED: leucine aminopeptidase 1-like           630   0.0      
ref|XP_008452840.1|  PREDICTED: leucine aminopeptidase 1-like           630   0.0      
ref|XP_010942088.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    627   0.0      
ref|XP_009366178.1|  PREDICTED: leucine aminopeptidase 1-like           628   0.0      
ref|XP_006404921.1|  hypothetical protein EUTSA_v10000127mg             625   0.0      
ref|XP_002880560.1|  cytosol aminopeptidase                             625   0.0      
emb|CAA18201.1|  leucyl aminopeptidase-like protein                     625   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EPS65095.1|  hypothetical protein M569_09684                         626   0.0      
ref|NP_179997.1|  aminopeptidase family protein                         622   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008803712.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    622   0.0      
ref|NP_194820.1|  cytosol aminopeptidase family protein                 620   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447643.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    620   0.0      
ref|XP_006293400.1|  hypothetical protein CARUB_v10024476mg             615   0.0      
gb|KFK32675.1|  hypothetical protein AALP_AA6G274200                    615   0.0      
ref|XP_006857233.1|  hypothetical protein AMTR_s00065p00209640          613   0.0      
emb|CDY20284.1|  BnaC04g36720D                                          612   0.0      
ref|XP_009410189.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    612   0.0      
emb|CDX76828.1|  BnaC08g34140D                                          611   0.0      
ref|XP_003553879.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    613   0.0      
ref|XP_009140523.1|  PREDICTED: leucine aminopeptidase 1                610   0.0      
ref|XP_004514667.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    610   0.0      
ref|XP_002454700.1|  hypothetical protein SORBIDRAFT_04g035840          610   0.0      Sorghum bicolor [broomcorn]
gb|AFW73857.1|  hypothetical protein ZEAMMB73_599286                    609   0.0      
ref|XP_004954213.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    608   0.0      
ref|XP_010429381.1|  PREDICTED: leucine aminopeptidase 1                605   0.0      
sp|Q6K669.1|AMPL2_ORYSJ  RecName: Full=Leucine aminopeptidase 2, ...    607   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CDY39696.1|  BnaA04g14130D                                          602   0.0      
emb|CDY34790.1|  BnaA09g41570D                                          600   0.0      
ref|XP_010472421.1|  PREDICTED: leucine aminopeptidase 1-like           600   0.0      
ref|XP_009117239.1|  PREDICTED: leucine aminopeptidase 1                599   0.0      
gb|KHN42824.1|  Leucine aminopeptidase 3, chloroplastic                 597   0.0      
ref|NP_001233862.1|  leucine aminopeptidase 1, chloroplastic            597   0.0      
ref|XP_004954212.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    598   0.0      
gb|AAC49457.1|  leucine aminopeptidase                                  595   0.0      Solanum lycopersicum
emb|CAA18202.1|  leucyl aminopeptidase-like protein (partial)           593   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006350102.1|  PREDICTED: leucine aminopeptidase, chloropla...    595   0.0      
pdb|4KSI|A  Chain A, Crystal Structure Analysis Of The Acidic Leu...    593   0.0      
ref|XP_010234597.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    593   0.0      
gb|AAA80498.1|  leucine aminopeptidase                                  593   0.0      Solanum lycopersicum
gb|KHN17492.1|  Leucine aminopeptidase 3, chloroplastic                 593   0.0      
gb|EMS53149.1|  Leucine aminopeptidase 2, chloroplastic                 593   0.0      
dbj|BAK00954.1|  predicted protein                                      588   0.0      
dbj|BAJ92683.1|  predicted protein                                      587   0.0      
ref|XP_006649129.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    587   0.0      
ref|XP_002308402.1|  leucine aminopeptidase family protein              579   0.0      Populus trichocarpa [western balsam poplar]
gb|KGN61047.1|  hypothetical protein Csa_2G035470                       578   0.0      
gb|ABK24447.1|  unknown                                                 577   0.0      Picea sitchensis
ref|XP_004144796.1|  PREDICTED: leucine aminopeptidase 1-like           573   0.0      
emb|CAA69614.1|  lap17.1a                                               574   0.0      Solanum lycopersicum
ref|XP_004253490.2|  PREDICTED: leucine aminopeptidase 1, chlorop...    569   0.0      
ref|XP_008643980.1|  PREDICTED: uncharacterized protein LOC100381...    608   0.0      
ref|XP_010236855.1|  PREDICTED: formin-like protein 7                   602   0.0      
dbj|BAJ85842.1|  predicted protein                                      559   0.0      
ref|XP_006283623.1|  hypothetical protein CARUB_v10004680mg             556   0.0      
ref|NP_001189587.1|  aminopeptidase family protein                      554   0.0      
ref|XP_008803713.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    534   0.0      
pir||A48788  leucyl aminopeptidase (EC 3.4.11.1) DR57 - tomato          535   0.0   
ref|XP_004158743.1|  PREDICTED: leucine aminopeptidase 1-like           536   0.0      
gb|EAY82956.1|  hypothetical protein OsI_38175                          532   2e-180   Oryza sativa Indica Group [Indian rice]
gb|EEE53139.1|  hypothetical protein OsJ_35947                          528   2e-178   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002965045.1|  hypothetical protein SELMODRAFT_167050             525   3e-177   
ref|XP_002962141.1|  hypothetical protein SELMODRAFT_140664             523   1e-176   
ref|NP_001066684.1|  Os12g0434400                                       519   3e-175   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002453876.1|  hypothetical protein SORBIDRAFT_04g020460          519   4e-175   Sorghum bicolor [broomcorn]
gb|EMT02487.1|  Formin-like protein 7                                   550   7e-174   
dbj|BAH57215.1|  AT4G30910                                              500   8e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006664532.1|  PREDICTED: putative leucine aminopeptidase 1...    493   1e-164   
gb|AFW73856.1|  hypothetical protein ZEAMMB73_599286                    490   1e-164   
gb|AFW71513.1|  hypothetical protein ZEAMMB73_883672                    487   1e-162   
gb|KGN61046.1|  hypothetical protein Csa_2G035460                       474   2e-158   
gb|EMT23101.1|  Leucine aminopeptidase 2, chloroplastic                 474   6e-158   
ref|XP_008352214.1|  PREDICTED: LOW QUALITY PROTEIN: leucine amin...    471   1e-157   
ref|XP_008645704.1|  PREDICTED: LOW QUALITY PROTEIN: leucine amin...    474   2e-157   
ref|XP_008785917.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    467   4e-157   
gb|AFK42034.1|  unknown                                                 460   4e-154   
gb|ACJ85545.1|  unknown                                                 459   5e-154   Medicago truncatula
ref|XP_008376006.1|  PREDICTED: LOW QUALITY PROTEIN: leucine amin...    457   2e-152   
ref|XP_001758543.1|  predicted protein                                  456   1e-150   
gb|ABY84519.1|  leucine aminopeptidase                                  429   2e-143   Solanum nigrum
ref|XP_001783885.1|  predicted protein                                  429   4e-140   
ref|XP_008666283.1|  PREDICTED: LOW QUALITY PROTEIN: leucine amin...    421   9e-139   
ref|NP_001048379.1|  Os02g0794700                                       406   2e-134   Oryza sativa Japonica Group [Japonica rice]
emb|CAA68143.1|  cytosol aminopeptidase                                 381   6e-125   Petroselinum crispum
ref|XP_008666459.1|  PREDICTED: LOW QUALITY PROTEIN: leucine amin...    387   1e-121   
tpg|DAA39426.1|  TPA: hypothetical protein ZEAMMB73_947180              374   2e-119   
gb|AFW68884.1|  hypothetical protein ZEAMMB73_253679                    380   2e-119   
gb|AFW81180.1|  hypothetical protein ZEAMMB73_308587                    375   3e-118   
gb|KHN18036.1|  Leucine aminopeptidase 1                                362   2e-116   
ref|XP_008358040.1|  PREDICTED: LOW QUALITY PROTEIN: leucine amin...    367   2e-115   
ref|WP_039713603.1|  aminopeptidase A                                   361   2e-114   
gb|EMS51906.1|  Leucine aminopeptidase 2, chloroplastic                 357   7e-114   
emb|CEF97939.1|  Leucine aminopeptidase/peptidase B                     360   1e-113   
ref|WP_035153350.1|  aminopeptidase A                                   358   2e-113   
ref|WP_019494406.1|  aminopeptidase A                                   357   5e-113   
gb|AFW71516.1|  hypothetical protein ZEAMMB73_883672                    351   1e-112   
ref|WP_027842357.1|  aminopeptidase A                                   356   1e-112   
ref|WP_013191100.1|  aminopeptidase A                                   356   3e-112   
ref|WP_015217123.1|  cytosol aminopeptidase                             355   6e-112   
ref|WP_037216500.1|  hypothetical protein                               354   1e-111   
ref|WP_017315758.1|  aminopeptidase A                                   354   1e-111   
ref|WP_015156822.1|  leucyl aminopeptidase                              353   2e-111   
ref|WP_002766908.1|  aminopeptidase A                                   352   5e-111   
ref|WP_008318986.1|  leucyl aminopeptidase                              352   9e-111   
ref|WP_015185013.1|  leucyl aminopeptidase                              351   2e-110   
ref|WP_017294075.1|  hypothetical protein                               351   2e-110   
ref|WP_026734312.1|  aminopeptidase A                                   350   3e-110   
ref|WP_018397622.1|  aminopeptidase A                                   350   4e-110   
ref|WP_002782251.1|  putative cytosol aminopeptidase                    350   5e-110   
ref|WP_035993085.1|  aminopeptidase A                                   350   5e-110   
ref|WP_029634482.1|  aminopeptidase A [                                 350   6e-110   
ref|WP_009545951.1|  MULTISPECIES: aminopeptidase A                     350   6e-110   
ref|WP_008207180.1|  aminopeptidase A                                   350   7e-110   
ref|WP_016874221.1|  aminopeptidase A                                   349   7e-110   
ref|WP_012268315.1|  aminopeptidase A                                   349   7e-110   
ref|WP_002773226.1|  aminopeptidase A                                   349   9e-110   
ref|XP_008337029.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    345   1e-109   
ref|WP_016515741.1|  Cytosol aminopeptidase                             349   1e-109   
ref|WP_013323896.1|  aminopeptidase A                                   348   2e-109   
dbj|GAL91486.1|  cytosol aminopeptidase PepA                            348   2e-109   
ref|WP_015165714.1|  cytosol aminopeptidase                             348   3e-109   
ref|WP_026722318.1|  aminopeptidase A                                   348   3e-109   
ref|WP_039726207.1|  aminopeptidase A                                   348   4e-109   
ref|WP_024545494.1|  aminopeptidase A                                   347   4e-109   
ref|WP_017742946.1|  aminopeptidase A                                   347   5e-109   
ref|WP_002785587.1|  aminopeptidase A                                   347   5e-109   
ref|WP_002744501.1|  leucine aminopeptidase 1                           347   5e-109   
ref|WP_038084500.1|  aminopeptidase A                                   347   5e-109   
ref|WP_024970899.1|  aminopeptidase A                                   347   7e-109   
ref|WP_002735635.1|  leucine aminopeptidase 1                           347   8e-109   
ref|WP_002797316.1|  aminopeptidase A                                   347   1e-108   
ref|WP_008275582.1|  aminopeptidase A                                   346   2e-108   
ref|WP_002790963.1|  aminopeptidase A                                   346   2e-108   
ref|WP_002751572.1|  aminopeptidase A                                   346   2e-108   
ref|WP_015191783.1|  cytosol aminopeptidase                             345   2e-108   
ref|WP_010469501.1|  aminopeptidase A                                   345   4e-108   
ref|WP_009342536.1|  aminopeptidase A                                   345   5e-108   
gb|KEH38071.1|  cytosol aminopeptidase family protein                   340   7e-108   
ref|WP_028083384.1|  aminopeptidase A                                   344   7e-108   
ref|WP_012629140.1|  aminopeptidase A                                   344   1e-107   
ref|WP_002801043.1|  aminopeptidase A                                   343   1e-107   
ref|WP_009556547.1|  leucyl aminopeptidase                              343   2e-107   
ref|WP_015211045.1|  leucyl aminopeptidase                              343   2e-107   
ref|XP_005644543.1|  hypothetical protein COCSUDRAFT_54513              344   2e-107   
ref|WP_015124149.1|  leucyl aminopeptidase                              343   2e-107   
ref|WP_006277890.1|  aminopeptidase A                                   343   3e-107   
ref|WP_007311314.1|  aminopeptidase A                                   342   3e-107   
ref|WP_012406927.1|  aminopeptidase A                                   342   4e-107   
dbj|BAP18524.1|  leucyl aminopeptidase                                  342   4e-107   
ref|WP_009631961.1|  leucyl aminopeptidase                              342   4e-107   
ref|WP_016949514.1|  aminopeptidase A                                   342   4e-107   
ref|WP_002757690.1|  aminopeptidase A                                   342   4e-107   
ref|WP_015784948.1|  aminopeptidase A                                   342   8e-107   
ref|WP_021830390.1|  Cytosol aminopeptidase PepA                        342   8e-107   
ref|WP_012163418.1|  aminopeptidase A                                   341   1e-106   
ref|WP_011431320.1|  aminopeptidase A                                   342   1e-106   
ref|NP_001168170.1|  uncharacterized protein LOC100381923               333   1e-106   Zea mays [maize]
ref|WP_026099711.1|  aminopeptidase A                                   341   2e-106   
ref|WP_006515687.1|  leucyl aminopeptidase                              341   2e-106   
ref|WP_017321976.1|  aminopeptidase A                                   341   2e-106   
ref|WP_012597067.1|  aminopeptidase A                                   341   2e-106   
ref|WP_017658914.1|  hypothetical protein                               340   2e-106   
ref|WP_030006934.1|  aminopeptidase A                                   340   2e-106   
ref|XP_002502369.1|  predicted protein                                  345   2e-106   Micromonas commoda
ref|XP_002953843.1|  hypothetical protein VOLCADRAFT_106122             344   3e-106   
ref|WP_012308056.1|  aminopeptidase A                                   340   3e-106   
ref|XP_008669992.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    333   4e-106   
ref|WP_028091351.1|  aminopeptidase A                                   340   5e-106   
ref|WP_019502106.1|  hypothetical protein                               341   5e-106   
ref|WP_017312999.1|  aminopeptidase A                                   339   6e-106   
ref|WP_039199262.1|  aminopeptidase A                                   339   7e-106   
ref|WP_010994414.1|  aminopeptidase A                                   339   9e-106   
ref|WP_039743238.1|  aminopeptidase A                                   338   1e-105   
ref|WP_036484522.1|  aminopeptidase A                                   338   1e-105   
ref|WP_007306122.1|  aminopeptidase A                                   338   1e-105   
ref|WP_015187371.1|  leucyl aminopeptidase                              338   1e-105   
ref|WP_026085699.1|  aminopeptidase A                                   338   1e-105   
ref|WP_009784389.1|  aminopeptidase A                                   338   2e-105   
ref|WP_006100918.1|  aminopeptidase A                                   338   2e-105   
ref|WP_015230084.1|  leucyl aminopeptidase                              338   2e-105   
ref|WP_008226312.1|  Cytosol aminopeptidase PepA                        338   2e-105   
ref|WP_009457386.1|  MULTISPECIES: aminopeptidase A                     338   2e-105   
ref|WP_011319481.1|  aminopeptidase A                                   337   4e-105   
ref|WP_017656226.1|  aminopeptidase A                                   337   7e-105   
ref|WP_010872664.1|  aminopeptidase A                                   337   7e-105   
ref|WP_006197752.1|  aminopeptidase A                                   336   9e-105   
ref|WP_016859555.1|  aminopeptidase A                                   336   1e-104   
ref|WP_015142479.1|  leucyl aminopeptidase                              335   2e-104   
ref|WP_012599158.1|  aminopeptidase A                                   335   2e-104   
ref|WP_015129473.1|  leucyl aminopeptidase                              335   3e-104   
ref|WP_015175730.1|  leucyl aminopeptidase                              334   5e-104   
ref|WP_019508312.1|  aminopeptidase A                                   334   8e-104   
ref|WP_023064677.1|  leucine aminopeptidase 1                           333   9e-104   
ref|WP_006456950.1|  aminopeptidase A                                   333   1e-103   
ref|WP_014407105.1|  aminopeptidase A                                   333   1e-103   
ref|WP_011609979.1|  aminopeptidase A                                   333   1e-103   
ref|WP_015219428.1|  leucyl aminopeptidase                              333   2e-103   
ref|WP_015198995.1|  leucyl aminopeptidase                              333   2e-103   
ref|WP_015224615.1|  leucyl aminopeptidase                              333   2e-103   
ref|WP_017297744.1|  hypothetical protein                               333   2e-103   
ref|WP_024124791.1|  cytosol aminopeptidase PepA                        332   3e-103   
ref|WP_008189563.1|  aminopeptidase A                                   332   3e-103   
ref|WP_027402251.1|  aminopeptidase A                                   332   5e-103   
gb|AIE73879.1|  Cytosol aminopeptidase PepA                             332   6e-103   
ref|WP_017306913.1|  hypothetical protein                               332   6e-103   
ref|WP_015112611.1|  leucyl aminopeptidase                              332   6e-103   
ref|WP_006631185.1|  aminopeptidase A                                   331   8e-103   
ref|WP_008049396.1|  aminopeptidase A                                   330   2e-102   
ref|XP_008452859.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    323   2e-102   
ref|XP_001417730.1|  predicted protein                                  328   3e-102   Ostreococcus lucimarinus CCE9901
ref|WP_015116302.1|  leucyl aminopeptidase                              330   3e-102   
ref|WP_006618432.1|  MULTISPECIES: aminopeptidase A                     330   3e-102   
ref|WP_011057582.1|  aminopeptidase A                                   330   3e-102   
ref|WP_009625931.1|  cytosol aminopeptidase                             330   3e-102   
ref|WP_023073841.1|  leucyl aminopeptidase                              328   9e-102   
ref|WP_015170769.1|  leucyl aminopeptidase                              328   1e-101   
ref|WP_011242673.1|  aminopeptidase A                                   328   1e-101   
ref|WP_017718624.1|  aminopeptidase A                                   328   1e-101   
ref|WP_011377907.1|  aminopeptidase A                                   327   3e-101   
gb|AAM82713.1|  AmpA                                                    327   3e-101   Synechococcus elongatus PCC 7942
ref|WP_015078290.1|  leucyl aminopeptidase                              327   5e-101   
ref|WP_015150368.1|  leucyl aminopeptidase                              326   9e-101   
gb|KEI67077.1|  Lap                                                     326   1e-100   
ref|WP_022604190.1|  leucyl aminopeptidase                              326   1e-100   
ref|WP_015205007.1|  cytosol aminopeptidase                             325   1e-100   
ref|WP_015139669.1|  leucyl aminopeptidase                              325   1e-100   
ref|WP_006529488.1|  leucyl aminopeptidase                              325   3e-100   
ref|WP_012954454.1|  aminopeptidase A                                   325   3e-100   
ref|WP_014274880.1|  leucine aminopeptidase                             323   6e-100   
ref|XP_003057064.1|  predicted protein                                  323   6e-100   
ref|WP_015223330.1|  leucyl aminopeptidase                              323   1e-99    
ref|WP_036000285.1|  aminopeptidase A                                   323   1e-99    
ref|WP_036534560.1|  aminopeptidase A                                   322   2e-99    
ref|WP_026785238.1|  MULTISPECIES: aminopeptidase A                     322   2e-99    
ref|WP_026796047.1|  MULTISPECIES: aminopeptidase A                     322   3e-99    
ref|WP_007356241.1|  MULTISPECIES: aminopeptidase A                     320   1e-98    
ref|WP_008233179.1|  Cytosol aminopeptidase PepA                        315   3e-98    
ref|WP_011433415.1|  aminopeptidase A                                   320   3e-98    
ref|WP_015167157.1|  leucyl aminopeptidase                              318   1e-97    
ref|WP_015133232.1|  leucyl aminopeptidase                              318   1e-97    
ref|WP_006509758.1|  leucyl aminopeptidase                              317   3e-97    
emb|CDY22921.1|  BnaA01g18590D                                          314   3e-97    
ref|WP_036918509.1|  MULTISPECIES: aminopeptidase A                     312   1e-95    
ref|WP_019478589.1|  hypothetical protein                               312   1e-95    
ref|WP_015160652.1|  leucyl aminopeptidase                              312   2e-95    
ref|WP_017289341.1|  hypothetical protein                               307   3e-95    
ref|WP_036922865.1|  aminopeptidase A                                   308   5e-94    
ref|WP_023174736.1|  leucyl aminopeptidase                              308   8e-94    
ref|WP_011125564.1|  MULTISPECIES: aminopeptidase A                     307   1e-93    
ref|WP_012195938.1|  aminopeptidase A                                   306   3e-93    
gb|KFF41622.1|  leucyl aminopeptidase                                   305   8e-93    
ref|XP_005704316.1|  leucyl aminopeptidase                              308   1e-92    
ref|WP_036905385.1|  aminopeptidase A                                   304   2e-92    
ref|WP_036899396.1|  aminopeptidase A                                   302   1e-91    
emb|CDX99645.1|  BnaC04g34020D                                          298   2e-91    
ref|WP_011824311.1|  aminopeptidase A                                   300   5e-91    
ref|XP_001700276.1|  predicted protein                                  298   1e-90    
ref|WP_019474761.1|  hypothetical protein                               299   2e-90    
ref|XP_005835498.1|  hypothetical protein GUITHDRAFT_68651              299   2e-90    
ref|WP_011295251.1|  aminopeptidase A                                   299   2e-90    
ref|WP_029626158.1|  aminopeptidase A                                   297   1e-89    
ref|WP_011142605.1|  aminopeptidase A                                   297   2e-89    
ref|XP_005851577.1|  hypothetical protein CHLNCDRAFT_33905              291   3e-89    
ref|WP_038653959.1|  aminopeptidase A                                   294   2e-88    
ref|YP_002049337.1|  leucyl aminopeptidase                              293   3e-88    
ref|WP_011365056.1|  aminopeptidase A                                   291   1e-87    
ref|XP_005713971.1|  unnamed protein product                            293   2e-87    
ref|WP_036902267.1|  aminopeptidase A                                   291   3e-87    
ref|WP_006171905.1|  aminopeptidase A                                   290   7e-87    
gb|EWM21808.1|  leucyl aminopeptidase                                   292   1e-86    
emb|CBJ32669.1|  Leucyl aminopeptidase                                  289   3e-86    
ref|WP_011359376.1|  aminopeptidase A                                   286   9e-86    
gb|AHF64524.1|  Leucyl aminopeptidase                                   285   5e-85    
ref|WP_006043376.1|  aminopeptidase A                                   285   5e-85    
ref|WP_011936225.1|  aminopeptidase A                                   285   6e-85    
ref|WP_014934890.1|  cytosol aminopeptidase                             286   7e-85    
gb|AIQ95644.1|  Cytosol aminopeptidase PepA                             284   1e-84    
ref|WP_025930781.1|  aminopeptidase A                                   284   1e-84    
ref|WP_009790419.1|  aminopeptidase A                                   283   1e-84    
ref|WP_032518210.1|  aminopeptidase A                                   283   1e-84    
ref|WP_025956070.1|  aminopeptidase A                                   283   2e-84    
ref|WP_025968245.1|  aminopeptidase A                                   283   2e-84    
ref|WP_015110622.1|  leucyl aminopeptidase                              283   2e-84    
ref|WP_011933847.1|  aminopeptidase A                                   283   2e-84    
ref|WP_007101703.1|  aminopeptidase A                                   283   2e-84    
ref|WP_038553352.1|  aminopeptidase A                                   283   3e-84    
ref|WP_034577096.1|  aminopeptidase A                                   282   6e-84    
tpg|DAA46938.1|  TPA: hypothetical protein ZEAMMB73_710024              283   1e-83    
emb|CDG49727.1|  Cytosol aminopeptidase PepA                            281   1e-83    
ref|WP_038548803.1|  aminopeptidase A                                   281   2e-83    
gb|AII44295.1|  aminopeptidase A                                        281   2e-83    
tpg|DAA46815.1|  TPA: hypothetical protein ZEAMMB73_269181              288   2e-83    
ref|WP_011620118.1|  aminopeptidase A                                   280   2e-83    
ref|WP_025954832.1|  aminopeptidase A                                   276   3e-83    
ref|WP_032516355.1|  aminopeptidase A                                   280   4e-83    
gb|EMT22172.1|  Leucine aminopeptidase 2, chloroplastic                 274   5e-83    
ref|WP_025932571.1|  aminopeptidase A                                   278   6e-83    
ref|WP_025958530.1|  aminopeptidase A                                   278   7e-83    
ref|WP_025972451.1|  aminopeptidase A                                   278   1e-82    
ref|WP_025964955.1|  aminopeptidase A                                   278   1e-82    
ref|WP_032521644.1|  aminopeptidase A                                   278   2e-82    
ref|WP_006909891.1|  aminopeptidase A                                   279   2e-82    
ref|WP_025891152.1|  aminopeptidase A                                   278   2e-82    
ref|WP_025889091.1|  aminopeptidase A                                   278   2e-82    
ref|WP_028952702.1|  aminopeptidase A                                   278   2e-82    
ref|WP_025975565.1|  aminopeptidase A                                   278   2e-82    
ref|WP_025941989.1|  aminopeptidase A                                   278   2e-82    
ref|WP_025942522.1|  MULTISPECIES: aminopeptidase A                     278   2e-82    
ref|WP_025975117.1|  aminopeptidase A                                   278   2e-82    
ref|WP_025939710.1|  MULTISPECIES: aminopeptidase A                     278   2e-82    
ref|WP_025925549.1|  MULTISPECIES: aminopeptidase A                     278   2e-82    
ref|WP_025913781.1|  MULTISPECIES: aminopeptidase A                     278   3e-82    
ref|WP_025979040.1|  aminopeptidase A                                   277   3e-82    
ref|WP_025914978.1|  aminopeptidase A                                   277   3e-82    
ref|WP_007098769.1|  aminopeptidase A                                   277   4e-82    
ref|WP_025940881.1|  aminopeptidase A                                   277   4e-82    
ref|WP_025922544.1|  aminopeptidase A                                   277   4e-82    
ref|WP_025894914.1|  MULTISPECIES: aminopeptidase A                     277   4e-82    
ref|WP_025882168.1|  aminopeptidase A                                   277   4e-82    
ref|WP_025926895.1|  MULTISPECIES: aminopeptidase A                     277   4e-82    
ref|WP_025969440.1|  aminopeptidase A                                   277   4e-82    
ref|WP_006853576.1|  aminopeptidase A                                   277   5e-82    
ref|WP_025963896.1|  aminopeptidase A                                   277   5e-82    
ref|WP_025900801.1|  MULTISPECIES: aminopeptidase A                     276   6e-82    
ref|WP_025928767.1|  aminopeptidase A                                   276   6e-82    
ref|WP_025947520.1|  aminopeptidase A                                   276   7e-82    
ref|WP_025979981.1|  aminopeptidase A                                   276   7e-82    
ref|WP_025946302.1|  aminopeptidase A                                   276   7e-82    
ref|WP_025924801.1|  aminopeptidase A                                   276   7e-82    
gb|EJK58205.1|  hypothetical protein THAOC_21689                        276   7e-82    
ref|WP_011818947.1|  aminopeptidase A                                   276   9e-82    
gb|AII45991.1|  aminopeptidase A                                        276   1e-81    
ref|WP_032513136.1|  aminopeptidase A                                   276   1e-81    
ref|WP_025933908.1|  aminopeptidase A                                   276   1e-81    
ref|WP_025937528.1|  aminopeptidase A                                   275   3e-81    
ref|WP_025935378.1|  aminopeptidase A                                   275   3e-81    
ref|WP_011132966.1|  aminopeptidase A                                   274   5e-81    
ref|WP_011376974.1|  aminopeptidase A                                   274   7e-81    
ref|XP_002179008.1|  predicted protein                                  272   8e-81    
ref|WP_025965865.1|  aminopeptidase A                                   273   9e-81    
ref|WP_032524918.1|  aminopeptidase A                                   273   1e-80    
ref|WP_011820796.1|  aminopeptidase A                                   273   2e-80    
gb|KEH38070.1|  leucine aminopeptidase (cytosol aminopeptidase), ...    264   2e-80    
emb|CDJ68823.1|  cytosol aminopeptidase, putative                       273   3e-80    
emb|CDJ40179.1|  cytosol aminopeptidase, putative                       273   3e-80    
ref|WP_012008215.1|  aminopeptidase A                                   271   5e-80    
gb|ABE11401.1|  cytosol aminopeptidase                                  271   7e-80    
ref|WP_002805871.1|  aminopeptidase A                                   271   8e-80    
ref|WP_011863445.1|  aminopeptidase A                                   271   8e-80    
ref|WP_025957966.1|  aminopeptidase A                                   266   9e-80    
gb|ABE11299.1|  cytosol aminopeptidase                                  270   3e-79    
ref|WP_025923443.1|  aminopeptidase A                                   269   4e-79    
ref|WP_032520221.1|  aminopeptidase A                                   268   7e-79    
ref|WP_038026706.1|  aminopeptidase A                                   268   1e-78    
gb|AFW71514.1|  hypothetical protein ZEAMMB73_883672                    262   3e-78    
ref|WP_032527266.1|  aminopeptidase A                                   265   1e-77    
ref|WP_011127431.1|  aminopeptidase A                                   265   1e-77    
ref|WP_036914320.1|  MULTISPECIES: aminopeptidase A                     265   2e-77    
ref|WP_011825231.1|  aminopeptidase A                                   265   2e-77    
gb|KFM27751.1|  putative cytosol aminopeptidase                         263   4e-77    
ref|WP_011130775.1|  aminopeptidase A                                   262   2e-76    
ref|WP_025981063.1|  aminopeptidase A                                   256   4e-76    
ref|XP_002179007.1|  predicted protein                                  262   6e-76    
ref|XP_009038232.1|  hypothetical protein AURANDRAFT_28164              252   1e-74    
ref|XP_002368461.1|  cytosol aminopeptidase                             256   2e-73    
dbj|BAH84840.1|  leucine aminopeptidase                                 255   2e-73    
ref|WP_013703373.1|  leucyl aminopeptidase                              254   2e-73    
emb|CDO66926.1|  M17 leucyl aminopeptidase                              256   5e-73    
ref|XP_008889203.1|  leucyl aminopeptidase LAP                          259   6e-73    
gb|ETW29101.1|  hypothetical protein PFFCH_03522                        255   6e-73    
ref|XP_003881232.1|  probable cytosol aminopeptidase, related           254   6e-73    
gb|EWC85449.1|  hypothetical protein PFNF54_05753                       255   6e-73    
ref|XP_004144797.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    245   7e-73    
pdb|3KQX|A  Chain A, Structure Of A Protease 1                          253   9e-73    
ref|WP_013458465.1|  leucyl aminopeptidase                              252   1e-72    
gb|ETW46651.1|  hypothetical protein PFMALIP_05288                      255   1e-72    
ref|XP_001348613.1|  M17 leucyl aminopeptidase                          255   1e-72    
gb|ETW15982.1|  hypothetical protein PFFVO_05086                        255   1e-72    
gb|EUR62911.1|  hypothetical protein PFBG_05516                         254   2e-72    
ref|WP_038066839.1|  leucyl aminopeptidase                              250   3e-72    
gb|KFG62794.1|  leucyl aminopeptidase LAP                               257   5e-72    
ref|WP_027892840.1|  leucyl aminopeptidase                              250   6e-72    
ref|XP_005536346.1|  probable leucine aminopeptidase                    245   7e-72    
gb|EPR59801.1|  leucyl aminopeptidase LAP                               256   7e-72    
gb|EPT28034.1|  leucyl aminopeptidase LAP                               256   7e-72    
gb|KFG99947.1|  leucyl aminopeptidase LAP                               256   8e-72    
gb|KFG31133.1|  leucyl aminopeptidase LAP                               256   8e-72    
gb|KFH05105.1|  leucyl aminopeptidase LAP                               256   8e-72    
ref|XP_004174120.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    239   8e-72    
ref|XP_005777919.1|  aminopeptidase                                     251   1e-71    
ref|XP_005785169.1|  aminopeptidase                                     251   2e-71    
ref|WP_026234738.1|  leucyl aminopeptidase                              248   3e-71    
gb|KFE67174.1|  Cytosol aminopeptidase PepA                             249   4e-71    
gb|EKE04761.1|  hypothetical protein ACD_20C00007G0022                  246   3e-70    
dbj|BAD94641.1|  putative leucine aminopeptidase                        235   1e-69    
ref|WP_007906242.1|  Leucyl aminopeptidase                              244   1e-69    
ref|WP_013157347.1|  leucyl aminopeptidase                              243   2e-69    
ref|WP_038055235.1|  leucyl aminopeptidase                              242   3e-69    
ref|WP_024050091.1|  leucyl aminopeptidase                              242   7e-69    
ref|WP_018110990.1|  leucyl aminopeptidase                              241   1e-68    
ref|WP_013013469.1|  leucyl aminopeptidase                              241   1e-68    
gb|EKD47535.1|  hypothetical protein ACD_66C00018G0003                  241   2e-68    
ref|WP_022022074.1|  probable cytosol aminopeptidase                    240   2e-68    
ref|WP_027878005.1|  leucyl aminopeptidase                              241   2e-68    
gb|EKD41833.1|  hypothetical protein ACD_73C00503G0002                  239   6e-68    
ref|XP_008814166.1|  leucyl aminopeptidase                              240   8e-68    
ref|WP_011683058.1|  cytosol aminopeptidase                             238   1e-67    
ref|WP_031499927.1|  cytosol aminopeptidase                             238   1e-67    
emb|CDI77668.1|  cytosol aminopeptidase, putative                       241   4e-67    
ref|XP_729735.1|  chromosome condensation regulator leucine amino...    241   4e-67    
gb|ETB56248.1|  hypothetical protein YYC_05698                          241   4e-67    
ref|XP_740385.1|  hypothetical protein                                  237   5e-67    
gb|EUD71334.1|  leucyl aminopeptidase                                   241   5e-67    
ref|WP_038040802.1|  leucyl aminopeptidase                              236   6e-67    
ref|WP_038031872.1|  leucyl aminopeptidase                              236   6e-67    
ref|WP_015716053.1|  leucyl aminopeptidase                              235   1e-66    
ref|XP_002292458.1|  predicted protein                                  229   2e-66    
ref|WP_022847164.1|  cytosol aminopeptidase                             235   2e-66    
ref|WP_022486266.1|  probable cytosol aminopeptidase                    234   2e-66    
ref|WP_025980607.1|  hypothetical protein                               226   2e-66    
ref|WP_010881373.1|  cytosol aminopeptidase                             235   3e-66    
ref|WP_028494547.1|  leucyl aminopeptidase                              234   3e-66    
ref|WP_014628909.1|  leucyl aminopeptidase                              234   4e-66    
ref|XP_010503087.1|  PREDICTED: leucine aminopeptidase 1-like iso...    228   4e-66    
emb|CDR95323.1|  leucine aminopeptidase, putative                       235   5e-66    
ref|XP_743929.1|  hypothetical protein                                  236   5e-66    
ref|WP_027883612.1|  leucyl aminopeptidase                              234   5e-66    
emb|CDR15328.1|  M17 leucyl aminopeptidase, putative                    235   5e-66    
emb|CDR15323.1|  M17 leucyl aminopeptidase, putative                    238   6e-66    
ref|XP_004831009.1|  leucine aminopeptidase, putative                   235   6e-66    
ref|WP_003046704.1|  leucyl aminopeptidase                              233   7e-66    
ref|XP_678034.1|  leucine aminopeptidase                                235   9e-66    
ref|XP_004830608.1|  leucine aminopeptidase, putative                   233   1e-65    
ref|WP_014509763.1|  leucyl aminopeptidase                              232   1e-65    
ref|WP_026441431.1|  cytosol aminopeptidase                             233   1e-65    
ref|XP_002260412.1|  leucine aminopeptidase                             236   2e-65    
ref|XP_001615930.1|  leucine aminopeptidase                             236   2e-65    
emb|CCF73941.1|  unnamed protein product                                233   3e-65    
dbj|BAL55042.1|  leucyl aminopeptidase                                  232   4e-65    
emb|CDS50097.1|  M17 leucyl aminopeptidase, putative                    235   5e-65    
ref|WP_011174092.1|  leucyl aminopeptidase                              233   5e-65    



>ref|XP_009795110.1| PREDICTED: leucine aminopeptidase 2, chloroplastic [Nicotiana 
sylvestris]
Length=576

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/483 (77%), Positives = 415/483 (86%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAHS+A ATLGLT PNQI+ PKI  AA+E+DL+EWKGDILAVG TEKD+ARD NSKFQN 
Sbjct  50    MAHSIARATLGLTHPNQIEAPKISFAAKEIDLVEWKGDILAVGATEKDLARDENSKFQNP  109

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             ILQKLDSKLGGLLSEASSEEDFSGKSGQS VLRLPGLGSKRI LVGLGS VSST AYR+L
Sbjct  110   ILQKLDSKLGGLLSEASSEEDFSGKSGQSTVLRLPGLGSKRIALVGLGSSVSSTAAYRSL  169

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +AAAAKSAQAS++AVALAS +GLS ESKLS+ASA+ TG   G FEDNRFK E K PT
Sbjct  170   GEAVAAAAKSAQASNIAVALASTDGLSAESKLSSASAIVTGATLGIFEDNRFKSESKKPT  229

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKS++ILGLGTGPEIEKKLKY+E V +GVIF +ELVNAPANVLTP  LAEEAK IAS YS
Sbjct  230   LKSLDILGLGTGPEIEKKLKYAEDVCAGVIFCRELVNAPANVLTPAVLAEEAKKIASTYS  289

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DVL+A IL+VEQCKELKMGS+L V  A+ NP +FIHLCYKP+ G +K KLAL+GKG+TFD
Sbjct  290   DVLSANILNVEQCKELKMGSYLAVGEASANPPHFIHLCYKPTGGEIKKKLALVGKGLTFD  349

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G    IELMK DM G+A V GAAKA+ QIKPAGVEVHFIV ACENMISGTGM
Sbjct  350   SGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKALGQIKPAGVEVHFIVAACENMISGTGM  409

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD++TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGACI ALG S+
Sbjct  410   RPGDVVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACIVALGPSI  469

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AG+FTPS+DLAKEV  A++V GEKLWRMPLEESYW+TMKS +ADM+N G   G AI A+L
Sbjct  470   AGVFTPSDDLAKEVAAASEVSGEKLWRMPLEESYWDTMKSGVADMVNTGGRQGGAIVAAL  529

Query  1715  FMK  1723
             F+K
Sbjct  530   FLK  532



>ref|XP_011079411.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Sesamum 
indicum]
Length=583

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/483 (75%), Positives = 418/483 (87%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAHS+A ATLGLT+PN+I  PK+  AA+E+DL EWKGDILAVGVTEKD+A+D NSKF+N+
Sbjct  58    MAHSIARATLGLTQPNKIDPPKVSFAAKEIDLGEWKGDILAVGVTEKDLAKDENSKFKNV  117

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             +LQKLDSKLGGLLSEASSEEDF+GK+GQS  LRLPGLGSKR+GL+GLGS  S+T+ YR L
Sbjct  118   VLQKLDSKLGGLLSEASSEEDFTGKAGQSTFLRLPGLGSKRVGLIGLGSAASATVTYRNL  177

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +AAAAKS QAS+VA+ LAS+EG+  E K S ASA+A+G V GTF+DNRFK E K P+
Sbjct  178   GEAVAAAAKSTQASNVAITLASSEGIPAELKPSTASAIASGAVLGTFDDNRFKSESKQPS  237

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKSVEILGLGTGPEIEKKLKY++ V SG+IF KELVNAPANVLTPGALA EA+ IAS YS
Sbjct  238   LKSVEILGLGTGPEIEKKLKYAQDVCSGIIFGKELVNAPANVLTPGALASEAQKIASEYS  297

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV +A ILDVEQCKELKMGS+LGVAAA+ NP +FIHLCYKP SG VKTKLAL+GKG+TFD
Sbjct  298   DVFSAKILDVEQCKELKMGSYLGVAAASANPPHFIHLCYKPPSGEVKTKLALVGKGLTFD  357

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G   SIELMK DM G+A V GAAKA+ QIKPAGVEVHFIV ACENMISGTGM
Sbjct  358   SGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKALGQIKPAGVEVHFIVAACENMISGTGM  417

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG S+
Sbjct  418   RPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGPSI  477

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
              G+FTPS+DLAKEVL A++V GEKLWRMPLEESYW++MKS +ADM+N G   G AITA+L
Sbjct  478   GGVFTPSDDLAKEVLGASEVSGEKLWRMPLEESYWDSMKSGVADMVNTGGRQGGAITAAL  537

Query  1715  FMK  1723
             F+K
Sbjct  538   FLK  540



>ref|XP_009614630.1| PREDICTED: leucine aminopeptidase 2, chloroplastic [Nicotiana 
tomentosiformis]
Length=579

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/483 (77%), Positives = 414/483 (86%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAHS+A ATLGLT PNQI+ PKI  AA+E+DL+EWKGDILAVG TEKD+ARD NSKFQN 
Sbjct  53    MAHSIARATLGLTHPNQIEAPKISFAAKEIDLVEWKGDILAVGATEKDLARDENSKFQNP  112

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             ILQKLDSKLGGLLSEASSEEDFSGKSGQS VLRLPGLGSKRI LVGLGS VSST AYR+L
Sbjct  113   ILQKLDSKLGGLLSEASSEEDFSGKSGQSTVLRLPGLGSKRIALVGLGSSVSSTAAYRSL  172

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +AAAAKSAQAS++AVALAS +GLS ESKLS+ASA+ TG   G FEDNRFK E K PT
Sbjct  173   GEAVAAAAKSAQASNIAVALASTDGLSAESKLSSASAIVTGAALGIFEDNRFKSESKKPT  232

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKS++ILGLGTGPEIEKKLKY+E V +GVIF +ELVNAPANVLTP  LAEEAK IAS YS
Sbjct  233   LKSLDILGLGTGPEIEKKLKYAEDVCAGVIFCRELVNAPANVLTPAVLAEEAKKIASTYS  292

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DVL+A ILDVEQCKELKMGS+L V  A+ NP +FIHLCYKP+ G +K KLAL+GKG+TFD
Sbjct  293   DVLSANILDVEQCKELKMGSYLAVGEASANPPHFIHLCYKPTGGEIKKKLALVGKGLTFD  352

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G    IELMK DM G+A V GAAKA+ QIKPAGVEVHFIV ACENMISGTGM
Sbjct  353   SGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKALGQIKPAGVEVHFIVAACENMISGTGM  412

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD++TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGACI ALG S+
Sbjct  413   RPGDVVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACIVALGPSI  472

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AG+FTPS+DLAKEV  A+++ GEKLWRMPLEESYW+TM S +ADM+N G   G AI A+L
Sbjct  473   AGVFTPSDDLAKEVAAASELSGEKLWRMPLEESYWDTMTSGVADMVNTGGRQGGAIVAAL  532

Query  1715  FMK  1723
             F+K
Sbjct  533   FLK  535



>emb|CDP10235.1| unnamed protein product [Coffea canephora]
Length=526

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/483 (76%), Positives = 422/483 (87%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAHS+A ATLGLT+PNQI  PKI  AA+E+DL+EWKGDILA+GVTEKD+A+D +SKFQN 
Sbjct  1     MAHSIAHATLGLTQPNQIVPPKISFAAKEIDLVEWKGDILAIGVTEKDIAKDESSKFQNP  60

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             ILQKLDSKLGGLLSEASSEEDF+GK+GQS +LR+PGLG+KR+GLVGLG   S+T AYR+L
Sbjct  61    ILQKLDSKLGGLLSEASSEEDFTGKAGQSTILRVPGLGTKRVGLVGLGQAASTTAAYRSL  120

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GETIAAAAKSAQAS+VA+ALAS+E LS +S+L+  SA+ATG V GT+ED+RFK E K PT
Sbjct  121   GETIAAAAKSAQASNVAIALASSETLSADSRLTTVSAIATGTVLGTYEDSRFKSESKKPT  180

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             L SV+ILGLGTGPEIEKKLK++E VSS VIF   LVNAPANVLTP  LAEEAK IASLYS
Sbjct  181   LTSVDILGLGTGPEIEKKLKFAESVSSAVIFGINLVNAPANVLTPAVLAEEAKRIASLYS  240

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DVLT TIL+VEQCKELKMGS+LGVAAA+ NP +FIH+ YKP  GSVKTKLAL+GKG+TFD
Sbjct  241   DVLTTTILNVEQCKELKMGSYLGVAAASANPPHFIHIVYKPLGGSVKTKLALVGKGLTFD  300

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G   SIELMK DM G+A V GAAKA+ QIKPAGVEVHFIV ACENMISGTGM
Sbjct  301   SGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKALGQIKPAGVEVHFIVAACENMISGTGM  360

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGACI ALG S+
Sbjct  361   RPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACIIALGSSI  420

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AG++TPS+DLAKEVLEA++V GEKLWRMPLEESYWE+MKS +ADM+N G   G +ITA+L
Sbjct  421   AGVYTPSDDLAKEVLEASEVAGEKLWRMPLEESYWESMKSGVADMVNTGGRPGGSITAAL  480

Query  1715  FMK  1723
             F+K
Sbjct  481   FLK  483



>gb|AGW47884.1| leucine aminopeptidase [Nicotiana tabacum]
Length=527

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/483 (76%), Positives = 412/483 (85%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAHS+A ATLGLT PNQI+  KI  AA+E+DL+EWKGDILAVG TEKD+ARD NSKFQN 
Sbjct  1     MAHSIARATLGLTHPNQIEAHKISFAAKEIDLVEWKGDILAVGATEKDLARDENSKFQNP  60

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             ILQKLDSKL GLLSEASSEEDFSGKSGQS VLRLPGLGSKRI LVGLGS VSST AYR+L
Sbjct  61    ILQKLDSKLAGLLSEASSEEDFSGKSGQSTVLRLPGLGSKRIALVGLGSSVSSTAAYRSL  120

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +AAAAKSAQAS++AVALAS +GLS ESKLS+ASA+ TG   G FEDNRFK E K PT
Sbjct  121   GEAVAAAAKSAQASNIAVALASTDGLSAESKLSSASAIVTGAALGIFEDNRFKSESKKPT  180

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKS++ILGLGTGPEIEKKLKY+E V +GVIF +ELVNAPANVLTP  LAEEAK IAS YS
Sbjct  181   LKSLDILGLGTGPEIEKKLKYAEDVCAGVIFCRELVNAPANVLTPAVLAEEAKKIASTYS  240

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DVL+A ILDVEQCKELKMGS+L V  A+ NP +FIHLCYKP+ G +K KLAL+GKG+TFD
Sbjct  241   DVLSANILDVEQCKELKMGSYLAVGEASANPPHFIHLCYKPTGGEIKKKLALVGKGLTFD  300

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G    IELMK DM G+A V GAAKA+ QIKPAGVEVHFIV ACENMISGTGM
Sbjct  301   SGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKALGQIKPAGVEVHFIVAACENMISGTGM  360

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD++TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGACI ALG S+
Sbjct  361   RPGDVVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACIVALGPSI  420

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AG+FTPS+DLAKEV  A++V GEKLWRMPLEESYW+TM S +ADM+N G   G AI A+L
Sbjct  421   AGVFTPSDDLAKEVAAASEVSGEKLWRMPLEESYWDTMTSGVADMVNTGGRQGGAIVAAL  480

Query  1715  FMK  1723
             F+K
Sbjct  481   FLK  483



>ref|XP_011083971.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Sesamum 
indicum]
Length=584

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/483 (75%), Positives = 411/483 (85%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAHS A ATLGLT+ N+I  PKI  AA+E+DL++WKGD+LAVGVTEKDMA+D NSKF+N 
Sbjct  59    MAHSTARATLGLTQANKIDPPKISFAAKEIDLVQWKGDLLAVGVTEKDMAKDDNSKFKNS  118

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             ILQKLD +LGGLLSEASSEEDF+GK+GQS VLRLPGLGSKR+GL+GLG+  S+T+AYR L
Sbjct  119   ILQKLDLQLGGLLSEASSEEDFTGKAGQSTVLRLPGLGSKRVGLIGLGAAASATVAYRNL  178

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE  AAAAKS QAS+VA+ LAS E    ESK   ASA+ATG + GTF+D+RFK E + P 
Sbjct  179   GEATAAAAKSTQASNVAITLASVERTPAESKPVIASAIATGAILGTFDDSRFKSESQKPA  238

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKSV+I+GLG+GPEIEKKLKY++ V SG+I  KELVNAPANVLTPG LAEEA  IAS YS
Sbjct  239   LKSVDIIGLGSGPEIEKKLKYADHVCSGIILGKELVNAPANVLTPGVLAEEASRIASEYS  298

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV TA ILDVEQCKELKMGS+LGVAAA+TNP +FIHLCYKP +G VKTKLAL+GKG+TFD
Sbjct  299   DVFTAKILDVEQCKELKMGSYLGVAAASTNPPHFIHLCYKPPNGKVKTKLALVGKGLTFD  358

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K GA   IELMK DM G+A V GAAKA+ QIKPAGVEVHFIV ACENMISGTGM
Sbjct  359   SGGYNIKTGAGCLIELMKFDMGGSAAVLGAAKALGQIKPAGVEVHFIVAACENMISGTGM  418

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGDILTASNGK IEVT+TDAEGRL LADALVYA   GVEK+VDLATLTGACI ALG S+
Sbjct  419   RPGDILTASNGKTIEVTNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACIVALGPSI  478

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AGIFTPSEDLAKEV  A++  GEKLWRMPLEESYWE+MKS +ADM+N+G   G AI A+L
Sbjct  479   AGIFTPSEDLAKEVFGASEASGEKLWRMPLEESYWESMKSGVADMVNSGGRQGGAIIAAL  538

Query  1715  FMK  1723
             F+K
Sbjct  539   FLK  541



>emb|CDP16585.1| unnamed protein product [Coffea canephora]
Length=526

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/483 (75%), Positives = 414/483 (86%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAHS+A ATLGLT+PNQI  PKI   A+E+DL+EWKGDILA+GVTEKD+A+D +SKFQN 
Sbjct  1     MAHSIARATLGLTQPNQIVPPKISFEAKEIDLVEWKGDILAIGVTEKDVAKDGSSKFQNP  60

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             ILQKLDSKLGGLLSEASSEEDF+GK+GQS +LR+PGLG+KR+GLVGLG    +T AY  L
Sbjct  61    ILQKLDSKLGGLLSEASSEEDFTGKAGQSTILRVPGLGTKRVGLVGLGPAALTTAAYCGL  120

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GETI AAAKSAQAS+VA+ALAS+E LS +SKL+  SA+A+G V GT+ED+RFK E K PT
Sbjct  121   GETIGAAAKSAQASNVAIALASSETLSADSKLTTVSAIASGTVLGTYEDSRFKSESKKPT  180

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             L SV+ILGLGTGPE+EKKLK++E VSS VIF   LVNAPAN+LTP  LAEEAK IASLYS
Sbjct  181   LTSVDILGLGTGPEVEKKLKFAESVSSAVIFGINLVNAPANILTPAVLAEEAKRIASLYS  240

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DVLT TIL+VEQCKELKMGS+LGVAAA+ NP +FIH+ YKP  GSVKTKLAL+GKG+TFD
Sbjct  241   DVLTTTILNVEQCKELKMGSYLGVAAASANPPHFIHIVYKPLGGSVKTKLALVGKGLTFD  300

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G    IELMK DM G+A V GAAKA+ QIKPAGVEVHFIV ACENMISGTGM
Sbjct  301   SGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKALGQIKPAGVEVHFIVAACENMISGTGM  360

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGAC  ALG S+
Sbjct  361   RPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACRIALGSSI  420

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             A +FTPS+DLAKEVLEA++V GEKLWRMPLEESYWE+MKS +ADM+N G   G +ITA+L
Sbjct  421   AAVFTPSDDLAKEVLEASEVAGEKLWRMPLEESYWESMKSGVADMVNTGGRPGGSITAAL  480

Query  1715  FMK  1723
             F+K
Sbjct  481   FLK  483



>ref|XP_010103674.1| Leucine aminopeptidase 3 [Morus notabilis]
 gb|EXB96617.1| Leucine aminopeptidase 3 [Morus notabilis]
Length=579

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/509 (71%), Positives = 423/509 (83%), Gaps = 9/509 (2%)
 Frame = +2

Query  224   LQKLNNGSSQILSF---------GSYMAHSVALATLGLTKPNQIQRPKILIAAREVDLLE  376
             L KL +  S  LSF         G  MAH++A ATLGLT+PN I+ PKI  AA+E+D+ E
Sbjct  28    LTKLRSAPSFRLSFAVTPLGYRRGRLMAHTIAKATLGLTQPNAIELPKISFAAKEIDVTE  87

Query  377   WKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRL  556
             WKGDILAVGVTEKD+ +D NSKF+N IL+KLDS LGGLL+EASSEEDF+GK+GQS VLRL
Sbjct  88    WKGDILAVGVTEKDLTKDENSKFENPILKKLDSHLGGLLAEASSEEDFTGKTGQSTVLRL  147

Query  557   PGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSA  736
             PGLGSKR+GL+GLG   SST  +R LGE +AAAAK+AQ++ VA+ LAS+EGLSVESKLS 
Sbjct  148   PGLGSKRVGLIGLGQSASSTADFRGLGEAVAAAAKAAQSAEVAIVLASSEGLSVESKLST  207

Query  737   ASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKE  916
             ASA+ +G V GT +DNR++ E K PT+KSV+ILGLGTGPE+EKKLKY+E +SSG++F KE
Sbjct  208   ASAIVSGTVLGTHDDNRYRSESKKPTIKSVDILGLGTGPEVEKKLKYAEDLSSGILFGKE  267

Query  917   LVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYF  1096
             LVN+PANVLTP  LAEEA  IA+ YSDVL+A ILDVEQCKELKMGS+LGVAAA+ NP  F
Sbjct  268   LVNSPANVLTPAVLAEEASKIAATYSDVLSAKILDVEQCKELKMGSYLGVAAASANPPRF  327

Query  1097  IHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakai  1276
             IHL YKP SG VKTKLAL+GKG+TFDSGGYN+K G   SIELMK DM G+AVV GAAKAI
Sbjct  328   IHLTYKPPSGDVKTKLALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAVVLGAAKAI  387

Query  1277  aQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYA  1456
              QIKPAGVEVHFIV ACENMISGTGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA
Sbjct  388   GQIKPAGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYA  447

Query  1457  SKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESY  1636
                G EK+VDLATLTGAC+ ALG S+AG+F+PS+DLA EVL A++ GGEK+WR+PLEESY
Sbjct  448   CNQGAEKIVDLATLTGACVVALGPSIAGVFSPSDDLANEVLAASESGGEKIWRLPLEESY  507

Query  1637  WETMKSSIADMINAGSLDGDAITASLFMK  1723
             WE+MKS IADM+N G   G AITA+LF+K
Sbjct  508   WESMKSGIADMVNTGGRQGGAITAALFLK  536



>gb|EYU34348.1| hypothetical protein MIMGU_mgv1a003554mg [Erythranthe guttata]
Length=578

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/483 (72%), Positives = 413/483 (86%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAHS+A ATLGLT+ N+I   KI   A+E+DL++WKGDILAVGVTEKDM +D NSKF+N 
Sbjct  53    MAHSIARATLGLTQANKIDAQKISFTAKEIDLVQWKGDILAVGVTEKDMVKDENSKFKNS  112

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             ILQKLD +LGGLLSEASSEEDF+GKSGQS VLR PG+GSKR+GL+GLGS  S T+ YR+L
Sbjct  113   ILQKLDLQLGGLLSEASSEEDFTGKSGQSTVLRFPGIGSKRVGLIGLGSTSSPTLTYRSL  172

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +AA AKSA+AS+VA+ALAS+EG+S ESKLS ASA+ATG V GTF+D RFK E K   
Sbjct  173   GEAVAAVAKSARASNVAIALASSEGISAESKLSTASAIATGTVLGTFDDTRFKSESKQSA  232

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKSV+I+GLG+GP+IEKKLKY+  V SG+IF K+LVNAPANVLTPG LA EA  IAS +S
Sbjct  233   LKSVDIIGLGSGPQIEKKLKYAADVCSGIIFGKQLVNAPANVLTPGVLAAEASRIASEHS  292

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DVL+A ILDVEQCKELKMGS+L VA A+ NP++FIHLCYKPS+G +K K+AL+GKG+TFD
Sbjct  293   DVLSAKILDVEQCKELKMGSYLAVAEASANPAHFIHLCYKPSNGEIKKKIALVGKGLTFD  352

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K GA  SIELMK DM G+A V GAAKA+ QIKP+GVEVHFIV ACENMISGTGM
Sbjct  353   SGGYNIKTGAGCSIELMKFDMGGSAAVLGAAKALGQIKPSGVEVHFIVAACENMISGTGM  412

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD++TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG S+
Sbjct  413   RPGDVVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGPSI  472

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AG+FTPS+DLAKEV+ A+++ GEKLWRMP+E+SYW++MKS +ADM+N G   G AITA+L
Sbjct  473   AGVFTPSDDLAKEVIGASEISGEKLWRMPMEDSYWDSMKSGVADMVNTGGRQGGAITAAL  532

Query  1715  FMK  1723
             F+K
Sbjct  533   FLK  535



>emb|CBI36527.3| unnamed protein product [Vitis vinifera]
Length=528

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/485 (73%), Positives = 411/485 (85%), Gaps = 2/485 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAH++A ATLGLT P+ ++ PKI   A+E+DL+EWKGDILAVGVTEKDMA+D N KF+N 
Sbjct  1     MAHTLARATLGLTHPSNVEPPKISFTAKEIDLVEWKGDILAVGVTEKDMAKDENLKFENP  60

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSV--VSSTIAYR  628
             IL+KLDS+LGGLL+EASSEEDF+GKSGQS +LRLPGLGSKR+GL+GLG +   S   AYR
Sbjct  61    ILKKLDSQLGGLLAEASSEEDFTGKSGQSTILRLPGLGSKRVGLIGLGQLTPCSPPAAYR  120

Query  629   TLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKT  808
             +LGET+A AAK+AQAS VA+ LAS+EGLS ESK+  ASA+A+G V G  EDNRFK E K 
Sbjct  121   SLGETVAVAAKAAQASDVAIVLASSEGLSAESKIYTASAIASGAVLGIHEDNRFKSESKK  180

Query  809   PTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASL  988
             P LKSV+I+GLGTGP+++KKLKY+E V SGVIF KELVNAPANVLTPG LAEEA  IAS 
Sbjct  181   PALKSVDIIGLGTGPDVQKKLKYAEDVCSGVIFGKELVNAPANVLTPGVLAEEASKIASA  240

Query  989   YSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGIT  1168
             YSDVL+A ILD EQCKELKMGS+LGVAAA+ NP +FIHLCYKP +G VK KL L+GKG+T
Sbjct  241   YSDVLSAKILDAEQCKELKMGSYLGVAAASANPPHFIHLCYKPLTGPVKAKLGLVGKGLT  300

Query  1169  FDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGT  1348
             FDSGGYN+K G   SIELMK DM G+A V GAAKAI QIKP+GVEVHFIV ACENMISGT
Sbjct  301   FDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGQIKPSGVEVHFIVAACENMISGT  360

Query  1349  GMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGR  1528
             GMRPGD++TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG 
Sbjct  361   GMRPGDVVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGP  420

Query  1529  SVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITA  1708
             S+AG+FTPS+DLAKEVL A++  GEKLWRMP+EESYWE+MKS +ADM+N G   G AITA
Sbjct  421   SIAGVFTPSDDLAKEVLAASEASGEKLWRMPMEESYWESMKSGVADMVNTGGRPGGAITA  480

Query  1709  SLFMK  1723
             +LF+K
Sbjct  481   ALFLK  485



>ref|XP_002276114.1| PREDICTED: leucine aminopeptidase 1 [Vitis vinifera]
Length=583

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/488 (73%), Positives = 412/488 (84%), Gaps = 2/488 (0%)
 Frame = +2

Query  266   GSYMAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKF  445
             G  MAH++A ATLGLT P+ ++ PKI   A+E+DL+EWKGDILAVGVTEKDMA+D N KF
Sbjct  53    GKLMAHTLARATLGLTHPSNVEPPKISFTAKEIDLVEWKGDILAVGVTEKDMAKDENLKF  112

Query  446   QNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSV--VSSTI  619
             +N IL+KLDS+LGGLL+EASSEEDF+GKSGQS +LRLPGLGSKR+GL+GLG +   S   
Sbjct  113   ENPILKKLDSQLGGLLAEASSEEDFTGKSGQSTILRLPGLGSKRVGLIGLGQLTPCSPPA  172

Query  620   AYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLE  799
             AYR+LGET+A AAK+AQAS VA+ LAS+EGLS ESK+  ASA+A+G V G  EDNRFK E
Sbjct  173   AYRSLGETVAVAAKAAQASDVAIVLASSEGLSAESKIYTASAIASGAVLGIHEDNRFKSE  232

Query  800   PKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNI  979
              K P LKSV+I+GLGTGP+++KKLKY+E V SGVIF KELVNAPANVLTPG LAEEA  I
Sbjct  233   SKKPALKSVDIIGLGTGPDVQKKLKYAEDVCSGVIFGKELVNAPANVLTPGVLAEEASKI  292

Query  980   ASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGK  1159
             AS YSDVL+A ILD EQCKELKMGS+LGVAAA+ NP +FIHLCYKP +G VK KL L+GK
Sbjct  293   ASAYSDVLSAKILDAEQCKELKMGSYLGVAAASANPPHFIHLCYKPLTGPVKAKLGLVGK  352

Query  1160  GITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMI  1339
             G+TFDSGGYN+K G   SIELMK DM G+A V GAAKAI QIKP+GVEVHFIV ACENMI
Sbjct  353   GLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGQIKPSGVEVHFIVAACENMI  412

Query  1340  SGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1519
             SGTGMRPGD++TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ A
Sbjct  413   SGTGMRPGDVVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVA  472

Query  1520  LGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDA  1699
             LG S+AG+FTPS+DLAKEVL A++  GEKLWRMP+EESYWE+MKS +ADM+N G   G A
Sbjct  473   LGPSIAGVFTPSDDLAKEVLAASEASGEKLWRMPMEESYWESMKSGVADMVNTGGRPGGA  532

Query  1700  ITASLFMK  1723
             ITA+LF+K
Sbjct  533   ITAALFLK  540



>emb|CAN66364.1| hypothetical protein VITISV_029979 [Vitis vinifera]
Length=583

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/488 (72%), Positives = 411/488 (84%), Gaps = 2/488 (0%)
 Frame = +2

Query  266   GSYMAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKF  445
             G  M H++A ATLGLT P+ ++ PKI   A+E+DL+EWKGDILAVGVTEKDMA+D N KF
Sbjct  53    GKLMXHTLARATLGLTHPSNVEPPKISFTAKEIDLVEWKGDILAVGVTEKDMAKDENLKF  112

Query  446   QNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSV--VSSTI  619
             +N IL+KLDS+LGGLL+EASSEEDF+GKSGQS +LRLPGLGSKR+GL+GLG +   S   
Sbjct  113   ENPILKKLDSQLGGLLAEASSEEDFTGKSGQSTILRLPGLGSKRVGLIGLGQLTPCSPPA  172

Query  620   AYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLE  799
             AYR+LGET+A AAK+AQAS VA+ LAS+EGLS ESK+  ASA+A+G V G  EDNRFK E
Sbjct  173   AYRSLGETVAVAAKAAQASDVAIVLASSEGLSAESKIYTASAIASGAVLGIHEDNRFKSE  232

Query  800   PKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNI  979
              K P LKSV+I+GLGTGP+++KKLKY+E V SGVIF KELVNAPANVLTPG LAEEA  I
Sbjct  233   SKKPALKSVDIIGLGTGPDVQKKLKYAEDVCSGVIFGKELVNAPANVLTPGVLAEEASKI  292

Query  980   ASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGK  1159
             AS YS+VL+A ILD EQCKELKMGS+LGVAAA+ NP +FIHLCYKP +G VK KL L+GK
Sbjct  293   ASAYSNVLSAKILDAEQCKELKMGSYLGVAAASANPPHFIHLCYKPLTGPVKAKLGLVGK  352

Query  1160  GITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMI  1339
             G+TFDSGGYN+K G   SIELMK DM G+A V GAAKAI QIKP+GVEVHFIV ACENMI
Sbjct  353   GLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGQIKPSGVEVHFIVAACENMI  412

Query  1340  SGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1519
             SGTGMRPGD++TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ A
Sbjct  413   SGTGMRPGDVVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVA  472

Query  1520  LGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDA  1699
             LG S+AG+FTPS+DLAKEVL A++  GEKLWRMP+EESYWE+MKS +ADM+N G   G A
Sbjct  473   LGPSIAGVFTPSDDLAKEVLAASEASGEKLWRMPMEESYWESMKSGVADMVNTGGRPGGA  532

Query  1700  ITASLFMK  1723
             ITA+LF+K
Sbjct  533   ITAALFLK  540



>ref|XP_006350101.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Solanum 
tuberosum]
Length=577

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/483 (75%), Positives = 412/483 (85%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAHS+A  TLGLT  NQ   PKI  AA+E+DL+EWKGDILAVG TEKD+ARD NSKFQN 
Sbjct  51    MAHSIARDTLGLTHTNQSDAPKISFAAKEIDLVEWKGDILAVGATEKDLARDGNSKFQNP  110

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             +LQKLDSKL GLLSEASSEEDFSGK+GQS +LRLPGLGSKRI LVGLGS  SST AYR L
Sbjct  111   LLQKLDSKLSGLLSEASSEEDFSGKAGQSTILRLPGLGSKRIALVGLGSPTSSTAAYRCL  170

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE  AAAAKSAQAS++A+ALAS +GLS ESKLS+ASA+ TG V GTFEDNRFK E K PT
Sbjct  171   GEAAAAAAKSAQASNIAIALASTDGLSAESKLSSASAITTGAVLGTFEDNRFKSESKKPT  230

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKS++ILGLGTGPEIEKK+KY+  V +GVI  +ELVNAPANVLTP  LAEEAK IAS YS
Sbjct  231   LKSLDILGLGTGPEIEKKIKYAADVCAGVILGRELVNAPANVLTPAVLAEEAKKIASTYS  290

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV +A ILDVEQCKELKMGS+L VAAA+ NP++FIHL YKPSSG +K K+AL+GKG+TFD
Sbjct  291   DVFSANILDVEQCKELKMGSYLAVAAASANPAHFIHLSYKPSSGEIKKKIALVGKGLTFD  350

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G   SIELMK DM GAA V GAAKA+ QIKPAGVEVHFIV ACENMISGTGM
Sbjct  351   SGGYNIKTGPGCSIELMKFDMGGAAAVLGAAKALGQIKPAGVEVHFIVAACENMISGTGM  410

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG S+
Sbjct  411   RPGDIITASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGPSI  470

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AGIFTPS+DLAKEV+ A++V GEKLWR+P+E+SYW++MKS +ADM+N G   G AITA+L
Sbjct  471   AGIFTPSDDLAKEVVAASEVSGEKLWRLPMEDSYWDSMKSGVADMVNTGGRQGGAITAAL  530

Query  1715  FMK  1723
             F+K
Sbjct  531   FLK  533



>ref|XP_010265583.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Nelumbo 
nucifera]
Length=528

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/485 (73%), Positives = 409/485 (84%), Gaps = 2/485 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MA S++  TLGLT+P   + P+I  +A+E+DL++WKGDILAVGVTEKDMA+D NSKF+N 
Sbjct  1     MAQSLSRVTLGLTQPANTEVPQIAFSAKEIDLVKWKGDILAVGVTEKDMAKDENSKFENP  60

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIA--YR  628
             IL+KLD+ LGGLL+EASSEEDF+GKSGQS VLRLPGLGSKRIGL+GLG    S+IA  YR
Sbjct  61    ILRKLDAHLGGLLAEASSEEDFTGKSGQSTVLRLPGLGSKRIGLIGLGQCAPSSIAAVYR  120

Query  629   TLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKT  808
             +LGE +AAAAK+AQAS VA+ALAS+EGLS +SK++A SA+A GIV G +EDNRFK E K 
Sbjct  121   SLGEAVAAAAKAAQASDVAIALASSEGLSEDSKVNAVSAIAFGIVLGVYEDNRFKSESKR  180

Query  809   PTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASL  988
             P LKSVEILGLG GPE+E KLKY+  V S +IF KELVNAPANVLTPGALAEEA  IAS+
Sbjct  181   PLLKSVEILGLGAGPELENKLKYAGHVCSAIIFGKELVNAPANVLTPGALAEEASKIASM  240

Query  989   YSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGIT  1168
             Y DVLTA ILD E+CKELKMGS+LGVAAA+ NP +FIHLCYKP SG +K KL L+GKG+T
Sbjct  241   YGDVLTAKILDEEKCKELKMGSYLGVAAASANPPHFIHLCYKPPSGPIKAKLGLVGKGLT  300

Query  1169  FDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGT  1348
             FDSGGYN+K G   SIE+MK DM G+A V GAAKAI QIKPAGVEVHFIV ACENMISGT
Sbjct  301   FDSGGYNIKTGPGCSIEIMKTDMGGSAAVLGAAKAIGQIKPAGVEVHFIVAACENMISGT  360

Query  1349  GMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGR  1528
             GMRPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGACI ALG 
Sbjct  361   GMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACIIALGP  420

Query  1529  SVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITA  1708
             S+AG+FTPS+DLAKEV  A+ + GEKLWRMPLEESYWE+MKS +ADM+N G   G AITA
Sbjct  421   SIAGVFTPSDDLAKEVFAASQISGEKLWRMPLEESYWESMKSGVADMVNTGGRQGGAITA  480

Query  1709  SLFMK  1723
             +LF+K
Sbjct  481   ALFLK  485



>gb|KHG14578.1| hypothetical protein F383_10344 [Gossypium arboreum]
Length=521

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/483 (71%), Positives = 408/483 (84%), Gaps = 5/483 (1%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAHS     LGLT+P  IQ PKI  AA+E+D+ EWKGDILAVGVTEKDM++D NSKFQN 
Sbjct  1     MAHS-----LGLTQPANIQHPKISFAAKEIDVAEWKGDILAVGVTEKDMSKDENSKFQNS  55

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL+KLD  LGG+L+EASSEEDF+GK+G+S+VLRLP  GSKR+GL+GLG   S   +++ L
Sbjct  56    ILKKLDGLLGGMLAEASSEEDFTGKAGKSMVLRLPSCGSKRVGLIGLGKTASYPASFQRL  115

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +AAA+K+AQA+SVA+ LAS+E LS ESKLS ASA+A+G V G +ED+R+K EP+ P 
Sbjct  116   GEAVAAASKTAQANSVAIILASSEDLSNESKLSTASAIASGTVLGIYEDSRYKSEPRKPK  175

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             L SV+I+GLGTGPE+EKKLKY+E VSS +IF +ELVN+PANVLTP ALA EA NIASLYS
Sbjct  176   LNSVDIIGLGTGPELEKKLKYAENVSSAIIFGRELVNSPANVLTPAALAAEASNIASLYS  235

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DVL+A IL  EQCKELKMGS+LGVAAA+ NP +FIHLCYKPSSG +KTKLAL+GKG+TFD
Sbjct  236   DVLSANILSAEQCKELKMGSYLGVAAASANPPHFIHLCYKPSSGPIKTKLALVGKGLTFD  295

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K GA  SI++MK DM G+A V GAAKA+ QIKP GVEVHFIV +CENMISGTGM
Sbjct  296   SGGYNIKTGAGCSIDIMKTDMGGSAAVLGAAKALGQIKPPGVEVHFIVASCENMISGTGM  355

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGDI+TASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+
Sbjct  356   RPGDIITASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACIVALGPSI  415

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AG+FTPS+DLAKEV EA++V GEK WRMPLEESYWE+MKS +ADM+N G   G AITA+L
Sbjct  416   AGVFTPSDDLAKEVFEASEVSGEKFWRMPLEESYWESMKSGVADMVNTGGRQGGAITAAL  475

Query  1715  FMK  1723
             F+K
Sbjct  476   FLK  478



>gb|AAO15916.1| neutral leucine aminopeptidase preprotein [Solanum lycopersicum]
Length=577

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/483 (75%), Positives = 411/483 (85%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAHS+A  TLGLT  NQ   PKI  AA+E+DL+EWKGDIL VG TEKD+ARD NSKFQN 
Sbjct  51    MAHSIARDTLGLTHTNQSDAPKISFAAKEIDLVEWKGDILTVGATEKDLARDGNSKFQNP  110

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             +LQKLDSKL GLLSEASSEEDFSGK+GQS +LRLPGLGSKRI LVGLGS  SST AYR L
Sbjct  111   LLQKLDSKLSGLLSEASSEEDFSGKAGQSTILRLPGLGSKRIALVGLGSPTSSTAAYRCL  170

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE  AAAAKSAQAS++A+ALAS +GLS E KLS+ASA+ TG V GTFEDNRFK E K PT
Sbjct  171   GEAAAAAAKSAQASNIAIALASTDGLSAELKLSSASAITTGAVLGTFEDNRFKSESKKPT  230

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKS++ILGLGTGPEIEKK+KY+  V +GVI  +ELVNAPANVLTP  LAEEAK IAS YS
Sbjct  231   LKSLDILGLGTGPEIEKKIKYAADVCAGVILGRELVNAPANVLTPAVLAEEAKKIASTYS  290

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV +A ILDVEQCKELKMGS+L VAAA+ NP++FIHLCYKPSSG +K K+AL+GKG+TFD
Sbjct  291   DVFSANILDVEQCKELKMGSYLAVAAASANPAHFIHLCYKPSSGEIKKKIALVGKGLTFD  350

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G   SIELMK DM GAA V GAAKA+ QIKPAGVEVHFIV ACENMISGTGM
Sbjct  351   SGGYNIKTGPGCSIELMKFDMGGAAAVLGAAKALGQIKPAGVEVHFIVAACENMISGTGM  410

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG S+
Sbjct  411   RPGDIITASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGPSI  470

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AGIFTPS+DLAKEV+ A++V GEKLWR+P+E+SYW++MKS +ADM+N G   G AITA+L
Sbjct  471   AGIFTPSDDLAKEVVAASEVSGEKLWRLPMEDSYWDSMKSGVADMVNTGGRPGGAITAAL  530

Query  1715  FMK  1723
             F+K
Sbjct  531   FLK  533



>gb|EYU35326.1| hypothetical protein MIMGU_mgv1a003455mg [Erythranthe guttata]
Length=584

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/484 (73%), Positives = 404/484 (83%), Gaps = 1/484 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             M+HS+A ATLGLT+PN+   P I  AA+E DLLEWKGDILAVGVTEKDM++D NSKF+N 
Sbjct  58    MSHSIAHATLGLTEPNKTDPPTISFAAKETDLLEWKGDILAVGVTEKDMSKDENSKFENP  117

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSS-TIAYRT  631
              LQKLDS LGGLLSEASSEEDF+ K+GQS  LR+ GLGSKR+GL+GLGS  S   +AYR 
Sbjct  118   TLQKLDSYLGGLLSEASSEEDFTAKAGQSTFLRVTGLGSKRVGLIGLGSAASPPVVAYRG  177

Query  632   LGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTP  811
             LGE +A AAKS QAS VAV LAS +G+SVE K S ASA+ATG + G F+DNRFK E K P
Sbjct  178   LGEAVANAAKSVQASIVAVTLASCDGISVELKASVASAIATGAMLGIFDDNRFKSESKKP  237

Query  812   TLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLY  991
             +L+SVEI+GLG+G EIEKKLKY++ +SSG+IF +ELVNAP NVLTPG LAEEA  IAS Y
Sbjct  238   SLESVEIIGLGSGLEIEKKLKYAQGLSSGIIFGRELVNAPPNVLTPGVLAEEATRIASEY  297

Query  992   SDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITF  1171
             SDV TA ILD EQCKELKMGS+LGVAAA+ NP YFIHLCYKP SG VKTKLAL+GKG+TF
Sbjct  298   SDVFTAKILDEEQCKELKMGSYLGVAAASANPPYFIHLCYKPLSGEVKTKLALVGKGLTF  357

Query  1172  DSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTG  1351
             DSGGYN+K G  S IELMK DM G+A V GAAKA+AQIKP+GVEVHFIV ACENMISGTG
Sbjct  358   DSGGYNIKAGPGSMIELMKFDMGGSAAVLGAAKALAQIKPSGVEVHFIVAACENMISGTG  417

Query  1352  MRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1531
             MRPGD+LTASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S
Sbjct  418   MRPGDVLTASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACIVALGPS  477

Query  1532  VAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITAS  1711
             +AG+FTPS+DLA EV  A++V GEK WRMP+EESYWE+MKS +ADM+N G   G AITA+
Sbjct  478   IAGVFTPSDDLANEVFGASEVSGEKFWRMPMEESYWESMKSGVADMVNTGGRQGGAITAA  537

Query  1712  LFMK  1723
             LF+K
Sbjct  538   LFLK  541



>ref|NP_001233884.1| leucine aminopeptidase 2, chloroplastic [Solanum lycopersicum]
 sp|Q42876.1|AMPL2_SOLLC RecName: Full=Leucine aminopeptidase 2, chloroplastic; AltName: 
Full=Leucyl aminopeptidase 2; Short=LAP 2; AltName: Full=Proline 
aminopeptidase 2; AltName: Full=Prolyl aminopeptidase 
2; Flags: Precursor [Solanum lycopersicum]
 gb|AAA80499.1| leucine aminopeptidase [Solanum lycopersicum]
Length=569

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/483 (73%), Positives = 407/483 (84%), Gaps = 2/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAHS+A  TLGLT  NQ   PKI  AA+E+DL+EWKGDIL VG TEKD+ARD NSKFQN 
Sbjct  45    MAHSIARDTLGLTHTNQSDAPKISFAAKEIDLVEWKGDILTVGATEKDLARDGNSKFQNP  104

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             +LQKLDSKL GLLSEASSEEDFSGK+GQS +LRLPGLGSKRI LVGLGS  SST AYR L
Sbjct  105   LLQKLDSKLSGLLSEASSEEDFSGKAGQSTILRLPGLGSKRIALVGLGSPTSSTAAYRCL  164

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE  AAAAKSAQAS++A+ALAS +GLS E KLS+ASA+ TG V GTFEDNRFK E K PT
Sbjct  165   GEAAAAAAKSAQASNIAIALASTDGLSAELKLSSASAITTGAVLGTFEDNRFKSESKKPT  224

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKS++ILGLGTGPEIEKK+KY+  V +GVI  +ELVNAPANVLTP  LAEEAK IAS YS
Sbjct  225   LKSLDILGLGTGPEIEKKIKYAADVCAGVILGRELVNAPANVLTPAVLAEEAKKIASTYS  284

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV +A ILDVEQCKELKMGS+L VAAA+ NP++FIHLCYKPSSG +K K+AL+GKG+TFD
Sbjct  285   DVFSANILDVEQCKELKMGSYLRVAAASANPAHFIHLCYKPSSGEIKKKIALVGKGLTFD  344

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G   SIELMK DM GAA V GAAKA+ QIKPAGVEVHFIV ACENMISGTGM
Sbjct  345   SGGYNIKTGPGCSIELMKFDMGGAAAVLGAAKALGQIKPAGVEVHFIVAACENMISGTGM  404

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGDI+TASNGK IEV +TDAEGRL L+  +  +   GVEK+VDLATLTGAC+ ALG S+
Sbjct  405   RPGDIITASNGKTIEVNNTDAEGRLTLSVGI--SCNQGVEKIVDLATLTGACVVALGPSI  462

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AGIFTPS+DLAKEV+ A++V GEKLWR+P+E+SYW++MKS +ADM+N G   G AITA+L
Sbjct  463   AGIFTPSDDLAKEVVAASEVSGEKLWRLPMEDSYWDSMKSGVADMVNTGGRPGGAITAAL  522

Query  1715  FMK  1723
             F+K
Sbjct  523   FLK  525



>ref|XP_006600543.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Glycine 
max]
Length=570

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/483 (71%), Positives = 403/483 (83%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             M+H++A ATLGLT P+ I+ PKI   +++VD+ EWKGDILAVGVTEKD+ARD NSKF+N+
Sbjct  42    MSHTLARATLGLTHPSNIETPKISFGSKDVDVTEWKGDILAVGVTEKDLARDANSKFENV  101

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL+K+DSKLGGLL+EASSEEDFSGK GQS VLR+ GLGSKR+GL+GLG   S+   ++ L
Sbjct  102   ILRKIDSKLGGLLAEASSEEDFSGKVGQSTVLRITGLGSKRVGLIGLGQSPSTPSPFKGL  161

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +  AAKS+QASSVAV LAS+EGLS +SKLS A A+A+G V G FEDNR+K E K  T
Sbjct  162   GEAVVEAAKSSQASSVAVVLASSEGLSAQSKLSTAYAIASGAVLGLFEDNRYKSEAKKST  221

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             L+S++I+GLG GPE+EKKLKY+  VSSG+IF +ELVN+PANVLTPG LAEEA  IAS YS
Sbjct  222   LRSIDIIGLGMGPELEKKLKYAGDVSSGIIFGRELVNSPANVLTPGVLAEEAAKIASTYS  281

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV TA IL+ EQC ELKMGS+LGVAAA+ NP +FIHLCYKP SG V  KLAL+GKG+TFD
Sbjct  282   DVFTAKILNAEQCAELKMGSYLGVAAASENPPHFIHLCYKPLSGPVNVKLALVGKGLTFD  341

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G   SIELMK DM G+A V G AKA+ QIKP GVEVHFIV ACENMISGTGM
Sbjct  342   SGGYNIKTGPGCSIELMKFDMGGSAAVLGTAKALGQIKPLGVEVHFIVAACENMISGTGM  401

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK++DLATLTGAC+ ALG S+
Sbjct  402   RPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIIDLATLTGACVVALGPSI  461

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AG+FTPS+DLAKEV EA+DV GEKLWR+PLEESYWETMKS +ADM+N G   G AI A+L
Sbjct  462   AGVFTPSDDLAKEVFEASDVSGEKLWRLPLEESYWETMKSGVADMLNTGGRQGGAIVAAL  521

Query  1715  FMK  1723
             F+K
Sbjct  522   FLK  524



>ref|XP_011018033.1| PREDICTED: leucine aminopeptidase 1-like [Populus euphratica]
Length=582

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/486 (71%), Positives = 403/486 (83%), Gaps = 0/486 (0%)
 Frame = +2

Query  266   GSYMAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKF  445
             G  MAHS+A ATLGLT+P  I  PKI  +A+E+D+ EWKGDILAVGVTEKDM +D + +F
Sbjct  54    GKLMAHSLARATLGLTQPANIDAPKIAFSAKEIDVAEWKGDILAVGVTEKDMTKDDSKRF  113

Query  446   QNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAY  625
             +N +L+KLD+KLGG LSEASSEEDF+GKSGQS+VLRLPGLGSKRIGL+GLG   ++T A+
Sbjct  114   ENSLLKKLDAKLGGHLSEASSEEDFTGKSGQSLVLRLPGLGSKRIGLIGLGQSATNTYAF  173

Query  626   RTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPK  805
             R  GE IAAAAK+AQA +V + LAS    + ESKL+ ASA+A+G V GT+EDNR+K + K
Sbjct  174   RNFGEAIAAAAKTAQACNVGIVLASTGSTANESKLNTASAIASGTVLGTYEDNRYKSDSK  233

Query  806   TPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIAS  985
              P LKSV+ILG GTGPE+EKKLKY+E VSS VIF KELVN+PANVLTP  LAEEA  IAS
Sbjct  234   KPVLKSVDILGFGTGPELEKKLKYAEDVSSAVIFGKELVNSPANVLTPAVLAEEATKIAS  293

Query  986   LYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGI  1165
              YSDVL+ATIL+ EQCKELKMGS+LGVAAA+ NP +FIHLCYKP SG +K KLAL+GKG+
Sbjct  294   TYSDVLSATILNAEQCKELKMGSYLGVAAASANPPHFIHLCYKPPSGPIKAKLALVGKGL  353

Query  1166  TFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISG  1345
             TFDSGGYN+K G   SIELMK DM G+A V GAAKAI Q+KP GVEVHFIV ACENMISG
Sbjct  354   TFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGQVKPPGVEVHFIVAACENMISG  413

Query  1346  TGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALG  1525
             TGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA   G EK++DLATLTGAC+ ALG
Sbjct  414   TGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGAEKIIDLATLTGACVVALG  473

Query  1526  RSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAIT  1705
              S+AG+FTPS++LA EV  AA+  GEKLWRMP+EESYWE+MKS +ADM+N G   G AIT
Sbjct  474   PSIAGVFTPSDELANEVFAAAEASGEKLWRMPMEESYWESMKSGVADMVNTGGRQGGAIT  533

Query  1706  ASLFMK  1723
             A+LF+K
Sbjct  534   AALFLK  539



>ref|XP_010275823.1| PREDICTED: leucine aminopeptidase 1-like [Nelumbo nucifera]
Length=574

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/486 (72%), Positives = 409/486 (84%), Gaps = 3/486 (1%)
 Frame = +2

Query  275   MAHSVAL-ATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQN  451
             MAH+ A+ ATLGLT+P  ++ PKI  +A+E+DL+EWKGDILAVGVTEKDMA+D NSKF+N
Sbjct  46    MAHTSAIRATLGLTQPANVEVPKIAFSAKEIDLVEWKGDILAVGVTEKDMAKDDNSKFKN  105

Query  452   LILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVV--SSTIAY  625
              IL+KLD+ LGGLL+EASSEEDF+GKSGQS VLRLPGLGSKRIGL+GLG  +  S T  Y
Sbjct  106   PILRKLDAHLGGLLAEASSEEDFTGKSGQSTVLRLPGLGSKRIGLIGLGQCLPSSGTTTY  165

Query  626   RTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPK  805
             R+LGE + AAAK+AQA+ VA+ALAS+EG+S  SKL+  SA+A+G V G +EDNRFK E K
Sbjct  166   RSLGEAVGAAAKAAQANDVAIALASSEGISGNSKLNTVSAIASGTVLGVYEDNRFKSESK  225

Query  806   TPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIAS  985
                LKSV+ILGLGTGPE++ KLKY   V SGVI  KELVN+PANVLTPG LAEEA  IAS
Sbjct  226   KSLLKSVDILGLGTGPELQNKLKYVGDVCSGVILGKELVNSPANVLTPGVLAEEASKIAS  285

Query  986   LYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGI  1165
             +Y+DVLTATILDVEQCK+LKMGS+LGVAAA+ NP +FIHLCYKP  G+VK KLAL+GKG+
Sbjct  286   MYNDVLTATILDVEQCKKLKMGSYLGVAAASANPPHFIHLCYKPPGGAVKAKLALVGKGL  345

Query  1166  TFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISG  1345
             TFDSGGYN+K G   SIELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISG
Sbjct  346   TFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISG  405

Query  1346  TGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALG  1525
             TGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA   GV K+VDLATLTGACI ALG
Sbjct  406   TGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVGKIVDLATLTGACIVALG  465

Query  1526  RSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAIT  1705
              S+AG+FTPS+DLAKEV  A+++ GEKLWRMPLE+SYWE+MKS +ADM+N G   G AIT
Sbjct  466   PSIAGVFTPSDDLAKEVFAASEISGEKLWRMPLEDSYWESMKSGVADMVNTGGRQGGAIT  525

Query  1706  ASLFMK  1723
             A+LF+K
Sbjct  526   AALFLK  531



>ref|XP_002529380.1| leucine aminopeptidase, putative [Ricinus communis]
 gb|EEF32976.1| leucine aminopeptidase, putative [Ricinus communis]
Length=587

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/483 (72%), Positives = 402/483 (83%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAHS+A ATLGLT+P  +  PKI  +A+E+D++EWKGDILAVGVTEKDM +D ++KF N 
Sbjct  62    MAHSLARATLGLTQPANVDVPKISFSAKEIDVVEWKGDILAVGVTEKDMTKDKSTKFDNS  121

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             +L+KLD+ LGGLLSEASSEEDF+GK+GQS+VLRLPGLGSKRIGL+GLG   S+T A+R  
Sbjct  122   LLKKLDTHLGGLLSEASSEEDFTGKAGQSMVLRLPGLGSKRIGLIGLGQSASTTFAFRNF  181

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GETIAA AK+AQAS+VA+ LASAE +S E KL+ ASA+A+G V GT+ED RFK E K P 
Sbjct  182   GETIAATAKAAQASNVAIVLASAESISNELKLNTASAIASGTVLGTYEDARFKSESKKPV  241

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKSV+ILG GTGP++ KKLKY+E VSS VIF KELVN+PANVLTP  LAEEA  IAS YS
Sbjct  242   LKSVDILGFGTGPDLAKKLKYAEDVSSAVIFGKELVNSPANVLTPAVLAEEASKIASTYS  301

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DVL+A IL  EQCKELKMGS+LGVAAA+ NP +FIHL YKP  G+VK KLAL+GKG+TFD
Sbjct  302   DVLSANILSAEQCKELKMGSYLGVAAASANPPHFIHLHYKPPGGTVKAKLALVGKGLTFD  361

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G   SIELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISGTGM
Sbjct  362   SGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTGM  421

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGDI+TASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGAC+ ALG S+
Sbjct  422   RPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACVVALGPSI  481

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AG+FTPS+DLA EV  AA+  GEKLWRMPLEESYWE MKS +ADM+N G   G AITA+L
Sbjct  482   AGVFTPSDDLANEVFTAAEASGEKLWRMPLEESYWENMKSGVADMVNTGGRQGGAITAAL  541

Query  1715  FMK  1723
             F+K
Sbjct  542   FLK  544



>ref|XP_006453614.1| hypothetical protein CICLE_v10007834mg [Citrus clementina]
 gb|ESR66854.1| hypothetical protein CICLE_v10007834mg [Citrus clementina]
 gb|KDO59458.1| hypothetical protein CISIN_1g007947mg [Citrus sinensis]
Length=583

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/484 (72%), Positives = 411/484 (85%), Gaps = 1/484 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAHS+A ATLGLTKP QI   KI  AA+EVD++EWKGDILAVGVTEKDM +D NSKFQN 
Sbjct  57    MAHSIARATLGLTKPAQIDPLKISFAAKEVDVVEWKGDILAVGVTEKDMGKDDNSKFQNS  116

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL+KLD++LGGLLSEASSEEDF+GK+GQS V+RLPG+GSKR+GL+GLG   S    +R+L
Sbjct  117   ILKKLDAQLGGLLSEASSEEDFTGKAGQSTVIRLPGIGSKRVGLIGLGQSASRAGDFRSL  176

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTP-  811
             GE++AAAAK+AQAS+VAV LAS++GLS ESKL+AASA+A+G V GTFEDNR++ E K P 
Sbjct  177   GESVAAAAKAAQASNVAVVLASSDGLSDESKLTAASAVASGTVLGTFEDNRYRSESKKPV  236

Query  812   TLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLY  991
             +LKSV+I+GLGTGPE+EKKLKY+E VSS VIF +ELVN+PANVLTP  LAEEA  +AS+Y
Sbjct  237   SLKSVDIIGLGTGPELEKKLKYAEHVSSAVIFGRELVNSPANVLTPAVLAEEASKVASMY  296

Query  992   SDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITF  1171
             SDVL+ATILD+E+CKELKMGS+LGVAAA+ N  +FIHLCYKP  GS K KLAL+GKG+TF
Sbjct  297   SDVLSATILDIEKCKELKMGSYLGVAAASANLPHFIHLCYKPPGGSAKIKLALVGKGLTF  356

Query  1172  DSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTG  1351
             DSGGYN+K G    IE MK DM GAA V GAAKAI QIKP GVEVHFIV ACENMISGTG
Sbjct  357   DSGGYNIKTGPGCLIENMKYDMGGAAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTG  416

Query  1352  MRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1531
             MRPGDI+TA+NGK IEV +TDAEGRL LADAL+YA   GV+K++DLATLTGAC+ ALG S
Sbjct  417   MRPGDIITAANGKTIEVNNTDAEGRLTLADALIYACNQGVDKVIDLATLTGACVVALGPS  476

Query  1532  VAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITAS  1711
             VAG FTPS+DLA EV+ A+ V GEK+WRMPLEESYWE MKS +ADM+N G   G AITA+
Sbjct  477   VAGAFTPSDDLANEVMAASQVSGEKIWRMPLEESYWEMMKSGVADMVNTGGRQGGAITAA  536

Query  1712  LFMK  1723
             LF+K
Sbjct  537   LFLK  540



>ref|XP_003518220.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Glycine 
max]
Length=570

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/483 (72%), Positives = 404/483 (84%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             M+H++A ATLGLT P+ I+ PKI   A++VD+ EWKGDILAVGVTEKD+ARD NSKF+N+
Sbjct  42    MSHTLARATLGLTHPSNIETPKISFGAKDVDVTEWKGDILAVGVTEKDLARDANSKFENV  101

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL K+DSKLGGLL+EASSEEDFSGK GQS VLR+ GLGSKR+GL+GLG   S+   +++L
Sbjct  102   ILSKIDSKLGGLLAEASSEEDFSGKVGQSTVLRITGLGSKRVGLIGLGQSPSTPAPFKSL  161

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE I AAAKS+QASSVAVALAS+EGLS +SKLS A A+A+G V G FEDNR+K E K  T
Sbjct  162   GEAIVAAAKSSQASSVAVALASSEGLSAQSKLSTAYAIASGAVLGLFEDNRYKSEAKKST  221

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             L+S++ +GLGTGPE+EKKLKY+  VSSG+IF +ELVN+PANVLTPG LAEEA  IAS YS
Sbjct  222   LRSIDFIGLGTGPELEKKLKYAGDVSSGIIFGRELVNSPANVLTPGVLAEEAAKIASTYS  281

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV TA IL+ EQC ELKMGS+LGVAAA+ NP +FIHLCYKP SG V  KLAL+GKG+TFD
Sbjct  282   DVFTAKILNSEQCAELKMGSYLGVAAASANPPHFIHLCYKPLSGPVNVKLALVGKGLTFD  341

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G   SIELMK DM G+A V G AKA+ QIKP GVEVHFIV ACENMISGTGM
Sbjct  342   SGGYNIKTGPGCSIELMKFDMGGSAAVLGTAKALGQIKPLGVEVHFIVAACENMISGTGM  401

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK++DLATLTGAC+ ALG S+
Sbjct  402   RPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIIDLATLTGACVVALGPSI  461

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AG+FTP +DLAKEV EA+DV GEKLWR+PLEESYWETMKS +ADM+N G   G AI A+L
Sbjct  462   AGVFTPCDDLAKEVFEASDVSGEKLWRLPLEESYWETMKSGVADMLNTGGRQGGAIVAAL  521

Query  1715  FMK  1723
             F+K
Sbjct  522   FLK  524



>gb|KHG23887.1| hypothetical protein F383_01434 [Gossypium arboreum]
Length=580

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/484 (72%), Positives = 405/484 (84%), Gaps = 0/484 (0%)
 Frame = +2

Query  272   YMAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQN  451
             +MAH++A A LGLT+P  I+ PKI  AA+E+D+ EWKGD+LAVGVTEKDM +D NSKFQN
Sbjct  54    FMAHTLASANLGLTQPANIESPKIAFAAKEIDVGEWKGDMLAVGVTEKDMTKDENSKFQN  113

Query  452   LILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRT  631
              IL+ LD  LGGLL+E SSEEDF+GKSGQS VLRLPGLGSKR+GL+GLG    S  A+R 
Sbjct  114   SILKNLDRLLGGLLAEVSSEEDFTGKSGQSTVLRLPGLGSKRVGLIGLGQSALSPSAFRG  173

Query  632   LGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTP  811
             LGE +AAAAK+AQA+SVAV LAS+EGLS ESKL  ASA+A+G V G  EDNR+K E K P
Sbjct  174   LGEAVAAAAKTAQANSVAVVLASSEGLSNESKLGFASAIASGTVLGLHEDNRYKSESKKP  233

Query  812   TLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLY  991
              LKS++ILGLGTGPE+EKKLKY+E VSS ++F +ELVN+PANVLTP ALAEEA  IAS Y
Sbjct  234   QLKSLDILGLGTGPELEKKLKYAEDVSSAIVFGRELVNSPANVLTPAALAEEASKIASSY  293

Query  992   SDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITF  1171
             SDV+ A IL  EQCKELKMGS+LGVAAA+ NP YFIHLCYKPSSG +K KLAL+GKG+TF
Sbjct  294   SDVIYANILTAEQCKELKMGSYLGVAAASDNPPYFIHLCYKPSSGPIKAKLALVGKGLTF  353

Query  1172  DSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTG  1351
             DSGGYN+K G   SI++MK DM G+A V GAAKA+ QIKP GVEVHFIV +CENMISGTG
Sbjct  354   DSGGYNIKTGPGCSIDVMKIDMGGSAAVLGAAKALGQIKPPGVEVHFIVASCENMISGTG  413

Query  1352  MRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1531
             MRPGDILTASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGACI ALG S
Sbjct  414   MRPGDILTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACIVALGPS  473

Query  1532  VAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITAS  1711
             +AG+FTPS++LAKEV EA+++ GEK WRMPLEESYWE+MKS +ADM+N G   G AITA+
Sbjct  474   IAGVFTPSDELAKEVFEASEISGEKFWRMPLEESYWESMKSGVADMVNTGGRPGGAITAA  533

Query  1712  LFMK  1723
             LF+K
Sbjct  534   LFLK  537



>ref|XP_006474000.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Citrus 
sinensis]
Length=583

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/484 (72%), Positives = 410/484 (85%), Gaps = 1/484 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAHS+A ATLGLTKP QI   KI  AA+EVD++EWKGDILAVGVTEKDM +D NSKFQN 
Sbjct  57    MAHSIARATLGLTKPAQIDPLKISFAAKEVDVVEWKGDILAVGVTEKDMGKDDNSKFQNS  116

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL+KLD++LGGLLSEASSEEDF+GK GQS V+RLPG+GSKR+GL+GLG   S    +R+L
Sbjct  117   ILKKLDAQLGGLLSEASSEEDFTGKPGQSTVIRLPGIGSKRVGLIGLGQSASRAGDFRSL  176

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTP-  811
             GE++AAAAK+AQAS+VAV LAS++GLS ESKL+AASA+A+G V GTFEDNR++ E K P 
Sbjct  177   GESVAAAAKAAQASNVAVVLASSDGLSDESKLTAASAVASGTVLGTFEDNRYRSESKKPV  236

Query  812   TLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLY  991
             +LKSV+I+GLGTGPE+EKKLKY+E VSS VIF +ELVN+PANVLTP  LAEEA  +AS+Y
Sbjct  237   SLKSVDIIGLGTGPELEKKLKYAEHVSSAVIFGRELVNSPANVLTPAVLAEEASKVASMY  296

Query  992   SDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITF  1171
             SDVL+ATILD+E+CKELKMGS+LGVAAA+ N  +FIHLCYKP  GS K KLAL+GKG+TF
Sbjct  297   SDVLSATILDIEKCKELKMGSYLGVAAASANLPHFIHLCYKPPGGSAKIKLALVGKGLTF  356

Query  1172  DSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTG  1351
             DSGGYN+K G    IE MK DM GAA V GAAKAI QIKP GVEVHFIV ACENMISGTG
Sbjct  357   DSGGYNIKTGPGCLIENMKYDMGGAAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTG  416

Query  1352  MRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1531
             MRPGDI+TA+NGK IEV +TDAEGRL LADAL+YA   GV+K++DLATLTGAC+ ALG S
Sbjct  417   MRPGDIITAANGKTIEVNNTDAEGRLTLADALIYACNQGVDKVIDLATLTGACVVALGPS  476

Query  1532  VAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITAS  1711
             VAG FTPS+DLA EV+ A+ V GEK+WRMPLEESYWE MKS +ADM+N G   G AITA+
Sbjct  477   VAGAFTPSDDLANEVMAASQVSGEKIWRMPLEESYWEMMKSGVADMVNTGGRQGGAITAA  536

Query  1712  LFMK  1723
             LF+K
Sbjct  537   LFLK  540



>ref|XP_010047106.1| PREDICTED: leucine aminopeptidase 1-like [Eucalyptus grandis]
 gb|KCW78900.1| hypothetical protein EUGRSUZ_C00345 [Eucalyptus grandis]
Length=576

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/486 (70%), Positives = 406/486 (84%), Gaps = 0/486 (0%)
 Frame = +2

Query  266   GSYMAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKF  445
             G  MAH++A ATLGLT+P  +  PKI  AA+++D +EW GDILAVGVTEKDMA+D NSKF
Sbjct  48    GRLMAHTLAQATLGLTQPANVDVPKIAFAAKDIDAVEWSGDILAVGVTEKDMAKDENSKF  107

Query  446   QNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAY  625
             QN ILQ+LD +L GLL+EASSEEDF+GKSGQS+VLRLPG+GSKR+ L+GLG   S+  A+
Sbjct  108   QNSILQRLDKQLSGLLAEASSEEDFTGKSGQSVVLRLPGIGSKRVSLIGLGQSASTPTAF  167

Query  626   RTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPK  805
             R LGE +AAAAK+AQAS++ + LAS+EGLS ESKL+ ASA+A+G V G  +D R+K E K
Sbjct  168   RGLGEAVAAAAKAAQASNIGIVLASSEGLSAESKLTTASAIASGTVLGIHDDTRYKSESK  227

Query  806   TPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIAS  985
                LKSV+ILGLG+GPE++KKLKY+E VSSG+IF ++LVN+PANVLTP  LA+EA  IAS
Sbjct  228   KIALKSVDILGLGSGPEVDKKLKYAEDVSSGIIFGRQLVNSPANVLTPAVLADEASKIAS  287

Query  986   LYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGI  1165
              YSDV++ATIL+ EQCKELKMGS+LGVAAA+ NP +FIHLCYKP  G  K KLAL+GKG+
Sbjct  288   TYSDVISATILNAEQCKELKMGSYLGVAAASANPPHFIHLCYKPVGGPAKVKLALVGKGL  347

Query  1166  TFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISG  1345
             TFDSGGYN+K G   SIELMK DM G+A V GAAKA+ QIKP GVEVHFIV ACENMISG
Sbjct  348   TFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKALGQIKPPGVEVHFIVAACENMISG  407

Query  1346  TGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALG  1525
             TGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG
Sbjct  408   TGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALG  467

Query  1526  RSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAIT  1705
              S+AG+FTPS+DLAKEV  A+++ GEKLWRMPLEESYWE+MKS +ADM+N G   G AIT
Sbjct  468   PSIAGVFTPSDDLAKEVFAASELSGEKLWRMPLEESYWESMKSGVADMVNTGGRQGGAIT  527

Query  1706  ASLFMK  1723
             A+LF+K
Sbjct  528   AALFLK  533



>gb|KDP38679.1| hypothetical protein JCGZ_04032 [Jatropha curcas]
Length=587

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/483 (70%), Positives = 403/483 (83%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAHS+A A LGLT+P  I  PKI  AA+E+D+ EWKGDI+AVGVTEKDMA+D ++KF+N 
Sbjct  62    MAHSLARANLGLTQPANIDVPKISFAAKEIDVAEWKGDIVAVGVTEKDMAKDESAKFENS  121

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             +L+KLD+ LGGLLSEASSEEDF+GK+GQSIVLRLPGLGSKR+GL+GLG   S+T A+R L
Sbjct  122   LLKKLDTHLGGLLSEASSEEDFTGKAGQSIVLRLPGLGSKRVGLIGLGPCASTTFAFRNL  181

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +AA AK+ QAS+V + LAS + +S +SKL+ ASA+A+G V G +EDNR+K + K   
Sbjct  182   GEAVAATAKTVQASNVGIVLASTDSISNQSKLNTASAIASGTVLGIYEDNRYKTDSKKQV  241

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKSV+ILGLGTGPE+EKKLKY+E VSS VIF +ELVN+PANVLTP ALAEEA  IAS  S
Sbjct  242   LKSVDILGLGTGPELEKKLKYAEDVSSAVIFGRELVNSPANVLTPAALAEEASKIASASS  301

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV++ATIL  EQCKELKMG++LGVAAA+ N  +FIHLCYKP SG VK KLAL+GKG+TFD
Sbjct  302   DVISATILTAEQCKELKMGAYLGVAAASANIPHFIHLCYKPPSGPVKAKLALVGKGLTFD  361

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G   SI+LMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISGTGM
Sbjct  362   SGGYNIKTGPGCSIDLMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTGM  421

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGDI+TASNGK IEV +TDAEGRL LADAL+YA   GV K+VDLATLTGAC+ ALG S+
Sbjct  422   RPGDIVTASNGKTIEVNNTDAEGRLTLADALIYACNQGVRKIVDLATLTGACVVALGPSI  481

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AG+FTPS+DLAKEV  AA+  GEKLWR+PLEESYWE+MKS +ADM+N G   G AITA+L
Sbjct  482   AGVFTPSDDLAKEVFSAAEASGEKLWRLPLEESYWESMKSGVADMVNTGGRQGGAITAAL  541

Query  1715  FMK  1723
             F+K
Sbjct  542   FLK  544



>ref|XP_004507738.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Cicer 
arietinum]
Length=570

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/483 (70%), Positives = 403/483 (83%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             M+H+ A ATLGLT P  ++ PKI  +A +VD+ EWKGDILAVGVTEKD+ RD  S+F+NL
Sbjct  45    MSHTPARATLGLTHPTNVETPKISFSATDVDVTEWKGDILAVGVTEKDLTRDAKSRFENL  104

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL K+DSKLGGLL+EASSEEDFSGK GQS +LR+ GLGSKR+GL+GLG   S+T  ++ L
Sbjct  105   ILNKIDSKLGGLLAEASSEEDFSGKVGQSTILRIAGLGSKRVGLIGLGQSPSTTALFKGL  164

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE + AAAKSAQAS+VA+ LAS+EGLS +SKLS A A+A+G V G FED RFK E K P 
Sbjct  165   GEAVVAAAKSAQASNVAIVLASSEGLSSQSKLSTAYAIASGAVLGLFEDQRFKSESKKPA  224

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             L+S++I+GLGTGPE+EKKLKY+  VSSG+IF +ELVN+PANVLTPG LAEEA  +AS YS
Sbjct  225   LRSIDIIGLGTGPELEKKLKYAGDVSSGIIFGRELVNSPANVLTPGVLAEEASKVASTYS  284

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV TA ILD EQCKELKMGS+LGVAAA+ NP +FIHLCYKP SG V  KLAL+GKG+TFD
Sbjct  285   DVFTAKILDAEQCKELKMGSYLGVAAASANPPHFIHLCYKPPSGPVNVKLALVGKGLTFD  344

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G   SIELMK DM G+A V GAAKA+ QIKP GVEVHFIV ACENMISGTGM
Sbjct  345   SGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKALGQIKPLGVEVHFIVAACENMISGTGM  404

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD++TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG S+
Sbjct  405   RPGDVVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGPSI  464

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AG+F+P+++L KEVLEA++V GEKLWR+PLEESYWE+MKS +ADM+N G   G +ITA+L
Sbjct  465   AGVFSPNDELVKEVLEASEVSGEKLWRLPLEESYWESMKSGVADMVNTGGRQGGSITAAL  524

Query  1715  FMK  1723
             F+K
Sbjct  525   FLK  527



>ref|XP_007154883.1| hypothetical protein PHAVU_003G156100g [Phaseolus vulgaris]
 gb|ESW26877.1| hypothetical protein PHAVU_003G156100g [Phaseolus vulgaris]
Length=570

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/483 (71%), Positives = 404/483 (84%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             M+ ++  ATLGLT P+ I+ PKI  AA++VD+ EWKGDILAVGVTEKD+A+D NS+F+N+
Sbjct  42    MSQTLTRATLGLTHPSNIETPKICFAAKDVDVTEWKGDILAVGVTEKDLAKDANSRFENV  101

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL K+DSKLGGLL+EASSEEDFSGK GQS VLR+ GLGSKR+ L+GLG + S+   ++ L
Sbjct  102   ILSKIDSKLGGLLAEASSEEDFSGKVGQSTVLRITGLGSKRVSLIGLGQLSSTPAPFKGL  161

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE + AAAKS+QASSVAV LAS+EGLS  SKLS A A+A+G V G FEDNR+K E K P 
Sbjct  162   GEAVVAAAKSSQASSVAVVLASSEGLSAPSKLSTAYAIASGAVLGLFEDNRYKSEAKKPA  221

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             L+S++I+GLGTGPE+EKKLKY+  VSSG+IF +ELVN+PANVLTPG LAEEA NIAS YS
Sbjct  222   LQSIDIIGLGTGPELEKKLKYAGDVSSGIIFGRELVNSPANVLTPGVLAEEAANIASTYS  281

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV TA IL+ EQC+ELKMGS+LGVAAA+ NP +FIHLCYKP SG V  KLAL+GKG+TFD
Sbjct  282   DVFTAKILNAEQCEELKMGSYLGVAAASANPPHFIHLCYKPLSGPVNAKLALVGKGLTFD  341

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G   SIELMK DM G+A V G AKA+ QIKP GVEVHFIV ACENMISGTGM
Sbjct  342   SGGYNIKTGPGCSIELMKFDMGGSAAVLGTAKALGQIKPPGVEVHFIVAACENMISGTGM  401

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD++TASNGK IEV +TDAEGRL LADALVYA   GVEK++DLATLTGAC+ ALG S+
Sbjct  402   RPGDVVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIIDLATLTGACVVALGPSI  461

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AG+FTPS+DLAKEV EA+DV GEKLWR+PLEESYWE+MKS +ADM+N G   G AI A+L
Sbjct  462   AGVFTPSDDLAKEVFEASDVSGEKLWRLPLEESYWESMKSGVADMVNTGGRQGGAIIAAL  521

Query  1715  FMK  1723
             F+K
Sbjct  522   FLK  524



>gb|KFK29676.1| hypothetical protein AALP_AA7G164200 [Arabis alpina]
Length=588

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/483 (71%), Positives = 410/483 (85%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAH++A ATLGLT PN    PKI  AA+E+D+ EWKGDILAVGVTEKDM +D +SKF+N 
Sbjct  61    MAHTIAHATLGLTHPNSTDHPKISFAAKEIDVTEWKGDILAVGVTEKDMVKDVDSKFENP  120

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL+KLD+ LGGLL++ S+EEDFSGK GQS VLRLPGLGSKR+GL+GLG   SS  A+++L
Sbjct  121   ILKKLDAHLGGLLADVSTEEDFSGKPGQSTVLRLPGLGSKRVGLIGLGKSASSHSAFQSL  180

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +AAAAK++QASSVAV LAS+EG S ESKLS+ASA+A+G V G FED+R+K E K P+
Sbjct  181   GEAVAAAAKASQASSVAVVLASSEGASNESKLSSASAIASGTVLGLFEDSRYKSESKKPS  240

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKSV+I+G GTGPE+EKKLKY+E VS GVIF +ELVN+PANVLTP  LAEEA N+AS+YS
Sbjct  241   LKSVDIIGFGTGPELEKKLKYAEDVSYGVIFGRELVNSPANVLTPAVLAEEASNLASMYS  300

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV+TA IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKPSSG+VKTKLAL+GKG+TFD
Sbjct  301   DVMTANILNEEQCKELKMGSYLAVAAASANPPHFIHLVYKPSSGTVKTKLALVGKGLTFD  360

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G + SIELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISGTGM
Sbjct  361   SGGYNIKTGPDCSIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTGM  420

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD++TASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGAC+ ALG S+
Sbjct  421   RPGDVITASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACVVALGTSM  480

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AGI+TPS++LAKEV+ A+   GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+L
Sbjct  481   AGIYTPSDELAKEVIAASVRSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGSITAAL  540

Query  1715  FMK  1723
             F+K
Sbjct  541   FLK  543



>ref|XP_002325134.2| leucine aminopeptidase family protein [Populus trichocarpa]
 gb|EEF03699.2| leucine aminopeptidase family protein [Populus trichocarpa]
Length=582

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/486 (70%), Positives = 402/486 (83%), Gaps = 0/486 (0%)
 Frame = +2

Query  266   GSYMAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKF  445
             G  MAHS+A ATLGLT+P  I  PKI I+A+E+D+ EWKGDILAVGVTEKDM +D + +F
Sbjct  54    GKLMAHSLARATLGLTQPANIDAPKIAISAKEIDVAEWKGDILAVGVTEKDMTKDDSKRF  113

Query  446   QNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAY  625
             +N +L+KLD+KLGG LSEASSEEDF+GK GQS+VLRLPGLGSKRIGL+GLG   ++T A+
Sbjct  114   ENSLLKKLDAKLGGHLSEASSEEDFTGKPGQSLVLRLPGLGSKRIGLIGLGQSATNTYAF  173

Query  626   RTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPK  805
             R  GE IAAAAK+AQA +V + LAS    S ESKL+ ASA+A+G V GT+EDNR+K + K
Sbjct  174   RNFGEAIAAAAKTAQACNVGIVLASTGSTSNESKLNTASAIASGTVLGTYEDNRYKSDSK  233

Query  806   TPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIAS  985
              P LKSV+ILG GTGPE+EKKLK++E VSS VIF KELVN+PANVLTP  LAEEA  IAS
Sbjct  234   KPVLKSVDILGFGTGPELEKKLKHAEDVSSAVIFGKELVNSPANVLTPAVLAEEATKIAS  293

Query  986   LYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGI  1165
             +YSDVL+ATIL+ EQCKELKMGS+LGVAAA+ NP +FIHLCYKP SG  K KLAL+GKG+
Sbjct  294   MYSDVLSATILNAEQCKELKMGSYLGVAAASANPPHFIHLCYKPPSGPTKAKLALVGKGL  353

Query  1166  TFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISG  1345
             TFDSGGYN+K G    IELMK DM G+A V GAAKAI Q+KP GVEVHFIV ACENMISG
Sbjct  354   TFDSGGYNIKTGPGCFIELMKFDMGGSAAVLGAAKAIGQVKPPGVEVHFIVAACENMISG  413

Query  1346  TGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALG  1525
             TGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA   G EK++DLATLTGAC+ ALG
Sbjct  414   TGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGAEKIIDLATLTGACVVALG  473

Query  1526  RSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAIT  1705
              S+AG+FTPS++LA EV  AA+  GEKLWRMP+EESYWE+MKS +ADM+N G   G AIT
Sbjct  474   PSIAGVFTPSDELANEVFAAAEASGEKLWRMPMEESYWESMKSGVADMVNTGGRQGGAIT  533

Query  1706  ASLFMK  1723
             A+LF+K
Sbjct  534   AALFLK  539



>ref|XP_002867321.1| cytosol aminopeptidase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43580.1| cytosol aminopeptidase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=583

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/483 (71%), Positives = 410/483 (85%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAH++A ATLGLT  N +  PKIL + +E+D+ EWKGDILAVGVTEKDMA+D NSKF+N 
Sbjct  57    MAHTIAQATLGLTHANSVDHPKILFSGKEIDVTEWKGDILAVGVTEKDMAKDVNSKFENP  116

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL+KLD+ LGGLL++ SSEEDFSGK GQS VLRLPGLGSKR+GL+GLG   SS  A+++L
Sbjct  117   ILKKLDAHLGGLLADVSSEEDFSGKPGQSTVLRLPGLGSKRVGLIGLGKSASSPSAFQSL  176

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +AAAAK++QASSVAV LAS++ +S ESKLS+ASA+A+G V G FED+R+K E K P+
Sbjct  177   GEAVAAAAKASQASSVAVVLASSDSVSNESKLSSASAIASGTVLGLFEDSRYKSESKKPS  236

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKSV+I+G GTGPE+E+KLKY+E VS GVIF KELVN+PANVLTP  LAEEA N+AS+YS
Sbjct  237   LKSVDIIGFGTGPELEEKLKYAEHVSYGVIFGKELVNSPANVLTPAVLAEEASNLASMYS  296

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV+TA IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKPSSG VKTKLAL+GKG+TFD
Sbjct  297   DVMTANILNEEQCKELKMGSYLAVAAASANPPHFIHLIYKPSSGPVKTKLALVGKGLTFD  356

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G    IELMK DM G+A V GAAKAIAQIKP GVEVHFIV ACENMISGTGM
Sbjct  357   SGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKAIAQIKPPGVEVHFIVAACENMISGTGM  416

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD++TASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+
Sbjct  417   RPGDVITASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKVVDLATLTGACIIALGTSM  476

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AGI+TPS++LAKEV+ A++  GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+L
Sbjct  477   AGIYTPSDELAKEVIAASERSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGSITAAL  536

Query  1715  FMK  1723
             F+K
Sbjct  537   FLK  539



>ref|XP_010525807.1| PREDICTED: leucine aminopeptidase 1 [Tarenaya hassleriana]
Length=588

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/483 (72%), Positives = 408/483 (84%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAH++A ATLGLT+P+ I  PKI  +A++VD+ EWKGDILAVGVTEKDM +D NSKF+N 
Sbjct  62    MAHTLARATLGLTQPSSIDPPKISFSAKDVDMTEWKGDILAVGVTEKDMKKDDNSKFENP  121

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL+KLD  LGGLL+E SSEEDF+GK GQS VLRLPGLGSKR+GL+GLGS +SS   +++L
Sbjct  122   ILKKLDDHLGGLLAEVSSEEDFAGKPGQSTVLRLPGLGSKRVGLIGLGSKISSPSTFQSL  181

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +AAAAKSAQAS+VA+ALAS E +S ESKL +ASA+A+G V G +ED R+K E K P+
Sbjct  182   GEAVAAAAKSAQASNVAIALASPESVSDESKLISASAIASGTVLGIYEDIRYKTESKKPS  241

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKSV+I+G GTGPE+EKKLKY+E VSSGVI  KELVN+PANVLTP ALAEEAK +ASLYS
Sbjct  242   LKSVDIIGFGTGPELEKKLKYAEDVSSGVILGKELVNSPANVLTPAALAEEAKKLASLYS  301

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DVLTA ILD E+CKELKMGS+LGVAAA+ NP +FIHL Y+PSSG VK KLAL+GKG+TFD
Sbjct  302   DVLTANILDEEKCKELKMGSYLGVAAASANPPHFIHLLYRPSSGPVKRKLALVGKGLTFD  361

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G   SIELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISGTGM
Sbjct  362   SGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTGM  421

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD+LTASNGK IEV +TDAEGRL LADALVYA   GV+K++DLATLTGAC+ ALG ++
Sbjct  422   RPGDVLTASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKVIDLATLTGACVVALGPTI  481

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AG FTPSE+LA E+ +A+   GEKLWRMPLEESYWE+MKS +ADM+N G   G AITA+L
Sbjct  482   AGCFTPSEELAHEIFDASQSSGEKLWRMPLEESYWESMKSGVADMVNTGGRPGGAITAAL  541

Query  1715  FMK  1723
             F+K
Sbjct  542   FLK  544



>ref|XP_007011931.1| Cytosol aminopeptidase family protein [Theobroma cacao]
 gb|EOY29550.1| Cytosol aminopeptidase family protein [Theobroma cacao]
Length=580

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/484 (73%), Positives = 410/484 (85%), Gaps = 0/484 (0%)
 Frame = +2

Query  272   YMAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQN  451
             +MAH++A ATLGLT+P  I+ P+I  AA+E+D+ EWKGDILAVGVTEKDM +D NSKFQN
Sbjct  54    FMAHTIARATLGLTQPANIEHPRISFAAKEIDVAEWKGDILAVGVTEKDMTKDENSKFQN  113

Query  452   LILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRT  631
              IL+KLD  LGGLL+E SSEEDF+GK+GQS VLRLPGLGSKR+GL+GLG  V S  A+R 
Sbjct  114   SILKKLDGLLGGLLAEVSSEEDFTGKAGQSTVLRLPGLGSKRVGLIGLGQSVLSPAAFRG  173

Query  632   LGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTP  811
             LGE +AAAAK+AQASSVAVALAS+EGLS ESKLS ASA+A+G V G +EDNR+K E K P
Sbjct  174   LGEAVAAAAKTAQASSVAVALASSEGLSNESKLSTASAIASGTVLGVYEDNRYKSESKKP  233

Query  812   TLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLY  991
              LKSV+ILGLGTGP++EKKLKY+E VSS +IF +ELVN+PANVLTP ALA EA  IAS Y
Sbjct  234   QLKSVDILGLGTGPDLEKKLKYAEDVSSAIIFGRELVNSPANVLTPAALAAEASKIASSY  293

Query  992   SDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITF  1171
             SDV++ATIL  EQCKELKMGS+LGVAAA+ NP +FIHLCYKP SG +K KLAL+GKG+TF
Sbjct  294   SDVISATILSAEQCKELKMGSYLGVAAASANPPHFIHLCYKPPSGPIKAKLALVGKGLTF  353

Query  1172  DSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTG  1351
             DSGGYN+K G    IELMK DM G+A V GAAKA+ QIKP GVEVHFIV +CENMISGTG
Sbjct  354   DSGGYNIKTGVGCLIELMKTDMGGSAAVLGAAKALGQIKPPGVEVHFIVASCENMISGTG  413

Query  1352  MRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1531
             MRPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG S
Sbjct  414   MRPGDIITASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGPS  473

Query  1532  VAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITAS  1711
             +AG+FTPS++LAKEV EA++V GEK WRMPLEESYWE+MKS +ADM+N G   G AITA+
Sbjct  474   IAGVFTPSDNLAKEVFEASEVSGEKFWRMPLEESYWESMKSGVADMVNTGGRQGGAITAA  533

Query  1712  LFMK  1723
             LF+K
Sbjct  534   LFLK  537



>ref|XP_011033404.1| PREDICTED: leucine aminopeptidase 1 [Populus euphratica]
Length=582

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/483 (71%), Positives = 397/483 (82%), Gaps = 1/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAHS A ATLGLT+P  I  PKI  +A+E+D+ EWKGDILAVGVTEKDMA D + KF N 
Sbjct  58    MAHS-ARATLGLTQPANIDVPKIAFSAKEIDVAEWKGDILAVGVTEKDMAMDDSKKFDNS  116

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             +L+KLD+KLGG LSEASSEEDF+GK GQS+VLRLPGLGSKRIGL+GLG   ++T  +R  
Sbjct  117   LLKKLDAKLGGQLSEASSEEDFTGKPGQSLVLRLPGLGSKRIGLIGLGQSATNTYNFRNF  176

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE IAAAAK+AQAS V +  AS   +S ESKL+ ASA+ +G V GT+EDNR+K + K P 
Sbjct  177   GEAIAAAAKTAQASDVGIVFASTGSISNESKLNTASAIVSGTVLGTYEDNRYKSDSKKPV  236

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKSV+ILGLGTGPE+ KKLKY+E VSS VIF KELVN+PANVLTP  LAEEA  IAS YS
Sbjct  237   LKSVDILGLGTGPELAKKLKYAEDVSSAVIFGKELVNSPANVLTPAVLAEEASKIASTYS  296

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DVL+ATIL  EQC ELKMGS+LGVAAA+ NP +FIHLCYKPSSG VK KLAL+GKG+TFD
Sbjct  297   DVLSATILSAEQCIELKMGSYLGVAAASENPPHFIHLCYKPSSGPVKAKLALVGKGLTFD  356

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G   SIE MK DM G+A V GAAKAI Q+KP GVEVHFIV ACENMISGTGM
Sbjct  357   SGGYNIKTGPGCSIEFMKFDMGGSAAVLGAAKAIGQVKPRGVEVHFIVAACENMISGTGM  416

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK++DLATLTGAC+ ALG S+
Sbjct  417   RPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIIDLATLTGACVVALGPSI  476

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AG+FTPS++LA EV  AA+  GEKLWRMPLEESYWE+MKS +ADM+N G+  G AITA+L
Sbjct  477   AGVFTPSDELANEVFTAAEASGEKLWRMPLEESYWESMKSGVADMVNTGARQGGAITAAL  536

Query  1715  FMK  1723
             F+K
Sbjct  537   FLK  539



>ref|NP_194821.1| leucine aminopeptidase 2 [Arabidopsis thaliana]
 sp|Q944P7.2|AMPL3_ARATH RecName: Full=Leucine aminopeptidase 3, chloroplastic; AltName: 
Full=Leucyl aminopeptidase 3; Short=LAP 3; AltName: Full=Proline 
aminopeptidase 3; AltName: Full=Prolyl aminopeptidase 
3; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE85830.1| leucine aminopeptidase 2 [Arabidopsis thaliana]
Length=583

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/483 (71%), Positives = 407/483 (84%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAH+++ ATLGLT+ N +  PKI  + +E+D+ EWKGDILAVGVTEKDMA+D NSKF+N 
Sbjct  57    MAHTISHATLGLTQANSVDHPKISFSGKEIDVTEWKGDILAVGVTEKDMAKDVNSKFENP  116

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL+KLD+ LGGLL++ SSEEDFSGK GQS VLRLPGLGSKR+GL+GLG   S+  A+++L
Sbjct  117   ILKKLDAHLGGLLADVSSEEDFSGKPGQSTVLRLPGLGSKRVGLIGLGKSASTPSAFQSL  176

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +AAAAK++QASSVAV LAS+E +S ESKL +ASA+A+G V G FED+R+K E K P+
Sbjct  177   GEAVAAAAKASQASSVAVVLASSESVSNESKLCSASAIASGTVLGLFEDSRYKSESKKPS  236

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKSV+I+G G+GPE+EKKLKY+E VS GVIF KELVN+PANVLTP  LAEEA N+AS+YS
Sbjct  237   LKSVDIIGFGSGPELEKKLKYAEHVSYGVIFGKELVNSPANVLTPAVLAEEALNLASMYS  296

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV+TA IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKPSSG VKTKLAL+GKG+TFD
Sbjct  297   DVMTANILNEEQCKELKMGSYLAVAAASANPPHFIHLIYKPSSGPVKTKLALVGKGLTFD  356

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G    IELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISGTGM
Sbjct  357   SGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTGM  416

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD+LTASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+
Sbjct  417   RPGDVLTASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKVVDLATLTGACIIALGTSM  476

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AGI+TPS+ LAKEV+ A++  GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+L
Sbjct  477   AGIYTPSDKLAKEVIAASERSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGSITAAL  536

Query  1715  FMK  1723
             F+K
Sbjct  537   FLK  539



>ref|XP_009127424.1| PREDICTED: leucine aminopeptidase 3, chloroplastic [Brassica 
rapa]
 emb|CDY28227.1| BnaA01g06220D [Brassica napus]
Length=583

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/488 (71%), Positives = 407/488 (83%), Gaps = 2/488 (0%)
 Frame = +2

Query  260   SFGSYMAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNS  439
             S G  MAH++A ATLGLT+ N    PK+  +A++VD+ EWKGDILAVGVTEKDMA+D NS
Sbjct  54    SRGRAMAHTLAQATLGLTQANSTDHPKVTFSAKDVDVTEWKGDILAVGVTEKDMAKDVNS  113

Query  440   KFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTI  619
             KFQN IL KLD+ LGGLL++ SSEEDFSGK GQS VLRLPGLGSKR+GL+GLG   SS  
Sbjct  114   KFQNAILNKLDAHLGGLLADVSSEEDFSGKPGQSTVLRLPGLGSKRVGLIGLGKTASSPS  173

Query  620   AYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLE  799
             A+++LGE +AAAAK++QASSVAV LAS+E  S ESKL++ASA+A+G V G FED+R+K E
Sbjct  174   AFQSLGEAVAAAAKASQASSVAVVLASSE--SNESKLTSASAIASGTVLGLFEDSRYKSE  231

Query  800   PKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNI  979
              K P+LKSV+I+G GTGPE+EKKLKY+E VS GVIF +ELVN+PANVLTP  LA+EA  +
Sbjct  232   SKKPSLKSVDIIGFGTGPELEKKLKYAEDVSYGVIFGRELVNSPANVLTPAVLADEASKL  291

Query  980   ASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGK  1159
             AS+YSDV+TA IL+ EQCKELKMGS+L VAAA+ NP  FIHL YKPSSG VKTKLAL+GK
Sbjct  292   ASMYSDVMTANILNEEQCKELKMGSYLAVAAASANPPRFIHLVYKPSSGPVKTKLALVGK  351

Query  1160  GITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMI  1339
             G+TFDSGGYN+K G    IELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMI
Sbjct  352   GLTFDSGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMI  411

Query  1340  SGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1519
             SGTGMRPGD+LTASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGACI A
Sbjct  412   SGTGMRPGDVLTASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKVVDLATLTGACIVA  471

Query  1520  LGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDA  1699
             LG S+AGI+TPS++LAKEV+ A++  GEKLWRMP+EESYWE MKS +ADM+N G   G +
Sbjct  472   LGNSMAGIYTPSDELAKEVIAASERSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGS  531

Query  1700  ITASLFMK  1723
             ITA+LF+K
Sbjct  532   ITAALFLK  539



>ref|XP_006412653.1| hypothetical protein EUTSA_v10024754mg [Eutrema salsugineum]
 gb|ESQ54106.1| hypothetical protein EUTSA_v10024754mg [Eutrema salsugineum]
Length=587

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/483 (71%), Positives = 405/483 (84%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAH++A ATLGLT+ N    PKI  AA+E+D+ EWKGDILAVGVTEKDMA+D NS F+N 
Sbjct  60    MAHTLAHATLGLTQANSTDHPKISFAAKEMDVTEWKGDILAVGVTEKDMAKDANSMFENP  119

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL+KLD+ LGGLL++ SSEEDFSGK GQS VLRLPGLGSKR+GL+GLG   SS  A+++L
Sbjct  120   ILKKLDAHLGGLLADVSSEEDFSGKPGQSTVLRLPGLGSKRVGLIGLGKSASSPSAFQSL  179

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +AAAAK++QASSVAV LAS+E +S ESKLS+ASA+A+G V G FED+R+K E K P 
Sbjct  180   GEAVAAAAKASQASSVAVVLASSESVSNESKLSSASAIASGTVLGLFEDSRYKSESKKPC  239

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             L SV+I+G GTGPE+EKKLKY+E VS GVIF +ELVN+PANVLTP  LAEEA  +AS+YS
Sbjct  240   LNSVDIIGFGTGPELEKKLKYAEDVSYGVIFGRELVNSPANVLTPAVLAEEASKLASMYS  299

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV+TA IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKPSSG VKTKLAL+GKG+TFD
Sbjct  300   DVMTANILNEEQCKELKMGSYLAVAAASANPPHFIHLVYKPSSGPVKTKLALVGKGLTFD  359

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G    IELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISGTGM
Sbjct  360   SGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTGM  419

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD++TASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+
Sbjct  420   RPGDVITASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACIVALGSSM  479

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AGI+TP+++LAKEV+ A++  GEKLWRMPLEESYWE MKS +ADM+N G   G +ITA+L
Sbjct  480   AGIYTPNDNLAKEVIAASERSGEKLWRMPLEESYWEMMKSGVADMVNTGGRAGGSITAAL  539

Query  1715  FMK  1723
             F+K
Sbjct  540   FLK  542



>ref|XP_008367747.1| PREDICTED: leucine aminopeptidase 1-like [Malus domestica]
Length=573

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/509 (68%), Positives = 407/509 (80%), Gaps = 11/509 (2%)
 Frame = +2

Query  224   LQKLNNGSSQILSF---------GSYMAHSVALATLGLTKPNQIQRPKILIAAREVDLLE  376
             L KL +  S  LSF         G  MAH++A A LGLT P+ I  PKI  AA+E+D+ E
Sbjct  24    LTKLRSAPSLRLSFAVSPLCSRRGKLMAHTLAQANLGLTYPSGIDAPKISFAAKEIDVAE  83

Query  377   WKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRL  556
             WKGD+LAVGVTEKD+A+D NSKFQN +L+KLDS LGGLL+E SSEEDF+GKSGQS V+RL
Sbjct  84    WKGDLLAVGVTEKDLAKDENSKFQNSVLKKLDSHLGGLLAEVSSEEDFTGKSGQSTVVRL  143

Query  557   PGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSA  736
             PGLGSKR+GL GLG   SST A+R LGE  AAAAK+ Q S +A+ LAS+EGLS +S  + 
Sbjct  144   PGLGSKRVGLFGLGQSASSTAAFRGLGEAAAAAAKATQXSDIAIVLASSEGLSAKS--NT  201

Query  737   ASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKE  916
             ASA+A+G V G +ED R+K E K   LKSV+ILGLGTG E+EKKLKY+E V+SG+IF KE
Sbjct  202   ASAIASGTVLGIYEDGRYKSESKKSALKSVDILGLGTGAEVEKKLKYTEDVTSGIIFGKE  261

Query  917   LVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYF  1096
             LVN+PANVLTPG LAEEA  IAS YSDVL+A IL+ EQCKELKMGS+L VAAA+TNP +F
Sbjct  262   LVNSPANVLTPGKLAEEASKIASTYSDVLSANILNEEQCKELKMGSYLAVAAASTNPPHF  321

Query  1097  IHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakai  1276
             IHL YKP  G  K KL L+GKG+TFDSGGYN+K G   SIE MK DM G+A V GAAKAI
Sbjct  322   IHLIYKPPGGPAKVKLGLVGKGLTFDSGGYNIKTGPGCSIEQMKFDMGGSAAVLGAAKAI  381

Query  1277  aQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYA  1456
             AQIKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA
Sbjct  382   AQIKPXGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYA  441

Query  1457  SKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESY  1636
                GV+K+VDLATLTGACI ALG S+AG+FTPS+DLAKEV  A+++ GEK WR+P+EESY
Sbjct  442   CNQGVDKIVDLATLTGACIVALGPSIAGVFTPSDDLAKEVFAASEISGEKFWRLPMEESY  501

Query  1637  WETMKSSIADMINAGSLDGDAITASLFMK  1723
             WE+MKS IADM+N G+  G +ITA+LF+K
Sbjct  502   WESMKSGIADMLNTGARQGGSITAALFLK  530



>ref|XP_009358438.1| PREDICTED: leucine aminopeptidase 1-like [Pyrus x bretschneideri]
Length=575

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/509 (68%), Positives = 408/509 (80%), Gaps = 11/509 (2%)
 Frame = +2

Query  224   LQKLNNGSSQILSF---------GSYMAHSVALATLGLTKPNQIQRPKILIAAREVDLLE  376
             L KL +  S  LSF         G  MAH++A A LGLT P+ I  PK+L AA+E D+ E
Sbjct  26    LTKLRSAPSLRLSFAVSPLCSRRGKLMAHTLAQANLGLTYPSGIDAPKLLFAAKETDVAE  85

Query  377   WKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRL  556
             WKGD+LAVGVTEKD+A+D NSKFQN +L+KLDS LGGLL+E SSEEDF+GKSGQS V+RL
Sbjct  86    WKGDLLAVGVTEKDLAKDENSKFQNSVLKKLDSHLGGLLAEVSSEEDFTGKSGQSTVVRL  145

Query  557   PGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSA  736
             PGLGSKR+GL GLG   SST A+R LGE  AAAAK+ QAS +A+ LAS+EGLS +S  + 
Sbjct  146   PGLGSKRVGLFGLGQSASSTAAFRGLGEAAAAAAKATQASDIAIVLASSEGLSAKS--NT  203

Query  737   ASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKE  916
             ASA+A+G V G +ED+R+K E K   LKSV+ILGLGTG E+EKKLKY+E V+SG+IF KE
Sbjct  204   ASAIASGTVLGIYEDSRYKSESKKSALKSVDILGLGTGAEVEKKLKYTEDVTSGIIFGKE  263

Query  917   LVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYF  1096
             LVN+PANVLTPG LAEEA  IAS YSDVL+A IL+ EQCKELKMGS+L VAAA+TNP +F
Sbjct  264   LVNSPANVLTPGKLAEEASKIASTYSDVLSANILNEEQCKELKMGSYLAVAAASTNPPHF  323

Query  1097  IHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakai  1276
             IHL YKP  G  K KL L+GKG+TFDSGGYN+K G   SIE MK DM G+  V GAAKAI
Sbjct  324   IHLIYKPPGGPAKVKLGLVGKGLTFDSGGYNIKTGPGCSIEQMKFDMGGSPAVLGAAKAI  383

Query  1277  aQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYA  1456
             AQIKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA
Sbjct  384   AQIKPPGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYA  443

Query  1457  SKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESY  1636
                GV+K+VDLATLTGACI ALG S+AG+FTPS+DLAKEV  A+++ GEK WR+P+EESY
Sbjct  444   CNQGVDKIVDLATLTGACIVALGPSIAGVFTPSDDLAKEVFAASEISGEKFWRLPMEESY  503

Query  1637  WETMKSSIADMINAGSLDGDAITASLFMK  1723
             WE+MKS IADM+N G+  G +ITA+LF+K
Sbjct  504   WESMKSGIADMLNTGARQGGSITAALFLK  532



>ref|XP_004287132.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=575

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/508 (68%), Positives = 413/508 (81%), Gaps = 12/508 (2%)
 Frame = +2

Query  230   KLNNGSSQILSF---------GSYMAHSVALATLGLTKPN-QIQRPKILIAAREVDLLEW  379
             KL +  S  LSF         G +MAH++A ATLGLT+ +   + PK+  A +E+D+ EW
Sbjct  27    KLRSAPSLRLSFTVSPLCSRRGRHMAHTIARATLGLTQISPAFEAPKLTFATKEIDVTEW  86

Query  380   KGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLP  559
             KGD+LAVGVTEKD+A+D NSKF+N IL+KLDS LGG+L+E S+EEDF+GKSGQS V+RLP
Sbjct  87    KGDLLAVGVTEKDLAKDQNSKFENPILKKLDSHLGGVLAEVSTEEDFTGKSGQSTVVRLP  146

Query  560   GLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAA  739
             GLGSKR+GL GLG   ++T A++ LGE  AAAAK+AQAS +A+ LAS+EGLS +S    A
Sbjct  147   GLGSKRVGLFGLGQSATATAAFKGLGEAAAAAAKTAQASDIAIVLASSEGLSAKS--CTA  204

Query  740   SAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKEL  919
             SA+A+G V G +EDNR+K E K P LKSV+ILGLGTGPE+EKKLKY++ V+SG+IF KEL
Sbjct  205   SAIASGAVLGIYEDNRYKSESKKPALKSVDILGLGTGPELEKKLKYAQDVASGIIFGKEL  264

Query  920   VNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFI  1099
             VN+PANVLTPG LAEEA NIASLYSDVL+A IL+ EQCK+LKMGS+L VAAA+ NP +FI
Sbjct  265   VNSPANVLTPGKLAEEASNIASLYSDVLSAKILNEEQCKDLKMGSYLAVAAASANPPHFI  324

Query  1100  HLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaia  1279
             HL YKP  G  K KLAL+GKG+TFDSGGYN+K G   SIELMK DM G+A V GAAKAI 
Sbjct  325   HLTYKPPGGPAKLKLALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIG  384

Query  1280  QIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYAS  1459
             QIKP+GVEVHFIV ACENMISGTGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA 
Sbjct  385   QIKPSGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYAC  444

Query  1460  KLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYW  1639
               GV+K+VDLATLTGACI ALG S+AG+FTPS+DLAKEV  A+++ GEK WRMP+EESYW
Sbjct  445   NQGVDKIVDLATLTGACIVALGPSIAGVFTPSDDLAKEVFAASEISGEKFWRMPMEESYW  504

Query  1640  ETMKSSIADMINAGSLDGDAITASLFMK  1723
             ETMKS +ADM+N G   G AI+A+LF+K
Sbjct  505   ETMKSGVADMVNTGGRQGGAISAALFLK  532



>gb|AAL11627.1|AF424634_1 AT4g30920/F6I18_170 [Arabidopsis thaliana]
 gb|AAO11568.1| At4g30920/F6I18_170 [Arabidopsis thaliana]
Length=583

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/483 (71%), Positives = 406/483 (84%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAH+++ ATLGLT+ N +  PKI  + +E+D+ E KGDILAVGVTEKDMA+D NSKF+N 
Sbjct  57    MAHTISHATLGLTQANSVDHPKISFSGKEIDVTEGKGDILAVGVTEKDMAKDVNSKFENP  116

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL+KLD+ LGGLL++ SSEEDFSGK GQS VLRLPGLGSKR+GL+GLG   S+  A+++L
Sbjct  117   ILKKLDAHLGGLLADVSSEEDFSGKPGQSTVLRLPGLGSKRVGLIGLGKSASTPSAFQSL  176

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +AAAAK++QASSVAV LAS+E +S ESKL +ASA+A+G V G FED+R+K E K P+
Sbjct  177   GEAVAAAAKASQASSVAVVLASSESVSNESKLCSASAIASGTVLGLFEDSRYKSESKKPS  236

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKSV+I+G G+GPE+EKKLKY+E VS GVIF KELVN+PANVLTP  LAEEA N+AS+YS
Sbjct  237   LKSVDIIGFGSGPELEKKLKYAEHVSYGVIFGKELVNSPANVLTPAVLAEEALNLASMYS  296

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV+TA IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKPSSG VKTKLAL+GKG+TFD
Sbjct  297   DVMTANILNEEQCKELKMGSYLAVAAASANPPHFIHLIYKPSSGPVKTKLALVGKGLTFD  356

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G    IELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISGTGM
Sbjct  357   SGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTGM  416

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD+LTASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+
Sbjct  417   RPGDVLTASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKVVDLATLTGACIIALGTSM  476

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AGI+TPS+ LAKEV+ A++  GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+L
Sbjct  477   AGIYTPSDKLAKEVIAASERSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGSITAAL  536

Query  1715  FMK  1723
             F+K
Sbjct  537   FLK  539



>ref|XP_008242990.1| PREDICTED: leucine aminopeptidase 1 [Prunus mume]
Length=574

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/486 (70%), Positives = 401/486 (83%), Gaps = 2/486 (0%)
 Frame = +2

Query  266   GSYMAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKF  445
             G  MAH++A ATLGLT P+ +  PKI  AA+++D+ EWKGD+LAVGVTEKD+A+D NS+F
Sbjct  48    GKLMAHTLARATLGLTLPSGVDAPKISFAAKDIDVTEWKGDLLAVGVTEKDLAKDENSEF  107

Query  446   QNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAY  625
             QN IL+ LDS+LGGLL+EASSEEDF+GKSGQS V+RLPGLGSKRIGL GLG   SST A+
Sbjct  108   QNSILKNLDSRLGGLLAEASSEEDFTGKSGQSTVVRLPGLGSKRIGLFGLGQSASSTAAF  167

Query  626   RTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPK  805
             R LGE  A AAK+ QAS +AV LAS+EGLS +S  + ASA+A+G V G +ED+R+K E K
Sbjct  168   RGLGEAAATAAKATQASDLAVVLASSEGLSAKS--NTASAIASGTVLGIYEDSRYKSESK  225

Query  806   TPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIAS  985
                LKSV+ILGLGTGPE+EKKLKY+E V+SG+IF KELVN+PANVLTPG LAEEA  IAS
Sbjct  226   KSALKSVDILGLGTGPEVEKKLKYAEDVTSGIIFGKELVNSPANVLTPGKLAEEASKIAS  285

Query  986   LYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGI  1165
              YSDVL+A IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKP  G  K KL L+GKG+
Sbjct  286   TYSDVLSAKILNEEQCKELKMGSYLAVAAASANPPHFIHLIYKPPGGPAKVKLGLVGKGL  345

Query  1166  TFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISG  1345
             TFDSGGYN+K G   SIELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISG
Sbjct  346   TFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISG  405

Query  1346  TGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALG  1525
             TG+RPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG
Sbjct  406   TGVRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALG  465

Query  1526  RSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAIT  1705
              S+AG+FTPS+DLAKEV  A+++ GEK WR+PLEESYWE+MKS IADM+N G   G +I+
Sbjct  466   PSIAGVFTPSDDLAKEVFAASELSGEKFWRLPLEESYWESMKSGIADMVNTGGRPGGSIS  525

Query  1706  ASLFMK  1723
             A+LF+K
Sbjct  526   AALFLK  531



>ref|XP_010432926.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Camelina 
sativa]
Length=584

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/483 (71%), Positives = 403/483 (83%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAH++A ATLGLT  N +  PKI  + +E+D+ EWKGDILAVGVTEKDM +D NSKF+N 
Sbjct  58    MAHTIAQATLGLTHANSVDHPKISFSGKEIDVTEWKGDILAVGVTEKDMTKDANSKFENP  117

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL+KLD+ LGGLL++ SSEEDFSGK GQS VLRLPGLGSKR+GL+GLG   SS  A+++L
Sbjct  118   ILKKLDAHLGGLLADVSSEEDFSGKPGQSTVLRLPGLGSKRVGLIGLGKSASSPSAFQSL  177

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +AAAAK++QASSVAV LAS+E +S ESKLS+ASA+A+G V G FED R+K E K P+
Sbjct  178   GEAVAAAAKASQASSVAVVLASSETVSNESKLSSASAIASGTVLGLFEDCRYKSESKKPS  237

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKSV+I+G GTGPE+EKKLKY+E VS GVIF KELVN+PANVLTP  LAEEA  +AS+YS
Sbjct  238   LKSVDIIGFGTGPELEKKLKYAEDVSYGVIFGKELVNSPANVLTPAVLAEEASKLASMYS  297

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV+TA IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKPSSG VKTKLA++GKG+TFD
Sbjct  298   DVMTANILNEEQCKELKMGSYLAVAAASANPPHFIHLVYKPSSGPVKTKLAIVGKGLTFD  357

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G    IELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISGTGM
Sbjct  358   SGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTGM  417

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGDI+TASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+
Sbjct  418   RPGDIITASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKVVDLATLTGACIIALGTSM  477

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             A I+T S++LAKEV+ A++  GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+L
Sbjct  478   AAIYTSSDELAKEVIAASERSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGSITAAL  537

Query  1715  FMK  1723
             F+K
Sbjct  538   FLK  540



>emb|CDX68703.1| BnaC01g07500D [Brassica napus]
Length=582

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/480 (71%), Positives = 404/480 (84%), Gaps = 2/480 (0%)
 Frame = +2

Query  284   SVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQ  463
             +++ ATLGLT+ N I  PK+  AA++VD+ EWKGDILAVGVTEKDMA+D NSKFQN IL 
Sbjct  61    TLSQATLGLTQANSIDHPKVTFAAKDVDVTEWKGDILAVGVTEKDMAKDVNSKFQNPILS  120

Query  464   KLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGET  643
             KLD+ LGGLL++ SSEEDFSGK GQS VLRLPGLGSKR+GL+GLG   SS  A+++LGE 
Sbjct  121   KLDAHLGGLLADVSSEEDFSGKPGQSTVLRLPGLGSKRVGLIGLGKSASSPSAFQSLGEA  180

Query  644   IaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKS  823
             +AAAAK++QASSVAV LAS+E  S ESKL++ASA+A+G V G FED+R+K E K P+LKS
Sbjct  181   VAAAAKASQASSVAVVLASSE--SNESKLTSASAIASGTVLGLFEDSRYKSESKKPSLKS  238

Query  824   VEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVL  1003
             V+I+G GTGPE+EKKLKY+E VS GVIF +ELVN+PANVLTP  LAEEA N+AS+YSDV+
Sbjct  239   VDIIGFGTGPELEKKLKYAEDVSYGVIFGRELVNSPANVLTPAVLAEEASNLASMYSDVM  298

Query  1004  TATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGG  1183
             TA IL+ EQCKELKMGS+L VAAA+ NP  FIHL YKPSSG VKTKLAL+GKG+TFDSGG
Sbjct  299   TANILNEEQCKELKMGSYLAVAAASANPPRFIHLVYKPSSGPVKTKLALVGKGLTFDSGG  358

Query  1184  YNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPG  1363
             YN+K G    IELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISGTGMRPG
Sbjct  359   YNIKTGPGCLIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTGMRPG  418

Query  1364  DILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGI  1543
             D+LTASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+AGI
Sbjct  419   DVLTASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKVVDLATLTGACIVALGNSMAGI  478

Query  1544  FTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +TPS++LAKEV+ A++  GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+LF+K
Sbjct  479   YTPSDELAKEVIAASERSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGSITAALFLK  538



>ref|XP_007204206.1| hypothetical protein PRUPE_ppa003434mg [Prunus persica]
 gb|EMJ05405.1| hypothetical protein PRUPE_ppa003434mg [Prunus persica]
Length=574

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/486 (70%), Positives = 400/486 (82%), Gaps = 2/486 (0%)
 Frame = +2

Query  266   GSYMAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKF  445
             G  MAH++A ATLGLT P+ +  PKI  A +++D+ EWKGD+LAVGVTEKD+A+D NSKF
Sbjct  48    GKLMAHTLARATLGLTFPSGLDAPKISFAVKDIDVTEWKGDLLAVGVTEKDLAKDENSKF  107

Query  446   QNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAY  625
             QN IL+ LDS+LGGLL+EASSEEDF+GKSGQS V+RLPGLGSKRIGL GLG   SST A+
Sbjct  108   QNSILKNLDSRLGGLLAEASSEEDFTGKSGQSTVVRLPGLGSKRIGLFGLGQSASSTAAF  167

Query  626   RTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPK  805
             R LGE  A AAK+ QAS +A+ LAS+EGLS +S  + ASA+A+G V G +ED+R+K E K
Sbjct  168   RGLGEAAATAAKATQASDLAIVLASSEGLSAKS--NTASAIASGTVLGIYEDSRYKSESK  225

Query  806   TPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIAS  985
                LKSV+ILGLGTGPE+EKKLKY+E V+SG+IF KELVN+PANVLTPG LAEEA  IAS
Sbjct  226   KSALKSVDILGLGTGPEVEKKLKYAEDVTSGIIFGKELVNSPANVLTPGKLAEEASKIAS  285

Query  986   LYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGI  1165
              YSDVL+A IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKP  G  K KL L+GKG+
Sbjct  286   TYSDVLSAKILNEEQCKELKMGSYLAVAAASANPPHFIHLIYKPPGGPAKVKLGLVGKGL  345

Query  1166  TFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISG  1345
             TFDSGGYN+K G   SIELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISG
Sbjct  346   TFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISG  405

Query  1346  TGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALG  1525
             TG+RPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG
Sbjct  406   TGVRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALG  465

Query  1526  RSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAIT  1705
              S+AG+FTPS+DLAKEV  A+++ GEK WR+PLEESYWE+MKS IADM+N G   G +I+
Sbjct  466   PSIAGVFTPSDDLAKEVFAASELSGEKFWRLPLEESYWESMKSGIADMVNTGGRPGGSIS  525

Query  1706  ASLFMK  1723
             A+LF+K
Sbjct  526   AALFLK  531



>ref|XP_010438109.1| PREDICTED: leucine aminopeptidase 3, chloroplastic [Camelina 
sativa]
Length=583

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/483 (71%), Positives = 403/483 (83%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAH++A ATLGLT  N +  PKI  + +E+D+ EWKGDILAVGVTEKDM +D NSKF+N 
Sbjct  57    MAHTIAQATLGLTHANSVDHPKISFSGKEMDVTEWKGDILAVGVTEKDMTKDANSKFENP  116

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL+KLD+ LGGLL++ SSEEDFSGK GQS VLRLPGLGSKR+GL+GLG   SS  A+++L
Sbjct  117   ILKKLDAHLGGLLADVSSEEDFSGKPGQSTVLRLPGLGSKRVGLIGLGKSASSPSAFQSL  176

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +AAAAK++QASSVAV LAS+E +S ESKLS+ASA+A+G V G FED R+K E K P+
Sbjct  177   GEAVAAAAKASQASSVAVVLASSETVSNESKLSSASAIASGTVLGLFEDCRYKSESKKPS  236

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKSV+I+G GTGPE+EKKLKY+E VS GVIF KELVN+PANVLTP  LAEEA  +AS+YS
Sbjct  237   LKSVDIIGFGTGPELEKKLKYAEDVSYGVIFGKELVNSPANVLTPAVLAEEASKLASMYS  296

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV+TA IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKPSSG VKTKLA++GKG+TFD
Sbjct  297   DVMTANILNEEQCKELKMGSYLAVAAASANPPHFIHLVYKPSSGPVKTKLAIVGKGLTFD  356

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G    IELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISGTGM
Sbjct  357   SGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTGM  416

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGDI+TASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+
Sbjct  417   RPGDIITASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKVVDLATLTGACIIALGTSM  476

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             A I+T S++LAKEV+ A++  GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+L
Sbjct  477   AAIYTSSDELAKEVIAASERSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGSITAAL  536

Query  1715  FMK  1723
             F+K
Sbjct  537   FLK  539



>ref|XP_010929163.1| PREDICTED: leucine aminopeptidase 1-like [Elaeis guineensis]
Length=604

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/487 (70%), Positives = 400/487 (82%), Gaps = 4/487 (1%)
 Frame = +2

Query  275   MAHSVAL--ATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQ  448
             M H  A   ATLGLTKP  ++ P+I  AA+E+D  EWKGDILAV V+EKDM++D NS F+
Sbjct  75    MGHVTAATRATLGLTKPAVVEIPQITFAAKEIDFAEWKGDILAVAVSEKDMSKDSNSTFE  134

Query  449   NLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG--SVVSSTIA  622
             N IL++LD KLGGLL+EAS EEDF+GK+GQS VLRLPGLG KRIGLVGLG  S  S+T A
Sbjct  135   NSILKRLDEKLGGLLAEASVEEDFTGKAGQSTVLRLPGLGFKRIGLVGLGQCSPSSTTTA  194

Query  623   YRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEP  802
             YR++GE+IA  AK+AQAS+ AV LAS   +S E KL+ ASA+A+G V G +EDNRFK + 
Sbjct  195   YRSIGESIAVVAKAAQASNAAVVLASCNEISEEFKLNTASAIASGTVLGVYEDNRFKSDS  254

Query  803   KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIA  982
             K   LK+V+I+GLG+GPE+++KLKY+  V SGVIF KELVNAPANVLTPG LAEEA  +A
Sbjct  255   KKTHLKAVDIIGLGSGPELDRKLKYASDVCSGVIFGKELVNAPANVLTPGVLAEEASKVA  314

Query  983   SLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKG  1162
             S YSDVLTATILD EQC ELKMGS+LGVAAA++NP +FIHLCYKP  G VK KLA++GKG
Sbjct  315   SSYSDVLTATILDAEQCTELKMGSYLGVAAASSNPPHFIHLCYKPPDGDVKRKLAIVGKG  374

Query  1163  ITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMIS  1342
             +TFDSGGYN+K G   SIELMK DM G+A  FGAAKAIAQIKP GVEVHFIV ACENMIS
Sbjct  375   LTFDSGGYNIKTGPGCSIELMKFDMGGSAATFGAAKAIAQIKPPGVEVHFIVAACENMIS  434

Query  1343  GTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITAL  1522
             GTGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGACI AL
Sbjct  435   GTGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACIVAL  494

Query  1523  GRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAI  1702
             G S+AG FTPS+DLAKE++ A+++ GEK WRMPLEESYWE+MKS +ADM+N G   G AI
Sbjct  495   GPSIAGFFTPSDDLAKEIVAASEITGEKFWRMPLEESYWESMKSGVADMVNTGGRQGGAI  554

Query  1703  TASLFMK  1723
             TA+LF+K
Sbjct  555   TAALFLK  561



>ref|XP_007138276.1| hypothetical protein PHAVU_009G195000g [Phaseolus vulgaris]
 gb|ESW10270.1| hypothetical protein PHAVU_009G195000g [Phaseolus vulgaris]
Length=577

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/480 (70%), Positives = 402/480 (84%), Gaps = 1/480 (0%)
 Frame = +2

Query  287   VALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQK  466
             +A A+LGLT+P+  + PK+  A++EVD+++WKGD+LA+GVTEKD+A +  +KFQN IL  
Sbjct  55    MACASLGLTRPSNTETPKVSFASKEVDVVQWKGDLLAIGVTEKDLAPNAEAKFQNAILNA  114

Query  467   LDSKLGGLLSEASSEEDFSGKSGQSIVLRLP-GLGSKRIGLVGLGSVVSSTIAYRTLGET  643
             LDSKLGGLL +ASSEEDF+GK GQS+VLR+  GLGSKR+ L+GLG+  SS  A+++LGE 
Sbjct  115   LDSKLGGLLGQASSEEDFTGKPGQSVVLRIADGLGSKRVALLGLGASASSFAAFKSLGEA  174

Query  644   IaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKS  823
             +AAAAKSAQA  VAVALAS++  SVESKL+AASA+A+G V GTFEDNR++ E K   LKS
Sbjct  175   VAAAAKSAQAGHVAVALASSDAFSVESKLNAASAIASGTVLGTFEDNRYRSESKKSALKS  234

Query  824   VEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVL  1003
             V+I+GLG+GPE+EKKLK++  VSSG+IF +ELVN+PANVLTPG LAEEA  IA+ YSDV 
Sbjct  235   VDIIGLGSGPELEKKLKFATDVSSGIIFGRELVNSPANVLTPGVLAEEASKIAATYSDVF  294

Query  1004  TATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGG  1183
             TA ILD EQCKELKMGS+LGVAAA+ NP +FIHLCYKP +G V  KLAL+GKG+TFDSGG
Sbjct  295   TAKILDAEQCKELKMGSYLGVAAASANPPHFIHLCYKPPTGPVNVKLALVGKGLTFDSGG  354

Query  1184  YNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPG  1363
             YN+K G    IELMK DM G+A V GAAKA+ QIKP GVEVHFIV ACENMISGTGMRPG
Sbjct  355   YNIKTGPGCLIELMKFDMGGSAAVLGAAKALGQIKPLGVEVHFIVAACENMISGTGMRPG  414

Query  1364  DILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGI  1543
             DILTASNGK IEV +TDAEGRL LADALVYA   G EK+VDLATLTGACI ALG S+AG+
Sbjct  415   DILTASNGKTIEVNNTDAEGRLTLADALVYACNQGAEKIVDLATLTGACIIALGSSIAGV  474

Query  1544  FTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             FTPS+DLAKEV EA++  GEKLWR+PLEESYWE+MKS +ADM+N GS  G AITA+LF+K
Sbjct  475   FTPSDDLAKEVFEASEASGEKLWRLPLEESYWESMKSGVADMVNTGSRPGSAITAALFLK  534



>gb|KHG12351.1| Leucine aminopeptidase 1 -like protein [Gossypium arboreum]
Length=522

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/483 (70%), Positives = 399/483 (83%), Gaps = 5/483 (1%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAH     TLGLT+P  I+ PKI  AA+E+D+ EWKGD+LAVGVTEKDM +D NSKFQN 
Sbjct  1     MAH-----TLGLTQPANIELPKISFAAKEIDVAEWKGDLLAVGVTEKDMTKDENSKFQNP  55

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL+KLD  LG LL+EAS EEDF+GK+GQS+V RLPGLGSKR+GL GLG   SS  A+  L
Sbjct  56    ILKKLDGLLGSLLAEASFEEDFTGKAGQSLVHRLPGLGSKRVGLFGLGQSASSPAAFHGL  115

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +AAAAK+AQASS AV LAS+E  SV SK + A+A+ +G V G +EDNR+K E K P 
Sbjct  116   GEAVAAAAKTAQASSAAVILASSECPSVMSKGNTAAAIVSGTVLGLYEDNRYKSESKKPQ  175

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKS++ILGLGTGPEIEKK+KY+EVVS  +IF +ELVN+PANVLTP ALA EA  IASLYS
Sbjct  176   LKSLDILGLGTGPEIEKKIKYAEVVSCAIIFGRELVNSPANVLTPAALAAEASKIASLYS  235

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DVL+A IL  EQC+ELKMGS+LGVAAA+ NP +FIHLCYKP SGSVKTKLAL+GKG+TFD
Sbjct  236   DVLSANILTEEQCRELKMGSYLGVAAASANPPHFIHLCYKPPSGSVKTKLALVGKGLTFD  295

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G  SSIE MK DM G+A VFGAAKA+ QIKP+GVEVHFIV +CENMISG GM
Sbjct  296   SGGYNIKTGPGSSIETMKVDMGGSAAVFGAAKALGQIKPSGVEVHFIVASCENMISGKGM  355

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG S+
Sbjct  356   RPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGPSI  415

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AG+FTP++DLAKE+ +A++  GEKLWRMPLEESYWE+MKS +ADM+N G   G AI A+L
Sbjct  416   AGVFTPNDDLAKELFQASEASGEKLWRMPLEESYWESMKSGVADMVNTGGRQGGAINAAL  475

Query  1715  FMK  1723
             F+K
Sbjct  476   FLK  478



>ref|XP_004144730.1| PREDICTED: leucine aminopeptidase 1-like [Cucumis sativus]
 ref|XP_004168114.1| PREDICTED: leucine aminopeptidase 1-like [Cucumis sativus]
 gb|KGN61048.1| hypothetical protein Csa_2G035480 [Cucumis sativus]
Length=585

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/486 (68%), Positives = 405/486 (83%), Gaps = 0/486 (0%)
 Frame = +2

Query  266   GSYMAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKF  445
             G +MAHS+A A LGLT P+  + P+I   A+++D+LEWKGD+LAVGVTEKD+A+D NSKF
Sbjct  57    GKFMAHSLAQANLGLTNPSPNETPQISFGAKDIDVLEWKGDLLAVGVTEKDVAKDENSKF  116

Query  446   QNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAY  625
             +N IL KLDS+LGGLL+EAS+EEDF+GK+GQS VLR PGLG+KR+ L+GLG   S+  A+
Sbjct  117   KNPILNKLDSRLGGLLAEASAEEDFTGKAGQSTVLRFPGLGTKRVSLIGLGQSASNVAAF  176

Query  626   RTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPK  805
             R+LGE +A+AAK++QAS VA++LAS E LS ESK + ASA+A+G + G FED R+K E K
Sbjct  177   RSLGEAVASAAKASQASEVAISLASPEELSSESKPNFASAIASGTILGIFEDTRYKSESK  236

Query  806   TPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIAS  985
                LKSVEI+GLG+G E+EKKLK+++ VSSG+I  +ELVN+PANVLTPGALA EA  IAS
Sbjct  237   KSALKSVEIIGLGSGAEVEKKLKFAQDVSSGIILGRELVNSPANVLTPGALAAEASKIAS  296

Query  986   LYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGI  1165
              YSDVL+ATIL+ EQCKEL MGS+LGVAAA+TNP +FIHL YKP SG V  KL L+GKG+
Sbjct  297   TYSDVLSATILNEEQCKELNMGSYLGVAAASTNPPHFIHLHYKPPSGPVSVKLGLVGKGL  356

Query  1166  TFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISG  1345
             TFDSGGYN+K G   SIE+MK DM G+A V GAAKAI QIKP GVE+HF++ ACENMISG
Sbjct  357   TFDSGGYNIKTGPGCSIEIMKTDMGGSAAVLGAAKAIGQIKPLGVEIHFVIAACENMISG  416

Query  1346  TGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALG  1525
             TGMRPGDI+TASNGK IEV +TDAEGRL LADALVY  K GV+K++DLATLTGACI ALG
Sbjct  417   TGMRPGDIITASNGKTIEVNNTDAEGRLTLADALVYTCKQGVDKVIDLATLTGACIVALG  476

Query  1526  RSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAIT  1705
              S+AGIFTPS+DLAKEVL A+++ GEK WRMP+E+SYWE+MKSS+ADM+N G   G AIT
Sbjct  477   PSIAGIFTPSDDLAKEVLAASEISGEKFWRMPMEDSYWESMKSSVADMVNTGGRPGGAIT  536

Query  1706  ASLFMK  1723
             A+LF+K
Sbjct  537   AALFLK  542



>ref|XP_008384407.1| PREDICTED: leucine aminopeptidase 1-like [Malus domestica]
Length=575

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/509 (67%), Positives = 403/509 (79%), Gaps = 11/509 (2%)
 Frame = +2

Query  224   LQKLNNGSSQILSF---------GSYMAHSVALATLGLTKPNQIQRPKILIAAREVDLLE  376
             L KL +  S  LSF         G  MAH++A A LGLT P+ I  PKI  AA+E+D  E
Sbjct  26    LTKLRSAHSLRLSFAVTHLCSRRGKLMAHTLAQANLGLTXPSCIDAPKISFAAKELDAAE  85

Query  377   WKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRL  556
             WKGD+LAVGVT KD+A+D NSKFQN +L+KLDS LGGLL+EASSEEDF+GKSGQS V+RL
Sbjct  86    WKGDLLAVGVTVKDLAKDENSKFQNSVLKKLDSHLGGLLAEASSEEDFTGKSGQSTVVRL  145

Query  557   PGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSA  736
             PGLGSKR+GL GLG    ST A++ LGE  AAAAK+ QA  +A+ LAS+EG+S +S  + 
Sbjct  146   PGLGSKRVGLFGLGQSAXSTEAFQGLGEAXAAAAKAVQAGDIAIVLASSEGISAKS--NT  203

Query  737   ASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKE  916
             ASA+A+G V G +EDNR+K E K   LKSV ILGLGTGPE+EKKL Y+E V+SG+IF KE
Sbjct  204   ASAIASGTVLGIYEDNRYKSESKKSVLKSVXILGLGTGPEVEKKLXYAEDVTSGIIFGKE  263

Query  917   LVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYF  1096
             LVN+PANVLTPG LAEEA  IAS YSDVL+A +L+ EQCKELKMGS+L VAAA+ NP +F
Sbjct  264   LVNSPANVLTPGKLAEEASKIASTYSDVLSANVLNEEQCKELKMGSYLAVAAASANPPHF  323

Query  1097  IHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakai  1276
             IHL YKP  G  K KL L+GKG+TFDSGGYN+K G   S+ELMK DM G+A + GAAKAI
Sbjct  324   IHLIYKPPGGPAKVKLGLVGKGLTFDSGGYNIKTGPGCSVELMKFDMGGSAAILGAAKAI  383

Query  1277  aQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYA  1456
             AQIKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA
Sbjct  384   AQIKPPGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYA  443

Query  1457  SKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESY  1636
                GV+K+VDLATLTGAC+ ALG S+AG+FTPS+DLAKEV  A+++ GEK WR+PLEESY
Sbjct  444   CNQGVDKIVDLATLTGACVVALGPSIAGVFTPSDDLAKEVFAASEISGEKFWRLPLEESY  503

Query  1637  WETMKSSIADMINAGSLDGDAITASLFMK  1723
             WETMKS IADM+N G   G +I A+LF+K
Sbjct  504   WETMKSGIADMLNTGGRAGGSINAALFLK  532



>ref|XP_009415506.1| PREDICTED: leucine aminopeptidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=591

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/474 (69%), Positives = 397/474 (84%), Gaps = 0/474 (0%)
 Frame = +2

Query  302   LGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKL  481
             LGLTKP  ++ P+I  AARE+D +EWKGDILAV V+EKDM +D +SKF+NL+L++LD KL
Sbjct  75    LGLTKPAAVEIPQIAFAARELDFVEWKGDILAVAVSEKDMKKDSDSKFENLVLKRLDEKL  134

Query  482   GGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaak  661
             GG+L+EAS+EEDF+GKSGQS VLRLPGLG KR+GL+GLGS  SS  AY+ +GE +AA AK
Sbjct  135   GGILAEASTEEDFTGKSGQSTVLRLPGLGFKRLGLLGLGSPSSSVTAYQGIGEAVAAVAK  194

Query  662   saqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGL  841
             +AQAS+ AV LAS +G+S E+KL AASA+A+G V G +EDNRFK E K P LK+V+I+G 
Sbjct  195   AAQASNAAVCLASLDGMSEEAKLHAASAIASGTVLGVYEDNRFKSESKKPLLKTVDIIGF  254

Query  842   GTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILD  1021
             G+G ++++KLKY+  V SGVIF KELVNAPANVLTPG +AEEA  IA+LYSDV T TILD
Sbjct  255   GSGEQVDQKLKYATDVCSGVIFGKELVNAPANVLTPGVMAEEASKIATLYSDVFTVTILD  314

Query  1022  VEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIG  1201
              EQCKELKMGS+LGVAAA++NP +FIHLCYKPSSG VK KLA++GKG+TFDSGGYN+K G
Sbjct  315   AEQCKELKMGSYLGVAAASSNPPHFIHLCYKPSSGDVKRKLAIVGKGLTFDSGGYNIKTG  374

Query  1202  ANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTAS  1381
                SIELMK DM GAA   GAAKA+ +IKP GVEVHFIV ACENMISGTGMRPGDI+TAS
Sbjct  375   PGCSIELMKFDMGGAAATLGAAKALGEIKPPGVEVHFIVAACENMISGTGMRPGDIVTAS  434

Query  1382  NGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSED  1561
             NGK IEV +TDAEGRL LADAL+YA   G+EK+VDLATLTGAC+ ALG S+AG F+P++D
Sbjct  435   NGKTIEVNNTDAEGRLTLADALIYACNQGIEKVVDLATLTGACVVALGPSIAGFFSPNDD  494

Query  1562  LAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             LAKE++ A++  GEK WRMPLE+SYWE+MKS +ADM+N G   G AITA+LF+K
Sbjct  495   LAKEIVAASEATGEKFWRMPLEDSYWESMKSGVADMVNTGGRQGGAITAALFLK  548



>ref|XP_003610319.1| Leucine aminopeptidase [Medicago truncatula]
 gb|AES92516.1| cytosol aminopeptidase family protein [Medicago truncatula]
Length=567

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/475 (69%), Positives = 394/475 (83%), Gaps = 0/475 (0%)
 Frame = +2

Query  299   TLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSK  478
             TLGLT P  I+ PKI  +A +VD+ EWKGDILAVGVTEKD+ RD  S+F+N IL K+D K
Sbjct  50    TLGLTHPTNIEAPKISFSATDVDVTEWKGDILAVGVTEKDLTRDAKSRFENSILNKIDLK  109

Query  479   LGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaa  658
             L GLLSEASSEEDFSGK GQS V+R+ GLGSKR+GL+GLG + S+T  Y+ LGE + A A
Sbjct  110   LDGLLSEASSEEDFSGKVGQSTVVRIKGLGSKRVGLIGLGQLPSTTALYKGLGEAVVAVA  169

Query  659   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  838
             KSAQAS+VA+ LAS+EGLS ESKLS A A+A+G V G FED R+K E K P ++S++I+G
Sbjct  170   KSAQASNVAIVLASSEGLSSESKLSTAYAIASGAVLGLFEDQRYKSESKKPAVRSIDIIG  229

Query  839   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1018
             LGTGP++EKKLKY+  VSSG+IF +ELVN+PANVLTPG LAEEA  +AS YSDV TA IL
Sbjct  230   LGTGPDLEKKLKYAGDVSSGIIFGRELVNSPANVLTPGVLAEEASKVASTYSDVFTAKIL  289

Query  1019  DVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKI  1198
             D +QCKELKMGS+LGVAAA+ NP  FIHL YKP SGSVK KLAL+GKG+TFDSGGYN+K 
Sbjct  290   DADQCKELKMGSYLGVAAASANPPRFIHLTYKPPSGSVKVKLALVGKGLTFDSGGYNIKT  349

Query  1199  GANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTA  1378
             G   SIELMK DM G+A V GAAKA+ QIKP GVEVHFIV ACENMISGTGMRPGD++TA
Sbjct  350   GPGCSIELMKFDMGGSAAVLGAAKALGQIKPLGVEVHFIVAACENMISGTGMRPGDVVTA  409

Query  1379  SNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSE  1558
             SNGK IEV +TDAEGRL LADALVYA   GVEK++DLATLTGAC+ ALG S+AG+F+P++
Sbjct  410   SNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIIDLATLTGACVVALGPSIAGVFSPND  469

Query  1559  DLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +L KEVLEA++V GEKLWR+P+EESYWE+MKS +ADM+N G   G +ITA+LF+K
Sbjct  470   ELVKEVLEASEVSGEKLWRLPIEESYWESMKSGVADMVNTGGRPGGSITAALFLK  524



>ref|XP_002867322.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43581.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=582

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/483 (70%), Positives = 404/483 (84%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             M+H++A ATLGLT+ N +  PKI  + +E+D+ EWKGDILAVGV EKDM +D NSKF+N 
Sbjct  57    MSHTIAHATLGLTQANSVDHPKISFSGKEIDVTEWKGDILAVGVMEKDMTKDANSKFENP  116

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL+KLD+ LGGLL++ SSEEDFSGK GQ  VLRL GLGSKR+GL+GLG   SS  A+++L
Sbjct  117   ILKKLDAHLGGLLADVSSEEDFSGKPGQYTVLRLRGLGSKRVGLIGLGKSASSPSAFQSL  176

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +AAAAK++QASSVAV LAS+E +S ESKLS+ASA+A+G V G FED+R+K E K P+
Sbjct  177   GEAVAAAAKASQASSVAVVLASSESVSNESKLSSASAIASGTVLGLFEDSRYKSESKKPS  236

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKSV+I+G GTGPE+E+KLKY+E VS GVIF KELVN+PANVLTP  LAEEA N+AS+YS
Sbjct  237   LKSVDIIGFGTGPELEEKLKYAEHVSYGVIFGKELVNSPANVLTPAVLAEEASNLASMYS  296

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV+TA IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKPSSG VKTKLAL+GKG+TFD
Sbjct  297   DVMTANILNEEQCKELKMGSYLAVAAASANPPHFIHLIYKPSSGPVKTKLALVGKGLTFD  356

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+KIG +  IELMK D+ G+A V G AKAI QIKP GVEVHFIV ACENMISGTGM
Sbjct  357   SGGYNIKIGPDMIIELMKIDVGGSAAVLGVAKAIGQIKPPGVEVHFIVAACENMISGTGM  416

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD++TASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGA I ALG S+
Sbjct  417   RPGDVITASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGAIIVALGPSM  476

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AG++T S++LAKEV  A++  GEKLWRMP+EE YWE MKSS+ADM+N G   GD+ITA+L
Sbjct  477   AGMYTASDELAKEVTAASERSGEKLWRMPMEERYWEMMKSSVADMVNLGGHAGDSITAAL  536

Query  1715  FMK  1723
             F+K
Sbjct  537   FLK  539



>emb|CAA48038.1| leucine aminopeptidase [Solanum tuberosum]
Length=554

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/484 (70%), Positives = 401/484 (83%), Gaps = 4/484 (1%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             + H +A  TLGLT+PN+   PKI I A++ D+++W+GD+LA+G TE D+ARD NSKF+N 
Sbjct  31    IVHCIAGDTLGLTRPNESDAPKISIGAKDTDVVQWQGDLLAIGATENDLARDDNSKFKNP  90

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             +LQ+LDSKL GLLS ASSEEDFSGKSGQSI LRLPG    RI LVGLGS  SS  +Y +L
Sbjct  91    LLQRLDSKLNGLLSAASSEEDFSGKSGQSINLRLPG---GRITLVGLGSSASSPTSYHSL  147

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE  AAAAKSAQA ++AV+LAS +GLS ESK+++ASA+ATG++ G FEDNRF+ E KTP 
Sbjct  148   GEAAAAAAKSAQARNIAVSLASTDGLSAESKINSASAIATGVMLGIFEDNRFRSESKTPA  207

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             L+S++ILGLGTGPEIE K+KY+E V +GVI  +ELVNAPAN++TPGALAEEAK IAS YS
Sbjct  208   LESLDILGLGTGPEIESKIKYAEHVCAGVILGRELVNAPANIVTPGALAEEAKKIASTYS  267

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAAT-NPSYFIHLCYKPSSGSVKTKLALLGKGITF  1171
             DV+T  ILD EQCKELKMG++LGVAAAAT NP YFIHLC+K +S   KTK+AL+GKG+TF
Sbjct  268   DVITVNILDAEQCKELKMGAYLGVAAAATENPPYFIHLCFKTNSRERKTKIALVGKGLTF  327

Query  1172  DSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTG  1351
             DSGGYNLK GA S IELMK DM GAA V GAAKA+ +IKP GVEVHFIV ACENMISG G
Sbjct  328   DSGGYNLKTGAGSKIELMKNDMGGAAAVLGAAKALGEIKPRGVEVHFIVAACENMISGAG  387

Query  1352  MRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1531
             MRPGDI+TASNGK IEV +TDAEGRL LADAL+YA   GVEK++DLATLTGA +TALG S
Sbjct  388   MRPGDIVTASNGKTIEVNNTDAEGRLTLADALIYACNQGVEKIIDLATLTGAIVTALGPS  447

Query  1532  VAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITAS  1711
             VAG FTPS+ LA+EV+ AA+  GEKLWRMP+EESYWE+MKS +ADMIN G  DG AIT +
Sbjct  448   VAGAFTPSDGLAREVVVAAEASGEKLWRMPMEESYWESMKSGVADMINTGPRDGGAITGA  507

Query  1712  LFMK  1723
             LF+K
Sbjct  508   LFLK  511



>ref|XP_010687715.1| PREDICTED: leucine aminopeptidase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=582

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/505 (67%), Positives = 407/505 (81%), Gaps = 4/505 (1%)
 Frame = +2

Query  221   PLQ--KLNNGSSQILSFGS--YMAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGD  388
             P Q  +L+  S + L F +   MAHS+  ATLGLT+P  ++  K+  A +++D++EWKGD
Sbjct  35    PFQILRLSTPSKKPLYFYAKPRMAHSLTRATLGLTQPANVEPFKVSFAVKDIDVVEWKGD  94

Query  389   ILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLG  568
             +LAVGVTEKDM++D N KF+N IL+KLD++LGGLL+EAS EEDF+GK+GQS +LRLPGLG
Sbjct  95    LLAVGVTEKDMSKDDNMKFENSILKKLDNQLGGLLAEASVEEDFTGKAGQSTILRLPGLG  154

Query  569   SKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAM  748
             SKRIGL+GLGS   S +AYR LGE +A AAK+AQAS +AV LAS+EGLS E KLS  SA+
Sbjct  155   SKRIGLIGLGSKQPSLLAYRGLGEAVATAAKTAQASDIAVFLASSEGLSAELKLSTVSAI  214

Query  749   ATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNA  928
             A+G + G  EDNRFK E K P LKS++I+GLGTG ++EKKLK  E   SG+IF +ELVNA
Sbjct  215   ASGTILGMHEDNRFKSESKKPHLKSLDIIGLGTGADLEKKLKSVEDTCSGIIFGRELVNA  274

Query  929   PANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLC  1108
             PANVLTPG LAEEA  IAS YSDVL+A IL +EQC+ELKMGS+L VAAA+ NP +FIHLC
Sbjct  275   PANVLTPGVLAEEASKIASAYSDVLSAKILSLEQCEELKMGSYLAVAAASANPPHFIHLC  334

Query  1109  YKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIK  1288
             YKP SG V  KLAL+GKG+TFDSGGYN+K G   SIELMK DM G+A V GAAKAI QIK
Sbjct  335   YKPLSGPVTAKLALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGQIK  394

Query  1289  PAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLG  1468
             PAGVEVHFIV ACENMISGTGMRPGD++TASNGK IEV +TDAEGRL LADALVYA   G
Sbjct  395   PAGVEVHFIVAACENMISGTGMRPGDVVTASNGKTIEVNNTDAEGRLTLADALVYACNQG  454

Query  1469  VEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETM  1648
             V+K++DLATLTGAC+ ALG S+AG+FTP + LAKE+  A++  GEK WRMPLE++YWE+M
Sbjct  455   VDKIIDLATLTGACVVALGPSIAGVFTPDDALAKELFAASEATGEKFWRMPLEDNYWESM  514

Query  1649  KSSIADMINAGSLDGDAITASLFMK  1723
             KS +ADM+N G   G AITA+LF+K
Sbjct  515   KSGVADMVNTGGRQGGAITAALFLK  539



>sp|P31427.2|AMPL_SOLTU RecName: Full=Leucine aminopeptidase, chloroplastic; AltName: 
Full=Leucyl aminopeptidase; Short=LAP; AltName: Full=Proline 
aminopeptidase; AltName: Full=Prolyl aminopeptidase; Flags: 
Precursor [Solanum tuberosum]
 emb|CAA54314.1| leucine aminopeptidase [Solanum tuberosum]
Length=573

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/484 (70%), Positives = 401/484 (83%), Gaps = 4/484 (1%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             + H +A  TLGLT+PN+   PKI I A++ D+++W+GD+LA+G TE D+ARD NSKF+N 
Sbjct  50    IVHCIAGDTLGLTRPNESDAPKISIGAKDTDVVQWQGDLLAIGATENDLARDDNSKFKNP  109

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             +LQ+LDSKL GLLS ASSEEDFSGKSGQSI LRLPG    RI LVGLGS  SS  +Y +L
Sbjct  110   LLQRLDSKLNGLLSAASSEEDFSGKSGQSINLRLPG---GRITLVGLGSSASSPTSYHSL  166

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE  AAAAKSAQA ++AV+LAS +GLS ESK+++ASA+ATG++ G FEDNRF+ E KTP 
Sbjct  167   GEAAAAAAKSAQARNIAVSLASTDGLSAESKINSASAIATGVMLGIFEDNRFRSESKTPA  226

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             L+S++ILGLGTGPEIE K+KY+E V +GVI  +ELVNAPAN++TPGALAEEAK IAS YS
Sbjct  227   LESLDILGLGTGPEIESKIKYAEHVCAGVILGRELVNAPANIVTPGALAEEAKKIASTYS  286

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAAT-NPSYFIHLCYKPSSGSVKTKLALLGKGITF  1171
             DV+T  ILD EQCKELKMG++LGVAAAAT NP YFIHLC+K +S   KTK+AL+GKG+TF
Sbjct  287   DVITVNILDAEQCKELKMGAYLGVAAAATENPPYFIHLCFKTNSRERKTKIALVGKGLTF  346

Query  1172  DSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTG  1351
             DSGGYNLK GA S IELMK DM GAA V GAAKA+ +IKP GVEVHFIV ACENMISG G
Sbjct  347   DSGGYNLKTGAGSKIELMKNDMGGAAAVLGAAKALGEIKPRGVEVHFIVAACENMISGAG  406

Query  1352  MRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1531
             MRPGDI+TASNGK IEV +TDAEGRL LADAL+YA   GVEK++DLATLTGA +TALG S
Sbjct  407   MRPGDIVTASNGKTIEVNNTDAEGRLTLADALIYACNQGVEKIIDLATLTGAIVTALGPS  466

Query  1532  VAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITAS  1711
             VAG FTPS+ LA+EV+ AA+  GEKLWRMP+EESYWE+MKS +ADMIN G  DG AIT +
Sbjct  467   VAGAFTPSDGLAREVVVAAEASGEKLWRMPMEESYWESMKSGVADMINTGPRDGGAITGA  526

Query  1712  LFMK  1723
             LF+K
Sbjct  527   LFLK  530



>ref|XP_008794352.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Phoenix 
dactylifera]
Length=584

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/487 (69%), Positives = 398/487 (82%), Gaps = 4/487 (1%)
 Frame = +2

Query  275   MAHSVAL--ATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQ  448
             M H  A   ATLGLTKP  ++ P+I  AA+E+D  EWKGD+LAV V+EKDM++D NSKF+
Sbjct  55    MGHVTAATRATLGLTKPAVVEIPQITFAAKEIDFAEWKGDMLAVAVSEKDMSKDSNSKFE  114

Query  449   NLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG--SVVSSTIA  622
             N IL++LD KLGGLL+EAS EEDF+GK+GQS VLRLPGLG KR+GLVGLG  S  S+T A
Sbjct  115   NSILKRLDEKLGGLLAEASIEEDFTGKAGQSTVLRLPGLGFKRVGLVGLGQCSPPSTTTA  174

Query  623   YRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEP  802
             YR +GE +AA AKSAQAS+ AV LAS+ G+S E KL+ ASA+A+G + G +EDNRFK + 
Sbjct  175   YRGIGEAVAAVAKSAQASNAAVVLASSNGISEEFKLNTASAIASGTMLGVYEDNRFKSDS  234

Query  803   KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIA  982
             K   LK+V+I+GLG+GPE+++KLKY+  V SGVIF KELVNAPANVLTPG LAEEA  +A
Sbjct  235   KKTHLKAVDIIGLGSGPELDRKLKYASDVCSGVIFGKELVNAPANVLTPGVLAEEASKVA  294

Query  983   SLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKG  1162
             S Y DVLTATI D E CKELKMGS+LGVAAA++NP +FIHLCYKP  G  K KLA++GKG
Sbjct  295   SSYRDVLTATIFDAELCKELKMGSYLGVAAASSNPPHFIHLCYKPPDGDAKRKLAIVGKG  354

Query  1163  ITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMIS  1342
             +TFDSGGYN+K G   SIELMK DM G+A  FGAAKAIAQIKP GVEVHFIV ACENMIS
Sbjct  355   LTFDSGGYNIKTGPGCSIELMKFDMGGSAAAFGAAKAIAQIKPPGVEVHFIVAACENMIS  414

Query  1343  GTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITAL  1522
             GTGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGAC  AL
Sbjct  415   GTGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKVVDLATLTGACRVAL  474

Query  1523  GRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAI  1702
             G S+AG FTPS+DLAKE++ A+++ GEK WRMPLEESYWE+MKS +ADM+N G   G AI
Sbjct  475   GPSIAGFFTPSDDLAKEIVAASEITGEKFWRMPLEESYWESMKSGVADMVNTGGRQGGAI  534

Query  1703  TASLFMK  1723
             TA+LF+K
Sbjct  535   TAALFLK  541



>ref|XP_010526298.1| PREDICTED: leucine aminopeptidase 1-like [Tarenaya hassleriana]
Length=594

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/483 (71%), Positives = 406/483 (84%), Gaps = 0/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAH++A ATLGLT+P+ I   KI  +A++VD+ EWKGDILAVGVTEKDM +D NSKF+N 
Sbjct  68    MAHTLARATLGLTQPHPIDLTKISFSAKDVDVTEWKGDILAVGVTEKDMKKDENSKFENP  127

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL+KLD+ LGGLL+E SSEEDF+GK GQS VLRLPGLGSKR+GL+GLGS VSS  ++++L
Sbjct  128   ILEKLDAHLGGLLAEVSSEEDFTGKPGQSTVLRLPGLGSKRVGLIGLGSSVSSPSSFQSL  187

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +AAAAKSAQAS+VAV LAS E +  ESK+S+ASA+A+G V G +ED R+K E K P+
Sbjct  188   GEAVAAAAKSAQASNVAVVLASLESVPDESKISSASAIASGTVLGIYEDTRYKSESKKPS  247

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKSV+I+G GTGPE+EKKLKY+E VSSG+IF KELVN+PANVLTP ALAEEA  +ASLYS
Sbjct  248   LKSVDIIGFGTGPELEKKLKYAEDVSSGIIFGKELVNSPANVLTPDALAEEAVKLASLYS  307

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DVLTA ILD E+CKELKMGS+LGVAAA+ NP  FIHL Y PSSG V TKLAL+GKG+TFD
Sbjct  308   DVLTANILDAEKCKELKMGSYLGVAAASANPPRFIHLRYTPSSGPVTTKLALVGKGLTFD  367

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G   SIELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISGTGM
Sbjct  368   SGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTGM  427

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD+LTASNGK IEV +TDAEGRL LADALVYA   GV+K++DLATLTGAC+ ALG ++
Sbjct  428   RPGDVLTASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKVIDLATLTGACVVALGPTI  487

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AG+FTPS++LA EV +A+   GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+L
Sbjct  488   AGVFTPSDELAYEVFDASQRSGEKLWRMPMEESYWEQMKSGVADMVNTGGRAGGSITAAL  547

Query  1715  FMK  1723
             F+K
Sbjct  548   FLK  550



>ref|XP_008452840.1| PREDICTED: leucine aminopeptidase 1-like [Cucumis melo]
Length=585

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/486 (68%), Positives = 403/486 (83%), Gaps = 0/486 (0%)
 Frame = +2

Query  266   GSYMAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKF  445
             G +MAHS+A A LGLT P   + P+I   A+++D+LEWKGD+LAVGVTEKD+A+D NSKF
Sbjct  57    GKFMAHSLAQANLGLTNPAPNESPQISFGAKDIDVLEWKGDLLAVGVTEKDVAKDENSKF  116

Query  446   QNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAY  625
             +N IL KLDS+LGGLL+EAS+EEDF+GK+GQS VLR PGLG+KR+ L+GLG    +  A+
Sbjct  117   KNPILNKLDSRLGGLLAEASAEEDFTGKAGQSTVLRFPGLGTKRVSLIGLGQSALNVAAF  176

Query  626   RTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPK  805
             R+LGE +A+AAK++QAS VA++LAS E LS ESK + ASA+A+G + G F+D R+K E K
Sbjct  177   RSLGEAVASAAKASQASEVAISLASPEELSSESKPNFASAIASGTILGIFDDTRYKSESK  236

Query  806   TPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIAS  985
                LKSVEI+GLG+G E++KKLK+++ VSSG+I  +ELVN+PANVLTPGALA EA  IAS
Sbjct  237   KSALKSVEIIGLGSGAEVDKKLKFAQDVSSGIILGRELVNSPANVLTPGALAAEASKIAS  296

Query  986   LYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGI  1165
              YSDVL+ATIL+ EQCKEL MGS+LGVAAA+TNP +FIHL YKP SG V  KL L+GKG+
Sbjct  297   TYSDVLSATILNEEQCKELNMGSYLGVAAASTNPPHFIHLRYKPPSGPVSVKLGLVGKGL  356

Query  1166  TFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISG  1345
             TFDSGGYN+K G   SIE+MK DM G+A V GAAKAI QIKP GVE+HF++ ACENMISG
Sbjct  357   TFDSGGYNIKTGPGCSIEIMKTDMGGSAAVLGAAKAIGQIKPLGVEIHFVIAACENMISG  416

Query  1346  TGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALG  1525
             TGMRPGDI+TASNGK IEV +TDAEGRL LADALVY  K GV+K++DLATLTGACI ALG
Sbjct  417   TGMRPGDIITASNGKTIEVNNTDAEGRLTLADALVYTCKQGVDKVIDLATLTGACIVALG  476

Query  1526  RSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAIT  1705
              S+AGIFTPS+DLAKEVL AA++ GEK WRMP+E+SYWE+MKSS+ADM+N G   G AIT
Sbjct  477   PSIAGIFTPSDDLAKEVLAAAEISGEKFWRMPMEDSYWESMKSSVADMVNTGGRPGGAIT  536

Query  1706  ASLFMK  1723
             A+LF+K
Sbjct  537   AALFLK  542



>ref|XP_010942088.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Elaeis 
guineensis]
Length=530

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/487 (69%), Positives = 400/487 (82%), Gaps = 4/487 (1%)
 Frame = +2

Query  275   MAHSVAL--ATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQ  448
             M H  A   ATLGLTKP  ++ P+I  + +E+D  EWKGDIL V V+EKDM++D +SKF+
Sbjct  1     MEHVTAATPATLGLTKPAPVEIPQISFSVKEIDFAEWKGDILVVAVSEKDMSKDLDSKFE  60

Query  449   NLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG--SVVSSTIA  622
             N IL++LD KLGGLL EAS+EEDF+GK+GQS VLRLPGLG KR+GLVGLG  S  S+  A
Sbjct  61    NSILRRLDEKLGGLLVEASTEEDFTGKAGQSTVLRLPGLGFKRVGLVGLGQCSPSSTATA  120

Query  623   YRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEP  802
             YR++GE +A  AK+AQAS+ AV LAS+ G+S E KL+AASA+A+G V G +EDNRFK + 
Sbjct  121   YRSIGEAVAGVAKAAQASNAAVVLASSNGISEEFKLNAASAIASGTVLGVYEDNRFKSDS  180

Query  803   KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIA  982
             K   LK+V+I+GLG+GP+++KKLKY+  V SGVIF KELVNAPANVLTPG LAEEA  +A
Sbjct  181   KKTHLKAVDIIGLGSGPQLDKKLKYASDVCSGVIFGKELVNAPANVLTPGVLAEEASKVA  240

Query  983   SLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKG  1162
             SLYSDVL+ATILDVEQCKELKMGS+LGVAAA++NP +FIHLCYKP  G VK KLA++GKG
Sbjct  241   SLYSDVLSATILDVEQCKELKMGSYLGVAAASSNPPHFIHLCYKPPGGDVKRKLAIVGKG  300

Query  1163  ITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMIS  1342
             +TFDSGGYN+K G    IELMK DM G+A  FGAAKA+AQIKP GVEVHFIV ACENMIS
Sbjct  301   LTFDSGGYNIKTGPGCLIELMKFDMGGSAAAFGAAKALAQIKPPGVEVHFIVAACENMIS  360

Query  1343  GTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITAL  1522
             GTGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ AL
Sbjct  361   GTGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVAL  420

Query  1523  GRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAI  1702
             G S+AG FT S+DLAKE+ EA+++ GEK WRMPLEESYWE+MKS +ADM+N G   G AI
Sbjct  421   GPSIAGFFTSSDDLAKEIAEASEITGEKFWRMPLEESYWESMKSGVADMVNTGGRQGGAI  480

Query  1703  TASLFMK  1723
              A+LF+K
Sbjct  481   LAALFLK  487



>ref|XP_009366178.1| PREDICTED: leucine aminopeptidase 1-like [Pyrus x bretschneideri]
Length=575

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/509 (68%), Positives = 406/509 (80%), Gaps = 11/509 (2%)
 Frame = +2

Query  224   LQKLNNGSSQILSF---------GSYMAHSVALATLGLTKPNQIQRPKILIAAREVDLLE  376
             L KL +  S  LSF         G  MAH++A A LGLT P+ I  PKI  AA+E+D  E
Sbjct  26    LTKLRSARSLRLSFAVTQLCSCRGKLMAHTLARANLGLTHPSGIDAPKISFAAKELDAAE  85

Query  377   WKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRL  556
             WKGD+LAVGVTEKD+A+D NSKFQN +L+KLDS LGGLL+EASSEEDF+GKSGQS V+RL
Sbjct  86    WKGDLLAVGVTEKDLAKDENSKFQNSVLKKLDSHLGGLLAEASSEEDFTGKSGQSTVVRL  145

Query  557   PGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSA  736
              GLG KR+GL GLG   SST A++ LG+  AAAAK+ QA  +A+ LAS+EG+S +S  + 
Sbjct  146   LGLGLKRVGLFGLGQSASSTEAFQGLGKAAAAAAKAGQAGDIAIVLASSEGISAKS--NT  203

Query  737   ASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKE  916
             ASA+A+G V G +EDNR+K E K   LKSV+ILGLGTGPE+EKKLKY+E V+SG+IF KE
Sbjct  204   ASAIASGTVLGIYEDNRYKSESKKSVLKSVDILGLGTGPEVEKKLKYAEDVTSGIIFGKE  263

Query  917   LVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYF  1096
             LVN+PANVLTPG LAEEA  IAS YSDVL+A IL+ EQCKELKMGS+L VAAA+ NP +F
Sbjct  264   LVNSPANVLTPGKLAEEASKIASTYSDVLSANILNEEQCKELKMGSYLAVAAASANPPHF  323

Query  1097  IHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakai  1276
             IHL YKP  G  K KL L+GKG+TFDSGGYN+K G   S+ELMK DM G+A + GAAKAI
Sbjct  324   IHLIYKPPGGPAKVKLGLVGKGLTFDSGGYNIKTGPGCSVELMKFDMGGSAAILGAAKAI  383

Query  1277  aQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYA  1456
             AQIKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA
Sbjct  384   AQIKPPGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYA  443

Query  1457  SKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESY  1636
             S  GV+K+VDLATLTGAC+ ALG S+AG+FTPS+DLAKEV  A+++ GEK WR+PLEESY
Sbjct  444   SNQGVDKIVDLATLTGACVVALGPSIAGVFTPSDDLAKEVFAASEISGEKFWRLPLEESY  503

Query  1637  WETMKSSIADMINAGSLDGDAITASLFMK  1723
             WETMKS IADM+N G   G +I A+LF+K
Sbjct  504   WETMKSGIADMLNTGGRAGGSINAALFLK  532



>ref|XP_006404921.1| hypothetical protein EUTSA_v10000127mg [Eutrema salsugineum]
 dbj|BAJ33647.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46374.1| hypothetical protein EUTSA_v10000127mg [Eutrema salsugineum]
Length=520

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/476 (69%), Positives = 394/476 (83%), Gaps = 4/476 (1%)
 Frame = +2

Query  299   TLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSK  478
             TLGLT+PN  + PKI  AA+E+D+ EWKGD L VGVTEKD+A+D +SKF+N IL KLD+ 
Sbjct  4     TLGLTQPNSTELPKISFAAKEIDVTEWKGDTLVVGVTEKDLAKDDHSKFENPILNKLDAH  63

Query  479   LGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG-SVVSSTIAYRTLGETIaaa  655
             L GLL+  SSEEDF+GK GQS VLRLPGLGSKRIGL+GLG S  SS +AY++LGE +A  
Sbjct  64    LSGLLALVSSEEDFTGKPGQSTVLRLPGLGSKRIGLIGLGKSASSSPVAYQSLGEAVATV  123

Query  656   aksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEIL  835
             +K++Q+SSVA+ LAS E   +ESKL++ASA+A+G+V G FED R+K E K P+LKSV+I+
Sbjct  124   SKASQSSSVAIVLASPE---IESKLASASAIASGVVLGLFEDGRYKSESKKPSLKSVDII  180

Query  836   GLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATI  1015
             G GTGPE+EKKLKY+E VS GVIF +EL N+PANVLTP  LAEEA  +AS YSDV TA I
Sbjct  181   GFGTGPELEKKLKYAEDVSYGVIFGRELTNSPANVLTPAVLAEEAAKVASTYSDVFTANI  240

Query  1016  LDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLK  1195
             L+ EQCKELKMGS+L VAAA+ NP YFIHL YKP SGSVKTKLAL+GKG+TFDSGGYN+K
Sbjct  241   LNEEQCKELKMGSYLAVAAASANPPYFIHLVYKPPSGSVKTKLALVGKGLTFDSGGYNIK  300

Query  1196  IGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILT  1375
              G   SIELMK DM G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGMRPGD++T
Sbjct  301   TGPGCSIELMKFDMGGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTGMRPGDVIT  360

Query  1376  ASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPS  1555
             ASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGAC+ ALG S+AGI+TP+
Sbjct  361   ASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACVIALGTSMAGIYTPN  420

Query  1556  EDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             ++LAKEV+ A++  GEKLWRMPLEESYWE MKS +ADM+N G   G +ITA+LF+K
Sbjct  421   DELAKEVIAASEKSGEKLWRMPLEESYWEMMKSGVADMVNTGGRAGGSITAALFLK  476



>ref|XP_002880560.1| cytosol aminopeptidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56819.1| cytosol aminopeptidase [Arabidopsis lyrata subsp. lyrata]
Length=520

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/483 (69%), Positives = 397/483 (82%), Gaps = 7/483 (1%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAH     TLGLT+PN I+  KI  +A+E+D+  WKGDI+ VGVTEKD+A+D NSKF+N 
Sbjct  1     MAH-----TLGLTQPNSIEPHKISFSAKEIDVTAWKGDIIVVGVTEKDLAKDGNSKFENP  55

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL KLD+ L GLL++ SSEEDF+GK GQS VLRLPGLGSKRIGL+GLG  VSS +A+ +L
Sbjct  56    ILNKLDTHLSGLLAQVSSEEDFTGKPGQSTVLRLPGLGSKRIGLIGLGQSVSSPVAFHSL  115

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +A  +K++Q+SS A+ LAS+  +S ESKLS+ASA+A+GIV G FED R+K E K P+
Sbjct  116   GEAVATVSKASQSSSAAIVLASS--VSDESKLSSASALASGIVLGLFEDGRYKSESKKPS  173

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKSV+I+G GTG E+EKKLKY+E VS GVIF +EL N+PANVLTP  LAEEA  +AS YS
Sbjct  174   LKSVDIIGFGTGAELEKKLKYAEDVSYGVIFGRELTNSPANVLTPAVLAEEAAKVASTYS  233

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV TA IL+ EQC++LKMGS+L VAAA+ NP YFIHL YKPSSGSVKTKLAL+GKG+TFD
Sbjct  234   DVFTANILNEEQCRKLKMGSYLAVAAASANPPYFIHLVYKPSSGSVKTKLALVGKGLTFD  293

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G   SIELMK DM G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGM
Sbjct  294   SGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTGM  353

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD++TASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGAC+ ALG S+
Sbjct  354   RPGDVITASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACVIALGTSM  413

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AGI+TPS++LAKEV+ A++  GEKLWRMPLEESYWE MKS +ADM+N G   G +ITA+L
Sbjct  414   AGIYTPSDELAKEVIAASERSGEKLWRMPLEESYWEMMKSGVADMVNTGGRAGGSITAAL  473

Query  1715  FMK  1723
             F+K
Sbjct  474   FLK  476



>emb|CAA18201.1| leucyl aminopeptidase-like protein [Arabidopsis thaliana]
 emb|CAB79810.1| leucyl aminopeptidase-like protein [Arabidopsis thaliana]
Length=525

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/483 (70%), Positives = 402/483 (83%), Gaps = 2/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAH+++ ATLGLT+ N +  PKI  + +E+D+ EWKGDILAVGVTEKDMA+D NSKF+N 
Sbjct  1     MAHTISHATLGLTQANSVDHPKISFSGKEIDVTEWKGDILAVGVTEKDMAKDVNSKFENP  60

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL+KLD+ LGGLL++ SSEEDFSGK GQS VLRLPGLGSKR+GL+GLG   S+  A+++L
Sbjct  61    ILKKLDAHLGGLLADVSSEEDFSGKPGQSTVLRLPGLGSKRVGLIGLGKSASTPSAFQSL  120

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +AAAAK++QASSVAV LAS+E +S ESKL +ASA+A+  V G FED+R+K E K P+
Sbjct  121   GEAVAAAAKASQASSVAVVLASSESVSNESKLCSASAIAS--VLGLFEDSRYKSESKKPS  178

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKSV+I+G G+GPE+EKKLKY+E VS GVIF KELVN+PANVLTP  LAEEA N+AS+YS
Sbjct  179   LKSVDIIGFGSGPELEKKLKYAEHVSYGVIFGKELVNSPANVLTPAVLAEEALNLASMYS  238

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV+TA IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKPSSG VKTKLAL+GK +   
Sbjct  239   DVMTANILNEEQCKELKMGSYLAVAAASANPPHFIHLIYKPSSGPVKTKLALVGKMVFVH  298

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G    IELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISGTGM
Sbjct  299   SGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTGM  358

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD+LTASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+
Sbjct  359   RPGDVLTASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKVVDLATLTGACIIALGTSM  418

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AGI+TPS+ LAKEV+ A++  GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+L
Sbjct  419   AGIYTPSDKLAKEVIAASERSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGSITAAL  478

Query  1715  FMK  1723
             F+K
Sbjct  479   FLK  481



>gb|EPS65095.1| hypothetical protein M569_09684, partial [Genlisea aurea]
Length=557

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/483 (69%), Positives = 397/483 (82%), Gaps = 1/483 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAHSVA A LGLT+P ++  PKI  AA+E+DLLEWKGDILAVGVTEKD+A+D NSKF+N 
Sbjct  57    MAHSVARANLGLTEPTKLDLPKISFAAKEIDLLEWKGDILAVGVTEKDVAKDENSKFKNS  116

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             +LQKLDSKLGGLLS+AS+EE+F+GK+GQS +LRL G G+KR+GL G+GS  SS++ YR L
Sbjct  117   LLQKLDSKLGGLLSDASAEEEFTGKAGQSTILRLSGFGAKRVGLFGIGSS-SSSLTYRNL  175

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +A+AAKS+Q S VA+ +  ++  S ESK SAA ++A G   G F+D RFK E K   
Sbjct  176   GEAVASAAKSSQGSHVAIFVPLSDDSSAESKPSAAYSVAIGAGLGLFDDVRFKSESKQVV  235

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKSV+ILG G GPEIEKKLK++  V SG+IF KELVNAPANVLTP  LA EA  IAS  S
Sbjct  236   LKSVDILGAGNGPEIEKKLKHAGDVISGIIFAKELVNAPANVLTPAVLAAEATRIASENS  295

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DVL+A ILDVEQCKELKMGS+LGVA A+ NP +FIHL YKP +G VK KLAL+GKG+TFD
Sbjct  296   DVLSAKILDVEQCKELKMGSYLGVAVASANPPHFIHLSYKPPTGDVKAKLALVGKGLTFD  355

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G   SIELMK DM G+A V GAAKA+AQ+KP+GVEVHFIV ACENMISGTGM
Sbjct  356   SGGYNIKTGPGCSIELMKIDMGGSAAVLGAAKALAQVKPSGVEVHFIVAACENMISGTGM  415

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG S+
Sbjct  416   RPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGPSI  475

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AGI++PS++LA EVL AA+  GEKLWR+PLEESYWETMKSS+ADM+N G   G +ITA+L
Sbjct  476   AGIYSPSDELAGEVLGAAEASGEKLWRLPLEESYWETMKSSVADMVNTGGRPGGSITAAL  535

Query  1715  FMK  1723
             F+K
Sbjct  536   FLK  538



>ref|NP_179997.1| aminopeptidase family protein [Arabidopsis thaliana]
 ref|NP_001118375.1| aminopeptidase family protein [Arabidopsis thaliana]
 sp|P30184.1|AMPL1_ARATH RecName: Full=Leucine aminopeptidase 1; AltName: Full=Leucyl 
aminopeptidase 1; Short=LAP 1; AltName: Full=Proline aminopeptidase 
1; AltName: Full=Prolyl aminopeptidase 1 [Arabidopsis 
thaliana]
 emb|CAA45040.1| leucine aminopeptidase [Arabidopsis thaliana]
 gb|AAD03381.1| putative leucine aminopeptidase [Arabidopsis thaliana]
 gb|AAL32980.1| At2g24200/F27D4.11 [Arabidopsis thaliana]
 gb|AAP21153.1| At2g24200/F27D4.11 [Arabidopsis thaliana]
 gb|AEC07539.1| aminopeptidase family protein [Arabidopsis thaliana]
 gb|AEC07540.1| aminopeptidase family protein [Arabidopsis thaliana]
Length=520

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/483 (67%), Positives = 395/483 (82%), Gaps = 7/483 (1%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAH     TLGLT+PN  +  KI   A+E+D++EWKGDIL VGVTEKD+A+D NSKF+N 
Sbjct  1     MAH-----TLGLTQPNSTEPHKISFTAKEIDVIEWKGDILVVGVTEKDLAKDGNSKFENP  55

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL K+D+ L GLL++ SSEEDF+GK GQS VLRLPGLGSKRI L+GLG  VSS +A+ +L
Sbjct  56    ILSKVDAHLSGLLAQVSSEEDFTGKPGQSTVLRLPGLGSKRIALIGLGQSVSSPVAFHSL  115

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +A  +K++Q++S A+ LAS+  +S ESKLS+ SA+A+GIV G FED R+K E K P+
Sbjct  116   GEAVATVSKASQSTSAAIVLASS--VSDESKLSSVSALASGIVLGLFEDGRYKSESKKPS  173

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LK+V+I+G GTG E+EKKLKY+E VS GVIF +EL+N+PANVLTP  LAEEA  +AS YS
Sbjct  174   LKAVDIIGFGTGAEVEKKLKYAEDVSYGVIFGRELINSPANVLTPAVLAEEAAKVASTYS  233

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV TA IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKP +GSVKTKLAL+GKG+TFD
Sbjct  234   DVFTANILNEEQCKELKMGSYLAVAAASANPPHFIHLVYKPPNGSVKTKLALVGKGLTFD  293

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G   SIELMK DM G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGM
Sbjct  294   SGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTGM  353

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD++TASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGAC+ ALG S+
Sbjct  354   RPGDVITASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACVIALGTSM  413

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AGI+TPS++LAKEV+ A++  GEKLWRMPLEESYWE MKS +ADM+N G   G +ITA+L
Sbjct  414   AGIYTPSDELAKEVIAASERSGEKLWRMPLEESYWEMMKSGVADMVNTGGRAGGSITAAL  473

Query  1715  FMK  1723
             F+K
Sbjct  474   FLK  476



>ref|XP_008803712.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=530

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/487 (68%), Positives = 399/487 (82%), Gaps = 4/487 (1%)
 Frame = +2

Query  275   MAH--SVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQ  448
             M H  S   ATLGLTKP  ++ P+I  +A+E+D   WKGDILAV V+E DM++D +SKF+
Sbjct  1     MGHVTSATRATLGLTKPALVEIPQISFSAKEIDFAVWKGDILAVAVSENDMSKDLDSKFE  60

Query  449   NLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG--SVVSSTIA  622
             N IL++LD KLGGLL+EAS+EEDF+GK+GQS+VLRLPGLG KR+GLVGLG  S  S+  A
Sbjct  61    NSILKRLDEKLGGLLAEASTEEDFTGKAGQSMVLRLPGLGFKRVGLVGLGQCSPSSTATA  120

Query  623   YRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEP  802
             YR++GE +A  AK+AQA + AV LAS+ G+S E KL+AASA+A+G V G +ED+RFK + 
Sbjct  121   YRSIGEAVAVVAKAAQAINAAVILASSNGISEEFKLNAASAIASGTVLGVYEDSRFKSDS  180

Query  803   KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIA  982
             K   LK+V+I+GLG+GPE++KK+KY+  V SGVIF KEL NAPANVLTPG LAEEA  +A
Sbjct  181   KKTHLKAVDIIGLGSGPELDKKIKYASDVCSGVIFGKELANAPANVLTPGVLAEEASKVA  240

Query  983   SLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKG  1162
             S YSDVL ATILDVEQCKELKMGS+LGVAAA++NP +FIHLCYKP  G VK KLA++GKG
Sbjct  241   SSYSDVLMATILDVEQCKELKMGSYLGVAAASSNPPHFIHLCYKPPGGDVKRKLAIVGKG  300

Query  1163  ITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMIS  1342
             +TFDSGGYN+K G   SIELMK DM G+A  FGAAKAIAQIKP GVEVHFIV ACENMIS
Sbjct  301   LTFDSGGYNIKTGPGCSIELMKFDMGGSAAAFGAAKAIAQIKPPGVEVHFIVAACENMIS  360

Query  1343  GTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITAL  1522
             GTGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ AL
Sbjct  361   GTGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVAL  420

Query  1523  GRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAI  1702
             G S+ G FTPS+DLAKE+ EA+++ GEK WRMPLEESYWE+M S +ADM+N+G   G AI
Sbjct  421   GPSIGGFFTPSDDLAKEIAEASEITGEKFWRMPLEESYWESMTSGVADMVNSGGRQGGAI  480

Query  1703  TASLFMK  1723
              A+LF+K
Sbjct  481   LAALFLK  487



>ref|NP_194820.1| cytosol aminopeptidase family protein [Arabidopsis thaliana]
 sp|Q8RX72.1|AMPL2_ARATH RecName: Full=Leucine aminopeptidase 2, chloroplastic; AltName: 
Full=Leucyl aminopeptidase 2; Short=LAP 2; AltName: Full=Proline 
aminopeptidase 2; AltName: Full=Prolyl aminopeptidase 
2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL91252.1| AT4g30910/F6I18_180 [Arabidopsis thaliana]
 gb|AAM78047.1| AT4g30910/F6I18_180 [Arabidopsis thaliana]
 gb|AEE85829.1| cytosol aminopeptidase family protein [Arabidopsis thaliana]
Length=581

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/482 (69%), Positives = 399/482 (83%), Gaps = 0/482 (0%)
 Frame = +2

Query  278   AHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLI  457
             AH++A ATLGLT+ N +  PKI  + +E+D+ EWKGDILAVGVTEKDMA+D NSKF+N I
Sbjct  57    AHTIAHATLGLTQANSVDHPKISFSGKEIDVTEWKGDILAVGVTEKDMAKDANSKFENPI  116

Query  458   LQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLG  637
             L+KLD+ LGGLL++ S+EEDFSGK GQS VLRLPGLGSKR+GL+GLG   S+  A+++LG
Sbjct  117   LKKLDAHLGGLLADVSAEEDFSGKPGQSTVLRLPGLGSKRVGLIGLGKSASTPSAFQSLG  176

Query  638   ETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTL  817
             E +AAAAK++QASSVAV LAS+E  S ESKLS+AS +A+G V G FED+R+K E K P+L
Sbjct  177   EAVAAAAKASQASSVAVVLASSESFSDESKLSSASDIASGTVLGLFEDSRYKSESKKPSL  236

Query  818   KSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSD  997
             KSV  +G GTGPE+E KLKY+E VS GVIF KELVN+PANVL+P  LAEEA N+AS+YS+
Sbjct  237   KSVVFIGFGTGPELENKLKYAEHVSYGVIFTKELVNSPANVLSPAVLAEEASNLASMYSN  296

Query  998   VLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDS  1177
             V+TA IL  EQCKELKMGS+L VAAA+ NP +FIHL YKPSSG VKTKLAL+GKG+TFDS
Sbjct  297   VMTANILKEEQCKELKMGSYLAVAAASANPPHFIHLIYKPSSGPVKTKLALVGKGLTFDS  356

Query  1178  GGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMR  1357
             GGYN+KIG    IELMK D+ G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGMR
Sbjct  357   GGYNIKIGPELIIELMKIDVGGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTGMR  416

Query  1358  PGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVA  1537
             PGD++TASNGK IEV DTD+EGRL LADALVYA   GV+K+VD+ATLTG  I ALG S+A
Sbjct  417   PGDVITASNGKTIEVNDTDSEGRLTLADALVYACNQGVDKIVDIATLTGEIIVALGPSMA  476

Query  1538  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1717
             G++T S++LAKEV+ A+   GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+LF
Sbjct  477   GMYTASDELAKEVIAASQRSGEKLWRMPMEESYWEMMKSGVADMVNFGGRAGGSITAALF  536

Query  1718  MK  1723
             +K
Sbjct  537   LK  538



>ref|XP_010447643.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Camelina 
sativa]
Length=579

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/483 (70%), Positives = 396/483 (82%), Gaps = 5/483 (1%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAH++A ATLGLT  N +  PKI  + +E+D+ EWKGDILAVGVTEKDM +D NSKF+N 
Sbjct  58    MAHTIAQATLGLTHANSVDHPKISFSGKEMDVTEWKGDILAVGVTEKDMTKDANSKFENP  117

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL+KLD+ LGGLL++ SSEEDFSGK GQS VLRLPGLGSKR+GL+GLG   SS  A+++L
Sbjct  118   ILKKLDAHLGGLLADVSSEEDFSGKPGQSTVLRLPGLGSKRVGLIGLGKSASSPSAFQSL  177

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +AAAAK++QASSVAV LAS+E +S ESKLS+ASA+A+G V G FED R+K E K P+
Sbjct  178   GEAVAAAAKASQASSVAVVLASSETVSNESKLSSASAIASGTVLGLFEDCRYKSESKKPS  237

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             L      G GTGPE+EKKLKY+E VS GVIF KELVN+PANVLTP  LAEEA  +AS+YS
Sbjct  238   LT-----GFGTGPELEKKLKYAEDVSYGVIFGKELVNSPANVLTPAVLAEEASKLASMYS  292

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV+TA IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKPSSG VKTKLA++GKG+TFD
Sbjct  293   DVMTANILNEEQCKELKMGSYLAVAAASANPPHFIHLVYKPSSGPVKTKLAIVGKGLTFD  352

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G    IELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISGTGM
Sbjct  353   SGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTGM  412

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGDI+TASN K IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+
Sbjct  413   RPGDIITASNRKTIEVNNTDAEGRLTLADALVYACNQGVDKVVDLATLTGACIIALGTSM  472

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             A I+T S++LAKEV+ A++  GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+L
Sbjct  473   AAIYTSSDELAKEVIAASERSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGSITAAL  532

Query  1715  FMK  1723
             F+K
Sbjct  533   FLK  535



>ref|XP_006293400.1| hypothetical protein CARUB_v10024476mg [Capsella rubella]
 gb|EOA26298.1| hypothetical protein CARUB_v10024476mg [Capsella rubella]
Length=490

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/475 (68%), Positives = 393/475 (83%), Gaps = 2/475 (0%)
 Frame = +2

Query  299   TLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSK  478
             TLGLT+PN  +  KI  AA+E+D++ WKGDIL VGVT+KD+++D NSKF+N IL KLD  
Sbjct  4     TLGLTQPNSTEPHKISFAAKEIDVIAWKGDILVVGVTDKDLSKDGNSKFENPILNKLDGH  63

Query  479   LGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaa  658
             L GLL++ SSEEDF+GK GQS VLRLPGLG+KRIGL+GLG  VSS +A+ +LG+ +A  +
Sbjct  64    LSGLLAQVSSEEDFTGKPGQSTVLRLPGLGAKRIGLIGLGQSVSSPLAFHSLGDGVATVS  123

Query  659   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  838
             K++Q+SS A+ LAS+  +S ESKLS+ASA+A+GIV G FED+R+K E K  +LKSV+I+G
Sbjct  124   KASQSSSAAIVLASS--VSDESKLSSASALASGIVLGLFEDSRYKSESKKASLKSVDIIG  181

Query  839   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1018
              GTGPE+EKKLKY++ VS GVIF +EL N+PANVLTP  LAEEA  +AS YSDV TA IL
Sbjct  182   FGTGPEVEKKLKYAQDVSYGVIFGRELTNSPANVLTPAVLAEEAAKVASTYSDVFTANIL  241

Query  1019  DVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKI  1198
             + EQCKELKMGS+L VAAA+ NP +FIHL YKP+SGSVKTKLAL+GKG+TFDSGGYN+K 
Sbjct  242   NEEQCKELKMGSYLAVAAASANPPHFIHLIYKPASGSVKTKLALVGKGLTFDSGGYNIKT  301

Query  1199  GANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTA  1378
             G    IELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISGTGMRPGD++TA
Sbjct  302   GPGCLIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTGMRPGDVITA  361

Query  1379  SNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSE  1558
             SNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGAC+ ALG S+AGI+TPS+
Sbjct  362   SNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACVIALGPSMAGIYTPSD  421

Query  1559  DLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +LAKEV+ A++  GEKLWRMPLEESYWE MKS +ADM+N G   G +ITA+LF+K
Sbjct  422   ELAKEVISASERSGEKLWRMPLEESYWEMMKSGVADMVNTGGRAGGSITAALFLK  476



>gb|KFK32675.1| hypothetical protein AALP_AA6G274200 [Arabis alpina]
Length=523

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/484 (67%), Positives = 389/484 (80%), Gaps = 6/484 (1%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPN-SKFQN  451
             M+H     TLGLT+ N    PKI  AA+E+ + EWKGDIL VGVTEKD+ +D + SKF N
Sbjct  1     MSH-----TLGLTQANSTHSPKISFAAKEIGVTEWKGDILVVGVTEKDLTKDSSTSKFLN  55

Query  452   LILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRT  631
              IL KLD+ L GLL+E +SEEDF+GK GQSIVLRLPGL SKR+GL+GLG  VSS  A+++
Sbjct  56    PILNKLDTHLSGLLTEVTSEEDFTGKPGQSIVLRLPGLASKRVGLIGLGQSVSSPAAFQS  115

Query  632   LGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTP  811
              GE +    K++Q+S+VA+ LAS E ++ ESKLS+ASA+A+GIV G FED R+K E K P
Sbjct  116   FGEAVGVTTKASQSSTVAIVLASPESVADESKLSSASAIASGIVLGLFEDGRYKSESKKP  175

Query  812   TLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLY  991
              LKSV+I+G GTGPE+EKKLKY+E VS GVIF +EL N+PANVLTP  LAEEA  +AS Y
Sbjct  176   ALKSVDIIGFGTGPELEKKLKYAEDVSYGVIFGRELTNSPANVLTPAVLAEEAAKLASTY  235

Query  992   SDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITF  1171
             SDV TA IL+ EQCKELKMGS+L VA A+ N  +FIHL YKPSSGSVKTKLAL+GKG+TF
Sbjct  236   SDVFTANILNEEQCKELKMGSYLAVAEASANRPHFIHLVYKPSSGSVKTKLALVGKGLTF  295

Query  1172  DSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTG  1351
             DSGGYN+K G   SIELMK DM G+A V GAAKAI +IKP GVEVHFIV ACENMISGTG
Sbjct  296   DSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTG  355

Query  1352  MRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1531
             MRPGD++TASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGAC+ ALG S
Sbjct  356   MRPGDVITASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACVIALGTS  415

Query  1532  VAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITAS  1711
             +AGI+TPS++LAKEV+ A++  GEKLWRMPLE+SYWE MKS +ADM+N G   G +ITA+
Sbjct  416   IAGIYTPSDELAKEVIAASEKSGEKLWRMPLEDSYWEMMKSGVADMVNTGGRAGGSITAA  475

Query  1712  LFMK  1723
             LF+K
Sbjct  476   LFLK  479



>ref|XP_006857233.1| hypothetical protein AMTR_s00065p00209640 [Amborella trichopoda]
 gb|ERN18700.1| hypothetical protein AMTR_s00065p00209640 [Amborella trichopoda]
Length=525

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/480 (67%), Positives = 392/480 (82%), Gaps = 1/480 (0%)
 Frame = +2

Query  284   SVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQ  463
             ++A   LGLTKP  +  P+I ++ +++D  EWKGD+LAVGV+EKDMARD    F+NL+LQ
Sbjct  3     AMANVNLGLTKPATVSLPEIDLSVKDIDFAEWKGDVLAVGVSEKDMARDEKGAFENLVLQ  62

Query  464   KLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGET  643
             KLD  L GLL+EAS EEDF+GK GQS VLR PGLG +R+GL+GLG    +T  ++  GE 
Sbjct  63    KLDGLLSGLLAEASKEEDFTGKPGQSTVLRFPGLGFRRVGLIGLGQGSLTTATFKGFGEA  122

Query  644   IaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKS  823
             +A++AK+AQA++V V LAS++ LS E+KL+ ASA+ +G + G +EDNRFK E K P LKS
Sbjct  123   VASSAKAAQAANVGVLLASSDCLSSEAKLNTASAIVSGTILGIYEDNRFKSESKKPVLKS  182

Query  824   VEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVL  1003
             ++I+GLGTGP+IEKKLKY+E   SGVI  +ELVNAPANVLTPGALAEEA+ IAS YSDVL
Sbjct  183   LDIIGLGTGPDIEKKLKYTEEFCSGVILARELVNAPANVLTPGALAEEAQKIASTYSDVL  242

Query  1004  TATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGG  1183
             TATIL+ +QC+ELKMGS+LGVAAA+ NP +FIH+CYKP  G+ KTKLA++GKG+TFDSGG
Sbjct  243   TATILNEDQCRELKMGSYLGVAAASANPPHFIHICYKPPGGNAKTKLAIVGKGLTFDSGG  302

Query  1184  YNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPG  1363
             YNLK G  SSIELMK DM G+A   GAAKAI QIKP GVEVHFIV ACENMISGTGMRPG
Sbjct  303   YNLKTGG-SSIELMKFDMGGSAAALGAAKAIGQIKPPGVEVHFIVAACENMISGTGMRPG  361

Query  1364  DILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGI  1543
             DI+TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG S+AG+
Sbjct  362   DIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGGSIAGV  421

Query  1544  FTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             FTPS+DLA E+  A+++ GEK WR+PLEESYWE+MKS +ADM+N G   G +ITA+LF+K
Sbjct  422   FTPSDDLANEIYLASEISGEKFWRLPLEESYWESMKSGVADMVNTGGRQGGSITAALFLK  481



>emb|CDY20284.1| BnaC04g36720D [Brassica napus]
Length=521

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/477 (68%), Positives = 386/477 (81%), Gaps = 5/477 (1%)
 Frame = +2

Query  299   TLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSK  478
             TLGLTKPN    PKI  AA+E+D+ EWKGD+L VGVTEKD+ +D  SKF+N IL KLD+ 
Sbjct  4     TLGLTKPNSTDHPKISFAAKEIDVTEWKGDLLVVGVTEKDLTKDDGSKFENPILNKLDAH  63

Query  479   LGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSST--IAYRTLGETIaa  652
               GLL   SSEEDF+GK GQS VLRLPGL +KRIGL+GLG   SS+   A+ +LGE +A 
Sbjct  64    TIGLLGLVSSEEDFAGKPGQSTVLRLPGLATKRIGLIGLGKTASSSSPAAFHSLGEGVAT  123

Query  653   aaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEI  832
              +K++Q+S+VAVALAS E    ESKLS+ASA+A+G+V G FED R+K E K P+L SV+I
Sbjct  124   VSKASQSSTVAVALASPES---ESKLSSASALASGVVLGLFEDGRYKSESKKPSLSSVDI  180

Query  833   LGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTAT  1012
             +G GTGPE+EKKLKY+E VS GVIF +EL+N+PANVLTP  LAEEA  +AS YSDV TA 
Sbjct  181   IGFGTGPEVEKKLKYAEDVSYGVIFGRELINSPANVLTPAVLAEEAAKVASTYSDVFTAN  240

Query  1013  ILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNL  1192
             IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKPSSG VKTKLAL+GKG+TFDSGGYN+
Sbjct  241   ILNEEQCKELKMGSYLAVAAASANPPFFIHLVYKPSSGDVKTKLALVGKGLTFDSGGYNI  300

Query  1193  KIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDIL  1372
             K G   SIELMK DM G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGMRPGD++
Sbjct  301   KTGPGCSIELMKFDMGGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTGMRPGDVI  360

Query  1373  TASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTP  1552
             TASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGAC+ ALG SVAGI+TP
Sbjct  361   TASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACVIALGTSVAGIYTP  420

Query  1553  SEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +++LAKEV+ A++  GEKLWRMPLEESYWE MKS  ADM+N G   G +ITA+LF+K
Sbjct  421   NDELAKEVIAASEKSGEKLWRMPLEESYWEMMKSGCADMVNTGGRAGGSITAALFLK  477



>ref|XP_009410189.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=530

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/470 (67%), Positives = 389/470 (83%), Gaps = 0/470 (0%)
 Frame = +2

Query  314   KPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLL  493
             KP  I+ P+I    +E+D  EWKGD+LAV V+EKD  +D +SKFQN+ L++LD K+GGLL
Sbjct  19    KPADIEIPQIAFTVKEMDFSEWKGDLLAVAVSEKDTKKDSDSKFQNVFLKRLDDKIGGLL  78

Query  494   SEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqa  673
             +EA +EEDF+GK+GQS  LRLPGLG KR+GLVGLGS  S+  AYR +GE +A  AK+AQA
Sbjct  79    AEAVTEEDFTGKAGQSTFLRLPGLGFKRLGLVGLGSSSSTAAAYRGIGEAVAGVAKAAQA  138

Query  674   ssvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGP  853
             +SVAV LAS++G+S E K++AASA+A+G + G +EDNRF+ + K P LK+V+++G G+G 
Sbjct  139   NSVAVCLASSDGISEELKINAASAIASGTILGVYEDNRFRSDSKKPLLKTVDVIGFGSGT  198

Query  854   EIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQC  1033
              +++KLKY+  V SGVIF KELVNAPANVLTPGALAEEA  IA+LYSDVLTATILD EQC
Sbjct  199   VVDQKLKYATDVCSGVIFGKELVNAPANVLTPGALAEEASKIATLYSDVLTATILDAEQC  258

Query  1034  KELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSS  1213
             KELKMGS+LGVAAA++NP +FIHLCYKP +G VK KLA++GKG+TFDSGGYN+K G   S
Sbjct  259   KELKMGSYLGVAAASSNPPHFIHLCYKPPNGDVKRKLAIVGKGLTFDSGGYNIKTGPGCS  318

Query  1214  IELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKR  1393
             IE MK DM GAA  FGAAK++AQIKP GVEVHFI  ACENMISGTGMRPGDI+TASNGK 
Sbjct  319   IETMKVDMGGAAAAFGAAKSLAQIKPPGVEVHFISAACENMISGTGMRPGDIVTASNGKT  378

Query  1394  IEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKE  1573
             IEV +TDAEGRL LADALVYA   G++K+VDLATLTGACI ALG S+AG ++PS+DLAKE
Sbjct  379   IEVNNTDAEGRLTLADALVYACNQGIDKVVDLATLTGACIVALGPSIAGFYSPSDDLAKE  438

Query  1574  VLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             ++ A++V GEK WRMPLEESYWE+MKS +ADM+N G   G +ITA+LF+K
Sbjct  439   IVTASEVTGEKFWRMPLEESYWESMKSGVADMVNTGGRQGGSITAALFLK  488



>emb|CDX76828.1| BnaC08g34140D [Brassica napus]
Length=519

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/483 (67%), Positives = 389/483 (81%), Gaps = 8/483 (2%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAHS     LGLT+P     PKI  AA+E+D+ EWKGD+L VG TEKD  +D  SKF+N 
Sbjct  1     MAHS-----LGLTQPKPTDHPKISFAAKEIDVTEWKGDLLVVGATEKDSTKDSASKFENP  55

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL KLD++L GLL+  SSEEDFSGK GQS VLRLPGLGSKRIGL+GLG   SS  A+++L
Sbjct  56    ILNKLDARLSGLLALVSSEEDFSGKPGQSTVLRLPGLGSKRIGLIGLGKSASSPAAFQSL  115

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +A  AK++Q+S+VAVALAS +    ESKLS+ASA+A+G+V G FED RFK E K P+
Sbjct  116   GEAVATVAKASQSSTVAVALASHDN---ESKLSSASALASGVVLGLFEDGRFKSESKKPS  172

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             L SV+I+G GTGPE+EKKLKY++ VS GVIF +EL+N+PANVLTP  LA+EA  +AS YS
Sbjct  173   LSSVDIIGFGTGPELEKKLKYAQDVSYGVIFGRELINSPANVLTPAVLADEAAKVASTYS  232

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV TA IL+ EQC+ELKMGS+L VAAA+ NP +FIHL Y+P SG VKTKLAL+GKG+TFD
Sbjct  233   DVFTANILNEEQCRELKMGSYLAVAAASANPPFFIHLVYRPPSGDVKTKLALVGKGLTFD  292

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G  SSIELMK DM G+A V GAAKA+ +IKP GVEVHFIV ACENMISGTGM
Sbjct  293   SGGYNIKAGPGSSIELMKFDMGGSAAVLGAAKAVGEIKPPGVEVHFIVAACENMISGTGM  352

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD++TASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGAC+ ALG S+
Sbjct  353   RPGDVITASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACVIALGTSM  412

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AGI+TP+++LA EV+ A++  GEKLWRMPLEESYWE MKS  ADM+N G   G +ITA+L
Sbjct  413   AGIYTPNDELATEVIAASEKSGEKLWRMPLEESYWEMMKSGCADMVNTGGRAGGSITAAL  472

Query  1715  FMK  1723
             F+K
Sbjct  473   FLK  475



>ref|XP_003553879.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like isoform 
1 [Glycine max]
Length=582

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/493 (68%), Positives = 396/493 (80%), Gaps = 2/493 (0%)
 Frame = +2

Query  251   QILSFGSY-MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMAR  427
             Q LSF S  +   +A ATLGLT P   +  K+  AA+E+D+ EWKGD+LAVGVTEKD+AR
Sbjct  47    QRLSFASQPLRRLMARATLGLTLPANTESLKVSFAAKELDVAEWKGDLLAVGVTEKDVAR  106

Query  428   DPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLP-GLGSKRIGLVGLGSV  604
             +  S+F+N IL  LDSKLGGLL + SSEEDFSGK GQS VLR+  GLG KR+ L+GLG+ 
Sbjct  107   NVESRFENAILSALDSKLGGLLGQVSSEEDFSGKLGQSTVLRIASGLGFKRVALLGLGAS  166

Query  605   VSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDN  784
              S+T A+++LGE +AAAAKSAQA  VAVALAS + LS ESK   ASA+A+G + GTFEDN
Sbjct  167   ASTTSAFKSLGEAVAAAAKSAQAGHVAVALASPDALSTESKPKTASAIASGTLLGTFEDN  226

Query  785   RFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAE  964
             R+K E K   L SV+I+GLGTGPE+EKKLKY+  +SSG+I  +ELVN+PANVLTPG LAE
Sbjct  227   RYKSESKKSVLSSVDIIGLGTGPELEKKLKYAADISSGIILGRELVNSPANVLTPGVLAE  286

Query  965   EAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKL  1144
             EA  IAS Y+DV TA ILD EQCKELKMGS+LGVAAA+ NP +FIHLCYKP +G V  KL
Sbjct  287   EASKIASTYNDVFTAKILDAEQCKELKMGSYLGVAAASANPPHFIHLCYKPPTGPVNVKL  346

Query  1145  ALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPA  1324
             AL+GKG+TFDSGGYN+K G    IELMK DM G+A VFGAAKA+ QIKP GVEVHFIV A
Sbjct  347   ALVGKGLTFDSGGYNIKTGPGCLIELMKFDMGGSAAVFGAAKALGQIKPLGVEVHFIVAA  406

Query  1325  CENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTG  1504
             CENMISGTGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA   G EK+VDLATLTG
Sbjct  407   CENMISGTGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGAEKIVDLATLTG  466

Query  1505  ACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGS  1684
             ACI  LG S+AG+FTPS+DLAKEV +A++  GEKLWR+PLEESYWE+MKS +ADM+N G 
Sbjct  467   ACIIGLGSSIAGVFTPSDDLAKEVFDASEASGEKLWRLPLEESYWESMKSGVADMVNTGG  526

Query  1685  LDGDAITASLFMK  1723
               G AITA+LF+K
Sbjct  527   RPGSAITAALFLK  539



>ref|XP_009140523.1| PREDICTED: leucine aminopeptidase 1 [Brassica rapa]
Length=521

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/477 (68%), Positives = 386/477 (81%), Gaps = 5/477 (1%)
 Frame = +2

Query  299   TLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSK  478
             TLGLTKPN    PKI  AA+E+D+ EWKGD+L VGV E+D+ +D  SKF+N IL KLD+ 
Sbjct  4     TLGLTKPNSTDHPKISFAAKEIDVTEWKGDLLVVGVREQDLTKDDGSKFENPILNKLDAH  63

Query  479   LGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSST--IAYRTLGETIaa  652
               GLL+  SSEEDF+GK GQS VLRLPGL +KRIGL+GLG  VSS+   A+ +LGE +A 
Sbjct  64    TSGLLALVSSEEDFTGKPGQSTVLRLPGLATKRIGLIGLGKTVSSSSPAAFHSLGEGVAN  123

Query  653   aaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEI  832
              +K++Q+S+VAVALAS E    ESKLS+ASA+A+G+V G FED R+K E K P+L SV+I
Sbjct  124   VSKASQSSTVAVALASPES---ESKLSSASALASGVVLGLFEDGRYKSESKKPSLSSVDI  180

Query  833   LGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTAT  1012
             +G GTGPE+EKKLKY+E VS GVIF +EL+N+PANVLTP  LAEEA  +AS YSDV TA 
Sbjct  181   IGFGTGPEVEKKLKYAEDVSYGVIFGRELINSPANVLTPAVLAEEAAKVASTYSDVFTAN  240

Query  1013  ILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNL  1192
             IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKP SG VKTKLAL+GKG+TFDSGGYN+
Sbjct  241   ILNEEQCKELKMGSYLAVAAASANPPFFIHLVYKPKSGDVKTKLALVGKGLTFDSGGYNI  300

Query  1193  KIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDIL  1372
             K G   SIELMK DM G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGMRPGD++
Sbjct  301   KTGPGCSIELMKFDMGGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTGMRPGDVI  360

Query  1373  TASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTP  1552
             TASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGAC+ ALG SVAGI+TP
Sbjct  361   TASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACVIALGTSVAGIYTP  420

Query  1553  SEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +++LAKEV+ A++  GEKLWRMPLEESYWE MKS  ADM+N G   G +ITA+LF+K
Sbjct  421   NDELAKEVIAASEKSGEKLWRMPLEESYWEMMKSGCADMVNTGGRAGGSITAALFLK  477



>ref|XP_004514667.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Cicer 
arietinum]
Length=575

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/492 (68%), Positives = 396/492 (80%), Gaps = 6/492 (1%)
 Frame = +2

Query  257   LSFGSYMAHS--VALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARD  430
             LSF S +     +A A+LGLT P   Q PK+   A+E D+ EWKGD+LAV VTEKD+ARD
Sbjct  44    LSFTSAVPFRNLMARASLGLTHPANTQTPKVSFTAKETDVAEWKGDLLAVAVTEKDVARD  103

Query  431   PNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLP-GLGSKRIGLVGLGSVV  607
              +S+FQN IL  LD KLGGLL+EASSEEDF+GK GQS VLR+  GLGSKR+ L+GLG+  
Sbjct  104   GDSRFQNPILSALDFKLGGLLAEASSEEDFTGKLGQSTVLRIAAGLGSKRVALLGLGASA  163

Query  608   SSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNR  787
             S    +++LGE +AAAAKSAQA+ VAV LAS++GLS    ++ ASA+ATG V GTFEDNR
Sbjct  164   SGPATFKSLGEAVAAAAKSAQAAHVAVVLASSQGLSA---INTASAIATGTVLGTFEDNR  220

Query  788   FKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEE  967
             +K E K   LKSV+I+GLGTGP++EKKLKY+  VSSG++  +ELVN+PANVLTPG LAEE
Sbjct  221   YKSESKKTALKSVDIIGLGTGPDLEKKLKYAGDVSSGILLGRELVNSPANVLTPGVLAEE  280

Query  968   AKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLA  1147
             A  IAS YSDV TA ILD EQCKELKMGS+L VAAA+ NP  FIHLCYKP SG V  KLA
Sbjct  281   ASKIASTYSDVFTAKILDAEQCKELKMGSYLAVAAASANPPQFIHLCYKPPSGPVNVKLA  340

Query  1148  LLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPAC  1327
             L+GKG+TFDSGGYN+K G    IELMK DM G+A VFGAAKA+ QIKP GVEVHFIV AC
Sbjct  341   LVGKGLTFDSGGYNIKTGPGCMIELMKFDMGGSAAVFGAAKALGQIKPLGVEVHFIVAAC  400

Query  1328  ENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGA  1507
             ENMISGTGMRPGD++TASNGK IEV +TDAEGRL LADALVYA   GV+K++DLATLTGA
Sbjct  401   ENMISGTGMRPGDVVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIIDLATLTGA  460

Query  1508  CITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSL  1687
             CI ALG ++AG+FTPS+DLAKEV +A++V GEKLWR+P+EESYWE+MKS +ADM+N G  
Sbjct  461   CIIALGPTIAGVFTPSDDLAKEVFDASEVSGEKLWRLPIEESYWESMKSGVADMVNTGGR  520

Query  1688  DGDAITASLFMK  1723
              G AITA+LF+K
Sbjct  521   QGGAITAALFLK  532



>ref|XP_002454700.1| hypothetical protein SORBIDRAFT_04g035840 [Sorghum bicolor]
 gb|EES07676.1| hypothetical protein SORBIDRAFT_04g035840 [Sorghum bicolor]
Length=594

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/475 (67%), Positives = 395/475 (83%), Gaps = 1/475 (0%)
 Frame = +2

Query  302   LGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKL  481
             LGLTKPN I+ P++  +A++V+  EWKGDILAV VTEKD+++D +SKF+N +L+KLD +L
Sbjct  76    LGLTKPNAIEPPQVTFSAKDVEFSEWKGDILAVAVTEKDLSKDADSKFENAVLKKLDGQL  135

Query  482   GGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAY-RTLGETIaaaa  658
             GGLLSEA++EEDF+GK+GQS+VLRL G G KR+GL+GLG    ST A  R LGE++A+ A
Sbjct  136   GGLLSEAAAEEDFTGKTGQSVVLRLAGQGFKRVGLIGLGQNAPSTAAAGRGLGESVASVA  195

Query  659   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  838
             K+AQAS+ A+ LAS  G+  E KL+AA+A+A+G V G +ED+R+K E K   LK V+I+G
Sbjct  196   KAAQASTAAIVLASPSGIQEEFKLTAAAAIASGTVLGLYEDSRYKSESKKVHLKQVDIIG  255

Query  839   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1018
             LG+G ++++KLKY+  +SSGVIF +ELVN+PANVLTP  LAEEA  IAS YSDV TATIL
Sbjct  256   LGSGADVDQKLKYANDLSSGVIFGRELVNSPANVLTPAVLAEEASKIASTYSDVFTATIL  315

Query  1019  DVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKI  1198
             DVE+CKELKMGS+LGVAAA+ NP +FIHLCYKP+ G+VK KLA++GKG+TFDSGGYN+K 
Sbjct  316   DVEKCKELKMGSYLGVAAASANPPHFIHLCYKPTDGNVKRKLAIVGKGLTFDSGGYNIKT  375

Query  1199  GANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTA  1378
             G   SIELMK DM G+A VFGAAKA+ QIKP GVEVHFIV ACENMISGTGMRPGDI+TA
Sbjct  376   GPGCSIELMKFDMGGSAAVFGAAKALGQIKPPGVEVHFIVAACENMISGTGMRPGDIVTA  435

Query  1379  SNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSE  1558
             SNGK IEV +TDAEGRL LADALVYA   GVEK++DLATLTGAC+ ALG S+AG+FTPS+
Sbjct  436   SNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIIDLATLTGACVIALGPSIAGVFTPSD  495

Query  1559  DLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +LAKEV  A++V GEK WR+PLEESYWE+MKS +ADM+N G   G +ITA+LF+K
Sbjct  496   ELAKEVTAASEVSGEKFWRLPLEESYWESMKSGVADMVNTGGRQGGSITAALFLK  550



>gb|AFW73857.1| hypothetical protein ZEAMMB73_599286 [Zea mays]
Length=596

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/475 (67%), Positives = 396/475 (83%), Gaps = 1/475 (0%)
 Frame = +2

Query  302   LGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKL  481
             LGLTKPN ++ P++  +A++++  EWKGDILAV VTEKD+++D +SKF+N +L+KLD +L
Sbjct  77    LGLTKPNAVEPPQVTFSAKDIEFSEWKGDILAVAVTEKDLSKDADSKFENAVLKKLDGQL  136

Query  482   GGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG-SVVSSTIAYRTLGETIaaaa  658
             GGLLSEA++EEDF+GK+GQS+VLRL G G KR+GL+GLG S  S+  A R LGE++A+ A
Sbjct  137   GGLLSEAAAEEDFTGKTGQSVVLRLAGQGFKRVGLIGLGQSAPSTAAASRGLGESVASVA  196

Query  659   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  838
             K+AQASS A+ LAS  G+  E KL+AA+A+A+G V G +ED+R+K E K   LK V+I+G
Sbjct  197   KAAQASSAAIVLASPSGIQEEFKLTAAAAVASGTVLGLYEDSRYKSESKKVHLKQVDIIG  256

Query  839   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1018
             LG+G E+++KLKY+  +SSGVIF +ELVN+PANVLTP  LAEEA  IAS YSDV TAT+L
Sbjct  257   LGSGAEVDQKLKYANDLSSGVIFGRELVNSPANVLTPAVLAEEASKIASTYSDVFTATVL  316

Query  1019  DVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKI  1198
             DVE+CKELKMGS+LGVAAA+ NP +FIHLCYKP+ G+VK KLA++GKG+TFDSGGYN+K 
Sbjct  317   DVEKCKELKMGSYLGVAAASANPPHFIHLCYKPTDGNVKRKLAIVGKGLTFDSGGYNIKT  376

Query  1199  GANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTA  1378
             G   SIELMK DM G+A VFGAAKA+ QIKP GVEVHFIV ACENMISGTGMRPGDI+TA
Sbjct  377   GPGCSIELMKFDMGGSAAVFGAAKALGQIKPPGVEVHFIVAACENMISGTGMRPGDIVTA  436

Query  1379  SNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSE  1558
             SNGK IEV +TDAEGRL LADALVYA   GVEK++DLATLTGAC+ ALG S+AGIFTPS+
Sbjct  437   SNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIIDLATLTGACVVALGPSIAGIFTPSD  496

Query  1559  DLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +LAKEV  A++V GEK WR+PLEESYWE+MKS +ADM+N G   G +ITA+LF+K
Sbjct  497   ELAKEVAAASEVSGEKFWRLPLEESYWESMKSGVADMVNTGGRQGGSITAALFLK  551



>ref|XP_004954213.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like isoform 
X2 [Setaria italica]
Length=592

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/507 (64%), Positives = 406/507 (80%), Gaps = 9/507 (2%)
 Frame = +2

Query  221   PLQKLNNGSSQILSFGSYMAHSVALA-----TLGLTKPNQIQRPKILIAAREVDLLEWKG  385
             PL  L   + Q L   + M H+ A A      LGLTKPN ++ P+I  +A++ +  EWKG
Sbjct  45    PLAPL---ARQPLGHRARMGHTAAAAAAAGPALGLTKPNAVEPPQITFSAKDFEFSEWKG  101

Query  386   DILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGL  565
             DILAV VTEKD+++D +SKF+N +L+KLDS+LGGLLSEA++EEDF+GK+GQS+VLR+ G 
Sbjct  102   DILAVAVTEKDLSKDSDSKFENAVLKKLDSQLGGLLSEAAAEEDFTGKAGQSVVLRVAGQ  161

Query  566   GSKRIGLVGLGSVVSSTIA-YRTLGETIaaaaksaqassvavalasaEGLSVESKLSAAS  742
             G KR+GL+GLG    ST A  R LGE++A+ AK+AQASS A+  AS  G+  E KL+AA+
Sbjct  162   GFKRVGLIGLGQNAPSTAAACRGLGESVASVAKAAQASSAAIVFASPSGIQEEFKLTAAA  221

Query  743   AMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELV  922
             A+A+G V G++ED+R+K E K   LK V+I+GLG+GPE+++KLKY+  +SSGVIF +ELV
Sbjct  222   AIASGTVLGSYEDSRYKSESKKVHLKQVDIIGLGSGPEVDQKLKYANDLSSGVIFGRELV  281

Query  923   NAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIH  1102
             N+PANVLTP  LAEEA  IAS YSDV TATILD E+CKELKMGS+L VAAA+ NP +FIH
Sbjct  282   NSPANVLTPAVLAEEASKIASTYSDVFTATILDEEKCKELKMGSYLAVAAASANPPHFIH  341

Query  1103  LCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQ  1282
             LCYKP+ G+VK KLA++GKG+TFDSGGYN+K G   SIELMK DM G+A VFGAAKA+ Q
Sbjct  342   LCYKPTDGNVKRKLAIVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVFGAAKALGQ  401

Query  1283  IKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASK  1462
             IKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA  
Sbjct  402   IKPPGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACN  461

Query  1463  LGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWE  1642
              GVEK+VDLATLTGAC+ ALG ++AGIFTPS++LAKEV  A++V GEK WR+PLEESYWE
Sbjct  462   QGVEKIVDLATLTGACVVALGPNIAGIFTPSDELAKEVTAASEVSGEKFWRLPLEESYWE  521

Query  1643  TMKSSIADMINAGSLDGDAITASLFMK  1723
             +MKS +ADM+N G   G +ITA+LF+K
Sbjct  522   SMKSGVADMVNTGGRQGGSITAALFLK  548



>ref|XP_010429381.1| PREDICTED: leucine aminopeptidase 1 [Camelina sativa]
Length=518

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/475 (68%), Positives = 390/475 (82%), Gaps = 4/475 (1%)
 Frame = +2

Query  299   TLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSK  478
             TLGLT+PN  +  KI  AA+E+D++EWKGD+L VGVT+KD+++D +SKF+N IL KLD  
Sbjct  4     TLGLTQPNSTEPHKISFAAKEIDVIEWKGDVLVVGVTDKDLSKDESSKFKNPILNKLDDH  63

Query  479   LGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaa  658
             L GLL + SSEEDF+GK GQS VLRLPGLG+KRI L+GLG  V S  A+ +LG+ +   +
Sbjct  64    LSGLLVQVSSEEDFNGKPGQSTVLRLPGLGAKRIALIGLGQSVPS--AFHSLGDAVVTVS  121

Query  659   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  838
             K++Q++SVAV LAS   +S ESK+S+ASA+A+GIV G FED+R+K E K P+LKSV+I+G
Sbjct  122   KASQSTSVAVVLAST--VSDESKISSASALASGIVLGLFEDSRYKSESKKPSLKSVDIIG  179

Query  839   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1018
              GTGPE+EKKLKY+E VS GVIF +EL N+PANVLTP  LAEEA  +AS YSDV TA IL
Sbjct  180   FGTGPELEKKLKYAEDVSYGVIFGRELTNSPANVLTPAVLAEEAAKLASSYSDVFTANIL  239

Query  1019  DVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKI  1198
             + EQCKELKMGS+L VAAA+ NP +FIHL YKP SGSVKTKLAL+GKG+TFDSGGYN+K 
Sbjct  240   NEEQCKELKMGSYLAVAAASANPPHFIHLVYKPPSGSVKTKLALVGKGLTFDSGGYNIKT  299

Query  1199  GANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTA  1378
             G    IELMK DM G+A VFGAAKAIA+IKP GVEVHFIV ACENMISGTGMRPGD++TA
Sbjct  300   GPGCLIELMKLDMGGSAAVFGAAKAIAEIKPPGVEVHFIVAACENMISGTGMRPGDVITA  359

Query  1379  SNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSE  1558
             SNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGAC+ ALG S+A I+TPS+
Sbjct  360   SNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACVVALGPSMAAIYTPSD  419

Query  1559  DLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +LAKEV+ A++  GEKLWRMPLE+SYWE MKS +ADM+N G   G +ITA+LF+K
Sbjct  420   ELAKEVVSASERSGEKLWRMPLEDSYWEMMKSGVADMVNTGGRAGGSITAALFLK  474



>sp|Q6K669.1|AMPL2_ORYSJ RecName: Full=Leucine aminopeptidase 2, chloroplastic; AltName: 
Full=Leucyl aminopeptidase 2; Short=LAP 2; AltName: Full=Proline 
aminopeptidase 2; AltName: Full=Prolyl aminopeptidase 
2; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD19264.1| putative leucine aminopeptidase [Oryza sativa Japonica Group]
 dbj|BAD19673.1| putative leucine aminopeptidase [Oryza sativa Japonica Group]
 gb|EAY87845.1| hypothetical protein OsI_09267 [Oryza sativa Indica Group]
 gb|EAZ24923.1| hypothetical protein OsJ_08704 [Oryza sativa Japonica Group]
Length=598

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/497 (65%), Positives = 400/497 (80%), Gaps = 6/497 (1%)
 Frame = +2

Query  251   QILSFGSYMAHSVALA-----TLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEK  415
             Q L   + M H+ A A      LGLTKPN ++ P++  AA++V+  EWKGDILA+ VTE 
Sbjct  59    QPLGHRARMGHTAAAAAAAGPALGLTKPNAVEPPQVSFAAKDVEFSEWKGDILAIAVTEN  118

Query  416   DMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGL  595
             D+ +  +SKF+N +L+KLD +LGGLLSEAS+EEDF+GK+GQS+VLRLPG G KR+GL+GL
Sbjct  119   DLVKGSDSKFENAVLKKLDGQLGGLLSEASAEEDFTGKAGQSVVLRLPGQGFKRVGLIGL  178

Query  596   G-SVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGT  772
             G +  S+T A + +GE++A+ AKSAQASS A+  AS  G+  + KL+AA+A+A+G V G 
Sbjct  179   GQNAPSTTTACKGIGESVASVAKSAQASSAAIVFASVGGIQEDFKLTAAAAIASGTVLGL  238

Query  773   FEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPG  952
              ED+R+K E K   LK V+++G G+GPE+++KLKY+  +SSGVIF KELVN+PANVLTP 
Sbjct  239   HEDSRYKSESKKVHLKQVDLIGFGSGPEVDQKLKYANDLSSGVIFGKELVNSPANVLTPA  298

Query  953   ALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSV  1132
              LAEEA NIAS YSDV TATILDVE+CKELKMGS+LGVAAA+ NP +FIHLCYKP  G+ 
Sbjct  299   VLAEEASNIASTYSDVFTATILDVEKCKELKMGSYLGVAAASANPPHFIHLCYKPPGGNA  358

Query  1133  KTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHF  1312
             K KLA++GKG+TFDSGGYN+K G   SIELMK DM G+A VFGAAKA+ QIKP GVEVHF
Sbjct  359   KRKLAIVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVFGAAKALGQIKPPGVEVHF  418

Query  1313  IVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLA  1492
             IV ACENMISGTGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA   GV+K++DLA
Sbjct  419   IVAACENMISGTGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIIDLA  478

Query  1493  TLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMI  1672
             TLTGAC+ ALG S+AGIFTPS++LAKEV  A+++ GEK WRMPLEESYWE+MKS +ADM+
Sbjct  479   TLTGACVVALGPSIAGIFTPSDELAKEVAAASEISGEKFWRMPLEESYWESMKSGVADMV  538

Query  1673  NAGSLDGDAITASLFMK  1723
             N G   G +ITA+LF+K
Sbjct  539   NTGGRQGGSITAALFLK  555



>emb|CDY39696.1| BnaA04g14130D [Brassica napus]
Length=522

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/478 (68%), Positives = 385/478 (81%), Gaps = 6/478 (1%)
 Frame = +2

Query  299   TLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSK  478
             TLGLTKPN    PKI  AA+E+D+ EWKGD+L VGVTEKD+ +D  SKF+N IL KLD+ 
Sbjct  4     TLGLTKPNSTDHPKISFAAKEIDVTEWKGDLLVVGVTEKDLTKDDGSKFENPILNKLDAH  63

Query  479   LGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG---SVVSSTIAYRTLGETIa  649
               GLL+  SSEEDF+GK GQS VLRLPGL +KRIGL+GLG   S  SS  A+ +LGE +A
Sbjct  64    TSGLLALVSSEEDFTGKPGQSTVLRLPGLATKRIGLIGLGKPASSSSSPTAFHSLGEGVA  123

Query  650   aaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVE  829
               +K++Q+S+VAVALAS E    ESKLS+ASA+A+G+V G FED R+K + K P+L SV+
Sbjct  124   NVSKASQSSTVAVALASPES---ESKLSSASALASGVVLGLFEDGRYKSDSKKPSLSSVD  180

Query  830   ILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTA  1009
             I+G GTG E+EKKLKY+E VS GVIF +EL+N+PANVLTP  LAEEA  +AS YSDV TA
Sbjct  181   IIGFGTGAEVEKKLKYAEDVSYGVIFGRELINSPANVLTPAVLAEEAAKVASTYSDVFTA  240

Query  1010  TILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYN  1189
              IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKP SG VKTKLAL+GKG+TFDSGGYN
Sbjct  241   NILNEEQCKELKMGSYLAVAAASANPPFFIHLVYKPKSGDVKTKLALVGKGLTFDSGGYN  300

Query  1190  LKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDI  1369
             +K G   SIELMK DM G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGMRPGD+
Sbjct  301   IKTGPGCSIELMKFDMGGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTGMRPGDV  360

Query  1370  LTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFT  1549
             +TASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGAC+ ALG SVAGI+T
Sbjct  361   ITASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACVIALGTSVAGIYT  420

Query  1550  PSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             P+++LAKEV+ A++  GEKLWRMPLEESYWE MKS  ADM+N G   G +ITA+LF+K
Sbjct  421   PNDELAKEVIAASEKSGEKLWRMPLEESYWEMMKSGCADMVNTGGRAGGSITAALFLK  478



>emb|CDY34790.1| BnaA09g41570D [Brassica napus]
Length=515

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/483 (67%), Positives = 386/483 (80%), Gaps = 12/483 (2%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAHS     LGLT+P     PKI  +A+++D+ EWKGD+L VGVTEKD  RD +SKF+N 
Sbjct  1     MAHS-----LGLTQPKPTDHPKISFSAKDIDVTEWKGDLLVVGVTEKDSKRDSSSKFENP  55

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL KLD+   GLL+  SSEEDF+GK GQS VLRLPGLGSKRIGL+GLG     + A+++L
Sbjct  56    ILNKLDAHSSGLLALVSSEEDFNGKPGQSTVLRLPGLGSKRIGLIGLGK----SAAFQSL  111

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +A  AK++Q+SSV VALAS E    ESKLS+ASA+A+G+V G FED RFK E K P+
Sbjct  112   GEAVATVAKASQSSSVGVALASHE---TESKLSSASALASGVVLGLFEDGRFKSESKKPS  168

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             L SV+I+G GTGPE+EKKLKY+E VS GVIF +EL N+PANVLTP  LA+EA  +AS YS
Sbjct  169   LSSVDIIGFGTGPEVEKKLKYAEDVSYGVIFGRELTNSPANVLTPAVLADEAVKVASSYS  228

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV TA IL+ EQC+ELKMGS+L VAAA+ NP +FIHL Y+P SG VKTKLAL+GKG+TFD
Sbjct  229   DVFTANILNEEQCRELKMGSYLAVAAASANPPFFIHLVYRPPSGDVKTKLALVGKGLTFD  288

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G  SSIELMK DM G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGM
Sbjct  289   SGGYNIKAGPGSSIELMKFDMGGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTGM  348

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD++TASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGAC+ ALG S+
Sbjct  349   RPGDVITASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACVIALGTSM  408

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AGI+TP+++LA EV+ A++  GEKLWRMPLEESYWE MKS  ADM+N G   G +ITA+L
Sbjct  409   AGIYTPNDELATEVIAASEKSGEKLWRMPLEESYWEMMKSGCADMVNTGGRAGGSITAAL  468

Query  1715  FMK  1723
             F+K
Sbjct  469   FLK  471



>ref|XP_010472421.1| PREDICTED: leucine aminopeptidase 1-like [Camelina sativa]
Length=518

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/483 (67%), Positives = 392/483 (81%), Gaps = 9/483 (2%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAH     TLGLT+PN  +  KI   A+E+D++EWKGD+L VGVT+KD+ +D +SKF+N 
Sbjct  1     MAH-----TLGLTQPNSTEPHKISFTAKEIDVIEWKGDVLVVGVTDKDLTKDESSKFKNP  55

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL KLD  L GLL++ SSEEDF+GK GQS VLRLPGLG+KRI L+GLG  V S  A+ +L
Sbjct  56    ILNKLDDHLNGLLAQVSSEEDFNGKPGQSTVLRLPGLGAKRIALIGLGQSVPS--AFHSL  113

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             G+++   +K++Q+SSVAV LAS+  +S ESK+S+ASA+A+GIV G FED+R+K E K P+
Sbjct  114   GDSVVTVSKASQSSSVAVVLASS--VSDESKISSASALASGIVLGLFEDSRYKSESKKPS  171

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKSV+I+G GTGP +EKKLKY + VS GVIF +EL N+PANVLTP  LAEEA  +AS YS
Sbjct  172   LKSVDIIGFGTGPALEKKLKYDDDVSYGVIFGRELTNSPANVLTPAVLAEEAAKLASSYS  231

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV TATIL+ EQCK LKMGS+L VAAA+ NP +FIHL YKP SGSVKTKLAL+GKG+TFD
Sbjct  232   DVFTATILNEEQCKVLKMGSYLAVAAASANPPHFIHLVYKPPSGSVKTKLALVGKGLTFD  291

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G    IELMK DM G+A VFGAAKAIA+IKP GVEVHFIV ACENMISGTGM
Sbjct  292   SGGYNIKTGPGCLIELMKLDMGGSAAVFGAAKAIAEIKPPGVEVHFIVAACENMISGTGM  351

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD++TASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGAC+ ALG S+
Sbjct  352   RPGDVITASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACVVALGPSM  411

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             A I+TPS++LAKEV+ A++  GEKLWRMPLE+SYWE MKS +ADM+N G   G +ITA+L
Sbjct  412   AAIYTPSDELAKEVVSASERSGEKLWRMPLEDSYWEMMKSGVADMVNTGGRAGGSITAAL  471

Query  1715  FMK  1723
             F+K
Sbjct  472   FLK  474



>ref|XP_009117239.1| PREDICTED: leucine aminopeptidase 1 [Brassica rapa]
Length=515

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/483 (67%), Positives = 386/483 (80%), Gaps = 12/483 (2%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAHS     LGLT+P     PKI  +A+++D+ EWKGD+L VGVTEKD  RD +SKF+N 
Sbjct  1     MAHS-----LGLTQPKPTDHPKISFSAKDIDVTEWKGDLLVVGVTEKDSTRDSSSKFENP  55

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL KLD+   GLL+  SSEEDF+GK GQS VLRLPGLGSKRIGL+GLG     + A+++L
Sbjct  56    ILNKLDAHSSGLLALVSSEEDFNGKPGQSTVLRLPGLGSKRIGLIGLGK----SAAFQSL  111

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +A  AK++Q+SSV VALAS E    ESKLS+ASA+A+G+V G FED RFK E K P+
Sbjct  112   GEAVATVAKASQSSSVGVALASHE---TESKLSSASALASGVVLGLFEDGRFKSESKKPS  168

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             L SV+I+G GTGPE+EKKLKY+E VS GVIF +EL N+PANVLTP  LAEEA  +AS YS
Sbjct  169   LSSVDIIGFGTGPELEKKLKYAEDVSYGVIFGRELTNSPANVLTPAVLAEEAVKVASSYS  228

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV TA IL+ EQC+ELKMGS+L VAAA+ NP +FIHL Y+PSSG VKTKLAL+GKG+TFD
Sbjct  229   DVFTANILNEEQCRELKMGSYLAVAAASANPPFFIHLVYRPSSGDVKTKLALVGKGLTFD  288

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G  SSIELMK DM G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGM
Sbjct  289   SGGYNIKAGPGSSIELMKFDMGGSAAVLGAAKAIGEIKPPGVEVHFIVSACENMISGTGM  348

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD++TASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGAC+ ALG S+
Sbjct  349   RPGDVITASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACVIALGTSM  408

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AGI+TP+++LA EV+ A++  GEKL RMPLEESYWE MKS  ADM+N G   G +ITA+L
Sbjct  409   AGIYTPNDELATEVIAASEKSGEKLRRMPLEESYWEMMKSGCADMVNTGGRAGGSITAAL  468

Query  1715  FMK  1723
             F+K
Sbjct  469   FLK  471



>gb|KHN42824.1| Leucine aminopeptidase 3, chloroplastic [Glycine soja]
Length=541

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/483 (66%), Positives = 372/483 (77%), Gaps = 29/483 (6%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             M+H++A ATLGLT P+ I+ PKI   A++VD+ EWKGDILAVGVTEKD+ARD NSKF+N+
Sbjct  42    MSHTLARATLGLTHPSNIETPKISFGAKDVDVTEWKGDILAVGVTEKDLARDANSKFENV  101

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL K+DSKLGGLL+EASSEEDFSGK           + S R    G+ +  SS  +   +
Sbjct  102   ILSKIDSKLGGLLAEASSEEDFSGK-----------VESWRGHCGGVAAAKSSQASSVAV  150

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
                                LAS+EGLS +SKLS A A+A+G V G FEDNR+K E K  T
Sbjct  151   A------------------LASSEGLSAQSKLSTAYAIASGAVLGLFEDNRYKSEAKKST  192

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             L+S++ +GLGTGPE+EKKLKY+  VSSG+IF +ELVN+PANVLTPG LAEEA  IAS YS
Sbjct  193   LRSIDFIGLGTGPELEKKLKYAGDVSSGIIFGRELVNSPANVLTPGVLAEEAAKIASTYS  252

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV TA IL+ EQC ELKMGS+LGVAAA+ NP +FIHLCYKP SG V  KLAL+GKG+TFD
Sbjct  253   DVFTAKILNSEQCAELKMGSYLGVAAASANPPHFIHLCYKPLSGPVNVKLALVGKGLTFD  312

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G   SIELMK DM G+A V G AKA+ QIKP GVEVHFIV ACENMISGTGM
Sbjct  313   SGGYNIKTGPGCSIELMKFDMGGSAAVLGTAKALGQIKPLGVEVHFIVAACENMISGTGM  372

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK++DLATLTGAC+ ALG S+
Sbjct  373   RPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIIDLATLTGACVVALGPSI  432

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AG+FTPS+DLAKEV EA+DV GEKLWR+PLEESYWETMKS +ADM+N G   G AI A+L
Sbjct  433   AGVFTPSDDLAKEVFEASDVSGEKLWRLPLEESYWETMKSGVADMLNTGGRQGGAIVAAL  492

Query  1715  FMK  1723
             F+K
Sbjct  493   FLK  495



>ref|NP_001233862.1| leucine aminopeptidase 1, chloroplastic [Solanum lycopersicum]
 sp|Q10712.1|AMPL1_SOLLC RecName: Full=Leucine aminopeptidase 1, chloroplastic; AltName: 
Full=DR57; AltName: Full=Leucyl aminopeptidase 1; Short=LAP 
1; AltName: Full=Proline aminopeptidase 1; AltName: Full=Prolyl 
aminopeptidase 1; Flags: Precursor [Solanum lycopersicum]
 gb|AAC49456.1| leucine aminopeptidase [Solanum lycopersicum]
Length=571

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/484 (67%), Positives = 397/484 (82%), Gaps = 4/484 (1%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             + H +A  TLGLT+PN+   PKI I A++  +++W+GD+LA+G TE DMARD NSKF+N 
Sbjct  50    IVHCIAGDTLGLTRPNESDAPKISIGAKDTAVVQWQGDLLAIGATENDMARDENSKFKNP  109

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             +LQ+LDS+L GLLS ASSEEDFSGKSGQS+ LR PG    RI LVGLGS  SS  +Y +L
Sbjct  110   LLQQLDSELNGLLSAASSEEDFSGKSGQSVNLRFPG---GRITLVGLGSSASSPTSYHSL  166

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             G+  AAAAKS+QA ++AVALAS +GLS ESK+++ASA+ATG+V G+FEDNRF+ E K  T
Sbjct  167   GQAAAAAAKSSQARNIAVALASTDGLSAESKINSASAIATGVVLGSFEDNRFRSESKKST  226

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             L+S++ILGLGTGPEIE+K+KY+E V +GVI  +ELVNAPAN++TP  LAEEAK IAS YS
Sbjct  227   LESLDILGLGTGPEIERKIKYAEHVCAGVILGRELVNAPANIVTPAVLAEEAKKIASTYS  286

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAAT-NPSYFIHLCYKPSSGSVKTKLALLGKGITF  1171
             DV++  ILD EQCKELKMG++L VAAAAT NP YFIHLC+K  +   KTKLAL+GKG+TF
Sbjct  287   DVISVNILDAEQCKELKMGAYLAVAAAATENPPYFIHLCFKTPTKERKTKLALVGKGLTF  346

Query  1172  DSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTG  1351
             DSGGYNLK+GA S IELMK DM GAA V GAAKA+ +I+P+ VEVHFIV ACENMIS  G
Sbjct  347   DSGGYNLKVGARSRIELMKNDMGGAAAVLGAAKALGEIRPSRVEVHFIVAACENMISAEG  406

Query  1352  MRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1531
             MRPGDI+TASNGK IEV +TDAEGRL LADAL+YA   GVEK++DLATLTGA + ALG S
Sbjct  407   MRPGDIVTASNGKTIEVNNTDAEGRLTLADALIYACNQGVEKIIDLATLTGAIMVALGPS  466

Query  1532  VAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITAS  1711
             VAG FTP++DLA+EV+EAA+  GEKLWRMP+EESYWE+MKS +ADMIN G  +G AIT +
Sbjct  467   VAGAFTPNDDLAREVVEAAEASGEKLWRMPMEESYWESMKSGVADMINTGPGNGGAITGA  526

Query  1712  LFMK  1723
             LF+K
Sbjct  527   LFLK  530



>ref|XP_004954212.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like isoform 
X1 [Setaria italica]
Length=601

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/516 (63%), Positives = 405/516 (78%), Gaps = 18/516 (3%)
 Frame = +2

Query  221   PLQKLNNGSSQILSFGSYMAHSVALA-----TLGLTKPNQIQRPKILIAAREVDLLEWKG  385
             PL  L   + Q L   + M H+ A A      LGLTKPN ++ P+I  +A++ +  EWKG
Sbjct  45    PLAPL---ARQPLGHRARMGHTAAAAAAAGPALGLTKPNAVEPPQITFSAKDFEFSEWKG  101

Query  386   DILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGL  565
             DILAV VTEKD+++D +SKF+N +L+KLDS+LGGLLSEA++EEDF+GK+GQS+VLR+ G 
Sbjct  102   DILAVAVTEKDLSKDSDSKFENAVLKKLDSQLGGLLSEAAAEEDFTGKAGQSVVLRVAGQ  161

Query  566   GSKRIGLVGLGSVVSSTIA-YRTLGETIaaaaksaqassvavalasaEGLSVESKLSAAS  742
             G KR+GL+GLG    ST A  R LGE++A+ AK+AQASS A+  AS  G+  E KL+AA+
Sbjct  162   GFKRVGLIGLGQNAPSTAAACRGLGESVASVAKAAQASSAAIVFASPSGIQEEFKLTAAA  221

Query  743   AMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELV  922
             A+A+G V G++ED+R+K E K   LK V+I+GLG+GPE+++KLKY+  +SSGVIF +ELV
Sbjct  222   AIASGTVLGSYEDSRYKSESKKVHLKQVDIIGLGSGPEVDQKLKYANDLSSGVIFGRELV  281

Query  923   NAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIH  1102
             N+PANVLTP  LAEEA  IAS YSDV TATILD E+CKELKMGS+L VAAA+ NP +FIH
Sbjct  282   NSPANVLTPAVLAEEASKIASTYSDVFTATILDEEKCKELKMGSYLAVAAASANPPHFIH  341

Query  1103  LCYKPSSGSVKTKLALLGKGITFDS---------GGYNLKIGANSSIELMKKDMagaavv  1255
             LCYKP+ G+VK KLA++GKG+TFD          GGYN+K G   SIELMK DM G+A V
Sbjct  342   LCYKPTDGNVKRKLAIVGKGLTFDRLVILSTYFIGGYNIKTGPGCSIELMKFDMGGSAAV  401

Query  1256  fgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLIL  1435
             FGAAKA+ QIKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IEV +TDAEGRL L
Sbjct  402   FGAAKALGQIKPPGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIEVNNTDAEGRLTL  461

Query  1436  ADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWR  1615
             ADALVYA   GVEK+VDLATLTGAC+ ALG ++AGIFTPS++LAKEV  A++V GEK WR
Sbjct  462   ADALVYACNQGVEKIVDLATLTGACVVALGPNIAGIFTPSDELAKEVTAASEVSGEKFWR  521

Query  1616  MPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +PLEESYWE+MKS +ADM+N G   G +ITA+LF+K
Sbjct  522   LPLEESYWESMKSGVADMVNTGGRQGGSITAALFLK  557



>gb|AAC49457.1| leucine aminopeptidase, partial [Solanum lycopersicum]
Length=566

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/484 (67%), Positives = 397/484 (82%), Gaps = 4/484 (1%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             + H +A  TLGLT+PN+   PKI I A++  +++W+GD+LA+G TE DMARD NSKF+N 
Sbjct  45    IVHCIAGDTLGLTRPNESDAPKISIGAKDTAVVQWQGDLLAIGATENDMARDENSKFKNP  104

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             +LQ+LDS+L GLLS ASSEEDFSGKSGQS+ LR PG    RI LVGLGS  SS  +Y +L
Sbjct  105   LLQQLDSELNGLLSAASSEEDFSGKSGQSVNLRFPG---GRITLVGLGSSASSPTSYHSL  161

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             G+  AAAAKS+QA ++AVALAS +GLS ESK+++ASA+ATG+V G+FEDNRF+ E K  T
Sbjct  162   GQAAAAAAKSSQARNIAVALASTDGLSAESKINSASAIATGVVLGSFEDNRFRSESKKST  221

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             L+S++ILGLGTGPEIE+K+KY+E V +GVI  +ELVNAPAN++TP  LAEEAK IAS YS
Sbjct  222   LESLDILGLGTGPEIERKIKYAEHVCAGVILGRELVNAPANIVTPAVLAEEAKKIASTYS  281

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAAT-NPSYFIHLCYKPSSGSVKTKLALLGKGITF  1171
             DV++  ILD EQCKELKMG++L VAAAAT NP YFIHLC+K  +   KTKLAL+GKG+TF
Sbjct  282   DVISVNILDAEQCKELKMGAYLAVAAAATENPPYFIHLCFKTPTKERKTKLALVGKGLTF  341

Query  1172  DSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTG  1351
             DSGGYNLK+GA S IELMK DM GAA V GAAKA+ +I+P+ VEVHFIV ACENMIS  G
Sbjct  342   DSGGYNLKVGAGSRIELMKNDMGGAAAVLGAAKALGEIRPSRVEVHFIVAACENMISAEG  401

Query  1352  MRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1531
             MRPGDI+TASNGK IEV +TDAEGRL LADAL+YA   GVEK++DLATLTGA + ALG S
Sbjct  402   MRPGDIVTASNGKTIEVNNTDAEGRLTLADALIYACNQGVEKIIDLATLTGAIMVALGPS  461

Query  1532  VAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITAS  1711
             VAG FTP++DLA+EV+EAA+  GEKLWRMP+EESYWE+MKS +ADMIN G  +G AIT +
Sbjct  462   VAGAFTPNDDLAREVVEAAEASGEKLWRMPMEESYWESMKSGVADMINLGPGNGGAITGA  521

Query  1712  LFMK  1723
             LF+K
Sbjct  522   LFLK  525



>emb|CAA18202.1| leucyl aminopeptidase-like protein (partial) [Arabidopsis thaliana]
 emb|CAB79809.1| leucyl aminopeptidase-like protein (partial) [Arabidopsis thaliana]
Length=505

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/462 (69%), Positives = 384/462 (83%), Gaps = 0/462 (0%)
 Frame = +2

Query  338   KILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEED  517
             +I  + +E+D+ EWKGDILAVGVTEKDMA+D NSKF+N IL+KLD+ LGGLL++ S+EED
Sbjct  1     QISFSGKEIDVTEWKGDILAVGVTEKDMAKDANSKFENPILKKLDAHLGGLLADVSAEED  60

Query  518   FSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  697
             FSGK GQS VLRLPGLGSKR+GL+GLG   S+  A+++LGE +AAAAK++QASSVAV LA
Sbjct  61    FSGKPGQSTVLRLPGLGSKRVGLIGLGKSASTPSAFQSLGEAVAAAAKASQASSVAVVLA  120

Query  698   saEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKY  877
             S+E  S ESKLS+AS +A+G V G FED+R+K E K P+LKSV  +G GTGPE+E KLKY
Sbjct  121   SSESFSDESKLSSASDIASGTVLGLFEDSRYKSESKKPSLKSVVFIGFGTGPELENKLKY  180

Query  878   SEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSF  1057
             +E VS GVIF KELVN+PANVL+P  LAEEA N+AS+YS+V+TA IL  EQCKELKMGS+
Sbjct  181   AEHVSYGVIFTKELVNSPANVLSPAVLAEEASNLASMYSNVMTANILKEEQCKELKMGSY  240

Query  1058  LGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDM  1237
             L VAAA+ NP +FIHL YKPSSG VKTKLAL+GKG+TFDSGGYN+KIG    IELMK D+
Sbjct  241   LAVAAASANPPHFIHLIYKPSSGPVKTKLALVGKGLTFDSGGYNIKIGPELIIELMKIDV  300

Query  1238  agaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDA  1417
              G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGMRPGD++TASNGK IEV DTD+
Sbjct  301   GGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTGMRPGDVITASNGKTIEVNDTDS  360

Query  1418  EGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVG  1597
             EGRL LADALVYA   GV+K+VD+ATLTG  I ALG S+AG++T S++LAKEV+ A+   
Sbjct  361   EGRLTLADALVYACNQGVDKIVDIATLTGEIIVALGPSMAGMYTASDELAKEVIAASQRS  420

Query  1598  GEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+LF+K
Sbjct  421   GEKLWRMPMEESYWEMMKSGVADMVNFGGRAGGSITAALFLK  462



>ref|XP_006350102.1| PREDICTED: leucine aminopeptidase, chloroplastic-like [Solanum 
tuberosum]
Length=574

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/484 (68%), Positives = 394/484 (81%), Gaps = 4/484 (1%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             + H +A  TLGLT+PN+   PKI I A++ D+++W+GD+LA+G TE D+ARD NSKF+N 
Sbjct  51    IVHCIAGDTLGLTRPNESDAPKISIGAKDTDVVQWQGDLLAIGATENDLARDENSKFKNP  110

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             +LQ+LDSKL GLLS ASSEEDFSGKSGQSI LRLPG    RI LVGLGS  SS  +Y +L
Sbjct  111   LLQQLDSKLNGLLSAASSEEDFSGKSGQSINLRLPG---GRITLVGLGSSASSPTSYHSL  167

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE  AAAAKSAQA ++AV+LAS +GLS ESK+S+ASA+ATG+V G FEDNRF+ + K   
Sbjct  168   GEAAAAAAKSAQARNIAVSLASTDGLSAESKISSASAIATGVVLGIFEDNRFRSDSKKAA  227

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             L+S++ILGLGTGPEIE K+KY+E V +GVI  +ELVNAPAN++TPG LAEEAK IAS YS
Sbjct  228   LESLDILGLGTGPEIESKIKYAEHVCAGVILGRELVNAPANIVTPGVLAEEAKKIASTYS  287

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAAT-NPSYFIHLCYKPSSGSVKTKLALLGKGITF  1171
             DV+T  ILD EQCKELKMG++L VAAAAT NP YFIHLC+K  +   KTK+AL+GKG+TF
Sbjct  288   DVITVNILDAEQCKELKMGAYLAVAAAATENPPYFIHLCFKTLTKERKTKIALVGKGLTF  347

Query  1172  DSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTG  1351
             DSGGYNLK GA S IELMK DM GAA V GAAKA+ +I+P GVEVHFIV ACENMISG G
Sbjct  348   DSGGYNLKTGAGSKIELMKYDMGGAAAVLGAAKALGEIRPFGVEVHFIVAACENMISGAG  407

Query  1352  MRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1531
             MRPGDI+TA+  K IEV +TDAEGRL LADAL+YA   GVEK++DLATLTGA +TALG S
Sbjct  408   MRPGDIVTANKSKTIEVNNTDAEGRLTLADALIYACNQGVEKIIDLATLTGAIVTALGPS  467

Query  1532  VAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITAS  1711
             VAG FTPS+ LA+EV+ AA+  GEKLWRMP+EESYWE+MKS +ADMIN G  DG AIT +
Sbjct  468   VAGAFTPSDGLAREVVVAAEASGEKLWRMPMEESYWESMKSGVADMINTGPRDGGAITGA  527

Query  1712  LFMK  1723
             LF+K
Sbjct  528   LFLK  531



>pdb|4KSI|A Chain A, Crystal Structure Analysis Of The Acidic Leucine Aminopeptidase 
Of Tomato
Length=529

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/480 (68%), Positives = 395/480 (82%), Gaps = 4/480 (1%)
 Frame = +2

Query  287   VALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQK  466
             +A  TLGLT+PN+   PKI I A++  +++W+GD+LA+G TE DMARD NSKF+N +LQ+
Sbjct  12    IAGDTLGLTRPNESDAPKISIGAKDTAVVQWQGDLLAIGATENDMARDENSKFKNPLLQQ  71

Query  467   LDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGETI  646
             LDS+L GLLS ASSEEDFSGKSGQS+ LR PG    RI LVGLGS  SS  +Y +LG+  
Sbjct  72    LDSELNGLLSAASSEEDFSGKSGQSVNLRFPG---GRITLVGLGSSASSPTSYHSLGQAA  128

Query  647   aaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSV  826
             AAAAKS+QA ++AVALAS +GLS ESK+++ASA+ATG+V G+FEDNRF+ E K  TL+S+
Sbjct  129   AAAAKSSQARNIAVALASTDGLSAESKINSASAIATGVVLGSFEDNRFRSESKKSTLESL  188

Query  827   EILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLT  1006
             +ILGLGTGPEIE+K+KY+E V +GVI  +ELVNAPAN++TP  LAEEAK IAS YSDV++
Sbjct  189   DILGLGTGPEIERKIKYAEHVCAGVILGRELVNAPANIVTPAVLAEEAKKIASTYSDVIS  248

Query  1007  ATILDVEQCKELKMGSFLGVAAAAT-NPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGG  1183
               ILD EQCKELKMG++L VAAAAT NP YFIHLC+K  +   KTKLAL+GKG+TFDSGG
Sbjct  249   VNILDAEQCKELKMGAYLAVAAAATENPPYFIHLCFKTPTKERKTKLALVGKGLTFDSGG  308

Query  1184  YNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPG  1363
             YNLK+GA S IELMK DM GAA V GAAKA+ +I+P+ VEVHFIV ACENMIS  GMRPG
Sbjct  309   YNLKVGARSRIELMKNDMGGAAAVLGAAKALGEIRPSRVEVHFIVAACENMISAEGMRPG  368

Query  1364  DILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGI  1543
             DI+TASNGK IEV +TDAEGRL LADAL+YA   GVEK++DLATLTGA + ALG SVAG 
Sbjct  369   DIVTASNGKTIEVNNTDAEGRLTLADALIYACNQGVEKIIDLATLTGAIMVALGPSVAGA  428

Query  1544  FTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             FTP++DLA+EV+EAA+  GEKLWRMP+EESYWE+MKS +ADMIN G  +G AIT +LF+K
Sbjct  429   FTPNDDLAREVVEAAEASGEKLWRMPMEESYWESMKSGVADMINTGPGNGGAITGALFLK  488



>ref|XP_010234597.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Brachypodium 
distachyon]
Length=526

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/484 (65%), Positives = 394/484 (81%), Gaps = 2/484 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAH+ A ATLGLTKPN I+  ++  AA +++  EWKGD+LAV VTE D++R P+++F+N 
Sbjct  1     MAHTAA-ATLGLTKPNAIEPLQVTFAATDIESSEWKGDLLAVAVTENDLSRGPDARFENA  59

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG-SVVSSTIAYRT  631
             +L KLDS+LGGLLSEAS+EEDF+GK+GQ++VLRL G G KR+ L+GLG S  S+  A R 
Sbjct  60    VLTKLDSQLGGLLSEASAEEDFAGKTGQAVVLRLQGQGFKRLALIGLGRSAPSTAAACRA  119

Query  632   LGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTP  811
             +GE++AAAAKSAQA + A+ +AS   +    KL+AA+A+A+G V G   D+R++ EP   
Sbjct  120   IGESVAAAAKSAQAGTAAIVIASPGAIQEGFKLNAAAAIASGTVLGLHVDSRYRSEPNNV  179

Query  812   TLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLY  991
              LK V+++GLG+GPE+E+KL+++  VSSGVIF K+LVN+PANVLTP  LAEEA  IAS Y
Sbjct  180   HLKHVDLIGLGSGPELERKLQHANYVSSGVIFGKDLVNSPANVLTPVVLAEEASKIASTY  239

Query  992   SDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITF  1171
             SDV TATILD E+CKELKMGS+LGVAAA+ NP  FIHLCYKP  G+VK KLA++GKG+TF
Sbjct  240   SDVFTATILDAERCKELKMGSYLGVAAASANPPRFIHLCYKPPGGNVKRKLAIVGKGLTF  299

Query  1172  DSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTG  1351
             DSGGYN+K+GA  SIELMK DM G+A VFGAAKA+ QIKP GVEVHFIV ACENMISGTG
Sbjct  300   DSGGYNIKVGAICSIELMKWDMGGSAAVFGAAKALGQIKPPGVEVHFIVAACENMISGTG  359

Query  1352  MRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1531
             MRPGDI+TASNG  IEV +TDAEGRL LADALVYA K GV+K++DLATLTG C  ALG S
Sbjct  360   MRPGDIVTASNGMTIEVNNTDAEGRLTLADALVYACKQGVDKIIDLATLTGYCRIALGLS  419

Query  1532  VAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITAS  1711
             +AGIFTPS++L KEV  A++V GEK WR+PLEESYWE+MKSS+ADM+N G+  G AITA+
Sbjct  420   IAGIFTPSDELDKEVAAASEVSGEKFWRLPLEESYWESMKSSVADMVNTGTPQGGAITAA  479

Query  1712  LFMK  1723
             LF+K
Sbjct  480   LFLK  483



>gb|AAA80498.1| leucine aminopeptidase, partial [Solanum lycopersicum]
Length=523

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/484 (67%), Positives = 396/484 (82%), Gaps = 4/484 (1%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             + H +A  TLGLT+PN+   PKI I A++  +++W+GD+LA+G TE DMARD NSKF+N 
Sbjct  2     IVHCIAGDTLGLTRPNESDAPKISIGAKDTAVVQWQGDLLAIGATENDMARDENSKFKNP  61

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             +LQ+LDS+L GLLS ASSEEDFSGKSGQS+ LR PG    RI LVGLGS  SS  +Y +L
Sbjct  62    LLQQLDSELNGLLSAASSEEDFSGKSGQSVNLRFPG---GRITLVGLGSSASSPTSYHSL  118

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             G+  AAAAKS+QA ++AVALAS +GLS ESK+++ASA+ATG+V G+FEDNRF+ E K  T
Sbjct  119   GQAAAAAAKSSQARNIAVALASTDGLSAESKINSASAIATGVVLGSFEDNRFRSESKKST  178

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             L+S++ILGLGTGPEIE+K+KY+E V +GVI  +ELVNAPAN++T   LAEEAK IAS YS
Sbjct  179   LESLDILGLGTGPEIERKIKYAEHVCAGVILGRELVNAPANIVTNAVLAEEAKKIASTYS  238

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAAT-NPSYFIHLCYKPSSGSVKTKLALLGKGITF  1171
             DV++  ILD EQCKELKMG++L VAAAAT NP YFIHLC+K  +   KTKLAL+GKG+TF
Sbjct  239   DVISVNILDAEQCKELKMGAYLAVAAAATENPPYFIHLCFKTPTKERKTKLALVGKGLTF  298

Query  1172  DSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTG  1351
             DSGGYNLK+GA S IELMK DM GAA V GAAKA+ +I+P+ VEVHFIV ACENMIS  G
Sbjct  299   DSGGYNLKVGAGSRIELMKNDMGGAAAVLGAAKALGEIRPSRVEVHFIVAACENMISAEG  358

Query  1352  MRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1531
             MRPGDI+TASNGK IEV +TDAEGRL LADAL+YA   GVEK++DLATLTGA + ALG S
Sbjct  359   MRPGDIVTASNGKTIEVNNTDAEGRLTLADALIYACNQGVEKIIDLATLTGAIMVALGPS  418

Query  1532  VAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITAS  1711
             VAG FTP++DLA+EV+EAA+  GEKLWRMP+EESYWE+MKS +ADMIN G  +G AIT +
Sbjct  419   VAGAFTPNDDLAREVVEAAEASGEKLWRMPMEESYWESMKSGVADMINTGPGNGGAITGA  478

Query  1712  LFMK  1723
             LF+K
Sbjct  479   LFLK  482



>gb|KHN17492.1| Leucine aminopeptidase 3, chloroplastic [Glycine soja]
Length=554

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/511 (64%), Positives = 385/511 (75%), Gaps = 44/511 (9%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             M+H++A ATLGLT P+ I+ PKI   A++VD+ EWKGDILAVGVTEKD+ARD NSKF+N+
Sbjct  42    MSHTLARATLGLTHPSNIETPKISFGAKDVDVTEWKGDILAVGVTEKDLARDANSKFENV  101

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL K+DSKLGGLL+EASSEEDFSGK GQS VLR+ GLGSKR+GL+GLG   S+   ++ L
Sbjct  102   ILSKIDSKLGGLLAEASSEEDFSGKVGQSTVLRITGLGSKRVGLIGLGQSPSTPSPFKGL  161

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +  AAKS+QASSVAV LAS+EGLS +SKLS A A+A+GI    +             
Sbjct  162   GEAVVEAAKSSQASSVAVVLASSEGLSAQSKLSTAYAIASGIEFVVY-------------  208

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTP--------GALAEEA  970
                + I+G G GPE+EKKLKY+  VSSG+IF +ELVN+PANVLTP        G LAEEA
Sbjct  209   ---IYIIGFGMGPELEKKLKYAGDVSSGIIFGRELVNSPANVLTPVLDDLFTSGVLAEEA  265

Query  971   KNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLAL  1150
               IAS YSDV TA IL+ EQC ELKMGS+LGVAAA+ NP +FIHLCYKP SG V  KLAL
Sbjct  266   AKIASTYSDVFTAKILNAEQCAELKMGSYLGVAAASENPPHFIHLCYKPLSGPVNVKLAL  325

Query  1151  LGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVE---------  1303
             +GKG+TFDSGGYN+K G   SIELMK DM G+A V G AKA+ QIKP GVE         
Sbjct  326   VGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGTAKALGQIKPLGVEALLRGGDGW  385

Query  1304  -----------VHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALV  1450
                        VHFIV ACENMISGTGMRPGDI+T SNGK IEV +TDAEGRL LADALV
Sbjct  386   DVANHGFIYIKVHFIVAACENMISGTGMRPGDIVTTSNGKTIEVNNTDAEGRLTLADALV  445

Query  1451  YASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEE  1630
             YA   GVEK++DLATLTGAC+ ALG S+AG+FTPS+DLAKEV EA+DV GEKLWR+PL E
Sbjct  446   YACNQGVEKIIDLATLTGACVVALGPSIAGVFTPSDDLAKEVFEASDVSGEKLWRLPLGE  505

Query  1631  SYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             SYWETMKS +ADM+N G   G AI A+LF+K
Sbjct  506   SYWETMKSGVADMLNTGGRQGGAIVAALFLK  536



>gb|EMS53149.1| Leucine aminopeptidase 2, chloroplastic [Triticum urartu]
Length=533

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/488 (65%), Positives = 393/488 (81%), Gaps = 5/488 (1%)
 Frame = +2

Query  275   MAHSVALAT----LGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSK  442
             M H+ A A+    LGLTK N ++ P++    ++++  +WKGDILAV VTEKD+ +  +SK
Sbjct  1     MGHTSAAASAVPALGLTKANAVELPQVAFTGKDIEFSDWKGDILAVAVTEKDLYKGSDSK  60

Query  443   FQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG-SVVSSTI  619
             F+N +L+KLD++L GLLSEAS+EEDF+GK+GQS+VLRL G G KR+ LVGLG S  S+  
Sbjct  61    FENAVLKKLDAQLSGLLSEASAEEDFTGKAGQSVVLRLSGQGFKRVALVGLGQSAPSTAA  120

Query  620   AYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLE  799
             A R +GE++A+ AKSAQASSVA+ LAS  G+    KL+AA+A+A+G V G  ED+RFK E
Sbjct  121   ACRGIGESVASVAKSAQASSVAIVLASPAGIQEGFKLNAAAAIASGTVLGLHEDSRFKAE  180

Query  800   PKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNI  979
              K   LK V+++GLG+G E+++KLKY   +SSGVIF KELVNAPANVLTP  LAEEA  I
Sbjct  181   SKKVHLKQVDLIGLGSGSELDQKLKYVNDLSSGVIFGKELVNAPANVLTPAVLAEEASKI  240

Query  980   ASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGK  1159
             AS YSDV TATILDVE+C+ELKMGS+LGVAAA+ NP +FIHLCYKP  G+VK KLA++GK
Sbjct  241   ASEYSDVFTATILDVEKCQELKMGSYLGVAAASANPPHFIHLCYKPVGGNVKRKLAIVGK  300

Query  1160  GITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMI  1339
             G+TFDSGGYN+K G   SIELMK DM G+A VFGAAKA+AQIKP GVEVHFIV ACENMI
Sbjct  301   GLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVFGAAKALAQIKPPGVEVHFIVAACENMI  360

Query  1340  SGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1519
             SGTGMRPGDILTASNGK IEV +TDAEGRL LADALVYA   GV+K++DLATLTGAC+ A
Sbjct  361   SGTGMRPGDILTASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIIDLATLTGACVVA  420

Query  1520  LGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDA  1699
             LG S+AGIFTPS++LA+EV  A+++ GEK WR+P+EESYWE MKS +ADM+N G   G +
Sbjct  421   LGPSIAGIFTPSDELAQEVTAASELSGEKFWRLPMEESYWEQMKSGVADMVNTGGRQGGS  480

Query  1700  ITASLFMK  1723
             ITA+LF+K
Sbjct  481   ITAALFLK  488



>dbj|BAK00954.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00974.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04996.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=538

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/475 (66%), Positives = 388/475 (82%), Gaps = 1/475 (0%)
 Frame = +2

Query  302   LGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKL  481
             LGLTK N ++ P++    ++++  +WKGDILAV VTEKD+++  +SKF+N +L+KLD++L
Sbjct  17    LGLTKANAVELPQVAFTGKDIEFSDWKGDILAVAVTEKDLSKGSDSKFENAVLKKLDAQL  76

Query  482   GGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG-SVVSSTIAYRTLGETIaaaa  658
              GLLSEAS+EEDF+GK+GQS+VLRL G G KR+ LVGLG S  S+  A R +GE++A+ A
Sbjct  77    SGLLSEASAEEDFTGKAGQSVVLRLSGQGFKRVALVGLGQSAPSTAAACRGIGESVASVA  136

Query  659   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  838
             KSAQA+SVA+ LAS  G+    KL+AA+A+A+G V G  ED+RFK E K   LK V+++G
Sbjct  137   KSAQATSVAIVLASPAGIQEGFKLNAAAAIASGTVLGLHEDSRFKAESKKVHLKQVDLIG  196

Query  839   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1018
             LG+G E+++KLKY   +SSGVIF KELVNAPANVLTP  LAEEA  IAS +SDV TATIL
Sbjct  197   LGSGSELDQKLKYVNDLSSGVIFGKELVNAPANVLTPAVLAEEASKIASEFSDVFTATIL  256

Query  1019  DVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKI  1198
             DVE+C+ELKMGS+LGVAAA+ NP +FIHLCYKP  G+VK KLA++GKG+TFDSGGYN+K 
Sbjct  257   DVEKCQELKMGSYLGVAAASANPPHFIHLCYKPVGGNVKRKLAIVGKGLTFDSGGYNIKT  316

Query  1199  GANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTA  1378
             G   SIELMK DM G+A VFGAAKA+AQIKP GVEVHFIV ACENMISGTGMRPGDILTA
Sbjct  317   GPGCSIELMKFDMGGSAAVFGAAKALAQIKPPGVEVHFIVAACENMISGTGMRPGDILTA  376

Query  1379  SNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSE  1558
             SNGK IEV +TDAEGRL LADALVYA   GV+K++DLATLTGAC+ ALG S+AGIFTPS+
Sbjct  377   SNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIIDLATLTGACVVALGPSIAGIFTPSD  436

Query  1559  DLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +LA+EV  A+++ GEK WR+P+EESYWE MKS +ADM+N G   G +ITA+LF+K
Sbjct  437   ELAQEVTAASELSGEKFWRLPMEESYWEQMKSGVADMVNTGGRQGGSITAALFLK  491



>dbj|BAJ92683.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=538

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/475 (65%), Positives = 388/475 (82%), Gaps = 1/475 (0%)
 Frame = +2

Query  302   LGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKL  481
             LGLTK N ++ P++    ++++  +WKGDILAV VTEKD+++  +SKF+N +L+KLD++L
Sbjct  17    LGLTKANAVELPQVAFTGKDIEFSDWKGDILAVAVTEKDLSKGSDSKFENAVLKKLDAQL  76

Query  482   GGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG-SVVSSTIAYRTLGETIaaaa  658
              GLLSEAS+EEDF+GK+GQS+VLRL G G KR+ LVGLG S  S+  A R +GE++A+ A
Sbjct  77    SGLLSEASAEEDFTGKAGQSVVLRLSGQGFKRVALVGLGQSAPSTAAACRGIGESVASVA  136

Query  659   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  838
             KSAQA+SVA+ LAS  G+    KL+AA+A+A+G V G  ED+RFK E K   LK V+++G
Sbjct  137   KSAQATSVAIVLASPAGIQEGFKLNAAAAIASGTVLGLHEDSRFKAESKKVHLKQVDLIG  196

Query  839   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1018
             LG+G E+++KLKY   +SSGVIF KELVNAPANVLTP  LAEEA  IAS +SDV TATIL
Sbjct  197   LGSGSELDQKLKYVNDLSSGVIFGKELVNAPANVLTPAVLAEEASKIASEFSDVFTATIL  256

Query  1019  DVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKI  1198
             DVE+C+ELKMGS+LGVAAA+ NP +FIHLCYKP  G+VK KLA++GKG+TFDSGGYN+K 
Sbjct  257   DVEKCQELKMGSYLGVAAASANPPHFIHLCYKPVGGNVKRKLAIVGKGLTFDSGGYNIKT  316

Query  1199  GANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTA  1378
             G   SIELMK DM G+A VFGAAKA+AQIKP GVEVHFIV ACENMISGTGMRPGDILTA
Sbjct  317   GPGCSIELMKFDMGGSAAVFGAAKALAQIKPPGVEVHFIVAACENMISGTGMRPGDILTA  376

Query  1379  SNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSE  1558
             SNGK IEV +TDAEGRL LADALVYA   GV+K++DLATLTGAC+ ALG S+AGIFTPS+
Sbjct  377   SNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIIDLATLTGACVVALGPSIAGIFTPSD  436

Query  1559  DLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +LA+EV  A+++ GEK WR+P+EESYWE M+S +ADM+N G   G +ITA+LF+K
Sbjct  437   ELAQEVTAASELSGEKFWRLPMEESYWEQMRSGVADMVNTGGRQGGSITAALFLK  491



>ref|XP_006649129.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Oryza 
brachyantha]
Length=529

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/463 (66%), Positives = 382/463 (83%), Gaps = 1/463 (0%)
 Frame = +2

Query  338   KILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEED  517
             ++  AA++V+  +WKGD+LA+ VTEKD+ +  +S+F+N +L+KLD +LGGLLSEAS+EED
Sbjct  24    RVSFAAKDVEFSDWKGDVLAIAVTEKDLIKGSDSQFENAVLKKLDGQLGGLLSEASAEED  83

Query  518   FSGKSGQSIVLRLPGLGSKRIGLVGLG-SVVSSTIAYRTLGETIaaaaksaqassvaval  694
             F+GK+GQS+VLRLPG G KR+GL+GLG +  S+T A + +GE+IA+ AKS QASS A+  
Sbjct  84    FTGKAGQSVVLRLPGQGFKRVGLIGLGQNAPSTTAACKGIGESIASVAKSVQASSAAIVF  143

Query  695   asaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLK  874
             AS  G+  + KL+AA+A+A+G V G  ED+R+K E K   LK V+++G G+GPE++KKLK
Sbjct  144   ASGGGIQEDFKLTAAAAIASGTVLGLHEDSRYKSESKKVHLKQVDLIGFGSGPEVDKKLK  203

Query  875   YSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGS  1054
             Y+  +SSGVIF KELVN+PANVLTP  LAEEA  IAS YSDV+TATILDVE+CKELKMGS
Sbjct  204   YANDLSSGVIFGKELVNSPANVLTPAVLAEEASKIASEYSDVITATILDVEKCKELKMGS  263

Query  1055  FLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKD  1234
             +L VAAA+ NP +FIHLCYKP  G+ K KLA++GKG+TFDSGGYN+K G   SIELMK D
Sbjct  264   YLAVAAASANPPHFIHLCYKPPGGNAKRKLAIVGKGLTFDSGGYNIKTGPGCSIELMKFD  323

Query  1235  MagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTD  1414
             M G+A VFGAAKA+ QIKPAGVEVHFIV ACENMISGTGMRPGDI+TASNGK IEV +TD
Sbjct  324   MGGSAAVFGAAKALGQIKPAGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIEVNNTD  383

Query  1415  AEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADV  1594
             AEGRL LADALVYA   GV+K++DLATLTGAC+ ALG S+AGIFTPS++LAKEV  A++V
Sbjct  384   AEGRLTLADALVYACNQGVDKIIDLATLTGACVVALGPSIAGIFTPSDELAKEVAAASEV  443

Query  1595  GGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
              GEK WR+PLEESYWE+MKS +ADM+N G   G +ITA+LF+K
Sbjct  444   SGEKFWRLPLEESYWESMKSGVADMVNTGGRQGGSITAALFLK  486



>ref|XP_002308402.1| leucine aminopeptidase family protein [Populus trichocarpa]
 gb|EEE91925.1| leucine aminopeptidase family protein [Populus trichocarpa]
Length=478

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/435 (71%), Positives = 360/435 (83%), Gaps = 0/435 (0%)
 Frame = +2

Query  419   MARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG  598
             MA+D + KF+N +L+KLD+KLGG LSEASSEEDF+GK GQS+VLRLPGLGSKRIGL+GLG
Sbjct  1     MAKDDSKKFENSLLKKLDAKLGGQLSEASSEEDFTGKPGQSLVLRLPGLGSKRIGLIGLG  60

Query  599   SVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFE  778
                ++T  +R  GE IAAAAK+AQAS V + LAS   +S ESKL+ ASA+ +G V GT+E
Sbjct  61    QSATNTYNFRNFGEAIAAAAKTAQASDVGIVLASTGSISNESKLNTASAIVSGTVLGTYE  120

Query  779   DNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGAL  958
             DNR+K + K P LKSV+ILGLGTGPE+ KKLKY+E VSS VIF KELVN+PANVLTP  L
Sbjct  121   DNRYKSDSKRPVLKSVDILGLGTGPELVKKLKYAEDVSSAVIFGKELVNSPANVLTPAVL  180

Query  959   AEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKT  1138
             AEEA  IAS YSDVL+ATIL  EQC ELKMGS+LGVAAA+ NP +FIHLCYKPSSG VK 
Sbjct  181   AEEASKIASTYSDVLSATILSAEQCIELKMGSYLGVAAASANPPHFIHLCYKPSSGPVKA  240

Query  1139  KLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIV  1318
             KLAL+GKG+TFDSGGYN+K G   SIE MK DM G+A V GAAKAI Q+KP GVEVHFIV
Sbjct  241   KLALVGKGLTFDSGGYNIKTGPGCSIEFMKFDMGGSAAVLGAAKAIGQVKPRGVEVHFIV  300

Query  1319  PACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATL  1498
              ACENMISGTGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK++DLATL
Sbjct  301   AACENMISGTGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIIDLATL  360

Query  1499  TGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINA  1678
             TGAC  ALG S+AG+FTPS++LA EV  AA+  GEKLWRMPLEESYWE+MKS +ADM+N 
Sbjct  361   TGACRVALGPSIAGVFTPSDELANEVFTAAEASGEKLWRMPLEESYWESMKSGVADMVNT  420

Query  1679  GSLDGDAITASLFMK  1723
             G+  G AITA+LF+K
Sbjct  421   GARQGGAITAALFLK  435



>gb|KGN61047.1| hypothetical protein Csa_2G035470 [Cucumis sativus]
Length=526

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/476 (65%), Positives = 381/476 (80%), Gaps = 1/476 (0%)
 Frame = +2

Query  299   TLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSK  478
             TLGLT+P     PKI  AA++ D+LEW GD+LAVGVTEKD+ +D N+ F N +L+KLD+ 
Sbjct  8     TLGLTRPGPSNAPKITFAAKDTDVLEWNGDLLAVGVTEKDVVKDDNNNFTNSLLKKLDAV  67

Query  479   LGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaa  658
             LGGLL+EASSEEDFSGKSGQ+IVLR+ GL  KR+GL GLG    S  A+  LGE IAAAA
Sbjct  68    LGGLLAEASSEEDFSGKSGQAIVLRVSGLSFKRVGLFGLGQSAYSAAAFVGLGEAIAAAA  127

Query  659   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  838
             ++++A S+AVALA +  LS ESK   AS++A GIV+G F+DNR++  PK   L+SV++LG
Sbjct  128   QASRAVSLAVALAFSADLSDESKPDIASSIAIGIVNGIFDDNRYRSNPKATVLQSVDVLG  187

Query  839   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1018
             LG+G  + KKLKY++ VSSG++FV+ELVN+PAN+LTPG LA E  NIA  YSDVL+A I 
Sbjct  188   LGSGAAMIKKLKYAQYVSSGIVFVRELVNSPANILTPGQLAAEVLNIARNYSDVLSARIF  247

Query  1019  DVEQCKELKMGSFLGVAAAAT-NPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLK  1195
             + ++  E+KMGS+LGV AAAT NP  FIHLCYKP SG V  KL L+GKGITFDSGGYNLK
Sbjct  248   NEDEIIEMKMGSYLGVTAAATANPPKFIHLCYKPPSGCVSAKLGLVGKGITFDSGGYNLK  307

Query  1196  IGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILT  1375
              GANS+IE MK DM GA  +FGAAKAIA+IKP GVE+HF+V ACENMIS TGMRP DI+T
Sbjct  308   TGANSNIETMKNDMGGAGAIFGAAKAIAEIKPLGVEIHFVVAACENMISATGMRPSDIVT  367

Query  1376  ASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPS  1555
             A+NGK IEV +TDAEGRL LADAL+Y  KLGV+K++DLATLTGACI ALG SVAG FTP+
Sbjct  368   AANGKTIEVNNTDAEGRLCLADALIYTCKLGVDKIIDLATLTGACIIALGPSVAGAFTPN  427

Query  1556  EDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             E+LA EVL AA+  GEKLWR+P+EESYW++MKS +ADM+N G   G AITA+LF+K
Sbjct  428   EELASEVLSAAERSGEKLWRLPIEESYWDSMKSGVADMLNTGPSQGGAITAALFLK  483



>gb|ABK24447.1| unknown [Picea sitchensis]
Length=613

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/482 (63%), Positives = 381/482 (79%), Gaps = 2/482 (0%)
 Frame = +2

Query  284   SVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQ  463
             +V+   LGLTKP ++  P++  +A+E+ + EWKGDILAVGV EKD+ +D +  F+N  L+
Sbjct  89    AVSEPNLGLTKPAEVTLPELTFSAKEIHVTEWKGDILAVGVFEKDVTKDESGVFENPTLK  148

Query  464   KLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTI--AYRTLG  637
             KLDS +GG+LS+   EEDFSGK+GQ+  +RLPG G KR+GL+GLG   S+++  + +   
Sbjct  149   KLDSHVGGVLSDVIKEEDFSGKAGQAAFVRLPGFGFKRVGLIGLGKNGSASLTKSLKGFA  208

Query  638   ETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTL  817
             E +A AAK+AQA+ VAV L+S E LS+  KL++   +A G++ G +ED RFK E K P L
Sbjct  209   ENLAGAAKTAQATEVAVTLSSTEDLSISLKLNSVLTIAAGVLLGIYEDTRFKSETKKPFL  268

Query  818   KSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSD  997
             K ++ LGLG+GPE E+K +Y + V SGVI  ++LVNAPANV+TP ALA EA NIAS YS+
Sbjct  269   KGLDFLGLGSGPEFEQKFEYIQQVCSGVILSRQLVNAPANVITPSALANEASNIASAYSN  328

Query  998   VLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDS  1177
             VLTA ILDVEQCKELKMGS+LGVAAA+ NP  FIHLCYKP +G VK KLA++GKG+TFDS
Sbjct  329   VLTAKILDVEQCKELKMGSYLGVAAASANPPKFIHLCYKPPTGDVKIKLAIVGKGLTFDS  388

Query  1178  GGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMR  1357
             GGYN+K G   SIELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISGTGMR
Sbjct  389   GGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTGMR  448

Query  1358  PGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVA  1537
             PGDI+TASNGK IEV +TDAEGRL LADALVYA K GV+K+VDLATLTGAC+ ALG  +A
Sbjct  449   PGDIVTASNGKTIEVNNTDAEGRLTLADALVYACKQGVDKVVDLATLTGACVVALGNDIA  508

Query  1538  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1717
             G+FTP++++A+E+ +AA++ GEK WRMPLEE+YWE+MKS IADM+N G   G +ITA+LF
Sbjct  509   GMFTPNDEMAEEISKAAEIAGEKFWRMPLEENYWESMKSGIADMVNTGGRQGGSITAALF  568

Query  1718  MK  1723
             +K
Sbjct  569   LK  570



>ref|XP_004144796.1| PREDICTED: leucine aminopeptidase 1-like [Cucumis sativus]
Length=526

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/476 (65%), Positives = 378/476 (79%), Gaps = 1/476 (0%)
 Frame = +2

Query  299   TLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSK  478
             TLGLT P     PKI  AA++ D+LEW GD+LAVGVTEKD+ +D N+ F N +L+KLD+ 
Sbjct  8     TLGLTNPGPSNAPKITFAAKDTDVLEWNGDLLAVGVTEKDVVKDDNNNFTNSLLKKLDAV  67

Query  479   LGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaa  658
             LGGLL+EASSEEDFSGKSGQ+IVLR+ GL  KR+GL GLG    S  A+  LGE IAAAA
Sbjct  68    LGGLLAEASSEEDFSGKSGQAIVLRVSGLSFKRVGLFGLGQSAYSAAAFVGLGEAIAAAA  127

Query  659   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  838
             ++++A S+AVALA +  LS ESK   AS++A GIV+G F+DNR++   K   L+SV++LG
Sbjct  128   QASRAVSLAVALAFSADLSDESKPDIASSIAIGIVNGIFDDNRYRSNSKATVLQSVDVLG  187

Query  839   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1018
             LG+G    KKLKY++ VSSG++FV+ELVN+PAN+LTPG LA E  NIA  YSDVL+A I 
Sbjct  188   LGSGASTIKKLKYAQYVSSGIVFVRELVNSPANILTPGQLAAEVLNIARNYSDVLSARIF  247

Query  1019  DVEQCKELKMGSFLGVAAAAT-NPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLK  1195
             + ++  E+KMGS+LGV AAAT NP  FIHLCYKP SG V  KL L+GKGITFDSGGYNLK
Sbjct  248   NEDEIIEMKMGSYLGVTAAATANPPKFIHLCYKPPSGCVSAKLGLVGKGITFDSGGYNLK  307

Query  1196  IGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILT  1375
              GANS+IE MK DM GA  +FGAAKAIA+IKP GVE+HF+V ACENMIS TGMRP DI+T
Sbjct  308   TGANSNIETMKNDMGGAGAIFGAAKAIAEIKPLGVEIHFVVAACENMISATGMRPSDIVT  367

Query  1376  ASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPS  1555
             A+NGK IEV +TDAEGRL LADAL+Y  KLGV+K++DLATLTGACI ALG SVAG FTP+
Sbjct  368   AANGKTIEVNNTDAEGRLCLADALIYTCKLGVDKIIDLATLTGACIIALGPSVAGAFTPN  427

Query  1556  EDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             E+LA EVL AA+  GEKLWR+P+EESYW++MKS +ADM+N G   G AITA+LF+K
Sbjct  428   EELASEVLSAAERSGEKLWRLPMEESYWDSMKSGVADMLNTGPSQGGAITAALFLK  483



>emb|CAA69614.1| lap17.1a [Solanum lycopersicum]
Length=571

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/484 (67%), Positives = 394/484 (81%), Gaps = 4/484 (1%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             + H +A  TLGLT+PN+   PKI I A++  +++W+GD+LA+G TE DMARD NSKF+N 
Sbjct  50    IVHCIAGDTLGLTRPNESDAPKISIGAKDTAVVQWQGDLLAIGATENDMARDENSKFKNP  109

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             +LQ+LDS+L GLLS ASSEEDFSGKSGQS+ LR PG    RI LVGLGS  SS  +Y +L
Sbjct  110   LLQQLDSELNGLLSAASSEEDFSGKSGQSVNLRFPG---GRISLVGLGSSASSPTSYHSL  166

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             G+  AAAA+S+QA ++AVALAS +GLS ESK+++ASA+ATG+V G+FEDNRF+ E K  T
Sbjct  167   GQAAAAAARSSQARNIAVALASTDGLSAESKINSASAIATGVVLGSFEDNRFRSESKKST  226

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             L+S++ILGLGTGPEIE+K+KY+E V +GVI  +ELVNAPAN++TP  LAEEAK IAS YS
Sbjct  227   LESLDILGLGTGPEIERKIKYAEHVCAGVILGRELVNAPANIVTPAVLAEEAKKIASTYS  286

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAAT-NPSYFIHLCYKPSSGSVKTKLALLGKGITF  1171
             DV++  ILD EQCKELKMG++L VAAAAT NP YFIHLC+K  +   KTKLAL+GKG+TF
Sbjct  287   DVISVNILDAEQCKELKMGAYLAVAAAATENPPYFIHLCFKTPTKERKTKLALVGKGLTF  346

Query  1172  DSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTG  1351
             DSGGYNLK+GA S IELMK DM GAA V GAAKA+ +I+P+ VEVHFIV ACENMIS  G
Sbjct  347   DSGGYNLKVGAGSRIELMKNDMGGAAAVLGAAKALGEIRPSRVEVHFIVAACENMISAEG  406

Query  1352  MRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1531
             MRPGDI+TASNGK IEV +TDAEGRL LADAL+YA   GVEK++DLATLTGA + ALG S
Sbjct  407   MRPGDIVTASNGKTIEVNNTDAEGRLTLADALIYACNQGVEKIIDLATLTGAIMVALGPS  466

Query  1532  VAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITAS  1711
             VAG FTP++ LA EV+ AA+  GEKLWRMP+EESYWE+MKS +ADMIN G  +G AIT +
Sbjct  467   VAGAFTPNDGLANEVVAAAEASGEKLWRMPMEESYWESMKSGVADMINLGPGNGGAITGA  526

Query  1712  LFMK  1723
             LF+K
Sbjct  527   LFLK  530



>ref|XP_004253490.2| PREDICTED: leucine aminopeptidase 1, chloroplastic-like, partial 
[Solanum lycopersicum]
Length=505

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/459 (68%), Positives = 378/459 (82%), Gaps = 4/459 (1%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             + H +A  TLGLT+PN+   PKI I A++  +++W+GD+LA+G TE DMARD NSKF+N 
Sbjct  50    IVHCIAGDTLGLTRPNESDAPKISIGAKDTAVVQWQGDLLAIGATENDMARDENSKFKNP  109

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             +LQ+LDS+L GLLS ASSEEDFSGKSGQS+ LR PG    RI LVGLGS  SS  +Y +L
Sbjct  110   LLQQLDSELNGLLSAASSEEDFSGKSGQSVNLRFPG---GRITLVGLGSSASSPTSYHSL  166

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             G+  AAAAKS+QA ++AVALAS +GLS ESK+++ASA+ATG+V G+FEDNRF+ E K  T
Sbjct  167   GQAAAAAAKSSQARNIAVALASTDGLSAESKINSASAIATGVVLGSFEDNRFRSESKKST  226

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             L+S++ILGLGTGPEIE+K+KY+E V +GVI  +ELVNAPAN++TP  LAEEAK IAS YS
Sbjct  227   LESLDILGLGTGPEIERKIKYAEHVCAGVILGRELVNAPANIVTPAVLAEEAKKIASTYS  286

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAAT-NPSYFIHLCYKPSSGSVKTKLALLGKGITF  1171
             DV++  ILD EQCKELKMG++L VAAAAT NP YFIHLC+K  +   KTKLAL+GKG+TF
Sbjct  287   DVISVNILDAEQCKELKMGAYLAVAAAATENPPYFIHLCFKTPTKERKTKLALVGKGLTF  346

Query  1172  DSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTG  1351
             DSGGYNLK+GA S IELMK DM GAA V GAAKA+ +I+P+ VEVHFIV ACENMIS  G
Sbjct  347   DSGGYNLKVGAGSRIELMKNDMGGAAAVLGAAKALGEIRPSRVEVHFIVAACENMISAEG  406

Query  1352  MRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1531
             MRPGDI+TASNGK IEV +TDAEGRL LADAL+YA   GVEK++DLATLTGA + ALG S
Sbjct  407   MRPGDIVTASNGKTIEVNNTDAEGRLTLADALIYACNQGVEKIIDLATLTGAIMVALGPS  466

Query  1532  VAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETM  1648
             VAG FTP++DLA+EV+EAA+  GEKLWRMP+EESYWE+M
Sbjct  467   VAGAFTPNDDLAREVVEAAEASGEKLWRMPMEESYWESM  505



>ref|XP_008643980.1| PREDICTED: uncharacterized protein LOC100381923 isoform X1 [Zea 
mays]
Length=2086

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/475 (67%), Positives = 396/475 (83%), Gaps = 1/475 (0%)
 Frame = +2

Query  302   LGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKL  481
             LGLTKPN ++ P++  +A++++  EWKGDILAV VTEKD+++D +SKF+N +L+KLD +L
Sbjct  1567  LGLTKPNAVEPPQVTFSAKDIEFSEWKGDILAVAVTEKDLSKDADSKFENAVLKKLDGQL  1626

Query  482   GGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG-SVVSSTIAYRTLGETIaaaa  658
             GGLLSEA++EEDF+GK+GQS+VLRL G G KR+GL+GLG S  S+  A R LGE++A+ A
Sbjct  1627  GGLLSEAAAEEDFTGKTGQSVVLRLAGQGFKRVGLIGLGQSAPSTAAASRGLGESVASVA  1686

Query  659   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  838
             K+AQASS A+ LAS  G+  E KL+AA+A+A+G V G +ED+R+K E K   LK V+I+G
Sbjct  1687  KAAQASSAAIVLASPSGIQEEFKLTAAAAVASGTVLGLYEDSRYKSESKKVHLKQVDIIG  1746

Query  839   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1018
             LG+G E+++KLKY+  +SSGVIF +ELVN+PANVLTP  LAEEA  IAS YSDV TAT+L
Sbjct  1747  LGSGAEVDQKLKYANDLSSGVIFGRELVNSPANVLTPAVLAEEASKIASTYSDVFTATVL  1806

Query  1019  DVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKI  1198
             DVE+CKELKMGS+LGVAAA+ NP +FIHLCYKP+ G+VK KLA++GKG+TFDSGGYN+K 
Sbjct  1807  DVEKCKELKMGSYLGVAAASANPPHFIHLCYKPTDGNVKRKLAIVGKGLTFDSGGYNIKT  1866

Query  1199  GANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTA  1378
             G   SIELMK DM G+A VFGAAKA+ QIKP GVEVHFIV ACENMISGTGMRPGDI+TA
Sbjct  1867  GPGCSIELMKFDMGGSAAVFGAAKALGQIKPPGVEVHFIVAACENMISGTGMRPGDIVTA  1926

Query  1379  SNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSE  1558
             SNGK IEV +TDAEGRL LADALVYA   GVEK++DLATLTGAC+ ALG S+AGIFTPS+
Sbjct  1927  SNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIIDLATLTGACVVALGPSIAGIFTPSD  1986

Query  1559  DLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +LAKEV  A++V GEK WR+PLEESYWE+MKS +ADM+N G   G +ITA+LF+K
Sbjct  1987  ELAKEVAAASEVSGEKFWRLPLEESYWESMKSGVADMVNTGGRQGGSITAALFLK  2041



>ref|XP_010236855.1| PREDICTED: formin-like protein 7 [Brachypodium distachyon]
Length=2049

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/494 (65%), Positives = 402/494 (81%), Gaps = 5/494 (1%)
 Frame = +2

Query  257   LSFGSYMAHSVALAT----LGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMA  424
             L   + M H+ A A+    LGLTKPN ++ P++   A++++  +W GD+LAV VTEKD++
Sbjct  1513  LGHRARMGHTSAAASAVPALGLTKPNVVEPPQVNFTAKDIEFSDWTGDVLAVAVTEKDLS  1572

Query  425   RDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG-S  601
             +  +SKF+N +L KLDS+LGG+LSEAS+EEDF+GK+GQS+VLRL G G KR+GL+GLG +
Sbjct  1573  KGSDSKFENALLNKLDSQLGGILSEASAEEDFTGKAGQSVVLRLSGQGFKRVGLIGLGQN  1632

Query  602   VVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFED  781
               S+T A R +GE+IA+ AKSAQASS AV LAS  G+  E KL+AA+A+A+G V G  ED
Sbjct  1633  APSTTSACRGIGESIASVAKSAQASSAAVLLASPGGIQQEFKLNAAAAIASGTVLGLHED  1692

Query  782   NRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALA  961
             +RFK + K   LK V+++GLG+GPE+++KLKY+  +SSGVIF KELVN+PANVLTP  LA
Sbjct  1693  SRFKSDSKKVHLKQVDLIGLGSGPEVDQKLKYANDLSSGVIFGKELVNSPANVLTPAVLA  1752

Query  962   EEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTK  1141
             EEA  IAS YSDV TATILDVE+C+ELKMGS+LGVAAA+ NP +FIHLCYKP  G+VK K
Sbjct  1753  EEASKIASTYSDVFTATILDVEKCQELKMGSYLGVAAASANPPHFIHLCYKPVGGNVKRK  1812

Query  1142  LALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVP  1321
             LA++GKG+TFDSGGYN+K G   SIELMK DM G+A VFGAAKA+AQIKP GVEVHFIV 
Sbjct  1813  LAIVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVFGAAKALAQIKPPGVEVHFIVA  1872

Query  1322  ACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLT  1501
             ACENMISGTGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA   GV+K++DLATLT
Sbjct  1873  ACENMISGTGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIIDLATLT  1932

Query  1502  GACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAG  1681
             GAC+ ALG S+AGIFTPS++LAKEV  A++V GEK WR+PLEESYWE+MKS +ADM+N G
Sbjct  1933  GACVVALGPSIAGIFTPSDELAKEVTAASEVSGEKFWRLPLEESYWESMKSGVADMVNTG  1992

Query  1682  SLDGDAITASLFMK  1723
                G +ITA+LF+K
Sbjct  1993  GRQGGSITAALFLK  2006



>dbj|BAJ85842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=529

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/486 (64%), Positives = 380/486 (78%), Gaps = 3/486 (1%)
 Frame = +2

Query  275   MAHSVA-LATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQN  451
             MAH+ A +A LGLTKPN I+  ++  AA + +  +W+GD+LAV VTEKD+ R P S F+N
Sbjct  1     MAHTTAAVAALGLTKPNVIEPLQVSFAAVDTEPSDWEGDVLAVAVTEKDVCRSPCSSFEN  60

Query  452   LILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG-SVVSSTIAYR  628
              +L++LDS LGGLLSEAS+EEDF+GK+GQ +VLRL G G KR+GL+GLG S   +  A R
Sbjct  61    AVLKRLDSHLGGLLSEASAEEDFAGKAGQLVVLRLQGKGLKRLGLIGLGRSAPITAAACR  120

Query  629   TLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKT  808
             +LGE  A+ AKSA+A+S A+ LA+  G+  E K  AA+A+A+G V G +EDNR++  P  
Sbjct  121   SLGECFASVAKSARAASAALVLAAPGGIHEEFKPIAAAAIASGTVLGLYEDNRYRSVPNK  180

Query  809   PTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASL  988
               LK V ++G G GPE+++KL+ +  VSSGVIF K+LVN+PANVLTP  LAEEA  IAS 
Sbjct  181   VHLKQVNLIGFGYGPEVDRKLELANHVSSGVIFGKDLVNSPANVLTPVVLAEEASKIAST  240

Query  989   YSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGIT  1168
             YSDV TATILD E+C+ELKMGS+L VAAA+ NP  FIHLCYKP  GSVK KLA++GKG+T
Sbjct  241   YSDVFTATILDAEKCRELKMGSYLAVAAASANPPRFIHLCYKPPGGSVKRKLAIVGKGLT  300

Query  1169  FDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGT  1348
             FDSGGYN+K+GA  SIELMK DM G+A VFGAAKA+ QIKP GVEVHFIV ACENMISGT
Sbjct  301   FDSGGYNIKVGAVCSIELMKWDMGGSAAVFGAAKALGQIKPPGVEVHFIVAACENMISGT  360

Query  1349  GMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGR  1528
             GMRPGDI+TASNGK IEV +TDAEGRL LADALVYA K GV+K++DLATLTG C  ALG 
Sbjct  361   GMRPGDIVTASNGKTIEVDNTDAEGRLTLADALVYACKQGVDKIIDLATLTGFCRVALGP  420

Query  1529  SVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSL-DGDAIT  1705
             S+AGI TPS++L  E   A++  GEK WR+PLEESYWETMKS +ADM+N G +  G  IT
Sbjct  421   SIAGILTPSDELHAEAAAASEASGEKFWRLPLEESYWETMKSGVADMLNTGVIPQGGVIT  480

Query  1706  ASLFMK  1723
             A+LF+K
Sbjct  481   AALFLK  486



>ref|XP_006283623.1| hypothetical protein CARUB_v10004680mg [Capsella rubella]
 gb|EOA16521.1| hypothetical protein CARUB_v10004680mg [Capsella rubella]
Length=488

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/423 (72%), Positives = 353/423 (83%), Gaps = 0/423 (0%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAH++  ATLGLT  N +  PKI  + +E+D+ EWKGDILAVGVTEKDM +D NSKF+N 
Sbjct  57    MAHTIPQATLGLTHANSVDHPKISFSGKEIDVTEWKGDILAVGVTEKDMTKDANSKFENP  116

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL+KLD+ LGGLL++ SSEEDFSGK GQS VLRLPGLGSKR+GL+GLG   SS  A+++L
Sbjct  117   ILKKLDAHLGGLLADVSSEEDFSGKPGQSTVLRLPGLGSKRVGLIGLGKSASSPSAFQSL  176

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +AAAAK++QASS AV LAS+E +S ESKLS+ASA+A+G V G FED+R+K E K P+
Sbjct  177   GEAVAAAAKASQASSAAVVLASSESVSNESKLSSASAIASGTVLGLFEDSRYKSESKKPS  236

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKSV+I+G GTGPE+EKKLKY+E VS GVIF KELVN+PANVLTP  LAEEA  +AS+YS
Sbjct  237   LKSVDIIGFGTGPELEKKLKYAEDVSYGVIFGKELVNSPANVLTPAVLAEEASKLASMYS  296

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV+TA IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKPSSG VKTKLAL+GKG+TFD
Sbjct  297   DVMTANILNEEQCKELKMGSYLAVAAASANPPHFIHLVYKPSSGPVKTKLALVGKGLTFD  356

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G    IELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISGTGM
Sbjct  357   SGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTGM  416

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGDILTASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+
Sbjct  417   RPGDILTASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKVVDLATLTGACIIALGNSM  476

Query  1535  AGI  1543
             A I
Sbjct  477   AYI  479



>ref|NP_001189587.1| aminopeptidase family protein [Arabidopsis thaliana]
 gb|AEC07541.1| aminopeptidase family protein [Arabidopsis thaliana]
Length=484

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/483 (62%), Positives = 365/483 (76%), Gaps = 43/483 (9%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAH     TLGLT+PN  +  KI   A+E+D++EWKGDIL VGVTEKD+A+D NSKF+N 
Sbjct  1     MAH-----TLGLTQPNSTEPHKISFTAKEIDVIEWKGDILVVGVTEKDLAKDGNSKFENP  55

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTL  634
             IL K+D+ L GLL++ SSEEDF+GK GQS VLRLPGLGSKRI L+GLG  VSS +A+ +L
Sbjct  56    ILSKVDAHLSGLLAQVSSEEDFTGKPGQSTVLRLPGLGSKRIALIGLGQSVSSPVAFHSL  115

Query  635   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  814
             GE +A  +K++Q++S A+ LAS+  +S ESKLS+ SA+A+GIV G FED R+K E K P+
Sbjct  116   GEAVATVSKASQSTSAAIVLASS--VSDESKLSSVSALASGIVLGLFEDGRYKSESKKPS  173

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LK+V+I+G GTG                                    AEEA  +AS YS
Sbjct  174   LKAVDIIGFGTG------------------------------------AEEAAKVASTYS  197

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV TA IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKP +GSVKTKLAL+GKG+TFD
Sbjct  198   DVFTANILNEEQCKELKMGSYLAVAAASANPPHFIHLVYKPPNGSVKTKLALVGKGLTFD  257

Query  1175  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1354
             SGGYN+K G   SIELMK DM G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGM
Sbjct  258   SGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTGM  317

Query  1355  RPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1534
             RPGD++TASNGK IEV +TDAEGRL LADALVYA   GV+K+VDLATLTGAC+ ALG S+
Sbjct  318   RPGDVITASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACVIALGTSM  377

Query  1535  AGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASL  1714
             AGI+TPS++LAKEV+ A++  GEKLWRMPLEESYWE MKS +ADM+N G   G +ITA+L
Sbjct  378   AGIYTPSDELAKEVIAASERSGEKLWRMPLEESYWEMMKSGVADMVNTGGRAGGSITAAL  437

Query  1715  FMK  1723
             F+K
Sbjct  438   FLK  440



>ref|XP_008803713.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=450

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/432 (68%), Positives = 351/432 (81%), Gaps = 4/432 (1%)
 Frame = +2

Query  275   MAH--SVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQ  448
             M H  S   ATLGLTKP  ++ P+I  +A+E+D   WKGDILAV V+E DM++D +SKF+
Sbjct  1     MGHVTSATRATLGLTKPALVEIPQISFSAKEIDFAVWKGDILAVAVSENDMSKDLDSKFE  60

Query  449   NLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG--SVVSSTIA  622
             N IL++LD KLGGLL+EAS+EEDF+GK+GQS+VLRLPGLG KR+GLVGLG  S  S+  A
Sbjct  61    NSILKRLDEKLGGLLAEASTEEDFTGKAGQSMVLRLPGLGFKRVGLVGLGQCSPSSTATA  120

Query  623   YRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEP  802
             YR++GE +A  AK+AQA + AV LAS+ G+S E KL+AASA+A+G V G +ED+RFK + 
Sbjct  121   YRSIGEAVAVVAKAAQAINAAVILASSNGISEEFKLNAASAIASGTVLGVYEDSRFKSDS  180

Query  803   KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIA  982
             K   LK+V+I+GLG+GPE++KK+KY+  V SGVIF KEL NAPANVLTPG LAEEA  +A
Sbjct  181   KKTHLKAVDIIGLGSGPELDKKIKYASDVCSGVIFGKELANAPANVLTPGVLAEEASKVA  240

Query  983   SLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKG  1162
             S YSDVL ATILDVEQCKELKMGS+LGVAAA++NP +FIHLCYKP  G VK KLA++GKG
Sbjct  241   SSYSDVLMATILDVEQCKELKMGSYLGVAAASSNPPHFIHLCYKPPGGDVKRKLAIVGKG  300

Query  1163  ITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMIS  1342
             +TFDSGGYN+K G   SIELMK DM G+A  FGAAKAIAQIKP GVEVHFIV ACENMIS
Sbjct  301   LTFDSGGYNIKTGPGCSIELMKFDMGGSAAAFGAAKAIAQIKPPGVEVHFIVAACENMIS  360

Query  1343  GTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITAL  1522
             GTGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ AL
Sbjct  361   GTGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVAL  420

Query  1523  GRSVAGIFTPSE  1558
             G S+ G    SE
Sbjct  421   GPSIGGCKDMSE  432



>pir||A48788 leucyl aminopeptidase (EC 3.4.11.1) DR57 - tomato
 gb|AAB28717.1| leucine aminopeptidase, LAP=DR57 product {EC 3.4.11.1} [Lycopersicon 
esculentum=tomatoes, Peto 238R, leaves, Peptide, 469 
aa]
Length=469

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/431 (69%), Positives = 358/431 (83%), Gaps = 4/431 (1%)
 Frame = +2

Query  434   NSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSS  613
             NSKF+N +LQ+LDS+L GLLS ASSEEDFSGKSGQS+ LR PG    RI LVGLGS  SS
Sbjct  1     NSKFKNPLLQQLDSELNGLLSAASSEEDFSGKSGQSVNLRFPG---GRITLVGLGSSASS  57

Query  614   TIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFK  793
               +Y +LG+  AAAAKS+QA ++AVALAS +GLS ESK+++ASA+ATG+V G+FEDNRF+
Sbjct  58    PTSYHSLGQAAAAAAKSSQARNIAVALASTDGLSAESKINSASAIATGVVLGSFEDNRFR  117

Query  794   LEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAK  973
              E K  TL+S++ILGLGTGPEIE+K+KY+E V +GVI  +ELVNAPAN++TP  LAEEAK
Sbjct  118   SESKKSTLESLDILGLGTGPEIERKIKYAEHVCAGVILGRELVNAPANIVTPAVLAEEAK  177

Query  974   NIASLYSDVLTATILDVEQCKELKMGSFLGVAAAAT-NPSYFIHLCYKPSSGSVKTKLAL  1150
              IAS YSDV++  ILD EQCKELKMG++L VAAAA+ NP YFIHLC+K  +   KTKLAL
Sbjct  178   KIASTYSDVISVNILDAEQCKELKMGAYLAVAAAASENPPYFIHLCFKTPTKERKTKLAL  237

Query  1151  LGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACE  1330
             +GKG+TFDSGGYNLK+GA S IELMK DM GAA V GAAKA+ +I+P+ VEVHFIV ACE
Sbjct  238   VGKGLTFDSGGYNLKVGAGSRIELMKNDMGGAAAVLGAAKALGEIRPSRVEVHFIVAACE  297

Query  1331  NMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGAC  1510
             NMIS  GMRPGDI+TASNGK IEV +TDAEGRL LADAL+YA   GVEK++DLATLTGA 
Sbjct  298   NMISAEGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALIYACNQGVEKIIDLATLTGAI  357

Query  1511  ITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLD  1690
             + ALG SVAG FTP++DLA+EV+EAA+  GEKLWRMP+EESYWE+MKS +ADMIN G  +
Sbjct  358   MVALGPSVAGAFTPNDDLAREVVEAAEASGEKLWRMPMEESYWESMKSGVADMINTGPGN  417

Query  1691  GDAITASLFMK  1723
             G AIT +LF+K
Sbjct  418   GGAITGALFLK  428



>ref|XP_004158743.1| PREDICTED: leucine aminopeptidase 1-like [Cucumis sativus]
Length=503

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/463 (64%), Positives = 360/463 (78%), Gaps = 14/463 (3%)
 Frame = +2

Query  338   KILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEED  517
              I  AA++ D+LEW GD+LAVGVTEKD             ++KLD+ LGGLL+EASSEED
Sbjct  11    NITFAAKDTDVLEWNGDLLAVGVTEKD-------------VKKLDAVLGGLLAEASSEED  57

Query  518   FSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  697
             FSGKSGQ+IVLR+ GL  KR+GL GLG    S  A+  LGE IAAAA++++A S+AVALA
Sbjct  58    FSGKSGQAIVLRVSGLSFKRVGLFGLGQSAYSAAAFVGLGEAIAAAAQASRAVSLAVALA  117

Query  698   saEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKY  877
              +  LS ESK   AS++A GIV+G F+DNR++  PK   L+SV +LGLG+G    KKLKY
Sbjct  118   FSADLSDESKPDIASSIAIGIVNGIFDDNRYRSNPKATVLQSVYVLGLGSGASTIKKLKY  177

Query  878   SEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSF  1057
             ++ VSSG++FV+ELVN+PAN+LTPG LA E  NI   YSDVL+A I + ++  E+KMGS+
Sbjct  178   AQYVSSGIVFVRELVNSPANILTPGQLAAEVLNITRNYSDVLSARIFNEDEIIEMKMGSY  237

Query  1058  LGVAAAAT-NPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKD  1234
             LGV AAAT NP  FIHLCYKP SG V  KL L+GKGITFDSGGYNLK GANS+IE MK D
Sbjct  238   LGVTAAATANPPKFIHLCYKPPSGCVSAKLGLVGKGITFDSGGYNLKTGANSNIETMKND  297

Query  1235  MagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTD  1414
             M GA  +FGAAKAIA+IKP GVE+HF+V ACENMIS TGMRP DI+TA+NGK IEV +TD
Sbjct  298   MGGAGAIFGAAKAIAEIKPLGVEIHFVVAACENMISATGMRPSDIVTAANGKTIEVNNTD  357

Query  1415  AEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADV  1594
             AEGRL LADAL+Y  K GV K++DLATLTGACITALG SVAG FTP+E+LA EVL AA+ 
Sbjct  358   AEGRLCLADALLYTCKQGVAKIIDLATLTGACITALGPSVAGAFTPNEELASEVLFAAER  417

Query  1595  GGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
              GEKLWR+P+EESYW++MKS +ADM+N G   G AITA+LF+K
Sbjct  418   SGEKLWRLPMEESYWDSMKSGVADMLNTGPSQGGAITAALFLK  460



>gb|EAY82956.1| hypothetical protein OsI_38175 [Oryza sativa Indica Group]
Length=525

 Score =   532 bits (1370),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 311/481 (65%), Positives = 380/481 (79%), Gaps = 12/481 (2%)
 Frame = +2

Query  317   PNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMAR--DPNSKFQNLI--LQKLDSKLG  484
             PN +  P+I  AA+++DL EW+GDILAV VTE D+++    +S+F N    L KLD +LG
Sbjct  2     PNVVDPPQISFAAKDMDLTEWEGDILAVLVTETDVSKATSSSSRFTNAAAALAKLDGELG  61

Query  485   GLLSEASSEEDFSGKSGQSIVLRLP---GL-GSKRIGLVGLGS-VVSSTIAYRTLGETIa  649
             GLLSEAS+EE+F+G++GQS+ LRLP   GL G KR+ LVG+G+ + SS  A R+ GETIA
Sbjct  62    GLLSEASAEEEFAGRAGQSVALRLPTAPGLHGFKRVCLVGVGNNMPSSAAACRSTGETIA  121

Query  650   aaaksaqassvavalasaEGLSVES---KLSAASAMATGIVSGTFEDNRFKLEPKTPTLK  820
             A AKSAQA S AVALAS     V+    +L+AA+A+A+G+V G  ED R+K + K   LK
Sbjct  122   AVAKSAQARSAAVALASPPPGWVQGEDLRLNAAAAVASGVVLGLHEDRRYKSDSKKVHLK  181

Query  821   SVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDV  1000
              V+++G G+G E+ +KL+Y+  VSS VIF KELVN+PANVLTP  LAEEA NIAS YSDV
Sbjct  182   QVDLIGFGSGQEMGRKLQYANHVSSAVIFAKELVNSPANVLTPAVLAEEASNIASSYSDV  241

Query  1001  LTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSG  1180
             LTATILD E+C+ELKMGS+L VAAA+ NP +FIHLCYKP  G+VK KLA++GKG+TFDSG
Sbjct  242   LTATILDEEKCRELKMGSYLAVAAASANPPHFIHLCYKPPGGNVKRKLAIVGKGLTFDSG  301

Query  1181  GYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRP  1360
             GYN+KIGA ++IELMKKDM G+A +FGAAKA+ QIKP GVEVHFI  ACENMISGTGMRP
Sbjct  302   GYNIKIGAVTTIELMKKDMGGSAALFGAAKALGQIKPPGVEVHFISAACENMISGTGMRP  361

Query  1361  GDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAG  1540
             GDI+TASNGK IEV +TDAEGRL LADALVYA KLGV+K++DLATLTG C  ALG S+AG
Sbjct  362   GDIVTASNGKTIEVDNTDAEGRLTLADALVYACKLGVDKIIDLATLTGYCRIALGPSIAG  421

Query  1541  IFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFM  1720
             I TPS++L KEV  A +  GEK WR+PLEESYWE MKSS+ADM+N GS  G AITA LF+
Sbjct  422   ILTPSDELDKEVAAAYEASGEKFWRLPLEESYWEQMKSSVADMLNTGSPLGGAITAGLFL  481

Query  1721  K  1723
             K
Sbjct  482   K  482



>gb|EEE53139.1| hypothetical protein OsJ_35947 [Oryza sativa Japonica Group]
Length=554

 Score =   528 bits (1360),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 315/504 (63%), Positives = 384/504 (76%), Gaps = 29/504 (6%)
 Frame = +2

Query  299   TLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMAR--DPNSKFQNLI--LQK  466
             TLGLT PN +  P+I  AA+++DL EW+GDILAV VTE D+++    +S+F N    L K
Sbjct  8     TLGLTMPNVVDPPQISFAAKDMDLTEWEGDILAVLVTETDVSKATSSSSRFTNAAAALAK  67

Query  467   LDSKLGGLLSEASSEEDFSGKSGQSIVLRLP---GL-GSKRIGLVGLGS-VVSSTIAYRT  631
             LD +LGGLLSEAS+EE+F+G++GQS+ LRLP   GL G KR+ LVG+G+ + SS  A R+
Sbjct  68    LDGELGGLLSEASAEEEFAGRAGQSVALRLPTAPGLHGFKRVCLVGVGNNMPSSAAACRS  127

Query  632   LGETIaaaaksaqassvavalasaEGLSVES---KLSAASAMATGIVSGTFEDNRFKLEP  802
              GETIAA AKSAQA S AVALAS     V+    +L+AA+A+A+G+V G  ED R+K + 
Sbjct  128   TGETIAAVAKSAQARSAAVALASPPPGWVQGEDLRLNAAAAVASGVVLGLHEDRRYKSDS  187

Query  803   KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIA  982
             K   LK V+++G G+G E+ +KL+Y+  VSS VIF KELVN+PANVLTP  LAEEA NIA
Sbjct  188   KKVHLKQVDLIGFGSGQEMGRKLQYANHVSSAVIFAKELVNSPANVLTPAVLAEEASNIA  247

Query  983   SLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKG  1162
             S YSDVLTATILD E+C+ELKMGS+L VAAA+ NP +FIHLCYKP  G+VK KLA++GKG
Sbjct  248   SSYSDVLTATILDEEKCRELKMGSYLAVAAASANPPHFIHLCYKPPGGNVKRKLAIVGKG  307

Query  1163  ITFDS-----------------GGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKP  1291
             +TFD                  GGYN+KIGA ++IELMKKDM G+A +FGAAKA+ QIKP
Sbjct  308   LTFDRFYLSLDNLLIVTKFVCIGGYNIKIGAVTTIELMKKDMGGSAALFGAAKALGQIKP  367

Query  1292  AGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGV  1471
              GVEVHFI  ACENMISGTGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA KLGV
Sbjct  368   PGVEVHFISAACENMISGTGMRPGDIVTASNGKTIEVDNTDAEGRLTLADALVYACKLGV  427

Query  1472  EKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMK  1651
             +K++DLATLTG C  ALG S+AGI TPS++L KEV  A +  GEK WR+PLEESYWE MK
Sbjct  428   DKIIDLATLTGYCRIALGPSIAGILTPSDELDKEVAAAYEASGEKFWRLPLEESYWEQMK  487

Query  1652  SSIADMINAGSLDGDAITASLFMK  1723
             SS+ADM+N GS  G AITA LF+K
Sbjct  488   SSVADMLNTGSPLGGAITAGLFLK  511



>ref|XP_002965045.1| hypothetical protein SELMODRAFT_167050 [Selaginella moellendorffii]
 gb|EFJ33883.1| hypothetical protein SELMODRAFT_167050 [Selaginella moellendorffii]
Length=538

 Score =   525 bits (1351),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 296/479 (62%), Positives = 368/479 (77%), Gaps = 12/479 (3%)
 Frame = +2

Query  293   LATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLD  472
             LAT+GLTK ++   P++ +   E+D+ +WKGD+LA+ V E  M+ +            LD
Sbjct  25    LATVGLTKASEQPIPELEVRVSELDVSQWKGDLLAIAVFEGGMSDEA--------FGILD  76

Query  473   SKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIA--YRTLGETI  646
               L GLL++ ++EEDF+GKSGQ+  +R+PG G KRIGLVGLG +  S++A  ++ +GE+I
Sbjct  77    KDLNGLLADVAAEEDFTGKSGQASFVRIPGQGFKRIGLVGLGKLEKSSLARPWKGVGESI  136

Query  647   aaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSV  826
             AAAAK+AQASSV + L++ +   V+S  + ASA+ +G++ G+FED RFK EPK P LK V
Sbjct  137   AAAAKTAQASSVGIVLSALDQEGVDSN-AGASAITSGVILGSFEDTRFKSEPKAPKLKRV  195

Query  827   EILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLT  1006
             EILGLG+ PE+EKKL+    V +GVI  ++LVNAPANVLTP ALAEEA +IAS +SDV T
Sbjct  196   EILGLGSAPELEKKLQNLVKVCTGVISARQLVNAPANVLTPSALAEEAVSIASSHSDVFT  255

Query  1007  ATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGY  1186
             A ILD  +CKELKMGS+LGVAAA+ NP  FIHL YKP SG VKTKLA++GKG+TFDSGGY
Sbjct  256   AKILDEAECKELKMGSYLGVAAASVNPPKFIHLQYKPPSGDVKTKLAIIGKGLTFDSGGY  315

Query  1187  NLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGD  1366
             NLKI   SSIELMK DM GAA   GAAKA+  I+P GVEVHFIV ACENMISG GMRPGD
Sbjct  316   NLKI-QGSSIELMKFDMGGAAAALGAAKALGAIQPLGVEVHFIVAACENMISGAGMRPGD  374

Query  1367  ILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIF  1546
             ILTASNGK IEV +TDAEGRL LADALVYA  L V+K+VDLATLTGACI ALG  + G+F
Sbjct  375   ILTASNGKTIEVNNTDAEGRLTLADALVYACNLKVDKIVDLATLTGACIIALGNEIGGMF  434

Query  1547  TPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             TPS++LA+E+ +A+   GEKLWRMP+EE+YWE MKS IADM+N G   G +ITASLF+K
Sbjct  435   TPSDELAEELSQASSAAGEKLWRMPMEENYWEMMKSGIADMVNTGGRPGGSITASLFLK  493



>ref|XP_002962141.1| hypothetical protein SELMODRAFT_140664 [Selaginella moellendorffii]
 gb|EFJ37401.1| hypothetical protein SELMODRAFT_140664 [Selaginella moellendorffii]
Length=538

 Score =   523 bits (1346),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 295/479 (62%), Positives = 367/479 (77%), Gaps = 12/479 (3%)
 Frame = +2

Query  293   LATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLD  472
             LAT+GLTK ++   P++ +   E+D+ +WKGD+LA+ V E  M+ +            LD
Sbjct  25    LATVGLTKASEQPIPELEVRVSELDVSQWKGDLLAIAVFEGGMSDEA--------FGILD  76

Query  473   SKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIA--YRTLGETI  646
               L GLL++ ++EEDF+GKSGQ+  +R+PG G KRIGLVGLG +  S++A  ++ +GE+I
Sbjct  77    KDLNGLLADVAAEEDFTGKSGQASFVRIPGQGFKRIGLVGLGKLEKSSLARPWKGVGESI  136

Query  647   aaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSV  826
             AAAAK+AQASSV + L++ +   V+S  + AS + +G++ G+FED RFK EPK P LK V
Sbjct  137   AAAAKTAQASSVGIVLSALDQEGVDSN-AGASGITSGVILGSFEDTRFKSEPKAPKLKRV  195

Query  827   EILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLT  1006
             EILGLG+ PE+EKKL+    V +GVI  ++LVNAPANVLTP ALAEEA +IAS +SDV T
Sbjct  196   EILGLGSAPELEKKLQNLVKVCTGVISARQLVNAPANVLTPSALAEEAVSIASSHSDVFT  255

Query  1007  ATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGY  1186
             A ILD  +CKELKMGS+LGVAAA+ NP  FIHL YKP SG VKTKLA++GKG+TFDSGGY
Sbjct  256   AKILDEAECKELKMGSYLGVAAASVNPPKFIHLQYKPPSGDVKTKLAIIGKGLTFDSGGY  315

Query  1187  NLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGD  1366
             NLKI   SSIELMK DM GAA   GAAKA+  I+P GVEVHFIV ACENMISG GMRPGD
Sbjct  316   NLKI-QGSSIELMKFDMGGAAAALGAAKALGAIQPLGVEVHFIVAACENMISGAGMRPGD  374

Query  1367  ILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIF  1546
             ILTASNGK IEV +TDAEGRL LADALVYA  L V+K+VDLATLTGACI ALG  + G+F
Sbjct  375   ILTASNGKTIEVNNTDAEGRLTLADALVYACNLKVDKIVDLATLTGACIIALGNEIGGMF  434

Query  1547  TPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             TPS++LA+E+ +A+   GEKLWRMP+EE+YWE MKS IADM+N G   G +ITASLF+K
Sbjct  435   TPSDELAEELSQASSAAGEKLWRMPMEENYWEMMKSGIADMVNTGGRPGGSITASLFLK  493



>ref|NP_001066684.1| Os12g0434400 [Oryza sativa Japonica Group]
 sp|Q2QSB9.2|AMPL1_ORYSJ RecName: Full=Putative leucine aminopeptidase 1; AltName: Full=Leucyl 
aminopeptidase 1; Short=LAP 1; AltName: Full=Proline 
aminopeptidase 1; AltName: Full=Prolyl aminopeptidase 1 [Oryza 
sativa Japonica Group]
 gb|ABA97701.2| Aminopeptidase, chloroplast precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29703.1| Os12g0434400 [Oryza sativa Japonica Group]
Length=542

 Score =   519 bits (1337),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 310/498 (62%), Positives = 379/498 (76%), Gaps = 29/498 (6%)
 Frame = +2

Query  317   PNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMAR--DPNSKFQNLI--LQKLDSKLG  484
             PN +  P+I  AA+++DL EW+GDILAV VTE D+++    +S+F N    L KLD +LG
Sbjct  2     PNVVDPPQISFAAKDMDLTEWEGDILAVLVTETDVSKATSSSSRFTNAAAALAKLDGELG  61

Query  485   GLLSEASSEEDFSGKSGQSIVLRLP---GL-GSKRIGLVGLGS-VVSSTIAYRTLGETIa  649
             GLLSEAS+EE+F+G++GQS+ LRLP   GL G KR+ LVG+G+ + SS  A R+ GETIA
Sbjct  62    GLLSEASAEEEFAGRAGQSVALRLPTAPGLHGFKRVCLVGVGNNMPSSAAACRSTGETIA  121

Query  650   aaaksaqassvavalasaEGLSVES---KLSAASAMATGIVSGTFEDNRFKLEPKTPTLK  820
             A AKSAQA S AVALAS     V+    +L+AA+A+A+G+V G  ED R+K + K   LK
Sbjct  122   AVAKSAQARSAAVALASPPPGWVQGEDLRLNAAAAVASGVVLGLHEDRRYKSDSKKVHLK  181

Query  821   SVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDV  1000
              V+++G G+G E+ +KL+Y+  VSS VIF KELVN+PANVLTP  LAEEA NIAS YSDV
Sbjct  182   QVDLIGFGSGQEMGRKLQYANHVSSAVIFAKELVNSPANVLTPAVLAEEASNIASSYSDV  241

Query  1001  LTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDS-  1177
             LTATILD E+C+ELKMGS+L VAAA+ NP +FIHLCYKP  G+VK KLA++GKG+TFD  
Sbjct  242   LTATILDEEKCRELKMGSYLAVAAASANPPHFIHLCYKPPGGNVKRKLAIVGKGLTFDRF  301

Query  1178  ----------------GGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVH  1309
                             GGYN+KIGA ++IELMKKDM G+A +FGAAKA+ QIKP GVEVH
Sbjct  302   YLSLDNLLIVTKFVCIGGYNIKIGAVTTIELMKKDMGGSAALFGAAKALGQIKPPGVEVH  361

Query  1310  FIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDL  1489
             FI  ACENMISGTGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA KLGV+K++DL
Sbjct  362   FISAACENMISGTGMRPGDIVTASNGKTIEVDNTDAEGRLTLADALVYACKLGVDKIIDL  421

Query  1490  ATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADM  1669
             ATLTG C  ALG S+AGI TPS++L KEV  A +  GEK WR+PLEESYWE MKSS+ADM
Sbjct  422   ATLTGYCRIALGPSIAGILTPSDELDKEVAAAYEASGEKFWRLPLEESYWEQMKSSVADM  481

Query  1670  INAGSLDGDAITASLFMK  1723
             +N GS  G AITA LF+K
Sbjct  482   LNTGSPLGGAITAGLFLK  499



>ref|XP_002453876.1| hypothetical protein SORBIDRAFT_04g020460 [Sorghum bicolor]
 gb|EES06852.1| hypothetical protein SORBIDRAFT_04g020460 [Sorghum bicolor]
Length=537

 Score =   519 bits (1336),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 297/491 (60%), Positives = 378/491 (77%), Gaps = 13/491 (3%)
 Frame = +2

Query  284   SVALATLGLTKPNQ-IQRPKILIAAREVDLLEWKGDILAVGVTEKDM-----ARDPNSK-  442
             + A  TLGLT+PN  ++ P+I  AA++++  +W GDILAV VTEKD+     A D NSK 
Sbjct  5     ATAAPTLGLTRPNAALELPQISFAAKDIEFSDWHGDILAVAVTEKDVQPQQQALDSNSKS  64

Query  443   -FQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTI  619
              F+N +L+KLD +LGGLL  A++EE+F+GK GQS+V+R+ G   KR+ LVG   V  S  
Sbjct  65    LFENAVLKKLDGQLGGLLRAAAAEEEFTGKPGQSVVIRVQGQRFKRVALVGF--VARSAG  122

Query  620   AYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLE  799
               + LGE++A+ A++AQA+S A+ +A+   +  E KL+AA+A+A+G V G +ED+R+K E
Sbjct  123   CLQGLGESVASLARAAQATSAAILVAAPAVIRQELKLNAAAAIASGAVLGLYEDSRYKSE  182

Query  800   PKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNI  979
              K   LK V+++GLG GPE+++KL +   +S+GV+  ++LVN+PANVLTP ALAEEA  I
Sbjct  183   WKKVHLKQVDLIGLGCGPEVDQKLHHGNHLSTGVMLARDLVNSPANVLTPAALAEEAAKI  242

Query  980   ASLYSDVLTATILDVEQCKELKMGSFLGVAAAA-TNPSYFIHLCYKPSSGSVKTKLALLG  1156
             AS YSDV TATILD E+CKELKMGS+L VAAA+ TNP YFIHLCYKP  G+VKTKLAL+G
Sbjct  243   ASTYSDVFTATILDAEKCKELKMGSYLAVAAASETNPPYFIHLCYKPPGGNVKTKLALIG  302

Query  1157  KGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENM  1336
             KGITFDSGGYN+K    ++IELMKKDM GAA VFGAAK + QIKP GVEVHFI  A ENM
Sbjct  303   KGITFDSGGYNIKAVPVATIELMKKDMGGAAAVFGAAKVLGQIKPPGVEVHFISAASENM  362

Query  1337  ISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACIT  1516
             ISGTGMRPGDI+TASNGK IEV +TDAEGRL LADALVYA   GV+K++DLATLTGA   
Sbjct  363   ISGTGMRPGDIVTASNGKTIEVDNTDAEGRLTLADALVYACNQGVDKIIDLATLTGAIRV  422

Query  1517  ALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLD--  1690
             ALG S+AGI TP+++LA+E   A +V GEK WR+P+EESYWE+M+SSIADM+ AG L   
Sbjct  423   ALGPSIAGILTPNDELAEEFAAAYEVSGEKFWRLPMEESYWESMESSIADMLAAGPLQPK  482

Query  1691  GDAITASLFMK  1723
               AITA+LF+K
Sbjct  483   AGAITAALFLK  493



>gb|EMT02487.1| Formin-like protein 7 [Aegilops tauschii]
Length=1819

 Score =   550 bits (1417),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 288/461 (62%), Positives = 354/461 (77%), Gaps = 28/461 (6%)
 Frame = +2

Query  341   ILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             I    ++++  +WKGDILAV VTEKD+++  +SKF+N +L+KLD++L GLLSEAS+EEDF
Sbjct  1343  IAFTGKDIEFSDWKGDILAVAVTEKDLSKGSDSKFENAVLKKLDAQLSGLLSEASAEEDF  1402

Query  521   SGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalas  700
             +GK+GQS+VLRL G G KR   V L S V+  +A  T                       
Sbjct  1403  TGKAGQSVVLRLSGQGFKR---VALASSVAVVLASPT-----------------------  1436

Query  701   aEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYS  880
               G+    KL+AA+A+A+G V G  ED+RFK E K   LK V+++GLG+G E+++KLKY 
Sbjct  1437  --GVQEGFKLNAAAAIASGTVLGLHEDSRFKAESKKVHLKQVDLIGLGSGSELDQKLKYV  1494

Query  881   EVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFL  1060
               +SSGVIF KELVNAPANVLTP  LAEEA  IAS +SDV TATILDVE+C+ELKMGS+L
Sbjct  1495  NDLSSGVIFGKELVNAPANVLTPAVLAEEASKIASEHSDVFTATILDVEKCQELKMGSYL  1554

Query  1061  GVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMa  1240
             GVAAA+ NP +FIHLCYKP  G+VK KLA++GKG+TFDSGGYN+K G   SIELMK DM 
Sbjct  1555  GVAAASANPPHFIHLCYKPVGGNVKRKLAIVGKGLTFDSGGYNIKTGPGCSIELMKFDMG  1614

Query  1241  gaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAE  1420
             G+A VFGAAKA+AQIKP GVEVHFIV ACENMISGTGMRPGDILTASNGK IEV +TDAE
Sbjct  1615  GSAAVFGAAKALAQIKPPGVEVHFIVAACENMISGTGMRPGDILTASNGKTIEVNNTDAE  1674

Query  1421  GRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGG  1600
             GRL LADALVYA   GV+K++DLATLTGAC+ ALG S+AGIFTPS++LA+EV  A+++ G
Sbjct  1675  GRLTLADALVYACNQGVDKIIDLATLTGACVVALGPSIAGIFTPSDELAQEVAAASELSG  1734

Query  1601  EKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             EK WR+P+EESYWE MKS +ADM+N G   G +ITA+LF+K
Sbjct  1735  EKFWRLPMEESYWEQMKSGVADMVNTGGRQGGSITAALFLK  1775



>dbj|BAH57215.1| AT4G30910 [Arabidopsis thaliana]
Length=478

 Score =   500 bits (1288),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 279/422 (66%), Positives = 333/422 (79%), Gaps = 23/422 (5%)
 Frame = +2

Query  278   AHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLI  457
             AH++A ATLGLT+ N +  PKI  + +E+D+ EWKGDILAVGVTEKDMA+D NSKF+N I
Sbjct  57    AHTIAHATLGLTQANSVDHPKISFSGKEIDVTEWKGDILAVGVTEKDMAKDANSKFENPI  116

Query  458   LQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLG  637
             L+KLD+ LGGLL++ S+EEDFSGK GQS VLRLPGLGSKR+GL+GLG   S+  A+++LG
Sbjct  117   LKKLDAHLGGLLADVSAEEDFSGKPGQSTVLRLPGLGSKRVGLIGLGKSASTPSAFQSLG  176

Query  638   ETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTL  817
             E +AAAAK++QASSVAV LAS+E  S ESKLS+AS +A+G V G FED+R+K E K P+L
Sbjct  177   EAVAAAAKASQASSVAVVLASSESFSDESKLSSASDIASGTVLGLFEDSRYKSESKKPSL  236

Query  818   KSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSD  997
             KSV  +G GTGPE+E KLKY+E VS GVIF KELVN+PANVL+P  LAEEA N+AS+YS+
Sbjct  237   KSVVFIGFGTGPELENKLKYAEHVSYGVIFTKELVNSPANVLSPAVLAEEASNLASMYSN  296

Query  998   VLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDS  1177
             V+TA IL  EQCKELKMGS+L VAAA+ NP +FIHL YKPSSG VKTKLAL+GKG+TFDS
Sbjct  297   VMTANILKEEQCKELKMGSYLAVAAASANPPHFIHLIYKPSSGPVKTKLALVGKGLTFDS  356

Query  1178  GGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMR  1357
             GGYN+KIG    IELMK D+ G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGMR
Sbjct  357   GGYNIKIGPELIIELMKIDVGGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTGMR  416

Query  1358  PGDILTASNGKRIEVT-----------------------DTDAEGRLILADALVYASKLG  1468
             PGD++TASNGK IEV+                       DTD+EGRL LADALVYA   G
Sbjct  417   PGDVITASNGKTIEVSLHRFHMNSASKGSSFPLLVLQVNDTDSEGRLTLADALVYACNQG  476

Query  1469  VE  1474
             V+
Sbjct  477   VD  478



>ref|XP_006664532.1| PREDICTED: putative leucine aminopeptidase 1-like [Oryza brachyantha]
Length=568

 Score =   493 bits (1269),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 306/509 (60%), Positives = 374/509 (73%), Gaps = 34/509 (7%)
 Frame = +2

Query  299   TLGLTKPNQI-QRP-KILIAAREVDLLEWKGDILAVGVTEKDM--ARDPNSKFQNLI-LQ  463
             +LGLT PN     P ++  AA++++L EW+GDILAV V E  +  A  P+S F N   L 
Sbjct  17    SLGLTVPNAAADNPLQVTFAAKDMELTEWEGDILAVLVPESGVSGATPPSSTFANAAALA  76

Query  464   KLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGL----GSKRIGLVGLGSV-----VSST  616
             +LD +LGGLLSEAS+EEDFSGK+GQ + LRLP      G KR+ LVG+G V      ++ 
Sbjct  77    RLDGQLGGLLSEASAEEDFSGKAGQLVALRLPAATGSHGFKRVCLVGVGKVDAPRSAAAA  136

Query  617   IAYRTLGETIaaaaksaqassvavalasaE---GLSVESKLSAASAMATGIVSGTFEDNR  787
              A R+ GE++AAAA++AQA S AVAL S +   G   + +  AA+A+A+ IV G  ED+R
Sbjct  137   AACRSAGESVAAAARAAQAHSAAVALGSPKPGWGHGEDFRPEAAAAVASVIVLGLHEDSR  196

Query  788   FKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEE  967
             +K E K   L+ V+ +G G G E+E KL+Y+  VSSGVI  KELVN+PANVLTP ALAEE
Sbjct  197   YKSESKKVHLERVDFIGFGAGDEVESKLQYANDVSSGVILCKELVNSPANVLTPAALAEE  256

Query  968   AKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLA  1147
             A  IAS YSDVLTATILD  +C+ELKMGS+L VAAA+ NP +FIHLCYKP  G+VK KLA
Sbjct  257   ASKIASTYSDVLTATILDQGKCRELKMGSYLAVAAASANPPHFIHLCYKPPGGNVKRKLA  316

Query  1148  LLGKGITFD-----------------SGGYNLKIGANSSIELMKKDMagaavvfgaakai  1276
             ++GKG+TFD                 SGGYN+KIGA ++IELMKKDM GAA VFGAAKA+
Sbjct  317   IVGKGLTFDRFYFYKQFLQLIQRFVCSGGYNIKIGAATNIELMKKDMGGAAAVFGAAKAL  376

Query  1277  aQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYA  1456
              QIKP GVEVHFI  ACENMISGTGMRPGDI+TASNGK IEV +TDAEGRL LADAL+YA
Sbjct  377   GQIKPPGVEVHFISAACENMISGTGMRPGDIVTASNGKTIEVDNTDAEGRLTLADALIYA  436

Query  1457  SKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESY  1636
              K GV+K++DLATLTG C  ALG S+AG+ TPS++LAKEV  A +  GEK WR+P+EESY
Sbjct  437   CKQGVDKILDLATLTGYCRIALGPSIAGVLTPSDELAKEVAAAYEASGEKFWRLPMEESY  496

Query  1637  WETMKSSIADMINAGSLDGDAITASLFMK  1723
             WE MKSS+ADMIN GS  G AITA+LF+K
Sbjct  497   WEQMKSSVADMINTGSPLGGAITAALFLK  525



>gb|AFW73856.1| hypothetical protein ZEAMMB73_599286 [Zea mays]
Length=487

 Score =   490 bits (1261),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 264/397 (66%), Positives = 329/397 (83%), Gaps = 1/397 (0%)
 Frame = +2

Query  302   LGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKL  481
             LGLTKPN ++ P++  +A++++  EWKGDILAV VTEKD+++D +SKF+N +L+KLD +L
Sbjct  77    LGLTKPNAVEPPQVTFSAKDIEFSEWKGDILAVAVTEKDLSKDADSKFENAVLKKLDGQL  136

Query  482   GGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG-SVVSSTIAYRTLGETIaaaa  658
             GGLLSEA++EEDF+GK+GQS+VLRL G G KR+GL+GLG S  S+  A R LGE++A+ A
Sbjct  137   GGLLSEAAAEEDFTGKTGQSVVLRLAGQGFKRVGLIGLGQSAPSTAAASRGLGESVASVA  196

Query  659   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  838
             K+AQASS A+ LAS  G+  E KL+AA+A+A+G V G +ED+R+K E K   LK V+I+G
Sbjct  197   KAAQASSAAIVLASPSGIQEEFKLTAAAAVASGTVLGLYEDSRYKSESKKVHLKQVDIIG  256

Query  839   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1018
             LG+G E+++KLKY+  +SSGVIF +ELVN+PANVLTP  LAEEA  IAS YSDV TAT+L
Sbjct  257   LGSGAEVDQKLKYANDLSSGVIFGRELVNSPANVLTPAVLAEEASKIASTYSDVFTATVL  316

Query  1019  DVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKI  1198
             DVE+CKELKMGS+LGVAAA+ NP +FIHLCYKP+ G+VK KLA++GKG+TFDSGGYN+K 
Sbjct  317   DVEKCKELKMGSYLGVAAASANPPHFIHLCYKPTDGNVKRKLAIVGKGLTFDSGGYNIKT  376

Query  1199  GANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTA  1378
             G   SIELMK DM G+A VFGAAKA+ QIKP GVEVHFIV ACENMISGTGMRPGDI+TA
Sbjct  377   GPGCSIELMKFDMGGSAAVFGAAKALGQIKPPGVEVHFIVAACENMISGTGMRPGDIVTA  436

Query  1379  SNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDL  1489
             SNGK IEV +TDAEGRL LADALVYA   GVEK++ L
Sbjct  437   SNGKTIEVNNTDAEGRLTLADALVYACNQGVEKVMKL  473



>gb|AFW71513.1| hypothetical protein ZEAMMB73_883672 [Zea mays]
Length=538

 Score =   487 bits (1253),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 284/483 (59%), Positives = 371/483 (77%), Gaps = 9/483 (2%)
 Frame = +2

Query  302   LGLTKPNQ-IQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPN---SKFQNLILQKL  469
             LGLT PN  ++ P+I  AA++ +  +W GDILAV VT+KD+   P+   S+F+N +L++L
Sbjct  12    LGLTWPNAAVELPQISFAAKDSEFSDWDGDILAVAVTDKDVQVQPHVSGSEFENAVLRRL  71

Query  470   DSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIA--YRTLGET  643
             D +LGGLL  A++EE+F+G+ GQS+VLR+ G   KR+ LVG  +      A     LGE+
Sbjct  72    DVQLGGLLRAAAAEEEFAGRPGQSVVLRVRGQRFKRVALVGFAARDRDRDAGCLHGLGES  131

Query  644   IaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKS  823
             +A+ A++A+A+S A+ +A    +  ES+L+AA+A+A+G V G +EDNR+K E +   LK 
Sbjct  132   VASVARAARATSAAILVADPAVVRPESRLNAAAAIASGTVLGLYEDNRYKSEWEKVHLKQ  191

Query  824   VEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVL  1003
             V+++GLG+GPE+++KL+++  +SSGV+  ++LVN+PANVLTPGALAE A  IAS YSDV 
Sbjct  192   VDLIGLGSGPELDQKLRHANRLSSGVMLARDLVNSPANVLTPGALAEAAAKIASTYSDVF  251

Query  1004  TATILDVEQCKELKMGSFLGVAAAA-TNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSG  1180
             TATILD  +C+ELKMGS+L VAAA+ TNP YFIHLCYKP  G V+ KLAL+GKGITFDSG
Sbjct  252   TATILDAAKCRELKMGSYLAVAAASETNPPYFIHLCYKPRGGDVRRKLALVGKGITFDSG  311

Query  1181  GYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRP  1360
             GYN+K    ++IELMKKDM GAA VFGAA+ + QIKP GVEVHFI  A ENMISG+GMRP
Sbjct  312   GYNIKAVPVATIELMKKDMGGAAAVFGAAEVLGQIKPPGVEVHFISAASENMISGSGMRP  371

Query  1361  GDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAG  1540
             GDI+TASNGK IEV +TDAEGRL LADALVYA   GV+K++DLATLTGA   ALG S+AG
Sbjct  372   GDIVTASNGKTIEVDNTDAEGRLTLADALVYACNQGVDKIIDLATLTGAIRVALGPSIAG  431

Query  1541  IFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSL--DGDAITASL  1714
             I TPS++LA+E   A +V GEK WR+P+EESYWE+M+SSIADM+ AG L     AITA+L
Sbjct  432   ILTPSDELAEEFAAAYEVSGEKFWRLPMEESYWESMESSIADMLCAGPLQPQAGAITAAL  491

Query  1715  FMK  1723
             F+K
Sbjct  492   FLK  494



>gb|KGN61046.1| hypothetical protein Csa_2G035460 [Cucumis sativus]
Length=482

 Score =   474 bits (1220),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 279/476 (59%), Positives = 337/476 (71%), Gaps = 45/476 (9%)
 Frame = +2

Query  299   TLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSK  478
             TLGLT P     PKI  AA++ D+LEW GD+LAVGVTEKD+ +D N+ F NL+L+KLD+ 
Sbjct  8     TLGLTNPGPSNAPKITFAAKDTDVLEWNGDLLAVGVTEKDVVKDDNNNFTNLLLKKLDAV  67

Query  479   LGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaa  658
             LGGLL+EASSEEDFSGKSGQ+IVLR+ GL  KR+GL G+G       A+  LGE IAAAA
Sbjct  68    LGGLLAEASSEEDFSGKSGQAIVLRVSGLCFKRVGLFGVGQSAYKAAAFVGLGEAIAAAA  127

Query  659   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  838
             ++++A S+AVALA +  LS ESK   AS++A GIV+G F+D                   
Sbjct  128   QASRAVSLAVALAFSADLSDESKPDIASSIAIGIVNGIFDD-------------------  168

Query  839   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1018
                         Y     S + F+             G LA E  NIA  YSDVL+A I 
Sbjct  169   ------------YILFCLSVIYFL-------------GQLAAEVLNIARNYSDVLSARIF  203

Query  1019  DVEQCKELKMGSFLGVAAAAT-NPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLK  1195
             + ++  E+KMGS+LGV AAAT NP  FIHLCYKP SGSV  KL L+GKGITFDSGGYNLK
Sbjct  204   NEDEIIEMKMGSYLGVTAAATANPPKFIHLCYKPPSGSVSAKLGLVGKGITFDSGGYNLK  263

Query  1196  IGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILT  1375
              G+ S+IE MK DM GA  +FGAAKAIA+IKP GVE+HF+V ACENMIS TGMRP DI+T
Sbjct  264   AGSGSNIETMKNDMGGAGTIFGAAKAIAEIKPLGVEIHFVVAACENMISATGMRPSDIVT  323

Query  1376  ASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPS  1555
             A+NGK IEV +TDAEGRL LADAL+Y  K GV K++DLATLTGACITALG SVAG FTP+
Sbjct  324   AANGKTIEVNNTDAEGRLCLADALLYTCKQGVAKIIDLATLTGACITALGPSVAGAFTPN  383

Query  1556  EDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             E+LA EVL AA+  GEKLWR+P+EESYW++MKS +ADM+N G   G AITA+LF+K
Sbjct  384   EELASEVLSAAERSGEKLWRLPIEESYWDSMKSGVADMLNTGPSQGGAITAALFLK  439



>gb|EMT23101.1| Leucine aminopeptidase 2, chloroplastic [Aegilops tauschii]
Length=530

 Score =   474 bits (1221),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 278/506 (55%), Positives = 353/506 (70%), Gaps = 57/506 (11%)
 Frame = +2

Query  275   MAHSVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNL  454
             MAH+ A   LGLTKPN ++  ++  AA  ++  +W+GD+LAV VTEKD+ R P S F+N 
Sbjct  1     MAHTAA--ALGLTKPNVVEPLQVSFAAIGIEPSDWEGDVLAVAVTEKDLCRSPCSSFENA  58

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG-SVVSSTIAYRT  631
             +L++LDS+LGGLLSEAS+EEDF+GK+GQ +VLRL G G KR+GL+GLG S   +  A R 
Sbjct  59    VLKRLDSQLGGLLSEASAEEDFAGKAGQLVVLRLQGQGFKRLGLIGLGRSAPFTAAACRG  118

Query  632   LGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTP  811
             LGE+ A+ AKSA+A S A+ALAS  G+  E K +AA+A+A+G V G +EDNR++ E    
Sbjct  119   LGESFASVAKSARAGSAALALASPGGIHGEFKPNAAAAIASGTVLGLYEDNRYRSESNKV  178

Query  812   TLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLY  991
              LK V ++G G GPE++++L+ +  VSSGVIF K+LVN+PANVLTP  LAEEA  IAS Y
Sbjct  179   HLKHVHLIGFGYGPEVDRRLELANYVSSGVIFGKDLVNSPANVLTPVVLAEEASKIASTY  238

Query  992   SDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITF  1171
             SDV TATILD E+C+ELKMGS+L VAAA+ NP  FIHLCYKP  G+VK KLA++GKG+TF
Sbjct  239   SDVFTATILDEERCRELKMGSYLAVAAASANPPRFIHLCYKPPGGNVKRKLAIVGKGLTF  298

Query  1172  DSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTG  1351
             DSGGYN+KIGA  +IELMK DM G+A V GAAKA+ +IKP GV                 
Sbjct  299   DSGGYNIKIGAVCNIELMKWDMGGSAAVLGAAKALGEIKPPGV-----------------  341

Query  1352  MRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1531
                            EV +TDAEGRL LADALVYA K GV+K++DLATLTG C  ALG S
Sbjct  342   ---------------EVDNTDAEGRLTLADALVYACKQGVDKIIDLATLTGFCRVALGPS  386

Query  1532  VA---------------------GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETM  1648
             +A                     GI TPS++L +EV  A++V GEK WR+PLEESYWETM
Sbjct  387   IAVIFSSCPVLALFWHVQRSISTGILTPSDELHEEVAAASEVSGEKFWRLPLEESYWETM  446

Query  1649  KSSIADMINAGSL-DGDAITASLFMK  1723
             KS +ADM+N G++  G  ITA+LF+K
Sbjct  447   KSGVADMLNTGAIPQGGVITAALFLK  472



>ref|XP_008352214.1| PREDICTED: LOW QUALITY PROTEIN: leucine aminopeptidase 1-like 
[Malus domestica]
Length=439

 Score =   471 bits (1211),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 243/340 (71%), Positives = 281/340 (83%), Gaps = 2/340 (1%)
 Frame = +2

Query  704   EGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSE  883
             EGLSV+S  + ASA+A+G V G +ED R+K E K   LKSV+ILGLGTG E+EKKLKY E
Sbjct  59    EGLSVKS--NTASAIASGTVLGIYEDGRYKSESKKSALKSVDILGLGTGAEVEKKLKYXE  116

Query  884   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLG  1063
              V+SG+IF KELVN+PANVLTPG LAEEA  IAS YSDVL+A IL+ EQCKELKMGS+L 
Sbjct  117   DVTSGIIFGKELVNSPANVLTPGKLAEEASKIASTYSDVLSANILNEEQCKELKMGSYLA  176

Query  1064  VAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMag  1243
             VAAA+TNP +FIHL YKP  G  K KL L+GKG+TFDSGGYN+K G   SIE MK DM G
Sbjct  177   VAAASTNPPHFIHLIYKPPGGPAKVKLGLVGKGLTFDSGGYNIKTGPGCSIEQMKFDMGG  236

Query  1244  aavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEG  1423
             +A V GAAKAIAQIKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IEV +TDAEG
Sbjct  237   SAAVLGAAKAIAQIKPXGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIEVNNTDAEG  296

Query  1424  RLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGE  1603
             RL LADALVYA   GV+K+VDLATLTGACI ALG S+AG+FTPS+DLAKEV  A+++ GE
Sbjct  297   RLTLADALVYACNQGVDKIVDLATLTGACIVALGPSIAGVFTPSDDLAKEVFAASEISGE  356

Query  1604  KLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             K WR+P+EESYWE+MKS IADM+N G+  G +ITA+LF+K
Sbjct  357   KFWRLPMEESYWESMKSGIADMLNTGARQGGSITAALFLK  396



>ref|XP_008645704.1| PREDICTED: LOW QUALITY PROTEIN: leucine aminopeptidase 2, chloroplastic-like 
[Zea mays]
Length=559

 Score =   474 bits (1220),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 284/504 (56%), Positives = 371/504 (74%), Gaps = 30/504 (6%)
 Frame = +2

Query  302   LGLTKPNQ-IQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPN---SKFQNLILQKL  469
             LGLT PN  ++ P+I  AA++ +  +W GDILAV VT+KD+   P+   S+F+N +L++L
Sbjct  12    LGLTWPNAAVELPQISFAAKDSEFSDWDGDILAVAVTDKDVQVQPHVSGSEFENAVLRRL  71

Query  470   DSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIA--YRTLGET  643
             D +LGGLL  A++EE+F+G+ GQS+VLR+ G   KR+ LVG  +      A     LGE+
Sbjct  72    DVQLGGLLRAAAAEEEFAGRPGQSVVLRVRGQRFKRVALVGFAARDRDRDAGCLHGLGES  131

Query  644   IaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKS  823
             +A+ A++A+A+S A+ +A    +  ES+L+AA+A+A+G V G +EDNR+K E +   LK 
Sbjct  132   VASVARAARATSAAILVADPAVVRPESRLNAAAAIASGTVLGLYEDNRYKSEWEKVHLKQ  191

Query  824   VEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVL  1003
             V+++GLG+GPE+++KL+++  +SSGV+  ++LVN+PANVLTPGALAE A  IAS YSDV 
Sbjct  192   VDLIGLGSGPELDQKLRHANRLSSGVMLARDLVNSPANVLTPGALAEAAAKIASTYSDVF  251

Query  1004  TATILDVEQCKELKMGSFLGVAAAA-TNPSYFIHLCYKPSSGSVKTKLALLGKGITFD--  1174
             TATILD  +C+ELKMGS+L VAAA+ TNP YFIHLCYKP  G V+ KLAL+GKGITFD  
Sbjct  252   TATILDAAKCRELKMGSYLAVAAASETNPPYFIHLCYKPRGGDVRRKLALVGKGITFDRF  311

Query  1175  -------------------SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAG  1297
                                SGGYN+K    ++IELMKKDM GAA VFGAA+ + QIKP G
Sbjct  312   ILSTPNTXFLDARFTSVVSSGGYNIKAVPVATIELMKKDMGGAAAVFGAAEVLGQIKPPG  371

Query  1298  VEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEK  1477
             VEVHFI  A ENMISG+GMRPGDI+TASNGK IEV +TDAEGRL LADALVYA   GV+K
Sbjct  372   VEVHFISAASENMISGSGMRPGDIVTASNGKTIEVDNTDAEGRLTLADALVYACNQGVDK  431

Query  1478  MVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSS  1657
             ++DLATLTGA   ALG S+AGI TPS++LA+E   A +V GEK WR+P+EESYWE+M+SS
Sbjct  432   IIDLATLTGAIRVALGPSIAGILTPSDELAEEFAAAYEVSGEKFWRLPMEESYWESMESS  491

Query  1658  IADMINAGSL--DGDAITASLFMK  1723
             IADM+ AG L     AITA+LF+K
Sbjct  492   IADMLCAGPLQPQAGAITAALFLK  515



>ref|XP_008785917.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Phoenix 
dactylifera]
Length=385

 Score =   467 bits (1202),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 259/381 (68%), Positives = 312/381 (82%), Gaps = 4/381 (1%)
 Frame = +2

Query  275   MAH--SVALATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQ  448
             M H  S   ATLGLTKP  ++ P+I  +A+E+D   WKGDILAV V+E DM++D +SKF+
Sbjct  1     MGHVTSATRATLGLTKPALVEIPQISFSAKEIDFAVWKGDILAVAVSENDMSKDLDSKFE  60

Query  449   NLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG--SVVSSTIA  622
             N IL++LD KLGGLL+EAS+EEDF+GK+GQS+VLRLPGLG KR+GLVGLG  S  S+  A
Sbjct  61    NSILKRLDEKLGGLLAEASTEEDFTGKAGQSMVLRLPGLGFKRVGLVGLGQCSPSSTATA  120

Query  623   YRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEP  802
             YR++GE +A  AK+AQA + AV LAS+ G+S E KL+AASA+A+G V G +ED+RFK + 
Sbjct  121   YRSIGEAVAVVAKAAQAINAAVILASSNGISEEFKLNAASAIASGTVLGVYEDSRFKSDS  180

Query  803   KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIA  982
             K   LK+V+I+GLG+GPE++KK+KY+  V SGVIF KEL NAPANVLTPG LAEEA  +A
Sbjct  181   KKTHLKAVDIIGLGSGPELDKKIKYASDVCSGVIFGKELANAPANVLTPGVLAEEASKVA  240

Query  983   SLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKG  1162
             S YSDVL ATILDVEQCKELKMGS+LGVAAA++NP +FIHLCYKP  G VK KLA++GKG
Sbjct  241   SSYSDVLMATILDVEQCKELKMGSYLGVAAASSNPPHFIHLCYKPPGGDVKRKLAIVGKG  300

Query  1163  ITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMIS  1342
             +TFDSGGYN+K G   SIELMK DM G+A  FGAAKAIAQIKP GVEVHFIV ACENMIS
Sbjct  301   LTFDSGGYNIKTGPGCSIELMKFDMGGSAAAFGAAKAIAQIKPPGVEVHFIVAACENMIS  360

Query  1343  GTGMRPGDILTASNGKRIEVT  1405
             GTGMRPGDI+TASNGK IEV+
Sbjct  361   GTGMRPGDIVTASNGKTIEVS  381



>gb|AFK42034.1| unknown [Medicago truncatula]
Length=392

 Score =   460 bits (1183),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 229/323 (71%), Positives = 271/323 (84%), Gaps = 0/323 (0%)
 Frame = +2

Query  755   GIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPA  934
             G V G FED R+K E K P ++S++I+GLGTGP++EKKLKY+  VSSG+IF  ELVN+PA
Sbjct  27    GAVLGLFEDQRYKSESKKPAVRSIDIIGLGTGPDLEKKLKYAGDVSSGIIFGGELVNSPA  86

Query  935   NVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYK  1114
             NVLTPG LAEEA  +AS YSDV TA ILD +QCKELKMGS+LGVAAA+ NP  FIHL YK
Sbjct  87    NVLTPGVLAEEASKVASTYSDVFTAKILDADQCKELKMGSYLGVAAASANPPRFIHLTYK  146

Query  1115  PSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPA  1294
             P SGSVK KLAL+GKG+TFDSGGYN+K G   SIELMK DM G+A V GAAKA+ QIKP 
Sbjct  147   PPSGSVKVKLALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKALGQIKPL  206

Query  1295  GVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVE  1474
             GVEVHFIV ACENMISGTGMRPGD++TASNGK IEV +TDAEGRL LADALVYA   GVE
Sbjct  207   GVEVHFIVAACENMISGTGMRPGDVVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVE  266

Query  1475  KMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKS  1654
             K++DLATLTGAC+ ALG S+AG+F+P+++L KEVLEA++V GEKLWR+P+EESYWE+MKS
Sbjct  267   KIIDLATLTGACVVALGPSIAGVFSPNDELVKEVLEASEVSGEKLWRLPIEESYWESMKS  326

Query  1655  SIADMINAGSLDGDAITASLFMK  1723
              +ADM+N G   G +ITA+LF+K
Sbjct  327   GVADMVNTGGRPGGSITAALFLK  349



>gb|ACJ85545.1| unknown [Medicago truncatula]
Length=392

 Score =   459 bits (1182),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 228/323 (71%), Positives = 271/323 (84%), Gaps = 0/323 (0%)
 Frame = +2

Query  755   GIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPA  934
             G V G FED R+K E K P ++S++I+GLGTGP++EKKLKY+  VSSG+IF  ELVN+PA
Sbjct  27    GAVLGLFEDQRYKSESKKPAVRSIDIIGLGTGPDLEKKLKYAGDVSSGIIFGGELVNSPA  86

Query  935   NVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYK  1114
             NVLTPG LAEEA  +AS YSDV TA ILD +QCKELKMGS+LGVAAA+ NP  FIHL YK
Sbjct  87    NVLTPGVLAEEASKVASTYSDVFTAKILDADQCKELKMGSYLGVAAASANPPRFIHLTYK  146

Query  1115  PSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPA  1294
             P SGSVK KLAL+GKG+TFDSGGYN+K G   SIELMK DM G+A + GAAKA+ QIKP 
Sbjct  147   PPSGSVKVKLALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAILGAAKALGQIKPL  206

Query  1295  GVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVE  1474
             GVEVHFIV ACENMISGTGMRPGD++TASNGK IEV +TDAEGRL LADALVYA   GVE
Sbjct  207   GVEVHFIVAACENMISGTGMRPGDVVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVE  266

Query  1475  KMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKS  1654
             K++DLATLTGAC+ ALG S+AG+F+P+++L KEVLEA++V GEKLWR+P+EESYWE+MKS
Sbjct  267   KIIDLATLTGACVVALGPSIAGVFSPNDELVKEVLEASEVSGEKLWRLPIEESYWESMKS  326

Query  1655  SIADMINAGSLDGDAITASLFMK  1723
              +ADM+N G   G +ITA+LF+K
Sbjct  327   GVADMVNTGGRPGGSITAALFLK  349



>ref|XP_008376006.1| PREDICTED: LOW QUALITY PROTEIN: leucine aminopeptidase 1-like 
[Malus domestica]
Length=426

 Score =   457 bits (1175),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 235/340 (69%), Positives = 275/340 (81%), Gaps = 2/340 (1%)
 Frame = +2

Query  704   EGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSE  883
             EGLS +S  + ASA+A+G V G +ED R+K E K   LKSV+ILGLGTG E+EKKLKY+E
Sbjct  46    EGLSAKS--NTASAIASGTVLGIYEDGRYKSESKKSALKSVDILGLGTGAEVEKKLKYTE  103

Query  884   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLG  1063
              V+SG+IF KELVN+PAN LTPG LAEEA  I S YSDVL+A IL+ EQCKELKMGS+L 
Sbjct  104   DVTSGIIFGKELVNSPANALTPGKLAEEASKITSTYSDVLSANILNEEQCKELKMGSYLA  163

Query  1064  VAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMag  1243
             VAAA+TNP +FIHL YKP     K KL L+GKG+TFDSGGYN+K G + SIE MK DM G
Sbjct  164   VAAASTNPPHFIHLIYKPPGXPAKVKLGLVGKGLTFDSGGYNIKTGPSCSIEQMKFDMGG  223

Query  1244  aavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEG  1423
             +A V GAAKAIAQIKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IEV +TDAEG
Sbjct  224   SAAVLGAAKAIAQIKPVGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIEVNNTDAEG  283

Query  1424  RLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGE  1603
             RL LADALVYA   GV+K+VDLAT TGACI ALG S+A +FTPS+DLA EV   +++ GE
Sbjct  284   RLTLADALVYACNQGVDKIVDLATFTGACIVALGPSIASVFTPSDDLANEVFTVSEISGE  343

Query  1604  KLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             K WR+P+EESYWE+MKS IADM+N G+  G +ITA+LF+K
Sbjct  344   KFWRLPMEESYWESMKSGIADMLNTGARQGGSITAALFLK  383



>ref|XP_001758543.1| predicted protein [Physcomitrella patens]
 gb|EDQ76521.1| predicted protein [Physcomitrella patens]
Length=524

 Score =   456 bits (1173),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 268/480 (56%), Positives = 352/480 (73%), Gaps = 4/480 (1%)
 Frame = +2

Query  293   LATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLD  472
             ++ +GLTK      P+I + +  +++  W GD+L +GV E    +  + KF N  L+ LD
Sbjct  2     VSEVGLTKTATPVVPEIAVKSSGLEVANWGGDLLVLGVFEGCATKSEDGKFSNSELEALD  61

Query  473   SKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGS---VVSSTIAYRTLGET  643
             + +GGLLS  +SEE+F+GKSGQS   R+ G G KR+GLVGLG    V +++  +R+LGE+
Sbjct  62    ALVGGLLSVVASEEEFTGKSGQSTFHRVIGCGFKRVGLVGLGKSDKVETNSKVWRSLGES  121

Query  644   IaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKS  823
             IA AA +A + S AV +  A  LS   K +AAS +ATG++ G+FED RFK + K P LK 
Sbjct  122   IATAAAAAHSGSAAVVVVDAGSLSDAVKKTAASMIATGVMLGSFEDMRFKSDFKKPQLKD  181

Query  824   VEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVL  1003
             +E+ GLG+  ++E +L  +    +GVI  K+LVNAP NVL P  +A EA+ IA+ + DV+
Sbjct  182   LELFGLGSDADLEAQLAQTIQQCTGVILAKQLVNAPPNVLLPSVMACEAEAIAAAHGDVM  241

Query  1004  TATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGG  1183
             T  IL+ E+C++L MG++LGV+AA+TNP  FIHLCY P  G+V TKLA++GKG+TFDSGG
Sbjct  242   TCKILEKEECEKLGMGAYLGVSAASTNPPKFIHLCYSPL-GAVTTKLAIVGKGLTFDSGG  300

Query  1184  YNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPG  1363
             YNLK G    IELMK DM GAA V GAAKAIA IKP GVEV+F+V ACENMISG GMRPG
Sbjct  301   YNLKTGPGCMIELMKFDMGGAAAVLGAAKAIAAIKPEGVEVNFVVAACENMISGGGMRPG  360

Query  1364  DILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGI  1543
             DILTASNGK IEV +TDAEGRL LADALVYA+ L V+K+VDLATLTGACI ALG  + G+
Sbjct  361   DILTASNGKTIEVNNTDAEGRLTLADALVYANNLKVDKIVDLATLTGACIIALGNDIGGM  420

Query  1544  FTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             FTP+++LA+E+ EA+  GGEK WRMP+E+SY+E +KS+IADM+N G   G +I ASLF+K
Sbjct  421   FTPNDELAQELTEASKKGGEKFWRMPMEDSYFEMLKSNIADMVNTGGRAGGSIIASLFLK  480



>gb|ABY84519.1| leucine aminopeptidase, partial [Solanum nigrum]
Length=310

 Score =   429 bits (1103),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 230/302 (76%), Positives = 259/302 (86%), Gaps = 0/302 (0%)
 Frame = +2

Query  704   EGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSE  883
             +GLS ESKLS+ASA+ATG V G FEDNRFK E K PTLKS++ILG GTGPEIEKK+KY+ 
Sbjct  9     DGLSAESKLSSASAIATGAVLGIFEDNRFKSESKKPTLKSLDILGTGTGPEIEKKIKYAA  68

Query  884   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLG  1063
              V +GVI  +ELVNAPANVLTP  LAEEAK IAS YSDV +A ILDVEQCKELKMGS+L 
Sbjct  69    DVCAGVILGRELVNAPANVLTPAVLAEEAKKIASTYSDVFSANILDVEQCKELKMGSYLA  128

Query  1064  VAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMag  1243
             VAAA+ NP++FIHLCYKPSSG +K K+AL+GKG+TFDSGGYN+K G   SIELMK DM G
Sbjct  129   VAAASANPAHFIHLCYKPSSGEIKKKIALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGG  188

Query  1244  aavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEG  1423
             AA V GAAKA+ QIKPAGVEVHFIV ACENMISGTGMRPGDI+TASNGK IEV +TDAEG
Sbjct  189   AAAVLGAAKALGQIKPAGVEVHFIVAACENMISGTGMRPGDIITASNGKTIEVNNTDAEG  248

Query  1424  RLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGE  1603
             RL LADALVYA   GVEK+VDLATLTGAC+ ALG S+AGIFTPS+DLAKEV+ A++V GE
Sbjct  249   RLTLADALVYACNQGVEKIVDLATLTGACVVALGPSIAGIFTPSDDLAKEVVAASEVSGE  308

Query  1604  KL  1609
             KL
Sbjct  309   KL  310



>ref|XP_001783885.1| predicted protein [Physcomitrella patens]
 gb|EDQ51282.1| predicted protein [Physcomitrella patens]
Length=517

 Score =   429 bits (1102),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 238/465 (51%), Positives = 316/465 (68%), Gaps = 6/465 (1%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSG  526
             I A +  L EW+GD+LA+GV E+++ R   +KF +  L +LD  +GG+L E + E+DF+G
Sbjct  3     IRAHDGALYEWEGDVLALGVFEENLTRSEENKFLHPGLAELDYVMGGVLGELADEDDFTG  62

Query  527   KSGQSIVLRLPGLGSKRIGLVGLG------SVVSSTIAYRTLGETIaaaaksaqassvav  688
             K GQ  V+RL     KR+ LVGLG        V ++ ++R LG T A  AK  +  S+ +
Sbjct  63    KLGQLSVVRLASSKIKRLALVGLGRANNVMDAVYASDSWRILGFTAARIAKQLKMCSMGL  122

Query  689   alasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKK  868
             A      +   SKL A  ++A+G + GT+ED RFK E K   L  V ++ LGTG + ++ 
Sbjct  123   AAMDTNLMDESSKLVAVESIASGAILGTYEDTRFKSEAKPSKLTQVAVMSLGTGSDRDEA  182

Query  869   LKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKM  1048
             L+ +  +++GVI  K+LV APANVLTPGALA+ A +IA  +S+VLT TIL+   C+ L M
Sbjct  183   LRRAVCITAGVIVAKQLVAAPANVLTPGALADAAVSIAMAHSEVLTCTILEKVDCEALGM  242

Query  1049  GSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMK  1228
             G+FLGVA  +  P  FIHL Y P  G V  ++A++GKGI FDSGGYN+K GAN ++ELMK
Sbjct  243   GAFLGVANGSDQPPKFIHLKYCPPDGVVYKRVAIVGKGICFDSGGYNIKTGANCAVELMK  302

Query  1229  KDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTD  1408
              DM GA    GAA AI  +KP GVEVHFI  ACENMISG GMRPGDI+TA NG  IEV +
Sbjct  303   FDMGGAGAALGAASAIGALKPKGVEVHFISAACENMISGKGMRPGDIVTAMNGITIEVNN  362

Query  1409  TDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAA  1588
             TDAEGRL LAD+LVYA +L V+ +VDLATLTGAC+ ALG  V G FTPS  +A+++  AA
Sbjct  363   TDAEGRLTLADSLVYACRLRVDAIVDLATLTGACVVALGHEVGGFFTPSATMAQQLETAA  422

Query  1589  DVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
              + GEK+WRMPL E Y +T++S IAD++N    DG +I A+LF+K
Sbjct  423   QIAGEKIWRMPLVEQYKQTLESPIADLVNTSGRDGGSIKAALFLK  467



>ref|XP_008666283.1| PREDICTED: LOW QUALITY PROTEIN: leucine aminopeptidase 2, chloroplastic-like 
[Zea mays]
Length=396

 Score =   421 bits (1081),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 235/367 (64%), Positives = 293/367 (80%), Gaps = 3/367 (1%)
 Frame = +2

Query  302   LGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKL  481
             LGLTKPN ++ P++   A+++   EWKGDILAV VTEKD+++D  SKF+N +L+KLD +L
Sbjct  16    LGLTKPNAVEPPQVTFFAKDIKFSEWKGDILAVTVTEKDLSKDAYSKFENAVLKKLDGQL  75

Query  482   GGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG-SVVSSTIAYRTLGETIaaaa  658
             GGLLSEA+ EEDF+GK+GQS+VLRL G G KR+GL+GLG S  S+  A R L E++A+ A
Sbjct  76    GGLLSEAAVEEDFTGKTGQSVVLRLAGQGFKRVGLIGLGQSAPSTAAASRGLRESVASVA  135

Query  659   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  838
             K+AQASS A+ LAS  G+  E KL+A  +  T  V G +EDNR+K E K   LK V+I+G
Sbjct  136   KAAQASSAAIVLASPSGIQEEFKLAALXSSRT--VLGLYEDNRYKSESKKVHLKQVDIIG  193

Query  839   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1018
             LG+G E+++K+KY+  +SSGVIF +ELVN+PANVLTP  LAEEA  IAS +SDV TAT+L
Sbjct  194   LGSGAEVDQKIKYANDLSSGVIFGRELVNSPANVLTPAVLAEEASKIASTFSDVFTATVL  253

Query  1019  DVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKI  1198
             DVE+CKELKMGS+LGVAAA+ NP +FIHLCYKP+ G++K KLA++GKG+TFDSGGYN+K 
Sbjct  254   DVEKCKELKMGSYLGVAAASANPPHFIHLCYKPTDGNIKRKLAIVGKGLTFDSGGYNIKT  313

Query  1199  GANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTA  1378
             G   SIELMK DM G+A VFGAAKA+ QIKP GVEVHFIV ACENMISGT MR GDI+TA
Sbjct  314   GPGCSIELMKFDMGGSAAVFGAAKALGQIKPPGVEVHFIVAACENMISGTDMRTGDIVTA  373

Query  1379  SNGKRIE  1399
             SNGK IE
Sbjct  374   SNGKTIE  380



>ref|NP_001048379.1| Os02g0794700 [Oryza sativa Japonica Group]
 dbj|BAF10293.1| Os02g0794700, partial [Oryza sativa Japonica Group]
Length=316

 Score =   406 bits (1044),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/273 (74%), Positives = 233/273 (85%), Gaps = 0/273 (0%)
 Frame = +2

Query  905   FVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATN  1084
             F KELVN+PANVLTP  LAEEA NIAS YSDV TATILDVE+CKELKMGS+LGVAAA+ N
Sbjct  1     FGKELVNSPANVLTPAVLAEEASNIASTYSDVFTATILDVEKCKELKMGSYLGVAAASAN  60

Query  1085  PSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfga  1264
             P +FIHLCYKP  G+ K KLA++GKG+TFDSGGYN+K G   SIELMK DM G+A VFGA
Sbjct  61    PPHFIHLCYKPPGGNAKRKLAIVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVFGA  120

Query  1265  akaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADA  1444
             AKA+ QIKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IEV +TDAEGRL LADA
Sbjct  121   AKALGQIKPPGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIEVNNTDAEGRLTLADA  180

Query  1445  LVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPL  1624
             LVYA   GV+K++DLATLTGAC+ ALG S+AGIFTPS++LAKEV  A+++ GEK WRMPL
Sbjct  181   LVYACNQGVDKIIDLATLTGACVVALGPSIAGIFTPSDELAKEVAAASEISGEKFWRMPL  240

Query  1625  EESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             EESYWE+MKS +ADM+N G   G +ITA+LF+K
Sbjct  241   EESYWESMKSGVADMVNTGGRQGGSITAALFLK  273



>emb|CAA68143.1| cytosol aminopeptidase [Petroselinum crispum]
Length=295

 Score =   381 bits (979),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 191/250 (76%), Positives = 222/250 (89%), Gaps = 1/250 (0%)
 Frame = +2

Query  977   IASLYSDVLTATILDVEQCKELKMGSFLGVAAAAT-NPSYFIHLCYKPSSGSVKTKLALL  1153
             IASLYSDV++ATILDVEQCKELKMGS+LGVAAAA+ NP++FIHLCYKP SG+VK+KLAL+
Sbjct  2     IASLYSDVISATILDVEQCKELKMGSYLGVAAAASENPAHFIHLCYKPPSGTVKSKLALV  61

Query  1154  GKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACEN  1333
             GKG+TFDSGGYN+K G   SIELMK DM G+A V GAAKAI QIKPAGVEVHFIV ACEN
Sbjct  62    GKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGQIKPAGVEVHFIVAACEN  121

Query  1334  MISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACI  1513
             MISG GMRPGDILTASNGK IEV +TDAEGRL LADALVYA   GV+K++DLATLTGAC+
Sbjct  122   MISGAGMRPGDILTASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIIDLATLTGACV  181

Query  1514  TALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDG  1693
              ALG S+AGIFTPS+DLAKEV+EA+++ GEKLWR+P+EESYWE+MKS +ADM+N G   G
Sbjct  182   VALGPSIAGIFTPSDDLAKEVVEASEIAGEKLWRLPMEESYWESMKSGVADMVNTGGRQG  241

Query  1694  DAITASLFMK  1723
              +ITA+LF+K
Sbjct  242   GSITAALFLK  251



>ref|XP_008666459.1| PREDICTED: LOW QUALITY PROTEIN: leucine aminopeptidase 2, chloroplastic-like 
[Zea mays]
Length=699

 Score =   387 bits (993),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 223/355 (63%), Positives = 279/355 (79%), Gaps = 2/355 (1%)
 Frame = +2

Query  341   ILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             +   A++++  EWKGDILA+ +TEKD+++D  SKF+N +L+KLD +LGGLLSEA  EEDF
Sbjct  145   VTFFAKDIEFSEWKGDILAITITEKDLSKDAYSKFENAVLKKLDGQLGGLLSEAGVEEDF  204

Query  521   SGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAY-RTLGETIaaaaksaqassvavala  697
             +GK+GQS+VLRL G G KR+GL+GLG   SST A  R L E++A+ AK+AQASS A+ LA
Sbjct  205   TGKTGQSVVLRLAGQGFKRVGLIGLGQSASSTAAASRGLRESVASVAKAAQASSAAIVLA  264

Query  698   saEGLSVES-KLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLK  874
             S  G+  +   L       TG V G +ED+R+K E K   LK V+I+G+ +G ++++KLK
Sbjct  265   SPSGIQEDGWMLKFLPVXITGTVLGLYEDSRYKSESKKVHLKHVDIIGVSSGAKVDQKLK  324

Query  875   YSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGS  1054
             Y+  +SSGVIF +ELVN+PANVLTP  LAEEA  IAS +SDV TAT+LDVE+CKELKMGS
Sbjct  325   YANDLSSGVIFGRELVNSPANVLTPAVLAEEASKIASTFSDVFTATVLDVEKCKELKMGS  384

Query  1055  FLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKD  1234
             +LGVAAA+ NP +FIHLCYKP+ G+VK KLA++GKG+TFDSGGYN+K G   SIELMK D
Sbjct  385   YLGVAAASANPPHFIHLCYKPTDGNVKRKLAIVGKGLTFDSGGYNIKTGPGYSIELMKFD  444

Query  1235  MagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIE  1399
             M G+A VFGAAKA+ QIKP GVEVHFIV ACENMISGTGMR GDI+TASNGK IE
Sbjct  445   MGGSAAVFGAAKALGQIKPPGVEVHFIVAACENMISGTGMRTGDIVTASNGKTIE  499



>tpg|DAA39426.1| TPA: hypothetical protein ZEAMMB73_947180 [Zea mays]
Length=492

 Score =   374 bits (961),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 213/398 (54%), Positives = 274/398 (69%), Gaps = 47/398 (12%)
 Frame = +2

Query  302   LGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKL  481
             LGLTKPN ++ P++   A++++  EWKGDILAV VTEKD+++D  SKF+N++L+KLD +L
Sbjct  16    LGLTKPNAVEPPQVTFFAKDIEFSEWKGDILAVTVTEKDLSKDAYSKFENVVLKKLDGQL  75

Query  482   GGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG-SVVSSTIAYRTLGETIaaaa  658
             GGLLSEA+ EEDF+ K+GQS+VLRL G G KR+GL+GLG S  S+  A R L E++A+ A
Sbjct  76    GGLLSEAAVEEDFTRKTGQSVVLRLAGQGFKRVGLIGLGQSAPSTAAASRGLRESVASVA  135

Query  659   ksaqassvavalasaEGLSVESKLSA--------------ASAMATGIVSGTFEDNRFKL  796
             K+AQASS A+ LAS  G+  E KL+A              ++ + TG V G +ED+R+K 
Sbjct  136   KAAQASSTAIVLASPSGIQEEFKLAALQSSSCFWWMDAEISAGLITGTVLGLYEDSRYKS  195

Query  797   EPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTP---------  949
             E K   LK V+I+GLG+G E+++K+KY+   SSGVIF +ELVN+PANVLTP         
Sbjct  196   ESKKVHLKQVDIIGLGSGAEVDQKIKYANDFSSGVIFGRELVNSPANVLTPDLLPVYLSQ  255

Query  950   ------GALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCY  1111
                     LAEEA  I S +SDV TAT+LDVE+CKELKMGS+LGV AA+ NP +FIHLCY
Sbjct  256   SSFVLSAMLAEEASKITSTFSDVFTATVLDVEKCKELKMGSYLGVVAASANPPHFIHLCY  315

Query  1112  KPSSGSVKTKLALLGKGITFDSGGYNLKIGAN-SSIELMKKDMagaavvfgaakaiaQIK  1288
             KP+ G+VK KLA++GKG+TFDSGGYN+K     + I L    M                 
Sbjct  316   KPTDGNVKRKLAIVGKGLTFDSGGYNIKTSRGFTQISLSVNSMFFPFS------------  363

Query  1289  PAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEV  1402
                 +VHFIV ACENMISGTGMR GDI+TASNGK IEV
Sbjct  364   ----QVHFIVAACENMISGTGMRTGDIVTASNGKTIEV  397



>gb|AFW68884.1| hypothetical protein ZEAMMB73_253679 [Zea mays]
Length=690

 Score =   380 bits (977),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 208/359 (58%), Positives = 260/359 (72%), Gaps = 40/359 (11%)
 Frame = +2

Query  326   IQRPK-ILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEA  502
             +  PK +   A++++  EWKGDILA+ VTEKD+++D  SKF+N +L+KLD +LGGLLSEA
Sbjct  27    LHNPKGVTFFAKDIEFSEWKGDILAITVTEKDLSKDAYSKFENAVLKKLDGQLGGLLSEA  86

Query  503   SSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassv  682
               EEDF+GK+GQS+VLRL G G KR+GL+GLG   SST A                    
Sbjct  87    GVEEDFTGKTGQSVVLRLAGQGFKRVGLIGLGQSASSTAA--------------------  126

Query  683   avalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIE  862
                  ++ GL                V G +ED+R+K E K   LK V+I+G+G+G +++
Sbjct  127   -----ASRGLRT--------------VLGLYEDSRYKSESKKVHLKHVDIIGVGSGAKVD  167

Query  863   KKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKEL  1042
             +KLKY+  +SSGVIF +ELVN+PANVLTP  LAEEA  IAS +SDV TAT+LDVE+CKEL
Sbjct  168   QKLKYANDLSSGVIFGRELVNSPANVLTPAVLAEEASKIASTFSDVFTATVLDVEKCKEL  227

Query  1043  KMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIEL  1222
             KMGS+LGVAAA+ NP +FIHLCYKP+ G+VK KLA++GKG+TFDSGGYN+K G   SIEL
Sbjct  228   KMGSYLGVAAASANPPHFIHLCYKPTDGNVKRKLAIVGKGLTFDSGGYNIKTGPGYSIEL  287

Query  1223  MKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIE  1399
             MK DM G+  VFGAAKA+ QIKP GVEVHFI+ ACENMISGTGMR GDI+TASNGK IE
Sbjct  288   MKFDMGGSTAVFGAAKALGQIKPPGVEVHFIIAACENMISGTGMRTGDIVTASNGKTIE  346



>gb|AFW81180.1| hypothetical protein ZEAMMB73_308587 [Zea mays]
Length=617

 Score =   375 bits (964),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 211/394 (54%), Positives = 265/394 (67%), Gaps = 63/394 (16%)
 Frame = +2

Query  290   ALATLGLTKPNQIQRPKILIA---------AREVDLLEWKGDILAVGVTEKDMARDPNSK  442
             ALA  G  +P +    ++L+          A++++  EWKGDILA+ VTEKD+++D  SK
Sbjct  78    ALAAKGAHQPLKSSLHRLLLGLGISSVTFFAKDIEFSEWKGDILAITVTEKDLSKDAYSK  137

Query  443   FQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIA  622
             F+N +L+KLD +LGGLLSEA  EEDF+ K+GQS+VLRL G G KR+GL+GLG    ST  
Sbjct  138   FENAVLKKLDGQLGGLLSEAGVEEDFTRKTGQSVVLRLAGQGFKRVGLIGLGQSAPST--  195

Query  623   YRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEP  802
                                                  AA++     V G +ED+R+K E 
Sbjct  196   -------------------------------------AAASRGLRTVLGLYEDSRYKSES  218

Query  803   KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTP-----------  949
             K   LK V+I+G+G+G ++++KLKY+  +SSGVIF +ELVN+PANVLTP           
Sbjct  219   KKVHLKHVDIIGVGSGAKVDQKLKYANDLSSGVIFGRELVNSPANVLTPDLLPVYLSQSS  278

Query  950   ----GALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKP  1117
                   LAEEA  IAS +SDV TAT+LDVE+CKELKMGS+LGVAAA+ NP +FIHLCYKP
Sbjct  279   FVLSAVLAEEASKIASTFSDVFTATVLDVEKCKELKMGSYLGVAAASANPPHFIHLCYKP  338

Query  1118  SSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAG  1297
             + G+VK KLA++GKG+TFDSGGYN+K G   SIELMK DM G+A VFGAAKA+ QIKP G
Sbjct  339   TDGNVKRKLAIVGKGLTFDSGGYNIKTGPGYSIELMKFDMGGSAAVFGAAKALGQIKPPG  398

Query  1298  VEVHFIVPACENMISGTGMRPGDILTASNGKRIE  1399
             VEVHFIV ACENMISGTGMR GDI+TASNGK IE
Sbjct  399   VEVHFIVAACENMISGTGMRTGDIVTASNGKTIE  432



>gb|KHN18036.1| Leucine aminopeptidase 1, partial [Glycine soja]
Length=370

 Score =   362 bits (930),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 193/280 (69%), Positives = 230/280 (82%), Gaps = 0/280 (0%)
 Frame = +2

Query  338   KILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEED  517
             KI   A++VD+ EWKGDILAVGVTEKD+ARD NSKF+N+IL K+DSKLGGLL+EASSEED
Sbjct  3     KISFGAKDVDVTEWKGDILAVGVTEKDLARDANSKFENVILSKIDSKLGGLLAEASSEED  62

Query  518   FSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  697
             FSGK GQS VLR+ GLGSKR+GL+GLG   S+   ++ LG+ +  AAKS+Q SS AV LA
Sbjct  63    FSGKVGQSTVLRITGLGSKRVGLIGLGQSPSTPSPFKGLGDAVVEAAKSSQESSAAVVLA  122

Query  698   saEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKY  877
             S+EGLS +SKLS A A+A+G V G FEDNR+K E K  TL+S++I+GLG GPE+EKKLKY
Sbjct  123   SSEGLSAQSKLSTAYAIASGAVLGLFEDNRYKSEAKKSTLRSIDIIGLGMGPELEKKLKY  182

Query  878   SEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSF  1057
             +  VSSG+IF +ELVN+PANVLTPG LAEEA  IAS YSDV TA IL+ EQC ELKMGS+
Sbjct  183   AGDVSSGIIFGRELVNSPANVLTPGVLAEEAAKIASTYSDVFTAKILNAEQCAELKMGSY  242

Query  1058  LGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDS  1177
             LGVAAA+ NP +FIHLCYKP SG V  KLAL+GKG+TFDS
Sbjct  243   LGVAAASENPPHFIHLCYKPLSGPVNVKLALVGKGLTFDS  282



>ref|XP_008358040.1| PREDICTED: LOW QUALITY PROTEIN: leucine aminopeptidase 1-like 
[Malus domestica]
Length=582

 Score =   367 bits (942),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 205/295 (69%), Positives = 234/295 (79%), Gaps = 4/295 (1%)
 Frame = +2

Query  704   EGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSE  883
             EGLSV+S  + ASA+A+G V G +ED R+K E K   LKSV+ILGLGTG E+EKKLKY E
Sbjct  232   EGLSVKS--NTASAIASGTVLGIYEDGRYKSESKKSALKSVDILGLGTGAEVEKKLKYXE  289

Query  884   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELK-MGSFL  1060
              V+SG+IF KELVN+PANVLTPG LAEEA  IAS YSDV +A IL+ EQCK+LK MGS+L
Sbjct  290   DVTSGIIFGKELVNSPANVLTPGKLAEEASKIASTYSDV-SANILNEEQCKKLKKMGSYL  348

Query  1061  GVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMa  1240
              VAAA+TNP +FIHL YKP  G  K KL L+GKG+TFDSGGYN+K G   SIE MK DM 
Sbjct  349   AVAAASTNPPHFIHLIYKPPGGPAKVKLGLVGKGLTFDSGGYNIKTGPGCSIEQMKFDMG  408

Query  1241  gaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAE  1420
             G+A V GAAKAIAQIKP GVEVHFIV ACENM+SGTGMRPGDI+TASNGK IEV +TDAE
Sbjct  409   GSAAVLGAAKAIAQIKPTGVEVHFIVAACENMMSGTGMRPGDIVTASNGKTIEVNNTDAE  468

Query  1421  GRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEA  1585
             G L LADALVYA   GV+K+ DLATLTGACI A G SVAG+FTPS   +   LE+
Sbjct  469   GGLTLADALVYACNQGVDKIADLATLTGACIVAFGPSVAGVFTPSSSPSSSSLES  523



>ref|WP_039713603.1| aminopeptidase A [Scytonema millei]
 gb|KIF21277.1| aminopeptidase A [Scytonema millei VB511283]
Length=491

 Score =   361 bits (927),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 234/468 (50%), Positives = 301/468 (64%), Gaps = 33/468 (7%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSG  526
             I A +  LL+W GD LA+G+ E  +            L +LD K  G ++E +++ +F  
Sbjct  3     IRAIDTPLLDWAGDALALGLFEDAVELTGE-------LAELDGKFAGAIAELTADTEFKA  55

Query  527   KSGQSIVLRLPGLGS--KRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavala  697
             K G + V R+ G GS  +++ LVGLG      I  +R     +A  AK  +  +V     
Sbjct  56    KEGSTAVTRVGG-GSAVRKVILVGLGKPEGLKIDNWRKAAAVVARLAKKERCKTV-----  109

Query  698   saEGLSVES----KLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEI  859
                G+S+ +      + A A+A GI    F+DNRFK EP  K PT++ V++LGLG+    
Sbjct  110   ---GISLPAWNNDPAATAQALAEGIQLALFQDNRFKSEPEDKPPTVERVDLLGLGSQ---  163

Query  860   EKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKE  1039
             +  +  +  ++SGVI  +ELV APAN +TP  +AE A+ IAS Y   L   IL+ E C++
Sbjct  164   DDAVTRASQIASGVILARELVAAPANAVTPVTMAETAQAIASEYG--LAVEILEREDCEK  221

Query  1040  LKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIE  1219
             L MG+FLGVA A+  P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K GA S IE
Sbjct  222   LGMGAFLGVAQASELPPKFIHLTYKPD-GTPKRKLAIIGKGLTFDSGGLNIK-GAGSGIE  279

Query  1220  LMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIE  1399
              MK DM GAA   GAAKAIAQ+KP  VEVHFI  A ENMISG  M PGDIL ASNGK IE
Sbjct  280   TMKMDMGGAAATLGAAKAIAQLKP-DVEVHFISAATENMISGRAMHPGDILKASNGKTIE  338

Query  1400  VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVL  1579
             V +TDAEGRL LADALV+A KLGV+ +VDLATLTGACI ALG  +AG+FTP +DLA E+ 
Sbjct  339   VNNTDAEGRLTLADALVFAEKLGVDAIVDLATLTGACIVALGDEIAGLFTPHDDLANEIQ  398

Query  1580  EAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
              AA   GEK WR+P+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  399   AAAQTAGEKFWRLPMEEKYFEGLKSGIADMKNTGPRAGGSITAALFLK  446



>gb|EMS51906.1| Leucine aminopeptidase 2, chloroplastic [Triticum urartu]
Length=422

 Score =   357 bits (917),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 197/340 (58%), Positives = 243/340 (71%), Gaps = 33/340 (10%)
 Frame = +2

Query  707   GLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEV  886
             GL  E+      A   G V G +EDNR++ E     LK V+++GLG GPE++ +L+ ++ 
Sbjct  72    GLLSEASAEEDFAGKAGTVLGLYEDNRYRSESNKVHLKQVDLIGLGYGPEMDHRLELAKH  131

Query  887   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1066
             VSSGVIF K+LVN+PANVLTP  LAEEA  IAS+YSDV TATIL+ E+C+ELKMGS+L V
Sbjct  132   VSSGVIFGKDLVNSPANVLTPVVLAEEASKIASMYSDVFTATILNEERCRELKMGSYLAV  191

Query  1067  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1246
             AAA+ NP  FIHLCYKPS G+VK KLA++GKG+TFDSGGYN+KIGA  +IELMK DM G+
Sbjct  192   AAASANPPRFIHLCYKPSGGNVKRKLAIVGKGVTFDSGGYNIKIGAVCNIELMKWDMGGS  251

Query  1247  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGR  1426
             A VFGAAKA+ QIKP GV                                EV +TDAEGR
Sbjct  252   AAVFGAAKALGQIKPPGV--------------------------------EVDNTDAEGR  279

Query  1427  LILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEK  1606
             L LADALVYA K GV+K++DLATLTG C  ALG S+AGI TPS++L +EV  A++V GEK
Sbjct  280   LTLADALVYACKQGVDKIIDLATLTGFCRVALGPSIAGILTPSDELHEEVAAASEVSGEK  339

Query  1607  LWRMPLEESYWETMKSSIADMINAGSL-DGDAITASLFMK  1723
              WR+PLEESYWETMKS +ADM+N G++  G  ITA+LF+K
Sbjct  340   FWRLPLEESYWETMKSGVADMLNTGAIPQGGVITAALFLK  379


 Score = 99.0 bits (245),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  302  LGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKL  481
            LGLTKPN ++  ++  AA  ++  +W+GD+LAV VTEKD+ R P S F+N +L++LDS+L
Sbjct  11   LGLTKPNVVEPLQVSFAAIGIEPSDWEGDVLAVAVTEKDVCRSPGSSFENAVLKRLDSQL  70

Query  482  GGLLSEASSEEDFSGKSG  535
            GGLLSEAS+EEDF+GK+G
Sbjct  71   GGLLSEASAEEDFAGKAG  88



>emb|CEF97939.1| Leucine aminopeptidase/peptidase B [Ostreococcus tauri]
Length=506

 Score =   360 bits (923),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 216/448 (48%), Positives = 283/448 (63%), Gaps = 20/448 (4%)
 Frame = +2

Query  386   DILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGL  565
             D +   V E+D+  +  S  ++  L+  D++ GG +SE  +E +F GK+G S   R  G 
Sbjct  34    DAIVFAVCEEDVNAE-TSAIESEALRAFDARSGGAVSEMMAEGEFKGKAGSSAFSRARGG  92

Query  566   GSKRIGLVGLGSVVSSTIA-YRTLGETIaaaaksaqassvavalasaEGLSVESKLSAAS  742
              +K +G+VGLG      ++    LG T AA A+ ++ ++          L +       +
Sbjct  93    NAKHVGVVGLGKREERGVSVMMALGSTAAAHAQKSKCAT----------LGIAGAAGFEN  142

Query  743   AMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELV  922
             A+A G   G  +D RFK +P+  TLK+V +L      ++   +   +  + GV   KELV
Sbjct  143   AVAAGAYLGATDDQRFKSKPQAKTLKTVSLL------DVTADVSAGKARAVGVQLTKELV  196

Query  923   NAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIH  1102
              AP NV+TP ALAE AK IA+ +SD +T  IL+   C++L MGS+LGV+ A+  P  FIH
Sbjct  197   AAPPNVVTPTALAETAKEIAAKHSDCMTVKILEKADCEKLGMGSYLGVSEASDEPPKFIH  256

Query  1103  LCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQ  1282
             L YK  +GS   K+A++GKG+TFDSGGYNLK GA S IE+MK DM G+    GAAK IAQ
Sbjct  257   LTYK-GAGSDLKKVAVVGKGLTFDSGGYNLKAGAGSMIEMMKFDMGGSGATLGAAKIIAQ  315

Query  1283  IKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASK  1462
              KPAGVE HFI+ ACENMI   G+RPGDILTASNGK IEV +TDAEGRL LADALVYA K
Sbjct  316   TKPAGVEAHFIIAACENMIGSRGLRPGDILTASNGKTIEVNNTDAEGRLTLADALVYADK  375

Query  1463  -LGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYW  1639
               G   +VD ATLTGA I ALG  +AG+F+P +D AK V  AA   GE LWRMP+ +S W
Sbjct  376   TCGATAIVDCATLTGAIIVALGDEMAGLFSPKDDAAKRVEAAAKAAGEDLWRMPMPDSMW  435

Query  1640  ETMKSSIADMINAGSLDGDAITASLFMK  1723
               MKS IADM N G+  G +ITA+LF+K
Sbjct  436   AIMKSEIADMKNTGTRGGGSITAALFLK  463



>ref|WP_035153350.1| aminopeptidase A [Calothrix sp. 336/3]
 gb|KFB83598.1| aminopeptidase A [Calothrix sp. 336/3]
Length=491

 Score =   358 bits (920),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 230/458 (50%), Positives = 301/458 (66%), Gaps = 27/458 (6%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             L +W GD LAVG+ E+      +       L  LD KLGG ++E  +EE+F GK G  I 
Sbjct  10    LFDWTGDGLAVGLFEETTELTGD-------LVALDGKLGGAIAELIAEEEFKGKVGSLIS  62

Query  548   LRLPGLGS-KRIGLVGLGS---VVSSTIAYRTLGETIaaaaksaqassvavalasaEGLS  715
              R+ G  S +++ LVGLG    + + T+  R    T+A +A+  +  ++ + L    G +
Sbjct  63    TRISGNTSIRKVILVGLGKGEGLTAETL--RKTAATVAKSARKQKCKTLGIYLPIYNGDA  120

Query  716   VESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVV  889
                  + A A+  GI  G ++D RFK EP  K+P ++++++LGLG     E  +     +
Sbjct  121   A----TTAQAITEGIELGLYQDTRFKSEPEEKSPQIETIDLLGLGGQ---EAAITRGTQI  173

Query  890   SSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVA  1069
             +SGVI  ++LV APAN +TP  +A+ A  IA  Y   L  TIL+  +C++L MG+FLGVA
Sbjct  174   ASGVILARQLVAAPANEVTPITMADTASAIAKDYG--LELTILEQAECEQLGMGAFLGVA  231

Query  1070  AAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaa  1249
              A+  P  FIHL YKP  G+ + KLA++GKG+TFDSGG N+K GA S IE MK DM GAA
Sbjct  232   QASDLPPKFIHLTYKPQ-GTPRKKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGGAA  289

Query  1250  vvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRL  1429
                GAAKAIAQ+KP  VEVHFI    ENMISG  M PGDIL ASNGK IEV +TDAEGRL
Sbjct  290   ATLGAAKAIAQLKPD-VEVHFISAVTENMISGHAMHPGDILKASNGKTIEVNNTDAEGRL  348

Query  1430  ILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKL  1609
              LADALVYA KLGV+ MVDLATLTGAC+ ALG  +AG+FTP + LAKE+ +AAD GGEK+
Sbjct  349   TLADALVYADKLGVDAMVDLATLTGACVIALGDDIAGLFTPHDGLAKELEQAADKGGEKI  408

Query  1610  WRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             WRMP+E+ Y++ +KS IADM N G   G +ITASLF+K
Sbjct  409   WRMPMEDKYFDGLKSGIADMKNTGPRAGGSITASLFLK  446



>ref|WP_019494406.1| aminopeptidase A [Calothrix sp. PCC 7103]
Length=491

 Score =   357 bits (917),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 236/465 (51%), Positives = 301/465 (65%), Gaps = 27/465 (6%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEK--DMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             + A    LLEW GD LAVG+ E+  ++A D         L  LD KL G+L E  +EEDF
Sbjct  3     VRATNTPLLEWTGDGLAVGLFEEATELAGD---------LAALDEKLAGVLKELITEEDF  53

Query  521   SGKSGQSIVLRLPGLGS--KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvaval  694
              GK G + V R+ G GS  ++I LVGLG     T+   TL    AA A+ A+        
Sbjct  54    KGKLGSTAVTRV-GAGSPVRKIILVGLGK--PDTLKAETLRRAAAAIARLAKKQKCKTLG  110

Query  695   asaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKK  868
              S   +  +  +SA  A+  G+    ++D RFK EP  K P L++V++LGL      E  
Sbjct  111   ISLPVVDSDPAISA-QAITEGVQLALYQDIRFKSEPEDKGPQLETVDLLGLNGQ---EAA  166

Query  869   LKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKM  1048
             ++ +  ++SGV   ++LV APAN +TP  +AE A+ IA+ Y   L   IL+ E C++L M
Sbjct  167   IERANHIASGVFLARQLVAAPANAVTPITMAETAQTIANDYG--LQLQILEQEDCEKLGM  224

Query  1049  GSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMK  1228
             G+FLGVA A+  P  FIHL YKP  G+ K K+A++GKG+TFDSGG N+K GA S IE MK
Sbjct  225   GAFLGVAQASEIPPKFIHLTYKPE-GTPKRKVAIIGKGLTFDSGGLNIK-GAGSGIETMK  282

Query  1229  KDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTD  1408
              DM GAA   GAAKAI Q+KP  VEVHFI    ENMISG  M PGDILTASNGK IEV +
Sbjct  283   IDMGGAAATLGAAKAIGQLKP-DVEVHFISAVTENMISGRAMHPGDILTASNGKTIEVNN  341

Query  1409  TDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAA  1588
             TDAEGRL LADALVY  KLGV+ +VDLATLTGAC+ ALG  +AG+FTP ++LAK++ EA+
Sbjct  342   TDAEGRLTLADALVYTDKLGVDAIVDLATLTGACVIALGDDIAGLFTPDDNLAKQLEEAS  401

Query  1589  DVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
                GEKLWRMP+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  402   TSAGEKLWRMPMEEKYFEGLKSGIADMKNTGPRPGGSITAALFLK  446



>gb|AFW71516.1| hypothetical protein ZEAMMB73_883672 [Zea mays]
Length=321

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 192/277 (69%), Positives = 225/277 (81%), Gaps = 3/277 (1%)
 Frame = +2

Query  902   IFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAA-  1078
             +  ++LVN+PANVLTPGALAE A  IAS YSDV TATILD  +C+ELKMGS+L VAAA+ 
Sbjct  1     MLARDLVNSPANVLTPGALAEAAAKIASTYSDVFTATILDAAKCRELKMGSYLAVAAASE  60

Query  1079  TNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvf  1258
             TNP YFIHLCYKP  G V+ KLAL+GKGITFDSGGYN+K    ++IELMKKDM GAA VF
Sbjct  61    TNPPYFIHLCYKPRGGDVRRKLALVGKGITFDSGGYNIKAVPVATIELMKKDMGGAAAVF  120

Query  1259  gaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILA  1438
             GAA+ + QIKP GVEVHFI  A ENMISG+GMRPGDI+TASNGK IEV +TDAEGRL LA
Sbjct  121   GAAEVLGQIKPPGVEVHFISAASENMISGSGMRPGDIVTASNGKTIEVDNTDAEGRLTLA  180

Query  1439  DALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRM  1618
             DALVYA   GV+K++DLATLTGA   ALG S+AGI TPS++LA+E   A +V GEK WR+
Sbjct  181   DALVYACNQGVDKIIDLATLTGAIRVALGPSIAGILTPSDELAEEFAAAYEVSGEKFWRL  240

Query  1619  PLEESYWETMKSSIADMINAGSL--DGDAITASLFMK  1723
             P+EESYWE+M+SSIADM+ AG L     AITA+LF+K
Sbjct  241   PMEESYWESMESSIADMLCAGPLQPQAGAITAALFLK  277



>ref|WP_027842357.1| aminopeptidase A [Mastigocoleus testarum]
Length=492

 Score =   356 bits (914),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 223/466 (48%), Positives = 301/466 (65%), Gaps = 29/466 (6%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSG  526
             + A   + LEWKGD LA+G+ E   A +   +     L  LD KLGG+L E  +EE+F  
Sbjct  3     VRASNTNFLEWKGDALAIGLFED--ATELTGQ-----LTSLDEKLGGILKEIITEEEFKA  55

Query  527   KSGQSIVLRLPGLGS-KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasa  703
             K+G SI  R+PG+   K++ ++GLG++ S T+        +   A +  A +        
Sbjct  56    KAGSSIFTRVPGVSPIKKLLVIGLGTIESLTL-------EVLRKAAATAARNAKKQKCKT  108

Query  704   EGLSV----ESKLSAASAMATGIVSGTFEDNRFKLEPKTP--TLKSVEILGLGTGPEIEK  865
              G+S      +      A+A G+    ++DNRFK EP+T    ++ V++LGL      E 
Sbjct  109   LGISFPYGEHNPEDVTQALAEGVQLALYQDNRFKSEPETKETQVEEVDLLGLADN---EA  165

Query  866   KLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELK  1045
              +  +  + SGV   ++LV APAN LTP  +AE A+ IAS ++  L   IL+ + C++L 
Sbjct  166   AIVRANQICSGVFLARQLVAAPANDLTPVTMAEIAQEIASTHN--LELEILEQKDCEKLG  223

Query  1046  MGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELM  1225
             MG+FLGVA A+  P  FIHL YKP + + + KLA++GKG+TFDSGG N+K GA S IE M
Sbjct  224   MGAFLGVAKASDLPPKFIHLTYKPQA-TPRRKLAIIGKGLTFDSGGLNIK-GAGSGIETM  281

Query  1226  KKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVT  1405
             K DM GAA   GAAKAI Q++P  VEVHFI  A ENMISG  M PGDIL ASNGK IEV 
Sbjct  282   KIDMGGAAATLGAAKAIGQLQP-DVEVHFISAATENMISGHAMHPGDILKASNGKTIEVN  340

Query  1406  DTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEA  1585
             +TDAEGRL LADALV+A KLG++ +VDLATLTGAC+ ALG  +AG+FTPS++LA E+ +A
Sbjct  341   NTDAEGRLTLADALVFADKLGLDAIVDLATLTGACVVALGNDIAGLFTPSDELASELEKA  400

Query  1586  ADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             A+  GEK+WRMP+E+ Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  401   AEGAGEKIWRMPMEDKYFEGLKSGIADMKNTGPRAGGSITAALFLK  446



>ref|WP_013191100.1| aminopeptidase A [Trichormus azollae]
 ref|YP_003721206.1| leucyl aminopeptidase ['Nostoc azollae' 0708]
 gb|ADI64083.1| Leucyl aminopeptidase ['Nostoc azollae' 0708]
Length=490

 Score =   356 bits (913),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 231/460 (50%), Positives = 304/460 (66%), Gaps = 31/460 (7%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEK--DMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQS  541
             LL+W GD LAVG+ E   D+  D         L  L+  LGGLL E  +EE+F+GK+  +
Sbjct  10    LLDWTGDTLAVGLFEDAVDLTGD---------LAILNDNLGGLLKELIAEEEFTGKANST  60

Query  542   IVLRL-PGLGSKRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEGLS  715
             IV R+  G   +++ LVGLG   +  +   R L  T+A  AK  +  ++A++      L 
Sbjct  61    IVARVGAGHPVRKVILVGLGKPDALKLETLRCLAATVARTAKKQKTKTLAIS------LP  114

Query  716   VESKLSAAS--AMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSE  883
             V +   AA+  A+A G     ++D RFK EP  K P ++++++LGLG     E  +  +E
Sbjct  115   VWNNDQAATGQAIAEGTQLALYQDIRFKSEPEDKNPPIETIDLLGLGGQ---EAAITRAE  171

Query  884   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLG  1063
              + SGVI  ++LV APAN +TP  +AE AK IA  +   L   IL+ E+C++L MG+FLG
Sbjct  172   QIVSGVILARQLVAAPANAVTPITMAETAKAIAKDHG--LHLEILEQEECEKLGMGAFLG  229

Query  1064  VAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMag  1243
             VA A+  P  FIHL YKP++ + K KLA++GKG+TFDSGG N+K GA S IE MK DM G
Sbjct  230   VAQASDLPPKFIHLIYKPAT-TPKRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGG  287

Query  1244  aavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEG  1423
             AA   GAAKAI Q+KP  VEVHFI    ENMISG  MRPGDILTASNGK IEV +TDAEG
Sbjct  288   AAATLGAAKAIGQLKP-DVEVHFISAVTENMISGRAMRPGDILTASNGKTIEVNNTDAEG  346

Query  1424  RLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGE  1603
             RL LADALVYA KLGV+ +VDLATLTGAC+ ALG  +AG+FTP + +A ++  A++  GE
Sbjct  347   RLTLADALVYADKLGVDAIVDLATLTGACVVALGDDIAGLFTPDDAVASQLQTASESAGE  406

Query  1604  KLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             KLWR+P+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  407   KLWRLPMEEKYFEGLKSGIADMKNTGPRYGGSITAALFLK  446



>ref|WP_015217123.1| cytosol aminopeptidase [Anabaena cylindrica]
 ref|YP_007159418.1| cytosol aminopeptidase [Anabaena cylindrica PCC 7122]
 gb|AFZ60508.1| cytosol aminopeptidase [Anabaena cylindrica PCC 7122]
Length=490

 Score =   355 bits (910),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 225/456 (49%), Positives = 297/456 (65%), Gaps = 23/456 (5%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             LL+W GD LA+ + E  +    +       L  LD K GG+L E  +EE+F+GK   +IV
Sbjct  10    LLDWTGDTLAIALFEDAVELTGD-------LATLDEKCGGILKELIAEEEFTGKLNSTIV  62

Query  548   LRL-PGLGSKRIGLVGLGSV-VSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVE  721
             +R   G   +++ LVGLG   V      R +  T+A  AK  +  ++A++L         
Sbjct  63    MRAGAGHPVRKVILVGLGKPEVLKLETLRRVAATVARTAKKQKTKTLAMSLPVWN----N  118

Query  722   SKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVVSS  895
                + A A+A G     ++D RFK EP  K P ++++++LGLG     E  +  +E + S
Sbjct  119   DPTATAQAIAEGTQLALYQDTRFKSEPEDKNPQIETIDLLGLGGQ---EAAITRAEQIVS  175

Query  896   GVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAA  1075
             GVI  ++LV APAN +TP  +AE A  IA  Y   L   IL+ E+C++L MG+FLGVA A
Sbjct  176   GVILARQLVAAPANAVTPITMAETAIAIAKDYG--LEIQILEKEECEKLGMGAFLGVAQA  233

Query  1076  ATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavv  1255
             +  P  FIHL YKP +G+ K KLA++GKG+TFDSGG N+K GA S IE MK DM GAA  
Sbjct  234   SDLPPKFIHLTYKP-AGTPKRKLAIIGKGVTFDSGGLNIK-GAGSGIETMKMDMGGAAAT  291

Query  1256  fgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLIL  1435
              GAAKAI Q+KP  VEVHFI    ENMISG  MRPGDILTASNGK IEV +TDAEGRL L
Sbjct  292   LGAAKAIGQLKP-DVEVHFISAVTENMISGRAMRPGDILTASNGKTIEVNNTDAEGRLTL  350

Query  1436  ADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWR  1615
             ADALVYA KLGV+ +VDLATLTGAC+ ALG  +AG+FTP + +A ++  A++ GGEK+WR
Sbjct  351   ADALVYADKLGVDAIVDLATLTGACVVALGDDIAGLFTPDDAVASQLQTASEAGGEKIWR  410

Query  1616  MPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             MP+E+ Y++ +KS IADM N G   G +ITA+LF+K
Sbjct  411   MPMEDKYFDGLKSGIADMKNTGPRYGGSITAALFLK  446



>ref|WP_037216500.1| hypothetical protein [Richelia intracellularis]
 emb|CDN10349.1| Cytosol aminopeptidase PepA [Richelia intracellularis]
Length=490

 Score =   354 bits (908),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 226/464 (49%), Positives = 305/464 (66%), Gaps = 26/464 (6%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSG  526
             + A    L++W GD LA+G+ E  +    +       L+ L+ KL G + E  +EE+F G
Sbjct  3     VKASNTPLVQWTGDGLAIGLFEDHLELTSD-------LEALNDKLAGTIQELITEEEFKG  55

Query  527   KSGQSIVLRLPGLGS--KRIGLVGLGSVVSSTIA-YRTLGETIaaaaksaqassvavala  697
             K+G +I  R+ G GS  +++ +VGLG      +   R  G +I+   K  +  ++A++L 
Sbjct  56    KAGSTIFTRVGG-GSQVRKLIVVGLGKAEDLNLERLRGAGASISRLGKKQKCKTLAISLP  114

Query  698   saEGLSVESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKL  871
                  +  S    A A+A G+  G +ED RFK +P  K  T+++V++LGL      +  +
Sbjct  115   -----TCNSPAETAQAIAEGVELGLYEDTRFKSDPEDKKTTVETVDLLGLAGQ---KTAI  166

Query  872   KYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMG  1051
               ++ + SGVI  KELV APAN +TP  +AE A+++A+     L   IL+ E+C++L MG
Sbjct  167   ALAQKICSGVILAKELVAAPANEVTPVTMAETAQSLATECG--LHLEILEQEECEKLGMG  224

Query  1052  SFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKK  1231
             +FLGVA A+  P  FIHL YKP  GS + KLA++GKG+TFDSGG N+K GANS IE MK 
Sbjct  225   AFLGVAKASDLPPKFIHLTYKPQ-GSPRRKLAIIGKGLTFDSGGLNIK-GANSGIETMKI  282

Query  1232  DMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDT  1411
             DMAGA   FGAAKAI QIKP  VEVHF+    ENMISG  M PGDIL ASNGK IEV +T
Sbjct  283   DMAGAGATFGAAKAIGQIKP-DVEVHFVSAVTENMISGHAMHPGDILKASNGKTIEVNNT  341

Query  1412  DAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAAD  1591
             DAEGRL LADALV+  KLGV+ +VDLATLTGAC+ ALG  +AG+FTP+++LAKE+  A D
Sbjct  342   DAEGRLTLADALVFTDKLGVDAIVDLATLTGACVVALGNDIAGMFTPNDELAKELDAAGD  401

Query  1592  VGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
               GEKLWRMP+E+ Y+E +KSSIADM N G   G +I+A+LF+K
Sbjct  402   KAGEKLWRMPMEDKYFEGLKSSIADMKNTGPRPGGSISAALFLK  445



>ref|WP_017315758.1| aminopeptidase A [Mastigocladopsis repens]
Length=500

 Score =   354 bits (909),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 230/467 (49%), Positives = 295/467 (63%), Gaps = 31/467 (7%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSG  526
             I   +  LL+W GD LA+G+ E  +            L  LD  L G + E  +EE+F G
Sbjct  3     IRGTDTPLLKWTGDGLAIGLFEDAVELTGE-------LATLDENLAGSIKELITEEEFKG  55

Query  527   KSGQSIVLRLPGLGS--KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalas  700
             K G SIV R+ G GS  ++I LVGLG   + TI      ET+  AA      +      +
Sbjct  56    KQGSSIVTRV-GAGSPVRKIILVGLGKPEALTI------ETLRRAAAVVGRLAKKQKCRT  108

Query  701   aEGLSV----ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIE  862
               G+S+      +   A A+A G+    ++DNRFK EP  K P ++ V++LGLG     E
Sbjct  109   L-GISLPIWNNDRAQTAQALAEGVQLALYQDNRFKSEPEDKGPQVEQVDLLGLGGQ---E  164

Query  863   KKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKEL  1042
               +  +  +SSGV   ++LV APAN +TP  +AE A  IAS +S  L   IL+ E C+ L
Sbjct  165   AAITRANQISSGVFLARQLVAAPANSVTPITMAETAVAIASEHS--LQVEILEQEDCERL  222

Query  1043  KMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIEL  1222
              MG+FLGVA A+  P  FIHL YKP+ G+ K K+A++GKG+TFDSGG N+K GA S IE 
Sbjct  223   GMGAFLGVAKASELPPKFIHLTYKPA-GAPKRKIAIIGKGVTFDSGGLNIK-GAGSGIET  280

Query  1223  MKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEV  1402
             MK DM GAA   GAAKAI Q+KP  VEVHFI    ENMISG  M PGDILTASNGK IEV
Sbjct  281   MKMDMGGAAATLGAAKAIGQLKP-DVEVHFISAVTENMISGHAMHPGDILTASNGKTIEV  339

Query  1403  TDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLE  1582
              +TDAEGRL LADALV+A KLGV+ +VDLATLTGACI ALG  +AG+F+P + LA ++ +
Sbjct  340   NNTDAEGRLTLADALVFAEKLGVDAIVDLATLTGACIIALGDEIAGLFSPDDALAGQLQK  399

Query  1583  AADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             A +  GEK WR+P+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  400   AGETAGEKFWRLPMEEKYFEGLKSGIADMKNTGPRAGGSITAALFLK  446



>ref|WP_015156822.1| leucyl aminopeptidase [Chroococcidiopsis thermalis]
 ref|YP_007094151.1| leucyl aminopeptidase [Chroococcidiopsis thermalis PCC 7203]
 gb|AFY90282.1| leucyl aminopeptidase [Chroococcidiopsis thermalis PCC 7203]
Length=491

 Score =   353 bits (907),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 230/469 (49%), Positives = 298/469 (64%), Gaps = 35/469 (7%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSG  526
             I A +  LL+W GD LA+G+ E  +            L +LD K  G ++E  ++ +F  
Sbjct  3     IRAIDTPLLDWAGDALALGLFEDAVELTGE-------LAELDGKFAGAIAELIADTEFKA  55

Query  527   KSGQSIVLRLPGLGS--KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalas  700
             K G + V R+ G GS  +++ LVGLG         +  G  I +  K+A A +       
Sbjct  56    KEGSTAVTRVSG-GSAVRKVILVGLG---------KPDGLKIDSWRKAAAAVARLAKKER  105

Query  701   aEGLSV------ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPE  856
              + L +          + A A+A GI    F+DNRFK EP  K PT++ V++LGLG+   
Sbjct  106   CKTLGISLPAWNNDPTATAQALAEGIQLALFQDNRFKSEPEEKPPTVERVDLLGLGSQ--  163

Query  857   IEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCK  1036
              +  +  +  ++SGVI  +ELV APAN +TP  +AE A+ IAS +   L   IL+ E C+
Sbjct  164   -DDAVTRASQIASGVILARELVAAPANAVTPVTMAETAQAIASEHG--LAVEILEREDCE  220

Query  1037  ELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSI  1216
             +L MG+FLGVA A+  P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K GA S I
Sbjct  221   KLGMGAFLGVAQASELPPKFIHLTYKPD-GTPKRKLAIIGKGLTFDSGGLNIK-GAGSGI  278

Query  1217  ELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRI  1396
             E MK DM GAA   GAAKAIAQ+KP  VEVHFI  A ENMISG  M PGDIL ASNGK I
Sbjct  279   ETMKMDMGGAAATLGAAKAIAQLKP-DVEVHFISAATENMISGRAMHPGDILKASNGKTI  337

Query  1397  EVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEV  1576
             EV +TDAEGRL LADALV+A KLGV+ +VDLATLTGACI ALG  +AG+FTP + LA E+
Sbjct  338   EVNNTDAEGRLTLADALVFAEKLGVDAIVDLATLTGACIVALGDEIAGLFTPHDALAHEI  397

Query  1577  LEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
               AA++ GEK WR+P+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  398   QAAAEIAGEKFWRLPMEEKYFEGLKSGIADMKNTGPRAGGSITAALFLK  446



>ref|WP_002766908.1| aminopeptidase A [Microcystis aeruginosa]
 emb|CCI01558.1| putative cytosol aminopeptidase [Microcystis aeruginosa PCC 9443]
Length=490

 Score =   352 bits (904),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 228/463 (49%), Positives = 290/463 (63%), Gaps = 25/463 (5%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEK--DMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             I + +  LL W GD LA+G+ E   ++A +         L +L+ KLGG L +  SE +F
Sbjct  3     IRSTDTSLLTWTGDTLALGLPEGAIEIAGE---------LAELNDKLGGNLEDLISETEF  53

Query  521   SGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalas  700
              GK G S   RL G   +++ LVGLG      +    L     A     Q S        
Sbjct  54    EGKLGSSAATRLGGGPIRKLILVGLGKTTDFDLQTLRLAAAAIARLAKQQKSQALAISLP  113

Query  701   aEGLSVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLK  874
               G     + + A A+A G++  T +D RFK   E K   L++VE+LGLG   E    + 
Sbjct  114   VVG----DQSATAGAIAEGLLLATHQDTRFKSTKEEKGVKLETVELLGLG---EQTSAIA  166

Query  875   YSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGS  1054
              +E + SGVI  +ELVNAPAN +TP  +AE A+ IA+ Y   L+  IL+ E+C+ L MG+
Sbjct  167   KAEQICSGVILARELVNAPANTVTPLTMAETAEQIAAEYG--LSLKILEQEECESLGMGA  224

Query  1055  FLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKD  1234
             FLGVA A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK D
Sbjct  225   FLGVAKASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMD  282

Query  1235  MagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTD  1414
             M G A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IEV +TD
Sbjct  283   MGGGAATLGAAKAIAQLRPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIEVNNTD  341

Query  1415  AEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADV  1594
             AEGRL LADALV+A KL V+ +VDLATLTGAC+ ALG  +AG+++  E LA ++ EAA +
Sbjct  342   AEGRLTLADALVFAEKLEVDAIVDLATLTGACVVALGEDIAGLWSSDESLAAQIQEAAKL  401

Query  1595  GGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
              GEK W MPLEE Y+E MKS IADM N G   G +ITA+LF+K
Sbjct  402   AGEKFWPMPLEEKYFEGMKSQIADMKNTGPRPGGSITAALFLK  444



>ref|WP_008318986.1| leucyl aminopeptidase [Leptolyngbya sp. PCC 6406]
Length=491

 Score =   352 bits (902),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 227/454 (50%), Positives = 294/454 (65%), Gaps = 20/454 (4%)
 Frame = +2

Query  371   LEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVL  550
             L W GD LA+GV + D+  D        +L ++D +  GL+ E   E DF GKSG S ++
Sbjct  11    LTWTGDCLALGVLDTDLPLDG-------LLAEMDGQFSGLVQELIDETDFKGKSGTSAII  63

Query  551   RLPGLGS-KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESK  727
             RL   G  +++ LVGLG+    T+    L    A AA+ ++     +   S    S+E+ 
Sbjct  64    RLGSGGPVRKLALVGLGAAADLTV--DGLRRATAIAARLSKKEKCKILGLSLPLGSLETA  121

Query  728   LSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGV  901
             + AA A+A GI     ED RFK EP  K  TL+ V++LGL    +    ++  + ++SGV
Sbjct  122   I-AAQAIAEGITLTLHEDTRFKSEPDPKAFTLERVDLLGLA---QQAASVQRGQQIASGV  177

Query  902   IFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAAT  1081
             I  +ELV AP NV+TP  LA+ A+ IA  +   LT  IL+   C  L MG+FLGVA A+ 
Sbjct  178   ILARELVAAPPNVVTPQVLADTAQAIADDHG--LTVEILEQAACAALGMGAFLGVAQASD  235

Query  1082  NPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfg  1261
              P  FIHL Y+PSS   + KLA++GKG+TFDSGG N+K GA S IELMK DM GAA   G
Sbjct  236   LPPKFIHLTYRPSS-PPRRKLAIVGKGLTFDSGGLNIKAGAGSMIELMKFDMGGAAATLG  294

Query  1262  aakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILAD  1441
             AAKAIAQ++P  VEVHFI  A ENMISG  MRPGDILTASNGK IEV +TDAEGRL LAD
Sbjct  295   AAKAIAQLQP-DVEVHFISAAAENMISGGAMRPGDILTASNGKTIEVNNTDAEGRLTLAD  353

Query  1442  ALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMP  1621
             ALV+A KL V+ +VDLATLTGACI ALG ++AG+++ S +LA  +  A+ V GEK W MP
Sbjct  354   ALVFAEKLEVDAIVDLATLTGACIVALGENIAGLWSSSNELATAIQSASTVAGEKFWTMP  413

Query  1622  LEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             LE+ Y++ +KS +ADM N G   G AITA+LF+K
Sbjct  414   LEDQYFDGLKSIVADMKNTGPRFGGAITAALFLK  447



>ref|WP_015185013.1| leucyl aminopeptidase [Microcoleus sp. PCC 7113]
 ref|YP_007124286.1| leucyl aminopeptidase [Microcoleus sp. PCC 7113]
 gb|AFZ20880.1| leucyl aminopeptidase [Microcoleus sp. PCC 7113]
Length=492

 Score =   351 bits (901),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 233/467 (50%), Positives = 300/467 (64%), Gaps = 31/467 (7%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSG  526
             I A +   +EW GD LAVG+ E+      +       L +LD KLGG L E   E +F G
Sbjct  3     IRATDTPRIEWTGDALAVGLLEEATTLTGD-------LAQLDEKLGGTLQELIEETEFKG  55

Query  527   KSGQSIVLRLPGLGS--KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalas  700
              +G + V R+ G+GS  ++I LVGLG     T++  +L    AA A++A+   +      
Sbjct  56    SAGSTAVTRV-GVGSSIRKIILVGLGK--PDTLSLNSLRRAAAAIARTAKQQKIKTL---  109

Query  701   aEGLSV----ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIE  862
               G+S+    E + +   A+  GIV    +DNRFK EP  K   L+ VE+LGLG     E
Sbjct  110   --GISLPVVNEDQAATTQAITEGIVLALHQDNRFKSEPEDKGAKLEQVELLGLGNQ---E  164

Query  863   KKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKEL  1042
               +  +  + SGVI  +ELV APAN++TP +LAE A+ IAS Y   L+  +L+ E C++L
Sbjct  165   TAINRAHGICSGVILARELVAAPANIVTPISLAETAEAIASQYG--LSLEVLEWEDCEKL  222

Query  1043  KMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIEL  1222
              MG+FLGVA A+  P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K GA S IE 
Sbjct  223   GMGAFLGVAQASEMPPKFIHLTYKPE-GTAKRKLAIVGKGLTFDSGGLNIK-GAGSGIET  280

Query  1223  MKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEV  1402
             MK DM GAA   GAAKAI  +KP  VEVHFI  A ENMISGT M PGDILTASNGK IEV
Sbjct  281   MKMDMGGAAATLGAAKAIGHLKP-DVEVHFISAATENMISGTAMHPGDILTASNGKTIEV  339

Query  1403  TDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLE  1582
              +TDAEGRL LADALV+A KLGV+ +VDLATLTGACI ALG  + GI+   + +A ++  
Sbjct  340   NNTDAEGRLTLADALVFAEKLGVDAIVDLATLTGACIVALGNDIGGIWATDDTVASQLKA  399

Query  1583  AADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             AA+  GEK W+MP+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  400   AAEAAGEKFWQMPMEEKYFEGLKSPIADMKNTGPRAGGSITAALFLK  446



>ref|WP_017294075.1| hypothetical protein [Geminocystis herdmanii]
Length=490

 Score =   351 bits (900),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 231/456 (51%), Positives = 300/456 (66%), Gaps = 25/456 (5%)
 Frame = +2

Query  371   LEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVL  550
             L W GD LA+G     +    + K        LD KL G +SE  +E +F GKSG + + 
Sbjct  11    LNWSGDALAIGFFADKVELTGDLKL-------LDQKLDGTISELIAETEFKGKSGTTSIE  63

Query  551   RLPGLGS-KRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEGLSVES  724
             R+ G  + ++I LVGLG     T+ ++R  G +IA  AK A+  ++++AL   +G   E 
Sbjct  64    RIGGKNALRKIILVGLGKEEDLTLDSFRQAGGSIARVAKQAKLKTLSIALNH-DGYDNEI  122

Query  725   KLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPE-IEKKLKYSEVVSS  895
                 A  ++ G++    +DNRFK   E +  TL+++E+L L   P+ IEK    +E ++S
Sbjct  123   ---LAQVISEGVILALHQDNRFKSDTENQKITLETIELLDLPASPQAIEK----AEKIAS  175

Query  896   GVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAA  1075
             GVI  +ELVNAPAN L P  +AE A+N+AS Y   L  TIL+ E C++L MG+FLGVA A
Sbjct  176   GVILARELVNAPANALNPVTMAEMAENLASEYG--LELTILEQEDCEKLGMGAFLGVAKA  233

Query  1076  ATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavv  1255
             +  P  FIHL YKP + + K KLA++GKG+TFDSGG NLK+ + S IE MK DM GAA  
Sbjct  234   SDLPPKFIHLVYKPQN-TPKRKLAIVGKGLTFDSGGLNLKV-SGSGIETMKMDMGGAAAT  291

Query  1256  fgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLIL  1435
             FGAAKAIAQ+KP  VE+HFI    ENMISG  M PGDIL ASN K IEV +TDAEGRL L
Sbjct  292   FGAAKAIAQLKP-DVEIHFISAVTENMISGKAMHPGDILIASNDKTIEVNNTDAEGRLTL  350

Query  1436  ADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWR  1615
             ADALVY  KLGV+ MVDLATLTGACI ALG  +AG++T  +DLA ++  +A   GEK W+
Sbjct  351   ADALVYTDKLGVDAMVDLATLTGACIVALGNDIAGLWTSDDDLATQLKASAQTAGEKFWQ  410

Query  1616  MPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             MPLE  Y+E MKSSIADM N GS  G +ITA+LF++
Sbjct  411   MPLETKYFEQMKSSIADMKNTGSRAGGSITAALFLQ  446



>ref|WP_026734312.1| aminopeptidase A [Fischerella sp. PCC 9605]
Length=493

 Score =   350 bits (899),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 232/462 (50%), Positives = 292/462 (63%), Gaps = 35/462 (8%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEK--DMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQS  541
             LLEW GD LA+G  E   D+  +         L  LD K  G L E  +EE+F GK+G S
Sbjct  10    LLEWGGDGLAIGFFEDGVDLTGE---------LAALDEKFAGCLKELIAEEEFKGKTGSS  60

Query  542   IVLRLPGLGS--KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLS  715
             +  R+ G GS  ++I LVGLG      +   TL    A  A+ A+            G+S
Sbjct  61    VFTRV-GSGSPVRKIMLVGLGK--PEAVKLDTLRRAAAVVARIAKKQKCKTL-----GIS  112

Query  716   V----ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKY  877
             +          A A+A G+    ++DNRFK EP  K   L++VE+LGLG     E  + +
Sbjct  113   LPVWNNDPAQTAQALAEGVQLSLYQDNRFKSEPEDKGAQLETVELLGLGGQ---EAAITH  169

Query  878   SEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSF  1057
             +  + SGVI  ++LV APAN +TP  +AE A  IAS +   L   IL+ E C++L MG+F
Sbjct  170   ANQICSGVILARQLVAAPANEVTPITMAETAMAIASEHG--LQVEILEQEDCEKLGMGAF  227

Query  1058  LGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDM  1237
             LGVA A+  P  FIHL YKP + + K KLA++GKG+TFDSGG N+K GA S IE MK DM
Sbjct  228   LGVAKASDLPPKFIHLTYKPEA-TPKRKLAIIGKGLTFDSGGLNIK-GAGSGIENMKIDM  285

Query  1238  agaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDA  1417
              GAA   GAAKAI Q+KP  VEVHFI    ENMISG  M PGDIL ASNGK IEV +TDA
Sbjct  286   GGAAATLGAAKAIGQLKP-DVEVHFISAVTENMISGRAMHPGDILKASNGKTIEVNNTDA  344

Query  1418  EGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVG  1597
             EGRL LADALV+A KLGV+ +VDLATLTGAC+ ALG  +AG+FTP + LAK++  AA+  
Sbjct  345   EGRLTLADALVFADKLGVDAIVDLATLTGACVIALGDEIAGLFTPDDALAKQLETAAESA  404

Query  1598  GEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             GEK+WRMP+EE Y+E MKS IADM N G   G +ITA+LF+K
Sbjct  405   GEKIWRMPMEEKYFEGMKSGIADMKNTGPRPGGSITAALFLK  446



>ref|WP_018397622.1| aminopeptidase A [filamentous cyanobacterium ESFC-1]
Length=485

 Score =   350 bits (897),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 227/469 (48%), Positives = 293/469 (62%), Gaps = 40/469 (9%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSG  526
             I A     L+W+G+ LA+GV E D                LD +LGG+L+E  +E +F G
Sbjct  3     ITAVSTSELKWEGETLALGVFEGDTE-----------CADLDKRLGGVLAEVMAEAEFEG  51

Query  527   KSGQSIVLRLPGLGS--KRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavala  697
             KSG S+V R+ G  S  +++ LVGLG      +   R+   +I          +      
Sbjct  52    KSGSSVVTRV-GSSSPIRKVILVGLGKAEDWQLEGMRSAAASI----------ARLAKQN  100

Query  698   saEGLSV-----ESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLK--SVEILGLGTGPE  856
               +GL V     ES  + ASA+A GI+     D RFK EP+   LK  +VEILG+    +
Sbjct  101   YVKGLGVCLPPLESDNATASAIAQGIILALHSDRRFKSEPEEQKLKLETVEILGINDAGD  160

Query  857   IEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCK  1036
                 +  +E +SSG I  +ELV APAN +TP  LAE A+ +A+ Y   L   IL+  +C+
Sbjct  161   ---AIAQAEALSSGTILARELVAAPANSVTPITLAETAQQLAADYG--LELEILEKAECE  215

Query  1037  ELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSI  1216
             +L MG++LGVA A+  P  FIHL YKP S + + KLA++GKG+TFDSGG NLK G  S I
Sbjct  216   KLGMGAYLGVAQASDLPPKFIHLTYKPQS-TPRRKLAIVGKGLTFDSGGLNLKTG-GSGI  273

Query  1217  ELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRI  1396
             E MK DM GA    GAAKAI QIKP  VEVHFIV A ENMISG  M PGDILTASNGK I
Sbjct  274   ETMKMDMGGAGATLGAAKAIGQIKP-DVEVHFIVAATENMISGHAMHPGDILTASNGKTI  332

Query  1397  EVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEV  1576
             EV +TDAEGRL LADALV+A KL V+ +VDLATLTGAC+ ALG ++AG+++  + LA E+
Sbjct  333   EVNNTDAEGRLTLADALVFAEKLEVDAIVDLATLTGACMVALGNNIAGLWSTDDTLADEL  392

Query  1577  LEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
              +AA+  GEK W+MP+EE Y+E MKS  ADM N G   G +ITA+LF+K
Sbjct  393   KKAAEAAGEKFWQMPIEEKYFEGMKSQYADMKNTGPRAGGSITATLFLK  441



>ref|WP_002782251.1| putative cytosol aminopeptidase [Microcystis aeruginosa]
 emb|CCI12027.1| putative cytosol aminopeptidase [Microcystis aeruginosa PCC 9806]
Length=491

 Score =   350 bits (897),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 229/464 (49%), Positives = 290/464 (63%), Gaps = 26/464 (6%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEK--DMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             I + +  LL W GD LA+G+ E   ++A +         L +L+ KLGG L +  SE +F
Sbjct  3     IRSTDTSLLTWTGDTLALGLPEGAIEIAGE---------LAELNDKLGGNLGDLISETEF  53

Query  521   SGKSGQSIVLRLPGLGS-KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  697
              GK G S   RL G G  +++ LVGLG      +    L     A     Q S       
Sbjct  54    EGKLGSSAATRLGGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISL  113

Query  698   saEGLSVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKL  871
                G     + + A A+  G++  T +D RFK   E K   L++VE+LGLG   E    +
Sbjct  114   PVVG----DQSATAGAITEGLLLATHQDTRFKSTKEEKGAKLETVELLGLG---EQTSAI  166

Query  872   KYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMG  1051
               +E + SGVI  +ELVNAPAN +TP  +AE A+ IAS Y   L+  IL+ E+C+ L MG
Sbjct  167   AKAEQICSGVILARELVNAPANTVTPLTMAETAEQIASEYG--LSLKILEQEECESLGMG  224

Query  1052  SFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKK  1231
             +FLGVA A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK 
Sbjct  225   AFLGVAKASDIPPKFLHLIYKPE-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKM  282

Query  1232  DMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDT  1411
             DM G A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IEV +T
Sbjct  283   DMGGGAATLGAAKAIAQLQPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIEVNNT  341

Query  1412  DAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAAD  1591
             DAEGRL LADALV+A KL V+ +VDLATLTGAC+ ALG  +AG+++  E LA ++ EAA 
Sbjct  342   DAEGRLTLADALVFAEKLEVDAIVDLATLTGACVVALGDDIAGLWSSDESLAAQIQEAAK  401

Query  1592  VGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             + GEK W MPLEE Y+E MKS IADM N G   G +ITA+LF+K
Sbjct  402   LAGEKFWPMPLEEKYFEGMKSQIADMKNTGPRPGGSITAALFLK  445



>ref|WP_035993085.1| aminopeptidase A [Leptolyngbya sp. KIOST-1]
Length=496

 Score =   350 bits (898),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 225/454 (50%), Positives = 303/454 (67%), Gaps = 20/454 (4%)
 Frame = +2

Query  371   LEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVL  550
             L+W GD L +G++E  +   P S      L +L+S++ GLL E   E +F+GK+G + + 
Sbjct  11    LDWSGDALILGLSEAAL---PLSG----TLAELNSQVAGLLQELIDEVEFTGKAGSTAIT  63

Query  551   RL-PGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESK  727
             R+  G   +++G+VGLG++    I   TL    AAAA+ A+    A    S   L  ++ 
Sbjct  64    RVGTGANIRKLGIVGLGAI--DAITGDTLRRAAAAAARLAKKEKCASLGLSFPNLQHDAA  121

Query  728   LSAASAMATGIVSGTFEDNRFKLEPKT--PTLKSVEILGLGTGPEIEKKLKYSEVVSSGV  901
             L+A  A+A G +    +DNRFK E K   PT++ + IL L    +    L+ ++ +  GV
Sbjct  122   LTA-QAIAEGAILALHQDNRFKSEDKNGKPTVEHIHILDLAG--QDSSSLQTAQAICDGV  178

Query  902   IFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAAT  1081
             I  +ELV+APAN++TP  LA+ A+ IAS +   L   IL+ EQC+ L MG++LGVA A+ 
Sbjct  179   ILARELVSAPANIVTPELLAQTAQEIASAHG--LELEILEREQCEALGMGAYLGVARASD  236

Query  1082  NPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfg  1261
              P  FIHL YKP+ G+   KLA++GKG+TFDSGG N+K GA S IE+MK DM GAA   G
Sbjct  237   LPPKFIHLTYKPT-GTPTRKLAIVGKGLTFDSGGLNIK-GAGSGIEMMKIDMGGAAATLG  294

Query  1262  aakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILAD  1441
             AAKAIAQ+KP+  EVHFI  A ENMISG  MRPGDILTASNGK IEV +TDAEGRL LAD
Sbjct  295   AAKAIAQLKPS-AEVHFISAAAENMISGNAMRPGDILTASNGKTIEVNNTDAEGRLTLAD  353

Query  1442  ALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMP  1621
             ALV+A KLGV+ +VDLATLTGACI ALG  +AG+F+ +E+LA+ +  AA   GEK WR+P
Sbjct  354   ALVFAEKLGVDAIVDLATLTGACIIALGDDIAGLFSENEELAEAIATAAKTAGEKFWRLP  413

Query  1622  LEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +EE Y++ +KS +ADM N G   G +ITA+LF+K
Sbjct  414   MEEKYFDGLKSIVADMKNTGPRPGGSITAALFLK  447



>ref|WP_029634482.1| aminopeptidase A [[Scytonema hofmanni] UTEX B 1581]
Length=490

 Score =   350 bits (897),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 226/456 (50%), Positives = 299/456 (66%), Gaps = 23/456 (5%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             LLEWKGD LA+G+ E  +            L  LD K+GG+L E  +EE+F GK+G SI 
Sbjct  10    LLEWKGDGLAIGLFEDAVELSGE-------LATLDEKIGGILKELIAEEEFKGKAGSSIS  62

Query  548   LRLPGLGS-KRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEGLSVE  721
              RL G  S +++ +VGLG   +  + + R    ++A  AK  +  ++A+ L         
Sbjct  63    TRLGGDRSVRKLIVVGLGKPDALKLDSLRRAAASMARLAKKQKCKTLAIDLPVWN----N  118

Query  722   SKLSAASAMATGIVSGTFEDNRFKLE--PKTPTLKSVEILGLGTGPEIEKKLKYSEVVSS  895
             +  + A A+A GI    ++D RFK E   K P +++V +LGLG     E  +  +  ++S
Sbjct  119   NPEATAQAIAEGIELALYQDTRFKSENEDKGPQVETVHLLGLGGQ---EAAITRANQITS  175

Query  896   GVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAA  1075
             GVI  ++LV APAN +TP  +AE A+ IA+ Y   L   IL+ E C++L MG+FLGVA A
Sbjct  176   GVILARQLVAAPANAVTPITMAETAQAIATDYD--LQIEILEQEDCEKLGMGAFLGVAQA  233

Query  1076  ATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavv  1255
             +  P  FIHL YKP  G+ + KLA++GKG+TFDSGG N+K GA S IE MK DM GAA  
Sbjct  234   SDLPPKFIHLTYKPQ-GTPRRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGGAAAT  291

Query  1256  fgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLIL  1435
              GAAKAI Q+KP  VEVHFI    ENMISG  M PGD+LTASNGK IEV +TDAEGRL L
Sbjct  292   LGAAKAIGQLKP-DVEVHFISAVTENMISGRAMHPGDVLTASNGKTIEVNNTDAEGRLTL  350

Query  1436  ADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWR  1615
             ADALV+A KLGVE +VDLATLTGAC+ ALG  +AG+FTP + +AK++  A++  GEK+WR
Sbjct  351   ADALVFADKLGVEAIVDLATLTGACLIALGDDIAGLFTPDDGVAKQLETASETAGEKIWR  410

Query  1616  MPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +P+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  411   LPMEEKYFEGLKSGIADMKNTGPRAGGSITAALFLK  446



>ref|WP_009545951.1| MULTISPECIES: aminopeptidase A [Cyanothece]
 ref|YP_001802125.1| leucyl aminopeptidase [Cyanothece sp. ATCC 51142]
 sp|B1WR01.1|AMPA_CYAA5 RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Cyanothece sp. ATCC 51142]
 gb|ACB50059.1| leucine aminopeptidase [Cyanothece sp. ATCC 51142]
Length=490

 Score =   350 bits (897),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 221/463 (48%), Positives = 300/463 (65%), Gaps = 23/463 (5%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSG  526
             I   +  LL+W G+ +A+G+ E + A           L +LD K+GG ++E   E +F G
Sbjct  3     IRGTDTPLLDWSGEAIALGIFENETALTGE-------LTQLDEKIGGTIAELIEEAEFEG  55

Query  527   KSGQSIVLRLPGLGS-KRIGLVGLGSVVSSTIAYRTLGE-TIaaaaksaqassvavalas  700
             KSG S+  R+ G    +++ LVGLG     T+    LG  T+A   K  +  ++A+    
Sbjct  56    KSGSSVATRIGGKSPIRKLILVGLGKKEELTLETVRLGAATVARLGKKEKVKTLAIQFPV  115

Query  701   aEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLK--SVEILGLGTGPEIEKKLK  874
              +  + ++     +A+A G++    +DNRFK EP+   LK  +V+ILG+G   E  + + 
Sbjct  116   VDNDAAQT----TAAIAEGMILSLHQDNRFKSEPEDKPLKLETVDILGVG---EQSEAIN  168

Query  875   YSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGS  1054
              +E V SGVI  +ELV APAN +TP   AE A+N+A  Y   L   IL+ ++C++ KMG+
Sbjct  169   QAETVCSGVILARELVAAPANTVTPVTFAETAQNLAKDYG--LDLEILEKDECEKRKMGA  226

Query  1055  FLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKD  1234
             FLGVA A+  P  FIHL YKPS G+ K KLA++GK +TFDSGG NLK+ + S IE MK D
Sbjct  227   FLGVAKASDLPPKFIHLTYKPS-GTPKRKLAIVGKSLTFDSGGLNLKV-SGSGIETMKMD  284

Query  1235  MagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTD  1414
             M G A   GAAKAIAQ+KP  VEVHF+  A ENMISG  M PGDILTASNGK IEV +TD
Sbjct  285   MGGGAATLGAAKAIAQLKP-DVEVHFVCAATENMISGKAMHPGDILTASNGKTIEVNNTD  343

Query  1415  AEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADV  1594
             AEGRL LADALV+A +L V+ +VDLATLTGACI ALG +++G+++  E LA+E+  A++ 
Sbjct  344   AEGRLTLADALVFAEQLEVDAIVDLATLTGACIVALGDNISGLWSTDETLAEEIKTASEA  403

Query  1595  GGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
              GEK W MP+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  404   AGEKFWIMPMEEKYFEGLKSPIADMKNTGPRAGGSITAALFLK  446



>ref|WP_008207180.1| aminopeptidase A [Microcystis sp. T1-4]
 emb|CCI34585.1| putative cytosol aminopeptidase [Microcystis sp. T1-4]
Length=491

 Score =   350 bits (897),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 227/464 (49%), Positives = 290/464 (63%), Gaps = 26/464 (6%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEK--DMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             I + +  LL W GD LA+G+ E   ++A +         L +L++KLGG L E  SE +F
Sbjct  3     IRSTDTSLLTWTGDTLALGLPEGAVEIAGE---------LAELNNKLGGTLEELISETEF  53

Query  521   SGKSGQSIVLRLPGLGS-KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  697
              GK G S   RL G G  +++ LVGLG      +    L     A     Q S       
Sbjct  54    EGKLGSSAATRLGGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISL  113

Query  698   saEGLSVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKL  871
                G     + + A A+  G++  T +D RFK   E K   L++VE+LGLG   E    +
Sbjct  114   PVVG----DQSATAGAITEGLLLATHQDTRFKSTKEEKGAKLETVELLGLG---EQTSAI  166

Query  872   KYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMG  1051
               +E + SGVI  +ELVNAPAN +TP  +AE A+ IA+ Y   L+  IL+ E+C+ L MG
Sbjct  167   AKAEQICSGVILARELVNAPANTVTPLTMAETAEQIAAEYG--LSLKILEQEECESLGMG  224

Query  1052  SFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKK  1231
             +FLGVA A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK 
Sbjct  225   AFLGVAKASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKM  282

Query  1232  DMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDT  1411
             DM G A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IEV +T
Sbjct  283   DMGGGAATLGAAKAIAQLRPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIEVNNT  341

Query  1412  DAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAAD  1591
             DAEGRL LAD LV+A KL V+ +VDLATLTGAC+ ALG  +AG+++  E LA ++ +AA 
Sbjct  342   DAEGRLTLADGLVFAEKLAVDAIVDLATLTGACVVALGDDIAGLWSSDESLADQLQQAAK  401

Query  1592  VGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             + GEK W MPLEE Y+E MKS IADM N G   G +ITA+LF+K
Sbjct  402   LAGEKFWPMPLEEKYFEGMKSQIADMKNTGPRPGGSITAALFLK  445



>ref|WP_016874221.1| aminopeptidase A [Chlorogloeopsis fritschii]
Length=490

 Score =   349 bits (896),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 230/462 (50%), Positives = 293/462 (63%), Gaps = 35/462 (8%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEK--DMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQS  541
             +LEW GD LA+G+ E   D+  D         L  LD K  G+L E  +EE+F GK+G +
Sbjct  10    VLEWAGDGLAIGLFEDAVDLTGD---------LAALDEKFAGVLKELIAEEEFKGKTGST  60

Query  542   IVLRLPGLGS--KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLS  715
              V R+ G GS  +++ LVGLG           L       A +A A           G+S
Sbjct  61    AVTRV-GSGSPVRKLILVGLGK-------PEALKLDTLRRAAAAVARLAKKQKCKTLGIS  112

Query  716   V----ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKY  877
             +          A A+A GI    ++DNRFK EP  K   +++V++LGLG     E  +  
Sbjct  113   LPVWNNDPAQTAQAIAEGIQLALYQDNRFKSEPEDKGVQVETVDLLGLGGQ---EAAITR  169

Query  878   SEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSF  1057
             +  ++SGVI  ++LV APAN +TP  +AE A  IAS +   L   IL+ E+C++L MG+F
Sbjct  170   ANQIASGVILARQLVAAPANEVTPITMAETAMAIASEHG--LQVEILEQEECEKLGMGAF  227

Query  1058  LGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDM  1237
             LGVA A+  P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K GA S IE MK DM
Sbjct  228   LGVAKASDLPPKFIHLTYKPE-GTPKRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDM  285

Query  1238  agaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDA  1417
              G A   GAAKAIAQ+KP  VEVHFI    ENMISG  M PGDIL ASNGK IEV +TDA
Sbjct  286   GGGAATLGAAKAIAQLKP-DVEVHFISAVTENMISGHAMHPGDILKASNGKTIEVNNTDA  344

Query  1418  EGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVG  1597
             EGRL LADALV+A KLGV+ ++DLATLTGAC+ ALG  +AG+FTP + LAKE+  AA+  
Sbjct  345   EGRLTLADALVFAEKLGVDAIIDLATLTGACVIALGDDIAGLFTPDDALAKELETAAETS  404

Query  1598  GEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             GEK+WRMP+EE Y+E +KSSIADM N G   G +ITA+LF+K
Sbjct  405   GEKIWRMPMEEKYFEGLKSSIADMKNTGPRAGGSITAALFLK  446



>ref|WP_012268315.1| aminopeptidase A [Microcystis aeruginosa]
 ref|YP_001661214.1| leucyl aminopeptidase [Microcystis aeruginosa NIES-843]
 sp|B0JL23.1|AMPA_MICAN RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Microcystis aeruginosa NIES-843]
 dbj|BAG06022.1| leucine aminopeptidase [Microcystis aeruginosa NIES-843]
Length=490

 Score =   349 bits (896),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 227/463 (49%), Positives = 288/463 (62%), Gaps = 25/463 (5%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEK--DMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             I + +  LL W GD LA+G+ E   ++A +         L +L+ KLGG L +  SE +F
Sbjct  3     IRSTDTSLLTWTGDTLALGLPEGAIEIAGE---------LAELNDKLGGNLGDLISETEF  53

Query  521   SGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalas  700
              GK G S   RL G   +++ LVGLG      +    L     A     Q S        
Sbjct  54    EGKLGSSAATRLGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISLP  113

Query  701   aEGLSVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLK  874
               G     + + A A+  G++  T +D RFK   E K   L++VE+LGLG   E    + 
Sbjct  114   VVG----DQSATAGAITEGLLLATHQDTRFKSTKEEKGAKLETVELLGLG---EQASAIA  166

Query  875   YSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGS  1054
              SE + SGVI  +ELVNAPAN +TP  +AE A+ IA+ Y   L+  IL+ E+C+ L MG+
Sbjct  167   KSEQICSGVILARELVNAPANTVTPLTMAETAEQIAAEYG--LSLNILEQEECESLGMGA  224

Query  1055  FLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKD  1234
             FLGVA A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK D
Sbjct  225   FLGVAKASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMD  282

Query  1235  MagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTD  1414
             M G A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IEV +TD
Sbjct  283   MGGGAATLGAAKAIAQLQPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIEVNNTD  341

Query  1415  AEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADV  1594
             AEGRL LAD LV+A KL V+ +VDLATLTGAC+ ALG  +AG+++  E LA ++ EAA +
Sbjct  342   AEGRLTLADGLVFAEKLEVDAIVDLATLTGACVIALGDDIAGLWSSDESLAAQIQEAAKL  401

Query  1595  GGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
              GEK W MPLEE Y+E MKS IADM N G   G +ITA+LF+K
Sbjct  402   AGEKFWPMPLEEKYFEGMKSQIADMKNTGPRPGGSITAALFLK  444



>ref|WP_002773226.1| aminopeptidase A [Microcystis aeruginosa]
 emb|CCI06078.1| putative cytosol aminopeptidase [Microcystis aeruginosa PCC 7941]
Length=491

 Score =   349 bits (896),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 228/464 (49%), Positives = 290/464 (63%), Gaps = 26/464 (6%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEK--DMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             I + +  LL W GD LA+G+ E   ++A +         L +L++KLGG L E  SE +F
Sbjct  3     IRSTDTSLLTWTGDTLALGLPEGAVEIAGE---------LAELNNKLGGTLGELISETEF  53

Query  521   SGKSGQSIVLRLPGLGS-KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  697
              GKSG S   RL G G  +++ LVGLG      +    L     A     Q S       
Sbjct  54    EGKSGSSAATRLGGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISL  113

Query  698   saEGLSVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKL  871
                G     + + A A+  G++    +D RFK   E K   L++VE+LGLG   E    +
Sbjct  114   PVVG----DQSATAGAITEGLLLANHQDTRFKSTKEEKGAKLETVELLGLG---EQASAI  166

Query  872   KYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMG  1051
               +E + SGVI  +ELVNAPAN +TP  +AE A+ IAS Y   L+  IL+ E+C+ L MG
Sbjct  167   AKAEQICSGVILARELVNAPANTVTPLTMAETAEQIASEYG--LSLKILEQEECESLGMG  224

Query  1052  SFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKK  1231
             +FLGVA A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK 
Sbjct  225   AFLGVAKASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKM  282

Query  1232  DMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDT  1411
             DM G A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IEV +T
Sbjct  283   DMGGGAATLGAAKAIAQLQPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIEVNNT  341

Query  1412  DAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAAD  1591
             DAEGRL LAD LV+A KL V+ +VDLATLTGAC+ ALG  +AG+++  E LA ++ EAA 
Sbjct  342   DAEGRLTLADGLVFAEKLEVDAIVDLATLTGACVIALGDDIAGLWSSDESLAAQLQEAAK  401

Query  1592  VGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             + GEK W MPLEE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  402   LAGEKFWPMPLEEKYFEGLKSPIADMKNTGPRPGGSITAALFLK  445



>ref|XP_008337029.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Malus 
domestica]
Length=378

 Score =   345 bits (885),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 172/242 (71%), Positives = 200/242 (83%), Gaps = 0/242 (0%)
 Frame = +2

Query  998   VLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDS  1177
             +L+A ILD EQCKELKMGS+L VAAA+TNPS+FIHL YKP  G  K KL L+GKG+TFDS
Sbjct  94    LLSANILDEEQCKELKMGSYLAVAAASTNPSHFIHLIYKPPGGPAKVKLGLVGKGLTFDS  153

Query  1178  GGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMR  1357
             GGYN+K G   SIE MK DM G+A V GAAKAIAQIKP GV VHFIV ACENM+SGTGMR
Sbjct  154   GGYNIKTGPGCSIEQMKXDMGGSAAVLGAAKAIAQIKPTGVXVHFIVAACENMMSGTGMR  213

Query  1358  PGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVA  1537
             PGDI+TASNGK IEV +TDAEGRL LAD LVYA   GV+K+VDLATLTGACI A G S+A
Sbjct  214   PGDIVTASNGKTIEVNNTDAEGRLTLADTLVYACNQGVDKIVDLATLTGACIVAFGPSIA  273

Query  1538  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1717
             G+FTPS+DLAKEV  A+++ GEK WR+P+EESYWE+MKS IADM+N G+  G +IT +LF
Sbjct  274   GVFTPSDDLAKEVFAASEISGEKFWRLPMEESYWESMKSGIADMLNTGARQGGSITVALF  333

Query  1718  MK  1723
             +K
Sbjct  334   LK  335



>ref|WP_016515741.1| Cytosol aminopeptidase [Microcystis aeruginosa]
 gb|EPF21780.1| Cytosol aminopeptidase [Microcystis aeruginosa SPC777]
Length=491

 Score =   349 bits (895),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 228/464 (49%), Positives = 289/464 (62%), Gaps = 26/464 (6%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEK--DMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             I + +  LL W GD LA+G+ E   ++A +         L +L+ KLGG L E  SE +F
Sbjct  3     IRSTDTSLLTWTGDTLALGLPEGAIEIAGE---------LAELNDKLGGTLGELISETEF  53

Query  521   SGKSGQSIVLRLPGLGS-KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  697
              GKSG S   RL G G  +++ LVGLG      +    L     A     Q S       
Sbjct  54    EGKSGSSAATRLGGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISL  113

Query  698   saEGLSVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKL  871
                G     + + A A+  G++    +D RFK   E K   L++VE+LGLG   E    +
Sbjct  114   PVVG----DQSATAGAITEGLLLANHQDTRFKSTKEEKGAKLETVELLGLG---EQASAI  166

Query  872   KYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMG  1051
               +E + SGVI  +ELVNAPAN +TP  +AE A+ IAS Y   L+  IL+ E+C+ L MG
Sbjct  167   AKAEQICSGVILARELVNAPANTVTPLTMAETAEQIASEYG--LSLKILEQEECESLGMG  224

Query  1052  SFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKK  1231
             +FLGVA A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK 
Sbjct  225   AFLGVAKASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKM  282

Query  1232  DMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDT  1411
             DM G A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IEV +T
Sbjct  283   DMGGGAATLGAAKAIAQLQPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIEVNNT  341

Query  1412  DAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAAD  1591
             DAEGRL LAD LV+A KL V+ +VDLATLTGAC+ ALG  +AG+++  E LA ++ EAA 
Sbjct  342   DAEGRLTLADGLVFAEKLEVDAIVDLATLTGACVIALGDDIAGLWSSDESLAAQLQEAAK  401

Query  1592  VGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             + GEK W MPLEE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  402   LAGEKFWPMPLEEKYFEGLKSPIADMKNTGPRPGGSITAALFLK  445



>ref|WP_013323896.1| aminopeptidase A [Cyanothece sp. PCC 7822]
 ref|YP_003889103.1| leucyl aminopeptidase [Cyanothece sp. PCC 7822]
 gb|ADN15828.1| Leucyl aminopeptidase [Cyanothece sp. PCC 7822]
Length=489

 Score =   348 bits (894),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 222/473 (47%), Positives = 301/473 (64%), Gaps = 44/473 (9%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTE-KDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFS  523
             I A E   L W G+ LA+G+ E  D++ +         L +L+ KL G++ E  +EE+F 
Sbjct  3     IRATEQTKLNWTGEALALGIFEGTDLSGE---------LAELNEKLAGVIQELITEEEFE  53

Query  524   GKSGQSIVLRLPG-LGSKRIGLVGLGS-----VVSSTIAYRTLGETIaaaaksaqassva  685
             GK+G S++ R+   L  +++ LVGLG      + S  IA  ++  T              
Sbjct  54    GKAGTSVISRIGNELSIRKLILVGLGKAEDFKLNSLRIAAASIARTAKKQKIKTL-----  108

Query  686   valasaEGLSV-----ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLG  844
                    G+S+     E  L+   A+  G +     DNRFK +P  K P L++V++L LG
Sbjct  109   -------GISLPLVNDEPALTTG-AIVEGFLLALHTDNRFKSDPEDKGPKLETVDLLELG  160

Query  845   TGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDV  1024
                  +  +  +++++ GVI  +ELVNAPAN LTP  +AE A+ IAS Y  VL   +L+ 
Sbjct  161   GQ---QAAITKAQIIADGVILARELVNAPANTLTPVTMAETAQKIASDYGLVLE--VLEK  215

Query  1025  EQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGA  1204
             E C+ L MG+FLGVA A+  P  FIHL YKP  G+ K KLA++GK +TFDSGG N+K+ +
Sbjct  216   EDCENLGMGAFLGVAQASDLPPKFIHLTYKPE-GTPKRKLAIVGKSLTFDSGGLNIKV-S  273

Query  1205  NSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASN  1384
              S IE MK DM G A   GAAKAIAQ+KP  VEVHF+  A ENMISG  + PGDILTASN
Sbjct  274   GSGIETMKMDMGGGAATLGAAKAIAQLKP-DVEVHFVCAATENMISGKAIHPGDILTASN  332

Query  1385  GKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDL  1564
             GK IEV +TDAEGRL LADALV+  KLGV+ +VDLATLTGAC+ ALG ++AG+++P+E+L
Sbjct  333   GKTIEVNNTDAEGRLTLADALVFTEKLGVDAIVDLATLTGACVIALGDNIAGLWSPNEEL  392

Query  1565  AKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             A ++ E+A++ GEK W+MPLEE Y+E MKS IADM N G   G +ITA+LF+K
Sbjct  393   ANQIKESAELAGEKFWQMPLEEKYFEGMKSPIADMKNTGPRAGGSITAALFLK  445



>dbj|GAL91486.1| cytosol aminopeptidase PepA [Microcystis aeruginosa NIES-44]
Length=491

 Score =   348 bits (893),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 228/464 (49%), Positives = 289/464 (62%), Gaps = 26/464 (6%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEK--DMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             I + +  LL W GD LA+G+ E   ++A +         L +L+ KLGG L +  SE +F
Sbjct  3     IRSTDTSLLTWTGDTLALGLPEGAIEIAGE---------LAELNDKLGGNLGDLISETEF  53

Query  521   SGKSGQSIVLRLPGLGS-KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  697
              GK G S   RL G G  +++ LVGLG      +    L     A     Q S       
Sbjct  54    EGKLGSSAATRLGGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISL  113

Query  698   saEGLSVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKL  871
                G     + + A A+  G++  T +D RFK   E K   L++VE+LGLG   E    +
Sbjct  114   PVVG----DQSATAGAITEGLLLATHQDTRFKSTKEEKGAKLETVELLGLG---EQSSAI  166

Query  872   KYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMG  1051
               SE + SGVI  +ELVNAPAN +TP  +AE A+ IAS Y   L+  IL+ E+C+ L MG
Sbjct  167   AKSEQICSGVILARELVNAPANTVTPLTMAETAEQIASEYG--LSLKILEQEECESLGMG  224

Query  1052  SFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKK  1231
             +FLGVA A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK 
Sbjct  225   AFLGVAKASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKM  282

Query  1232  DMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDT  1411
             DM G A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IEV +T
Sbjct  283   DMGGGAATLGAAKAIAQLRPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIEVNNT  341

Query  1412  DAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAAD  1591
             DAEGRL LAD LV+A KL V+ +VDLATLTGAC+ ALG  +AG+++  E LA ++ EAA 
Sbjct  342   DAEGRLTLADGLVFAEKLEVDAIVDLATLTGACVVALGDDIAGLWSSDESLADQLQEAAK  401

Query  1592  VGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             + GEK W MPLEE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  402   LAGEKFWPMPLEEKYFEGLKSQIADMKNTGPRPGGSITAALFLK  445



>ref|WP_015165714.1| cytosol aminopeptidase [Pseudanabaena sp. PCC 7367]
 ref|YP_007103186.1| cytosol aminopeptidase [Pseudanabaena sp. PCC 7367]
 gb|AFY70758.1| cytosol aminopeptidase [Pseudanabaena sp. PCC 7367]
Length=512

 Score =   348 bits (894),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 223/463 (48%), Positives = 300/463 (65%), Gaps = 22/463 (5%)
 Frame = +2

Query  374   EWKGDILAVGVT-EKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVL  550
             +W GD LA+    ++ +A   N +  NL      + L G L E  +E ++ G SG  +  
Sbjct  12    DWTGDGLAIATFGQETVAAALNQQLLNLD----QTTLLGTLQEIVTEAEYKGDSGSMVSG  67

Query  551   RLPGLGS-KRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEGLSVES  724
             R+ G  + +++ LVGLG     TI  +R   +  A A K A  +       S    +++ 
Sbjct  68    RVGGSAAIRKVMLVGLGDPAQGTIDNWR---KAAAQAVKWANGAKCKTLALSFPLYNLDQ  124

Query  725   KLSAASAMATGIVSGTFEDNRFK---LEPKTP----TLKSVEILGLGTGPEIEKKLKYSE  883
             +L+A  A+A G +    +DNRFK   ++ +TP    +L+ VEILGL +    +  L  ++
Sbjct  125   ELTA-QAIAEGALLAAHQDNRFKSQDIDDETPKNGDSLELVEILGLDSDAA-QAGLTRAK  182

Query  884   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLG  1063
              ++ GVI  +ELV+APANV+TP ALAE A  IAS YSD +T  +L+ EQC+ + MG++LG
Sbjct  183   QIADGVILTRELVSAPANVITPEALAETALAIASDYSDCMTVEVLEREQCEAMGMGAYLG  242

Query  1064  VAAAATNPSYFIHLCYK-PSSG--SVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKD  1234
             V+ A+  P  FIHL Y   SSG  + K KLA++GKG+TFDSGG N+K GANS I +MK D
Sbjct  243   VSQASELPPKFIHLTYSGKSSGDEAAKRKLAIVGKGVTFDSGGLNIKAGANSGIAMMKTD  302

Query  1235  MagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTD  1414
             M GA    GAAKAIAQIKP  +E+HFIV ACENMISG  + PGDILTASNGK IEV +TD
Sbjct  303   MGGAGATLGAAKAIAQIKPQDIEIHFIVAACENMISGRAIHPGDILTASNGKTIEVNNTD  362

Query  1415  AEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADV  1594
             AEGRL LADALV+A KL ++ +VDLATLTGAC+ ALG  +AG+++  +DLA  +  AA +
Sbjct  363   AEGRLTLADALVFADKLELDGIVDLATLTGACVVALGDEIAGMWSNDDDLAGTIHAAAKL  422

Query  1595  GGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
              GEK WRMPLEE Y+E MKS +AD  N G+  G AITA+LF+K
Sbjct  423   AGEKFWRMPLEEPYFEAMKSVVADFKNTGNRAGGAITAALFLK  465



>ref|WP_026722318.1| aminopeptidase A [Fischerella sp. PCC 9431]
Length=493

 Score =   348 bits (892),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 232/459 (51%), Positives = 288/459 (63%), Gaps = 29/459 (6%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             LLEW GD LAVG+ E       +    N  L  LD K  G + E  +EE+F GK G + V
Sbjct  10    LLEWTGDGLAVGLFE-------DGTELNGELATLDEKFAGYIKELITEEEFKGKVGSTAV  62

Query  548   LRLP-GLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV--  718
              RL  G   +++ LVGLG      +   TL    AA A+ A+            G+S+  
Sbjct  63    TRLASGSPVRKLILVGLGK--PDAVKLDTLRRAAAAIARQAKKQKCKTL-----GISLPV  115

Query  719   --ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEV  886
                     A A+A G+    ++DNRFK EP  K P +++VE+LGL      E  +  +  
Sbjct  116   WNHDPAQTAQALAEGVQLALYQDNRFKSEPEDKGPQVETVELLGLSGQ---EAAIARANQ  172

Query  887   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1066
             +SSGVI  +ELV APAN +TP  +AE A  IAS     +   IL+ E C+ L MG+FLGV
Sbjct  173   ISSGVILARELVAAPANEVTPITMAETATAIASQTG--MHIEILEQEDCERLGMGAFLGV  230

Query  1067  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1246
             A A+  P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K GA S IE MK DM GA
Sbjct  231   AKASDLPPKFIHLTYKPD-GTPKRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKMDMGGA  288

Query  1247  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGR  1426
             A  FGAAKAI Q+KP  VEVHFI    ENMISG  M PGDIL ASNGK IEV +TDAEGR
Sbjct  289   AATFGAAKAIGQLKP-DVEVHFISAVTENMISGRAMHPGDILKASNGKTIEVNNTDAEGR  347

Query  1427  LILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEK  1606
             L LADALV+A KLGV+ +VDLATLTGACI ALG  +AG+FTP + LA+E+  AA   GEK
Sbjct  348   LTLADALVFAEKLGVDAIVDLATLTGACIIALGDEIAGLFTPDDTLAQELETAAQSAGEK  407

Query  1607  LWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +WR+P+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  408   IWRLPMEEKYFEGLKSGIADMKNTGPRPGGSITAALFLK  446



>ref|WP_039726207.1| aminopeptidase A [Lyngbya confervoides]
 gb|KIF14452.1| aminopeptidase A [Aphanocapsa montana BDHKU210001]
 gb|KIF39382.1| aminopeptidase A [Lyngbya confervoides BDU141951]
Length=491

 Score =   348 bits (892),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 225/459 (49%), Positives = 291/459 (63%), Gaps = 28/459 (6%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             +L+W GD LA+GVTE D+   P S      L  LDSKL G++ E   E +F   +  S V
Sbjct  10    VLDWTGDCLAIGVTEADL---PLSGG----LADLDSKLSGVVQELIDESEFKAAADSSAV  62

Query  548   LRLPGLGS-KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVES  724
             +R+   G  +++ L+GLG   + T+      ET+  A   A   +         G+S+ +
Sbjct  63    IRVGSSGPVRKLALIGLGKPEAMTL------ETLRRAGAIAARLAKKEKCKVV-GMSLPT  115

Query  725   KLSAASAMATGIVSGTF----EDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEV  886
               +  S  A GI  G      EDNRFK E   K+  ++ +E++G    P     +  ++ 
Sbjct  116   WNADTSLSAQGICEGALLALHEDNRFKSESDDKSFAIERIELIGY---PNEAPAIARAQQ  172

Query  887   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1066
             V+ GVI  +ELV AP NV TP  LAE A+ IA  +   +   IL+ E C+ L MG+FLGV
Sbjct  173   VADGVILARELVAAPPNVATPAMLAETAEAIARDHG--IEVEILEKEACEALGMGAFLGV  230

Query  1067  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1246
             A A+  P  FIHL YKP+ G+ + KLA++GKG+TFDSGG N+K GA S IE+MK DM GA
Sbjct  231   AQASDLPPKFIHLTYKPT-GTPRRKLAIIGKGLTFDSGGLNIKAGAGSMIEMMKFDMGGA  289

Query  1247  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGR  1426
             A   GAAKAIAQIKP  VEVHFI  A ENMISG  + PGDI+TASNGK IEV +TDAEGR
Sbjct  290   AATLGAAKAIAQIKP-DVEVHFISAAAENMISGNALHPGDIITASNGKTIEVNNTDAEGR  348

Query  1427  LILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEK  1606
             L LADALV+A KLG++ M+DLATLTGACI ALG S+AG+++P + LA E+  A+   GEK
Sbjct  349   LTLADALVFAEKLGLDAMIDLATLTGACIVALGDSIAGLWSPDDTLAGEIEAASVTAGEK  408

Query  1607  LWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             LWRMPLEE Y+E MKS  ADM N G   G +ITA+LF+K
Sbjct  409   LWRMPLEEKYFEGMKSLAADMKNTGPRFGGSITAALFLK  447



>ref|WP_024545494.1| aminopeptidase A [Synechococcus sp. NKBG15041c]
Length=491

 Score =   347 bits (891),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 227/452 (50%), Positives = 297/452 (66%), Gaps = 20/452 (4%)
 Frame = +2

Query  377   WKGDILAVGVTEKD-MARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  553
             W G+ +A+G  E++ +   P S      L  LD +L G+++E  +E DF GKSG+  V R
Sbjct  13    WSGEAIALGFFEQEAVITVPES------LAALDERLSGVITEVITETDFKGKSGELSVTR  66

Query  554   L-PGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKL  730
             +  G   K++ LVGLG+      A  TL  T AA A++ +     V LA    ++ ES+ 
Sbjct  67    VGSGAPIKKVILVGLGNGEKWNSA--TLRSTAAAIARAVKGDKTIVNLALQLPIA-ESEA  123

Query  731   SAASAMATGIVSGTFEDNRFKLEPK-TPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIF  907
             + A  +  G+     EDNRFK E K  PTL+++EILG+G  PE    +     +  GVI+
Sbjct  124   TTAQMVTEGMYLAFHEDNRFKSEQKDPPTLEAIEILGIGEQPE---AIALGTSLCEGVIY  180

Query  908   VKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNP  1087
              +ELVNAPAN++ P  LA   +N++S Y   L   IL   +C+   MGSFLGVAAA+  P
Sbjct  181   ARELVNAPANIINPVTLAASVENLSSTYG--LELNILGEAECEAAGMGSFLGVAAASDLP  238

Query  1088  SYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaa  1267
               FIHL YKP  G+ + K+A++GKG+TFDSGGYN+K  +  SI +MK DM GAA  FGAA
Sbjct  239   PKFIHLVYKPP-GTPRKKVAIVGKGLTFDSGGYNIK-PSGPSIAMMKMDMGGAAATFGAA  296

Query  1268  kaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADAL  1447
             KAIA++KP  VEVHFI    ENMISG GMRPGDILTASNGK IEV +TDAEGRL LADAL
Sbjct  297   KAIAELKP-DVEVHFISAVTENMISGRGMRPGDILTASNGKTIEVNNTDAEGRLTLADAL  355

Query  1448  VYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLE  1627
             VYA KL VE +VD+ATLTGAC+ ALG  + G+++  EDLA+ +  A++  GEK WRMPLE
Sbjct  356   VYAEKLDVEAIVDIATLTGACVIALGDDICGLWSDDEDLAQAITAASEKAGEKFWRMPLE  415

Query  1628  ESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             E Y+E +KS IADM N G  +G +ITA+LF+K
Sbjct  416   EKYFEGLKSPIADMKNTGPREGGSITAALFLK  447



>ref|WP_017742946.1| aminopeptidase A [Scytonema hofmanni]
Length=493

 Score =   347 bits (891),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 221/458 (48%), Positives = 294/458 (64%), Gaps = 27/458 (6%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             LLEW GD LA+G+ E  +            L  LD KL G + E  +EE+F GK G S  
Sbjct  10    LLEWTGDGLAIGLFEDAVELTGE-------LATLDEKLAGSIKELIAEEEFKGKQGSSTS  62

Query  548   LRLPGLGS----KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLS  715
             +R   +GS    +++ +VGLG      +   TL    A AA++A+             L+
Sbjct  63    IR---VGSHSPVRKVIVVGLGK--PEALKLETLRRAAAVAARTAKKQRCKTLAIHLPILN  117

Query  716   VESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVV  889
              + +   A A+A G+    ++DNRFK EP  K+P ++ V++LGLG     E  +  +  +
Sbjct  118   -DDQAQTAQALAEGVQLALYQDNRFKSEPEDKSPQVEQVDLLGLGGQ---EAAITRANQI  173

Query  890   SSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVA  1069
             +SGV   ++LV APAN +TP  +AE A  IAS +   L   IL+ E C++L MG+FLGVA
Sbjct  174   ASGVFLARQLVAAPANSVTPITMAETATQIASDHG--LQLEILEQEDCEKLNMGAFLGVA  231

Query  1070  AAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaa  1249
              A+  P  FIHL YKP  G+ + KLA++GKG+TFDSGG N+K GA S IE MK DM GAA
Sbjct  232   KASDLPPKFIHLTYKP-EGTPRRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGGAA  289

Query  1250  vvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRL  1429
                GAAKAI Q+KP  VEVHFI    ENMISG  M PGDILTASNGK IEV +TDAEGRL
Sbjct  290   ATLGAAKAIGQLKP-DVEVHFISAVTENMISGHAMHPGDILTASNGKTIEVNNTDAEGRL  348

Query  1430  ILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKL  1609
              LADALV+A KLGV+ ++DLATLTGAC+ ALG  +AG+FTP + LA ++ +A+++ GEK+
Sbjct  349   TLADALVFADKLGVDAIIDLATLTGACVVALGEDIAGLFTPDDALATQLEKASEISGEKI  408

Query  1610  WRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             WR+P+EE Y+E +KS +ADM N G   G +ITA+LF+K
Sbjct  409   WRLPMEEKYFEGLKSGLADMKNTGPRAGGSITAALFLK  446



>ref|WP_002785587.1| aminopeptidase A [Microcystis aeruginosa]
 emb|CCI20322.1| putative cytosol aminopeptidase [Microcystis aeruginosa PCC 9807]
Length=490

 Score =   347 bits (891),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 226/463 (49%), Positives = 286/463 (62%), Gaps = 25/463 (5%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEK--DMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             I + +  LL W GD LA+G+ E   ++A +         L +L+ KLGG L +  SE +F
Sbjct  3     IRSTDTSLLTWTGDTLALGLPEGTIEIAGE---------LAELNDKLGGNLGDLISETEF  53

Query  521   SGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalas  700
              GK G S   RL G   +++ LVGLG      +    L     A     Q S        
Sbjct  54    EGKLGSSAATRLGGGPIRKLILVGLGKTTDFDLQTLRLAAAAIARLAKQQKSQALAISLP  113

Query  701   aEGLSVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLK  874
               G       + A A+A G++    +D RFK   E K   L++VE+LGLG   E    + 
Sbjct  114   VVG----DHSATAGAIAEGLLLANHQDTRFKSTKEEKGAKLETVELLGLG---EQTSAIA  166

Query  875   YSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGS  1054
              +E + SGVI  +ELVNAPAN +TP  +AE A+ IA+ Y   L+  IL+ E+C+ L MG+
Sbjct  167   KAEQICSGVILARELVNAPANTVTPLTMAETAEQIAAEYG--LSLKILEQEECESLGMGA  224

Query  1055  FLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKD  1234
             FLGVA A+  P  F+HL YKP     K KLA++GK +TFDSGG N+K GA S IE MK D
Sbjct  225   FLGVAKASDIPPKFLHLIYKPQVAP-KRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMD  282

Query  1235  MagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTD  1414
             M G A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IEV +TD
Sbjct  283   MGGGAATLGAAKAIAQLRPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIEVNNTD  341

Query  1415  AEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADV  1594
             AEGRL LADALV+A KL V+ +VDLATLTGAC+ ALG  +AG+++  E LA ++ EAA +
Sbjct  342   AEGRLTLADALVFAEKLEVDAIVDLATLTGACVVALGEDIAGLWSSDESLADQIQEAAKL  401

Query  1595  GGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
              GEK W MPLEE Y+E MKS IADM N G   G +ITA+LF+K
Sbjct  402   AGEKFWPMPLEEKYFEGMKSQIADMKNTGPRPGGSITAALFLK  444



>ref|WP_002744501.1| leucine aminopeptidase 1 [Microcystis aeruginosa]
 emb|CAO90152.1| pepA [Microcystis aeruginosa PCC 7806]
 gb|ELS47529.1| leucine aminopeptidase 1 [Microcystis aeruginosa DIANCHI905]
Length=490

 Score =   347 bits (891),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 225/463 (49%), Positives = 288/463 (62%), Gaps = 25/463 (5%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEK--DMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             I + +  LL W GD LA+G+ E   ++A +         L +L+ KLGG L +  SE +F
Sbjct  3     IRSTDTSLLTWTGDTLALGLPEGAIEIAGE---------LAELNDKLGGNLGDLISETEF  53

Query  521   SGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalas  700
              GK G S   RL G   +++ LVGLG      +    L     A     Q S        
Sbjct  54    EGKLGSSAATRLGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISLP  113

Query  701   aEGLSVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLK  874
               G     + + A A+A G++    +D RFK   E K   L++VE+LGLG   E    + 
Sbjct  114   VVG----DRSATAGAIAEGLLLANHQDTRFKSTKEEKGAKLETVELLGLG---EQTSAIA  166

Query  875   YSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGS  1054
              +E + SGVI  +ELVNAPAN +TP  +AE A+ IA+ Y   L+  IL+ E+C+ L MG+
Sbjct  167   KAEQICSGVILARELVNAPANTVTPLTMAETAEQIAAEYG--LSLKILEQEECESLGMGA  224

Query  1055  FLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKD  1234
             FLGVA A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK D
Sbjct  225   FLGVAKASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMD  282

Query  1235  MagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTD  1414
             M G A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IEV +TD
Sbjct  283   MGGGAATLGAAKAIAQLRPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIEVNNTD  341

Query  1415  AEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADV  1594
             AEGRL LAD LV+A KL V+ +VDLATLTGAC+ ALG  +AG+++  E LA ++ EAA +
Sbjct  342   AEGRLTLADGLVFAEKLEVDAIVDLATLTGACVVALGDDIAGLWSSDESLASQIQEAAKL  401

Query  1595  GGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
              GEK W MPLEE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  402   AGEKFWPMPLEEKYFEGLKSPIADMKNTGPRPGGSITAALFLK  444



>ref|WP_038084500.1| aminopeptidase A [Tolypothrix bouteillei]
 gb|KIE07840.1| aminopeptidase A [Tolypothrix bouteillei VB521301]
Length=493

 Score =   347 bits (891),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 224/458 (49%), Positives = 293/458 (64%), Gaps = 27/458 (6%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             LLEW GD LA+G+ E  +            L  LD KL G + E  +EE+F GK G S  
Sbjct  10    LLEWVGDGLAIGLFEDAVELTGE-------LATLDEKLAGSIKELIAEEEFKGKQGSSSS  62

Query  548   LRLPGLGS----KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLS  715
             +R+   GS    +++ +VGLG      +   TL    AAAA++A+              +
Sbjct  63    IRV---GSQSPVRKVIVVGLGK--PEALKLETLRRAAAAAARTAKKQKCKTLAIHLPIFN  117

Query  716   VESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVV  889
                K   A A+A G+    ++DNRFK EP  K+P ++ V++LGLG     E  +  +  +
Sbjct  118   -NDKAQTAQAIAEGVQLALYQDNRFKSEPEDKSPQIEQVDLLGLGGQ---EAAITRANQI  173

Query  890   SSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVA  1069
             +SGV   ++LV APAN +TP  +AE A  IAS +   L   IL+ E C++L MG+FLGVA
Sbjct  174   ASGVFLARQLVAAPANSVTPITMAETATQIASEHG--LQLEILEQEDCEKLNMGAFLGVA  231

Query  1070  AAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaa  1249
              A+  P  FIHL YKP  G+ + KLA++GKG+TFDSGG N+K GA S IE MK DM GAA
Sbjct  232   KASDLPPKFIHLTYKPE-GTPRRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGGAA  289

Query  1250  vvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRL  1429
                GAAKAI Q+KP  VEVHFI    ENMISG  M PGDILTASNGK IEV +TDAEGRL
Sbjct  290   ATLGAAKAIGQLKP-DVEVHFISAVTENMISGHAMHPGDILTASNGKTIEVNNTDAEGRL  348

Query  1430  ILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKL  1609
              LADALV+A KLGV+ ++DLATLTGAC+ ALG  +AG+FTP + LA ++ +A++V GEK+
Sbjct  349   TLADALVFADKLGVDAIIDLATLTGACVVALGEDIAGLFTPDDALATQLEKASEVSGEKI  408

Query  1610  WRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             WR+P+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  409   WRLPMEEKYFEGLKSGIADMKNTGPRAGGSITAALFLK  446



>ref|WP_024970899.1| aminopeptidase A [Microcystis aeruginosa]
Length=491

 Score =   347 bits (890),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 227/464 (49%), Positives = 288/464 (62%), Gaps = 26/464 (6%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEK--DMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             I + +  LL W GD LA+G+ E   ++A +         L +L+ KLGG L E  SE +F
Sbjct  3     IRSTDTSLLTWTGDTLALGLPEGAVEIAGE---------LAELNDKLGGTLGELISETEF  53

Query  521   SGKSGQSIVLRLPGLGS-KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  697
              GK G S   RL G G  +++ LVGLG      +    L     A     Q S       
Sbjct  54    EGKLGSSAATRLGGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISL  113

Query  698   saEGLSVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKL  871
                G     + + A A+  G++    +D RFK   E K   L++VE+LGLG   E    +
Sbjct  114   PVVG----DQSATAGAITEGLLLANHQDTRFKSTKEEKGAKLETVELLGLG---EQASAI  166

Query  872   KYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMG  1051
               +E + SGVI  +ELVNAPAN +TP  +AE A+ IAS Y   L+  IL+ E+C+ L MG
Sbjct  167   AKAEQICSGVILARELVNAPANTVTPLTMAETAEQIASEYG--LSLKILEQEECESLGMG  224

Query  1052  SFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKK  1231
             +FLGVA A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK 
Sbjct  225   AFLGVAKASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKM  282

Query  1232  DMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDT  1411
             DM G A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IEV +T
Sbjct  283   DMGGGAATLGAAKAIAQLRPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIEVNNT  341

Query  1412  DAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAAD  1591
             DAEGRL LAD LV+A KL V+ +VDLATLTGAC+ ALG  +AG+++  E LA ++ EAA 
Sbjct  342   DAEGRLTLADGLVFAEKLEVDAIVDLATLTGACVVALGDDIAGLWSSDESLAAQLQEAAK  401

Query  1592  VGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             + GEK W MPLEE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  402   LAGEKFWPMPLEEKYFEGLKSPIADMKNTGPRPGGSITAALFLK  445



>ref|WP_002735635.1| leucine aminopeptidase 1 [Microcystis aeruginosa]
 gb|ELP53501.1| leucine aminopeptidase 1 [Microcystis aeruginosa TAIHU98]
Length=491

 Score =   347 bits (889),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 227/464 (49%), Positives = 287/464 (62%), Gaps = 26/464 (6%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEK--DMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             I + +  LL W GD LA+G+ E   ++A +         L +L+ KLGG+L +  SE +F
Sbjct  3     IRSTDTSLLTWTGDTLALGLPEGAIEIAGE---------LAELNDKLGGILEDLISETEF  53

Query  521   SGKSGQSIVLRLPGLGS-KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  697
              GK G S   RL G G  +++ LVGLG      +    L     A     Q S       
Sbjct  54    EGKLGSSAATRLGGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISL  113

Query  698   saEGLSVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKL  871
                G     + + A A+  G++    +D RFK   E K   L +VE+LGLG   E    +
Sbjct  114   PVVG----DQSATAGAITEGLLLANHQDTRFKSTKEEKGAKLATVELLGLG---EQASAI  166

Query  872   KYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMG  1051
               +E + SGVI  +ELVNAPAN +TP  +AE A+ IAS Y   L+  IL+ E+C+ L MG
Sbjct  167   AKAEQICSGVILARELVNAPANTVTPLTMAETAEQIASEYG--LSLNILEQEECESLGMG  224

Query  1052  SFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKK  1231
             +FLGVA A+  P  FIHL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK 
Sbjct  225   AFLGVAKASDIPPKFIHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKM  282

Query  1232  DMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDT  1411
             DM G A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IEV +T
Sbjct  283   DMGGGAATLGAAKAIAQLRPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIEVNNT  341

Query  1412  DAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAAD  1591
             DAEGRL LAD LV+A KL V+ +VDLATLTGAC+ ALG  +AG+++  E L  ++ EAA 
Sbjct  342   DAEGRLTLADGLVFAEKLEVDAIVDLATLTGACVIALGDDIAGLWSSDESLTVQLQEAAK  401

Query  1592  VGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             + GEK W MPLEE Y+E MKS IADM N G   G +ITA+LF+K
Sbjct  402   LAGEKFWPMPLEEKYFEGMKSQIADMKNTGPRPGGSITAALFLK  445



>ref|WP_002797316.1| aminopeptidase A [Microcystis aeruginosa]
 emb|CCI25250.1| putative cytosol aminopeptidase [Microcystis aeruginosa PCC 9809]
Length=490

 Score =   347 bits (889),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 226/463 (49%), Positives = 287/463 (62%), Gaps = 25/463 (5%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEK--DMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             I + +  LL W GD LA+G+ E   ++A +         L +L+ KLGG L +  SE +F
Sbjct  3     IRSTDTSLLTWTGDTLALGLPEGAIEIAGE---------LAELNDKLGGNLGDLISETEF  53

Query  521   SGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalas  700
              GK G S   RL G   +++ LVGLG      +    L     A     Q S        
Sbjct  54    EGKLGSSAATRLGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISLP  113

Query  701   aEGLSVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLK  874
               G     + + A A+  G++  T +D RFK   E K   L++VE+LGLG   E    + 
Sbjct  114   VVG----DQSATAGAITEGLLLATHQDTRFKSTKEEKGAKLETVELLGLG---EQASAIA  166

Query  875   YSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGS  1054
              SE + SGVI  +ELVNAPAN +TP  +AE A+ IA+ Y   L+  IL+ E+C+ L MG+
Sbjct  167   KSEQICSGVILARELVNAPANTVTPLTMAETAEQIAAEYG--LSLNILEQEECESLGMGA  224

Query  1055  FLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKD  1234
             FLGVA A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK D
Sbjct  225   FLGVAKASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMD  282

Query  1235  MagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTD  1414
             M G A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IEV +TD
Sbjct  283   MGGGAATLGAAKAIAQLQPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIEVNNTD  341

Query  1415  AEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADV  1594
             AEGRL LAD LV+A KL V+ +VDLATLTGAC+ ALG  +AG+++  E L  ++ EAA +
Sbjct  342   AEGRLTLADGLVFAEKLEVDAIVDLATLTGACVIALGDDIAGLWSSDESLTVQLQEAAKL  401

Query  1595  GGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
              GEK W MPLEE Y+E MKS IADM N G   G +ITA+LF+K
Sbjct  402   AGEKFWPMPLEEKYFEGMKSQIADMKNTGPRPGGSITAALFLK  444



>ref|WP_008275582.1| aminopeptidase A [Cyanothece sp. CCY0110]
 gb|EAZ91456.1| leucyl aminopeptidase [Cyanothece sp. CCY0110]
Length=490

 Score =   346 bits (887),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 219/462 (47%), Positives = 289/462 (63%), Gaps = 21/462 (5%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSG  526
             I   +  LL+W GD +A+G  E ++A           L +LD K+G  ++E   E +F G
Sbjct  3     IRGTDTPLLDWSGDAIALGFFENEIALTEE-------LSQLDEKIGKTMTELIEETEFEG  55

Query  527   KSGQSIVLRLPGLGS-KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasa  703
             KSG S+V R+ G  + +++ LVGLG     T+    LG    A     +           
Sbjct  56    KSGSSMVTRIGGKSAIRKLILVGLGKKDEFTLDTVRLGAAAVARLGKKEKVKSLGIHFP-  114

Query  704   EGLSVESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKY  877
               L         +A+A G++    +DNRFK EP  K   L++VEILG+G   E    +  
Sbjct  115   --LMDNDAAKTTAAIAEGMILSLHQDNRFKSEPEDKPSKLETVEILGVGDQSE---AINQ  169

Query  878   SEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSF  1057
             +E V SGVI  +ELV APAN + P   A+ A+++A  Y   L   IL+ ++C++  MG+F
Sbjct  170   AETVCSGVILARELVAAPANAINPVTFAKTAQDLAKEYG--LDIEILEKDECEKRGMGAF  227

Query  1058  LGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDM  1237
             LGVA A+  P  FIHL YKPS G+ K KLA++GK +TFDSGG NLK G+ S IE MK DM
Sbjct  228   LGVAKASDLPPKFIHLIYKPS-GTPKRKLAIVGKSLTFDSGGLNLK-GSGSGIETMKMDM  285

Query  1238  agaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDA  1417
              G A   GAAKAIAQ+KP  VEVHF+  A ENMISG  MRPGDILTASNGK IEV +TDA
Sbjct  286   GGGAATLGAAKAIAQLKP-DVEVHFVCAATENMISGHAMRPGDILTASNGKTIEVNNTDA  344

Query  1418  EGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVG  1597
             EGRL LADALV+A +L V+ +VDLATLTGACI ALG +++G+++  E LA+E+  A++  
Sbjct  345   EGRLTLADALVFAEQLAVDAIVDLATLTGACIVALGDNISGLWSTDETLAEEIKTASEAA  404

Query  1598  GEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             GEK W MP+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  405   GEKFWIMPMEEKYFEGLKSPIADMKNTGPRAGGSITAALFLK  446



>ref|WP_002790963.1| aminopeptidase A [Microcystis aeruginosa]
 emb|CCI28498.1| putative cytosol aminopeptidase [Microcystis aeruginosa PCC 9808]
Length=491

 Score =   346 bits (887),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 225/464 (48%), Positives = 289/464 (62%), Gaps = 26/464 (6%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEK--DMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             I + +  LL W GD LA+G+ E   ++A +         L +L+ KLGG+L +  SE +F
Sbjct  3     IRSTDTSLLTWTGDTLALGLPEGAIEIAGE---------LAELNDKLGGILEDLISETEF  53

Query  521   SGKSGQSIVLRLPGLGS-KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  697
              GK G S   RL G G  +++ LVGLG      +    L     A     Q S       
Sbjct  54    EGKLGSSAATRLGGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISL  113

Query  698   saEGLSVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKL  871
                G     + + A A+  G++    +D RFK   E K   L++VE+LGLG   E    +
Sbjct  114   PVVG----DQSATAGAITEGLLLANHQDTRFKSTKEEKGAKLETVELLGLG---EQASAI  166

Query  872   KYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMG  1051
               +E + SGVI  +ELVNAPAN +TP  +AE A+ IA+ Y   L+  IL+ E+C+ L MG
Sbjct  167   AKAEQICSGVILARELVNAPANTVTPLTMAETAEQIAAEYG--LSLKILEQEECESLGMG  224

Query  1052  SFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKK  1231
             +FLGVA A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK 
Sbjct  225   AFLGVAKASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKM  282

Query  1232  DMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDT  1411
             DM G A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IEV +T
Sbjct  283   DMGGGAATLGAAKAIAQLRPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIEVNNT  341

Query  1412  DAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAAD  1591
             DAEGRL LAD LV+A KL V+ +VDLATLTGAC+ ALG  +AG+++  E LA ++ EAA 
Sbjct  342   DAEGRLTLADGLVFAEKLEVDAIVDLATLTGACVVALGDDIAGLWSSDESLAAQLQEAAK  401

Query  1592  VGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             + GEK W MPLEE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  402   LAGEKFWPMPLEEKYFEGLKSPIADMKNTGPRPGGSITAALFLK  445



>ref|WP_002751572.1| aminopeptidase A [Microcystis aeruginosa]
 emb|CCH95427.1| putative cytosol aminopeptidase [Microcystis aeruginosa PCC 9432]
Length=491

 Score =   346 bits (887),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 225/464 (48%), Positives = 288/464 (62%), Gaps = 26/464 (6%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEK--DMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             I + +  LL W GD LA+G+ E   ++A +         L +L+ KLGG+L +  SE +F
Sbjct  3     IRSTDTSLLTWTGDTLALGLPEGAIEIAGE---------LAELNDKLGGILEDLISETEF  53

Query  521   SGKSGQSIVLRLPGLGS-KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  697
              GK G S   RL G G  +++ LVGLG      +    L     A     Q S       
Sbjct  54    EGKLGSSAATRLGGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISL  113

Query  698   saEGLSVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKL  871
                G     + + A A+  G++    +D RFK   E K   L +VE+LGLG   E    +
Sbjct  114   PVVG----DQSATAGAITEGLLLANHQDTRFKSTKEEKGAKLATVELLGLG---EQASAI  166

Query  872   KYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMG  1051
               +E + SGVI  +ELVNAPAN +TP  +AE A+ IA+ Y   L+  IL+ E+C+ L MG
Sbjct  167   AKAEQICSGVILARELVNAPANTVTPLTMAETAEQIATEYG--LSLNILEQEECESLGMG  224

Query  1052  SFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKK  1231
             +FLGVA A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK 
Sbjct  225   AFLGVAKASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKT  282

Query  1232  DMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDT  1411
             DM G A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IEV +T
Sbjct  283   DMGGGAATLGAAKAIAQLRPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIEVNNT  341

Query  1412  DAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAAD  1591
             DAEGRL LAD LV+A KL V+ +VDLATLTGAC+ ALG  +AG+++  E LA ++ EAA 
Sbjct  342   DAEGRLTLADGLVFAEKLEVDAIVDLATLTGACVVALGDDIAGLWSSDESLAAQLQEAAK  401

Query  1592  VGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             + GEK W MPLEE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  402   LAGEKFWPMPLEEKYFEGLKSPIADMKNTGPRPGGSITAALFLK  445



>ref|WP_015191783.1| cytosol aminopeptidase [Stanieria cyanosphaera]
 ref|YP_007131076.1| cytosol aminopeptidase [Stanieria cyanosphaera PCC 7437]
 gb|AFZ34110.1| cytosol aminopeptidase [Stanieria cyanosphaera PCC 7437]
Length=490

 Score =   345 bits (886),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 221/464 (48%), Positives = 293/464 (63%), Gaps = 26/464 (6%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSG  526
             I A +  LL+W GD LA+G+ E               L +L+ +L G + E  + E+F G
Sbjct  3     ILATDRSLLDWTGDTLAIGIFEGQTELTGE-------LAQLNEQLAGTIQELIAVEEFEG  55

Query  527   KSGQSIVLRLPGLGS-KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasa  703
             KSG + V RL G  S +++ LVGLG   S          T A   + A+           
Sbjct  56    KSGTTAVTRLMGNSSLRKLILVGLGK--SDKFKLENYQNTAATVVRLAKKDHSLAISFPI  113

Query  704   EGLSVESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKY  877
             +G    S  + A  M  GI+    +DNRFK EP  K   L+++++LGL      +  +K 
Sbjct  114   QG----SPDAVAQTMTEGILLALHQDNRFKSEPEEKEIKLETIDLLGLNGQ---DAAIKR  166

Query  878   SEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELK--MG  1051
             +E+V+SGVI  +ELVNAPAN +TP  +A  A+ IAS Y   L+  IL+ E C++ +  MG
Sbjct  167   AEIVASGVILARELVNAPANEVTPLTMAATAEAIASEYG--LSLEILEQEDCEQFEQGMG  224

Query  1052  SFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKK  1231
             +FLGVA A+  P  FIHL YKP+  + K K+A++GK +TFDSGG NLK+ + S IE MK 
Sbjct  225   AFLGVAKASDIPPKFIHLTYKPTE-TPKRKVAIVGKSLTFDSGGLNLKV-SGSGIETMKM  282

Query  1232  DMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDT  1411
             DM G A   GAAKAIAQ+KP  VEVHFI  A ENMISG  M PGDIL A+NGK IEV +T
Sbjct  283   DMGGGAATLGAAKAIAQLKP-NVEVHFICAATENMISGRAMHPGDILKAANGKTIEVNNT  341

Query  1412  DAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAAD  1591
             DAEGRL LADAL+YA KLG++ +VDLATLTGACI ALG  +AG+++  +DLA ++  AA+
Sbjct  342   DAEGRLTLADALIYAEKLGLDAIVDLATLTGACIIALGDQIAGLWSTDDDLANQIKTAAE  401

Query  1592  VGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             + GEK W+MPLEE Y++ MKS+IADM N G   G +ITA+LF+K
Sbjct  402   LAGEKFWQMPLEEPYFDGMKSAIADMKNTGPRAGGSITAALFLK  445



>ref|WP_010469501.1| aminopeptidase A [Acaryochloris sp. CCMEE 5410]
Length=492

 Score =   345 bits (885),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 226/456 (50%), Positives = 294/456 (64%), Gaps = 27/456 (6%)
 Frame = +2

Query  377   WKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRL  556
             W GD L +G  E   A D         L +LDS L  +L +  SE +F GK G+    R+
Sbjct  13    WSGDYLGIGFFEDSAAIDAG-------LTQLDSSLRDILQDLVSETEFQGKVGEQPWTRI  65

Query  557   PGLGS-KRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEGLSVESKL  730
              GLGS +++ L+GLGS  + T+ + R      A AA+  +A+S  + L     L  +   
Sbjct  66    AGLGSIRKVMLIGLGSQEAFTLDSLRQAAAAFAKAAQKQKAASAGLQLP----LWHDDAP  121

Query  731   SAASAMATGIVSGTFEDNRFKLEP--KTP--TLKSVEILGLGT-GPEIEKKLKYSEVVSS  895
             ++  AMA G+     +D RFK +P  K P    + V +LGL      IEK    ++ + +
Sbjct  122   ASTQAMAEGVELALHQDIRFKSDPDAKKPGEFPQEVHVLGLANQAAAIEK----AQQICA  177

Query  896   GVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAA  1075
             GVI  +ELV APANV+TP ALAE A  IA  +   LT  +L+ E+C+   MG+FLGV+ A
Sbjct  178   GVILTRELVAAPANVVTPSALAETAAQIAEDHG--LTLEVLEREECEAQGMGAFLGVSLA  235

Query  1076  ATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavv  1255
             +  P  FIHL YKPS G+ + KLA++GKG+TFDSGG NLK+G  S IE MK DMAG+   
Sbjct  236   SELPPKFIHLTYKPS-GTPRRKLAIVGKGVTFDSGGLNLKVGG-SGIETMKMDMAGSGAT  293

Query  1256  fgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLIL  1435
              GAAKAI Q+KP  VEVHFIV A ENMISG  + PGDILTASNGK IE+ +TDAEGRL L
Sbjct  294   LGAAKAIGQLKP-DVEVHFIVAAAENMISGHALHPGDILTASNGKTIEINNTDAEGRLTL  352

Query  1436  ADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWR  1615
             ADALV+A K GV+ +VDLATLTGACI ALG  +AG++TP + LA+E+ +A++  GEK WR
Sbjct  353   ADALVFAEKQGVDAIVDLATLTGACIVALGNDIAGMWTPEDSLAEELNQASEQAGEKFWR  412

Query  1616  MPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             MPLEE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  413   MPLEEKYFEGLKSPIADMKNTGPRPGGSITAALFLK  448



>ref|WP_009342536.1| aminopeptidase A [Raphidiopsis brookii]
 gb|EFA73521.1| Peptidase M17, leucyl aminopeptidase-like protein [Raphidiopsis 
brookii D9]
Length=494

 Score =   345 bits (885),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 219/465 (47%), Positives = 298/465 (64%), Gaps = 35/465 (8%)
 Frame = +2

Query  359   EVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQ  538
             + +LL W GD L +G+ E  +    +       L  L+ K GG+ SE  +EE+F+GK+  
Sbjct  10    DTELLNWTGDTLGIGLFEDAVELKDD-------LATLNQKYGGVFSEVIAEEEFTGKANT  62

Query  539   SIVLRLPGLGS--KRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEG  709
             ++V+R+ G  S  +++  +GLG V +  +   R  G T+A  AK  +   +        G
Sbjct  63    TVVIRV-GTHSPIRKVIFIGLGKVDTLKLETLRIAGATLARTAKKQKTKIL--------G  113

Query  710   LSVESKLSAASAMATGIVSGT----FEDNRFKLEP--KTPTLKSVEILGL-GTGPEIEKK  868
             +S     +  +A A  I  G     ++D RFK EP  K P+++++++L L G  P I + 
Sbjct  114   ISFPIYNNQPAATAQAITEGAQLALYQDIRFKSEPEDKNPSIETIDLLNLSGQQPAITR-  172

Query  869   LKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKM  1048
                +E + SGVI  +ELV APAN +TP  +A+ A+ IA  +   L   IL+ E C++L M
Sbjct  173   ---AEQIVSGVILARELVAAPANAVTPITMAQTAQAIAQEHG--LELKILEQEDCEKLGM  227

Query  1049  GSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMK  1228
             G++LGVA A+  P  FIHL YKP + + K KLA++GKG+TFDSGG N+K GA S IE MK
Sbjct  228   GAYLGVAQASDLPPKFIHLIYKPPT-TPKRKLAIIGKGLTFDSGGLNIK-GAGSGIETMK  285

Query  1229  KDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTD  1408
              DM GAA   GAAKAI QIKP  VEVHFI    ENMISG  M PGDIL ASNGK IEV +
Sbjct  286   IDMGGAAATLGAAKAIGQIKP-DVEVHFISAVTENMISGKAMHPGDILKASNGKTIEVNN  344

Query  1409  TDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAA  1588
             TDAEGRL LADALVY  +LG++ MVDLATLTGAC+ ALG  +AG+FTP++++A ++  AA
Sbjct  345   TDAEGRLTLADALVYTDQLGLDAMVDLATLTGACVVALGDDIAGLFTPNDNIASQLQTAA  404

Query  1589  DVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +  GEK+WRMP+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  405   ESSGEKIWRMPMEEKYFEGLKSGIADMKNTGPRYGGSITAALFLK  449



>gb|KEH38071.1| cytosol aminopeptidase family protein [Medicago truncatula]
Length=358

 Score =   340 bits (871),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 193/300 (64%), Positives = 230/300 (77%), Gaps = 10/300 (3%)
 Frame = +2

Query  296   ATLGLTKPNQIQRPKILIAAREVD--LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKL  469
             ATLG T P   + PKI  AA+++D  + EWKGD+LAV VTEKD+ RD   KFQN IL+ L
Sbjct  61    ATLGFTHPANTETPKISFAAKDIDTDVAEWKGDLLAVAVTEKDVTRDGELKFQNSILRTL  120

Query  470   DSKLGGLLSEASSEEDFSGKSGQSIVLRL---PGLGSKRIGLVGLGSVVSSTIAYRTLGE  640
             DSKLGGLL EASSEEDF+GK GQS +LR+    GLGSKR+ L+GLG   SST A++TLGE
Sbjct  121   DSKLGGLLGEASSEEDFTGKLGQSTLLRITPAAGLGSKRLALLGLGPSASSTAAFKTLGE  180

Query  641   TIaaaaksaqassvaval-asaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKT-PT  814
             ++A+AA  AQA+ VAV +  +++GLS  +    ASA+ATG V GTFEDNRFK E K  P 
Sbjct  181   SVASAANFAQAAHVAVVVLPTSKGLSAPN---IASAIATGTVVGTFEDNRFKSESKKKPV  237

Query  815   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  994
             LKS++I+GLGTGPE EKKLKY+  VSSG+I  KELVN+P NVLTPG LAEEA  IAS YS
Sbjct  238   LKSLDIIGLGTGPEFEKKLKYAGDVSSGIILGKELVNSPPNVLTPGVLAEEASKIASTYS  297

Query  995   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DV TA +LD EQCKELKMGS+L VAAA+ NP  FIHLCYKP +G V  KLAL+GKG+TFD
Sbjct  298   DVFTAKVLDAEQCKELKMGSYLAVAAASANPPQFIHLCYKPPTGPVNVKLALVGKGLTFD  357



>ref|WP_028083384.1| aminopeptidase A [Dolichospermum circinale]
Length=490

 Score =   344 bits (883),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 214/456 (47%), Positives = 290/456 (64%), Gaps = 23/456 (5%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             LL+W GD LA+G+ E  +    +       L  LD KL G+ +E  +EE+F+GK   +I 
Sbjct  10    LLDWTGDTLAIGLFEDAVQLTGD-------LATLDQKLAGIFTELIAEEEFTGKVNSTIF  62

Query  548   LRLPGLGS--KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVE  721
              R+ G G+  +++ LVGLG      +   TL   +AA             L  +  L   
Sbjct  63    TRV-GAGNLVRKVILVGLGK--PEALQLETL-RRVAATVARTAKKQKTKTLGISLPLWSN  118

Query  722   SKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVVSS  895
                + A A+  GI    ++D RFK EP  K+P ++++++LGL    E +  +  ++ + S
Sbjct  119   DPAATAQAITEGIELALYQDIRFKSEPEDKSPNIETIDLLGLA---EQQAAITRADQIVS  175

Query  896   GVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAA  1075
             GVI  ++LV APAN +TP  +AE A  IA  Y   L   +L+  +C++L MG+FLGVA A
Sbjct  176   GVILARQLVAAPANAVTPITMAETAGAIAHEYG--LQLEVLEQAECQKLGMGAFLGVAQA  233

Query  1076  ATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavv  1255
             +  P  FIHL YKP++ + + KLA++GKG+TFDSGG N+K GA S IE MK DM GAA  
Sbjct  234   SELPPKFIHLIYKPAT-TPRRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGGAAAT  291

Query  1256  fgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLIL  1435
              GAAK I Q+KP  VEVHFI    ENMISG  M PGDILTASNGK IEV +TDAEGRL L
Sbjct  292   LGAAKVIGQLKP-DVEVHFISAVTENMISGKAMHPGDILTASNGKTIEVNNTDAEGRLTL  350

Query  1436  ADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWR  1615
             ADALVYA KLGV+ +VDLATLTGAC+ ALG  +AG+FTP + +A ++  AA+  GEK+WR
Sbjct  351   ADALVYADKLGVDAIVDLATLTGACVVALGEDIAGLFTPDDAMASQLQTAAETAGEKIWR  410

Query  1616  MPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +P+E+ Y++ +KS IADM N G   G +ITA+LF+K
Sbjct  411   LPMEDKYFDGLKSGIADMKNTGPRYGGSITAALFLK  446



>ref|WP_012629140.1| aminopeptidase A [Cyanothece sp. PCC 7425]
 ref|YP_002484445.1| leucyl aminopeptidase [Cyanothece sp. PCC 7425]
 sp|B8HTK3.1|AMPA_CYAP4 RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Cyanothece sp. PCC 7425]
 gb|ACL46084.1| Leucyl aminopeptidase [Cyanothece sp. PCC 7425]
Length=493

 Score =   344 bits (882),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 218/460 (47%), Positives = 293/460 (64%), Gaps = 33/460 (7%)
 Frame = +2

Query  374   EWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  553
             +W GD+LA+G  E  +    +       L +LD KL G+L E  +E +F GK+G+S + R
Sbjct  12    DWAGDLLALGFFEDQVELSGS-------LAELDQKLDGILQELIAETEFKGKAGKSAIAR  64

Query  554   LPGLGS-KRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEGLSV---  718
             +      ++I ++GLG      +   R    TIA +AK  +  ++        G+S+   
Sbjct  65    ISSKSPIRKIMILGLGKAEDFKLDTLRRTAATIARSAKKEKGKTL--------GISLPLW  116

Query  719   -ESKLSAASAMATGIVSGTFEDNRFKLEPK----TPTLKSVEILGLGTGPEIEKKLKYSE  883
                  S   A+A GI     +D+RFK   +        + +++LGLG   +    ++ ++
Sbjct  117   NNDPTSTTQAIAEGIELALHQDHRFKSNSEDNNDNHAPEQIQLLGLG---DQTTAIERAQ  173

Query  884   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLG  1063
              + SGVI  +ELV APANV+TP  LAE A+++A  Y   L   +L   +C+ L MG+FLG
Sbjct  174   RICSGVILARELVAAPANVVTPVTLAETARDLAQEYG--LDVEVLGQAECEALGMGAFLG  231

Query  1064  VAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMag  1243
             VA A+  P  FIHL Y+PS G+ + KLA++GKG+TFDSGG NLK G  S IE MK DMAG
Sbjct  232   VALASDLPPQFIHLTYRPS-GTPRRKLAIIGKGLTFDSGGLNLKTGG-SGIETMKMDMAG  289

Query  1244  aavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEG  1423
             +A   GAAK + Q+KP  VEVHFIV A ENMISG  M PGDILTASNGK IEV +TDAEG
Sbjct  290   SAATLGAAKVVGQLKP-DVEVHFIVAATENMISGRAMHPGDILTASNGKTIEVNNTDAEG  348

Query  1424  RLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGE  1603
             RL LADALV+A KLGV+ +VDLATLTGACI ALG  +AG+++  + LA+++L+AAD  GE
Sbjct  349   RLTLADALVFAEKLGVDALVDLATLTGACIVALGDDIAGLWSSDDALAEQILQAADHSGE  408

Query  1604  KLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             KLWRMP+EE Y+E MKS IADM N G   G +ITA+LF+K
Sbjct  409   KLWRMPMEEKYFEGMKSQIADMKNTGPRAGGSITAALFLK  448



>ref|WP_002801043.1| aminopeptidase A [Microcystis aeruginosa]
 emb|CCI38639.1| putative cytosol aminopeptidase [Microcystis aeruginosa PCC 9701]
Length=491

 Score =   343 bits (881),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 225/464 (48%), Positives = 286/464 (62%), Gaps = 26/464 (6%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEK--DMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             I + +  LL W GD LA+G+ E   ++A +         L +L+ KLGG L +  SE +F
Sbjct  3     IRSTDTSLLTWTGDTLALGLPEGAVEIAGE---------LAELNDKLGGTLEDLISETEF  53

Query  521   SGKSGQSIVLRLPGLGS-KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  697
              GK G S   RL G    +++ LVGLG      +    L     A     Q S       
Sbjct  54    EGKLGSSAATRLGGGDPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISL  113

Query  698   saEGLSVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKL  871
                G     + + A A+  G++    +D RFK   E K   L +VE+LGLG   E    +
Sbjct  114   PVVG----DQSATAGAITEGLLLANHQDTRFKSTKEEKGAKLATVELLGLG---EQASAI  166

Query  872   KYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMG  1051
               +E + SGVI  +ELVNAPAN +TP  +AE A+ IA+ Y   L+  IL+ E+C+ L MG
Sbjct  167   AKAEQICSGVILARELVNAPANAVTPLTMAETAEQIATEYG--LSLNILEQEECESLGMG  224

Query  1052  SFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKK  1231
             +FLGVA A+  P  FIHL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK 
Sbjct  225   AFLGVAKASDIPPKFIHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKT  282

Query  1232  DMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDT  1411
             DM G A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IEV +T
Sbjct  283   DMGGGAATLGAAKAIAQLRPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIEVNNT  341

Query  1412  DAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAAD  1591
             DAEGRL LAD LV+A KL V+ +VDLATLTGAC+ ALG  +AG+++  E LA ++ EAA 
Sbjct  342   DAEGRLTLADGLVFAEKLEVDAIVDLATLTGACVVALGDDIAGLWSSDESLAAQIQEAAK  401

Query  1592  VGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             + GEK W MPLEE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  402   LAGEKFWPMPLEEKYFEGLKSPIADMKNTGPRPGGSITAALFLK  445



>ref|WP_009556547.1| leucyl aminopeptidase [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ69637.1| leucyl aminopeptidase [Oscillatoriales cyanobacterium JSC-12]
Length=492

 Score =   343 bits (881),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 229/455 (50%), Positives = 298/455 (65%), Gaps = 22/455 (5%)
 Frame = +2

Query  371   LEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVL  550
             LEW GD LAVG+ E     D      +L++  LD KL G + E  +E +F GK+  S+  
Sbjct  11    LEWSGDALAVGLFE-----DHVELTDDLVV--LDEKLSGTIQELIAEGEFKGKASSSVSA  63

Query  551   RLPGLGS--KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVES  724
             R+ G GS  ++I LVGLG      +    L    A AAK+A+             +  E 
Sbjct  64    RV-GRGSNIRKIILVGLGK--PDDLKLEGLRRAGAVAAKTAKKEKAKTLGIRLP-ICHED  119

Query  725   KLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSG  898
               ++A A+A GI     +D RFK +P  K   L+ +E+LGLG     E  +  +  + SG
Sbjct  120   AAASAQAIAEGIELALHQDTRFKSDPEDKGAKLEMIELLGLGGQ---EAAITRARQLCSG  176

Query  899   VIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAA  1078
             VI  +ELV APAN++TP  LAE A  IA+ Y   L   IL+ ++C++L MG+FLGVA A+
Sbjct  177   VILARELVAAPANIVTPITLAETALAIANEYG--LDVEILERDECEKLGMGAFLGVAQAS  234

Query  1079  TNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvf  1258
               P  FIHL Y+P+S + + KLA++GKG+TFDSGG N+K  + S IE+MK DM GAA   
Sbjct  235   DLPPKFIHLTYRPAS-TPRRKLAIIGKGLTFDSGGLNIK-PSGSGIEMMKTDMGGAAATL  292

Query  1259  gaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILA  1438
             GAAKAIAQ+KPA VEVHFI  A ENMISG  M PGDILTASNGK IE+ +TDAEGRL LA
Sbjct  293   GAAKAIAQLKPADVEVHFISAATENMISGHAMHPGDILTASNGKTIEINNTDAEGRLTLA  352

Query  1439  DALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRM  1618
             DALV+A KLGV+ +VDLATLTGAC+ ALG  +AG+++P++DLA E++ AAD  GEKLW+M
Sbjct  353   DALVFAEKLGVDAIVDLATLTGACVIALGDDIAGLWSPNDDLAAELVAAADRAGEKLWKM  412

Query  1619  PLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             P+EE Y+E MKS +ADM N G   G AITA+LF+K
Sbjct  413   PMEEKYFEGMKSVVADMKNTGPRPGGAITAALFLK  447



>ref|WP_015211045.1| leucyl aminopeptidase [Cylindrospermum stagnale]
 ref|YP_007150491.1| leucyl aminopeptidase [Cylindrospermum stagnale PCC 7417]
 gb|AFZ27811.1| leucyl aminopeptidase [Cylindrospermum stagnale PCC 7417]
Length=490

 Score =   343 bits (880),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 222/459 (48%), Positives = 292/459 (64%), Gaps = 29/459 (6%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             LLEW GD LAVG+ E  +    +       L  LD K  G+  E  +EE+F+ K+  +I 
Sbjct  10    LLEWAGDTLAVGLFEDAVELTGD-------LAALDQKFAGIFKELIAEEEFTAKANSTIF  62

Query  548   LRLPGLGS-KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV--  718
              R+  +   K++ LVGLG      +   TL    AA AK A+            G+S+  
Sbjct  63    TRVGAVNQVKKVILVGLGK--PEALKLDTLRRVAAAVAKVAKKQKTKTL-----GISLPL  115

Query  719   --ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEV  886
                   + A A+A G     ++DNRFK EP  K P ++++++LGL      E  +  +  
Sbjct  116   WNNDPAATAQAIAEGAQLALYQDNRFKSEPEDKGPQIETIDLLGLSGQ---EAAVTRANQ  172

Query  887   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1066
             + SGV   ++LV APAN +TP  LAE A+ IA+ +   L   IL+ E C++L MG+FLGV
Sbjct  173   IVSGVNLARQLVAAPANAVTPITLAETAQAIATEHG--LQVEILEREDCEKLGMGAFLGV  230

Query  1067  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1246
             A A+  P  FIHL YKP + + K KLA++GKG+TFDSGG N+K GA S IE MK DM GA
Sbjct  231   AQASDLPPKFIHLTYKPET-TAKRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGGA  288

Query  1247  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGR  1426
             A   GAAKAIAQIKP  VEVHFI  A ENMISG  M PGD+LTASNGK IEV +TDAEGR
Sbjct  289   AATLGAAKAIAQIKP-DVEVHFISAATENMISGHAMHPGDVLTASNGKTIEVNNTDAEGR  347

Query  1427  LILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEK  1606
             L LADALVYA KLG++ +VDLATLTGAC+ ALG  +AG+FTP + +A ++ +AA+  GEK
Sbjct  348   LTLADALVYADKLGLDAIVDLATLTGACVVALGNDIAGLFTPDDAVASQLEKAAESAGEK  407

Query  1607  LWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +WR+P+E+ Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  408   IWRLPMEDKYFEGLKSGIADMKNTGPRPGGSITAALFLK  446



>ref|XP_005644543.1| hypothetical protein COCSUDRAFT_54513 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19999.1| hypothetical protein COCSUDRAFT_54513 [Coccomyxa subellipsoidea 
C-169]
Length=531

 Score =   344 bits (883),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 219/469 (47%), Positives = 298/469 (64%), Gaps = 20/469 (4%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEKDMARDPNSK--FQNLILQKLDSKLGGLLSEASSEEDF  520
             I+A   D   WKGD+LAVG+ E  ++        FQ+  L  LD  L G+L+E   + +F
Sbjct  28    ISASSGDPAAWKGDLLAVGIFEDALSDKSGDGGVFQDAELAALDGSLDGILTELIEKAEF  87

Query  521   SGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTI-------AYRTLGETIaaaaksaqass  679
              GK G S   RL G  +  +G+VGLG   ++ +        Y+  G  +AAAAK+ +A+S
Sbjct  88    QGKQGSSTFTRLKG-NAHYVGVVGLGKKSAAAVVPDWGVSCYQAFGGAVAAAAKNHKAAS  146

Query  680   vavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEI  859
              A+A+   + LS     +A   +  G++ G +E +RFK +  +P LKS++IL      + 
Sbjct  147   AAIAVVGGDPLSE----TAVEKLTVGVLLGGYEASRFKNKAASPPLKSLDILSAAA--DA  200

Query  860   EKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKE  1039
                +      + GV+  + LV  PAN+ TP  LA+ A  IA    DV    I++ + C+E
Sbjct  201   AAAIGRGHGAAKGVLLSRYLVETPANICTPTYLAKVAAVIAESAPDVFKLEIIEEDACEE  260

Query  1040  LKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIE  1219
             + MG FLGV A +  P+ FIHL Y P  G VK  + L+GKG+TFDSGGYNLK+G    I+
Sbjct  261   MGMGCFLGVTACSEEPAKFIHLTYTPK-GEVKKVVGLVGKGVTFDSGGYNLKVGG--MID  317

Query  1220  LMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIE  1399
             +MK DM GAA V GAA+A+A ++PAGV+VH I  ACENMI G G+RPGDIL A+NGK +E
Sbjct  318   MMKFDMGGAAAVLGAAQALASLQPAGVQVHIITAACENMIDGRGLRPGDILQAANGKTVE  377

Query  1400  VTDTDAEGRLILADALVYAS-KLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEV  1576
             V +TDAEGRL LADAL YA  K GV+ +VD+ATLTGAC+ ALG  VAG+FTPSE +A  +
Sbjct  378   VNNTDAEGRLTLADALWYAQEKCGVQSVVDVATLTGACMVALGNQVAGVFTPSEAMAASL  437

Query  1577  LEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
              +A+   GEK+WR+P+E+SYWE MKS IADM NAG   G AITA+LF++
Sbjct  438   KDASKTAGEKVWRLPMEDSYWEQMKSPIADMKNAGGRLGGAITAALFLR  486



>ref|WP_015124149.1| leucyl aminopeptidase [Synechococcus sp. PCC 6312]
 ref|YP_007061148.1| leucyl aminopeptidase [Synechococcus sp. PCC 6312]
 gb|AFY60605.1| leucyl aminopeptidase [Synechococcus sp. PCC 6312]
Length=492

 Score =   343 bits (879),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 222/467 (48%), Positives = 292/467 (63%), Gaps = 30/467 (6%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGV-TEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFS  523
             I A    +L W GD++A G  TE D    P        L +L     G+L E   +  F 
Sbjct  3     IQAPTTAVLNWSGDLIAFGFFTESDAVVWPAE------LAELPQAWDGILPELIHDAKFQ  56

Query  524   GKSGQSIVLRL-PGLGSKRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavala  697
             GK+G S+ +RL P    K+I LVGLG+    T+   R    T+  +A+     +V     
Sbjct  57    GKAGTSLTVRLSPKSPVKKIMLVGLGAASDFTLETLRRAAATVVKSARKDHDKTV-----  111

Query  698   saEGLSVE-SKLSAASAMATGIVSGTFEDNRFKLEPKTPT----LKSVEILGLGTGPEIE  862
                GL V         A+A GI  G  +D RFK +P+        +S+++LG G    ++
Sbjct  112   ---GLYVPIYDNDPTQALAEGIHLGLHQDLRFKSDPEAKENLAFPESIDLLGPGV---VQ  165

Query  863   KKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKEL  1042
             + L  + + + GVI  +ELVNAPANV+TP  LAE+A+ IAS Y   L + IL+   C+ L
Sbjct  166   EALPIAAIRAEGVILARELVNAPANVITPVTLAEKAQAIASTYG--LESEILEQADCEAL  223

Query  1043  KMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIEL  1222
              MG++LGVA A+  P  FIHL Y+P  G+   KLA++GKG+TFDSGG NLK+ + S IE 
Sbjct  224   GMGAYLGVAQASDLPPKFIHLTYRPQ-GTATRKLAIIGKGLTFDSGGLNLKV-SGSGIET  281

Query  1223  MKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEV  1402
             MK DMAG+A V GAA+ IAQ+KP+  EVHFIV A ENMISG  M PGDILTA+NGK IE+
Sbjct  282   MKMDMAGSAAVLGAAQVIAQLKPSA-EVHFIVAATENMISGKAMHPGDILTAANGKTIEI  340

Query  1403  TDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLE  1582
              +TDAEGRL LADAL++A KLGV+ +VDLATLTGACI ALG S+AG++   + LA  +L 
Sbjct  341   NNTDAEGRLTLADALIFAEKLGVDAIVDLATLTGACIVALGESIAGLWATDQPLADHLLT  400

Query  1583  AADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             AA+  GEK W+MP+EE Y+E MKS IADM N G   G +ITA+LF+K
Sbjct  401   AANQAGEKFWQMPMEEKYFEGMKSPIADMKNTGPRAGGSITAALFLK  447



>ref|WP_006277890.1| aminopeptidase A [Cylindrospermopsis raciborskii]
 gb|EFA69277.1| Peptidase M17, leucyl aminopeptidase-like protein [Cylindrospermopsis 
raciborskii CS-505]
Length=494

 Score =   343 bits (879),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 217/460 (47%), Positives = 294/460 (64%), Gaps = 25/460 (5%)
 Frame = +2

Query  359   EVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQ  538
             + +LL W GD L +G+ E  +    +       L  L+ K GG+ SE  +EE+F+GK+  
Sbjct  10    DTELLNWTGDTLGIGLFEDAVELKDD-------LATLNQKYGGVFSEVIAEEEFTGKANT  62

Query  539   SIVLRLPGLGS--KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGL  712
             ++V+R+ G  S  +++  +GLG V   T+   TL    AA             LA +  +
Sbjct  63    TVVIRV-GANSPIRKVIFIGLGKV--DTLKLETL-RIAAATLARTAKKQKTKTLAISFPI  118

Query  713   SVESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGL-GTGPEIEKKLKYSE  883
                   + A A+  G     ++D RFK EP  K P ++++++L L G  P I +    +E
Sbjct  119   YNNQPAATAQAITEGAQLALYQDIRFKSEPEDKNPPIETIDLLNLSGQQPAITR----AE  174

Query  884   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLG  1063
              + SGVI  +ELV APAN +TP  +A+ A+ IA    + L   IL+ E C++L MG++LG
Sbjct  175   QIVSGVILARELVAAPANAVTPITMAQTAQAIAQ--ENGLELKILEQEDCEKLGMGAYLG  232

Query  1064  VAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMag  1243
             VA A+  P  FIHL YKP++ + K KLA++GKG+TFDSGG N+K GA S IE MK DM G
Sbjct  233   VAQASDLPPKFIHLIYKPAT-TPKRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGG  290

Query  1244  aavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEG  1423
             AA   GAAKAI QIKP  VEVHFI    ENMISG  M PGDIL ASNGK IEV +TDAEG
Sbjct  291   AAATLGAAKAIGQIKP-DVEVHFISAVTENMISGKAMHPGDILKASNGKTIEVNNTDAEG  349

Query  1424  RLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGE  1603
             RL LADALVY  +LG++ MVDLATLTGAC+ ALG ++AG+FTP++++A ++  AA+  GE
Sbjct  350   RLTLADALVYTDQLGLDAMVDLATLTGACVVALGDNIAGLFTPNDNIASQLQTAAESSGE  409

Query  1604  KLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             K+WRMP+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  410   KIWRMPMEEKYFEGLKSGIADMKNTGPRYGGSITAALFLK  449



>ref|WP_007311314.1| aminopeptidase A [Crocosphaera watsonii]
 gb|EHJ12052.1| Cytosol aminopeptidase PepA [Crocosphaera watsonii WH 0003]
 emb|CCQ62417.1| Cytosol aminopeptidase PepA [Crocosphaera watsonii WH 0401]
 emb|CCQ57768.1| Cytosol aminopeptidase PepA [Crocosphaera watsonii WH 0005]
 emb|CCQ66088.1| Cytosol aminopeptidase PepA [Crocosphaera watsonii WH 0402]
Length=489

 Score =   342 bits (878),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 218/456 (48%), Positives = 289/456 (63%), Gaps = 24/456 (5%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             LL+W GD +A+G+ E +             L +LD K GG L+E   E +F GKSG S V
Sbjct  10    LLDWSGDAIALGLFEDETILTGE-------LSQLDEKTGGTLAELIEETEFKGKSGSSAV  62

Query  548   LRLPGLGS--KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVE  721
              R+ G GS  +++ L+GLG     ++    LG    A     +               VE
Sbjct  63    TRIGG-GSAIRKLILIGLGKKDELSLDSLRLGAAAVARLGKKEKVKSLGINFPV----VE  117

Query  722   SKLSAASAMATGIVSGTFEDNRFKLEPKTPTLK--SVEILGLGTGPEIEKKLKYSEVVSS  895
             ++ S  +A+A G++    +DNRFK EP+   LK  +V ILG+G   E    ++ ++ ++S
Sbjct  118   NEASTTTAIAEGMILSLHQDNRFKSEPEDKPLKLETVHILGVGAQSE---AVEQAQTITS  174

Query  896   GVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAA  1075
             GVI  +ELV APAN + P   AE A+ +A+ Y   L   IL+ E+C++L MG+FLGVA A
Sbjct  175   GVILARELVAAPANSVNPVTFAETAQTLATDYG--LDIEILEQEECEKLGMGAFLGVAKA  232

Query  1076  ATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavv  1255
             +  P  FIHL YKP++ + K KLA++GK +TFDSGG NLK G+ S IE MK DM G A  
Sbjct  233   SDLPPKFIHLTYKPAA-TPKRKLAIVGKSLTFDSGGLNLK-GSGSGIETMKMDMGGGAAT  290

Query  1256  fgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLIL  1435
              GAAKAIAQ+KP  VEVHF+  A ENMISG  M PGDILTASNGK IEV +TDAEGRL L
Sbjct  291   LGAAKAIAQLKP-DVEVHFVCAATENMISGRAMHPGDILTASNGKTIEVNNTDAEGRLTL  349

Query  1436  ADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWR  1615
             ADALVYA KL V+ +VDLATLTGAC+ ALG  ++G+++  E L +E+  A++  GEK W 
Sbjct  350   ADALVYAEKLEVDAIVDLATLTGACLVALGNDISGLWSTDETLTEELKTASETAGEKFWV  409

Query  1616  MPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             MP+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  410   MPMEEKYFEGLKSPIADMKNTGPRAGGSITAALFLK  445



>ref|WP_012406927.1| aminopeptidase A [Nostoc punctiforme]
 ref|YP_001863841.1| leucyl aminopeptidase [Nostoc punctiforme PCC 73102]
 sp|B2J3G8.1|AMPA_NOSP7 RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Nostoc punctiforme PCC 73102]
 gb|ACC78898.1| peptidase M17, leucyl aminopeptidase domain protein [Nostoc punctiforme 
PCC 73102]
Length=493

 Score =   342 bits (878),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 226/455 (50%), Positives = 288/455 (63%), Gaps = 21/455 (5%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             LLEW GD LA+G+ E  +            L  LD K  G+L E  +EE+F GK+  +I 
Sbjct  10    LLEWAGDSLAIGLFEDAVELTGE-------LATLDQKFSGVLKELIAEEEFKGKANSTIF  62

Query  548   LRL-PGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVES  724
              R+ PG   +++ LVGLG      +   TL    AA A+ A+     +   S   L    
Sbjct  63    TRVNPGRPVRKLILVGLGK--PDALKLDTLRRAAAAVARVAKKQKSKILGFSFP-LWNND  119

Query  725   KLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSG  898
               ++A A+A G+    ++D RFK EP  K   +++V++LG       E  +  +  + SG
Sbjct  120   PAASAQAIAEGVELALYQDIRFKSEPEDKGSQIETVDLLGFSGQ---EAAITLANQIVSG  176

Query  899   VIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAA  1078
             V   +ELV APAN +TP  LAE A+ IA  Y   L   IL+ E C++L MG+FLGVA A+
Sbjct  177   VNLARELVAAPANAVTPITLAETAQAIAKDYG--LQVEILEKEDCEKLGMGAFLGVAQAS  234

Query  1079  TNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvf  1258
               P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K GA S IE MK DM GAA   
Sbjct  235   ELPPKFIHLTYKPE-GTPKKKLAIIGKGVTFDSGGLNIK-GAGSGIETMKMDMGGAAATL  292

Query  1259  gaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILA  1438
             GAAKAIAQIKP  VEVHFI    ENMISG  M PGDILTASNGK IEV +TDAEGRL LA
Sbjct  293   GAAKAIAQIKP-DVEVHFISAVAENMISGRAMHPGDILTASNGKTIEVNNTDAEGRLTLA  351

Query  1439  DALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRM  1618
             DALVYA KLG++ +VDLATLTGA + ALG  +AG++TP +D+A ++ +AA   GEK+WRM
Sbjct  352   DALVYAEKLGLDAIVDLATLTGANVIALGDDIAGLYTPDDDVASQIEKAAQTSGEKIWRM  411

Query  1619  PLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             P+EE Y+E +KS IADM N G   G AITA+LF+K
Sbjct  412   PMEEKYFEGLKSGIADMKNTGPRPGGAITAALFLK  446



>dbj|BAP18524.1| leucyl aminopeptidase [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=491

 Score =   342 bits (878),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 223/467 (48%), Positives = 282/467 (60%), Gaps = 31/467 (7%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSG  526
             I   E  LL W GD LA+G  E  M            LQKLD KL   L E  +E +F G
Sbjct  3     IRGTETPLLNWTGDALALGFFEDSMELTET-------LQKLDEKLNRNLRELITETEFEG  55

Query  527   KSGQSIVLRLPGLGS--KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalas  700
             KS  ++V R+ G GS  ++I LVGLG     T+    LG    A                
Sbjct  56    KSSNNVVTRI-GSGSPVQKIILVGLGKTEDLTLDTVRLGAATIARLAKQAKVKTL-----  109

Query  701   aEGLSV----ESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLK--SVEILGLGTGPEIE  862
               G+++    +   S  SA+  G++    +DNRFK EP    LK   VEILG G   E  
Sbjct  110   --GINLPVVNDDAASTVSAITQGVILPLHQDNRFKSEPDKNELKLEKVEILGCG---EHR  164

Query  863   KKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKEL  1042
             + +  ++ + SGVI  +ELV APAN +TP   AE A+ IA  +   L   IL+ ++C+ L
Sbjct  165   EAINKAQTLCSGVILARELVAAPANSVTPVTFAEIAQTIAQDHG--LDIEILERKECQNL  222

Query  1043  KMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIEL  1222
              MG+FLGVA A+  P  FIH+ YKPS    K KLA++GK +TFDSGG NLK G+ S IE 
Sbjct  223   GMGAFLGVAQASDLPPKFIHITYKPSETPQK-KLAIVGKSLTFDSGGLNLK-GSQSGIET  280

Query  1223  MKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEV  1402
             MK DM G A   GAAK I Q+KP  VEVHFI    ENMISG  M PGDILTASNGK IEV
Sbjct  281   MKMDMGGGAATLGAAKVIGQLKP-DVEVHFICAVTENMISGRAMHPGDILTASNGKTIEV  339

Query  1403  TDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLE  1582
              +TDAEGRL LADALV+A KLGV+ +VDLATLTGAC+ ALG +++G+++  E LA ++ +
Sbjct  340   NNTDAEGRLTLADALVFAEKLGVDAIVDLATLTGACVVALGDNISGLWSTDETLATQIKK  399

Query  1583  AADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             A  + GEK+W MPLEE Y+E +KS IAD+ N G   G AITA+LF+K
Sbjct  400   AGAMAGEKVWEMPLEEKYFEGLKSPIADIKNTGPRAGGAITAALFLK  446



>ref|WP_009631961.1| leucyl aminopeptidase [Synechocystis sp. PCC 7509]
Length=490

 Score =   342 bits (878),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 219/467 (47%), Positives = 301/467 (64%), Gaps = 31/467 (7%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSG  526
             I A +  LL+W GD +A+G+ E  +        Q+  L +LD+K  G+L E  +E +F G
Sbjct  3     IRAVDTPLLDWAGDAIALGLFEDTLE-------QSEELTQLDAKFAGVLKEVIAETEFKG  55

Query  527   KSGQSIVLRLPGLGS-KRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalas  700
             K G S+V R+ G  S +++ LVGLG      +  +R     IA  AK  +  +V      
Sbjct  56    KDGSSVVTRVGGSSSVRKVLLVGLGKPDKLKLDNWRRCAAAIAKLAKKEKCQTV------  109

Query  701   aEGLSV----ESKLSAASAMATGIVSGTFEDNRFKLEPKTPT--LKSVEILGLGTGPEIE  862
               G+S+        + A A++ GI     +D RFK EP+  +  L+ V+++G       E
Sbjct  110   --GISLPIWNNEPGATAGAISEGIELALHQDRRFKSEPEENSFNLERVDLIGFSGQ---E  164

Query  863   KKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKEL  1042
               +  ++ + SGVI  ++LV APAN +TP ++A+ A+ IAS +   L   IL+ E+C++L
Sbjct  165   NAISRAQQICSGVILARQLVTAPANTVTPMSMAQTAEEIASTHG--LQVEILEREECEQL  222

Query  1043  KMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIEL  1222
              MG+FLGVA A+  P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K GA S IE 
Sbjct  223   GMGAFLGVAQASEMPPKFIHLTYKPE-GTPKRKLAIIGKGVTFDSGGLNIK-GAGSGIET  280

Query  1223  MKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEV  1402
             MK DM GAA   GAAKAI+Q+KP  VEVHFI    ENMISG  + PGDILTASNGK IEV
Sbjct  281   MKMDMGGAAATLGAAKAISQLKP-DVEVHFISAVTENMISGRAIHPGDILTASNGKTIEV  339

Query  1403  TDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLE  1582
              +TDAEGRL LADALV+  KLGV+ +VDLATLTGAC+ ALG  +AG+++  ++LA ++++
Sbjct  340   NNTDAEGRLTLADALVFTEKLGVDAIVDLATLTGACVIALGDDIAGLWSSDDELANQLVQ  399

Query  1583  AADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
              AD  GEK+WRMP+EE Y+E +KSSIADM N G   G +ITA+LF++
Sbjct  400   GADKAGEKIWRMPMEEKYFEGLKSSIADMKNTGPRPGGSITAALFLQ  446



>ref|WP_016949514.1| aminopeptidase A [Anabaena sp. PCC 7108]
Length=490

 Score =   342 bits (878),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 217/460 (47%), Positives = 295/460 (64%), Gaps = 31/460 (7%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             LL+W GD LA+ + E  +            L  LD K  G+L E  +EE+F+GK   +I 
Sbjct  10    LLDWSGDTLAIALFEDAVELTGE-------LAALDEKFAGILQEIIAEEEFTGKVNSTIF  62

Query  548   LRL-PGLGSKRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEGLSV-  718
              R+  G   +++ LVGLG      +  +R +  T+A  AK  +  ++        G+S+ 
Sbjct  63    TRVGAGNNVRKLILVGLGKPDGLKLETFRRVAATVARTAKKQKTKTL--------GISLP  114

Query  719   ---ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSE  883
                    + A A+A G     ++D RFK EP  K+P ++++++LGL TG E    +  + 
Sbjct  115   VFNNDPAATAQAIAEGAQLALYQDTRFKSEPEDKSPNIETIDLLGL-TGQE--AAITRAN  171

Query  884   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLG  1063
              + SGVI  ++LV APAN +TP  +AE A+ IA+ Y   L   IL+  +C++L MG+FLG
Sbjct  172   QIVSGVILARQLVAAPANAVTPITMAETAQAIANEYG--LQLEILEQAECEKLGMGAFLG  229

Query  1064  VAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMag  1243
             VA A+  P  FIHL YKP++ + + KLA++GKG+TFDSGG N+K GA S IE MK DM G
Sbjct  230   VAQASDLPPKFIHLIYKPAT-TPRRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGG  287

Query  1244  aavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEG  1423
             AA   GAAKAI Q+KP  VEVHFI    ENMISG  M PGDILTASNGK IEV +TDAEG
Sbjct  288   AAATLGAAKAIGQLKP-DVEVHFISAVTENMISGRAMHPGDILTASNGKTIEVNNTDAEG  346

Query  1424  RLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGE  1603
             RL LADALVYA KLGV+ +VDLATLTGAC+ ALG  +AG+FTP + +A ++  A++  GE
Sbjct  347   RLTLADALVYADKLGVDAIVDLATLTGACVVALGDDIAGLFTPDDAVASQLQTASEAAGE  406

Query  1604  KLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             K+WRMP+E+ Y++ +KS IADM N G   G +ITA+LF+K
Sbjct  407   KIWRMPMEDKYFDGLKSGIADMKNTGPRYGGSITAALFLK  446



>ref|WP_002757690.1| aminopeptidase A [Microcystis aeruginosa]
 emb|CCI00627.1| putative cytosol aminopeptidase [Microcystis aeruginosa PCC 9717]
Length=490

 Score =   342 bits (878),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 224/463 (48%), Positives = 285/463 (62%), Gaps = 25/463 (5%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEK--DMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             I + +  LL W GD LA+G+ E   ++A +         L +L+ KLGG L +  SE +F
Sbjct  3     IRSTDTSLLTWTGDTLALGLPEGTIEIAGE---------LAELNDKLGGNLGDLISETEF  53

Query  521   SGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalas  700
              GK G S   RL G   +++ LVGLG      +    L     A     Q S        
Sbjct  54    EGKLGSSAATRLGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISLP  113

Query  701   aEGLSVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLK  874
               G     + + A A+  G++    +D RFK   E K   L +VE+LGLG   E    + 
Sbjct  114   VVG----DQSATAGAITEGLLLANHQDTRFKSTKEEKGAKLATVELLGLG---EQTSAIA  166

Query  875   YSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGS  1054
              +E + SGVI  +ELVNAPAN +TP  +AE A+ IA+ Y   L+  IL+ E+C+ L MG+
Sbjct  167   KAEQICSGVILARELVNAPANTVTPLTMAETAEQIAAEYG--LSLKILEQEECESLGMGA  224

Query  1055  FLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKD  1234
             FLGVA A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK D
Sbjct  225   FLGVAKASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMD  282

Query  1235  MagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTD  1414
             M G A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IEV +TD
Sbjct  283   MGGGAATLGAAKAIAQLQPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIEVNNTD  341

Query  1415  AEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADV  1594
             AEGRL LAD LV+A KL V+ +VDLATLTGAC+ ALG  +AG+++  E L  ++ EAA +
Sbjct  342   AEGRLTLADGLVFAEKLEVDAIVDLATLTGACVIALGDDIAGLWSSDESLTVQLQEAAKL  401

Query  1595  GGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
              GEK W MPLEE Y+E MKS IADM N G   G +ITA+LF+K
Sbjct  402   AGEKFWPMPLEEKYFEGMKSQIADMKNTGPRPGGSITAALFLK  444



>ref|WP_015784948.1| aminopeptidase A [Cyanothece sp. PCC 8802]
 ref|YP_003139549.1| leucyl aminopeptidase [Cyanothece sp. PCC 8802]
 gb|ACV02714.1| Leucyl aminopeptidase [Cyanothece sp. PCC 8802]
Length=491

 Score =   342 bits (876),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 221/456 (48%), Positives = 292/456 (64%), Gaps = 23/456 (5%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
              L+W GD LA+G+ E+              L +LD KL G L E   E +F GK+G   V
Sbjct  10    FLDWTGDALALGIFEEGTQITGE-------LSQLDGKLTGTLQELIQEAEFEGKAGTKAV  62

Query  548   LRLPGLGS--KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVE  721
              R+ G  S  +++ LVGLG   +  +   ++ E   A A+ A+   V     +   ++ +
Sbjct  63    TRV-GSNSPIRKVMLVGLGK--AEDLQLNSVREAAGAIARLAKLEKVKTLGINLPVVNND  119

Query  722   SKLSAASAMATGIVSGTFEDNRFKLEPKTPTLK--SVEILGLGTGPEIEKKLKYSEVVSS  895
                  ASA+A GI+    +DNRFK +P+   LK  +V+ILG G   E  + +  ++ +SS
Sbjct  120   GA-KTASAIAEGILLALHQDNRFKSDPQENALKLENVDILGCG---EATEAINRAQTLSS  175

Query  896   GVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAA  1075
             GVI  +ELVN+PAN +TP   AE A+ IA   +  LT  IL+ E C++L MGSFLGVA A
Sbjct  176   GVILARELVNSPANTITPVTFAETAQEIAQ--TSGLTCEILEQEDCEKLGMGSFLGVAKA  233

Query  1076  ATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavv  1255
             +  P  FIHL YKPS G+ K KLA++GK +TFD GG NLK+ A +SIE+MK DM G A  
Sbjct  234   SDLPPKFIHLTYKPS-GTPKKKLAIVGKSLTFDCGGLNLKV-AGASIEMMKMDMGGGAAT  291

Query  1256  fgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLIL  1435
              GAAK I Q+KP  VEVHFI  A ENMISG  + PGDILTASNGK IEV +TDAEGRL L
Sbjct  292   LGAAKVIGQLKP-DVEVHFICAATENMISGRAIHPGDILTASNGKTIEVNNTDAEGRLTL  350

Query  1436  ADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWR  1615
             ADALV+A KL V+ +VDLATLTGACI ALG +++G+++  + LA ++  AA+  GEK W+
Sbjct  351   ADALVFAEKLEVDAIVDLATLTGACIIALGDNISGLWSTDQTLADQLKAAAETAGEKFWQ  410

Query  1616  MPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             MPLEE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  411   MPLEEKYFEGLKSPIADMKNTGPRAGGSITAALFLK  446



>ref|WP_021830390.1| Cytosol aminopeptidase PepA [Crocosphaera watsonii]
 emb|CCQ50872.1| Cytosol aminopeptidase PepA [Crocosphaera watsonii WH 8502]
Length=503

 Score =   342 bits (877),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 218/456 (48%), Positives = 289/456 (63%), Gaps = 24/456 (5%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             LL+W GD +A+G+ E +             L +LD K GG L+E   E +F GKSG S V
Sbjct  24    LLDWSGDAIALGLFEDETILTGE-------LSQLDEKTGGTLAELIEETEFKGKSGSSAV  76

Query  548   LRLPGLGS--KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVE  721
              R+ G GS  +++ L+GLG     ++    LG    A     +               VE
Sbjct  77    TRIGG-GSAIRKLILIGLGKKDELSLDSLRLGAAAVARLGKKEKVKSLGINFPV----VE  131

Query  722   SKLSAASAMATGIVSGTFEDNRFKLEPKTPTLK--SVEILGLGTGPEIEKKLKYSEVVSS  895
             ++ S  +A+A G++    +DNRFK EP+   LK  +V ILG+G   E    ++ ++ ++S
Sbjct  132   NEASTTTAIAEGMILSLHQDNRFKSEPEDKPLKLETVHILGVGAQSE---AVEQAQTITS  188

Query  896   GVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAA  1075
             GVI  +ELV APAN + P   AE A+ +A+ Y   L   IL+ E+C++L MG+FLGVA A
Sbjct  189   GVILARELVAAPANSVNPVTFAETAQTLATDYG--LDIEILEQEECEKLGMGAFLGVAKA  246

Query  1076  ATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavv  1255
             +  P  FIHL YKP++ + K KLA++GK +TFDSGG NLK G+ S IE MK DM G A  
Sbjct  247   SDLPPKFIHLTYKPAA-TPKRKLAIVGKSLTFDSGGLNLK-GSGSGIETMKMDMGGGAAT  304

Query  1256  fgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLIL  1435
              GAAKAIAQ+KP  VEVHF+  A ENMISG  M PGDILTASNGK IEV +TDAEGRL L
Sbjct  305   LGAAKAIAQLKP-DVEVHFVCAATENMISGRAMHPGDILTASNGKTIEVNNTDAEGRLTL  363

Query  1436  ADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWR  1615
             ADALVYA KL V+ +VDLATLTGAC+ ALG  ++G+++  E L +E+  A++  GEK W 
Sbjct  364   ADALVYAEKLEVDAIVDLATLTGACLVALGNDISGLWSTDETLTEELKTASETAGEKFWV  423

Query  1616  MPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             MP+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  424   MPMEEKYFEGLKSPIADMKNTGPRAGGSITAALFLK  459



>ref|WP_012163418.1| aminopeptidase A [Acaryochloris marina]
 ref|YP_001517301.1| leucyl aminopeptidase [Acaryochloris marina MBIC11017]
 sp|B0CCF6.1|AMPA_ACAM1 RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Acaryochloris marina MBIC11017]
 gb|ABW27985.1| cytosol aminopeptidase family protein [Acaryochloris marina MBIC11017]
Length=492

 Score =   341 bits (875),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 227/470 (48%), Positives = 296/470 (63%), Gaps = 35/470 (7%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSG  526
             I A E    +W GD L +G  E   A D         L +LD  L  +L +  SE +F G
Sbjct  3     IQAIETVAADWSGDYLGIGFFEDSAAIDAG-------LTQLDQSLQDILQDLVSETEFQG  55

Query  527   KSGQSIVLRLPGLGS-KRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalas  700
             K G+    R+ G GS +++ L+GLGS  + T+ + R         A +A A +     A+
Sbjct  56    KVGEQPWTRIAGPGSIRKVMLIGLGSPDAFTLDSLRQ--------AAAAFAKAAQKQKAA  107

Query  701   aEGLSVES----KLSAASAMATGIVSGTFEDNRFKLEP--KTP--TLKSVEILGLGT-GP  853
             + GL + S      ++  AMA GI     ++ RFK +P  K P    + V +LGL     
Sbjct  108   SAGLQLPSWDDDAAASTQAMAEGIELALHQEIRFKSDPDAKKPGEFPQEVHLLGLANQAA  167

Query  854   EIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQC  1033
              IEK    ++ + +GVI  +ELV APANV+TP ALAE A  IA  +   LT  +L+ E+C
Sbjct  168   AIEK----AQQICAGVILTRELVAAPANVVTPSALAETAAQIAEDHG--LTLEVLEREEC  221

Query  1034  KELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSS  1213
             +   MG+FLGV+ A+  P  FIHL YKPS G+ + KLA++GKG+TFDSGG NLK+G  S 
Sbjct  222   EAQGMGAFLGVSLASELPPKFIHLTYKPS-GTPRRKLAIVGKGVTFDSGGLNLKVG-GSG  279

Query  1214  IELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKR  1393
             IE MK DMAG+    GAAKAI Q+KP  VEVHFIV A ENMISG  + PGDILTASNGK 
Sbjct  280   IETMKMDMAGSGATLGAAKAIGQLKP-DVEVHFIVAAAENMISGHALHPGDILTASNGKT  338

Query  1394  IEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKE  1573
             IE+ +TDAEGRL LADALV+A K GV+ +VDLATLTGACI ALG  +AG++TP + LA+E
Sbjct  339   IEINNTDAEGRLTLADALVFAEKQGVDAIVDLATLTGACIVALGNDIAGMWTPEDSLAEE  398

Query  1574  VLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             + +A++  GEK WRMPLEE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  399   LSQASEQAGEKFWRMPLEEKYFEGLKSPIADMKNTGPRPGGSITAALFLK  448



>ref|WP_011431320.1| aminopeptidase A [Synechococcus sp. JA-3-3Ab]
 ref|YP_475910.1| leucyl aminopeptidase [Synechococcus sp. JA-3-3Ab]
 sp|Q2JRU4.1|AMPA_SYNJA RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Synechococcus sp. JA-3-3Ab]
 gb|ABD00647.1| peptidase, M17 (leucyl aminopeptidase) family [Synechococcus 
sp. JA-3-3Ab]
Length=510

 Score =   342 bits (876),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 212/428 (50%), Positives = 276/428 (64%), Gaps = 17/428 (4%)
 Frame = +2

Query  467   LDSKL-GGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGET  643
             LD K+  GL++EA+ E+ F GK   S+ LRLPG   +++ LVGLG   + T+        
Sbjct  39    LDEKVWSGLVAEAAQEQKFQGKPNSSLALRLPG-PIRKLVLVGLGDPAALTLEALRRATA  97

Query  644   IaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLK-  820
                    +  +   V      GL    ++ A  A+A   +    +DNRFK  PK    + 
Sbjct  98    NGLRQAHSLKAKQVVLSLPDTGLD---QVRAVQAVAEASLLVAHQDNRFKSPPKPEEERG  154

Query  821   -SVE-----ILGLGTG-PEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNI  979
              SVE     + GL     + E  L+ +  +++G I  +ELV APANV+TP ALAE A+ +
Sbjct  155   FSVEEVTLLVPGLAQARQDYENALQRATEMAAGTILARELVAAPANVVTPPALAETARQL  214

Query  980   ASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGK  1159
             A  Y   L   IL  E+C+ L MG+FLGVA A+  P  FIHL YKP  G    KLAL+GK
Sbjct  215   AQDYG--LEVEILGREECQALGMGAFLGVAQASDLPPQFIHLTYKPKEGDPVAKLALVGK  272

Query  1160  GITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMI  1339
             G+TFDSGG N+K  + S I +MK DM GAA V GAA+A+A +KP  VEVHFIV A ENMI
Sbjct  273   GLTFDSGGLNIKTDSRS-IAMMKTDMGGAAAVLGAARALAALKPQ-VEVHFIVAATENMI  330

Query  1340  SGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1519
             SG  + PGDILTASNGK IEV +TDAEGRL LADALV+A KLGV+ +VDLATLTGAC+ A
Sbjct  331   SGRALHPGDILTASNGKTIEVNNTDAEGRLTLADALVFAEKLGVDAIVDLATLTGACVIA  390

Query  1520  LGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDA  1699
             LG  +AG+FTP E LA+E+ +AA++ GEK+WR+PLEESY+E + S++ADM N G   G +
Sbjct  391   LGEEIAGLFTPDEKLAQELQQAANLSGEKIWRLPLEESYFEGLSSTVADMKNTGPRSGGS  450

Query  1700  ITASLFMK  1723
             ITA+LF+K
Sbjct  451   ITAALFLK  458



>ref|NP_001168170.1| uncharacterized protein LOC100381923 [Zea mays]
 gb|ACN27317.1| unknown [Zea mays]
Length=271

 Score =   333 bits (854),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 194/226 (86%), Gaps = 0/226 (0%)
 Frame = +2

Query  1046  MGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELM  1225
             MGS+LGVAAA+ NP +FIHLCYKP+ G+VK KLA++GKG+TFDSGGYN+K G   SIELM
Sbjct  1     MGSYLGVAAASANPPHFIHLCYKPTDGNVKRKLAIVGKGLTFDSGGYNIKTGPGCSIELM  60

Query  1226  KKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVT  1405
             K DM G+A VFGAAKA+ QIKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IEV 
Sbjct  61    KFDMGGSAAVFGAAKALGQIKPPGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIEVN  120

Query  1406  DTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEA  1585
             +TDAEGRL LADALVYA   GVEK++DLATLTGAC+ ALG S+AGIFTPS++LAKEV  A
Sbjct  121   NTDAEGRLTLADALVYACNQGVEKIIDLATLTGACVVALGPSIAGIFTPSDELAKEVAAA  180

Query  1586  ADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             ++V GEK WR+PLEESYWE+MKS +ADM+N G   G +ITA+LF+K
Sbjct  181   SEVSGEKFWRLPLEESYWESMKSGVADMVNTGGRQGGSITAALFLK  226



>ref|WP_026099711.1| aminopeptidase A [Prochlorothrix hollandica]
Length=491

 Score =   341 bits (874),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 218/457 (48%), Positives = 293/457 (64%), Gaps = 26/457 (6%)
 Frame = +2

Query  371   LEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVL  550
             L+W+G  LA+GV+  D+  +P+       LQ LD  L GL+SE   + DF+ K G S V 
Sbjct  11    LDWQGHGLAIGVSSADL--NPDGSLGE-SLQPLDQSLDGLVSELVKDVDFTAKLGSSAVS  67

Query  551   RLPGLGSKRIGLVGLG-SVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESK  727
             R+ G   +++ LVGLG S + S    R    T    A   Q  ++        GL +   
Sbjct  68    RVRGAQIRKLILVGLGDSKIPSLDTLRQGAATAVRLAAQEQCETL--------GLQMPPG  119

Query  728   LSAAS---AMATGIVSGTFEDNRF--KLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVS  892
             ++AA+   A+  G +   + D+RF  K+EP  P+L  V +LGLG   + +  +  ++ + 
Sbjct  120   VTAAATVQALCEGGILALYRDDRFRSKIEP-IPSLSQVTVLGLG---DHQAAIATAQQIC  175

Query  893   SGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAA  1072
              GVIF ++ V APAN L P  LA   + +A   +  L   IL+ + C  L MG+FLGVA 
Sbjct  176   EGVIFARQWVAAPANSLNPVTLAAAVEELAQ--TQGLELRILERDDCAALGMGAFLGVAQ  233

Query  1073  AATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaav  1252
             A+  P  F+HL YKP  G+ + K+A++GKG+TFDSGG NLK+G NSSIE+MK DM GA  
Sbjct  234   ASDLPPKFLHLIYKPE-GTPRRKVAIVGKGLTFDSGGLNLKVG-NSSIEMMKTDMGGAGA  291

Query  1253  vfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLI  1432
              FGAAKAIA +KP  VEVHFI    ENM+SG  MRPGD+LTASNGK IEV +TDAEGRL 
Sbjct  292   TFGAAKAIALLKP-DVEVHFISAVTENMVSGRAMRPGDVLTASNGKTIEVNNTDAEGRLT  350

Query  1433  LADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLW  1612
             LADALVYA  LG++ +VDLATLTGAC+ ALG S+AG+++  + LA ++L A+D  GEKLW
Sbjct  351   LADALVYADGLGLDAIVDLATLTGACVVALGESIAGLWSSDDTLAAQLLAASDKSGEKLW  410

Query  1613  RMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             RMPLE  Y+E+MKS +ADM N GS  G +ITA+LF++
Sbjct  411   RMPLEPPYFESMKSVVADMKNTGSRAGGSITATLFLQ  447



>ref|WP_006515687.1| leucyl aminopeptidase [Leptolyngbya sp. PCC 7375]
 gb|EKV01290.1| leucyl aminopeptidase [Leptolyngbya sp. PCC 7375]
Length=491

 Score =   341 bits (874),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 225/463 (49%), Positives = 289/463 (62%), Gaps = 28/463 (6%)
 Frame = +2

Query  353   AREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKS  532
             A +   L W GD L VG++E+ +   P +     +L +L+ ++ GLL E   E DF  K+
Sbjct  5     ASDKSCLTWSGDCLVVGLSEESL---PLTG----LLSELNERVSGLLQELIDETDFKAKA  57

Query  533   GQSIVLRLPGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGL  712
             G S V+R+ G   +++ +VGLG       A   L       A +A A        ++ G+
Sbjct  58    GSSAVIRV-GNDVRKLAIVGLG-------ASEDLKLESLRRAAAAAAKLAKREKCASLGI  109

Query  713   SV----ESKLSAASAMATGIVSGTFEDNRFKLEPKTP--TLKSVEILGLGTGPEIEKKLK  874
             S      S       +A G+     ED RFK +   P   L  + +L L  G   E  L+
Sbjct  110   SFPIWNNSPERTTQTIAEGVTLAMHEDKRFKSDTDAPKVVLSDISLLDL-VG--YEAALE  166

Query  875   YSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGS  1054
              +  V  GVI  +ELV AP NV+TP ++AE A +IA  +   LT  +L+  +C+EL MG+
Sbjct  167   TAAHVCDGVILARELVAAPPNVVTPTSMAETAADIAKEHG--LTLKVLEQAECEELGMGA  224

Query  1055  FLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKD  1234
             +LGVA A+  P  FIHL Y P  G+ K KLAL+GKG+TFDSGG N+K GA S IELMK D
Sbjct  225   YLGVAMASEMPPKFIHLTYTPE-GTPKRKLALIGKGLTFDSGGLNIKAGAGSMIELMKMD  283

Query  1235  MagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTD  1414
             M GAA V GAAKAIAQIKP  VEVHFI  A ENMISG  M PGDILTASNGK IEV +TD
Sbjct  284   MGGAAAVLGAAKAIAQIKP-DVEVHFISAATENMISGHAMHPGDILTASNGKTIEVNNTD  342

Query  1415  AEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADV  1594
             AEGRL LADALVYA KLGV+ MVDLATLTGACI ALG  +AG+F+P ++LA  +  A++ 
Sbjct  343   AEGRLTLADALVYADKLGVDAMVDLATLTGACIVALGNDLAGLFSPDDELAGALANASEE  402

Query  1595  GGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
              GEKLWRMP+EE Y++ +KS +ADM N G   G +ITA+LF+K
Sbjct  403   AGEKLWRMPMEEKYFDGLKSIVADMKNTGPRPGGSITAALFLK  445



>ref|WP_017321976.1| aminopeptidase A [cyanobacterium PCC 7702]
Length=492

 Score =   341 bits (874),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 220/454 (48%), Positives = 288/454 (63%), Gaps = 21/454 (5%)
 Frame = +2

Query  374   EWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  553
             EW GD LA+G+ E   A D   +     L +LD+KL G L E  +EE+F GK+G S V R
Sbjct  12    EWTGDGLAIGLFED--AVDLTGE-----LAELDTKLAGNLKELIAEEEFKGKTGSSAVTR  64

Query  554   LPGLGS--KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESK  727
             +    S  +++ LVGLG   +  +         AA     Q    A        +   + 
Sbjct  65    IATNNSLVRKVMLVGLGKAEALKLDTLRRAAATAARLAKKQKCKTAGIFLP---IWNHAP  121

Query  728   LSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGV  901
                A A+A G+  G ++D+RFK EP  K P ++ +++LGLG     E  +  +  + SGV
Sbjct  122   AQTAQALAEGVQLGLYQDHRFKSEPEDKGPQVERIDLLGLGGQ---EAAVNRANQIISGV  178

Query  902   IFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAAT  1081
                ++LV APAN +TP  +AE A  IAS +   L   IL+ E C++L MG+FLGVA  + 
Sbjct  179   TLARQLVAAPANEVTPITMAETAMAIASEHK--LQVEILEQEDCEKLGMGAFLGVAKGSD  236

Query  1082  NPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfg  1261
              P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K+ A S IE MK DM GAA + G
Sbjct  237   LPPKFIHLTYKP-EGTPKRKLAVIGKGLTFDSGGLNIKV-AGSGIENMKIDMGGAAAILG  294

Query  1262  aakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILAD  1441
             AAKAIAQ++P  VEVHFI    ENMISG  M PGDIL ASNGK IEV +TDAEGRL LAD
Sbjct  295   AAKAIAQLQPEDVEVHFISAVTENMISGHAMHPGDILKASNGKTIEVNNTDAEGRLTLAD  354

Query  1442  ALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMP  1621
             ALV+A KLGV+ +VDLATLTGAC+ ALG  +AG+FTP + LA+++  AA+  GEK+WRMP
Sbjct  355   ALVFAEKLGVDAIVDLATLTGACVIALGDDIAGLFTPDDTLAQQLEAAAESTGEKIWRMP  414

Query  1622  LEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +EE Y+E +KS+IADM N G     +ITA+LF+K
Sbjct  415   MEEKYFEGLKSNIADMKNTGPRAAGSITAALFLK  448



>ref|WP_012597067.1| aminopeptidase A [Cyanothece sp. PCC 8801]
 ref|YP_002373966.1| leucyl aminopeptidase [Cyanothece sp. PCC 8801]
 sp|B7K4A4.1|AMPA_CYAP8 RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Cyanothece sp. PCC 8801]
 gb|ACK67810.1| Leucyl aminopeptidase [Cyanothece sp. PCC 8801]
Length=491

 Score =   341 bits (874),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 220/456 (48%), Positives = 292/456 (64%), Gaps = 23/456 (5%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
              L+W GD LA+G+ E+              L +LD KL G + E   E +F GK+G   V
Sbjct  10    FLDWTGDALALGIFEEGTQITGE-------LSQLDGKLTGTVQELIQEAEFEGKAGTKAV  62

Query  548   LRLPGLGS--KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVE  721
              R+ G  S  +++ LVGLG   +  +   ++ E   A A+ A+   V     +   ++ +
Sbjct  63    TRV-GSNSPIRKVMLVGLGK--AEDLQLNSVREAAGAIARLAKLEKVKTLGINLPVVNND  119

Query  722   SKLSAASAMATGIVSGTFEDNRFKLEPKTPTLK--SVEILGLGTGPEIEKKLKYSEVVSS  895
                  ASA+A GI+    +DNRFK +P+   LK  +V+ILG G   E  + +  ++ +SS
Sbjct  120   GA-KTASAIAEGILLALHQDNRFKSDPQENALKLENVDILGCG---EATEAINRAQTLSS  175

Query  896   GVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAA  1075
             GVI  +ELVN+PAN +TP   AE A+ IA   +  LT  IL+ E C++L MGSFLGVA A
Sbjct  176   GVILARELVNSPANTITPVTFAETAQEIAQ--TSGLTCEILEQEDCEKLGMGSFLGVAKA  233

Query  1076  ATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavv  1255
             +  P  FIHL YKPS G+ K KLA++GK +TFD GG NLK+ A +SIE+MK DM G A  
Sbjct  234   SDLPPKFIHLTYKPS-GTPKKKLAIVGKSLTFDCGGLNLKV-AGASIEMMKMDMGGGAAT  291

Query  1256  fgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLIL  1435
              GAAK I Q+KP  VEVHFI  A ENMISG  + PGDILTASNGK IEV +TDAEGRL L
Sbjct  292   LGAAKVIGQLKP-DVEVHFICAATENMISGRAIHPGDILTASNGKTIEVNNTDAEGRLTL  350

Query  1436  ADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWR  1615
             ADALV+A KL V+ +VDLATLTGACI ALG +++G+++  + LA ++  AA+  GEK W+
Sbjct  351   ADALVFAEKLEVDAIVDLATLTGACIIALGDNISGLWSTDQTLADQLKAAAETAGEKFWQ  410

Query  1616  MPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             MPLEE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  411   MPLEEKYFEGLKSPIADMKNTGPRAGGSITAALFLK  446



>ref|WP_017658914.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=488

 Score =   340 bits (873),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 228/461 (49%), Positives = 292/461 (63%), Gaps = 35/461 (8%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             LL+W GD LA+G+ E       N+      L +LD KL G L E   E +F GK   S V
Sbjct  10    LLDWSGDALAIGLPE-------NAVELTGELAQLDEKLAGTLKELIEETEFDGKRDNSAV  62

Query  548   LRLPGLGS--KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV-  718
              R+ G GS  +++ LVGLG        +R     +   AK  +  ++        G+SV 
Sbjct  63    TRVGG-GSTVRKVILVGLGKA-DHLDDWRRCAAMMGRLAKQEKCKTL--------GVSVP  112

Query  719   ---ESKLSAASAMATGIVSGTFEDNRFKLE--PKTPTLKSVEILGL-GTGPEIEKKLKYS  880
                    S   ++  GI     +D RFK E   K   +++V++L L G    ++K LK  
Sbjct  113   QWNNDPASTVRSLVEGIELALHQDTRFKSETDDKGAIVETVDLLELDGQDEAVDKSLK--  170

Query  881   EVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFL  1060
               + SGV+  +ELV APANV+ P  LAE A+ +A+ Y   L   IL+ E C++L MG+FL
Sbjct  171   --ICSGVLLARELVAAPANVVNPITLAETAQAMANEYG--LELEILEKEDCEKLGMGAFL  226

Query  1061  GVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMa  1240
             GVA A+  P  F+HL YKP  G+ + KLA++GKG+TFDSGG NLK G  S IE MK DM 
Sbjct  227   GVAQASALPPKFVHLAYKPE-GTPRKKLAIVGKGLTFDSGGLNLKTGG-SGIETMKIDMG  284

Query  1241  gaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAE  1420
             GA   FGAAKAIAQ+KP  VEVHFI    ENMISG  MRPGDILTASNGK IEV +TDAE
Sbjct  285   GAGATFGAAKAIAQLKP-DVEVHFISAVTENMISGHAMRPGDILTASNGKTIEVNNTDAE  343

Query  1421  GRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGG  1600
             GRL LADALV+A KLGV+ +VDLATLTGAC+ ALG ++AG+++P +++A  ++ A+DV G
Sbjct  344   GRLTLADALVFADKLGVDAIVDLATLTGACVVALGNTIAGLWSPDDEVANGLMAASDVAG  403

Query  1601  EKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             EKLWRMPLEE Y+E MKS  ADM NAGS  G AITA+LF+K
Sbjct  404   EKLWRMPLEEPYFELMKSLHADMKNAGSRAGGAITAALFLK  444



>ref|WP_030006934.1| aminopeptidase A [Synechococcus sp. NKBG042902]
Length=491

 Score =   340 bits (873),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 221/428 (52%), Positives = 286/428 (67%), Gaps = 21/428 (5%)
 Frame = +2

Query  458   LQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRL-PGLGSKRIGLVGLGSVVS-STIAYRT  631
             L  LD +L G++SE   E +F GKSG+  V RL  G   K++ LVGLG+    S+ A R+
Sbjct  35    LTALDERLSGVISEVIVETEFKGKSGELSVTRLGSGAPIKKLILVGLGNAEKWSSAALRS  94

Query  632   LGETIaaaaksaqassvavalasaEGLSV---ESKLSAASAMATGIVSGTFEDNRFKLEP  802
                 IA AAK  +A +         GL +   E++   A  +  G+  G +EDNRFK E 
Sbjct  95    TAAAIARAAKGDKAITTL-------GLQLPVAETEAITAQMVTEGMYLGFYEDNRFKSEQ  147

Query  803   K-TPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNI  979
             K  P L++VEILG+G  P     +     +  GVI+ +ELVNAPAN++ P  LA   +++
Sbjct  148   KDPPALETVEILGIGDQP---AAIALGTSLCEGVIYARELVNAPANIINPVTLAASVESL  204

Query  980   ASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGK  1159
             AS Y   L   IL+   C+   MGSFLGVAAA+  P  FIHL YKP  G+ + K+A++GK
Sbjct  205   ASTYG--LELNILEEADCEAAGMGSFLGVAAASDLPPKFIHLVYKPP-GTPRKKVAIVGK  261

Query  1160  GITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMI  1339
             G+TFDSGGYN+K  +  SI +MK DM GAA  FGAAKAIA++KP  VEVHFI  A ENMI
Sbjct  262   GLTFDSGGYNIK-PSGPSIAMMKMDMGGAAATFGAAKAIAELKP-DVEVHFISAATENMI  319

Query  1340  SGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1519
             SG GMRPGDILTASNGK IEV +TDAEGRL LADALVYA KLGVE +VD+ATLTGAC+ A
Sbjct  320   SGRGMRPGDILTASNGKTIEVNNTDAEGRLTLADALVYAEKLGVEAIVDIATLTGACVIA  379

Query  1520  LGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDA  1699
             LG  + G+++ ++DLA+ +  A++  GEK W+MPLEE Y+E +KS IADM N G  +G +
Sbjct  380   LGDDICGLWSDNDDLAQAIATASEKAGEKFWQMPLEEKYFEGLKSPIADMKNTGPREGGS  439

Query  1700  ITASLFMK  1723
             ITA+LF+K
Sbjct  440   ITAALFLK  447



>ref|XP_002502369.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63627.1| predicted protein [Micromonas sp. RCC299]
Length=633

 Score =   345 bits (884),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 208/429 (48%), Positives = 275/429 (64%), Gaps = 12/429 (3%)
 Frame = +2

Query  455   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLGSVVS-STIAYRT  631
             +L+     L  ++ +   E++F G +G S+  R+ GL  K +GLVGLG   + +  A+ +
Sbjct  167   VLEGYAPGLAAVVKDMCDEQEFKGAAGSSVFTRVAGLPFKHVGLVGLGKADAIAGDAWMS  226

Query  632   LGE--TIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPK  805
             LG+  T AAA     + +V       E  +   K   A  +A G   G+FED+RFK + K
Sbjct  227   LGKEATAAAAKSKCTSVAVGKYWMGDEEAAFRGK---AEGIAAGAFLGSFEDSRFKSDAK  283

Query  806   TPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIAS  985
                LK+V +L    G ++  ++   +  +SGV   K+LV AP NV+TP ALA  A  IA+
Sbjct  284   PGPLKTVHVL-TQPGVDVASEIAAGKAKASGVALTKQLVAAPPNVVTPSALARIANEIAA  342

Query  986   LYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGI  1165
              + D  +  IL+ E+C+ + MGS+LGVA A+  P  FIHL YK   G+ KT +A++GKG+
Sbjct  343   QFPDTCSVKILEKEECEAMGMGSYLGVAEASDEPPKFIHLTYK-GEGAKKT-VAVVGKGL  400

Query  1166  TFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISG  1345
             TFDSGGYN+K GA S IE+MK DM GA    GAA+ IA+  PAGVE HFIV +CENMI  
Sbjct  401   TFDSGGYNIKAGAGSMIEMMKFDMGGAGATLGAARIIAETAPAGVEAHFIVASCENMIGS  460

Query  1346  TGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKL-GVEKMVDLATLTGACITAL  1522
              G+RPGDILTASNGK IEV +TDAEGRL LADALVYA K  G   +VD+ATLTGACI  L
Sbjct  461   RGLRPGDILTASNGKTIEVNNTDAEGRLTLADALVYAEKTAGATSIVDVATLTGACIVGL  520

Query  1523  GRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWET--MKSSIADMINAGSLDGD  1696
             G  VAG+FTP +DLA E+  +A   GE  WRMP++E+YW++  M S  ADM N GS  G 
Sbjct  521   GPEVAGVFTPDDDLAAELEASAKEAGELFWRMPMQETYWKSCGMTSEYADMKNTGSRGGG  580

Query  1697  AITASLFMK  1723
             AITA+LF+K
Sbjct  581   AITAALFLK  589



>ref|XP_002953843.1| hypothetical protein VOLCADRAFT_106122 [Volvox carteri f. nagariensis]
 gb|EFJ45167.1| hypothetical protein VOLCADRAFT_106122 [Volvox carteri f. nagariensis]
Length=608

 Score =   344 bits (882),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 217/477 (45%), Positives = 300/477 (63%), Gaps = 18/477 (4%)
 Frame = +2

Query  335   PKILIAAREVDLLEWKGDILAVGVTEKDMAR-DPNSKFQNLILQKLDSKLGGLLSEASSE  511
             P + +A+  +D   W+GD+L + VTE D    D  +  ++  LQ+LD+KLGG L+E  + 
Sbjct  87    PSVGLASSALD--SWEGDLLVLAVTEDDFVTADEVTAVRSEGLQQLDAKLGGQLAEIVAW  144

Query  512   EDFSGKSG-QSIVLRLPGLGSK--RIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassv  682
               F GK G QS V+R  G GSK   + +VGLG     T+A    G +   A  +A A+  
Sbjct  145   GGFDGKQGSQSRVVRYTGTGSKAKHVAMVGLGKAAKLTVATE-WGVSPFQALGAAVAALA  203

Query  683   avalasaEGLSVESKL------SAASAMATGIVSGTFEDNRFKLEPKTPT---LKSVEIL  835
                 A    +++ ++       SA + + TG + G +E +RFK + K+PT   L S+E+L
Sbjct  204   KANKAEKVAVAITTQPDPAVRGSALTQITTGSLLGGYESSRFKSK-KSPTASKLTSLEVL  262

Query  836   GLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATI  1015
                     E  +      + G +  + LV AP NV TP  LA+ A +IA+   DV T  +
Sbjct  263   MDLDAAAAEAAVARGVAAARGNLLTRYLVEAPPNVCTPTHLADAAAHIAAKSPDVFTLKV  322

Query  1016  LDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLK  1195
              + E+C+ + MG +LGVA A+  P  FIHL Y P  G+   K+A++GKG+TFDSGGYNLK
Sbjct  323   YEKEECEAMGMGCYLGVAEASLEPPKFIHLKYSPPGGTTSRKIAIVGKGLTFDSGGYNLK  382

Query  1196  IGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILT  1375
              G  S IELMK DM GA    GAA+ + ++KP+ VE+HFI+ +CENM++G G+RPGDILT
Sbjct  383   AGPGSMIELMKFDMGGAGATLGAARILGELKPSDVEIHFIIASCENMVAGAGLRPGDILT  442

Query  1376  ASNGKRIEVTDTDAEGRLILADALVYAS-KLGVEKMVDLATLTGACITALGRSVAGIFTP  1552
             A+NGK +EV +TDAEGRL LADA+ +A  K G   MVD+ATLTGACI ALG SVAG+FTP
Sbjct  443   AANGKTVEVNNTDAEGRLTLADAMWFAQEKCGATSMVDIATLTGACIIALGTSVAGLFTP  502

Query  1553  SEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             S+ LA  +  A+   GEK+WRMP+EE YWE+MKS +ADM N G+  G +ITA+LF+K
Sbjct  503   SDSLAASLTTASKATGEKIWRMPMEEEYWESMKSPVADMKNTGTRYGGSITAALFLK  559



>ref|WP_012308056.1| aminopeptidase A [Synechococcus sp. PCC 7002]
 ref|YP_001735693.1| cytosol aminopeptidase [Synechococcus sp. PCC 7002]
 sp|B1XK83.1|AMPA_SYNP2 RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Synechococcus sp. PCC 7002]
 gb|ACB00438.1| cytosol aminopeptidase [Synechococcus sp. PCC 7002]
Length=491

 Score =   340 bits (872),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 213/427 (50%), Positives = 282/427 (66%), Gaps = 19/427 (4%)
 Frame = +2

Query  458   LQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRL-PGLGSKRIGLVGLGSVVSSTIAYRTL  634
             L  LD +L G+++E  +E +F GKSG+  V RL  G   K++ LVGLG+      A +  
Sbjct  35    LTALDERLSGVIAEVIAETEFKGKSGKLSVTRLGSGAPIKKLLLVGLGN------AEKWN  88

Query  635   GETIaaaaksaqassvavalasaEGLSV---ESKLSAASAMATGIVSGTFEDNRFKLEPK  805
                + + A +   +       +  GL +   E++   A  +  G+  G +EDNRFK E K
Sbjct  89    SAVLRSTAAAIARAVKGDKAITTLGLQLPVAETEAITAQMVTEGMYLGFYEDNRFKSEQK  148

Query  806   -TPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIA  982
               P L++VEILG+G  P     +     +  GVI+ +ELVNAPAN++ P  LA   +++A
Sbjct  149   DPPALEAVEILGIGDQP---AAIALGTSLCEGVIYARELVNAPANIINPVTLAASVESLA  205

Query  983   SLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKG  1162
             S Y   L   IL+   C+   MGSFLGVAAA+  P  FIHL YKP  G+ + K+A++GKG
Sbjct  206   STYG--LELNILEEADCEAAGMGSFLGVAAASDLPPKFIHLVYKPL-GTPRKKVAIVGKG  262

Query  1163  ITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMIS  1342
             +TFDSGGYN+K  +  SI +MK DM GAA  FGAAKAIA++KP  VEVHFI  A ENMIS
Sbjct  263   LTFDSGGYNIK-PSGPSIAMMKMDMGGAAATFGAAKAIAELKP-DVEVHFISAATENMIS  320

Query  1343  GTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITAL  1522
             G GMRPGDILTASNGK IEV +TDAEGRL LADALVYA KLGVE +VD+ATLTGAC+ AL
Sbjct  321   GRGMRPGDILTASNGKTIEVNNTDAEGRLTLADALVYAEKLGVEAIVDIATLTGACVIAL  380

Query  1523  GRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAI  1702
             G  + G+++ ++DLA+ +  A++  GEK W+MPLEE Y+E +KS IADM N G  +G +I
Sbjct  381   GDDICGLWSDNDDLAQAIATASEKAGEKFWQMPLEEKYFEGLKSPIADMKNTGPREGGSI  440

Query  1703  TASLFMK  1723
             TA+LF+K
Sbjct  441   TAALFLK  447



>ref|XP_008669992.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like isoform 
X2 [Zea mays]
Length=319

 Score =   333 bits (855),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 175/292 (60%), Positives = 231/292 (79%), Gaps = 1/292 (0%)
 Frame = +2

Query  302   LGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKL  481
             LGLTKPN ++ P++   A++++  EWKGDILAV VTEKD+++D  SKF+N++L+KLD +L
Sbjct  16    LGLTKPNAVEPPQVTFFAKDIEFSEWKGDILAVTVTEKDLSKDAYSKFENVVLKKLDGQL  75

Query  482   GGLLSEASSEEDFSGKSGQSIVLRLPGLGSKRIGLVGLG-SVVSSTIAYRTLGETIaaaa  658
             GGLLSEA+ EEDF+ K+GQS+VLRL G G KR+GL+GLG S  S+  A R L E++A+ A
Sbjct  76    GGLLSEAAVEEDFTRKTGQSVVLRLAGQGFKRVGLIGLGQSAPSTAAASRGLRESVASVA  135

Query  659   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  838
             K+AQASS A+ LAS  G+  E KL+A + + TG V G +ED+R+K E K   LK V+I+G
Sbjct  136   KAAQASSTAIVLASPSGIQEEFKLAALAGLITGTVLGLYEDSRYKSESKKVHLKQVDIIG  195

Query  839   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1018
             LG+G E+++K+KY+   SSGVIF +ELVN+PANVLTP  LAEEA  I S +SDV TAT+L
Sbjct  196   LGSGAEVDQKIKYANDFSSGVIFGRELVNSPANVLTPAMLAEEASKITSTFSDVFTATVL  255

Query  1019  DVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1174
             DVE+CKELKMGS+LGV AA+ NP +FIHLCYKP+ G+VK KLA++GKG+TFD
Sbjct  256   DVEKCKELKMGSYLGVVAASANPPHFIHLCYKPTDGNVKRKLAIVGKGLTFD  307



>ref|WP_028091351.1| aminopeptidase A [Dolichospermum circinale]
Length=490

 Score =   340 bits (871),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 213/461 (46%), Positives = 296/461 (64%), Gaps = 33/461 (7%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             LL+W GD LA+G+ E  +    +       L  LD KL G+ +E  +EE+F+GK   +I 
Sbjct  10    LLDWTGDTLAIGLFEDAVQLTGD-------LATLDQKLAGIFTELIAEEEFTGKVNSTIF  62

Query  548   LRLPGLGS--KRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEGLSV  718
              R+ G G+  +++ LVGLG   +  +   R +  T+A  AK  +  ++        G+S+
Sbjct  63    TRV-GAGNLVRKVILVGLGKPEALQLETLRRVAATVARTAKKQKTKTL--------GISL  113

Query  719   ----ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYS  880
                     + A A+  GI    ++D RFK EP  K+P ++++++LGL      +  +  +
Sbjct  114   PLWNNDPAATAQAITEGIELALYQDIRFKSEPEDKSPNIETIDLLGLAGQ---QAAITRA  170

Query  881   EVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFL  1060
             + + SGVI  ++LV APAN +TP  +AE A  IA  Y   L   +L+  +C++L MG+FL
Sbjct  171   DQIVSGVILARQLVAAPANAVTPITMAETAGAIAQEYG--LQLEVLEQAECEKLGMGAFL  228

Query  1061  GVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMa  1240
             GVA A+  P  FIHL YKP++ + + KLA++GKG+TFDSGG N+K GA S IE MK DM 
Sbjct  229   GVAQASELPPKFIHLIYKPAT-TPRRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMG  286

Query  1241  gaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAE  1420
             GAA   GAAK I Q+KP  VEVHFI    ENMISG  M PGDILTASNGK IEV +TDAE
Sbjct  287   GAAATLGAAKVIGQLKP-DVEVHFISAVTENMISGKAMHPGDILTASNGKTIEVNNTDAE  345

Query  1421  GRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGG  1600
             GRL LADALVYA KLGV+ ++DLATLTGAC+ ALG  +AG+FTP + +A ++  AA+  G
Sbjct  346   GRLTLADALVYADKLGVDAILDLATLTGACVVALGEDIAGLFTPDDAMASQLQTAAETAG  405

Query  1601  EKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             EK+WR+P+E+ Y++ +KS IADM N G   G +ITA+LF+K
Sbjct  406   EKIWRLPMEDKYFDGLKSGIADMKNTGPRYGGSITAALFLK  446



>ref|WP_019502106.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=527

 Score =   341 bits (874),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 221/476 (46%), Positives = 301/476 (63%), Gaps = 34/476 (7%)
 Frame = +2

Query  374   EWKGDILAVGVTEKDMARDPNSKFQNLI---LQKLDS-KLGGLLSEASSEEDFSGKSGQS  541
             +W GD LA+ + +KD     +++  +++   L +LD+ KL G L E  SE  F  ++G +
Sbjct  12    DWSGDGLAIALFQKDRTDGESTETSSVLSTALLELDANKLAGTLQELVSEAAFKAEAGST  71

Query  542   IVLRLPGLGS-KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV  718
             I  R+    + +++ L+GLG    +T       E     A +  A     +   +  +SV
Sbjct  72    IGGRVGANATIRKVLLMGLGEPAKAT-------EDTWRKAAAQAAKWATQSKCQSLAISV  124

Query  719   ----ESKLSAASAMATGIVSGTFEDNRFK---------LEPKTPT-LKSVEILGLGTGPE  856
                 + +   A A+A GI+    +D RFK          EPK  T L+ V++LG    P 
Sbjct  125   PLYNQDEALTAQALAEGILLAAHQDKRFKSKSEDKAEGKEPKPETKLEQVDLLGFSL-PA  183

Query  857   IEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCK  1036
              +  L+ ++ + SG I  +ELV+APANV+TP  LAE A  IA+ Y D ++  IL+ E+C 
Sbjct  184   AQTGLETAQKICSGAIAARELVSAPANVVTPITLAEIASAIAAEYKDCMSVKILEKEECD  243

Query  1037  ELKMGSFLGVAAAATNPSYFIHLCYK-PS------SGSVKTKLALLGKGITFDSGGYNLK  1195
              L MG+FLGV+ A+  P  FIHL Y  P+      +GS K KLA++GKGITFDSGG N+K
Sbjct  244   ALGMGAFLGVSQASDLPPKFIHLTYSSPTKSATEGNGSPKRKLAIIGKGITFDSGGLNIK  303

Query  1196  IGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILT  1375
              G  SSIE+MK DM GAA   GAA+AIAQ++P  +EVHFI+ ACENMISG  + PGDILT
Sbjct  304   AGVGSSIEMMKTDMGGAAATLGAAQAIAQLRPHDIEVHFIIAACENMISGKAIHPGDILT  363

Query  1376  ASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPS  1555
             ASNGK IEV +TDAEGRL LADALVYA KLGV+ +VDLATLTGAC+ ALG S+AG+++ S
Sbjct  364   ASNGKTIEVNNTDAEGRLTLADALVYADKLGVDAIVDLATLTGACVVALGDSIAGLWSNS  423

Query  1556  EDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             ++LA ++  A+   GEK WRMPLEE Y+E MKS +AD  N GS  G +ITA+LF+K
Sbjct  424   DELAAQIESASQKAGEKFWRMPLEEPYFEQMKSVVADFKNTGSRAGGSITAALFLK  479



>ref|WP_017312999.1| aminopeptidase A [Fischerella sp. PCC 9339]
Length=493

 Score =   339 bits (870),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 230/459 (50%), Positives = 289/459 (63%), Gaps = 29/459 (6%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             L +W GD LAVG+ E   A D   +     L  LD K  G + E  +EE+F GK G   V
Sbjct  10    LTDWTGDGLAVGLFED--ATDLTGE-----LATLDEKFAGYIKELIAEEEFKGKVGSIAV  62

Query  548   LRLP-GLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV--  718
              RL  G   +++ LVGLG      +   TL    AA A+ A+   +        G+S+  
Sbjct  63    TRLASGSPVRKVILVGLGK--PDAVKLDTLRRAAAAIARQAKKQKIKTL-----GISLPV  115

Query  719   --ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEV  886
                     A A+A G+    ++DNRFK EP  KTP L++VE+L L      E  +  +  
Sbjct  116   WNNDPDQTAQALAEGVQLALYQDNRFKSEPEDKTPQLETVELLRLNGQ---EAAIARANK  172

Query  887   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1066
             +SSGVI  ++LV APAN +TP  +AE A  IAS     +   IL+ E C++L MG+FLGV
Sbjct  173   ISSGVILARQLVAAPANEVTPITMAETATAIASETG--MHIEILEQEDCEKLGMGAFLGV  230

Query  1067  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1246
             A A+  P  FIHL YKP  G+   KLA++GKG+TFDSGG N+K GA S IE MK DM GA
Sbjct  231   AKASDLPPKFIHLTYKPD-GTPTRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGGA  288

Query  1247  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGR  1426
             A  FGAAKAI Q+KP  VEVHFI    ENMISG  M PGDIL ASNGK IEV +TDAEGR
Sbjct  289   AATFGAAKAIGQLKP-DVEVHFISAVTENMISGRAMHPGDILKASNGKTIEVNNTDAEGR  347

Query  1427  LILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEK  1606
             L LADALV+A KLGV+ +VDLATLTGACI ALG  +AG+FTP++ LA+E+  AA   GEK
Sbjct  348   LTLADALVFAEKLGVDAIVDLATLTGACIIALGDDIAGLFTPNDTLAQELETAAQGAGEK  407

Query  1607  LWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +WR+P+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  408   IWRLPMEEKYFEGLKSGIADMKNTGPRPGGSITAALFLK  446



>ref|WP_039199262.1| aminopeptidase A [Aphanizomenon flos-aquae]
 gb|KHG42686.1| aminopeptidase A [Aphanizomenon flos-aquae 2012/KM/D3]
 gb|KHG43244.1| aminopeptidase A [Aphanizomenon flos-aquae 2012/KM/D3]
Length=490

 Score =   339 bits (870),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 220/460 (48%), Positives = 297/460 (65%), Gaps = 31/460 (7%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             LL+W GD LA G+ E  +    +       L  L+ K  G+L E  +EE+F+GK+  ++V
Sbjct  10    LLDWTGDTLAFGLFEDAVELTGD-------LVNLNDKFAGILKEVIAEEEFTGKANSTVV  62

Query  548   LRLPGLGS-KRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEGLSV-  718
             +RL G GS K++ +VGLG   +  + + R +  T+A  AK  +  ++        G+S+ 
Sbjct  63    IRLAGTGSVKKVIVVGLGKPDALKLDSLRRVAATVAKTAKKQKTKTL--------GISLP  114

Query  719   ---ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSE  883
                +   + A A+  GI    ++D RFK EP  K P ++++++LGL      E  +  + 
Sbjct  115   LWNDDPAATAQALTEGIELALYQDIRFKSEPEDKNPNIETIDLLGLAGQ---EAAITCAN  171

Query  884   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLG  1063
              + SGVI  ++LV APAN +TP  +AE A+ IA  +   L       E+C++L MG+FLG
Sbjct  172   QIVSGVILARQLVAAPANAVTPITMAETAQAIAHEHGLELEILE--QEECEKLGMGAFLG  229

Query  1064  VAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMag  1243
             VA A+  P  FIHL YKP+ G+ K KLA++GKG+TFDSGG N+K GA S IE MK DM G
Sbjct  230   VAQASDLPPKFIHLIYKPA-GTPKRKLAIIGKGVTFDSGGLNIK-GAGSGIETMKMDMGG  287

Query  1244  aavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEG  1423
             AA   GAAKAI Q+KP  VEVHFI    ENMISG  M PGDILTASNGK IEV +TDAEG
Sbjct  288   AAATLGAAKAIGQLKP-DVEVHFISAVTENMISGKAMHPGDILTASNGKTIEVNNTDAEG  346

Query  1424  RLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGE  1603
             RL LADALVYA KLGV+ +VDLATLTGAC+ ALG  +AG+FTP + +A ++  AAD  GE
Sbjct  347   RLTLADALVYADKLGVDAIVDLATLTGACVVALGEDIAGLFTPDDTVASQLKTAADNAGE  406

Query  1604  KLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             K+WRMP+E+ Y++ +KS IADM N G   G +ITA+LF+K
Sbjct  407   KIWRMPMEDKYFDGLKSGIADMKNTGPRYGGSITAALFLK  446



>ref|WP_010994414.1| aminopeptidase A [Nostoc sp. PCC 7120]
 ref|NP_484281.1| leucyl aminopeptidase [Nostoc sp. PCC 7120]
 sp|Q8Z064.1|AMPA_NOSS1 RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Nostoc sp. PCC 7120]
 dbj|BAB77761.1| leucine aminopeptidase [Nostoc sp. PCC 7120]
Length=491

 Score =   339 bits (869),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 223/459 (49%), Positives = 288/459 (63%), Gaps = 29/459 (6%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             LLEW GD LA+ + E  +            L  LD K  G+L E  +EE+F+GK+  ++ 
Sbjct  10    LLEWAGDTLAIALFEDAVELTGE-------LGSLDEKFAGILKELITEEEFTGKANSTVF  62

Query  548   LRL-PGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV--  718
              R+   +  ++I LVGLG     T A++   ET+  AA +              GLS   
Sbjct  63    TRVSSNIPVRKIILVGLG----KTEAFKI--ETLRRAAAAVGKVGKKQKSKVI-GLSFPL  115

Query  719   --ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEV  886
                   ++A A+A G+    ++DNRFK +P  K   +++VE+LG       E  +  +  
Sbjct  116   WNNDPTASAQAIAEGLQLALYQDNRFKSDPEDKGSQVETVELLGFAGQ---EAAINRANQ  172

Query  887   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1066
             + SGVI  ++LV APAN +TP  +AE A+ IA  Y   L   IL+ E C++L MG+FLGV
Sbjct  173   IVSGVILARQLVAAPANSVTPITMAETAQQIAQDYG--LQIEILEQEDCEKLGMGAFLGV  230

Query  1067  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1246
             A A+  P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K GA S IE MK DM GA
Sbjct  231   ALASDLPPKFIHLTYKP-EGTPKRKLAIVGKGLTFDSGGLNIK-GAGSGIETMKIDMGGA  288

Query  1247  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGR  1426
             A   GAAKAIAQIKP  VEVHFI    ENMISG  M PGDILTASNGK IEV +TDAEGR
Sbjct  289   AATLGAAKAIAQIKP-NVEVHFISAVTENMISGKAMHPGDILTASNGKTIEVNNTDAEGR  347

Query  1427  LILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEK  1606
             L LADALVY  KLG++ +VDLATLTGA + ALG  +AG++TP + LA ++ +AA   GEK
Sbjct  348   LTLADALVYTDKLGLDAIVDLATLTGANVIALGDDIAGLYTPDDALAGQLEQAASESGEK  407

Query  1607  LWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +WRMPLEE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  408   IWRMPLEEKYFEGLKSGIADMKNTGPRPGGSITAALFLK  446



>ref|WP_039743238.1| aminopeptidase A [Hassallia byssoidea]
 gb|KIF35708.1| aminopeptidase A [Hassallia byssoidea VB512170]
Length=490

 Score =   338 bits (868),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 222/463 (48%), Positives = 295/463 (64%), Gaps = 23/463 (5%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSG  526
             I A      EWKGD LA+G+ E  +            L  LD ++GG+L E  +EE+F G
Sbjct  3     ILASNTPFKEWKGDGLAIGLFEDAVELTGE-------LAALDEQVGGVLKELIAEEEFKG  55

Query  527   KSGQSIVLRLPGLGS-KRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalas  700
             K+G SI  RL G  S +++ +VGLG   +  + + R    ++A  AK  +  ++A+ L  
Sbjct  56    KAGSSIFTRLSGDKSVRKLMVVGLGKPDALKLDSLRRAAASVARLAKKQKCKTLAIDLPV  115

Query  701   aEGLSVESKLSAASAMATGIVSGTFEDNRFKLE--PKTPTLKSVEILGLGTGPEIEKKLK  874
                    +  + A A+A GI    ++D RFK E   K P +++V +L L      E  + 
Sbjct  116   WN----NNPEATAQAIAEGIQLALYQDTRFKSENEDKGPQVETVHLLRLSGQ---EAAIA  168

Query  875   YSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGS  1054
              +  ++SGVI  +ELV APAN +TP  +AE A+ IAS +   L   IL+ E C++L MG+
Sbjct  169   RANQIASGVILARELVAAPANAVTPITMAETAQAIASDHD--LQLEILEKEDCEKLGMGA  226

Query  1055  FLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKD  1234
             FLGVA A+  P  FIHL YKP  G+ + KLA++GKG+TFDSGG N+K GA S IE MK D
Sbjct  227   FLGVAQASELPPKFIHLTYKPQ-GTPRRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKID  284

Query  1235  MagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTD  1414
             M GAA   GAAKAI Q+KP  VEVHFI    ENMISG  M PGD+L ASNGK IEV +TD
Sbjct  285   MGGAAATLGAAKAIGQLKP-DVEVHFISAVTENMISGRAMHPGDVLKASNGKTIEVNNTD  343

Query  1415  AEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADV  1594
             AEGRL LADALV+A KLGVE +VDLATLTGAC+ ALG  + G+F+P + +AK++  A++ 
Sbjct  344   AEGRLTLADALVFAEKLGVEAIVDLATLTGACLIALGDDIGGLFSPDDTVAKQLETASET  403

Query  1595  GGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
              GEKLWR+P+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  404   AGEKLWRLPMEEKYFEGLKSGIADMKNTGPRAGGSITAALFLK  446



>ref|WP_036484522.1| aminopeptidase A [Myxosarcina sp. GI1]
Length=490

 Score =   338 bits (868),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 224/472 (47%), Positives = 299/472 (63%), Gaps = 41/472 (9%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTE--KDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             I A    LL+W GD+LAVG+ E   ++A D         L KLD KL G++ E  +EE+F
Sbjct  3     IKATTTSLLDWTGDLLAVGIFEGETELAGD---------LAKLDDKLAGIVKELIAEEEF  53

Query  521   SGKSGQSIVLRLPGLGS-KRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvaval  694
              GK+G +I  R+      ++I LVGLG +    + ++R+    IA  A   ++       
Sbjct  54    EGKAGSTITSRVGNKNPVRKIALVGLGKLEDLKLDSWRSAAAAIARLAAKEKSL------  107

Query  695   asaEGLSV----ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGL-GTGP  853
                 G+S+    E+    A AMA  IV    +DNRFK EP  K   L++V+++GL G   
Sbjct  108   ----GISLPVGSEAADKIAQAMAEAIVLALHQDNRFKSEPEDKQTKLETVDLIGLNGQDG  163

Query  854   EIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQC  1033
              + K     E ++SGVI  +ELVNAPAN + P A+AE A+ +A      L   IL+ + C
Sbjct  164   AVAK----GETIASGVILARELVNAPANAIDPVAMAETAQKLAEECG--LAIEILERDAC  217

Query  1034  KELK--MGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGAN  1207
             ++ +  MG++LGVA A+  P  FIHL YKP  G+ K KLA++GK +TFDSGG NLK+ + 
Sbjct  218   EQFEQGMGAYLGVAQASDLPPKFIHLTYKPD-GTPKKKLAIVGKSVTFDSGGLNLKV-SG  275

Query  1208  SSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNG  1387
             S IE MK DM G A   GAAKAIAQ+KP  VEVHFI  A ENMISG  M PGDIL ASNG
Sbjct  276   SGIETMKMDMGGGAATLGAAKAIAQLKP-DVEVHFICAAAENMISGHAMHPGDILKASNG  334

Query  1388  KRIEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLA  1567
             K IEV +TDAEGRL LADALV+A KL V+ +VDLATLTGACI ALG ++AG+++  + LA
Sbjct  335   KTIEVNNTDAEGRLTLADALVFAEKLEVDAIVDLATLTGACIVALGNNIAGLWSTDDSLA  394

Query  1568  KEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +++  AA+  GEK W++P+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  395   EQIKTAAESAGEKFWQLPMEEKYFEGLKSQIADMKNTGPRAGGSITAALFLK  446



>ref|WP_007306122.1| aminopeptidase A [Crocosphaera watsonii]
 gb|EAM50183.1| Leucyl aminopeptidase [Crocosphaera watsonii WH 8501]
Length=489

 Score =   338 bits (868),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 217/456 (48%), Positives = 288/456 (63%), Gaps = 24/456 (5%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             LL+W GD +A+G+ E +             L +LD K GG L+E   E +F GKSG S V
Sbjct  10    LLDWSGDAIALGLFEDETILTGE-------LSQLDEKTGGTLAELIEETEFKGKSGSSAV  62

Query  548   LRLPGLGS--KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVE  721
              R+ G GS  +++ L+GLG     ++    L     A     +               VE
Sbjct  63    TRIGG-GSAIRKLILIGLGKKDELSLDSLRLAAAAVARLGKKEKVKSLGINFPV----VE  117

Query  722   SKLSAASAMATGIVSGTFEDNRFKLEPKTPTLK--SVEILGLGTGPEIEKKLKYSEVVSS  895
             ++ S  +A+A G++    +DNRFK EP+   LK  +V ILG+G   E    ++ ++ ++S
Sbjct  118   NEASTTTAIAEGMILSLHQDNRFKSEPEDKPLKLETVHILGVGAQSE---AVEQAQTITS  174

Query  896   GVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAA  1075
             GVI  +ELV APAN + P   AE A+ +A+ Y   L   IL+ E+C++L MG+FLGVA A
Sbjct  175   GVILARELVAAPANSVNPVTFAETAQTLATDYG--LDIEILEQEECEKLGMGAFLGVAKA  232

Query  1076  ATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavv  1255
             +  P  FIHL YKP++ + K KLA++GK +TFDSGG NLK G+ S IE MK DM G A  
Sbjct  233   SDLPPKFIHLTYKPAA-TPKRKLAIVGKSLTFDSGGLNLK-GSGSGIETMKMDMGGGAAT  290

Query  1256  fgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLIL  1435
              GAAKAIAQ+KP  VEVHF+  A ENMISG  M PGDILTASNGK IEV +TDAEGRL L
Sbjct  291   LGAAKAIAQLKP-DVEVHFVCAATENMISGRAMHPGDILTASNGKTIEVNNTDAEGRLTL  349

Query  1436  ADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWR  1615
             ADALVYA KL V+ +VDLATLTGAC+ ALG  ++G+++  E L +E+  A++  GEK W 
Sbjct  350   ADALVYAEKLEVDAIVDLATLTGACLVALGNDISGLWSTDETLTEELKTASETAGEKFWV  409

Query  1616  MPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             MP+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  410   MPMEEKYFEGLKSPIADMKNTGPRAGGSITAALFLK  445



>ref|WP_015187371.1| leucyl aminopeptidase [Gloeocapsa sp. PCC 7428]
 ref|YP_007126654.1| leucyl aminopeptidase [Gloeocapsa sp. PCC 7428]
 gb|AFZ29494.1| leucyl aminopeptidase [Gloeocapsa sp. PCC 7428]
Length=491

 Score =   338 bits (868),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 224/462 (48%), Positives = 297/462 (64%), Gaps = 21/462 (5%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSG  526
             I A +  LL+W GD LA+G+ E+        + Q  + Q L+ K  G L E   E +F G
Sbjct  3     IRAIDTPLLDWTGDCLAIGLFEE------AEELQGDVAQ-LNDKFAGALKEIIEETEFKG  55

Query  527   KSGQSIVLRLPGLGS-KRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalas  700
             K G S V R+ G    +++ L+GLG+  +  + + R  G T+A  AK  +  +V V L +
Sbjct  56    KEGSSAVTRIGGASPVRKVFLIGLGNQETLRLDSLRRAGATVARLAKKEKCKTVGVNLPT  115

Query  701   aEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTL-KSVEILGLGTGPEIEKKLKY  877
              +        +   A+A G+   +++DNRFK EP+   L + V++LG       E  +  
Sbjct  116   VD----NDPAATVQAIAEGLQLASYQDNRFKSEPEEKVLVERVDLLGFAGQ---EAAIAR  168

Query  878   SEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSF  1057
             +  + SGV   +ELV AP N +TP  LAE A+ IA  +   L   IL+ E+C++L MG+F
Sbjct  169   ANSICSGVNLARELVAAPPNEVTPITLAETAQKIAEDHG--LQVEILEREECEKLGMGAF  226

Query  1058  LGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDM  1237
             LGVA A+  P  FIHL YKP  G+ K +LA++GKG+TFDSGG N+K GA SSIE+MK DM
Sbjct  227   LGVAQASDLPPKFIHLTYKPE-GTPKRRLAIIGKGLTFDSGGLNIKAGAGSSIEMMKMDM  285

Query  1238  agaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDA  1417
              GA    GAAKAIAQ+KP  VEVHFI  A ENMISG  M PGDIL ASNGK IEV +TDA
Sbjct  286   GGAGATLGAAKAIAQLKP-DVEVHFISAATENMISGRAMHPGDILKASNGKTIEVNNTDA  344

Query  1418  EGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVG  1597
             EGRL LADALV+A KLGV+ +VDLATLTGACI ALG  +AG+F+P ++LA+++ +AA+  
Sbjct  345   EGRLTLADALVFAEKLGVDAIVDLATLTGACIIALGDEIAGLFSPDDELAQQLAQAAEAA  404

Query  1598  GEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             GEKLWRMP EE Y+E +KS IAD  N G   G +ITA+LF+K
Sbjct  405   GEKLWRMPFEEKYFEGLKSGIADFKNTGPRGGGSITAALFLK  446



>ref|WP_026085699.1| aminopeptidase A [Fischerella muscicola]
Length=493

 Score =   338 bits (868),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 231/458 (50%), Positives = 289/458 (63%), Gaps = 27/458 (6%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             +LEW GD LAVG+ E       N++     L  L+ K  G + E  +EE+F GK G +  
Sbjct  10    ILEWTGDGLAVGLFED------NTELTGE-LATLNEKFAGYIKELIAEEEFKGKVGSTAF  62

Query  548   LRLPGLGS--KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVE  721
              RL G GS  ++I LVGLG   +  +   TL    AA A+ A+         S   L V 
Sbjct  63    TRL-GSGSPVRKIILVGLGK--ADALKLDTLRRAAAAIARQAKKQKCKTLAIS---LPVW  116

Query  722   SKLSA--ASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVV  889
             +   A  A A+A G+    ++DNRFK EP  K P ++ VE+LGL      E  +  +  +
Sbjct  117   NNDPAQTAQALAEGVQLALYQDNRFKSEPEDKGPQVEIVELLGLNGQ---EAAIARANQI  173

Query  890   SSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVA  1069
              SGVI  ++LV APAN +TP  +AE A  IAS     +   IL+ E C++L MG+FLGVA
Sbjct  174   CSGVILARQLVAAPANEVTPITMAETAMAIASEAG--MHIEILEREDCEKLGMGAFLGVA  231

Query  1070  AAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaa  1249
              A+  P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K G  S IE MK DM GAA
Sbjct  232   KASDLPPKFIHLTYKPE-GTPKRKLAIIGKGLTFDSGGLNIK-GPGSGIENMKIDMGGAA  289

Query  1250  vvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRL  1429
               FGAAK I Q+KP  VEVHFI    ENMISG  M PGDIL ASNGK IEV +TDAEGRL
Sbjct  290   ATFGAAKVIGQLKP-DVEVHFISAVTENMISGHAMHPGDILKASNGKTIEVNNTDAEGRL  348

Query  1430  ILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKL  1609
              LADALV+A KLGV+ +VDLATLTGAC+ ALG  +AG+FTP + LAKE+  AA   GEK+
Sbjct  349   TLADALVFADKLGVDAIVDLATLTGACVIALGDDIAGLFTPDDGLAKELETAAHSAGEKI  408

Query  1610  WRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             WR+P+EE Y+E MKS IADM N G   G +ITA+LF+K
Sbjct  409   WRLPMEEKYFEGMKSGIADMKNTGPRPGGSITAALFLK  446



>ref|WP_009784389.1| aminopeptidase A [Lyngbya sp. PCC 8106]
 gb|EAW37149.1| leucyl aminopeptidase [Lyngbya sp. PCC 8106]
Length=489

 Score =   338 bits (867),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 223/456 (49%), Positives = 292/456 (64%), Gaps = 26/456 (6%)
 Frame = +2

Query  371   LEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVL  550
             ++W GD LAVG+ E ++  D + +     L +LD KL G L E   E +F GK   S   
Sbjct  11    IDWTGDALAVGIFEHEV--DLSGE-----LAQLDEKLAGTLKELIEETEFDGKPNSSAST  63

Query  551   RLPGLGS--KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVES  724
             R+ G  S  +++ LVGLGS  S  ++  TL   +AAA     A ++     +      E+
Sbjct  64    RV-GSNSPIRKVILVGLGS--SENLSLDTL--RLAAATAGRLAKTIKCKTLALSLPVYET  118

Query  725   KLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGL-GTGPEIEKKLKYSEVVSS  895
                   A+  G+    ++DNRFK   E K P ++ VE+LGL GT    E+ +  ++ + S
Sbjct  119   PDQTTQALVEGVELALYQDNRFKSETEDKGPAIERVELLGLAGT----EEAIIRAQNICS  174

Query  896   GVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAA  1075
             GV   +ELV APAN + P  +AE A+ +A+ Y       IL+ E C++L MG+FLGVA A
Sbjct  175   GVFLARELVAAPANEINPITMAEMAEALATEYG--FDIEILEKEDCEKLGMGAFLGVAQA  232

Query  1076  ATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavv  1255
             +  P  FIHL YKPS G+ K KLA++GKG+TFDSGG NLK+GA SSIE+MK DM GA   
Sbjct  233   SDMPPKFIHLTYKPS-GTPKRKLAIIGKGLTFDSGGLNLKVGA-SSIEMMKTDMGGAGAT  290

Query  1256  fgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLIL  1435
             FGAAKAI  +KP  VEVHFI    ENMISG  M PGD LTASNGK IEV +TDAEGRL L
Sbjct  291   FGAAKAIGLLKP-DVEVHFISAVTENMISGRAMHPGDFLTASNGKTIEVNNTDAEGRLTL  349

Query  1436  ADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWR  1615
             ADALV+  KLGV+ MVDLATLTGAC+ ALG  +AG+++P++DLA ++  A+   GEKLWR
Sbjct  350   ADALVFTDKLGVDAMVDLATLTGACVVALGNDIAGLWSPNDDLASQLETASKSTGEKLWR  409

Query  1616  MPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             MP+EE Y+E +K+  ADM N G   G AITA+LF+K
Sbjct  410   MPIEEKYFEGLKAVHADMKNTGPRQGGAITATLFLK  445



>ref|WP_006100918.1| aminopeptidase A [Coleofasciculus chthonoplastes]
 gb|EDX75780.1| Cytosol aminopeptidase family, catalytic domain [Coleofasciculus 
chthonoplastes PCC 7420]
Length=490

 Score =   338 bits (867),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 222/469 (47%), Positives = 301/469 (64%), Gaps = 35/469 (7%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLI-----LQKLDSKLGGLLSEASSE  511
             I A +   ++W GD LA+G             F++++     L +LD KL G L E   E
Sbjct  3     IRATDTPRVDWTGDALALGF------------FEDVVELTGDLAQLDQKLSGTLKELIEE  50

Query  512   EDFSGKSGQSIVLRLPGLGS--KRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassv  682
              +F G  G S V R+ G GS  +++ LVGLG   + T+ + R +G  IA  AK  ++ ++
Sbjct  51    TEFKGSVGSSAVTRV-GAGSSVRKVILVGLGKSDALTVDSLRRVGAAIARMAKQQKSKTL  109

Query  683   avalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPE  856
              ++L +A     ++ LSA  A+A GI      DNRFK EP  K   L+ VE+LGLG   +
Sbjct  110   GISLPAANN---DTALSA-QAIAEGITLALHLDNRFKSEPEDKGAKLEQVELLGLG---D  162

Query  857   IEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCK  1036
             ++  +     +  GVI  +ELV AP N +TP  LA+ A++IAS Y   +T  +L+ ++C+
Sbjct  163   VQAAINQGNAICQGVILARELVAAPPNSVTPMTLAQTAQDIASAYG--MTLEVLEKDECE  220

Query  1037  ELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSI  1216
             +L MG+FLGVA A+  P  FIHL YKP  G+ + KLA++GKG+TFDSGG NLK+ + S I
Sbjct  221   KLGMGAFLGVAQASEMPPKFIHLTYKPQ-GTPRRKLAIVGKGLTFDSGGLNLKV-SGSGI  278

Query  1217  ELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRI  1396
             E MK DM GA   FGAAKAI ++KP  VEVHFI  A ENMISG  + PGDI+TASNGK I
Sbjct  279   ETMKMDMGGAGATFGAAKAIGELKP-DVEVHFISAATENMISGHALHPGDIITASNGKTI  337

Query  1397  EVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEV  1576
             EV +TDAEGRL LADALV+A KL V+ +VDLATLTGAC+ ALG ++ G++T  + LA + 
Sbjct  338   EVNNTDAEGRLTLADALVFAEKLEVDAIVDLATLTGACVVALGNNIGGLWTTDDTLATQF  397

Query  1577  LEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
               A++  GEK W+MP+EE Y+E MKS IADM N G   G +ITA+LF+K
Sbjct  398   KTASEKAGEKFWQMPMEEKYFEGMKSPIADMKNTGPRAGGSITAALFLK  446



>ref|WP_015230084.1| leucyl aminopeptidase [Dactylococcopsis salina]
 ref|YP_007172451.1| leucyl aminopeptidase [Dactylococcopsis salina PCC 8305]
 gb|AFZ51094.1| leucyl aminopeptidase [Dactylococcopsis salina PCC 8305]
Length=500

 Score =   338 bits (868),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 226/469 (48%), Positives = 297/469 (63%), Gaps = 23/469 (5%)
 Frame = +2

Query  329   QRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASS  508
             ++ K+ + A E   L W GD LAVG+    +            L +LD KL G + E  +
Sbjct  7     KKAKMKVQATEQTTLSWSGDTLAVGLFVGGVTVTGE-------LAELDEKLAGTIKELIA  59

Query  509   EEDFSGKSGQSIVLRLPG-LGSKRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassv  682
             E +F GK+G ++V R+ G    ++I LVGLG      +   R  G +IA  AKS  + ++
Sbjct  60    ETNFEGKAGSNVVTRVGGNTPVRKIMLVGLGETKDFKLDTVRVAGGSIARLAKSQHSKNL  119

Query  683   avalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLK--SVEILGLGTGPE  856
             A++L   +     ++   A A+  GI    +ED RFK EP+   LK  SVE+L LG   +
Sbjct  120   AISLPIVD----NNQALTAQAITEGITLALYEDRRFKSEPEENPLKLESVELLELG---D  172

Query  857   IEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCK  1036
                 +  +E +  GVI  K+LV APAN +T   LA  A+ +A+ +   L   IL+ E C+
Sbjct  173   QAAAITKAEQICDGVILAKQLVAAPANSVTSVTLANLAEELAAEHG--LEVEILEKEDCE  230

Query  1037  ELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSI  1216
             +L MG++LGVA A+  P  FIHL YKP  G+ + K+A++GKG+TFDSGG NLK  A S I
Sbjct  231   KLGMGAYLGVAQASDIPPKFIHLTYKPQ-GTPRRKVAIVGKGVTFDSGGLNLK-PAGSGI  288

Query  1217  ELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRI  1396
             E MK DM GA    GAAKAIAQ+KP  VEVHFI  A ENMISG  M PGDILTASNGK I
Sbjct  289   ETMKMDMGGAGATLGAAKAIAQLKP-DVEVHFISAATENMISGHAMHPGDILTASNGKTI  347

Query  1397  EVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEV  1576
             EV +TDAEGRL LADALV+A KLGV+ +VDLATLTGAC+ ALG  + G+++  + LA ++
Sbjct  348   EVNNTDAEGRLTLADALVFAEKLGVDAIVDLATLTGACVIALGDDIGGLWSTDDLLADQL  407

Query  1577  LEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
               AADVGGEK+W+MPLEE Y+E MKS IADM N G   G +ITA+LF+K
Sbjct  408   KNAADVGGEKIWQMPLEEKYFEAMKSEIADMKNVGPRQGGSITAALFLK  456



>ref|WP_008226312.1| Cytosol aminopeptidase PepA [Richelia intracellularis]
 emb|CCH64879.1| Cytosol aminopeptidase PepA [Richelia intracellularis HM01]
Length=490

 Score =   338 bits (867),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 225/460 (49%), Positives = 298/460 (65%), Gaps = 30/460 (7%)
 Frame = +2

Query  365   DLLEWKGDILAVGVTEKDMARDPNSKFQNLI--LQKLDSKLGGLLSEASSEEDFSGKSGQ  538
             +LL+W GD LA+G  E  +          LI  L+ L+ KL G + E  +EE F  K   
Sbjct  9     NLLQWTGDGLAIGFFEGKL---------ELIGDLENLNDKLAGAIQEIITEEKFEAKINS  59

Query  539   SIVLRLPGLGS--KRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEG  709
              I  RL G GS  ++I +VGLG      + + RT   +I   AK  +  S+A++L     
Sbjct  60    IIFTRLIG-GSQVRKIIVVGLGKAEDFNLESLRTAAASIIRVAKKQKCKSLAISLPICNN  118

Query  710   LSVESKLSAASAMATGIVSGTFEDNRFKLEPKTP--TLKSVEILGLGTGPEIEKKLKYSE  883
             L+       A  +   +    +EDNRFK EP+    T+++V+++GL  G E  + +  + 
Sbjct  119   LA-----ETAKTITESVELAVYEDNRFKSEPENEKNTIETVDLIGL-VGQE--EAINLAH  170

Query  884   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLG  1063
              + SGVI  +ELV APAN +TP  +AE A+ +A+ Y+  L   +L+  +C+ L MG+FLG
Sbjct  171   QICSGVILARELVAAPANEVTPITMAETAQKLATEYN--LHLEVLEHGECENLGMGAFLG  228

Query  1064  VAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMag  1243
             VA A+  P  FIHL Y+P  G  + KLA++GKG+TFDSGG N+K  A+SSIE+MK DMAG
Sbjct  229   VAKASDIPPKFIHLTYQPQ-GIPRRKLAIIGKGLTFDSGGLNIK-SASSSIEIMKIDMAG  286

Query  1244  aavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEG  1423
             A   FGAAKAI QIKP  VEVHFI    ENMISG  M PGDIL ASNGK IEV +TDAEG
Sbjct  287   AGATFGAAKAIGQIKP-DVEVHFISAVTENMISGCAMHPGDILKASNGKTIEVNNTDAEG  345

Query  1424  RLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGE  1603
             RL LADALV+A KLGV+ +VDLATLTGACI ALG ++AG+FTP+++LAK++  A    GE
Sbjct  346   RLTLADALVFADKLGVDAIVDLATLTGACIVALGNNIAGMFTPNDELAKQLDIAGYKAGE  405

Query  1604  KLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             KLWRMP+E  Y+E +KSSIADM N+G   G +ITASLF++
Sbjct  406   KLWRMPMENKYFEGLKSSIADMKNSGPSAGSSITASLFLQ  445



>ref|WP_009457386.1| MULTISPECIES: aminopeptidase A [Fischerella]
 gb|EHC12054.1| cytosol aminopeptidase [Fischerella sp. JSC-11]
Length=493

 Score =   338 bits (867),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 231/460 (50%), Positives = 289/460 (63%), Gaps = 31/460 (7%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             +LEW GD LAVG+ E       N++     L  L+ K  G + E  +EE+F GK G +  
Sbjct  10    ILEWTGDGLAVGLFED------NTELTGE-LATLNEKFAGYIKELIAEEEFKGKVGSTAF  62

Query  548   LRLPGLGS----KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLS  715
              RL   GS    ++I LVGLG   +  +   TL    AA A+ A+         S   L 
Sbjct  63    TRL---GSSSPVRKIILVGLGK--ADALKLDTLRRAAAAIARQAKKQKCKTLAIS---LP  114

Query  716   VESKLSA--ASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSE  883
             V +   A  A A+A G+    ++DNRFK EP  K P ++ VE+LGL      E  +  + 
Sbjct  115   VWNNDPAQTAQALAEGVQLALYQDNRFKSEPEDKGPQVEIVELLGLNGQ---EAAIARAN  171

Query  884   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLG  1063
              + SGVI  ++LV APAN +TP  +AE A  IAS     +   IL+ E C++L MG+FLG
Sbjct  172   QICSGVILARQLVAAPANEVTPITMAETAMAIASEAG--MHIEILEREDCEKLGMGAFLG  229

Query  1064  VAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMag  1243
             VA A+  P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K G  S IE MK DM G
Sbjct  230   VAKASDLPPKFIHLTYKPE-GTPKRKLAIIGKGLTFDSGGLNIK-GPGSGIENMKIDMGG  287

Query  1244  aavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEG  1423
             AA  FGAAK I Q+KP  VEVHFI    ENMISG  M PGDIL ASNGK IEV +TDAEG
Sbjct  288   AAATFGAAKVIGQLKP-DVEVHFISAVTENMISGHAMHPGDILKASNGKTIEVNNTDAEG  346

Query  1424  RLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGE  1603
             RL LADALV+A KLGV+ +VDLATLTGAC+ ALG  +AG+FTP + LAKE+  AAD  GE
Sbjct  347   RLTLADALVFADKLGVDAIVDLATLTGACVIALGDDIAGLFTPDDALAKELETAADSAGE  406

Query  1604  KLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             K+WR+P+EE Y+E MKS IADM N G   G +ITA+LF+K
Sbjct  407   KIWRLPMEEKYFEGMKSGIADMKNTGPRPGGSITAALFLK  446



>ref|WP_011319481.1| aminopeptidase A [Anabaena variabilis]
 ref|YP_323235.1| leucyl aminopeptidase [Anabaena variabilis ATCC 29413]
 sp|Q3M9J6.1|AMPA_ANAVT RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Anabaena variabilis ATCC 29413]
 gb|ABA22340.1| leucyl aminopeptidase, Metallo peptidase, MEROPS family M17 [Anabaena 
variabilis ATCC 29413]
Length=491

 Score =   337 bits (864),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 220/459 (48%), Positives = 286/459 (62%), Gaps = 29/459 (6%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             LLEW GD LA+ + E  +            L  LD K  G+L E  +EE+F+GK+  ++ 
Sbjct  10    LLEWAGDTLAIALFEDAVELTGE-------LASLDEKFAGILKELIAEEEFTGKANSTVF  62

Query  548   LRLPG-LGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV--  718
              R+   +  ++I LVGLG   +  I      +T+  AA +              GLS   
Sbjct  63    TRVSANIPVRKIILVGLGKTEAFNI------DTLRRAAAAVGKVGKKQKSKVI-GLSFPL  115

Query  719   --ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEV  886
                   +++ A+A G+    ++DNRFK +P  K   +++VE+LG       E  +  +  
Sbjct  116   WNNDPTASSQAIAEGVQLALYQDNRFKSDPDDKGSQVETVELLGFAGQ---EAAINRANQ  172

Query  887   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1066
             + SGVI  ++LV APAN +TP  +AE A+ IA  Y   L   IL+ E C++L MG+FLGV
Sbjct  173   IVSGVILARQLVAAPANSVTPITMAETAQQIAQDYG--LQIEILEQEDCEKLGMGAFLGV  230

Query  1067  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1246
             A A+  P  FIHL YKP S + K KLA++GKG+TFDSGG N+K GA S IE MK DM GA
Sbjct  231   ALASDLPPKFIHLTYKPES-TPKRKLAIVGKGLTFDSGGLNIK-GAGSGIETMKIDMGGA  288

Query  1247  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGR  1426
             A   GAAKAIAQIKP  VEVHFI    ENMISG  M PGDILTASNGK IEV +TDAEGR
Sbjct  289   AATLGAAKAIAQIKP-NVEVHFISAVTENMISGKAMHPGDILTASNGKTIEVNNTDAEGR  347

Query  1427  LILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEK  1606
             L LADALVY  KLG++ +VDLATLTGA + ALG  +AG++TP + LA ++ +AA   GEK
Sbjct  348   LTLADALVYTDKLGLDAIVDLATLTGANVIALGDDIAGLYTPDDALAGQLEQAASESGEK  407

Query  1607  LWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +WRMPLEE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  408   IWRMPLEEKYFEGLKSGIADMKNTGPRPGGSITAALFLK  446



>ref|WP_017656226.1| aminopeptidase A [Microchaete sp. PCC 7126]
Length=493

 Score =   337 bits (863),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 229/469 (49%), Positives = 297/469 (63%), Gaps = 31/469 (7%)
 Frame = +2

Query  341   ILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             ++I   +  LLEW GD LA+G+ E  +            L  LD +L G+L E  +EE+F
Sbjct  1     MIIRPSDTPLLEWAGDTLAIGLFEDAVELTGE-------LATLDERLAGVLKELIAEEEF  53

Query  521   SGKSGQSIVLRLPGLGS--KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvaval  694
              GK+  SI  R+   GS  K++ LVGLG   +  +   TL  T A  A+  +        
Sbjct  54    KGKANSSIFTRVAA-GSLIKKVILVGLGK--TEALKLDTLRRTAATVARVGKKLKSKTL-  109

Query  695   asaEGLSV----ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPE  856
                 GLS+        +AA A+A GI    ++D RFK EP  K   L++V++LGL     
Sbjct  110   ----GLSLPLGNHQADAAAQAIAEGIQLALYQDIRFKSEPEDKGTQLETVDLLGLSGQ--  163

Query  857   IEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCK  1036
              E  +  ++ V SGVI  ++LV APAN +TP  LAE A+ IA+ +   L   IL+ E C+
Sbjct  164   -EAAITRADQVVSGVILARQLVAAPANEVTPITLAETAQAIANEHG--LQLEILEREDCE  220

Query  1037  ELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSI  1216
             +L MG+FLGVA A+  P  FIHL YKP +G+   KLA++GKG+TFDSGG N+K GA S I
Sbjct  221   KLGMGAFLGVAQASDLPPKFIHLTYKP-NGTPTRKLAIIGKGLTFDSGGLNIK-GAGSGI  278

Query  1217  ELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRI  1396
             E MK DM GAA   GAAKAIAQIKP   EVHFI  A ENMISG  M PGDIL ASNGK I
Sbjct  279   ETMKIDMGGAAATLGAAKAIAQIKP-DAEVHFISAATENMISGKAMHPGDILKASNGKTI  337

Query  1397  EVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEV  1576
             EV +TDAEGRL LADALV+A KLG++ +VDLATLTGAC+ ALG  +AG+FTP + +A ++
Sbjct  338   EVNNTDAEGRLTLADALVFADKLGLDAIVDLATLTGACVVALGEDMAGLFTPDDAVASQL  397

Query  1577  LEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
              +AA   GEK+WRMP+EE Y+E +KS +ADM N G   G +ITA+LF+K
Sbjct  398   EKAAQSSGEKIWRMPMEEKYFEGLKSGLADMKNTGPRAGGSITAALFLK  446



>ref|WP_010872664.1| aminopeptidase A [Synechocystis sp. PCC 6803]
 ref|NP_441359.1| leucyl aminopeptidase [Synechocystis sp. PCC 6803]
 ref|YP_007451241.1| leucine aminopeptidase [Synechocystis sp. PCC 6803]
 dbj|BAA18039.1| leucine aminopeptidase [Synechocystis sp. PCC 6803]
 gb|AGF51727.1| leucine aminopeptidase [Synechocystis sp. PCC 6803]
Length=508

 Score =   337 bits (864),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 222/497 (45%), Positives = 297/497 (60%), Gaps = 56/497 (11%)
 Frame = +2

Query  293   LATLGLTKPNQIQRPKILIAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLD  472
             +A  G   P+  ++  + I   +   L W+GD LA+G  E       N+      L +LD
Sbjct  1     MAKWGTDSPSTEKQTAMQIRGTDYTALTWQGDALALGFFE-------NATEITGDLTQLD  53

Query  473   SKLGGLLSEASSEEDFSGKSGQSIVLRLPGLGSK----RIGLVGLGSVV----------S  610
              +L G+L E   E++F GK+GQ +V R+   GSK    ++ LVGLG +           +
Sbjct  54    DRLEGVLRELIEEKEFKGKAGQKLVSRV---GSKTPIKKLILVGLGEIEKFNSQVLGDGA  110

Query  611   STIAYRTLGETIaaaaksaqassvavalasaEGLSVESK----LSAASAMATGIVSGTFE  778
             + IA    GE +                    G+S+  +       A+ +  GI+    +
Sbjct  111   AAIARLAKGEKVKTL-----------------GVSLPQREHDPAQTAAILTEGILLALHQ  153

Query  779   DNRFKLEPKTPTLK--SVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPG  952
             DNRFK +P+   +K  +VE+LGLG   E    +  +E + SGVI  +E+V APAN +TP 
Sbjct  154   DNRFKSDPEDKEIKLTTVELLGLG---EQSTAIGKAEKIVSGVILAREMVAAPANEVTPL  210

Query  953   ALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSV  1132
                E A  +A  Y   L   +L   +C+ L MG+FLGVA A+  P  FIHL Y+P++  V
Sbjct  211   TFTEIATELAQTYG--LELEVLGQTECEALGMGAFLGVAKASELPPQFIHLTYRPAN-PV  267

Query  1133  KTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHF  1312
             K KLA++GK +TFDSGG N+K GA S IE MK DM G     GAAKAIAQ+KP  VE+HF
Sbjct  268   K-KLAIIGKSLTFDSGGLNIK-GAGSGIETMKMDMGGGGATLGAAKAIAQLKP-NVEIHF  324

Query  1313  IVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLILADALVYASKLGVEKMVDLA  1492
             I  A ENMISGT M PGDILTASNGK IEV +TDAEGRL LADALV+A KLGVE +VDLA
Sbjct  325   ICAATENMISGTAMHPGDILTASNGKTIEVNNTDAEGRLTLADALVFAEKLGVEAIVDLA  384

Query  1493  TLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMI  1672
             TLTGACI ALG  + G+++P+++LA E+  AAD  GEK W+MP+E  Y+E +KS IADM 
Sbjct  385   TLTGACIVALGDDIGGLWSPNQELADELKVAADKAGEKFWQMPMESKYFEGLKSPIADMK  444

Query  1673  NAGSLDGDAITASLFMK  1723
             N G   G +ITA+LF++
Sbjct  445   NTGPRSGGSITAALFLQ  461



>ref|WP_006197752.1| aminopeptidase A [Nodularia spumigena]
 gb|EAW44110.1| leucyl aminopeptidase [Nodularia spumigena CCY9414]
 gb|AHJ29248.1| Cytosol aminopeptidase PepA [Nodularia spumigena CCY9414]
Length=491

 Score =   336 bits (862),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 226/459 (49%), Positives = 289/459 (63%), Gaps = 29/459 (6%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             LLE  GD LA+G+ E  +            L KLD + GG+L E  +EE+F+ K+  SI 
Sbjct  10    LLELSGDTLAIGLFEDAVELTGE-------LAKLDEQFGGVLKELIAEEEFTAKAYSSIF  62

Query  548   LRL-PGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV--  718
              R+  G   ++I LVGLG      +   TL    AA A+ A+            GLS+  
Sbjct  63    TRVSAGSPIRKIILVGLGK--PDALKLETLRRAAAAVARVAKKQKSKNL-----GLSLPL  115

Query  719   --ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEV  886
                     A A+A G+    ++D RFK EP  K   +++V++LGL      E  +  +  
Sbjct  116   CDNKPAETAQAIAEGLQLALYQDIRFKSEPEDKGAKIETVDLLGLAGQ---EAAITRANH  172

Query  887   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1066
             + SGV   +ELV APAN +TP  LAE A+ IA+ +   +   IL+ E C++L MG+FLGV
Sbjct  173   IVSGVNLARELVAAPANEVTPITLAETAQAIATEHG--IEIQILEREDCEKLGMGAFLGV  230

Query  1067  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1246
             A A+  P  FIHL YKP+ G+ + KLA++GKG+TFDSGG N+K GA S IE MK DM GA
Sbjct  231   AQASDLPPKFIHLTYKPA-GTPRRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKMDMGGA  288

Query  1247  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGR  1426
                 GAAKAIAQIKP  VEVHFI  A ENMISG  M PGDIL ASNGK IEV +TDAEGR
Sbjct  289   GTTLGAAKAIAQIKP-DVEVHFISAATENMISGHAMHPGDILKASNGKTIEVNNTDAEGR  347

Query  1427  LILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEK  1606
             L LADALVYA KLGV+ +VDLATLTGACI ALG  +AG+FTP + +A ++ +AA   GEK
Sbjct  348   LTLADALVYADKLGVDAIVDLATLTGACIVALGDDIAGLFTPDDAVAAQLEQAAQSAGEK  407

Query  1607  LWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             LWR+P+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  408   LWRLPMEEKYFEGLKSGIADMKNTGPRAGGSITAALFLK  446



>ref|WP_016859555.1| aminopeptidase A [Fischerella muscicola]
Length=493

 Score =   336 bits (861),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 227/457 (50%), Positives = 290/457 (63%), Gaps = 25/457 (5%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             LLEW GD LAVG+ E   A +   +     L  LD K  G + E  +EE+F GK G + V
Sbjct  10    LLEWTGDGLAVGLFED--ATELTGE-----LATLDEKFAGYIKELITEEEFKGKVGSTAV  62

Query  548   LRLP-GLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVES  724
              RL  G   +++ LVGLG      +   T     AA A+ A+   +     S   L V +
Sbjct  63    TRLASGSPVRKLILVGLGK--PDAVKLDTWRRAAAAIARQAKKQKIKTLAIS---LPVWN  117

Query  725   KLSAASA--MATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVVS  892
                A +A  +A G+    ++DNRFK EP  K P +++VE+LG+      E  +  +  +S
Sbjct  118   NDPAQTAQVLAEGVQLALYQDNRFKSEPEDKGPQVETVELLGVSGQ---ESAIARANQIS  174

Query  893   SGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAA  1072
             SGVI  ++LV APAN +TP  +AE A  IAS     +   IL+ + C++L MG+FLGVA 
Sbjct  175   SGVILARQLVAAPANEVTPITMAETATAIASETG--MHIEILEQQDCEKLGMGAFLGVAK  232

Query  1073  AATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaav  1252
             A+  P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K GA S IE MK DM GAA 
Sbjct  233   ASDLPPKFIHLTYKPD-GTPKRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGGAAA  290

Query  1253  vfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLI  1432
              FGAAKAI Q+KP  VEVHFI    ENMISG  M PGDIL ASNGK IEV +TDAEGRL 
Sbjct  291   TFGAAKAIGQLKP-DVEVHFISAVTENMISGRAMHPGDILKASNGKTIEVNNTDAEGRLT  349

Query  1433  LADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLW  1612
             LADALV+  KLGV+ +VDLATLTGAC+ ALG  +AG+FTP + LA+E+  AA   GEK+W
Sbjct  350   LADALVFTEKLGVDAIVDLATLTGACVIALGDDIAGLFTPDDTLAQELETAAQGAGEKIW  409

Query  1613  RMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             R+P+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  410   RLPMEEKYFEGLKSGIADMKNTGPRPGGSITAALFLK  446



>ref|WP_015142479.1| leucyl aminopeptidase [Pleurocapsa minor]
 ref|YP_007079728.1| leucyl aminopeptidase [Pleurocapsa sp. PCC 7327]
 gb|AFY76171.1| leucyl aminopeptidase [Pleurocapsa sp. PCC 7327]
Length=492

 Score =   335 bits (859),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 218/461 (47%), Positives = 293/461 (64%), Gaps = 33/461 (7%)
 Frame = +2

Query  368   LLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  547
             +L+W GD LA+G+ E ++            L  LD KL G + E  +E +F GKS  + V
Sbjct  10    VLDWTGDALAIGLFESNIELTGE-------LAHLDEKLAGTIQELIAETEFEGKSSSTAV  62

Query  548   LRLPGLGS--KRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEGLSV  718
              R+ G  S  ++I LVGLG      + A R  G  IA  AK  +  ++        G+S+
Sbjct  63    TRV-GSNSPVRKIILVGLGKAEDLKLNAVRLAGAAIARIAKKEKVKTL--------GISL  113

Query  719   ----ESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLKYS  880
                     + A A+A G++    +D RFK  +E K   L++V+++GLG+  E    + ++
Sbjct  114   PVVDNDPAATAGAIAEGMLLALHQDTRFKSEVEDKGLKLETVDLIGLGSQDE---AIAHA  170

Query  881   EVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFL  1060
             E + +GVI  +ELVNAPAN +T   +A+ A+ IA+     L   IL+ E C++L MG+FL
Sbjct  171   EAICAGVILARELVNAPANSVTAITMAQTAEQIAA--EGGLAVEILEKEDCEKLGMGAFL  228

Query  1061  GVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMa  1240
             GVA A+  P  FIHL YKP+ G+ K KLA++GK +TFDSGG N+K GA S IE MK DM 
Sbjct  229   GVAMASDLPPKFIHLTYKPA-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMDMG  286

Query  1241  gaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAE  1420
             G A   G AKAIAQ+KP  VE+HFI  A ENMISG  + PGDIL ASNGK IEV +TDAE
Sbjct  287   GGAAALGTAKAIAQLKPE-VEIHFICAATENMISGHALHPGDILRASNGKTIEVNNTDAE  345

Query  1421  GRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGG  1600
             GRL LADALV+A KLGV+ +VDLATLTGAC+ ALG  +AG+++  E LA ++ EA+D  G
Sbjct  346   GRLTLADALVFAEKLGVDAIVDLATLTGACVVALGNDIAGLWSTDETLANQLKEASDKAG  405

Query  1601  EKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             EK W+MP+EE Y+E +KS IADM N G   G +ITA+LF+K
Sbjct  406   EKFWQMPMEEKYFEGLKSQIADMKNTGPCAGGSITAALFLK  446



>ref|WP_012599158.1| aminopeptidase A [Cyanothece sp. PCC 7424]
 ref|YP_002377083.1| leucyl aminopeptidase [Cyanothece sp. PCC 7424]
 sp|B7KCB0.1|AMPA_CYAP7 RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Cyanothece sp. PCC 7424]
 gb|ACK70215.1| Leucyl aminopeptidase [Cyanothece sp. PCC 7424]
Length=490

 Score =   335 bits (859),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 223/470 (47%), Positives = 299/470 (64%), Gaps = 37/470 (8%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTE--KDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDF  520
             I A E  +L W G+ LA+G+ E   ++  +         L +L+ +LGG L E  +EE+F
Sbjct  3     IRATEQTILNWTGETLALGIFEGATELTEE---------LGELNERLGGTLQELITEEEF  53

Query  521   SGKSGQSIVLRLPGLGS--KRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvava  691
               K+G S V RL G  S  +++ LVGLG      + + R     IA +AK  +  ++   
Sbjct  54    EAKTGTSAVTRL-GKDSPIRKLILVGLGKPEDFKLHSLRNAAANIARSAKKLKIKTL---  109

Query  692   lasaEGLSVESKLSAASAMATGIVSGTF----EDNRFKLEP--KTPTLKSVEILGLGTGP  853
                  G+S+    +A +     IV G       D RFK EP  K   L++V++LGL    
Sbjct  110   -----GISLPVFNNAPTLTTGAIVEGVLLALHTDLRFKSEPEDKGAKLETVDLLGLAGQ-  163

Query  854   EIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQC  1033
               E  +  ++++  GVI  +ELVN PAN +TP  +A+ A+ +AS Y   LT TIL+ E C
Sbjct  164   --ETAINQAQIICDGVILARELVNGPANSVTPITMAQTAETLASDYG--LTLTILEQEDC  219

Query  1034  KELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSS  1213
             ++L MG++LGVA A+  P  FIHL YKP  G+ K KLA++GK +TFDSGG N+K+ + S 
Sbjct  220   EKLGMGAYLGVAKASDLPPKFIHLTYKPE-GTPKRKLAIVGKSLTFDSGGLNIKV-SGSG  277

Query  1214  IELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKR  1393
             IE MK DM G A   GAAKAIAQ+KP  VEVHFI  A ENMISG  M PGDILTASNGK 
Sbjct  278   IETMKMDMGGGAATLGAAKAIAQLKP-DVEVHFICAATENMISGKAMHPGDILTASNGKT  336

Query  1394  IEVTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKE  1573
             IEV +TDAEGRL LADALV+A +L V+ +VDLATLTGACI ALG  ++G+++P+E+LA +
Sbjct  337   IEVNNTDAEGRLTLADALVFAEQLEVDAIVDLATLTGACIIALGDDISGLWSPNEELATQ  396

Query  1574  VLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             +  AA++ GEK W+MPLEE Y+E MKS IADM N G   G +ITA+LF+K
Sbjct  397   LKTAAELAGEKFWQMPLEEKYFEGMKSPIADMKNTGPRAGGSITAALFLK  446



>ref|WP_015129473.1| leucyl aminopeptidase [Calothrix sp. PCC 7507]
 ref|YP_007066498.1| leucyl aminopeptidase [Calothrix sp. PCC 7507]
 gb|AFY33664.1| leucyl aminopeptidase [Calothrix sp. PCC 7507]
Length=493

 Score =   335 bits (858),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 225/462 (49%), Positives = 290/462 (63%), Gaps = 21/462 (5%)
 Frame = +2

Query  347   IAAREVDLLEWKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSG  526
             I A +  LLEW GD LA+G+ E  +            L   D KL G+L E  +EE+F G
Sbjct  3     IQASDTPLLEWAGDTLAIGLFEDAVELTGE-------LATFDGKLAGVLKELIAEEEFKG  55

Query  527   KSGQSIVLRL-PGLGSKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasa  703
             K+  +I  R+  G   K++ +VGLG   +  +   TL    AA A+ A+     +   S 
Sbjct  56    KANSTIFTRVAAGSPVKKVIVVGLGK--AEALKLDTLRRAAAAVARVAKKQKSKILGFSF  113

Query  704   EGLSVESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKY  877
                + E   S A A+A GI    ++D RFK EP  K   +++V++LG       E  +  
Sbjct  114   PLWNNEPTAS-AQAIAEGIELALYQDIRFKSEPEDKGSQIETVDLLGFAGQ---EAAIAR  169

Query  878   SEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSF  1057
             +  + SGVI  ++LV APAN +TP  LAE A+ IA  Y   L   IL+ E C++L MG+F
Sbjct  170   ANQIVSGVILARQLVAAPANEVTPITLAETAQAIAKEYG--LQVEILEREDCEKLGMGAF  227

Query  1058  LGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDM  1237
             LGVA A+  P  FIHL YKP  G+   KLA++GKG+TFDSGG N+K GA S IE MK DM
Sbjct  228   LGVAQASDLPPKFIHLTYKP-DGTPTRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDM  285

Query  1238  agaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDA  1417
              GAA   GAAKAIAQIKP   EVHFI  A ENMISG  M PGDIL ASNGK IEV +TDA
Sbjct  286   GGAAATLGAAKAIAQIKP-DAEVHFISAATENMISGKAMHPGDILKASNGKTIEVNNTDA  344

Query  1418  EGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVG  1597
             EGRL LADALV+A KLGV+ +VDLATLTGAC+ ALG  +AG+F+P + +A ++ +AA   
Sbjct  345   EGRLTLADALVFADKLGVDAIVDLATLTGACVVALGEDMAGLFSPDDAVASQLEKAAAGS  404

Query  1598  GEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             GEK+WRMP+EE Y+E +KS +ADM N G   G +ITA+LF+K
Sbjct  405   GEKIWRMPMEEKYFEGLKSGLADMKNTGPRAGGSITAALFLK  446



>ref|WP_015175730.1| leucyl aminopeptidase [Oscillatoria nigro-viridis]
 ref|YP_007114835.1| leucyl aminopeptidase [Oscillatoria nigro-viridis PCC 7112]
 gb|AFZ06419.1| leucyl aminopeptidase [Oscillatoria nigro-viridis PCC 7112]
Length=492

 Score =   334 bits (857),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 217/457 (47%), Positives = 290/457 (63%), Gaps = 31/457 (7%)
 Frame = +2

Query  377   WKGDILAVGVTEKDMARDPNSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRL  556
             W GD LA+G+ E  +    +       L +LD KL G L E   E DF GK G S + R+
Sbjct  13    WTGDALAIGLFEDALELTGD-------LAQLDEKLAGTLKELLLEVDFKGKVGTSAITRV  65

Query  557   PGLGS-KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV----E  721
              G    ++I +VGLG   +  +   T+ +     AK A+            G+S      
Sbjct  66    GGNNPIRKIAIVGLGK--TEDLKLDTVRQAAGVCAKLAKKEKCKTL-----GISFPVWKN  118

Query  722   SKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGL-GTGPEIEKKLKYSEVVS  892
             +  S ASA+A G+     +DNRFK EP  K+P L+ + +LG  GT    E  +  +  ++
Sbjct  119   APDSTASAIAEGVELSLNQDNRFKSEPEDKSPQLEQIHLLGFAGT----ESAIARARQIT  174

Query  893   SGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAA  1072
             +GVI  +ELV APAN +TP  +AE A+++A+     L   IL+ E C++L MG+FLGVA 
Sbjct  175   AGVILARELVAAPANFVTPITMAETAQSLAAECG--LELKILEREDCEKLGMGAFLGVAL  232

Query  1073  AATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaav  1252
             A+  P  FIHL YKP  G+ + K+A++GKG+TFDSGG N+K GA S IE+MK DM GAA 
Sbjct  233   ASDLPPKFIHLTYKPE-GTPRRKIAIVGKGLTFDSGGLNIK-GAGSGIEMMKIDMGGAAA  290

Query  1253  vfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTDTDAEGRLI  1432
               GAAKAI  IKP  VEVHFI    ENMISG  +RPGDILTASNGK IEV +TDAEGRL 
Sbjct  291   TLGAAKAIGHIKP-DVEVHFISAVTENMISGRALRPGDILTASNGKTIEVNNTDAEGRLT  349

Query  1433  LADALVYASKLGVEKMVDLATLTGACITALGRSVAGIFTPSEDLAKEVLEAADVGGEKLW  1612
             LADALV+A KLGV+ +VDLATLTGAC+ ALG  +AG+++P + +A E++ A+++ GEK W
Sbjct  350   LADALVFADKLGVDAIVDLATLTGACVIALGDEIAGLWSPQDSVAAEIVAASELAGEKFW  409

Query  1613  RMPLEESYWETMKSSIADMINAGSLDGDAITASLFMK  1723
             RMP+EE Y+E +K+  ADM N G   G +ITA+LF+K
Sbjct  410   RMPMEEKYFEGLKALHADMKNTGPRPGGSITAALFLK  446



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4932926693546