BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25548_g1_i2 len=1871 path=[14557:0-413 9649:414-446 16458:447-458
9694:459-515 14370:516-551 9787:552-575 14429:576-599 16529:600-660
16575:661-682 9915:683-696 5869:697-744 9975:745-746 6924:747-759
5702:760-819 4972:820-858 10086:859-887 10114:888-890 10117:891-922
16688:923-923 10148:924-935 6733:936-1022 3587:1023-1044
3609:1045-1118 3892:1119-1269 3834:1270-1293 4066:1294-1378
15515:1379-1465 4151:1466-1500 4186:1501-1516 16954:1517-1525
13268:1526-1605 6147:1606-1684 6226:1685-1870]

Length=1871
                                                                      Score     E

ref|XP_009795110.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    635   0.0      
ref|XP_009614630.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    635   0.0      
ref|XP_011079411.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    625   0.0      
gb|AAO15916.1|  neutral leucine aminopeptidase preprotein               600   0.0      Solanum lycopersicum
ref|XP_011083971.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    600   0.0      
ref|XP_002276114.1|  PREDICTED: leucine aminopeptidase 1                597   0.0      Vitis vinifera
ref|XP_006350101.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    597   0.0      
gb|AGW47884.1|  leucine aminopeptidase                                  594   0.0      
ref|XP_010103674.1|  Leucine aminopeptidase 3                           596   0.0      
ref|NP_001233884.1|  leucine aminopeptidase 2, chloroplastic            595   0.0      
gb|EYU34348.1|  hypothetical protein MIMGU_mgv1a003554mg                595   0.0      
emb|CAN66364.1|  hypothetical protein VITISV_029979                     593   0.0      Vitis vinifera
emb|CDP10235.1|  unnamed protein product                                587   0.0      
gb|EYU35326.1|  hypothetical protein MIMGU_mgv1a003455mg                585   0.0      
gb|KHG23887.1|  hypothetical protein F383_01434                         578   0.0      
gb|KFK29676.1|  hypothetical protein AALP_AA7G164200                    578   0.0      
ref|XP_007011931.1|  Cytosol aminopeptidase family protein              574   0.0      
emb|CBI36527.3|  unnamed protein product                                572   0.0      
emb|CDP16585.1|  unnamed protein product                                568   0.0      
ref|XP_006283623.1|  hypothetical protein CARUB_v10004680mg             566   0.0      
ref|XP_011018033.1|  PREDICTED: leucine aminopeptidase 1-like           566   0.0      
ref|XP_008367747.1|  PREDICTED: leucine aminopeptidase 1-like           564   0.0      
ref|XP_002529380.1|  leucine aminopeptidase, putative                   564   0.0      Ricinus communis
ref|XP_008242990.1|  PREDICTED: leucine aminopeptidase 1                563   0.0      
ref|XP_007204206.1|  hypothetical protein PRUPE_ppa003434mg             562   0.0      
ref|XP_010525807.1|  PREDICTED: leucine aminopeptidase 1                562   0.0      
ref|XP_010265583.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    560   0.0      
ref|XP_006453614.1|  hypothetical protein CICLE_v10007834mg             562   0.0      
ref|XP_004287132.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    561   0.0      
ref|XP_006474000.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    561   0.0      
ref|XP_010047106.1|  PREDICTED: leucine aminopeptidase 1-like           561   0.0      
emb|CAA48038.1|  leucine aminopeptidase                                 560   0.0      Solanum tuberosum [potatoes]
ref|XP_010275823.1|  PREDICTED: leucine aminopeptidase 1-like           560   0.0      
ref|XP_002867321.1|  cytosol aminopeptidase family protein              560   0.0      
sp|P31427.2|AMPL_SOLTU  RecName: Full=Leucine aminopeptidase, chl...    560   0.0      Solanum tuberosum [potatoes]
gb|KDP38679.1|  hypothetical protein JCGZ_04032                         560   0.0      
ref|XP_010432926.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    560   0.0      
ref|XP_002325134.2|  leucine aminopeptidase family protein              559   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009358438.1|  PREDICTED: leucine aminopeptidase 1-like           558   0.0      
ref|XP_010438109.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    557   0.0      
ref|NP_194821.1|  leucine aminopeptidase 2                              557   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006600543.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    556   0.0      
ref|XP_002867322.1|  predicted protein                                  556   0.0      
gb|KHG14578.1|  hypothetical protein F383_10344                         554   0.0      
ref|XP_003518220.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    555   0.0      
ref|XP_004507738.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    554   0.0      
ref|XP_009366178.1|  PREDICTED: leucine aminopeptidase 1-like           553   0.0      
ref|XP_006412653.1|  hypothetical protein EUTSA_v10024754mg             552   0.0      
ref|XP_007154883.1|  hypothetical protein PHAVU_003G156100g             551   0.0      
ref|XP_011033404.1|  PREDICTED: leucine aminopeptidase 1                552   0.0      
gb|AAL11627.1|AF424634_1  AT4g30920/F6I18_170                           550   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008384407.1|  PREDICTED: leucine aminopeptidase 1-like           550   0.0      
ref|XP_010526298.1|  PREDICTED: leucine aminopeptidase 1-like           549   0.0      
emb|CDX68703.1|  BnaC01g07500D                                          548   0.0      
ref|XP_009127424.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    547   0.0      
ref|XP_010687715.1|  PREDICTED: leucine aminopeptidase 1-like           542   0.0      
ref|NP_194820.1|  cytosol aminopeptidase family protein                 541   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004144730.1|  PREDICTED: leucine aminopeptidase 1-like           540   0.0      
ref|XP_010929163.1|  PREDICTED: leucine aminopeptidase 1-like           540   0.0      
ref|XP_009415506.1|  PREDICTED: leucine aminopeptidase 1-like           539   0.0      
ref|XP_010447643.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    538   0.0      
gb|EPS65095.1|  hypothetical protein M569_09684                         536   0.0      
ref|XP_008452840.1|  PREDICTED: leucine aminopeptidase 1-like           536   1e-180   
ref|XP_003610319.1|  Leucine aminopeptidase                             534   7e-180   
gb|KHG12351.1|  Leucine aminopeptidase 1 -like protein                  532   1e-179   
ref|XP_010942088.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    531   2e-179   
ref|XP_008794352.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    533   4e-179   
ref|XP_008803713.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    528   4e-179   
ref|XP_008803712.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    528   6e-178   
ref|XP_004253490.2|  PREDICTED: leucine aminopeptidase 1, chlorop...    526   1e-177   
ref|XP_006404921.1|  hypothetical protein EUTSA_v10000127mg             526   1e-177   
emb|CAA18201.1|  leucyl aminopeptidase-like protein                     526   2e-177   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006350102.1|  PREDICTED: leucine aminopeptidase, chloropla...    527   5e-177   
dbj|BAH57215.1|  AT4G30910                                              523   7e-177   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002880560.1|  cytosol aminopeptidase                             523   2e-176   
ref|NP_001233862.1|  leucine aminopeptidase 1, chloroplastic            525   3e-176   
gb|AAC49457.1|  leucine aminopeptidase                                  525   4e-176   Solanum lycopersicum
ref|XP_007138276.1|  hypothetical protein PHAVU_009G195000g             524   9e-176   
ref|NP_179997.1|  aminopeptidase family protein                         520   4e-175   Arabidopsis thaliana [mouse-ear cress]
emb|CAA69614.1|  lap17.1a                                               522   4e-175   Solanum lycopersicum
ref|XP_006293400.1|  hypothetical protein CARUB_v10024476mg             516   6e-174   
emb|CDX76828.1|  BnaC08g34140D                                          516   9e-174   
emb|CDY20284.1|  BnaC04g36720D                                          515   5e-173   
ref|XP_006857233.1|  hypothetical protein AMTR_s00065p00209640          514   1e-172   
gb|KFK32675.1|  hypothetical protein AALP_AA6G274200                    514   1e-172   
ref|XP_003553879.1|  PREDICTED: leucine aminopeptidase 3, chlorop...    515   2e-172   
ref|XP_009410189.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    513   2e-172   
ref|XP_009140523.1|  PREDICTED: leucine aminopeptidase 1                513   3e-172   
sp|Q6K669.1|AMPL2_ORYSJ  RecName: Full=Leucine aminopeptidase 2, ...    515   6e-172   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454700.1|  hypothetical protein SORBIDRAFT_04g035840          512   8e-171   Sorghum bicolor [broomcorn]
gb|AFW73857.1|  hypothetical protein ZEAMMB73_599286                    511   1e-170   
ref|XP_010429381.1|  PREDICTED: leucine aminopeptidase 1                508   2e-170   
ref|XP_004954213.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    510   4e-170   
ref|XP_009117239.1|  PREDICTED: leucine aminopeptidase 1                507   5e-170   
ref|XP_010472421.1|  PREDICTED: leucine aminopeptidase 1-like           505   2e-169   
emb|CDY39696.1|  BnaA04g14130D                                          505   3e-169   
ref|XP_004514667.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    506   8e-169   
emb|CDY34790.1|  BnaA09g41570D                                          503   1e-168   
emb|CAA18202.1|  leucyl aminopeptidase-like protein (partial)           500   2e-167   Arabidopsis thaliana [mouse-ear cress]
gb|EMS53149.1|  Leucine aminopeptidase 2, chloroplastic                 498   3e-166   
ref|XP_004954212.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    500   5e-166   
gb|KHN17492.1|  Leucine aminopeptidase 3, chloroplastic                 497   1e-165   
gb|KHN42824.1|  Leucine aminopeptidase 3, chloroplastic                 494   1e-164   
ref|XP_006649129.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    492   4e-164   
dbj|BAK00954.1|  predicted protein                                      492   5e-164   
dbj|BAJ92683.1|  predicted protein                                      492   5e-164   
ref|XP_008643980.1|  PREDICTED: uncharacterized protein LOC100381...    510   1e-163   
ref|XP_010236855.1|  PREDICTED: formin-like protein 7                   509   3e-163   
gb|AAA80498.1|  leucine aminopeptidase                                  488   1e-162   Solanum lycopersicum
pdb|4KSI|A  Chain A, Crystal Structure Analysis Of The Acidic Leu...    487   5e-162   
gb|KGN61047.1|  hypothetical protein Csa_2G035470                       486   7e-162   
ref|XP_010234597.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    485   2e-161   
ref|XP_008785917.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    478   8e-161   
ref|XP_004144796.1|  PREDICTED: leucine aminopeptidase 1-like           483   2e-160   
gb|AFW73856.1|  hypothetical protein ZEAMMB73_599286                    481   2e-160   
gb|ABK24447.1|  unknown                                                 485   3e-160   Picea sitchensis
dbj|BAJ85842.1|  predicted protein                                      469   3e-155   
ref|XP_002308402.1|  leucine aminopeptidase family protein              467   6e-155   Populus trichocarpa [western balsam poplar]
ref|NP_001189587.1|  aminopeptidase family protein                      452   2e-149   
gb|EMT02487.1|  Formin-like protein 7                                   456   7e-146   
gb|EAY82956.1|  hypothetical protein OsI_38175                          444   1e-145   Oryza sativa Indica Group [Indian rice]
ref|XP_004158743.1|  PREDICTED: leucine aminopeptidase 1-like           442   7e-145   
gb|EEE53139.1|  hypothetical protein OsJ_35947                          440   2e-143   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002453876.1|  hypothetical protein SORBIDRAFT_04g020460          434   2e-141   Sorghum bicolor [broomcorn]
ref|NP_001066684.1|  Os12g0434400                                       432   1e-140   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008666283.1|  PREDICTED: LOW QUALITY PROTEIN: leucine amin...    425   7e-140   
pir||A48788  leucyl aminopeptidase (EC 3.4.11.1) DR57 - tomato          424   2e-138
ref|XP_002965045.1|  hypothetical protein SELMODRAFT_167050             425   9e-138   
ref|XP_002962141.1|  hypothetical protein SELMODRAFT_140664             424   3e-137   
gb|AFW71513.1|  hypothetical protein ZEAMMB73_883672                    401   2e-128   
ref|XP_006664532.1|  PREDICTED: putative leucine aminopeptidase 1...    398   4e-128   
gb|KGN61046.1|  hypothetical protein Csa_2G035460                       384   4e-124   
gb|ABY84519.1|  leucine aminopeptidase                                  380   8e-124   Solanum nigrum
ref|XP_008666459.1|  PREDICTED: LOW QUALITY PROTEIN: leucine amin...    393   1e-123   
ref|XP_008645704.1|  PREDICTED: LOW QUALITY PROTEIN: leucine amin...    389   2e-123   
gb|AFW68884.1|  hypothetical protein ZEAMMB73_253679                    386   9e-121   
tpg|DAA39426.1|  TPA: hypothetical protein ZEAMMB73_947180              379   2e-120   
ref|XP_008352214.1|  PREDICTED: LOW QUALITY PROTEIN: leucine amin...    365   4e-120   
gb|AFW81180.1|  hypothetical protein ZEAMMB73_308587                    380   1e-119   
gb|AFK42034.1|  unknown                                                 356   9e-117   
gb|ACJ85545.1|  unknown                                                 356   1e-116   Medicago truncatula
ref|XP_001758543.1|  predicted protein                                  366   1e-116   
ref|XP_008376006.1|  PREDICTED: LOW QUALITY PROTEIN: leucine amin...    355   2e-115   
gb|KHN18036.1|  Leucine aminopeptidase 1                                361   2e-115   
gb|EMT23101.1|  Leucine aminopeptidase 2, chloroplastic                 358   3e-112   
gb|KEH38071.1|  cytosol aminopeptidase family protein                   352   5e-112   
ref|XP_001783885.1|  predicted protein                                  348   1e-108   
ref|XP_008358040.1|  PREDICTED: LOW QUALITY PROTEIN: leucine amin...    347   3e-107   
ref|XP_008669992.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    338   3e-107   
ref|NP_001048379.1|  Os02g0794700                                       301   2e-100   Oryza sativa Japonica Group [Japonica rice]
emb|CDY22921.1|  BnaA01g18590D                                          310   3e-95    
emb|CAA68143.1|  cytosol aminopeptidase                                 272   4e-93    Petroselinum crispum
emb|CDX99645.1|  BnaC04g34020D                                          295   6e-90    
ref|WP_039713603.1|  aminopeptidase A                                   272   4e-87    
emb|CEF97939.1|  Leucine aminopeptidase/peptidase B                     276   8e-87    
ref|WP_035153350.1|  aminopeptidase A                                   267   2e-86    
ref|WP_013191100.1|  aminopeptidase A                                   276   3e-86    
tpg|DAA46815.1|  TPA: hypothetical protein ZEAMMB73_269181              296   3e-86    
ref|WP_015217123.1|  cytosol aminopeptidase                             274   9e-86    
ref|WP_019494406.1|  aminopeptidase A                                   266   2e-85    
ref|WP_017315758.1|  aminopeptidase A                                   274   2e-85    
ref|WP_027842357.1|  aminopeptidase A                                   268   2e-85    
tpg|DAA46938.1|  TPA: hypothetical protein ZEAMMB73_710024              288   3e-85    
ref|WP_008318986.1|  leucyl aminopeptidase                              280   6e-85    
ref|WP_015156822.1|  leucyl aminopeptidase                              266   7e-85    
ref|WP_037216500.1|  hypothetical protein                               262   2e-84    
ref|WP_002766908.1|  aminopeptidase A                                   270   3e-84    
ref|WP_035993085.1|  aminopeptidase A                                   273   3e-84    
ref|WP_017742946.1|  aminopeptidase A                                   268   4e-84    
ref|WP_038084500.1|  aminopeptidase A                                   266   4e-84    
gb|AFW71516.1|  hypothetical protein ZEAMMB73_883672                    261   5e-84    
ref|WP_015165714.1|  cytosol aminopeptidase                             270   5e-84    
ref|WP_013323896.1|  aminopeptidase A                                   263   6e-84    
ref|WP_026734312.1|  aminopeptidase A                                   262   7e-84    
ref|WP_017294075.1|  hypothetical protein                               269   9e-84    
ref|WP_012268315.1|  aminopeptidase A                                   268   9e-84    
ref|WP_009342536.1|  aminopeptidase A                                   264   1e-83    
ref|WP_002782251.1|  putative cytosol aminopeptidase                    268   1e-83    
ref|WP_016874221.1|  aminopeptidase A                                   259   1e-83    
ref|WP_026722318.1|  aminopeptidase A                                   264   2e-83    
ref|WP_008207180.1|  aminopeptidase A                                   269   2e-83    
ref|WP_039726207.1|  aminopeptidase A                                   270   2e-83    
ref|WP_002773226.1|  aminopeptidase A                                   269   3e-83    
ref|WP_006277890.1|  aminopeptidase A                                   262   3e-83    
ref|WP_015185013.1|  leucyl aminopeptidase                              279   3e-83    
ref|WP_016515741.1|  Cytosol aminopeptidase                             269   3e-83    
ref|WP_012629140.1|  aminopeptidase A                                   262   4e-83    
ref|WP_002744501.1|  leucine aminopeptidase 1                           267   5e-83    
ref|WP_002785587.1|  aminopeptidase A                                   266   5e-83    
ref|WP_015211045.1|  leucyl aminopeptidase                              265   6e-83    
dbj|GAL91486.1|  cytosol aminopeptidase PepA                            268   6e-83    
ref|XP_002502369.1|  predicted protein                                  266   8e-83    Micromonas commoda
ref|WP_002797316.1|  aminopeptidase A                                   268   8e-83    
ref|WP_028083384.1|  aminopeptidase A                                   266   9e-83    
ref|WP_002735635.1|  leucine aminopeptidase 1                           268   1e-82    
ref|WP_009545951.1|  MULTISPECIES: aminopeptidase A                     270   1e-82    
ref|WP_019502106.1|  hypothetical protein                               266   1e-82    
ref|WP_024970899.1|  aminopeptidase A                                   267   1e-82    
ref|WP_002751572.1|  aminopeptidase A                                   266   2e-82    
ref|XP_005835498.1|  hypothetical protein GUITHDRAFT_68651              279   2e-82    
ref|WP_002790963.1|  aminopeptidase A                                   266   2e-82    
ref|WP_008275582.1|  aminopeptidase A                                   269   4e-82    
ref|XP_008337029.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    240   4e-82    
ref|WP_015784948.1|  aminopeptidase A                                   267   5e-82    
ref|WP_016949514.1|  aminopeptidase A                                   264   6e-82    
ref|WP_006515687.1|  leucyl aminopeptidase                              263   6e-82    
ref|WP_002801043.1|  aminopeptidase A                                   263   7e-82    
ref|WP_021830390.1|  Cytosol aminopeptidase PepA                        270   8e-82    
ref|WP_012406927.1|  aminopeptidase A                                   255   8e-82    
ref|WP_009556547.1|  leucyl aminopeptidase                              254   8e-82    
ref|WP_010994414.1|  aminopeptidase A                                   259   9e-82    
ref|WP_007311314.1|  aminopeptidase A                                   270   1e-81    
ref|WP_012597067.1|  aminopeptidase A                                   266   1e-81    
ref|WP_002757690.1|  aminopeptidase A                                   265   1e-81    
ref|WP_011319481.1|  aminopeptidase A                                   259   1e-81    
ref|WP_011431320.1|  aminopeptidase A                                   251   1e-81    
ref|WP_015124149.1|  leucyl aminopeptidase                              265   1e-81    
ref|WP_010469501.1|  aminopeptidase A                                   258   1e-81    
ref|WP_017321976.1|  aminopeptidase A                                   259   2e-81    
dbj|BAP18524.1|  leucyl aminopeptidase                                  267   2e-81    
ref|WP_015191783.1|  cytosol aminopeptidase                             261   2e-81    
ref|WP_028091351.1|  aminopeptidase A                                   261   2e-81    
ref|WP_026099711.1|  aminopeptidase A                                   260   2e-81    
ref|WP_009457386.1|  MULTISPECIES: aminopeptidase A                     252   3e-81    
ref|WP_006197752.1|  aminopeptidase A                                   256   6e-81    
ref|WP_009631961.1|  leucyl aminopeptidase                              258   7e-81    
ref|WP_009784389.1|  aminopeptidase A                                   260   9e-81    
ref|WP_017312999.1|  aminopeptidase A                                   254   1e-80    
ref|WP_017656226.1|  aminopeptidase A                                   257   1e-80    
ref|WP_018397622.1|  aminopeptidase A                                   275   1e-80    
ref|WP_017658914.1|  hypothetical protein                               252   1e-80    
ref|WP_007306122.1|  aminopeptidase A                                   265   2e-80    
ref|WP_015187371.1|  leucyl aminopeptidase                              266   2e-80    
ref|WP_008226312.1|  Cytosol aminopeptidase PepA                        254   2e-80    
ref|WP_026085699.1|  aminopeptidase A                                   251   3e-80    
ref|WP_006100918.1|  aminopeptidase A                                   263   3e-80    
ref|WP_012163418.1|  aminopeptidase A                                   253   4e-80    
ref|WP_015230084.1|  leucyl aminopeptidase                              253   4e-80    
ref|WP_036484522.1|  aminopeptidase A                                   263   4e-80    
ref|WP_039199262.1|  aminopeptidase A                                   255   5e-80    
ref|WP_010872664.1|  aminopeptidase A                                   258   5e-80    
ref|WP_016859555.1|  aminopeptidase A                                   253   6e-80    
gb|AFW71514.1|  hypothetical protein ZEAMMB73_883672                    268   8e-80    
ref|WP_012599158.1|  aminopeptidase A                                   252   9e-80    
ref|WP_015129473.1|  leucyl aminopeptidase                              257   9e-80    
ref|WP_015142479.1|  leucyl aminopeptidase                              256   1e-79    
ref|WP_023064677.1|  leucine aminopeptidase 1                           256   1e-79    
ref|WP_006456950.1|  aminopeptidase A                                   252   1e-79    
ref|WP_011609979.1|  aminopeptidase A                                   253   2e-79    
ref|WP_014407105.1|  aminopeptidase A                                   256   2e-79    
ref|WP_017297744.1|  hypothetical protein                               265   3e-79    
ref|WP_024124791.1|  cytosol aminopeptidase PepA                        259   6e-79    
gb|AIE73879.1|  Cytosol aminopeptidase PepA                             258   7e-79    
ref|WP_008049396.1|  aminopeptidase A                                   258   7e-79    
ref|WP_015175730.1|  leucyl aminopeptidase                              255   9e-79    
ref|WP_017306913.1|  hypothetical protein                               252   1e-78    
ref|NP_001168170.1|  uncharacterized protein LOC100381923               229   1e-78    Zea mays [maize]
ref|WP_011057582.1|  aminopeptidase A                                   259   1e-78    
ref|WP_008189563.1|  aminopeptidase A                                   257   1e-78    
ref|WP_015198995.1|  leucyl aminopeptidase                              248   1e-78    
ref|WP_015219428.1|  leucyl aminopeptidase                              254   2e-78    
ref|WP_006618432.1|  MULTISPECIES: aminopeptidase A                     258   2e-78    
ref|WP_023073841.1|  leucyl aminopeptidase                              259   2e-78    
ref|WP_027402251.1|  aminopeptidase A                                   250   2e-78    
ref|WP_015112611.1|  leucyl aminopeptidase                              249   2e-78    
ref|WP_015078290.1|  leucyl aminopeptidase                              248   5e-78    
ref|WP_019508312.1|  aminopeptidase A                                   256   5e-78    
ref|WP_015224615.1|  leucyl aminopeptidase                              251   5e-78    
ref|WP_029634482.1|  aminopeptidase A [                                 268   5e-78    
ref|WP_009625931.1|  cytosol aminopeptidase                             259   1e-77    
ref|WP_017718624.1|  aminopeptidase A                                   256   1e-77    
ref|WP_006631185.1|  aminopeptidase A                                   251   1e-77    
ref|WP_011242673.1|  aminopeptidase A                                   246   1e-77    
ref|XP_001417730.1|  predicted protein                                  246   2e-77    Ostreococcus lucimarinus CCE9901
gb|AAM82713.1|  AmpA                                                    246   2e-77    Synechococcus elongatus PCC 7942
ref|WP_011377907.1|  aminopeptidase A                                   246   2e-77    
ref|WP_015170769.1|  leucyl aminopeptidase                              251   2e-77    
ref|WP_015150368.1|  leucyl aminopeptidase                              253   6e-77    
ref|WP_024545494.1|  aminopeptidase A                                   265   6e-77    
ref|WP_036534560.1|  aminopeptidase A                                   241   6e-77    
gb|EMS51906.1|  Leucine aminopeptidase 2, chloroplastic                 232   6e-77    
gb|KEI67077.1|  Lap                                                     251   6e-77    
ref|WP_015116302.1|  leucyl aminopeptidase                              240   6e-77    
ref|WP_015223330.1|  leucyl aminopeptidase                              254   8e-77    
ref|WP_014274880.1|  leucine aminopeptidase                             255   9e-77    
gb|EMT22172.1|  Leucine aminopeptidase 2, chloroplastic                 259   1e-76    
ref|WP_007356241.1|  MULTISPECIES: aminopeptidase A                     250   2e-76    
ref|WP_015205007.1|  cytosol aminopeptidase                             244   2e-76    
ref|WP_015139669.1|  leucyl aminopeptidase                              244   5e-76    
ref|WP_026796047.1|  MULTISPECIES: aminopeptidase A                     248   5e-76    
ref|WP_026785238.1|  MULTISPECIES: aminopeptidase A                     248   7e-76    
ref|WP_006509758.1|  leucyl aminopeptidase                              255   1e-75    
ref|XP_003057064.1|  predicted protein                                  236   1e-75    
ref|WP_030006934.1|  aminopeptidase A                                   261   1e-75    
ref|WP_012308056.1|  aminopeptidase A                                   261   2e-75    
ref|WP_036000285.1|  aminopeptidase A                                   246   2e-75    
ref|XP_008452859.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    219   3e-75    
ref|WP_012954454.1|  aminopeptidase A                                   249   4e-75    
ref|WP_006529488.1|  leucyl aminopeptidase                              244   4e-75    
ref|WP_011433415.1|  aminopeptidase A                                   233   4e-75    
ref|WP_008233179.1|  Cytosol aminopeptidase PepA                        234   2e-74    
ref|WP_015133232.1|  leucyl aminopeptidase                              252   3e-74    
ref|WP_015167157.1|  leucyl aminopeptidase                              237   1e-73    
ref|WP_019478589.1|  hypothetical protein                               244   1e-73    
ref|WP_039743238.1|  aminopeptidase A                                   254   3e-73    
ref|WP_015160652.1|  leucyl aminopeptidase                              241   4e-73    
ref|WP_036922865.1|  aminopeptidase A                                   241   1e-72    
ref|XP_002953843.1|  hypothetical protein VOLCADRAFT_106122             256   2e-72    
ref|WP_023174736.1|  leucyl aminopeptidase                              228   2e-72    
ref|WP_036918509.1|  MULTISPECIES: aminopeptidase A                     239   2e-72    
ref|XP_005704316.1|  leucyl aminopeptidase                              238   7e-72    
ref|XP_005644543.1|  hypothetical protein COCSUDRAFT_54513              252   1e-71    
ref|WP_036905385.1|  aminopeptidase A                                   234   2e-71    
ref|WP_011125564.1|  MULTISPECIES: aminopeptidase A                     232   4e-71    
ref|WP_017289341.1|  hypothetical protein                               222   4e-71    
gb|KFM27751.1|  putative cytosol aminopeptidase                         246   3e-70    
gb|KFF41622.1|  leucyl aminopeptidase                                   234   3e-70    
ref|WP_011824311.1|  aminopeptidase A                                   234   3e-70    
ref|WP_036899396.1|  aminopeptidase A                                   228   7e-70    
ref|WP_012195938.1|  aminopeptidase A                                   229   7e-70    
ref|WP_011295251.1|  aminopeptidase A                                   232   1e-69    
ref|WP_019474761.1|  hypothetical protein                               225   5e-69    
ref|WP_038653959.1|  aminopeptidase A                                   227   3e-68    
ref|WP_022604190.1|  leucyl aminopeptidase                              241   4e-68    
ref|XP_001700276.1|  predicted protein                                  220   4e-68    
ref|WP_011142605.1|  aminopeptidase A                                   212   8e-68    
ref|WP_029626158.1|  aminopeptidase A                                   219   9e-68    
emb|CBJ32669.1|  Leucyl aminopeptidase                                  223   2e-67    
ref|XP_010503087.1|  PREDICTED: leucine aminopeptidase 1-like iso...    231   4e-67    
ref|WP_011365056.1|  aminopeptidase A                                   228   6e-67    
ref|YP_002049337.1|  leucyl aminopeptidase                              219   1e-66    
ref|XP_005713971.1|  unnamed protein product                            225   1e-66    
ref|WP_006171905.1|  aminopeptidase A                                   211   1e-66    
ref|WP_007101703.1|  aminopeptidase A                                   216   2e-65    
ref|WP_025956070.1|  aminopeptidase A                                   215   4e-65    
ref|WP_006909891.1|  aminopeptidase A                                   221   6e-65    
ref|WP_032518210.1|  aminopeptidase A                                   216   7e-65    
ref|WP_025968245.1|  aminopeptidase A                                   213   9e-65    
gb|AIQ95644.1|  Cytosol aminopeptidase PepA                             213   1e-64    
gb|AHF64524.1|  Leucyl aminopeptidase                                   219   2e-64    
ref|WP_038548803.1|  aminopeptidase A                                   218   3e-64    
gb|AII44295.1|  aminopeptidase A                                        218   3e-64    
ref|WP_025930781.1|  aminopeptidase A                                   214   3e-64    
ref|WP_011359376.1|  aminopeptidase A                                   210   3e-64    
ref|WP_032516355.1|  aminopeptidase A                                   214   4e-64    
ref|WP_011933847.1|  aminopeptidase A                                   218   4e-64    
ref|WP_025972451.1|  aminopeptidase A                                   212   8e-64    
ref|WP_015110622.1|  leucyl aminopeptidase                              205   9e-64    
gb|EWM21808.1|  leucyl aminopeptidase                                   232   1e-63    
ref|WP_028952702.1|  aminopeptidase A                                   215   1e-63    
ref|WP_007098769.1|  aminopeptidase A                                   207   3e-63    
ref|WP_025914978.1|  aminopeptidase A                                   210   3e-63    
ref|WP_025926895.1|  MULTISPECIES: aminopeptidase A                     209   4e-63    
ref|WP_011620118.1|  aminopeptidase A                                   215   5e-63    
ref|WP_032521644.1|  aminopeptidase A                                   209   6e-63    
ref|WP_025941989.1|  aminopeptidase A                                   208   6e-63    
ref|WP_011818947.1|  aminopeptidase A                                   207   6e-63    
ref|WP_025964955.1|  aminopeptidase A                                   208   8e-63    
ref|WP_025939710.1|  MULTISPECIES: aminopeptidase A                     207   1e-62    
ref|WP_025891152.1|  aminopeptidase A                                   207   1e-62    
ref|WP_011132966.1|  aminopeptidase A                                   213   1e-62    
ref|WP_025935378.1|  aminopeptidase A                                   209   1e-62    
ref|WP_025940881.1|  aminopeptidase A                                   207   1e-62    
ref|WP_025946302.1|  aminopeptidase A                                   207   1e-62    
ref|WP_025913781.1|  MULTISPECIES: aminopeptidase A                     207   1e-62    
ref|WP_025925549.1|  MULTISPECIES: aminopeptidase A                     207   1e-62    
ref|WP_025889091.1|  aminopeptidase A                                   207   2e-62    
ref|WP_025979040.1|  aminopeptidase A                                   207   2e-62    
ref|WP_025975565.1|  aminopeptidase A                                   207   2e-62    
ref|WP_025975117.1|  aminopeptidase A                                   207   2e-62    
ref|WP_025942522.1|  MULTISPECIES: aminopeptidase A                     207   2e-62    
ref|WP_025932571.1|  aminopeptidase A                                   207   2e-62    
ref|WP_025937528.1|  aminopeptidase A                                   207   2e-62    
ref|WP_025958530.1|  aminopeptidase A                                   206   2e-62    
ref|WP_025979981.1|  aminopeptidase A                                   206   2e-62    
ref|WP_025947520.1|  aminopeptidase A                                   206   2e-62    
ref|WP_011820796.1|  aminopeptidase A                                   213   2e-62    
ref|WP_025928767.1|  aminopeptidase A                                   206   3e-62    
ref|WP_025882168.1|  aminopeptidase A                                   207   3e-62    
ref|WP_025894914.1|  MULTISPECIES: aminopeptidase A                     206   3e-62    
ref|WP_025963896.1|  aminopeptidase A                                   207   3e-62    
ref|WP_025969440.1|  aminopeptidase A                                   206   3e-62    
ref|WP_025900801.1|  MULTISPECIES: aminopeptidase A                     206   4e-62    
ref|WP_025922544.1|  aminopeptidase A                                   206   4e-62    
ref|XP_010503088.1|  PREDICTED: leucine aminopeptidase 1-like iso...    218   4e-62    
ref|WP_025933908.1|  aminopeptidase A                                   204   5e-62    
ref|WP_032524918.1|  aminopeptidase A                                   204   5e-62    
ref|WP_011376974.1|  aminopeptidase A                                   205   5e-62    
ref|WP_025924801.1|  aminopeptidase A                                   205   5e-62    
ref|WP_025954832.1|  aminopeptidase A                                   206   6e-62    
ref|WP_025965865.1|  aminopeptidase A                                   205   7e-62    
ref|WP_006853576.1|  aminopeptidase A                                   213   1e-61    
ref|WP_032513136.1|  aminopeptidase A                                   205   1e-61    
gb|ABE11401.1|  cytosol aminopeptidase                                  204   2e-61    
ref|WP_012008215.1|  aminopeptidase A                                   205   2e-61    
ref|WP_002805871.1|  aminopeptidase A                                   203   3e-61    
ref|WP_011863445.1|  aminopeptidase A                                   202   5e-61    
gb|ABE11299.1|  cytosol aminopeptidase                                  202   6e-61    
emb|CDJ68823.1|  cytosol aminopeptidase, putative                       204   9e-61    
emb|CDJ40179.1|  cytosol aminopeptidase, putative                       203   1e-60    
ref|WP_032520221.1|  aminopeptidase A                                   201   1e-60    
gb|AAQ96374.1|  leucine aminopeptidase                                  211   2e-60    
ref|WP_025923443.1|  aminopeptidase A                                   200   3e-60    
ref|WP_032527266.1|  aminopeptidase A                                   197   5e-59    
ref|WP_025957966.1|  aminopeptidase A                                   195   6e-59    
ref|WP_011127431.1|  aminopeptidase A                                   192   1e-58    
ref|WP_014934890.1|  cytosol aminopeptidase                             216   3e-58    
emb|CDY40137.1|  BnaC06g05520D                                          206   3e-57    
ref|WP_034577096.1|  aminopeptidase A                                   211   3e-57    
ref|XP_008889203.1|  leucyl aminopeptidase LAP                          209   4e-57    
emb|CDG49727.1|  Cytosol aminopeptidase PepA                            211   8e-57    
gb|EPT28034.1|  leucyl aminopeptidase LAP                               207   2e-56    
ref|XP_005851577.1|  hypothetical protein CHLNCDRAFT_33905              205   2e-56    
gb|EPR59801.1|  leucyl aminopeptidase LAP                               207   2e-56    
gb|KFH05105.1|  leucyl aminopeptidase LAP                               206   2e-56    
gb|KFG31133.1|  leucyl aminopeptidase LAP                               206   2e-56    
gb|KFG99947.1|  leucyl aminopeptidase LAP                               206   2e-56    
ref|XP_002368461.1|  cytosol aminopeptidase                             206   3e-56    
gb|KFG62794.1|  leucyl aminopeptidase LAP                               205   6e-56    
ref|WP_025981063.1|  aminopeptidase A                                   187   8e-56    
gb|ACR37644.1|  unknown                                                 197   9e-56    
dbj|BAH84840.1|  leucine aminopeptidase                                 195   4e-55    
ref|XP_003881232.1|  probable cytosol aminopeptidase, related           203   5e-55    
ref|XP_002179008.1|  predicted protein                                  204   5e-55    
ref|WP_038066839.1|  leucyl aminopeptidase                              180   1e-54    
ref|WP_027892840.1|  leucyl aminopeptidase                              187   1e-54    
ref|WP_013458465.1|  leucyl aminopeptidase                              176   2e-54    
ref|WP_026234738.1|  leucyl aminopeptidase                              183   9e-54    
pdb|3KQX|A  Chain A, Structure Of A Protease 1                          202   1e-53    
emb|CDO66926.1|  M17 leucyl aminopeptidase                              204   1e-53    
gb|ETW29101.1|  hypothetical protein PFFCH_03522                        203   2e-53    
gb|EWC85449.1|  hypothetical protein PFNF54_05753                       202   2e-53    
ref|XP_009038232.1|  hypothetical protein AURANDRAFT_28164              196   3e-53    
gb|ETW46651.1|  hypothetical protein PFMALIP_05288                      202   4e-53    
ref|XP_001348613.1|  M17 leucyl aminopeptidase                          202   4e-53    
gb|ETW15982.1|  hypothetical protein PFFVO_05086                        202   4e-53    
gb|KFE67174.1|  Cytosol aminopeptidase PepA                             181   4e-53    
gb|EUR62911.1|  hypothetical protein PFBG_05516                         202   5e-53    
gb|EJK58205.1|  hypothetical protein THAOC_21689                        199   6e-53    
ref|XP_005536346.1|  probable leucine aminopeptidase                    187   6e-53    
ref|WP_038055235.1|  leucyl aminopeptidase                              173   1e-52    
ref|WP_013157347.1|  leucyl aminopeptidase                              178   1e-52    
ref|XP_004144797.1|  PREDICTED: leucine aminopeptidase 2, chlorop...    145   2e-52    
ref|WP_018110990.1|  leucyl aminopeptidase                              172   3e-52    
ref|WP_038026706.1|  aminopeptidase A                                   197   5e-52    
ref|WP_007906242.1|  Leucyl aminopeptidase                              181   1e-51    
ref|WP_024050091.1|  leucyl aminopeptidase                              175   2e-51    
ref|WP_013013469.1|  leucyl aminopeptidase                              174   2e-51    
gb|EKD47535.1|  hypothetical protein ACD_66C00018G0003                  181   3e-51    
ref|WP_022022074.1|  probable cytosol aminopeptidase                    178   3e-51    
ref|XP_002260412.1|  leucine aminopeptidase                             196   6e-51    
ref|XP_001615930.1|  leucine aminopeptidase                             196   7e-51    
ref|WP_038031872.1|  leucyl aminopeptidase                              167   1e-50    
ref|WP_015716053.1|  leucyl aminopeptidase                              166   1e-50    
gb|EKD41833.1|  hypothetical protein ACD_73C00503G0002                  180   2e-50    
ref|XP_002179007.1|  predicted protein                                  194   2e-50    
emb|CCF73941.1|  unnamed protein product                                180   3e-50    
ref|XP_740385.1|  hypothetical protein                                  192   3e-50    
ref|WP_038040802.1|  leucyl aminopeptidase                              165   3e-50    
ref|XP_008814166.1|  leucyl aminopeptidase                              193   3e-50    
ref|WP_028494547.1|  leucyl aminopeptidase                              164   5e-50    
ref|WP_031499927.1|  cytosol aminopeptidase                             174   5e-50    
emb|CDR95323.1|  leucine aminopeptidase, putative                       180   8e-50    
emb|CDR15328.1|  M17 leucyl aminopeptidase, putative                    191   1e-49    
ref|WP_022847164.1|  cytosol aminopeptidase                             174   1e-49    
ref|XP_743929.1|  hypothetical protein                                  191   1e-49    
ref|WP_003046704.1|  leucyl aminopeptidase                              166   1e-49    
ref|WP_014628909.1|  leucyl aminopeptidase                              166   2e-49    
emb|CDR15323.1|  M17 leucyl aminopeptidase, putative                    192   2e-49    
ref|WP_027883612.1|  leucyl aminopeptidase                              167   4e-49    
ref|WP_022486266.1|  probable cytosol aminopeptidase                    174   4e-49    
ref|WP_038071932.1|  leucyl aminopeptidase                              161   6e-49    
ref|XP_678034.1|  leucine aminopeptidase                                189   7e-49    
gb|EUD71337.1|  leucyl aminopeptidase                                   190   8e-49    
ref|XP_004224071.1|  leucine aminopeptidase                             190   9e-49    
dbj|BAL55042.1|  leucyl aminopeptidase                                  169   1e-48    
ref|XP_729735.1|  chromosome condensation regulator leucine amino...    190   1e-48    
gb|EUD71334.1|  leucyl aminopeptidase                                   190   1e-48    
emb|CDS50097.1|  M17 leucyl aminopeptidase, putative                    190   2e-48    
ref|WP_011174092.1|  leucyl aminopeptidase                              165   2e-48    
gb|ETB56248.1|  hypothetical protein YYC_05698                          190   2e-48    
ref|WP_014509763.1|  leucyl aminopeptidase                              165   2e-48    
ref|WP_038039418.1|  leucyl aminopeptidase                              164   3e-48    
ref|WP_011227809.1|  leucyl aminopeptidase                              164   4e-48    
ref|WP_026441431.1|  cytosol aminopeptidase                             162   4e-48    
ref|WP_033399215.1|  leucyl aminopeptidase                              160   5e-48    
ref|WP_013536922.1|  cytosol aminopeptidase                             168   5e-48    
ref|WP_026328971.1|  leucyl aminopeptidase                              162   5e-48    
ref|XP_001609968.1|  leucine aminopeptidase                             182   6e-48    
ref|WP_016330097.1|  leucyl aminopeptidase                              162   9e-48    
ref|WP_021864916.1|  leucine aminopeptidase                             168   9e-48    
ref|WP_038048739.1|  leucyl aminopeptidase                              161   1e-47    
ref|WP_022482263.1|  leucine aminopeptidase                             167   1e-47    
ref|WP_013376940.1|  peptidase M17                                      167   1e-47    
ref|WP_011871795.1|  cytosol aminopeptidase                             155   1e-47    
ref|WP_002619964.1|  peptidase M17                                      167   2e-47    
ref|WP_038034921.1|  leucyl aminopeptidase                              162   2e-47    
gb|EIA40145.1|  leucine aminopeptidase                                  162   2e-47    
ref|WP_026234272.1|  leucyl aminopeptidase                              160   2e-47    
ref|WP_014514675.1|  leucyl aminopeptidase                              160   3e-47    



>ref|XP_009795110.1| PREDICTED: leucine aminopeptidase 2, chloroplastic [Nicotiana 
sylvestris]
Length=576

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/480 (73%), Positives = 389/480 (81%), Gaps = 30/480 (6%)
 Frame = +2

Query  176   IFLKFRSTSAWAISFSVSPL-CCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDL  352
             +F KF+S+  WAISFSV+PL C RR +RMAHSIARATLGLTHPNQIE PKISFAAKE+DL
Sbjct  22    VFTKFKSSPTWAISFSVTPLLCSRRAKRMAHSIARATLGLTHPNQIEAPKISFAAKEIDL  81

Query  353   LEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVL  532
             +EWKGDILAVG TEKD+ +DENSKFQN ILQKLDSKLGGLLSEASSEEDFSGKSGQS VL
Sbjct  82    VEWKGDILAVGATEKDLARDENSKFQNPILQKLDSKLGGLLSEASSEEDFSGKSGQSTVL  141

Query  533   RLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKL  712
             RLP LG KRI LVGLGS VSST AYR+LGE +AAAAKSAQAS++AVALAS +GLS ESKL
Sbjct  142   RLPGLGSKRIALVGLGSSVSSTAAYRSLGEAVAAAAKSAQASNIAVALASTDGLSAESKL  201

Query  713   SAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFV  892
             S+ASA+ TG   G FEDNRFK E K PTLKS++ILGLGTGPEIEKKLKY+E V +GVIF 
Sbjct  202   SSASAIVTGATLGIFEDNRFKSESKKPTLKSLDILGLGTGPEIEKKLKYAEDVCAGVIFC  261

Query  893   KELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPS  1072
             +ELVNAPANVLTP  LAEEAK IAS YSDVL+A IL+VEQCKELKMGS+L V  A+ NP 
Sbjct  262   RELVNAPANVLTPAVLAEEAKKIASTYSDVLSANILNVEQCKELKMGSYLAVGEASANPP  321

Query  1073  YFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaak  1252
             +FIHLCYKP+ G +K KLAL+GKG+TFDSGGYN+K G    IELMK DM G+A V GAAK
Sbjct  322   HFIHLCYKPTGGEIKKKLALVGKGLTFDSGGYNIKTGPGCLIELMKFDMGGSAAVLGAAK  381

Query  1253  aiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYI  1432
             A+ QIKPAGVEVHFIV ACENMISGTGMRPGD++TASNGK IE                 
Sbjct  382   ALGQIKPAGVEVHFIVAACENMISGTGMRPGDVVTASNGKTIE-----------------  424

Query  1433  VVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                         V +TDAEGRL LADALVYA   GVEK+VDLATLTGACI ALG S+AG+
Sbjct  425   ------------VNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACIVALGPSIAGV  472


 Score = 98.2 bits (243),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV  A++V GEKLWRMPLEESYW+TMKS +ADM+N G   G AI A+LF
Sbjct  471   GVFTPSDDLAKEVAAASEVSGEKLWRMPLEESYWDTMKSGVADMVNTGGRQGGAIVAALF  530

Query  1866  MK  1871
             +K
Sbjct  531   LK  532



>ref|XP_009614630.1| PREDICTED: leucine aminopeptidase 2, chloroplastic [Nicotiana 
tomentosiformis]
Length=579

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/480 (73%), Positives = 389/480 (81%), Gaps = 30/480 (6%)
 Frame = +2

Query  176   IFLKFRSTSAWAISFSVSPL-CCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDL  352
             +F KF+S+  W+ISFSV+PL C RR +RMAHSIARATLGLTHPNQIE PKISFAAKE+DL
Sbjct  25    VFTKFQSSPIWSISFSVTPLLCSRRAKRMAHSIARATLGLTHPNQIEAPKISFAAKEIDL  84

Query  353   LEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVL  532
             +EWKGDILAVG TEKD+ +DENSKFQN ILQKLDSKLGGLLSEASSEEDFSGKSGQS VL
Sbjct  85    VEWKGDILAVGATEKDLARDENSKFQNPILQKLDSKLGGLLSEASSEEDFSGKSGQSTVL  144

Query  533   RLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKL  712
             RLP LG KRI LVGLGS VSST AYR+LGE +AAAAKSAQAS++AVALAS +GLS ESKL
Sbjct  145   RLPGLGSKRIALVGLGSSVSSTAAYRSLGEAVAAAAKSAQASNIAVALASTDGLSAESKL  204

Query  713   SAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFV  892
             S+ASA+ TG   G FEDNRFK E K PTLKS++ILGLGTGPEIEKKLKY+E V +GVIF 
Sbjct  205   SSASAIVTGAALGIFEDNRFKSESKKPTLKSLDILGLGTGPEIEKKLKYAEDVCAGVIFC  264

Query  893   KELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPS  1072
             +ELVNAPANVLTP  LAEEAK IAS YSDVL+A ILDVEQCKELKMGS+L V  A+ NP 
Sbjct  265   RELVNAPANVLTPAVLAEEAKKIASTYSDVLSANILDVEQCKELKMGSYLAVGEASANPP  324

Query  1073  YFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaak  1252
             +FIHLCYKP+ G +K KLAL+GKG+TFDSGGYN+K G    IELMK DM G+A V GAAK
Sbjct  325   HFIHLCYKPTGGEIKKKLALVGKGLTFDSGGYNIKTGPGCLIELMKFDMGGSAAVLGAAK  384

Query  1253  aiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYI  1432
             A+ QIKPAGVEVHFIV ACENMISGTGMRPGD++TASNGK IE                 
Sbjct  385   ALGQIKPAGVEVHFIVAACENMISGTGMRPGDVVTASNGKTIE-----------------  427

Query  1433  VVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                         V +TDAEGRL LADALVYA   GVEK+VDLATLTGACI ALG S+AG+
Sbjct  428   ------------VNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACIVALGPSIAGV  475


 Score = 94.4 bits (233),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV  A+++ GEKLWRMPLEESYW+TM S +ADM+N G   G AI A+LF
Sbjct  474   GVFTPSDDLAKEVAAASELSGEKLWRMPLEESYWDTMTSGVADMVNTGGRQGGAIVAALF  533

Query  1866  MK  1871
             +K
Sbjct  534   LK  535



>ref|XP_011079411.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Sesamum 
indicum]
Length=583

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/479 (71%), Positives = 383/479 (80%), Gaps = 29/479 (6%)
 Frame = +2

Query  176   IFLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLL  355
             IF KFR    WA+S +  PL  RR +RMAHSIARATLGLT PN+I+ PK+SFAAKE+DL 
Sbjct  31    IFTKFRFGPIWAVSLTFPPLSSRRAKRMAHSIARATLGLTQPNKIDPPKVSFAAKEIDLG  90

Query  356   EWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  535
             EWKGDILAVGVTEKD+ KDENSKF+N++LQKLDSKLGGLLSEASSEEDF+GK+GQS  LR
Sbjct  91    EWKGDILAVGVTEKDLAKDENSKFKNVVLQKLDSKLGGLLSEASSEEDFTGKAGQSTFLR  150

Query  536   LPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLS  715
             LP LG KR+GL+GLGS  S+T+ YR LGE +AAAAKS QAS+VA+ LAS+EG+  E K S
Sbjct  151   LPGLGSKRVGLIGLGSAASATVTYRNLGEAVAAAAKSTQASNVAITLASSEGIPAELKPS  210

Query  716   AASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVK  895
              ASA+A+G V GTF+DNRFK E K P+LKSVEILGLGTGPEIEKKLKY++ V SG+IF K
Sbjct  211   TASAIASGAVLGTFDDNRFKSESKQPSLKSVEILGLGTGPEIEKKLKYAQDVCSGIIFGK  270

Query  896   ELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSY  1075
             ELVNAPANVLTPGALA EA+ IAS YSDV +A ILDVEQCKELKMGS+LGVAAA+ NP +
Sbjct  271   ELVNAPANVLTPGALASEAQKIASEYSDVFSAKILDVEQCKELKMGSYLGVAAASANPPH  330

Query  1076  FIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaaka  1255
             FIHLCYKP SG VKTKLAL+GKG+TFDSGGYN+K G   SIELMK DM G+A V GAAKA
Sbjct  331   FIHLCYKPPSGEVKTKLALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKA  390

Query  1256  iaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIV  1435
             + QIKPAGVEVHFIV ACENMISGTGMRPGDI+TASNGK IE                  
Sbjct  391   LGQIKPAGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIE------------------  432

Query  1436  VLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                        V +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG S+ G+
Sbjct  433   -----------VNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGPSIGGV  480


 Score =   100 bits (248),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEVL A++V GEKLWRMPLEESYW++MKS +ADM+N G   G AITA+LF
Sbjct  479   GVFTPSDDLAKEVLGASEVSGEKLWRMPLEESYWDSMKSGVADMVNTGGRQGGAITAALF  538

Query  1866  MK  1871
             +K
Sbjct  539   LK  540



>gb|AAO15916.1| neutral leucine aminopeptidase preprotein [Solanum lycopersicum]
Length=577

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/479 (71%), Positives = 381/479 (80%), Gaps = 29/479 (6%)
 Frame = +2

Query  176   IFLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLL  355
             IF KF+S+  W+ S SV+PLC RR +RMAHSIAR TLGLTH NQ + PKISFAAKE+DL+
Sbjct  24    IFTKFQSSPIWSFSISVTPLCSRRAKRMAHSIARDTLGLTHTNQSDAPKISFAAKEIDLV  83

Query  356   EWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  535
             EWKGDIL VG TEKD+ +D NSKFQN +LQKLDSKL GLLSEASSEEDFSGK+GQS +LR
Sbjct  84    EWKGDILTVGATEKDLARDGNSKFQNPLLQKLDSKLSGLLSEASSEEDFSGKAGQSTILR  143

Query  536   LPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLS  715
             LP LG KRI LVGLGS  SST AYR LGE  AAAAKSAQAS++A+ALAS +GLS E KLS
Sbjct  144   LPGLGSKRIALVGLGSPTSSTAAYRCLGEAAAAAAKSAQASNIAIALASTDGLSAELKLS  203

Query  716   AASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVK  895
             +ASA+ TG V GTFEDNRFK E K PTLKS++ILGLGTGPEIEKK+KY+  V +GVI  +
Sbjct  204   SASAITTGAVLGTFEDNRFKSESKKPTLKSLDILGLGTGPEIEKKIKYAADVCAGVILGR  263

Query  896   ELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSY  1075
             ELVNAPANVLTP  LAEEAK IAS YSDV +A ILDVEQCKELKMGS+L VAAA+ NP++
Sbjct  264   ELVNAPANVLTPAVLAEEAKKIASTYSDVFSANILDVEQCKELKMGSYLAVAAASANPAH  323

Query  1076  FIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaaka  1255
             FIHLCYKPSSG +K K+AL+GKG+TFDSGGYN+K G   SIELMK DM GAA V GAAKA
Sbjct  324   FIHLCYKPSSGEIKKKIALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGAAAVLGAAKA  383

Query  1256  iaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIV  1435
             + QIKPAGVEVHFIV ACENMISGTGMRPGDI+TASNGK IE                  
Sbjct  384   LGQIKPAGVEVHFIVAACENMISGTGMRPGDIITASNGKTIE------------------  425

Query  1436  VLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                        V +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG S+AG+
Sbjct  426   -----------VNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGPSIAGI  473


 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GIFTPS+DLAKEV+ A++V GEKLWR+P+E+SYW++MKS +ADM+N G   G AITA+LF
Sbjct  472   GIFTPSDDLAKEVVAASEVSGEKLWRLPMEDSYWDSMKSGVADMVNTGGRPGGAITAALF  531

Query  1866  MK  1871
             +K
Sbjct  532   LK  533



>ref|XP_011083971.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Sesamum 
indicum]
Length=584

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/479 (69%), Positives = 377/479 (79%), Gaps = 29/479 (6%)
 Frame = +2

Query  176   IFLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLL  355
             +F KFR      ISF+  PL  R+ +RMAHS ARATLGLT  N+I+ PKISFAAKE+DL+
Sbjct  32    LFTKFRFGPILNISFAFKPLSSRKAKRMAHSTARATLGLTQANKIDPPKISFAAKEIDLV  91

Query  356   EWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  535
             +WKGD+LAVGVTEKDM KD+NSKF+N ILQKLD +LGGLLSEASSEEDF+GK+GQS VLR
Sbjct  92    QWKGDLLAVGVTEKDMAKDDNSKFKNSILQKLDLQLGGLLSEASSEEDFTGKAGQSTVLR  151

Query  536   LPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLS  715
             LP LG KR+GL+GLG+  S+T+AYR LGE  AAAAKS QAS+VA+ LAS E    ESK  
Sbjct  152   LPGLGSKRVGLIGLGAAASATVAYRNLGEATAAAAKSTQASNVAITLASVERTPAESKPV  211

Query  716   AASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVK  895
              ASA+ATG + GTF+D+RFK E + P LKSV+I+GLG+GPEIEKKLKY++ V SG+I  K
Sbjct  212   IASAIATGAILGTFDDSRFKSESQKPALKSVDIIGLGSGPEIEKKLKYADHVCSGIILGK  271

Query  896   ELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSY  1075
             ELVNAPANVLTPG LAEEA  IAS YSDV TA ILDVEQCKELKMGS+LGVAAA+TNP +
Sbjct  272   ELVNAPANVLTPGVLAEEASRIASEYSDVFTAKILDVEQCKELKMGSYLGVAAASTNPPH  331

Query  1076  FIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaaka  1255
             FIHLCYKP +G VKTKLAL+GKG+TFDSGGYN+K GA   IELMK DM G+A V GAAKA
Sbjct  332   FIHLCYKPPNGKVKTKLALVGKGLTFDSGGYNIKTGAGCLIELMKFDMGGSAAVLGAAKA  391

Query  1256  iaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIV  1435
             + QIKPAGVEVHFIV ACENMISGTGMRPGDILTASNGK IE                  
Sbjct  392   LGQIKPAGVEVHFIVAACENMISGTGMRPGDILTASNGKTIE------------------  433

Query  1436  VLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                        VT+TDAEGRL LADALVYA   GVEK+VDLATLTGACI ALG S+AG+
Sbjct  434   -----------VTNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACIVALGPSIAGI  481


 Score = 98.6 bits (244),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GIFTPSEDLAKEV  A++  GEKLWRMPLEESYWE+MKS +ADM+N+G   G AI A+LF
Sbjct  480   GIFTPSEDLAKEVFGASEASGEKLWRMPLEESYWESMKSGVADMVNSGGRQGGAIIAALF  539

Query  1866  MK  1871
             +K
Sbjct  540   LK  541



>ref|XP_002276114.1| PREDICTED: leucine aminopeptidase 1 [Vitis vinifera]
Length=583

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/481 (68%), Positives = 379/481 (79%), Gaps = 31/481 (6%)
 Frame = +2

Query  176   IFLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLL  355
             IF + RS+ +   SF+V PLC RR + MAH++ARATLGLTHP+ +E PKISF AKE+DL+
Sbjct  29    IFTRLRSSPSLPFSFAVKPLCFRRGKLMAHTLARATLGLTHPSNVEPPKISFTAKEIDLV  88

Query  356   EWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  535
             EWKGDILAVGVTEKDM KDEN KF+N IL+KLDS+LGGLL+EASSEEDF+GKSGQS +LR
Sbjct  89    EWKGDILAVGVTEKDMAKDENLKFENPILKKLDSQLGGLLAEASSEEDFTGKSGQSTILR  148

Query  536   LPALGFKRIGLVGLGSVV--SSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESK  709
             LP LG KR+GL+GLG +   S   AYR+LGET+A AAK+AQAS VA+ LAS+EGLS ESK
Sbjct  149   LPGLGSKRVGLIGLGQLTPCSPPAAYRSLGETVAVAAKAAQASDVAIVLASSEGLSAESK  208

Query  710   LSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIF  889
             +  ASA+A+G V G  EDNRFK E K P LKSV+I+GLGTGP+++KKLKY+E V SGVIF
Sbjct  209   IYTASAIASGAVLGIHEDNRFKSESKKPALKSVDIIGLGTGPDVQKKLKYAEDVCSGVIF  268

Query  890   VKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNP  1069
              KELVNAPANVLTPG LAEEA  IAS YSDVL+A ILD EQCKELKMGS+LGVAAA+ NP
Sbjct  269   GKELVNAPANVLTPGVLAEEASKIASAYSDVLSAKILDAEQCKELKMGSYLGVAAASANP  328

Query  1070  SYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaa  1249
              +FIHLCYKP +G VK KL L+GKG+TFDSGGYN+K G   SIELMK DM G+A V GAA
Sbjct  329   PHFIHLCYKPLTGPVKAKLGLVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAA  388

Query  1250  kaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDY  1429
             KAI QIKP+GVEVHFIV ACENMISGTGMRPGD++TASNGK IE                
Sbjct  389   KAIGQIKPSGVEVHFIVAACENMISGTGMRPGDVVTASNGKTIE----------------  432

Query  1430  IVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAG  1609
                          V +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG S+AG
Sbjct  433   -------------VNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGPSIAG  479

Query  1610  M  1612
             +
Sbjct  480   V  480


 Score = 99.0 bits (245),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEVL A++  GEKLWRMP+EESYWE+MKS +ADM+N G   G AITA+LF
Sbjct  479   GVFTPSDDLAKEVLAASEASGEKLWRMPMEESYWESMKSGVADMVNTGGRPGGAITAALF  538

Query  1866  MK  1871
             +K
Sbjct  539   LK  540



>ref|XP_006350101.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Solanum 
tuberosum]
Length=577

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/476 (71%), Positives = 380/476 (80%), Gaps = 29/476 (6%)
 Frame = +2

Query  185   KFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWK  364
             KF+S+  W+ S SV+PLC RR +RMAHSIAR TLGLTH NQ + PKISFAAKE+DL+EWK
Sbjct  27    KFQSSPIWSFSISVTPLCSRRAKRMAHSIARDTLGLTHTNQSDAPKISFAAKEIDLVEWK  86

Query  365   GDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPA  544
             GDILAVG TEKD+ +D NSKFQN +LQKLDSKL GLLSEASSEEDFSGK+GQS +LRLP 
Sbjct  87    GDILAVGATEKDLARDGNSKFQNPLLQKLDSKLSGLLSEASSEEDFSGKAGQSTILRLPG  146

Query  545   LGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAAS  724
             LG KRI LVGLGS  SST AYR LGE  AAAAKSAQAS++A+ALAS +GLS ESKLS+AS
Sbjct  147   LGSKRIALVGLGSPTSSTAAYRCLGEAAAAAAKSAQASNIAIALASTDGLSAESKLSSAS  206

Query  725   AMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELV  904
             A+ TG V GTFEDNRFK E K PTLKS++ILGLGTGPEIEKK+KY+  V +GVI  +ELV
Sbjct  207   AITTGAVLGTFEDNRFKSESKKPTLKSLDILGLGTGPEIEKKIKYAADVCAGVILGRELV  266

Query  905   NAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIH  1084
             NAPANVLTP  LAEEAK IAS YSDV +A ILDVEQCKELKMGS+L VAAA+ NP++FIH
Sbjct  267   NAPANVLTPAVLAEEAKKIASTYSDVFSANILDVEQCKELKMGSYLAVAAASANPAHFIH  326

Query  1085  LCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQ  1264
             L YKPSSG +K K+AL+GKG+TFDSGGYN+K G   SIELMK DM GAA V GAAKA+ Q
Sbjct  327   LSYKPSSGEIKKKIALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGAAAVLGAAKALGQ  386

Query  1265  IKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLG  1444
             IKPAGVEVHFIV ACENMISGTGMRPGDI+TASNGK IE                     
Sbjct  387   IKPAGVEVHFIVAACENMISGTGMRPGDIITASNGKTIE---------------------  425

Query  1445  VIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                     V +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG S+AG+
Sbjct  426   --------VNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGPSIAGI  473


 Score = 96.7 bits (239),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GIFTPS+DLAKEV+ A++V GEKLWR+P+E+SYW++MKS +ADM+N G   G AITA+LF
Sbjct  472   GIFTPSDDLAKEVVAASEVSGEKLWRLPMEDSYWDSMKSGVADMVNTGGRQGGAITAALF  531

Query  1866  MK  1871
             +K
Sbjct  532   LK  533



>gb|AGW47884.1| leucine aminopeptidase [Nicotiana tabacum]
Length=527

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/452 (73%), Positives = 365/452 (81%), Gaps = 29/452 (6%)
 Frame = +2

Query  257   MAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNL  436
             MAHSIARATLGLTHPNQIE  KISFAAKE+DL+EWKGDILAVG TEKD+ +DENSKFQN 
Sbjct  1     MAHSIARATLGLTHPNQIEAHKISFAAKEIDLVEWKGDILAVGATEKDLARDENSKFQNP  60

Query  437   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTL  616
             ILQKLDSKL GLLSEASSEEDFSGKSGQS VLRLP LG KRI LVGLGS VSST AYR+L
Sbjct  61    ILQKLDSKLAGLLSEASSEEDFSGKSGQSTVLRLPGLGSKRIALVGLGSSVSSTAAYRSL  120

Query  617   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  796
             GE +AAAAKSAQAS++AVALAS +GLS ESKLS+ASA+ TG   G FEDNRFK E K PT
Sbjct  121   GEAVAAAAKSAQASNIAVALASTDGLSAESKLSSASAIVTGAALGIFEDNRFKSESKKPT  180

Query  797   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  976
             LKS++ILGLGTGPEIEKKLKY+E V +GVIF +ELVNAPANVLTP  LAEEAK IAS YS
Sbjct  181   LKSLDILGLGTGPEIEKKLKYAEDVCAGVIFCRELVNAPANVLTPAVLAEEAKKIASTYS  240

Query  977   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1156
             DVL+A ILDVEQCKELKMGS+L V  A+ NP +FIHLCYKP+ G +K KLAL+GKG+TFD
Sbjct  241   DVLSANILDVEQCKELKMGSYLAVGEASANPPHFIHLCYKPTGGEIKKKLALVGKGLTFD  300

Query  1157  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1336
             SGGYN+K G    IELMK DM G+A V GAAKA+ QIKPAGVEVHFIV ACENMISGTGM
Sbjct  301   SGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKALGQIKPAGVEVHFIVAACENMISGTGM  360

Query  1337  RPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADAL  1516
             RPGD++TASNGK IE                             V +TDAEGRL LADAL
Sbjct  361   RPGDVVTASNGKTIE-----------------------------VNNTDAEGRLTLADAL  391

Query  1517  VYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             VYA   GVEK+VDLATLTGACI ALG S+AG+
Sbjct  392   VYACNQGVEKIVDLATLTGACIVALGPSIAGV  423


 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV  A++V GEKLWRMPLEESYW+TM S +ADM+N G   G AI A+LF
Sbjct  422   GVFTPSDDLAKEVAAASEVSGEKLWRMPLEESYWDTMTSGVADMVNTGGRQGGAIVAALF  481

Query  1866  MK  1871
             +K
Sbjct  482   LK  483



>ref|XP_010103674.1| Leucine aminopeptidase 3 [Morus notabilis]
 gb|EXB96617.1| Leucine aminopeptidase 3 [Morus notabilis]
Length=579

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/476 (69%), Positives = 380/476 (80%), Gaps = 29/476 (6%)
 Frame = +2

Query  185   KFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWK  364
             K RS  ++ +SF+V+PL  RR R MAH+IA+ATLGLT PN IE PKISFAAKE+D+ EWK
Sbjct  30    KLRSAPSFRLSFAVTPLGYRRGRLMAHTIAKATLGLTQPNAIELPKISFAAKEIDVTEWK  89

Query  365   GDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPA  544
             GDILAVGVTEKD+ KDENSKF+N IL+KLDS LGGLL+EASSEEDF+GK+GQS VLRLP 
Sbjct  90    GDILAVGVTEKDLTKDENSKFENPILKKLDSHLGGLLAEASSEEDFTGKTGQSTVLRLPG  149

Query  545   LGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAAS  724
             LG KR+GL+GLG   SST  +R LGE +AAAAK+AQ++ VA+ LAS+EGLSVESKLS AS
Sbjct  150   LGSKRVGLIGLGQSASSTADFRGLGEAVAAAAKAAQSAEVAIVLASSEGLSVESKLSTAS  209

Query  725   AMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELV  904
             A+ +G V GT +DNR++ E K PT+KSV+ILGLGTGPE+EKKLKY+E +SSG++F KELV
Sbjct  210   AIVSGTVLGTHDDNRYRSESKKPTIKSVDILGLGTGPEVEKKLKYAEDLSSGILFGKELV  269

Query  905   NAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIH  1084
             N+PANVLTP  LAEEA  IA+ YSDVL+A ILDVEQCKELKMGS+LGVAAA+ NP  FIH
Sbjct  270   NSPANVLTPAVLAEEASKIAATYSDVLSAKILDVEQCKELKMGSYLGVAAASANPPRFIH  329

Query  1085  LCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQ  1264
             L YKP SG VKTKLAL+GKG+TFDSGGYN+K G   SIELMK DM G+AVV GAAKAI Q
Sbjct  330   LTYKPPSGDVKTKLALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAVVLGAAKAIGQ  389

Query  1265  IKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLG  1444
             IKPAGVEVHFIV ACENMISGTGMRPGDI+TASNGK IE                     
Sbjct  390   IKPAGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIE---------------------  428

Query  1445  VIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                     V +TDAEGRL LADALVYA   G EK+VDLATLTGAC+ ALG S+AG+
Sbjct  429   --------VNNTDAEGRLTLADALVYACNQGAEKIVDLATLTGACVVALGPSIAGV  476


 Score = 97.4 bits (241),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+F+PS+DLA EVL A++ GGEK+WR+PLEESYWE+MKS IADM+N G   G AITA+LF
Sbjct  475   GVFSPSDDLANEVLAASESGGEKIWRLPLEESYWESMKSGIADMVNTGGRQGGAITAALF  534

Query  1866  MK  1871
             +K
Sbjct  535   LK  536



>ref|NP_001233884.1| leucine aminopeptidase 2, chloroplastic [Solanum lycopersicum]
 sp|Q42876.1|AMPL2_SOLLC RecName: Full=Leucine aminopeptidase 2, chloroplastic; AltName: 
Full=Leucyl aminopeptidase 2; Short=LAP 2; AltName: Full=Proline 
aminopeptidase 2; AltName: Full=Prolyl aminopeptidase 
2; Flags: Precursor [Solanum lycopersicum]
 gb|AAA80499.1| leucine aminopeptidase [Solanum lycopersicum]
Length=569

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/479 (69%), Positives = 377/479 (79%), Gaps = 31/479 (6%)
 Frame = +2

Query  176   IFLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLL  355
             IF KF+S+  W+ S SV+PLC RR +RMAHSIAR TLGLTH NQ + PKISFAAKE+DL+
Sbjct  18    IFTKFQSSPIWSFSISVTPLCSRRAKRMAHSIARDTLGLTHTNQSDAPKISFAAKEIDLV  77

Query  356   EWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  535
             EWKGDIL VG TEKD+ +D NSKFQN +LQKLDSKL GLLSEASSEEDFSGK+GQS +LR
Sbjct  78    EWKGDILTVGATEKDLARDGNSKFQNPLLQKLDSKLSGLLSEASSEEDFSGKAGQSTILR  137

Query  536   LPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLS  715
             LP LG KRI LVGLGS  SST AYR LGE  AAAAKSAQAS++A+ALAS +GLS E KLS
Sbjct  138   LPGLGSKRIALVGLGSPTSSTAAYRCLGEAAAAAAKSAQASNIAIALASTDGLSAELKLS  197

Query  716   AASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVK  895
             +ASA+ TG V GTFEDNRFK E K PTLKS++ILGLGTGPEIEKK+KY+  V +GVI  +
Sbjct  198   SASAITTGAVLGTFEDNRFKSESKKPTLKSLDILGLGTGPEIEKKIKYAADVCAGVILGR  257

Query  896   ELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSY  1075
             ELVNAPANVLTP  LAEEAK IAS YSDV +A ILDVEQCKELKMGS+L VAAA+ NP++
Sbjct  258   ELVNAPANVLTPAVLAEEAKKIASTYSDVFSANILDVEQCKELKMGSYLRVAAASANPAH  317

Query  1076  FIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaaka  1255
             FIHLCYKPSSG +K K+AL+GKG+TFDSGGYN+K G   SIELMK DM GAA V GAAKA
Sbjct  318   FIHLCYKPSSGEIKKKIALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGAAAVLGAAKA  377

Query  1256  iaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIV  1435
             + QIKPAGVEVHFIV ACENMISGTGMRPGDI+TASNGK IE                  
Sbjct  378   LGQIKPAGVEVHFIVAACENMISGTGMRPGDIITASNGKTIE------------------  419

Query  1436  VLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                        V +TDAEGRL L+  +  +   GVEK+VDLATLTGAC+ ALG S+AG+
Sbjct  420   -----------VNNTDAEGRLTLSVGI--SCNQGVEKIVDLATLTGACVVALGPSIAGI  465


 Score = 96.3 bits (238),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GIFTPS+DLAKEV+ A++V GEKLWR+P+E+SYW++MKS +ADM+N G   G AITA+LF
Sbjct  464   GIFTPSDDLAKEVVAASEVSGEKLWRLPMEDSYWDSMKSGVADMVNTGGRPGGAITAALF  523

Query  1866  MK  1871
             +K
Sbjct  524   LK  525



>gb|EYU34348.1| hypothetical protein MIMGU_mgv1a003554mg [Erythranthe guttata]
Length=578

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/477 (68%), Positives = 377/477 (79%), Gaps = 31/477 (6%)
 Frame = +2

Query  182   LKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEW  361
             L+FR    W +S + +PL  R   RMAHSIARATLGLT  N+I+  KISF AKE+DL++W
Sbjct  30    LQFRPI--WGVSLTFAPLSSRTSNRMAHSIARATLGLTQANKIDAQKISFTAKEIDLVQW  87

Query  362   KGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLP  541
             KGDILAVGVTEKDMVKDENSKF+N ILQKLD +LGGLLSEASSEEDF+GKSGQS VLR P
Sbjct  88    KGDILAVGVTEKDMVKDENSKFKNSILQKLDLQLGGLLSEASSEEDFTGKSGQSTVLRFP  147

Query  542   ALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAA  721
              +G KR+GL+GLGS  S T+ YR+LGE +AA AKSA+AS+VA+ALAS+EG+S ESKLS A
Sbjct  148   GIGSKRVGLIGLGSTSSPTLTYRSLGEAVAAVAKSARASNVAIALASSEGISAESKLSTA  207

Query  722   SAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKEL  901
             SA+ATG V GTF+D RFK E K   LKSV+I+GLG+GP+IEKKLKY+  V SG+IF K+L
Sbjct  208   SAIATGTVLGTFDDTRFKSESKQSALKSVDIIGLGSGPQIEKKLKYAADVCSGIIFGKQL  267

Query  902   VNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFI  1081
             VNAPANVLTPG LA EA  IAS +SDVL+A ILDVEQCKELKMGS+L VA A+ NP++FI
Sbjct  268   VNAPANVLTPGVLAAEASRIASEHSDVLSAKILDVEQCKELKMGSYLAVAEASANPAHFI  327

Query  1082  HLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaia  1261
             HLCYKPS+G +K K+AL+GKG+TFDSGGYN+K GA  SIELMK DM G+A V GAAKA+ 
Sbjct  328   HLCYKPSNGEIKKKIALVGKGLTFDSGGYNIKTGAGCSIELMKFDMGGSAAVLGAAKALG  387

Query  1262  QIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVL  1441
             QIKP+GVEVHFIV ACENMISGTGMRPGD++TASNGK IE                    
Sbjct  388   QIKPSGVEVHFIVAACENMISGTGMRPGDVVTASNGKTIE--------------------  427

Query  1442  GVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                      V +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG S+AG+
Sbjct  428   ---------VNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGPSIAGV  475


 Score = 97.1 bits (240),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV+ A+++ GEKLWRMP+E+SYW++MKS +ADM+N G   G AITA+LF
Sbjct  474   GVFTPSDDLAKEVIGASEISGEKLWRMPMEDSYWDSMKSGVADMVNTGGRQGGAITAALF  533

Query  1866  MK  1871
             +K
Sbjct  534   LK  535



>emb|CAN66364.1| hypothetical protein VITISV_029979 [Vitis vinifera]
Length=583

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/481 (68%), Positives = 378/481 (79%), Gaps = 31/481 (6%)
 Frame = +2

Query  176   IFLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLL  355
             IF + RS+ +   SF+V PLC RR + M H++ARATLGLTHP+ +E PKISF AKE+DL+
Sbjct  29    IFTRLRSSPSLPFSFAVKPLCFRRGKLMXHTLARATLGLTHPSNVEPPKISFTAKEIDLV  88

Query  356   EWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  535
             EWKGDILAVGVTEKDM KDEN KF+N IL+KLDS+LGGLL+EASSEEDF+GKSGQS +LR
Sbjct  89    EWKGDILAVGVTEKDMAKDENLKFENPILKKLDSQLGGLLAEASSEEDFTGKSGQSTILR  148

Query  536   LPALGFKRIGLVGLGSVV--SSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESK  709
             LP LG KR+GL+GLG +   S   AYR+LGET+A AAK+AQAS VA+ LAS+EGLS ESK
Sbjct  149   LPGLGSKRVGLIGLGQLTPCSPPAAYRSLGETVAVAAKAAQASDVAIVLASSEGLSAESK  208

Query  710   LSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIF  889
             +  ASA+A+G V G  EDNRFK E K P LKSV+I+GLGTGP+++KKLKY+E V SGVIF
Sbjct  209   IYTASAIASGAVLGIHEDNRFKSESKKPALKSVDIIGLGTGPDVQKKLKYAEDVCSGVIF  268

Query  890   VKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNP  1069
              KELVNAPANVLTPG LAEEA  IAS YS+VL+A ILD EQCKELKMGS+LGVAAA+ NP
Sbjct  269   GKELVNAPANVLTPGVLAEEASKIASAYSNVLSAKILDAEQCKELKMGSYLGVAAASANP  328

Query  1070  SYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaa  1249
              +FIHLCYKP +G VK KL L+GKG+TFDSGGYN+K G   SIELMK DM G+A V GAA
Sbjct  329   PHFIHLCYKPLTGPVKAKLGLVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAA  388

Query  1250  kaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDY  1429
             KAI QIKP+GVEVHFIV ACENMISGTGMRPGD++TASNGK IE                
Sbjct  389   KAIGQIKPSGVEVHFIVAACENMISGTGMRPGDVVTASNGKTIE----------------  432

Query  1430  IVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAG  1609
                          V +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG S+AG
Sbjct  433   -------------VNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGPSIAG  479

Query  1610  M  1612
             +
Sbjct  480   V  480


 Score = 99.0 bits (245),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEVL A++  GEKLWRMP+EESYWE+MKS +ADM+N G   G AITA+LF
Sbjct  479   GVFTPSDDLAKEVLAASEASGEKLWRMPMEESYWESMKSGVADMVNTGGRPGGAITAALF  538

Query  1866  MK  1871
             +K
Sbjct  539   LK  540



>emb|CDP10235.1| unnamed protein product [Coffea canephora]
Length=526

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/452 (73%), Positives = 368/452 (81%), Gaps = 29/452 (6%)
 Frame = +2

Query  257   MAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNL  436
             MAHSIA ATLGLT PNQI  PKISFAAKE+DL+EWKGDILA+GVTEKD+ KDE+SKFQN 
Sbjct  1     MAHSIAHATLGLTQPNQIVPPKISFAAKEIDLVEWKGDILAIGVTEKDIAKDESSKFQNP  60

Query  437   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTL  616
             ILQKLDSKLGGLLSEASSEEDF+GK+GQS +LR+P LG KR+GLVGLG   S+T AYR+L
Sbjct  61    ILQKLDSKLGGLLSEASSEEDFTGKAGQSTILRVPGLGTKRVGLVGLGQAASTTAAYRSL  120

Query  617   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  796
             GETIAAAAKSAQAS+VA+ALAS+E LS +S+L+  SA+ATG V GT+ED+RFK E K PT
Sbjct  121   GETIAAAAKSAQASNVAIALASSETLSADSRLTTVSAIATGTVLGTYEDSRFKSESKKPT  180

Query  797   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  976
             L SV+ILGLGTGPEIEKKLK++E VSS VIF   LVNAPANVLTP  LAEEAK IASLYS
Sbjct  181   LTSVDILGLGTGPEIEKKLKFAESVSSAVIFGINLVNAPANVLTPAVLAEEAKRIASLYS  240

Query  977   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1156
             DVLT TIL+VEQCKELKMGS+LGVAAA+ NP +FIH+ YKP  GSVKTKLAL+GKG+TFD
Sbjct  241   DVLTTTILNVEQCKELKMGSYLGVAAASANPPHFIHIVYKPLGGSVKTKLALVGKGLTFD  300

Query  1157  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1336
             SGGYN+K G   SIELMK DM G+A V GAAKA+ QIKPAGVEVHFIV ACENMISGTGM
Sbjct  301   SGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKALGQIKPAGVEVHFIVAACENMISGTGM  360

Query  1337  RPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADAL  1516
             RPGDI+TASNGK IE                             V +TDAEGRL LADAL
Sbjct  361   RPGDIVTASNGKTIE-----------------------------VNNTDAEGRLTLADAL  391

Query  1517  VYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             VYA   GVEK+VDLATLTGACI ALG S+AG+
Sbjct  392   VYACNQGVEKIVDLATLTGACIIALGSSIAGV  423


 Score =   101 bits (252),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G++TPS+DLAKEVLEA++V GEKLWRMPLEESYWE+MKS +ADM+N G   G +ITA+LF
Sbjct  422   GVYTPSDDLAKEVLEASEVAGEKLWRMPLEESYWESMKSGVADMVNTGGRPGGSITAALF  481

Query  1866  MK  1871
             +K
Sbjct  482   LK  483



>gb|EYU35326.1| hypothetical protein MIMGU_mgv1a003455mg [Erythranthe guttata]
Length=584

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/480 (68%), Positives = 371/480 (77%), Gaps = 30/480 (6%)
 Frame = +2

Query  176   IFLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLL  355
             +F KFR    + ISF++ PL   R +RM+HSIA ATLGLT PN+ + P ISFAAKE DLL
Sbjct  31    VFTKFRFRPIFDISFAIGPLSPTRAKRMSHSIAHATLGLTEPNKTDPPTISFAAKETDLL  90

Query  356   EWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  535
             EWKGDILAVGVTEKDM KDENSKF+N  LQKLDS LGGLLSEASSEEDF+ K+GQS  LR
Sbjct  91    EWKGDILAVGVTEKDMSKDENSKFENPTLQKLDSYLGGLLSEASSEEDFTAKAGQSTFLR  150

Query  536   LPALGFKRIGLVGLGSVVSS-TIAYRTLGETIaaaaksaqassvavalasaEGLSVESKL  712
             +  LG KR+GL+GLGS  S   +AYR LGE +A AAKS QAS VAV LAS +G+SVE K 
Sbjct  151   VTGLGSKRVGLIGLGSAASPPVVAYRGLGEAVANAAKSVQASIVAVTLASCDGISVELKA  210

Query  713   SAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFV  892
             S ASA+ATG + G F+DNRFK E K P+L+SVEI+GLG+G EIEKKLKY++ +SSG+IF 
Sbjct  211   SVASAIATGAMLGIFDDNRFKSESKKPSLESVEIIGLGSGLEIEKKLKYAQGLSSGIIFG  270

Query  893   KELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPS  1072
             +ELVNAP NVLTPG LAEEA  IAS YSDV TA ILD EQCKELKMGS+LGVAAA+ NP 
Sbjct  271   RELVNAPPNVLTPGVLAEEATRIASEYSDVFTAKILDEEQCKELKMGSYLGVAAASANPP  330

Query  1073  YFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaak  1252
             YFIHLCYKP SG VKTKLAL+GKG+TFDSGGYN+K G  S IELMK DM G+A V GAAK
Sbjct  331   YFIHLCYKPLSGEVKTKLALVGKGLTFDSGGYNIKAGPGSMIELMKFDMGGSAAVLGAAK  390

Query  1253  aiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYI  1432
             A+AQIKP+GVEVHFIV ACENMISGTGMRPGD+LTASNGK IE                 
Sbjct  391   ALAQIKPSGVEVHFIVAACENMISGTGMRPGDVLTASNGKTIE-----------------  433

Query  1433  VVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                         V +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+AG+
Sbjct  434   ------------VNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACIVALGPSIAGV  481


 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLA EV  A++V GEK WRMP+EESYWE+MKS +ADM+N G   G AITA+LF
Sbjct  480   GVFTPSDDLANEVFGASEVSGEKFWRMPMEESYWESMKSGVADMVNTGGRQGGAITAALF  539

Query  1866  MK  1871
             +K
Sbjct  540   LK  541



>gb|KHG23887.1| hypothetical protein F383_01434 [Gossypium arboreum]
Length=580

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/479 (67%), Positives = 370/479 (77%), Gaps = 29/479 (6%)
 Frame = +2

Query  176   IFLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLL  355
             IF K RS+     SF+V+PLC RR + MAH++A A LGLT P  IE PKI+FAAKE+D+ 
Sbjct  28    IFNKLRSSPRLRFSFAVAPLCSRRAKFMAHTLASANLGLTQPANIESPKIAFAAKEIDVG  87

Query  356   EWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  535
             EWKGD+LAVGVTEKDM KDENSKFQN IL+ LD  LGGLL+E SSEEDF+GKSGQS VLR
Sbjct  88    EWKGDMLAVGVTEKDMTKDENSKFQNSILKNLDRLLGGLLAEVSSEEDFTGKSGQSTVLR  147

Query  536   LPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLS  715
             LP LG KR+GL+GLG    S  A+R LGE +AAAAK+AQA+SVAV LAS+EGLS ESKL 
Sbjct  148   LPGLGSKRVGLIGLGQSALSPSAFRGLGEAVAAAAKTAQANSVAVVLASSEGLSNESKLG  207

Query  716   AASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVK  895
              ASA+A+G V G  EDNR+K E K P LKS++ILGLGTGPE+EKKLKY+E VSS ++F +
Sbjct  208   FASAIASGTVLGLHEDNRYKSESKKPQLKSLDILGLGTGPELEKKLKYAEDVSSAIVFGR  267

Query  896   ELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSY  1075
             ELVN+PANVLTP ALAEEA  IAS YSDV+ A IL  EQCKELKMGS+LGVAAA+ NP Y
Sbjct  268   ELVNSPANVLTPAALAEEASKIASSYSDVIYANILTAEQCKELKMGSYLGVAAASDNPPY  327

Query  1076  FIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaaka  1255
             FIHLCYKPSSG +K KLAL+GKG+TFDSGGYN+K G   SI++MK DM G+A V GAAKA
Sbjct  328   FIHLCYKPSSGPIKAKLALVGKGLTFDSGGYNIKTGPGCSIDVMKIDMGGSAAVLGAAKA  387

Query  1256  iaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIV  1435
             + QIKP GVEVHFIV +CENMISGTGMRPGDILTASNGK IE                  
Sbjct  388   LGQIKPPGVEVHFIVASCENMISGTGMRPGDILTASNGKTIE------------------  429

Query  1436  VLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                        V +TDAEGRL LADALVYA   GVEK+VDLATLTGACI ALG S+AG+
Sbjct  430   -----------VNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACIVALGPSIAGV  477


 Score = 98.6 bits (244),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS++LAKEV EA+++ GEK WRMPLEESYWE+MKS +ADM+N G   G AITA+LF
Sbjct  476   GVFTPSDELAKEVFEASEISGEKFWRMPLEESYWESMKSGVADMVNTGGRPGGAITAALF  535

Query  1866  MK  1871
             +K
Sbjct  536   LK  537



>gb|KFK29676.1| hypothetical protein AALP_AA7G164200 [Arabis alpina]
Length=588

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/478 (67%), Positives = 378/478 (79%), Gaps = 30/478 (6%)
 Frame = +2

Query  182   LKFRSTSAWAISFSVSPL-CCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLE  358
             L+FR      ++F+V+PL C    R MAH+IA ATLGLTHPN  + PKISFAAKE+D+ E
Sbjct  35    LRFRLPPTLKLAFAVTPLYCSSTARAMAHTIAHATLGLTHPNSTDHPKISFAAKEIDVTE  94

Query  359   WKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRL  538
             WKGDILAVGVTEKDMVKD +SKF+N IL+KLD+ LGGLL++ S+EEDFSGK GQS VLRL
Sbjct  95    WKGDILAVGVTEKDMVKDVDSKFENPILKKLDAHLGGLLADVSTEEDFSGKPGQSTVLRL  154

Query  539   PALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSA  718
             P LG KR+GL+GLG   SS  A+++LGE +AAAAK++QASSVAV LAS+EG S ESKLS+
Sbjct  155   PGLGSKRVGLIGLGKSASSHSAFQSLGEAVAAAAKASQASSVAVVLASSEGASNESKLSS  214

Query  719   ASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKE  898
             ASA+A+G V G FED+R+K E K P+LKSV+I+G GTGPE+EKKLKY+E VS GVIF +E
Sbjct  215   ASAIASGTVLGLFEDSRYKSESKKPSLKSVDIIGFGTGPELEKKLKYAEDVSYGVIFGRE  274

Query  899   LVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYF  1078
             LVN+PANVLTP  LAEEA N+AS+YSDV+TA IL+ EQCKELKMGS+L VAAA+ NP +F
Sbjct  275   LVNSPANVLTPAVLAEEASNLASMYSDVMTANILNEEQCKELKMGSYLAVAAASANPPHF  334

Query  1079  IHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakai  1258
             IHL YKPSSG+VKTKLAL+GKG+TFDSGGYN+K G + SIELMK DM G+A V GAAKAI
Sbjct  335   IHLVYKPSSGTVKTKLALVGKGLTFDSGGYNIKTGPDCSIELMKFDMGGSAAVLGAAKAI  394

Query  1259  aQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVV  1438
              QIKP GVEVHFIV ACENMISGTGMRPGD++TASNGK IE                   
Sbjct  395   GQIKPPGVEVHFIVAACENMISGTGMRPGDVITASNGKTIE-------------------  435

Query  1439  LGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                       V +TDAEGRL LADALVYA   GV+K+VDLATLTGAC+ ALG S+AG+
Sbjct  436   ----------VNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACVVALGTSMAGI  483


 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI+TPS++LAKEV+ A+   GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+LF
Sbjct  482   GIYTPSDELAKEVIAASVRSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGSITAALF  541

Query  1866  MK  1871
             +K
Sbjct  542   LK  543



>ref|XP_007011931.1| Cytosol aminopeptidase family protein [Theobroma cacao]
 gb|EOY29550.1| Cytosol aminopeptidase family protein [Theobroma cacao]
Length=580

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/479 (69%), Positives = 376/479 (78%), Gaps = 29/479 (6%)
 Frame = +2

Query  176   IFLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLL  355
              F K RS+S    SF+V+PLC RR + MAH+IARATLGLT P  IE P+ISFAAKE+D+ 
Sbjct  28    FFTKLRSSSGLRFSFAVAPLCSRRAKFMAHTIARATLGLTQPANIEHPRISFAAKEIDVA  87

Query  356   EWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  535
             EWKGDILAVGVTEKDM KDENSKFQN IL+KLD  LGGLL+E SSEEDF+GK+GQS VLR
Sbjct  88    EWKGDILAVGVTEKDMTKDENSKFQNSILKKLDGLLGGLLAEVSSEEDFTGKAGQSTVLR  147

Query  536   LPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLS  715
             LP LG KR+GL+GLG  V S  A+R LGE +AAAAK+AQASSVAVALAS+EGLS ESKLS
Sbjct  148   LPGLGSKRVGLIGLGQSVLSPAAFRGLGEAVAAAAKTAQASSVAVALASSEGLSNESKLS  207

Query  716   AASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVK  895
              ASA+A+G V G +EDNR+K E K P LKSV+ILGLGTGP++EKKLKY+E VSS +IF +
Sbjct  208   TASAIASGTVLGVYEDNRYKSESKKPQLKSVDILGLGTGPDLEKKLKYAEDVSSAIIFGR  267

Query  896   ELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSY  1075
             ELVN+PANVLTP ALA EA  IAS YSDV++ATIL  EQCKELKMGS+LGVAAA+ NP +
Sbjct  268   ELVNSPANVLTPAALAAEASKIASSYSDVISATILSAEQCKELKMGSYLGVAAASANPPH  327

Query  1076  FIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaaka  1255
             FIHLCYKP SG +K KLAL+GKG+TFDSGGYN+K G    IELMK DM G+A V GAAKA
Sbjct  328   FIHLCYKPPSGPIKAKLALVGKGLTFDSGGYNIKTGVGCLIELMKTDMGGSAAVLGAAKA  387

Query  1256  iaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIV  1435
             + QIKP GVEVHFIV +CENMISGTGMRPGDI+TASNGK IE                  
Sbjct  388   LGQIKPPGVEVHFIVASCENMISGTGMRPGDIITASNGKTIE------------------  429

Query  1436  VLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                        V +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG S+AG+
Sbjct  430   -----------VNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGPSIAGV  477


 Score =   100 bits (249),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS++LAKEV EA++V GEK WRMPLEESYWE+MKS +ADM+N G   G AITA+LF
Sbjct  476   GVFTPSDNLAKEVFEASEVSGEKFWRMPLEESYWESMKSGVADMVNTGGRQGGAITAALF  535

Query  1866  MK  1871
             +K
Sbjct  536   LK  537



>emb|CBI36527.3| unnamed protein product [Vitis vinifera]
Length=528

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/454 (70%), Positives = 362/454 (80%), Gaps = 31/454 (7%)
 Frame = +2

Query  257   MAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNL  436
             MAH++ARATLGLTHP+ +E PKISF AKE+DL+EWKGDILAVGVTEKDM KDEN KF+N 
Sbjct  1     MAHTLARATLGLTHPSNVEPPKISFTAKEIDLVEWKGDILAVGVTEKDMAKDENLKFENP  60

Query  437   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVV--SSTIAYR  610
             IL+KLDS+LGGLL+EASSEEDF+GKSGQS +LRLP LG KR+GL+GLG +   S   AYR
Sbjct  61    ILKKLDSQLGGLLAEASSEEDFTGKSGQSTILRLPGLGSKRVGLIGLGQLTPCSPPAAYR  120

Query  611   TLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKT  790
             +LGET+A AAK+AQAS VA+ LAS+EGLS ESK+  ASA+A+G V G  EDNRFK E K 
Sbjct  121   SLGETVAVAAKAAQASDVAIVLASSEGLSAESKIYTASAIASGAVLGIHEDNRFKSESKK  180

Query  791   PTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASL  970
             P LKSV+I+GLGTGP+++KKLKY+E V SGVIF KELVNAPANVLTPG LAEEA  IAS 
Sbjct  181   PALKSVDIIGLGTGPDVQKKLKYAEDVCSGVIFGKELVNAPANVLTPGVLAEEASKIASA  240

Query  971   YSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGIT  1150
             YSDVL+A ILD EQCKELKMGS+LGVAAA+ NP +FIHLCYKP +G VK KL L+GKG+T
Sbjct  241   YSDVLSAKILDAEQCKELKMGSYLGVAAASANPPHFIHLCYKPLTGPVKAKLGLVGKGLT  300

Query  1151  FDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGT  1330
             FDSGGYN+K G   SIELMK DM G+A V GAAKAI QIKP+GVEVHFIV ACENMISGT
Sbjct  301   FDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGQIKPSGVEVHFIVAACENMISGT  360

Query  1331  GMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILAD  1510
             GMRPGD++TASNGK IE                             V +TDAEGRL LAD
Sbjct  361   GMRPGDVVTASNGKTIE-----------------------------VNNTDAEGRLTLAD  391

Query  1511  ALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             ALVYA   GVEK+VDLATLTGAC+ ALG S+AG+
Sbjct  392   ALVYACNQGVEKIVDLATLTGACVVALGPSIAGV  425


 Score = 99.0 bits (245),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEVL A++  GEKLWRMP+EESYWE+MKS +ADM+N G   G AITA+LF
Sbjct  424   GVFTPSDDLAKEVLAASEASGEKLWRMPMEESYWESMKSGVADMVNTGGRPGGAITAALF  483

Query  1866  MK  1871
             +K
Sbjct  484   LK  485



>emb|CDP16585.1| unnamed protein product [Coffea canephora]
Length=526

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/452 (71%), Positives = 360/452 (80%), Gaps = 29/452 (6%)
 Frame = +2

Query  257   MAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNL  436
             MAHSIARATLGLT PNQI  PKISF AKE+DL+EWKGDILA+GVTEKD+ KD +SKFQN 
Sbjct  1     MAHSIARATLGLTQPNQIVPPKISFEAKEIDLVEWKGDILAIGVTEKDVAKDGSSKFQNP  60

Query  437   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTL  616
             ILQKLDSKLGGLLSEASSEEDF+GK+GQS +LR+P LG KR+GLVGLG    +T AY  L
Sbjct  61    ILQKLDSKLGGLLSEASSEEDFTGKAGQSTILRVPGLGTKRVGLVGLGPAALTTAAYCGL  120

Query  617   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  796
             GETI AAAKSAQAS+VA+ALAS+E LS +SKL+  SA+A+G V GT+ED+RFK E K PT
Sbjct  121   GETIGAAAKSAQASNVAIALASSETLSADSKLTTVSAIASGTVLGTYEDSRFKSESKKPT  180

Query  797   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  976
             L SV+ILGLGTGPE+EKKLK++E VSS VIF   LVNAPAN+LTP  LAEEAK IASLYS
Sbjct  181   LTSVDILGLGTGPEVEKKLKFAESVSSAVIFGINLVNAPANILTPAVLAEEAKRIASLYS  240

Query  977   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1156
             DVLT TIL+VEQCKELKMGS+LGVAAA+ NP +FIH+ YKP  GSVKTKLAL+GKG+TFD
Sbjct  241   DVLTTTILNVEQCKELKMGSYLGVAAASANPPHFIHIVYKPLGGSVKTKLALVGKGLTFD  300

Query  1157  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1336
             SGGYN+K G    IELMK DM G+A V GAAKA+ QIKPAGVEVHFIV ACENMISGTGM
Sbjct  301   SGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKALGQIKPAGVEVHFIVAACENMISGTGM  360

Query  1337  RPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADAL  1516
             RPGDI+TASNGK IE                             V +TDAEGRL LADAL
Sbjct  361   RPGDIVTASNGKTIE-----------------------------VNNTDAEGRLTLADAL  391

Query  1517  VYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             VYA   GVEK+VDLATLTGAC  ALG S+A +
Sbjct  392   VYACNQGVEKIVDLATLTGACRIALGSSIAAV  423


 Score =   101 bits (251),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  1689  IFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFM  1868
             +FTPS+DLAKEVLEA++V GEKLWRMPLEESYWE+MKS +ADM+N G   G +ITA+LF+
Sbjct  423   VFTPSDDLAKEVLEASEVAGEKLWRMPLEESYWESMKSGVADMVNTGGRPGGSITAALFL  482

Query  1869  K  1871
             K
Sbjct  483   K  483



>ref|XP_006283623.1| hypothetical protein CARUB_v10004680mg [Capsella rubella]
 gb|EOA16521.1| hypothetical protein CARUB_v10004680mg [Capsella rubella]
Length=488

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/476 (66%), Positives = 371/476 (78%), Gaps = 30/476 (6%)
 Frame = +2

Query  179   FLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLE  358
             F++F+  S   ++F+V+PL C   R MAH+I +ATLGLTH N ++ PKISF+ KE+D+ E
Sbjct  32    FVRFQLPSRLRLAFAVTPLYCSS-RAMAHTIPQATLGLTHANSVDHPKISFSGKEIDVTE  90

Query  359   WKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRL  538
             WKGDILAVGVTEKDM KD NSKF+N IL+KLD+ LGGLL++ SSEEDFSGK GQS VLRL
Sbjct  91    WKGDILAVGVTEKDMTKDANSKFENPILKKLDAHLGGLLADVSSEEDFSGKPGQSTVLRL  150

Query  539   PALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSA  718
             P LG KR+GL+GLG   SS  A+++LGE +AAAAK++QASS AV LAS+E +S ESKLS+
Sbjct  151   PGLGSKRVGLIGLGKSASSPSAFQSLGEAVAAAAKASQASSAAVVLASSESVSNESKLSS  210

Query  719   ASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKE  898
             ASA+A+G V G FED+R+K E K P+LKSV+I+G GTGPE+EKKLKY+E VS GVIF KE
Sbjct  211   ASAIASGTVLGLFEDSRYKSESKKPSLKSVDIIGFGTGPELEKKLKYAEDVSYGVIFGKE  270

Query  899   LVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYF  1078
             LVN+PANVLTP  LAEEA  +AS+YSDV+TA IL+ EQCKELKMGS+L VAAA+ NP +F
Sbjct  271   LVNSPANVLTPAVLAEEASKLASMYSDVMTANILNEEQCKELKMGSYLAVAAASANPPHF  330

Query  1079  IHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakai  1258
             IHL YKPSSG VKTKLAL+GKG+TFDSGGYN+K G    IELMK DM G+A V GAAKAI
Sbjct  331   IHLVYKPSSGPVKTKLALVGKGLTFDSGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKAI  390

Query  1259  aQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVV  1438
              QIKP GVEVHFIV ACENMISGTGMRPGDILTASNGK IE                   
Sbjct  391   GQIKPPGVEVHFIVAACENMISGTGMRPGDILTASNGKTIE-------------------  431

Query  1439  LGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVA  1606
                       V +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+A
Sbjct  432   ----------VNNTDAEGRLTLADALVYACNQGVDKVVDLATLTGACIIALGNSMA  477



>ref|XP_011018033.1| PREDICTED: leucine aminopeptidase 1-like [Populus euphratica]
Length=582

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/501 (65%), Positives = 383/501 (76%), Gaps = 31/501 (6%)
 Frame = +2

Query  116   LATNIAVAAVststststssIFLKFRSTSAWAISFSVSPLCCRRP--RRMAHSIARATLG  289
             LAT++  A V +S S+S+S +F K  ST    I+FSVSP    R   + MAHS+ARATLG
Sbjct  8     LATSLTAAVVPSSFSSSSSFVFTKLWSTPCLRITFSVSPFSYSRGGGKLMAHSLARATLG  67

Query  290   LTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGG  469
             LT P  I+ PKI+F+AKE+D+ EWKGDILAVGVTEKDM KD++ +F+N +L+KLD+KLGG
Sbjct  68    LTQPANIDAPKIAFSAKEIDVAEWKGDILAVGVTEKDMTKDDSKRFENSLLKKLDAKLGG  127

Query  470   LLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksa  649
              LSEASSEEDF+GKSGQS+VLRLP LG KRIGL+GLG   ++T A+R  GE IAAAAK+A
Sbjct  128   HLSEASSEEDFTGKSGQSLVLRLPGLGSKRIGLIGLGQSATNTYAFRNFGEAIAAAAKTA  187

Query  650   qassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGT  829
             QA +V + LAS    + ESKL+ ASA+A+G V GT+EDNR+K + K P LKSV+ILG GT
Sbjct  188   QACNVGIVLASTGSTANESKLNTASAIASGTVLGTYEDNRYKSDSKKPVLKSVDILGFGT  247

Query  830   GPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVE  1009
             GPE+EKKLKY+E VSS VIF KELVN+PANVLTP  LAEEA  IAS YSDVL+ATIL+ E
Sbjct  248   GPELEKKLKYAEDVSSAVIFGKELVNSPANVLTPAVLAEEATKIASTYSDVLSATILNAE  307

Query  1010  QCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGAN  1189
             QCKELKMGS+LGVAAA+ NP +FIHLCYKP SG +K KLAL+GKG+TFDSGGYN+K G  
Sbjct  308   QCKELKMGSYLGVAAASANPPHFIHLCYKPPSGPIKAKLALVGKGLTFDSGGYNIKTGPG  367

Query  1190  SSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNG  1369
              SIELMK DM G+A V GAAKAI Q+KP GVEVHFIV ACENMISGTGMRPGDI+TASNG
Sbjct  368   CSIELMKFDMGGSAAVLGAAKAIGQVKPPGVEVHFIVAACENMISGTGMRPGDIVTASNG  427

Query  1370  KRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKM  1549
             K IE                             V +TDAEGRL LADALVYA   G EK+
Sbjct  428   KTIE-----------------------------VNNTDAEGRLTLADALVYACNQGAEKI  458

Query  1550  VDLATLTGACITALGRSVAGM  1612
             +DLATLTGAC+ ALG S+AG+
Sbjct  459   IDLATLTGACVVALGPSIAGV  479


 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS++LA EV  AA+  GEKLWRMP+EESYWE+MKS +ADM+N G   G AITA+LF
Sbjct  478   GVFTPSDELANEVFAAAEASGEKLWRMPMEESYWESMKSGVADMVNTGGRQGGAITAALF  537

Query  1866  MK  1871
             +K
Sbjct  538   LK  539



>ref|XP_008367747.1| PREDICTED: leucine aminopeptidase 1-like [Malus domestica]
Length=573

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/476 (66%), Positives = 366/476 (77%), Gaps = 31/476 (7%)
 Frame = +2

Query  185   KFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWK  364
             K RS  +  +SF+VSPLC RR + MAH++A+A LGLT+P+ I+ PKISFAAKE+D+ EWK
Sbjct  26    KLRSAPSLRLSFAVSPLCSRRGKLMAHTLAQANLGLTYPSGIDAPKISFAAKEIDVAEWK  85

Query  365   GDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPA  544
             GD+LAVGVTEKD+ KDENSKFQN +L+KLDS LGGLL+E SSEEDF+GKSGQS V+RLP 
Sbjct  86    GDLLAVGVTEKDLAKDENSKFQNSVLKKLDSHLGGLLAEVSSEEDFTGKSGQSTVVRLPG  145

Query  545   LGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAAS  724
             LG KR+GL GLG   SST A+R LGE  AAAAK+ Q S +A+ LAS+EGLS +S  + AS
Sbjct  146   LGSKRVGLFGLGQSASSTAAFRGLGEAAAAAAKATQXSDIAIVLASSEGLSAKS--NTAS  203

Query  725   AMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELV  904
             A+A+G V G +ED R+K E K   LKSV+ILGLGTG E+EKKLKY+E V+SG+IF KELV
Sbjct  204   AIASGTVLGIYEDGRYKSESKKSALKSVDILGLGTGAEVEKKLKYTEDVTSGIIFGKELV  263

Query  905   NAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIH  1084
             N+PANVLTPG LAEEA  IAS YSDVL+A IL+ EQCKELKMGS+L VAAA+TNP +FIH
Sbjct  264   NSPANVLTPGKLAEEASKIASTYSDVLSANILNEEQCKELKMGSYLAVAAASTNPPHFIH  323

Query  1085  LCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQ  1264
             L YKP  G  K KL L+GKG+TFDSGGYN+K G   SIE MK DM G+A V GAAKAIAQ
Sbjct  324   LIYKPPGGPAKVKLGLVGKGLTFDSGGYNIKTGPGCSIEQMKFDMGGSAAVLGAAKAIAQ  383

Query  1265  IKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLG  1444
             IKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IE                     
Sbjct  384   IKPXGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIE---------------------  422

Query  1445  VIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                     V +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+AG+
Sbjct  423   --------VNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACIVALGPSIAGV  470


 Score = 96.3 bits (238),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV  A+++ GEK WR+P+EESYWE+MKS IADM+N G+  G +ITA+LF
Sbjct  469   GVFTPSDDLAKEVFAASEISGEKFWRLPMEESYWESMKSGIADMLNTGARQGGSITAALF  528

Query  1866  MK  1871
             +K
Sbjct  529   LK  530



>ref|XP_002529380.1| leucine aminopeptidase, putative [Ricinus communis]
 gb|EEF32976.1| leucine aminopeptidase, putative [Ricinus communis]
Length=587

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/484 (65%), Positives = 369/484 (76%), Gaps = 37/484 (8%)
 Frame = +2

Query  185   KFRSTSAWAISFSVSPLCCRR--------PRRMAHSIARATLGLTHPNQIERPKISFAAK  340
             + RS S    SF+V+PL  R          + MAHS+ARATLGLT P  ++ PKISF+AK
Sbjct  30    RLRSPSVLRFSFAVAPLSYRSRGGGGGGGGKLMAHSLARATLGLTQPANVDVPKISFSAK  89

Query  341   EVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQ  520
             E+D++EWKGDILAVGVTEKDM KD+++KF N +L+KLD+ LGGLLSEASSEEDF+GK+GQ
Sbjct  90    EIDVVEWKGDILAVGVTEKDMTKDKSTKFDNSLLKKLDTHLGGLLSEASSEEDFTGKAGQ  149

Query  521   SIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV  700
             S+VLRLP LG KRIGL+GLG   S+T A+R  GETIAA AK+AQAS+VA+ LASAE +S 
Sbjct  150   SMVLRLPGLGSKRIGLIGLGQSASTTFAFRNFGETIAATAKAAQASNVAIVLASAESISN  209

Query  701   ESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSG  880
             E KL+ ASA+A+G V GT+ED RFK E K P LKSV+ILG GTGP++ KKLKY+E VSS 
Sbjct  210   ELKLNTASAIASGTVLGTYEDARFKSESKKPVLKSVDILGFGTGPDLAKKLKYAEDVSSA  269

Query  881   VIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAA  1060
             VIF KELVN+PANVLTP  LAEEA  IAS YSDVL+A IL  EQCKELKMGS+LGVAAA+
Sbjct  270   VIFGKELVNSPANVLTPAVLAEEASKIASTYSDVLSANILSAEQCKELKMGSYLGVAAAS  329

Query  1061  TNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvf  1240
              NP +FIHL YKP  G+VK KLAL+GKG+TFDSGGYN+K G   SIELMK DM G+A V 
Sbjct  330   ANPPHFIHLHYKPPGGTVKAKLALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVL  389

Query  1241  gaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSR  1420
             GAAKAI QIKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IE             
Sbjct  390   GAAKAIGQIKPPGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIE-------------  436

Query  1421  SDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1600
                             V +TDAEGRL LADALVYA   GV+K+VDLATLTGAC+ ALG S
Sbjct  437   ----------------VNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACVVALGPS  480

Query  1601  VAGM  1612
             +AG+
Sbjct  481   IAGV  484


 Score = 98.6 bits (244),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLA EV  AA+  GEKLWRMPLEESYWE MKS +ADM+N G   G AITA+LF
Sbjct  483   GVFTPSDDLANEVFTAAEASGEKLWRMPLEESYWENMKSGVADMVNTGGRQGGAITAALF  542

Query  1866  MK  1871
             +K
Sbjct  543   LK  544



>ref|XP_008242990.1| PREDICTED: leucine aminopeptidase 1 [Prunus mume]
Length=574

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/476 (66%), Positives = 368/476 (77%), Gaps = 31/476 (7%)
 Frame = +2

Query  185   KFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWK  364
             K RS+ +  +S +V+PLC RR + MAH++ARATLGLT P+ ++ PKISFAAK++D+ EWK
Sbjct  27    KLRSSPSLRLSLAVTPLCSRRGKLMAHTLARATLGLTLPSGVDAPKISFAAKDIDVTEWK  86

Query  365   GDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPA  544
             GD+LAVGVTEKD+ KDENS+FQN IL+ LDS+LGGLL+EASSEEDF+GKSGQS V+RLP 
Sbjct  87    GDLLAVGVTEKDLAKDENSEFQNSILKNLDSRLGGLLAEASSEEDFTGKSGQSTVVRLPG  146

Query  545   LGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAAS  724
             LG KRIGL GLG   SST A+R LGE  A AAK+ QAS +AV LAS+EGLS +S  + AS
Sbjct  147   LGSKRIGLFGLGQSASSTAAFRGLGEAAATAAKATQASDLAVVLASSEGLSAKS--NTAS  204

Query  725   AMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELV  904
             A+A+G V G +ED+R+K E K   LKSV+ILGLGTGPE+EKKLKY+E V+SG+IF KELV
Sbjct  205   AIASGTVLGIYEDSRYKSESKKSALKSVDILGLGTGPEVEKKLKYAEDVTSGIIFGKELV  264

Query  905   NAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIH  1084
             N+PANVLTPG LAEEA  IAS YSDVL+A IL+ EQCKELKMGS+L VAAA+ NP +FIH
Sbjct  265   NSPANVLTPGKLAEEASKIASTYSDVLSAKILNEEQCKELKMGSYLAVAAASANPPHFIH  324

Query  1085  LCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQ  1264
             L YKP  G  K KL L+GKG+TFDSGGYN+K G   SIELMK DM G+A V GAAKAI Q
Sbjct  325   LIYKPPGGPAKVKLGLVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGQ  384

Query  1265  IKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLG  1444
             IKP GVEVHFIV ACENMISGTG+RPGDI+TASNGK IE                     
Sbjct  385   IKPPGVEVHFIVAACENMISGTGVRPGDIVTASNGKTIE---------------------  423

Query  1445  VIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                     V +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG S+AG+
Sbjct  424   --------VNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGPSIAGV  471


 Score = 94.4 bits (233),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV  A+++ GEK WR+PLEESYWE+MKS IADM+N G   G +I+A+LF
Sbjct  470   GVFTPSDDLAKEVFAASELSGEKFWRLPLEESYWESMKSGIADMVNTGGRPGGSISAALF  529

Query  1866  MK  1871
             +K
Sbjct  530   LK  531



>ref|XP_007204206.1| hypothetical protein PRUPE_ppa003434mg [Prunus persica]
 gb|EMJ05405.1| hypothetical protein PRUPE_ppa003434mg [Prunus persica]
Length=574

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/476 (66%), Positives = 367/476 (77%), Gaps = 31/476 (7%)
 Frame = +2

Query  185   KFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWK  364
             K RS+ +  +S +V+PLC RR + MAH++ARATLGLT P+ ++ PKISFA K++D+ EWK
Sbjct  27    KLRSSPSLRLSLAVTPLCSRRGKLMAHTLARATLGLTFPSGLDAPKISFAVKDIDVTEWK  86

Query  365   GDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPA  544
             GD+LAVGVTEKD+ KDENSKFQN IL+ LDS+LGGLL+EASSEEDF+GKSGQS V+RLP 
Sbjct  87    GDLLAVGVTEKDLAKDENSKFQNSILKNLDSRLGGLLAEASSEEDFTGKSGQSTVVRLPG  146

Query  545   LGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAAS  724
             LG KRIGL GLG   SST A+R LGE  A AAK+ QAS +A+ LAS+EGLS +S  + AS
Sbjct  147   LGSKRIGLFGLGQSASSTAAFRGLGEAAATAAKATQASDLAIVLASSEGLSAKS--NTAS  204

Query  725   AMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELV  904
             A+A+G V G +ED+R+K E K   LKSV+ILGLGTGPE+EKKLKY+E V+SG+IF KELV
Sbjct  205   AIASGTVLGIYEDSRYKSESKKSALKSVDILGLGTGPEVEKKLKYAEDVTSGIIFGKELV  264

Query  905   NAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIH  1084
             N+PANVLTPG LAEEA  IAS YSDVL+A IL+ EQCKELKMGS+L VAAA+ NP +FIH
Sbjct  265   NSPANVLTPGKLAEEASKIASTYSDVLSAKILNEEQCKELKMGSYLAVAAASANPPHFIH  324

Query  1085  LCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQ  1264
             L YKP  G  K KL L+GKG+TFDSGGYN+K G   SIELMK DM G+A V GAAKAI Q
Sbjct  325   LIYKPPGGPAKVKLGLVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGQ  384

Query  1265  IKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLG  1444
             IKP GVEVHFIV ACENMISGTG+RPGDI+TASNGK IE                     
Sbjct  385   IKPPGVEVHFIVAACENMISGTGVRPGDIVTASNGKTIE---------------------  423

Query  1445  VIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                     V +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG S+AG+
Sbjct  424   --------VNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGPSIAGV  471


 Score = 94.4 bits (233),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV  A+++ GEK WR+PLEESYWE+MKS IADM+N G   G +I+A+LF
Sbjct  470   GVFTPSDDLAKEVFAASELSGEKFWRLPLEESYWESMKSGIADMVNTGGRPGGSISAALF  529

Query  1866  MK  1871
             +K
Sbjct  530   LK  531



>ref|XP_010525807.1| PREDICTED: leucine aminopeptidase 1 [Tarenaya hassleriana]
Length=588

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/467 (68%), Positives = 371/467 (79%), Gaps = 30/467 (6%)
 Frame = +2

Query  212   ISFSVSPL-CCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGV  388
             ++F+V+PL    R R MAH++ARATLGLT P+ I+ PKISF+AK+VD+ EWKGDILAVGV
Sbjct  46    LAFAVNPLYSSSRARAMAHTLARATLGLTQPSSIDPPKISFSAKDVDMTEWKGDILAVGV  105

Query  389   TEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGL  568
             TEKDM KD+NSKF+N IL+KLD  LGGLL+E SSEEDF+GK GQS VLRLP LG KR+GL
Sbjct  106   TEKDMKKDDNSKFENPILKKLDDHLGGLLAEVSSEEDFAGKPGQSTVLRLPGLGSKRVGL  165

Query  569   VGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVS  748
             +GLGS +SS   +++LGE +AAAAKSAQAS+VA+ALAS E +S ESKL +ASA+A+G V 
Sbjct  166   IGLGSKISSPSTFQSLGEAVAAAAKSAQASNVAIALASPESVSDESKLISASAIASGTVL  225

Query  749   GTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLT  928
             G +ED R+K E K P+LKSV+I+G GTGPE+EKKLKY+E VSSGVI  KELVN+PANVLT
Sbjct  226   GIYEDIRYKTESKKPSLKSVDIIGFGTGPELEKKLKYAEDVSSGVILGKELVNSPANVLT  285

Query  929   PGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSG  1108
             P ALAEEAK +ASLYSDVLTA ILD E+CKELKMGS+LGVAAA+ NP +FIHL Y+PSSG
Sbjct  286   PAALAEEAKKLASLYSDVLTANILDEEKCKELKMGSYLGVAAASANPPHFIHLLYRPSSG  345

Query  1109  SVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEV  1288
              VK KLAL+GKG+TFDSGGYN+K G   SIELMK DM G+A V GAAKAI QIKP GVEV
Sbjct  346   PVKRKLALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGQIKPPGVEV  405

Query  1289  HFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**  1468
             HFIV ACENMISGTGMRPGD+LTASNGK IE                             
Sbjct  406   HFIVAACENMISGTGMRPGDVLTASNGKTIE-----------------------------  436

Query  1469  VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAG  1609
             V +TDAEGRL LADALVYA   GV+K++DLATLTGAC+ ALG ++AG
Sbjct  437   VNNTDAEGRLTLADALVYACNQGVDKVIDLATLTGACVVALGPTIAG  483


 Score = 94.0 bits (232),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G FTPSE+LA E+ +A+   GEKLWRMPLEESYWE+MKS +ADM+N G   G AITA+LF
Sbjct  483   GCFTPSEELAHEIFDASQSSGEKLWRMPLEESYWESMKSGVADMVNTGGRPGGAITAALF  542

Query  1866  MK  1871
             +K
Sbjct  543   LK  544



>ref|XP_010265583.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Nelumbo 
nucifera]
Length=528

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/454 (69%), Positives = 359/454 (79%), Gaps = 31/454 (7%)
 Frame = +2

Query  257   MAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNL  436
             MA S++R TLGLT P   E P+I+F+AKE+DL++WKGDILAVGVTEKDM KDENSKF+N 
Sbjct  1     MAQSLSRVTLGLTQPANTEVPQIAFSAKEIDLVKWKGDILAVGVTEKDMAKDENSKFENP  60

Query  437   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIA--YR  610
             IL+KLD+ LGGLL+EASSEEDF+GKSGQS VLRLP LG KRIGL+GLG    S+IA  YR
Sbjct  61    ILRKLDAHLGGLLAEASSEEDFTGKSGQSTVLRLPGLGSKRIGLIGLGQCAPSSIAAVYR  120

Query  611   TLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKT  790
             +LGE +AAAAK+AQAS VA+ALAS+EGLS +SK++A SA+A GIV G +EDNRFK E K 
Sbjct  121   SLGEAVAAAAKAAQASDVAIALASSEGLSEDSKVNAVSAIAFGIVLGVYEDNRFKSESKR  180

Query  791   PTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASL  970
             P LKSVEILGLG GPE+E KLKY+  V S +IF KELVNAPANVLTPGALAEEA  IAS+
Sbjct  181   PLLKSVEILGLGAGPELENKLKYAGHVCSAIIFGKELVNAPANVLTPGALAEEASKIASM  240

Query  971   YSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGIT  1150
             Y DVLTA ILD E+CKELKMGS+LGVAAA+ NP +FIHLCYKP SG +K KL L+GKG+T
Sbjct  241   YGDVLTAKILDEEKCKELKMGSYLGVAAASANPPHFIHLCYKPPSGPIKAKLGLVGKGLT  300

Query  1151  FDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGT  1330
             FDSGGYN+K G   SIE+MK DM G+A V GAAKAI QIKPAGVEVHFIV ACENMISGT
Sbjct  301   FDSGGYNIKTGPGCSIEIMKTDMGGSAAVLGAAKAIGQIKPAGVEVHFIVAACENMISGT  360

Query  1331  GMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILAD  1510
             GMRPGDI+TASNGK IE                             V +TDAEGRL LAD
Sbjct  361   GMRPGDIVTASNGKTIE-----------------------------VNNTDAEGRLTLAD  391

Query  1511  ALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             ALVYA   GVEK+VDLATLTGACI ALG S+AG+
Sbjct  392   ALVYACNQGVEKIVDLATLTGACIIALGPSIAGV  425


 Score = 99.8 bits (247),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV  A+ + GEKLWRMPLEESYWE+MKS +ADM+N G   G AITA+LF
Sbjct  424   GVFTPSDDLAKEVFAASQISGEKLWRMPLEESYWESMKSGVADMVNTGGRQGGAITAALF  483

Query  1866  MK  1871
             +K
Sbjct  484   LK  485



>ref|XP_006453614.1| hypothetical protein CICLE_v10007834mg [Citrus clementina]
 gb|ESR66854.1| hypothetical protein CICLE_v10007834mg [Citrus clementina]
 gb|KDO59458.1| hypothetical protein CISIN_1g007947mg [Citrus sinensis]
Length=583

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/460 (69%), Positives = 368/460 (80%), Gaps = 30/460 (7%)
 Frame = +2

Query  233   LCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKD  412
             L CR   RMAHSIARATLGLT P QI+  KISFAAKEVD++EWKGDILAVGVTEKDM KD
Sbjct  49    LFCRGKLRMAHSIARATLGLTKPAQIDPLKISFAAKEVDVVEWKGDILAVGVTEKDMGKD  108

Query  413   ENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVS  592
             +NSKFQN IL+KLD++LGGLLSEASSEEDF+GK+GQS V+RLP +G KR+GL+GLG   S
Sbjct  109   DNSKFQNSILKKLDAQLGGLLSEASSEEDFTGKAGQSTVIRLPGIGSKRVGLIGLGQSAS  168

Query  593   STIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRF  772
                 +R+LGE++AAAAK+AQAS+VAV LAS++GLS ESKL+AASA+A+G V GTFEDNR+
Sbjct  169   RAGDFRSLGESVAAAAKAAQASNVAVVLASSDGLSDESKLTAASAVASGTVLGTFEDNRY  228

Query  773   KLEPKTP-TLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEE  949
             + E K P +LKSV+I+GLGTGPE+EKKLKY+E VSS VIF +ELVN+PANVLTP  LAEE
Sbjct  229   RSESKKPVSLKSVDIIGLGTGPELEKKLKYAEHVSSAVIFGRELVNSPANVLTPAVLAEE  288

Query  950   AKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLA  1129
             A  +AS+YSDVL+ATILD+E+CKELKMGS+LGVAAA+ N  +FIHLCYKP  GS K KLA
Sbjct  289   ASKVASMYSDVLSATILDIEKCKELKMGSYLGVAAASANLPHFIHLCYKPPGGSAKIKLA  348

Query  1130  LLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPAC  1309
             L+GKG+TFDSGGYN+K G    IE MK DM GAA V GAAKAI QIKP GVEVHFIV AC
Sbjct  349   LVGKGLTFDSGGYNIKTGPGCLIENMKYDMGGAAAVLGAAKAIGQIKPPGVEVHFIVAAC  408

Query  1310  ENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAE  1489
             ENMISGTGMRPGDI+TA+NGK IE                             V +TDAE
Sbjct  409   ENMISGTGMRPGDIITAANGKTIE-----------------------------VNNTDAE  439

Query  1490  GRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAG  1609
             GRL LADAL+YA   GV+K++DLATLTGAC+ ALG SVAG
Sbjct  440   GRLTLADALIYACNQGVDKVIDLATLTGACVVALGPSVAG  479


 Score = 95.1 bits (235),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G FTPS+DLA EV+ A+ V GEK+WRMPLEESYWE MKS +ADM+N G   G AITA+LF
Sbjct  479   GAFTPSDDLANEVMAASQVSGEKIWRMPLEESYWEMMKSGVADMVNTGGRQGGAITAALF  538

Query  1866  MK  1871
             +K
Sbjct  539   LK  540



>ref|XP_004287132.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=575

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/477 (66%), Positives = 370/477 (78%), Gaps = 32/477 (7%)
 Frame = +2

Query  185   KFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPN-QIERPKISFAAKEVDLLEW  361
             K RS  +  +SF+VSPLC RR R MAH+IARATLGLT  +   E PK++FA KE+D+ EW
Sbjct  27    KLRSAPSLRLSFTVSPLCSRRGRHMAHTIARATLGLTQISPAFEAPKLTFATKEIDVTEW  86

Query  362   KGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLP  541
             KGD+LAVGVTEKD+ KD+NSKF+N IL+KLDS LGG+L+E S+EEDF+GKSGQS V+RLP
Sbjct  87    KGDLLAVGVTEKDLAKDQNSKFENPILKKLDSHLGGVLAEVSTEEDFTGKSGQSTVVRLP  146

Query  542   ALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAA  721
              LG KR+GL GLG   ++T A++ LGE  AAAAK+AQAS +A+ LAS+EGLS +S    A
Sbjct  147   GLGSKRVGLFGLGQSATATAAFKGLGEAAAAAAKTAQASDIAIVLASSEGLSAKS--CTA  204

Query  722   SAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKEL  901
             SA+A+G V G +EDNR+K E K P LKSV+ILGLGTGPE+EKKLKY++ V+SG+IF KEL
Sbjct  205   SAIASGAVLGIYEDNRYKSESKKPALKSVDILGLGTGPELEKKLKYAQDVASGIIFGKEL  264

Query  902   VNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFI  1081
             VN+PANVLTPG LAEEA NIASLYSDVL+A IL+ EQCK+LKMGS+L VAAA+ NP +FI
Sbjct  265   VNSPANVLTPGKLAEEASNIASLYSDVLSAKILNEEQCKDLKMGSYLAVAAASANPPHFI  324

Query  1082  HLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaia  1261
             HL YKP  G  K KLAL+GKG+TFDSGGYN+K G   SIELMK DM G+A V GAAKAI 
Sbjct  325   HLTYKPPGGPAKLKLALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIG  384

Query  1262  QIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVL  1441
             QIKP+GVEVHFIV ACENMISGTGMRPGDI+TASNGK IE                    
Sbjct  385   QIKPSGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIE--------------------  424

Query  1442  GVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                      V +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+AG+
Sbjct  425   ---------VNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACIVALGPSIAGV  472


 Score = 97.8 bits (242),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV  A+++ GEK WRMP+EESYWETMKS +ADM+N G   G AI+A+LF
Sbjct  471   GVFTPSDDLAKEVFAASEISGEKFWRMPMEESYWETMKSGVADMVNTGGRQGGAISAALF  530

Query  1866  MK  1871
             +K
Sbjct  531   LK  532



>ref|XP_006474000.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Citrus 
sinensis]
Length=583

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/460 (69%), Positives = 367/460 (80%), Gaps = 30/460 (7%)
 Frame = +2

Query  233   LCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKD  412
             L CR   RMAHSIARATLGLT P QI+  KISFAAKEVD++EWKGDILAVGVTEKDM KD
Sbjct  49    LFCRGKLRMAHSIARATLGLTKPAQIDPLKISFAAKEVDVVEWKGDILAVGVTEKDMGKD  108

Query  413   ENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVS  592
             +NSKFQN IL+KLD++LGGLLSEASSEEDF+GK GQS V+RLP +G KR+GL+GLG   S
Sbjct  109   DNSKFQNSILKKLDAQLGGLLSEASSEEDFTGKPGQSTVIRLPGIGSKRVGLIGLGQSAS  168

Query  593   STIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRF  772
                 +R+LGE++AAAAK+AQAS+VAV LAS++GLS ESKL+AASA+A+G V GTFEDNR+
Sbjct  169   RAGDFRSLGESVAAAAKAAQASNVAVVLASSDGLSDESKLTAASAVASGTVLGTFEDNRY  228

Query  773   KLEPKTP-TLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEE  949
             + E K P +LKSV+I+GLGTGPE+EKKLKY+E VSS VIF +ELVN+PANVLTP  LAEE
Sbjct  229   RSESKKPVSLKSVDIIGLGTGPELEKKLKYAEHVSSAVIFGRELVNSPANVLTPAVLAEE  288

Query  950   AKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLA  1129
             A  +AS+YSDVL+ATILD+E+CKELKMGS+LGVAAA+ N  +FIHLCYKP  GS K KLA
Sbjct  289   ASKVASMYSDVLSATILDIEKCKELKMGSYLGVAAASANLPHFIHLCYKPPGGSAKIKLA  348

Query  1130  LLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPAC  1309
             L+GKG+TFDSGGYN+K G    IE MK DM GAA V GAAKAI QIKP GVEVHFIV AC
Sbjct  349   LVGKGLTFDSGGYNIKTGPGCLIENMKYDMGGAAAVLGAAKAIGQIKPPGVEVHFIVAAC  408

Query  1310  ENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAE  1489
             ENMISGTGMRPGDI+TA+NGK IE                             V +TDAE
Sbjct  409   ENMISGTGMRPGDIITAANGKTIE-----------------------------VNNTDAE  439

Query  1490  GRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAG  1609
             GRL LADAL+YA   GV+K++DLATLTGAC+ ALG SVAG
Sbjct  440   GRLTLADALIYACNQGVDKVIDLATLTGACVVALGPSVAG  479


 Score = 95.1 bits (235),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G FTPS+DLA EV+ A+ V GEK+WRMPLEESYWE MKS +ADM+N G   G AITA+LF
Sbjct  479   GAFTPSDDLANEVMAASQVSGEKIWRMPLEESYWEMMKSGVADMVNTGGRQGGAITAALF  538

Query  1866  MK  1871
             +K
Sbjct  539   LK  540



>ref|XP_010047106.1| PREDICTED: leucine aminopeptidase 1-like [Eucalyptus grandis]
 gb|KCW78900.1| hypothetical protein EUGRSUZ_C00345 [Eucalyptus grandis]
Length=576

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/468 (66%), Positives = 366/468 (78%), Gaps = 30/468 (6%)
 Frame = +2

Query  212   ISFSVSPLCC-RRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGV  388
             +SF+VSPL   RR R MAH++A+ATLGLT P  ++ PKI+FAAK++D +EW GDILAVGV
Sbjct  35    LSFAVSPLSSSRRGRLMAHTLAQATLGLTQPANVDVPKIAFAAKDIDAVEWSGDILAVGV  94

Query  389   TEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGL  568
             TEKDM KDENSKFQN ILQ+LD +L GLL+EASSEEDF+GKSGQS+VLRLP +G KR+ L
Sbjct  95    TEKDMAKDENSKFQNSILQRLDKQLSGLLAEASSEEDFTGKSGQSVVLRLPGIGSKRVSL  154

Query  569   VGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVS  748
             +GLG   S+  A+R LGE +AAAAK+AQAS++ + LAS+EGLS ESKL+ ASA+A+G V 
Sbjct  155   IGLGQSASTPTAFRGLGEAVAAAAKAAQASNIGIVLASSEGLSAESKLTTASAIASGTVL  214

Query  749   GTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLT  928
             G  +D R+K E K   LKSV+ILGLG+GPE++KKLKY+E VSSG+IF ++LVN+PANVLT
Sbjct  215   GIHDDTRYKSESKKIALKSVDILGLGSGPEVDKKLKYAEDVSSGIIFGRQLVNSPANVLT  274

Query  929   PGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSG  1108
             P  LA+EA  IAS YSDV++ATIL+ EQCKELKMGS+LGVAAA+ NP +FIHLCYKP  G
Sbjct  275   PAVLADEASKIASTYSDVISATILNAEQCKELKMGSYLGVAAASANPPHFIHLCYKPVGG  334

Query  1109  SVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEV  1288
               K KLAL+GKG+TFDSGGYN+K G   SIELMK DM G+A V GAAKA+ QIKP GVEV
Sbjct  335   PAKVKLALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKALGQIKPPGVEV  394

Query  1289  HFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**  1468
             HFIV ACENMISGTGMRPGDI+TASNGK IE                             
Sbjct  395   HFIVAACENMISGTGMRPGDIVTASNGKTIE-----------------------------  425

Query  1469  VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             V +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG S+AG+
Sbjct  426   VNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGPSIAGV  473


 Score = 99.8 bits (247),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV  A+++ GEKLWRMPLEESYWE+MKS +ADM+N G   G AITA+LF
Sbjct  472   GVFTPSDDLAKEVFAASELSGEKLWRMPLEESYWESMKSGVADMVNTGGRQGGAITAALF  531

Query  1866  MK  1871
             +K
Sbjct  532   LK  533



>emb|CAA48038.1| leucine aminopeptidase [Solanum tuberosum]
Length=554

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/479 (65%), Positives = 370/479 (77%), Gaps = 33/479 (7%)
 Frame = +2

Query  176   IFLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLL  355
             +F K +S+  WA SFSV+PLC RR +R+ H IA  TLGLT PN+ + PKIS  AK+ D++
Sbjct  4     VFTKCQSSPRWAFSFSVTPLCSRRSKRIVHCIAGDTLGLTRPNESDAPKISIGAKDTDVV  63

Query  356   EWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  535
             +W+GD+LA+G TE D+ +D+NSKF+N +LQ+LDSKL GLLS ASSEEDFSGKSGQSI LR
Sbjct  64    QWQGDLLAIGATENDLARDDNSKFKNPLLQRLDSKLNGLLSAASSEEDFSGKSGQSINLR  123

Query  536   LPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLS  715
             LP     RI LVGLGS  SS  +Y +LGE  AAAAKSAQA ++AV+LAS +GLS ESK++
Sbjct  124   LPG---GRITLVGLGSSASSPTSYHSLGEAAAAAAKSAQARNIAVSLASTDGLSAESKIN  180

Query  716   AASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVK  895
             +ASA+ATG++ G FEDNRF+ E KTP L+S++ILGLGTGPEIE K+KY+E V +GVI  +
Sbjct  181   SASAIATGVMLGIFEDNRFRSESKTPALESLDILGLGTGPEIESKIKYAEHVCAGVILGR  240

Query  896   ELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAAT-NPS  1072
             ELVNAPAN++TPGALAEEAK IAS YSDV+T  ILD EQCKELKMG++LGVAAAAT NP 
Sbjct  241   ELVNAPANIVTPGALAEEAKKIASTYSDVITVNILDAEQCKELKMGAYLGVAAAATENPP  300

Query  1073  YFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaak  1252
             YFIHLC+K +S   KTK+AL+GKG+TFDSGGYNLK GA S IELMK DM GAA V GAAK
Sbjct  301   YFIHLCFKTNSRERKTKIALVGKGLTFDSGGYNLKTGAGSKIELMKNDMGGAAAVLGAAK  360

Query  1253  aiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYI  1432
             A+ +IKP GVEVHFIV ACENMISG GMRPGDI+TASNGK IE                 
Sbjct  361   ALGEIKPRGVEVHFIVAACENMISGAGMRPGDIVTASNGKTIE-----------------  403

Query  1433  VVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAG  1609
                         V +TDAEGRL LADAL+YA   GVEK++DLATLTGA +TALG SVAG
Sbjct  404   ------------VNNTDAEGRLTLADALIYACNQGVEKIIDLATLTGAIVTALGPSVAG  450


 Score = 94.4 bits (233),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G FTPS+ LA+EV+ AA+  GEKLWRMP+EESYWE+MKS +ADMIN G  DG AIT +LF
Sbjct  450   GAFTPSDGLAREVVVAAEASGEKLWRMPMEESYWESMKSGVADMINTGPRDGGAITGALF  509

Query  1866  MK  1871
             +K
Sbjct  510   LK  511



>ref|XP_010275823.1| PREDICTED: leucine aminopeptidase 1-like [Nelumbo nucifera]
Length=574

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/482 (67%), Positives = 369/482 (77%), Gaps = 33/482 (7%)
 Frame = +2

Query  176   IFLKFRSTSAWAISFSVSPLCCRRPRRMAHSIA-RATLGLTHPNQIERPKISFAAKEVDL  352
             I  K R + A  +S   +PL   R  RMAH+ A RATLGLT P  +E PKI+F+AKE+DL
Sbjct  20    ILTKLRPSPALRLSLP-TPLSSPRRLRMAHTSAIRATLGLTQPANVEVPKIAFSAKEIDL  78

Query  353   LEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVL  532
             +EWKGDILAVGVTEKDM KD+NSKF+N IL+KLD+ LGGLL+EASSEEDF+GKSGQS VL
Sbjct  79    VEWKGDILAVGVTEKDMAKDDNSKFKNPILRKLDAHLGGLLAEASSEEDFTGKSGQSTVL  138

Query  533   RLPALGFKRIGLVGLGSVV--SSTIAYRTLGETIaaaaksaqassvavalasaEGLSVES  706
             RLP LG KRIGL+GLG  +  S T  YR+LGE + AAAK+AQA+ VA+ALAS+EG+S  S
Sbjct  139   RLPGLGSKRIGLIGLGQCLPSSGTTTYRSLGEAVGAAAKAAQANDVAIALASSEGISGNS  198

Query  707   KLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVI  886
             KL+  SA+A+G V G +EDNRFK E K   LKSV+ILGLGTGPE++ KLKY   V SGVI
Sbjct  199   KLNTVSAIASGTVLGVYEDNRFKSESKKSLLKSVDILGLGTGPELQNKLKYVGDVCSGVI  258

Query  887   FVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATN  1066
               KELVN+PANVLTPG LAEEA  IAS+Y+DVLTATILDVEQCK+LKMGS+LGVAAA+ N
Sbjct  259   LGKELVNSPANVLTPGVLAEEASKIASMYNDVLTATILDVEQCKKLKMGSYLGVAAASAN  318

Query  1067  PSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfga  1246
             P +FIHLCYKP  G+VK KLAL+GKG+TFDSGGYN+K G   SIELMK DM G+A V GA
Sbjct  319   PPHFIHLCYKPPGGAVKAKLALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGA  378

Query  1247  akaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSD  1426
             AKAI QIKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IE               
Sbjct  379   AKAIGQIKPPGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIE---------------  423

Query  1427  YIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVA  1606
                           V +TDAEGRL LADALVYA   GV K+VDLATLTGACI ALG S+A
Sbjct  424   --------------VNNTDAEGRLTLADALVYACNQGVGKIVDLATLTGACIVALGPSIA  469

Query  1607  GM  1612
             G+
Sbjct  470   GV  471


 Score = 99.0 bits (245),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV  A+++ GEKLWRMPLE+SYWE+MKS +ADM+N G   G AITA+LF
Sbjct  470   GVFTPSDDLAKEVFAASEISGEKLWRMPLEDSYWESMKSGVADMVNTGGRQGGAITAALF  529

Query  1866  MK  1871
             +K
Sbjct  530   LK  531



>ref|XP_002867321.1| cytosol aminopeptidase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43580.1| cytosol aminopeptidase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=583

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/478 (66%), Positives = 375/478 (78%), Gaps = 30/478 (6%)
 Frame = +2

Query  179   FLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLE  358
             F++F+  S   ++ +V+PL C   + MAH+IA+ATLGLTH N ++ PKI F+ KE+D+ E
Sbjct  32    FVRFQLPSRLRLASAVTPLYCSS-KAMAHTIAQATLGLTHANSVDHPKILFSGKEIDVTE  90

Query  359   WKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRL  538
             WKGDILAVGVTEKDM KD NSKF+N IL+KLD+ LGGLL++ SSEEDFSGK GQS VLRL
Sbjct  91    WKGDILAVGVTEKDMAKDVNSKFENPILKKLDAHLGGLLADVSSEEDFSGKPGQSTVLRL  150

Query  539   PALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSA  718
             P LG KR+GL+GLG   SS  A+++LGE +AAAAK++QASSVAV LAS++ +S ESKLS+
Sbjct  151   PGLGSKRVGLIGLGKSASSPSAFQSLGEAVAAAAKASQASSVAVVLASSDSVSNESKLSS  210

Query  719   ASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKE  898
             ASA+A+G V G FED+R+K E K P+LKSV+I+G GTGPE+E+KLKY+E VS GVIF KE
Sbjct  211   ASAIASGTVLGLFEDSRYKSESKKPSLKSVDIIGFGTGPELEEKLKYAEHVSYGVIFGKE  270

Query  899   LVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYF  1078
             LVN+PANVLTP  LAEEA N+AS+YSDV+TA IL+ EQCKELKMGS+L VAAA+ NP +F
Sbjct  271   LVNSPANVLTPAVLAEEASNLASMYSDVMTANILNEEQCKELKMGSYLAVAAASANPPHF  330

Query  1079  IHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakai  1258
             IHL YKPSSG VKTKLAL+GKG+TFDSGGYN+K G    IELMK DM G+A V GAAKAI
Sbjct  331   IHLIYKPSSGPVKTKLALVGKGLTFDSGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKAI  390

Query  1259  aQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVV  1438
             AQIKP GVEVHFIV ACENMISGTGMRPGD++TASNGK IE                   
Sbjct  391   AQIKPPGVEVHFIVAACENMISGTGMRPGDVITASNGKTIE-------------------  431

Query  1439  LGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                       V +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+AG+
Sbjct  432   ----------VNNTDAEGRLTLADALVYACNQGVDKVVDLATLTGACIIALGTSMAGI  479


 Score = 92.0 bits (227),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI+TPS++LAKEV+ A++  GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+LF
Sbjct  478   GIYTPSDELAKEVIAASERSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGSITAALF  537

Query  1866  MK  1871
             +K
Sbjct  538   LK  539



>sp|P31427.2|AMPL_SOLTU RecName: Full=Leucine aminopeptidase, chloroplastic; AltName: 
Full=Leucyl aminopeptidase; Short=LAP; AltName: Full=Proline 
aminopeptidase; AltName: Full=Prolyl aminopeptidase; Flags: 
Precursor [Solanum tuberosum]
 emb|CAA54314.1| leucine aminopeptidase [Solanum tuberosum]
Length=573

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/479 (65%), Positives = 370/479 (77%), Gaps = 33/479 (7%)
 Frame = +2

Query  176   IFLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLL  355
             +F K +S+  WA SFSV+PLC RR +R+ H IA  TLGLT PN+ + PKIS  AK+ D++
Sbjct  23    VFTKCQSSPRWAFSFSVTPLCSRRSKRIVHCIAGDTLGLTRPNESDAPKISIGAKDTDVV  82

Query  356   EWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  535
             +W+GD+LA+G TE D+ +D+NSKF+N +LQ+LDSKL GLLS ASSEEDFSGKSGQSI LR
Sbjct  83    QWQGDLLAIGATENDLARDDNSKFKNPLLQRLDSKLNGLLSAASSEEDFSGKSGQSINLR  142

Query  536   LPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLS  715
             LP     RI LVGLGS  SS  +Y +LGE  AAAAKSAQA ++AV+LAS +GLS ESK++
Sbjct  143   LPG---GRITLVGLGSSASSPTSYHSLGEAAAAAAKSAQARNIAVSLASTDGLSAESKIN  199

Query  716   AASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVK  895
             +ASA+ATG++ G FEDNRF+ E KTP L+S++ILGLGTGPEIE K+KY+E V +GVI  +
Sbjct  200   SASAIATGVMLGIFEDNRFRSESKTPALESLDILGLGTGPEIESKIKYAEHVCAGVILGR  259

Query  896   ELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAAT-NPS  1072
             ELVNAPAN++TPGALAEEAK IAS YSDV+T  ILD EQCKELKMG++LGVAAAAT NP 
Sbjct  260   ELVNAPANIVTPGALAEEAKKIASTYSDVITVNILDAEQCKELKMGAYLGVAAAATENPP  319

Query  1073  YFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaak  1252
             YFIHLC+K +S   KTK+AL+GKG+TFDSGGYNLK GA S IELMK DM GAA V GAAK
Sbjct  320   YFIHLCFKTNSRERKTKIALVGKGLTFDSGGYNLKTGAGSKIELMKNDMGGAAAVLGAAK  379

Query  1253  aiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYI  1432
             A+ +IKP GVEVHFIV ACENMISG GMRPGDI+TASNGK IE                 
Sbjct  380   ALGEIKPRGVEVHFIVAACENMISGAGMRPGDIVTASNGKTIE-----------------  422

Query  1433  VVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAG  1609
                         V +TDAEGRL LADAL+YA   GVEK++DLATLTGA +TALG SVAG
Sbjct  423   ------------VNNTDAEGRLTLADALIYACNQGVEKIIDLATLTGAIVTALGPSVAG  469


 Score = 94.7 bits (234),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G FTPS+ LA+EV+ AA+  GEKLWRMP+EESYWE+MKS +ADMIN G  DG AIT +LF
Sbjct  469   GAFTPSDGLAREVVVAAEASGEKLWRMPMEESYWESMKSGVADMINTGPRDGGAITGALF  528

Query  1866  MK  1871
             +K
Sbjct  529   LK  530



>gb|KDP38679.1| hypothetical protein JCGZ_04032 [Jatropha curcas]
Length=587

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/473 (65%), Positives = 363/473 (77%), Gaps = 35/473 (7%)
 Frame = +2

Query  212   ISFSVSPLCCR------RPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDI  373
              SF+V+P C R        + MAHS+ARA LGLT P  I+ PKISFAAKE+D+ EWKGDI
Sbjct  41    FSFAVAPFCYRVDTGERGAKLMAHSLARANLGLTQPANIDVPKISFAAKEIDVAEWKGDI  100

Query  374   LAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGF  553
             +AVGVTEKDM KDE++KF+N +L+KLD+ LGGLLSEASSEEDF+GK+GQSIVLRLP LG 
Sbjct  101   VAVGVTEKDMAKDESAKFENSLLKKLDTHLGGLLSEASSEEDFTGKAGQSIVLRLPGLGS  160

Query  554   KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMA  733
             KR+GL+GLG   S+T A+R LGE +AA AK+ QAS+V + LAS + +S +SKL+ ASA+A
Sbjct  161   KRVGLIGLGPCASTTFAFRNLGEAVAATAKTVQASNVGIVLASTDSISNQSKLNTASAIA  220

Query  734   TGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAP  913
             +G V G +EDNR+K + K   LKSV+ILGLGTGPE+EKKLKY+E VSS VIF +ELVN+P
Sbjct  221   SGTVLGIYEDNRYKTDSKKQVLKSVDILGLGTGPELEKKLKYAEDVSSAVIFGRELVNSP  280

Query  914   ANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCY  1093
             ANVLTP ALAEEA  IAS  SDV++ATIL  EQCKELKMG++LGVAAA+ N  +FIHLCY
Sbjct  281   ANVLTPAALAEEASKIASASSDVISATILTAEQCKELKMGAYLGVAAASANIPHFIHLCY  340

Query  1094  KPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKP  1273
             KP SG VK KLAL+GKG+TFDSGGYN+K G   SI+LMK DM G+A V GAAKAI QIKP
Sbjct  341   KPPSGPVKAKLALVGKGLTFDSGGYNIKTGPGCSIDLMKFDMGGSAAVLGAAKAIGQIKP  400

Query  1274  AGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVID  1453
              GVEVHFIV ACENMISGTGMRPGDI+TASNGK IE                        
Sbjct  401   PGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIE------------------------  436

Query  1454  PFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                  V +TDAEGRL LADAL+YA   GV K+VDLATLTGAC+ ALG S+AG+
Sbjct  437   -----VNNTDAEGRLTLADALIYACNQGVRKIVDLATLTGACVVALGPSIAGV  484


 Score =   100 bits (248),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV  AA+  GEKLWR+PLEESYWE+MKS +ADM+N G   G AITA+LF
Sbjct  483   GVFTPSDDLAKEVFSAAEASGEKLWRLPLEESYWESMKSGVADMVNTGGRQGGAITAALF  542

Query  1866  MK  1871
             +K
Sbjct  543   LK  544



>ref|XP_010432926.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Camelina 
sativa]
Length=584

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/478 (66%), Positives = 372/478 (78%), Gaps = 30/478 (6%)
 Frame = +2

Query  179   FLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLE  358
             F++F+  S   ++F+V+PL     R MAH+IA+ATLGLTH N ++ PKISF+ KE+D+ E
Sbjct  33    FVRFQLPSRLRLAFTVTPLYSSS-RAMAHTIAQATLGLTHANSVDHPKISFSGKEIDVTE  91

Query  359   WKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRL  538
             WKGDILAVGVTEKDM KD NSKF+N IL+KLD+ LGGLL++ SSEEDFSGK GQS VLRL
Sbjct  92    WKGDILAVGVTEKDMTKDANSKFENPILKKLDAHLGGLLADVSSEEDFSGKPGQSTVLRL  151

Query  539   PALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSA  718
             P LG KR+GL+GLG   SS  A+++LGE +AAAAK++QASSVAV LAS+E +S ESKLS+
Sbjct  152   PGLGSKRVGLIGLGKSASSPSAFQSLGEAVAAAAKASQASSVAVVLASSETVSNESKLSS  211

Query  719   ASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKE  898
             ASA+A+G V G FED R+K E K P+LKSV+I+G GTGPE+EKKLKY+E VS GVIF KE
Sbjct  212   ASAIASGTVLGLFEDCRYKSESKKPSLKSVDIIGFGTGPELEKKLKYAEDVSYGVIFGKE  271

Query  899   LVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYF  1078
             LVN+PANVLTP  LAEEA  +AS+YSDV+TA IL+ EQCKELKMGS+L VAAA+ NP +F
Sbjct  272   LVNSPANVLTPAVLAEEASKLASMYSDVMTANILNEEQCKELKMGSYLAVAAASANPPHF  331

Query  1079  IHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakai  1258
             IHL YKPSSG VKTKLA++GKG+TFDSGGYN+K G    IELMK DM G+A V GAAKAI
Sbjct  332   IHLVYKPSSGPVKTKLAIVGKGLTFDSGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKAI  391

Query  1259  aQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVV  1438
              QIKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IE                   
Sbjct  392   GQIKPPGVEVHFIVAACENMISGTGMRPGDIITASNGKTIE-------------------  432

Query  1439  LGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                       V +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+A +
Sbjct  433   ----------VNNTDAEGRLTLADALVYACNQGVDKVVDLATLTGACIIALGTSMAAI  480


 Score = 85.9 bits (211),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  1689  IFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFM  1868
             I+T S++LAKEV+ A++  GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+LF+
Sbjct  480   IYTSSDELAKEVIAASERSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGSITAALFL  539

Query  1869  K  1871
             K
Sbjct  540   K  540



>ref|XP_002325134.2| leucine aminopeptidase family protein [Populus trichocarpa]
 gb|EEF03699.2| leucine aminopeptidase family protein [Populus trichocarpa]
Length=582

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/501 (64%), Positives = 380/501 (76%), Gaps = 31/501 (6%)
 Frame = +2

Query  116   LATNIAVAAVststststssIFLKFRSTSAWAISFSVSPLCCRRP--RRMAHSIARATLG  289
             LAT++  A V +S S+S+S +F K  ST    I+FSVSP    R   + MAHS+ARATLG
Sbjct  8     LATSLTAAVVPSSFSSSSSFVFTKLWSTPCLRITFSVSPFSYSRGGGKLMAHSLARATLG  67

Query  290   LTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGG  469
             LT P  I+ PKI+ +AKE+D+ EWKGDILAVGVTEKDM KD++ +F+N +L+KLD+KLGG
Sbjct  68    LTQPANIDAPKIAISAKEIDVAEWKGDILAVGVTEKDMTKDDSKRFENSLLKKLDAKLGG  127

Query  470   LLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksa  649
              LSEASSEEDF+GK GQS+VLRLP LG KRIGL+GLG   ++T A+R  GE IAAAAK+A
Sbjct  128   HLSEASSEEDFTGKPGQSLVLRLPGLGSKRIGLIGLGQSATNTYAFRNFGEAIAAAAKTA  187

Query  650   qassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGT  829
             QA +V + LAS    S ESKL+ ASA+A+G V GT+EDNR+K + K P LKSV+ILG GT
Sbjct  188   QACNVGIVLASTGSTSNESKLNTASAIASGTVLGTYEDNRYKSDSKKPVLKSVDILGFGT  247

Query  830   GPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVE  1009
             GPE+EKKLK++E VSS VIF KELVN+PANVLTP  LAEEA  IAS+YSDVL+ATIL+ E
Sbjct  248   GPELEKKLKHAEDVSSAVIFGKELVNSPANVLTPAVLAEEATKIASMYSDVLSATILNAE  307

Query  1010  QCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGAN  1189
             QCKELKMGS+LGVAAA+ NP +FIHLCYKP SG  K KLAL+GKG+TFDSGGYN+K G  
Sbjct  308   QCKELKMGSYLGVAAASANPPHFIHLCYKPPSGPTKAKLALVGKGLTFDSGGYNIKTGPG  367

Query  1190  SSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNG  1369
               IELMK DM G+A V GAAKAI Q+KP GVEVHFIV ACENMISGTGMRPGDI+TASNG
Sbjct  368   CFIELMKFDMGGSAAVLGAAKAIGQVKPPGVEVHFIVAACENMISGTGMRPGDIVTASNG  427

Query  1370  KRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKM  1549
             K IE                             V +TDAEGRL LADALVYA   G EK+
Sbjct  428   KTIE-----------------------------VNNTDAEGRLTLADALVYACNQGAEKI  458

Query  1550  VDLATLTGACITALGRSVAGM  1612
             +DLATLTGAC+ ALG S+AG+
Sbjct  459   IDLATLTGACVVALGPSIAGV  479


 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS++LA EV  AA+  GEKLWRMP+EESYWE+MKS +ADM+N G   G AITA+LF
Sbjct  478   GVFTPSDELANEVFAAAEASGEKLWRMPMEESYWESMKSGVADMVNTGGRQGGAITAALF  537

Query  1866  MK  1871
             +K
Sbjct  538   LK  539



>ref|XP_009358438.1| PREDICTED: leucine aminopeptidase 1-like [Pyrus x bretschneideri]
Length=575

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/476 (66%), Positives = 365/476 (77%), Gaps = 31/476 (7%)
 Frame = +2

Query  185   KFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWK  364
             K RS  +  +SF+VSPLC RR + MAH++A+A LGLT+P+ I+ PK+ FAAKE D+ EWK
Sbjct  28    KLRSAPSLRLSFAVSPLCSRRGKLMAHTLAQANLGLTYPSGIDAPKLLFAAKETDVAEWK  87

Query  365   GDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPA  544
             GD+LAVGVTEKD+ KDENSKFQN +L+KLDS LGGLL+E SSEEDF+GKSGQS V+RLP 
Sbjct  88    GDLLAVGVTEKDLAKDENSKFQNSVLKKLDSHLGGLLAEVSSEEDFTGKSGQSTVVRLPG  147

Query  545   LGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAAS  724
             LG KR+GL GLG   SST A+R LGE  AAAAK+ QAS +A+ LAS+EGLS +S  + AS
Sbjct  148   LGSKRVGLFGLGQSASSTAAFRGLGEAAAAAAKATQASDIAIVLASSEGLSAKS--NTAS  205

Query  725   AMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELV  904
             A+A+G V G +ED+R+K E K   LKSV+ILGLGTG E+EKKLKY+E V+SG+IF KELV
Sbjct  206   AIASGTVLGIYEDSRYKSESKKSALKSVDILGLGTGAEVEKKLKYTEDVTSGIIFGKELV  265

Query  905   NAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIH  1084
             N+PANVLTPG LAEEA  IAS YSDVL+A IL+ EQCKELKMGS+L VAAA+TNP +FIH
Sbjct  266   NSPANVLTPGKLAEEASKIASTYSDVLSANILNEEQCKELKMGSYLAVAAASTNPPHFIH  325

Query  1085  LCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQ  1264
             L YKP  G  K KL L+GKG+TFDSGGYN+K G   SIE MK DM G+  V GAAKAIAQ
Sbjct  326   LIYKPPGGPAKVKLGLVGKGLTFDSGGYNIKTGPGCSIEQMKFDMGGSPAVLGAAKAIAQ  385

Query  1265  IKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLG  1444
             IKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IE                     
Sbjct  386   IKPPGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIE---------------------  424

Query  1445  VIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                     V +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+AG+
Sbjct  425   --------VNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACIVALGPSIAGV  472


 Score = 96.3 bits (238),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV  A+++ GEK WR+P+EESYWE+MKS IADM+N G+  G +ITA+LF
Sbjct  471   GVFTPSDDLAKEVFAASEISGEKFWRLPMEESYWESMKSGIADMLNTGARQGGSITAALF  530

Query  1866  MK  1871
             +K
Sbjct  531   LK  532



>ref|XP_010438109.1| PREDICTED: leucine aminopeptidase 3, chloroplastic [Camelina 
sativa]
Length=583

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/478 (66%), Positives = 371/478 (78%), Gaps = 30/478 (6%)
 Frame = +2

Query  179   FLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLE  358
              ++F+  S   ++F+V+PL     R MAH+IA+ATLGLTH N ++ PKISF+ KE+D+ E
Sbjct  32    LVRFQLPSRLRLAFAVTPLYSSS-RAMAHTIAQATLGLTHANSVDHPKISFSGKEMDVTE  90

Query  359   WKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRL  538
             WKGDILAVGVTEKDM KD NSKF+N IL+KLD+ LGGLL++ SSEEDFSGK GQS VLRL
Sbjct  91    WKGDILAVGVTEKDMTKDANSKFENPILKKLDAHLGGLLADVSSEEDFSGKPGQSTVLRL  150

Query  539   PALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSA  718
             P LG KR+GL+GLG   SS  A+++LGE +AAAAK++QASSVAV LAS+E +S ESKLS+
Sbjct  151   PGLGSKRVGLIGLGKSASSPSAFQSLGEAVAAAAKASQASSVAVVLASSETVSNESKLSS  210

Query  719   ASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKE  898
             ASA+A+G V G FED R+K E K P+LKSV+I+G GTGPE+EKKLKY+E VS GVIF KE
Sbjct  211   ASAIASGTVLGLFEDCRYKSESKKPSLKSVDIIGFGTGPELEKKLKYAEDVSYGVIFGKE  270

Query  899   LVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYF  1078
             LVN+PANVLTP  LAEEA  +AS+YSDV+TA IL+ EQCKELKMGS+L VAAA+ NP +F
Sbjct  271   LVNSPANVLTPAVLAEEASKLASMYSDVMTANILNEEQCKELKMGSYLAVAAASANPPHF  330

Query  1079  IHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakai  1258
             IHL YKPSSG VKTKLA++GKG+TFDSGGYN+K G    IELMK DM G+A V GAAKAI
Sbjct  331   IHLVYKPSSGPVKTKLAIVGKGLTFDSGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKAI  390

Query  1259  aQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVV  1438
              QIKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IE                   
Sbjct  391   GQIKPPGVEVHFIVAACENMISGTGMRPGDIITASNGKTIE-------------------  431

Query  1439  LGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                       V +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+A +
Sbjct  432   ----------VNNTDAEGRLTLADALVYACNQGVDKVVDLATLTGACIIALGTSMAAI  479


 Score = 85.9 bits (211),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  1689  IFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFM  1868
             I+T S++LAKEV+ A++  GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+LF+
Sbjct  479   IYTSSDELAKEVIAASERSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGSITAALFL  538

Query  1869  K  1871
             K
Sbjct  539   K  539



>ref|NP_194821.1| leucine aminopeptidase 2 [Arabidopsis thaliana]
 sp|Q944P7.2|AMPL3_ARATH RecName: Full=Leucine aminopeptidase 3, chloroplastic; AltName: 
Full=Leucyl aminopeptidase 3; Short=LAP 3; AltName: Full=Proline 
aminopeptidase 3; AltName: Full=Prolyl aminopeptidase 
3; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE85830.1| leucine aminopeptidase 2 [Arabidopsis thaliana]
Length=583

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/478 (65%), Positives = 372/478 (78%), Gaps = 30/478 (6%)
 Frame = +2

Query  179   FLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLE  358
             F++F+  S   ++F+V+PL     R MAH+I+ ATLGLT  N ++ PKISF+ KE+D+ E
Sbjct  32    FVRFQFPSRLRLAFAVTPLYSSS-RAMAHTISHATLGLTQANSVDHPKISFSGKEIDVTE  90

Query  359   WKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRL  538
             WKGDILAVGVTEKDM KD NSKF+N IL+KLD+ LGGLL++ SSEEDFSGK GQS VLRL
Sbjct  91    WKGDILAVGVTEKDMAKDVNSKFENPILKKLDAHLGGLLADVSSEEDFSGKPGQSTVLRL  150

Query  539   PALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSA  718
             P LG KR+GL+GLG   S+  A+++LGE +AAAAK++QASSVAV LAS+E +S ESKL +
Sbjct  151   PGLGSKRVGLIGLGKSASTPSAFQSLGEAVAAAAKASQASSVAVVLASSESVSNESKLCS  210

Query  719   ASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKE  898
             ASA+A+G V G FED+R+K E K P+LKSV+I+G G+GPE+EKKLKY+E VS GVIF KE
Sbjct  211   ASAIASGTVLGLFEDSRYKSESKKPSLKSVDIIGFGSGPELEKKLKYAEHVSYGVIFGKE  270

Query  899   LVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYF  1078
             LVN+PANVLTP  LAEEA N+AS+YSDV+TA IL+ EQCKELKMGS+L VAAA+ NP +F
Sbjct  271   LVNSPANVLTPAVLAEEALNLASMYSDVMTANILNEEQCKELKMGSYLAVAAASANPPHF  330

Query  1079  IHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakai  1258
             IHL YKPSSG VKTKLAL+GKG+TFDSGGYN+K G    IELMK DM G+A V GAAKAI
Sbjct  331   IHLIYKPSSGPVKTKLALVGKGLTFDSGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKAI  390

Query  1259  aQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVV  1438
              QIKP GVEVHFIV ACENMISGTGMRPGD+LTASNGK IE                   
Sbjct  391   GQIKPPGVEVHFIVAACENMISGTGMRPGDVLTASNGKTIE-------------------  431

Query  1439  LGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                       V +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+AG+
Sbjct  432   ----------VNNTDAEGRLTLADALVYACNQGVDKVVDLATLTGACIIALGTSMAGI  479


 Score = 91.3 bits (225),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI+TPS+ LAKEV+ A++  GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+LF
Sbjct  478   GIYTPSDKLAKEVIAASERSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGSITAALF  537

Query  1866  MK  1871
             +K
Sbjct  538   LK  539



>ref|XP_006600543.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Glycine 
max]
Length=570

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/489 (64%), Positives = 369/489 (75%), Gaps = 41/489 (8%)
 Frame = +2

Query  176   IFLKFRSTSAWA--------ISFSVSPLCCRRPRR--MAHSIARATLGLTHPNQIERPKI  325
             IF+ F +TS+          + F+  PL  R P R  M+H++ARATLGLTHP+ IE PKI
Sbjct  7     IFVSFTTTSSSPFLTRLTSRLHFAAFPL--RSPTRKLMSHTLARATLGLTHPSNIETPKI  64

Query  326   SFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFS  505
             SF +K+VD+ EWKGDILAVGVTEKD+ +D NSKF+N+IL+K+DSKLGGLL+EASSEEDFS
Sbjct  65    SFGSKDVDVTEWKGDILAVGVTEKDLARDANSKFENVILRKIDSKLGGLLAEASSEEDFS  124

Query  506   GKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasa  685
             GK GQS VLR+  LG KR+GL+GLG   S+   ++ LGE +  AAKS+QASSVAV LAS+
Sbjct  125   GKVGQSTVLRITGLGSKRVGLIGLGQSPSTPSPFKGLGEAVVEAAKSSQASSVAVVLASS  184

Query  686   EGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSE  865
             EGLS +SKLS A A+A+G V G FEDNR+K E K  TL+S++I+GLG GPE+EKKLKY+ 
Sbjct  185   EGLSAQSKLSTAYAIASGAVLGLFEDNRYKSEAKKSTLRSIDIIGLGMGPELEKKLKYAG  244

Query  866   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLG  1045
              VSSG+IF +ELVN+PANVLTPG LAEEA  IAS YSDV TA IL+ EQC ELKMGS+LG
Sbjct  245   DVSSGIIFGRELVNSPANVLTPGVLAEEAAKIASTYSDVFTAKILNAEQCAELKMGSYLG  304

Query  1046  VAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMag  1225
             VAAA+ NP +FIHLCYKP SG V  KLAL+GKG+TFDSGGYN+K G   SIELMK DM G
Sbjct  305   VAAASENPPHFIHLCYKPLSGPVNVKLALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGG  364

Query  1226  aavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVL  1405
             +A V G AKA+ QIKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IE        
Sbjct  365   SAAVLGTAKALGQIKPLGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIE--------  416

Query  1406  RCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACIT  1585
                                  V +TDAEGRL LADALVYA   GVEK++DLATLTGAC+ 
Sbjct  417   ---------------------VNNTDAEGRLTLADALVYACNQGVEKIIDLATLTGACVV  455

Query  1586  ALGRSVAGM  1612
             ALG S+AG+
Sbjct  456   ALGPSIAGV  464


 Score =   102 bits (255),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV EA+DV GEKLWR+PLEESYWETMKS +ADM+N G   G AI A+LF
Sbjct  463   GVFTPSDDLAKEVFEASDVSGEKLWRLPLEESYWETMKSGVADMLNTGGRQGGAIVAALF  522

Query  1866  MK  1871
             +K
Sbjct  523   LK  524



>ref|XP_002867322.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43581.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=582

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/478 (65%), Positives = 372/478 (78%), Gaps = 30/478 (6%)
 Frame = +2

Query  179   FLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLE  358
             F++F+S S   ++F+V+PL C   + M+H+IA ATLGLT  N ++ PKISF+ KE+D+ E
Sbjct  32    FVRFQSPSRLKVAFAVTPLYCSS-KAMSHTIAHATLGLTQANSVDHPKISFSGKEIDVTE  90

Query  359   WKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRL  538
             WKGDILAVGV EKDM KD NSKF+N IL+KLD+ LGGLL++ SSEEDFSGK GQ  VLRL
Sbjct  91    WKGDILAVGVMEKDMTKDANSKFENPILKKLDAHLGGLLADVSSEEDFSGKPGQYTVLRL  150

Query  539   PALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSA  718
               LG KR+GL+GLG   SS  A+++LGE +AAAAK++QASSVAV LAS+E +S ESKLS+
Sbjct  151   RGLGSKRVGLIGLGKSASSPSAFQSLGEAVAAAAKASQASSVAVVLASSESVSNESKLSS  210

Query  719   ASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKE  898
             ASA+A+G V G FED+R+K E K P+LKSV+I+G GTGPE+E+KLKY+E VS GVIF KE
Sbjct  211   ASAIASGTVLGLFEDSRYKSESKKPSLKSVDIIGFGTGPELEEKLKYAEHVSYGVIFGKE  270

Query  899   LVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYF  1078
             LVN+PANVLTP  LAEEA N+AS+YSDV+TA IL+ EQCKELKMGS+L VAAA+ NP +F
Sbjct  271   LVNSPANVLTPAVLAEEASNLASMYSDVMTANILNEEQCKELKMGSYLAVAAASANPPHF  330

Query  1079  IHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakai  1258
             IHL YKPSSG VKTKLAL+GKG+TFDSGGYN+KIG +  IELMK D+ G+A V G AKAI
Sbjct  331   IHLIYKPSSGPVKTKLALVGKGLTFDSGGYNIKIGPDMIIELMKIDVGGSAAVLGVAKAI  390

Query  1259  aQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVV  1438
              QIKP GVEVHFIV ACENMISGTGMRPGD++TASNGK IE                   
Sbjct  391   GQIKPPGVEVHFIVAACENMISGTGMRPGDVITASNGKTIE-------------------  431

Query  1439  LGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                       V +TDAEGRL LADALVYA   GV+K+VDLATLTGA I ALG S+AGM
Sbjct  432   ----------VNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGAIIVALGPSMAGM  479


 Score = 87.8 bits (216),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G++T S++LAKEV  A++  GEKLWRMP+EE YWE MKSS+ADM+N G   GD+ITA+LF
Sbjct  478   GMYTASDELAKEVTAASERSGEKLWRMPMEERYWEMMKSSVADMVNLGGHAGDSITAALF  537

Query  1866  MK  1871
             +K
Sbjct  538   LK  539



>gb|KHG14578.1| hypothetical protein F383_10344 [Gossypium arboreum]
Length=521

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/452 (67%), Positives = 358/452 (79%), Gaps = 34/452 (8%)
 Frame = +2

Query  257   MAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNL  436
             MAHS     LGLT P  I+ PKISFAAKE+D+ EWKGDILAVGVTEKDM KDENSKFQN 
Sbjct  1     MAHS-----LGLTQPANIQHPKISFAAKEIDVAEWKGDILAVGVTEKDMSKDENSKFQNS  55

Query  437   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTL  616
             IL+KLD  LGG+L+EASSEEDF+GK+G+S+VLRLP+ G KR+GL+GLG   S   +++ L
Sbjct  56    ILKKLDGLLGGMLAEASSEEDFTGKAGKSMVLRLPSCGSKRVGLIGLGKTASYPASFQRL  115

Query  617   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  796
             GE +AAA+K+AQA+SVA+ LAS+E LS ESKLS ASA+A+G V G +ED+R+K EP+ P 
Sbjct  116   GEAVAAASKTAQANSVAIILASSEDLSNESKLSTASAIASGTVLGIYEDSRYKSEPRKPK  175

Query  797   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  976
             L SV+I+GLGTGPE+EKKLKY+E VSS +IF +ELVN+PANVLTP ALA EA NIASLYS
Sbjct  176   LNSVDIIGLGTGPELEKKLKYAENVSSAIIFGRELVNSPANVLTPAALAAEASNIASLYS  235

Query  977   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1156
             DVL+A IL  EQCKELKMGS+LGVAAA+ NP +FIHLCYKPSSG +KTKLAL+GKG+TFD
Sbjct  236   DVLSANILSAEQCKELKMGSYLGVAAASANPPHFIHLCYKPSSGPIKTKLALVGKGLTFD  295

Query  1157  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1336
             SGGYN+K GA  SI++MK DM G+A V GAAKA+ QIKP GVEVHFIV +CENMISGTGM
Sbjct  296   SGGYNIKTGAGCSIDIMKTDMGGSAAVLGAAKALGQIKPPGVEVHFIVASCENMISGTGM  355

Query  1337  RPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADAL  1516
             RPGDI+TASNGK IE                             V +TDAEGRL LADAL
Sbjct  356   RPGDIITASNGKTIE-----------------------------VNNTDAEGRLTLADAL  386

Query  1517  VYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             VYA   GV+K+VDLATLTGACI ALG S+AG+
Sbjct  387   VYACNQGVDKIVDLATLTGACIVALGPSIAGV  418


 Score =   101 bits (252),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV EA++V GEK WRMPLEESYWE+MKS +ADM+N G   G AITA+LF
Sbjct  417   GVFTPSDDLAKEVFEASEVSGEKFWRMPLEESYWESMKSGVADMVNTGGRQGGAITAALF  476

Query  1866  MK  1871
             +K
Sbjct  477   LK  478



>ref|XP_003518220.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Glycine 
max]
Length=570

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/469 (66%), Positives = 363/469 (77%), Gaps = 33/469 (7%)
 Frame = +2

Query  212   ISFSVSPLCCRRPRR--MAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVG  385
             + F+  PL  R P R  M+H++ARATLGLTHP+ IE PKISF AK+VD+ EWKGDILAVG
Sbjct  27    LHFAAFPL--RSPTRKLMSHTLARATLGLTHPSNIETPKISFGAKDVDVTEWKGDILAVG  84

Query  386   VTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIG  565
             VTEKD+ +D NSKF+N+IL K+DSKLGGLL+EASSEEDFSGK GQS VLR+  LG KR+G
Sbjct  85    VTEKDLARDANSKFENVILSKIDSKLGGLLAEASSEEDFSGKVGQSTVLRITGLGSKRVG  144

Query  566   LVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIV  745
             L+GLG   S+   +++LGE I AAAKS+QASSVAVALAS+EGLS +SKLS A A+A+G V
Sbjct  145   LIGLGQSPSTPAPFKSLGEAIVAAAKSSQASSVAVALASSEGLSAQSKLSTAYAIASGAV  204

Query  746   SGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVL  925
              G FEDNR+K E K  TL+S++ +GLGTGPE+EKKLKY+  VSSG+IF +ELVN+PANVL
Sbjct  205   LGLFEDNRYKSEAKKSTLRSIDFIGLGTGPELEKKLKYAGDVSSGIIFGRELVNSPANVL  264

Query  926   TPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSS  1105
             TPG LAEEA  IAS YSDV TA IL+ EQC ELKMGS+LGVAAA+ NP +FIHLCYKP S
Sbjct  265   TPGVLAEEAAKIASTYSDVFTAKILNSEQCAELKMGSYLGVAAASANPPHFIHLCYKPLS  324

Query  1106  GSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVE  1285
             G V  KLAL+GKG+TFDSGGYN+K G   SIELMK DM G+A V G AKA+ QIKP GVE
Sbjct  325   GPVNVKLALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGTAKALGQIKPLGVE  384

Query  1286  VHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF*  1465
             VHFIV ACENMISGTGMRPGDI+TASNGK IE                            
Sbjct  385   VHFIVAACENMISGTGMRPGDIVTASNGKTIE----------------------------  416

Query  1466  *VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
              V +TDAEGRL LADALVYA   GVEK++DLATLTGAC+ ALG S+AG+
Sbjct  417   -VNNTDAEGRLTLADALVYACNQGVEKIIDLATLTGACVVALGPSIAGV  464


 Score =   101 bits (251),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP +DLAKEV EA+DV GEKLWR+PLEESYWETMKS +ADM+N G   G AI A+LF
Sbjct  463   GVFTPCDDLAKEVFEASDVSGEKLWRLPLEESYWETMKSGVADMLNTGGRQGGAIVAALF  522

Query  1866  MK  1871
             +K
Sbjct  523   LK  524



>ref|XP_004507738.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Cicer 
arietinum]
Length=570

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/454 (67%), Positives = 354/454 (78%), Gaps = 29/454 (6%)
 Frame = +2

Query  251   RRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQ  430
             + M+H+ ARATLGLTHP  +E PKISF+A +VD+ EWKGDILAVGVTEKD+ +D  S+F+
Sbjct  43    KLMSHTPARATLGLTHPTNVETPKISFSATDVDVTEWKGDILAVGVTEKDLTRDAKSRFE  102

Query  431   NLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYR  610
             NLIL K+DSKLGGLL+EASSEEDFSGK GQS +LR+  LG KR+GL+GLG   S+T  ++
Sbjct  103   NLILNKIDSKLGGLLAEASSEEDFSGKVGQSTILRIAGLGSKRVGLIGLGQSPSTTALFK  162

Query  611   TLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKT  790
              LGE + AAAKSAQAS+VA+ LAS+EGLS +SKLS A A+A+G V G FED RFK E K 
Sbjct  163   GLGEAVVAAAKSAQASNVAIVLASSEGLSSQSKLSTAYAIASGAVLGLFEDQRFKSESKK  222

Query  791   PTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASL  970
             P L+S++I+GLGTGPE+EKKLKY+  VSSG+IF +ELVN+PANVLTPG LAEEA  +AS 
Sbjct  223   PALRSIDIIGLGTGPELEKKLKYAGDVSSGIIFGRELVNSPANVLTPGVLAEEASKVAST  282

Query  971   YSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGIT  1150
             YSDV TA ILD EQCKELKMGS+LGVAAA+ NP +FIHLCYKP SG V  KLAL+GKG+T
Sbjct  283   YSDVFTAKILDAEQCKELKMGSYLGVAAASANPPHFIHLCYKPPSGPVNVKLALVGKGLT  342

Query  1151  FDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGT  1330
             FDSGGYN+K G   SIELMK DM G+A V GAAKA+ QIKP GVEVHFIV ACENMISGT
Sbjct  343   FDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKALGQIKPLGVEVHFIVAACENMISGT  402

Query  1331  GMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILAD  1510
             GMRPGD++TASNGK IE                             V +TDAEGRL LAD
Sbjct  403   GMRPGDVVTASNGKTIE-----------------------------VNNTDAEGRLTLAD  433

Query  1511  ALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             ALVYA   GVEK+VDLATLTGAC+ ALG S+AG+
Sbjct  434   ALVYACNQGVEKIVDLATLTGACVVALGPSIAGV  467


 Score = 96.3 bits (238),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+F+P+++L KEVLEA++V GEKLWR+PLEESYWE+MKS +ADM+N G   G +ITA+LF
Sbjct  466   GVFSPNDELVKEVLEASEVSGEKLWRLPLEESYWESMKSGVADMVNTGGRQGGSITAALF  525

Query  1866  MK  1871
             +K
Sbjct  526   LK  527



>ref|XP_009366178.1| PREDICTED: leucine aminopeptidase 1-like [Pyrus x bretschneideri]
Length=575

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/476 (65%), Positives = 366/476 (77%), Gaps = 31/476 (7%)
 Frame = +2

Query  185   KFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWK  364
             K RS  +  +SF+V+ LC  R + MAH++ARA LGLTHP+ I+ PKISFAAKE+D  EWK
Sbjct  28    KLRSARSLRLSFAVTQLCSCRGKLMAHTLARANLGLTHPSGIDAPKISFAAKELDAAEWK  87

Query  365   GDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPA  544
             GD+LAVGVTEKD+ KDENSKFQN +L+KLDS LGGLL+EASSEEDF+GKSGQS V+RL  
Sbjct  88    GDLLAVGVTEKDLAKDENSKFQNSVLKKLDSHLGGLLAEASSEEDFTGKSGQSTVVRLLG  147

Query  545   LGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAAS  724
             LG KR+GL GLG   SST A++ LG+  AAAAK+ QA  +A+ LAS+EG+S +S  + AS
Sbjct  148   LGLKRVGLFGLGQSASSTEAFQGLGKAAAAAAKAGQAGDIAIVLASSEGISAKS--NTAS  205

Query  725   AMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELV  904
             A+A+G V G +EDNR+K E K   LKSV+ILGLGTGPE+EKKLKY+E V+SG+IF KELV
Sbjct  206   AIASGTVLGIYEDNRYKSESKKSVLKSVDILGLGTGPEVEKKLKYAEDVTSGIIFGKELV  265

Query  905   NAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIH  1084
             N+PANVLTPG LAEEA  IAS YSDVL+A IL+ EQCKELKMGS+L VAAA+ NP +FIH
Sbjct  266   NSPANVLTPGKLAEEASKIASTYSDVLSANILNEEQCKELKMGSYLAVAAASANPPHFIH  325

Query  1085  LCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQ  1264
             L YKP  G  K KL L+GKG+TFDSGGYN+K G   S+ELMK DM G+A + GAAKAIAQ
Sbjct  326   LIYKPPGGPAKVKLGLVGKGLTFDSGGYNIKTGPGCSVELMKFDMGGSAAILGAAKAIAQ  385

Query  1265  IKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLG  1444
             IKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IE                     
Sbjct  386   IKPPGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIE---------------------  424

Query  1445  VIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                     V +TDAEGRL LADALVYAS  GV+K+VDLATLTGAC+ ALG S+AG+
Sbjct  425   --------VNNTDAEGRLTLADALVYASNQGVDKIVDLATLTGACVVALGPSIAGV  472


 Score = 95.5 bits (236),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV  A+++ GEK WR+PLEESYWETMKS IADM+N G   G +I A+LF
Sbjct  471   GVFTPSDDLAKEVFAASEISGEKFWRLPLEESYWETMKSGIADMLNTGGRAGGSINAALF  530

Query  1866  MK  1871
             +K
Sbjct  531   LK  532



>ref|XP_006412653.1| hypothetical protein EUTSA_v10024754mg [Eutrema salsugineum]
 gb|ESQ54106.1| hypothetical protein EUTSA_v10024754mg [Eutrema salsugineum]
Length=587

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/478 (65%), Positives = 367/478 (77%), Gaps = 30/478 (6%)
 Frame = +2

Query  182   LKFRSTSAWAISFSVSPLCCRR-PRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLE  358
             ++FR      ++ +V+PL C    R MAH++A ATLGLT  N  + PKISFAAKE+D+ E
Sbjct  34    VRFRLPPRLRLALAVTPLYCSSGARAMAHTLAHATLGLTQANSTDHPKISFAAKEMDVTE  93

Query  359   WKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRL  538
             WKGDILAVGVTEKDM KD NS F+N IL+KLD+ LGGLL++ SSEEDFSGK GQS VLRL
Sbjct  94    WKGDILAVGVTEKDMAKDANSMFENPILKKLDAHLGGLLADVSSEEDFSGKPGQSTVLRL  153

Query  539   PALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSA  718
             P LG KR+GL+GLG   SS  A+++LGE +AAAAK++QASSVAV LAS+E +S ESKLS+
Sbjct  154   PGLGSKRVGLIGLGKSASSPSAFQSLGEAVAAAAKASQASSVAVVLASSESVSNESKLSS  213

Query  719   ASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKE  898
             ASA+A+G V G FED+R+K E K P L SV+I+G GTGPE+EKKLKY+E VS GVIF +E
Sbjct  214   ASAIASGTVLGLFEDSRYKSESKKPCLNSVDIIGFGTGPELEKKLKYAEDVSYGVIFGRE  273

Query  899   LVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYF  1078
             LVN+PANVLTP  LAEEA  +AS+YSDV+TA IL+ EQCKELKMGS+L VAAA+ NP +F
Sbjct  274   LVNSPANVLTPAVLAEEASKLASMYSDVMTANILNEEQCKELKMGSYLAVAAASANPPHF  333

Query  1079  IHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakai  1258
             IHL YKPSSG VKTKLAL+GKG+TFDSGGYN+K G    IELMK DM G+A V GAAKAI
Sbjct  334   IHLVYKPSSGPVKTKLALVGKGLTFDSGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKAI  393

Query  1259  aQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVV  1438
              QIKP GVEVHFIV ACENMISGTGMRPGD++TASNGK IE                   
Sbjct  394   GQIKPPGVEVHFIVAACENMISGTGMRPGDVITASNGKTIE-------------------  434

Query  1439  LGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                       V +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+AG+
Sbjct  435   ----------VNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACIVALGSSMAGI  482


 Score = 92.0 bits (227),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI+TP+++LAKEV+ A++  GEKLWRMPLEESYWE MKS +ADM+N G   G +ITA+LF
Sbjct  481   GIYTPNDNLAKEVIAASERSGEKLWRMPLEESYWEMMKSGVADMVNTGGRAGGSITAALF  540

Query  1866  MK  1871
             +K
Sbjct  541   LK  542



>ref|XP_007154883.1| hypothetical protein PHAVU_003G156100g [Phaseolus vulgaris]
 gb|ESW26877.1| hypothetical protein PHAVU_003G156100g [Phaseolus vulgaris]
Length=570

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/469 (65%), Positives = 361/469 (77%), Gaps = 33/469 (7%)
 Frame = +2

Query  212   ISFSVSPLCCRRPRR--MAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVG  385
             + F+  PL  R P R  M+ ++ RATLGLTHP+ IE PKI FAAK+VD+ EWKGDILAVG
Sbjct  27    LHFAAFPL--RSPTRKLMSQTLTRATLGLTHPSNIETPKICFAAKDVDVTEWKGDILAVG  84

Query  386   VTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIG  565
             VTEKD+ KD NS+F+N+IL K+DSKLGGLL+EASSEEDFSGK GQS VLR+  LG KR+ 
Sbjct  85    VTEKDLAKDANSRFENVILSKIDSKLGGLLAEASSEEDFSGKVGQSTVLRITGLGSKRVS  144

Query  566   LVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIV  745
             L+GLG + S+   ++ LGE + AAAKS+QASSVAV LAS+EGLS  SKLS A A+A+G V
Sbjct  145   LIGLGQLSSTPAPFKGLGEAVVAAAKSSQASSVAVVLASSEGLSAPSKLSTAYAIASGAV  204

Query  746   SGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVL  925
              G FEDNR+K E K P L+S++I+GLGTGPE+EKKLKY+  VSSG+IF +ELVN+PANVL
Sbjct  205   LGLFEDNRYKSEAKKPALQSIDIIGLGTGPELEKKLKYAGDVSSGIIFGRELVNSPANVL  264

Query  926   TPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSS  1105
             TPG LAEEA NIAS YSDV TA IL+ EQC+ELKMGS+LGVAAA+ NP +FIHLCYKP S
Sbjct  265   TPGVLAEEAANIASTYSDVFTAKILNAEQCEELKMGSYLGVAAASANPPHFIHLCYKPLS  324

Query  1106  GSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVE  1285
             G V  KLAL+GKG+TFDSGGYN+K G   SIELMK DM G+A V G AKA+ QIKP GVE
Sbjct  325   GPVNAKLALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGTAKALGQIKPPGVE  384

Query  1286  VHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF*  1465
             VHFIV ACENMISGTGMRPGD++TASNGK IE                            
Sbjct  385   VHFIVAACENMISGTGMRPGDVVTASNGKTIE----------------------------  416

Query  1466  *VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
              V +TDAEGRL LADALVYA   GVEK++DLATLTGAC+ ALG S+AG+
Sbjct  417   -VNNTDAEGRLTLADALVYACNQGVEKIIDLATLTGACVVALGPSIAGV  464


 Score =   101 bits (252),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV EA+DV GEKLWR+PLEESYWE+MKS +ADM+N G   G AI A+LF
Sbjct  463   GVFTPSDDLAKEVFEASDVSGEKLWRLPLEESYWESMKSGVADMVNTGGRQGGAIIAALF  522

Query  1866  MK  1871
             +K
Sbjct  523   LK  524



>ref|XP_011033404.1| PREDICTED: leucine aminopeptidase 1 [Populus euphratica]
Length=582

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/502 (64%), Positives = 371/502 (74%), Gaps = 33/502 (7%)
 Frame = +2

Query  116   LATNIAVAAVststststssIFLKFRSTSAWAISFSVSPLCCRRPRR---MAHSIARATL  286
             LAT++    V +S S+S S    K +S      +FSVSP    R R    MAHS ARATL
Sbjct  8     LATSLTAVVVRSSFSSSPSLFLTKLKSAPCLRFTFSVSPFDSYRRRGVKLMAHS-ARATL  66

Query  287   GLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLG  466
             GLT P  I+ PKI+F+AKE+D+ EWKGDILAVGVTEKDM  D++ KF N +L+KLD+KLG
Sbjct  67    GLTQPANIDVPKIAFSAKEIDVAEWKGDILAVGVTEKDMAMDDSKKFDNSLLKKLDAKLG  126

Query  467   GLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaks  646
             G LSEASSEEDF+GK GQS+VLRLP LG KRIGL+GLG   ++T  +R  GE IAAAAK+
Sbjct  127   GQLSEASSEEDFTGKPGQSLVLRLPGLGSKRIGLIGLGQSATNTYNFRNFGEAIAAAAKT  186

Query  647   aqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLG  826
             AQAS V +  AS   +S ESKL+ ASA+ +G V GT+EDNR+K + K P LKSV+ILGLG
Sbjct  187   AQASDVGIVFASTGSISNESKLNTASAIVSGTVLGTYEDNRYKSDSKKPVLKSVDILGLG  246

Query  827   TGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDV  1006
             TGPE+ KKLKY+E VSS VIF KELVN+PANVLTP  LAEEA  IAS YSDVL+ATIL  
Sbjct  247   TGPELAKKLKYAEDVSSAVIFGKELVNSPANVLTPAVLAEEASKIASTYSDVLSATILSA  306

Query  1007  EQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGA  1186
             EQC ELKMGS+LGVAAA+ NP +FIHLCYKPSSG VK KLAL+GKG+TFDSGGYN+K G 
Sbjct  307   EQCIELKMGSYLGVAAASENPPHFIHLCYKPSSGPVKAKLALVGKGLTFDSGGYNIKTGP  366

Query  1187  NSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASN  1366
               SIE MK DM G+A V GAAKAI Q+KP GVEVHFIV ACENMISGTGMRPGDI+TASN
Sbjct  367   GCSIEFMKFDMGGSAAVLGAAKAIGQVKPRGVEVHFIVAACENMISGTGMRPGDIVTASN  426

Query  1367  GKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEK  1546
             GK IE                             V +TDAEGRL LADALVYA   GVEK
Sbjct  427   GKTIE-----------------------------VNNTDAEGRLTLADALVYACNQGVEK  457

Query  1547  MVDLATLTGACITALGRSVAGM  1612
             ++DLATLTGAC+ ALG S+AG+
Sbjct  458   IIDLATLTGACVVALGPSIAGV  479


 Score = 97.4 bits (241),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS++LA EV  AA+  GEKLWRMPLEESYWE+MKS +ADM+N G+  G AITA+LF
Sbjct  478   GVFTPSDELANEVFTAAEASGEKLWRMPLEESYWESMKSGVADMVNTGARQGGAITAALF  537

Query  1866  MK  1871
             +K
Sbjct  538   LK  539



>gb|AAL11627.1|AF424634_1 AT4g30920/F6I18_170 [Arabidopsis thaliana]
 gb|AAO11568.1| At4g30920/F6I18_170 [Arabidopsis thaliana]
Length=583

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/478 (65%), Positives = 371/478 (78%), Gaps = 30/478 (6%)
 Frame = +2

Query  179   FLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLE  358
             F++F+  S   ++F+V+PL     R MAH+I+ ATLGLT  N ++ PKISF+ KE+D+ E
Sbjct  32    FVRFQFPSRLRLAFAVTPLYSSS-RAMAHTISHATLGLTQANSVDHPKISFSGKEIDVTE  90

Query  359   WKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRL  538
              KGDILAVGVTEKDM KD NSKF+N IL+KLD+ LGGLL++ SSEEDFSGK GQS VLRL
Sbjct  91    GKGDILAVGVTEKDMAKDVNSKFENPILKKLDAHLGGLLADVSSEEDFSGKPGQSTVLRL  150

Query  539   PALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSA  718
             P LG KR+GL+GLG   S+  A+++LGE +AAAAK++QASSVAV LAS+E +S ESKL +
Sbjct  151   PGLGSKRVGLIGLGKSASTPSAFQSLGEAVAAAAKASQASSVAVVLASSESVSNESKLCS  210

Query  719   ASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKE  898
             ASA+A+G V G FED+R+K E K P+LKSV+I+G G+GPE+EKKLKY+E VS GVIF KE
Sbjct  211   ASAIASGTVLGLFEDSRYKSESKKPSLKSVDIIGFGSGPELEKKLKYAEHVSYGVIFGKE  270

Query  899   LVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYF  1078
             LVN+PANVLTP  LAEEA N+AS+YSDV+TA IL+ EQCKELKMGS+L VAAA+ NP +F
Sbjct  271   LVNSPANVLTPAVLAEEALNLASMYSDVMTANILNEEQCKELKMGSYLAVAAASANPPHF  330

Query  1079  IHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakai  1258
             IHL YKPSSG VKTKLAL+GKG+TFDSGGYN+K G    IELMK DM G+A V GAAKAI
Sbjct  331   IHLIYKPSSGPVKTKLALVGKGLTFDSGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKAI  390

Query  1259  aQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVV  1438
              QIKP GVEVHFIV ACENMISGTGMRPGD+LTASNGK IE                   
Sbjct  391   GQIKPPGVEVHFIVAACENMISGTGMRPGDVLTASNGKTIE-------------------  431

Query  1439  LGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                       V +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+AG+
Sbjct  432   ----------VNNTDAEGRLTLADALVYACNQGVDKVVDLATLTGACIIALGTSMAGI  479


 Score = 91.3 bits (225),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI+TPS+ LAKEV+ A++  GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+LF
Sbjct  478   GIYTPSDKLAKEVIAASERSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGSITAALF  537

Query  1866  MK  1871
             +K
Sbjct  538   LK  539



>ref|XP_008384407.1| PREDICTED: leucine aminopeptidase 1-like [Malus domestica]
Length=575

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/476 (64%), Positives = 362/476 (76%), Gaps = 31/476 (7%)
 Frame = +2

Query  185   KFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWK  364
             K RS  +  +SF+V+ LC RR + MAH++A+A LGLT P+ I+ PKISFAAKE+D  EWK
Sbjct  28    KLRSAHSLRLSFAVTHLCSRRGKLMAHTLAQANLGLTXPSCIDAPKISFAAKELDAAEWK  87

Query  365   GDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPA  544
             GD+LAVGVT KD+ KDENSKFQN +L+KLDS LGGLL+EASSEEDF+GKSGQS V+RLP 
Sbjct  88    GDLLAVGVTVKDLAKDENSKFQNSVLKKLDSHLGGLLAEASSEEDFTGKSGQSTVVRLPG  147

Query  545   LGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAAS  724
             LG KR+GL GLG    ST A++ LGE  AAAAK+ QA  +A+ LAS+EG+S +S  + AS
Sbjct  148   LGSKRVGLFGLGQSAXSTEAFQGLGEAXAAAAKAVQAGDIAIVLASSEGISAKS--NTAS  205

Query  725   AMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELV  904
             A+A+G V G +EDNR+K E K   LKSV ILGLGTGPE+EKKL Y+E V+SG+IF KELV
Sbjct  206   AIASGTVLGIYEDNRYKSESKKSVLKSVXILGLGTGPEVEKKLXYAEDVTSGIIFGKELV  265

Query  905   NAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIH  1084
             N+PANVLTPG LAEEA  IAS YSDVL+A +L+ EQCKELKMGS+L VAAA+ NP +FIH
Sbjct  266   NSPANVLTPGKLAEEASKIASTYSDVLSANVLNEEQCKELKMGSYLAVAAASANPPHFIH  325

Query  1085  LCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQ  1264
             L YKP  G  K KL L+GKG+TFDSGGYN+K G   S+ELMK DM G+A + GAAKAIAQ
Sbjct  326   LIYKPPGGPAKVKLGLVGKGLTFDSGGYNIKTGPGCSVELMKFDMGGSAAILGAAKAIAQ  385

Query  1265  IKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLG  1444
             IKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IE                     
Sbjct  386   IKPPGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIE---------------------  424

Query  1445  VIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                     V +TDAEGRL LADALVYA   GV+K+VDLATLTGAC+ ALG S+AG+
Sbjct  425   --------VNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACVVALGPSIAGV  472


 Score = 95.5 bits (236),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV  A+++ GEK WR+PLEESYWETMKS IADM+N G   G +I A+LF
Sbjct  471   GVFTPSDDLAKEVFAASEISGEKFWRLPLEESYWETMKSGIADMLNTGGRAGGSINAALF  530

Query  1866  MK  1871
             +K
Sbjct  531   LK  532



>ref|XP_010526298.1| PREDICTED: leucine aminopeptidase 1-like [Tarenaya hassleriana]
Length=594

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/468 (68%), Positives = 370/468 (79%), Gaps = 30/468 (6%)
 Frame = +2

Query  212   ISFSVSPL-CCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGV  388
             ++FSV+PL    R R MAH++ARATLGLT P+ I+  KISF+AK+VD+ EWKGDILAVGV
Sbjct  52    LAFSVTPLYSATRVRAMAHTLARATLGLTQPHPIDLTKISFSAKDVDVTEWKGDILAVGV  111

Query  389   TEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGL  568
             TEKDM KDENSKF+N IL+KLD+ LGGLL+E SSEEDF+GK GQS VLRLP LG KR+GL
Sbjct  112   TEKDMKKDENSKFENPILEKLDAHLGGLLAEVSSEEDFTGKPGQSTVLRLPGLGSKRVGL  171

Query  569   VGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVS  748
             +GLGS VSS  ++++LGE +AAAAKSAQAS+VAV LAS E +  ESK+S+ASA+A+G V 
Sbjct  172   IGLGSSVSSPSSFQSLGEAVAAAAKSAQASNVAVVLASLESVPDESKISSASAIASGTVL  231

Query  749   GTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLT  928
             G +ED R+K E K P+LKSV+I+G GTGPE+EKKLKY+E VSSG+IF KELVN+PANVLT
Sbjct  232   GIYEDTRYKSESKKPSLKSVDIIGFGTGPELEKKLKYAEDVSSGIIFGKELVNSPANVLT  291

Query  929   PGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSG  1108
             P ALAEEA  +ASLYSDVLTA ILD E+CKELKMGS+LGVAAA+ NP  FIHL Y PSSG
Sbjct  292   PDALAEEAVKLASLYSDVLTANILDAEKCKELKMGSYLGVAAASANPPRFIHLRYTPSSG  351

Query  1109  SVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEV  1288
              V TKLAL+GKG+TFDSGGYN+K G   SIELMK DM G+A V GAAKAI QIKP GVEV
Sbjct  352   PVTTKLALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGQIKPPGVEV  411

Query  1289  HFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**  1468
             HFIV ACENMISGTGMRPGD+LTASNGK IE                             
Sbjct  412   HFIVAACENMISGTGMRPGDVLTASNGKTIE-----------------------------  442

Query  1469  VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             V +TDAEGRL LADALVYA   GV+K++DLATLTGAC+ ALG ++AG+
Sbjct  443   VNNTDAEGRLTLADALVYACNQGVDKVIDLATLTGACVVALGPTIAGV  490


 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS++LA EV +A+   GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+LF
Sbjct  489   GVFTPSDELAYEVFDASQRSGEKLWRMPMEESYWEQMKSGVADMVNTGGRAGGSITAALF  548

Query  1866  MK  1871
             +K
Sbjct  549   LK  550



>emb|CDX68703.1| BnaC01g07500D [Brassica napus]
Length=582

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/476 (65%), Positives = 367/476 (77%), Gaps = 31/476 (7%)
 Frame = +2

Query  185   KFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWK  364
             +F+    + ++ +V+PLC     R   ++++ATLGLT  N I+ PK++FAAK+VD+ EWK
Sbjct  34    RFQLPPRFRLALAVTPLCHSSRGRAMTTLSQATLGLTQANSIDHPKVTFAAKDVDVTEWK  93

Query  365   GDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPA  544
             GDILAVGVTEKDM KD NSKFQN IL KLD+ LGGLL++ SSEEDFSGK GQS VLRLP 
Sbjct  94    GDILAVGVTEKDMAKDVNSKFQNPILSKLDAHLGGLLADVSSEEDFSGKPGQSTVLRLPG  153

Query  545   LGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAAS  724
             LG KR+GL+GLG   SS  A+++LGE +AAAAK++QASSVAV LAS+E  S ESKL++AS
Sbjct  154   LGSKRVGLIGLGKSASSPSAFQSLGEAVAAAAKASQASSVAVVLASSE--SNESKLTSAS  211

Query  725   AMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELV  904
             A+A+G V G FED+R+K E K P+LKSV+I+G GTGPE+EKKLKY+E VS GVIF +ELV
Sbjct  212   AIASGTVLGLFEDSRYKSESKKPSLKSVDIIGFGTGPELEKKLKYAEDVSYGVIFGRELV  271

Query  905   NAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIH  1084
             N+PANVLTP  LAEEA N+AS+YSDV+TA IL+ EQCKELKMGS+L VAAA+ NP  FIH
Sbjct  272   NSPANVLTPAVLAEEASNLASMYSDVMTANILNEEQCKELKMGSYLAVAAASANPPRFIH  331

Query  1085  LCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQ  1264
             L YKPSSG VKTKLAL+GKG+TFDSGGYN+K G    IELMK DM G+A V GAAKAI Q
Sbjct  332   LVYKPSSGPVKTKLALVGKGLTFDSGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKAIGQ  391

Query  1265  IKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLG  1444
             IKP GVEVHFIV ACENMISGTGMRPGD+LTASNGK IE                     
Sbjct  392   IKPPGVEVHFIVAACENMISGTGMRPGDVLTASNGKTIE---------------------  430

Query  1445  VIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                     V +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+AG+
Sbjct  431   --------VNNTDAEGRLTLADALVYACNQGVDKVVDLATLTGACIVALGNSMAGI  478


 Score = 91.7 bits (226),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI+TPS++LAKEV+ A++  GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+LF
Sbjct  477   GIYTPSDELAKEVIAASERSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGSITAALF  536

Query  1866  MK  1871
             +K
Sbjct  537   LK  538



>ref|XP_009127424.1| PREDICTED: leucine aminopeptidase 3, chloroplastic [Brassica 
rapa]
 emb|CDY28227.1| BnaA01g06220D [Brassica napus]
Length=583

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/477 (65%), Positives = 368/477 (77%), Gaps = 32/477 (7%)
 Frame = +2

Query  185   KFRSTSAWAISFSVSPLC-CRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEW  361
             +F+    + ++ +V+PL    R R MAH++A+ATLGLT  N  + PK++F+AK+VD+ EW
Sbjct  34    RFQLPPRFRLALAVTPLYHSSRGRAMAHTLAQATLGLTQANSTDHPKVTFSAKDVDVTEW  93

Query  362   KGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLP  541
             KGDILAVGVTEKDM KD NSKFQN IL KLD+ LGGLL++ SSEEDFSGK GQS VLRLP
Sbjct  94    KGDILAVGVTEKDMAKDVNSKFQNAILNKLDAHLGGLLADVSSEEDFSGKPGQSTVLRLP  153

Query  542   ALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAA  721
              LG KR+GL+GLG   SS  A+++LGE +AAAAK++QASSVAV LAS+E  S ESKL++A
Sbjct  154   GLGSKRVGLIGLGKTASSPSAFQSLGEAVAAAAKASQASSVAVVLASSE--SNESKLTSA  211

Query  722   SAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKEL  901
             SA+A+G V G FED+R+K E K P+LKSV+I+G GTGPE+EKKLKY+E VS GVIF +EL
Sbjct  212   SAIASGTVLGLFEDSRYKSESKKPSLKSVDIIGFGTGPELEKKLKYAEDVSYGVIFGREL  271

Query  902   VNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFI  1081
             VN+PANVLTP  LA+EA  +AS+YSDV+TA IL+ EQCKELKMGS+L VAAA+ NP  FI
Sbjct  272   VNSPANVLTPAVLADEASKLASMYSDVMTANILNEEQCKELKMGSYLAVAAASANPPRFI  331

Query  1082  HLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaia  1261
             HL YKPSSG VKTKLAL+GKG+TFDSGGYN+K G    IELMK DM G+A V GAAKAI 
Sbjct  332   HLVYKPSSGPVKTKLALVGKGLTFDSGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKAIG  391

Query  1262  QIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVL  1441
             QIKP GVEVHFIV ACENMISGTGMRPGD+LTASNGK IE                    
Sbjct  392   QIKPPGVEVHFIVAACENMISGTGMRPGDVLTASNGKTIE--------------------  431

Query  1442  GVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                      V +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+AG+
Sbjct  432   ---------VNNTDAEGRLTLADALVYACNQGVDKVVDLATLTGACIVALGNSMAGI  479


 Score = 92.0 bits (227),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI+TPS++LAKEV+ A++  GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+LF
Sbjct  478   GIYTPSDELAKEVIAASERSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGSITAALF  537

Query  1866  MK  1871
             +K
Sbjct  538   LK  539



>ref|XP_010687715.1| PREDICTED: leucine aminopeptidase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=582

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/464 (65%), Positives = 354/464 (76%), Gaps = 29/464 (6%)
 Frame = +2

Query  221   SVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKD  400
             S  PL      RMAHS+ RATLGLT P  +E  K+SFA K++D++EWKGD+LAVGVTEKD
Sbjct  45    SKKPLYFYAKPRMAHSLTRATLGLTQPANVEPFKVSFAVKDIDVVEWKGDLLAVGVTEKD  104

Query  401   MVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLG  580
             M KD+N KF+N IL+KLD++LGGLL+EAS EEDF+GK+GQS +LRLP LG KRIGL+GLG
Sbjct  105   MSKDDNMKFENSILKKLDNQLGGLLAEASVEEDFTGKAGQSTILRLPGLGSKRIGLIGLG  164

Query  581   SVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFE  760
             S   S +AYR LGE +A AAK+AQAS +AV LAS+EGLS E KLS  SA+A+G + G  E
Sbjct  165   SKQPSLLAYRGLGEAVATAAKTAQASDIAVFLASSEGLSAELKLSTVSAIASGTILGMHE  224

Query  761   DNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGAL  940
             DNRFK E K P LKS++I+GLGTG ++EKKLK  E   SG+IF +ELVNAPANVLTPG L
Sbjct  225   DNRFKSESKKPHLKSLDIIGLGTGADLEKKLKSVEDTCSGIIFGRELVNAPANVLTPGVL  284

Query  941   AEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKT  1120
             AEEA  IAS YSDVL+A IL +EQC+ELKMGS+L VAAA+ NP +FIHLCYKP SG V  
Sbjct  285   AEEASKIASAYSDVLSAKILSLEQCEELKMGSYLAVAAASANPPHFIHLCYKPLSGPVTA  344

Query  1121  KLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIV  1300
             KLAL+GKG+TFDSGGYN+K G   SIELMK DM G+A V GAAKAI QIKPAGVEVHFIV
Sbjct  345   KLALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGQIKPAGVEVHFIV  404

Query  1301  PACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDT  1480
              ACENMISGTGMRPGD++TASNGK IE                             V +T
Sbjct  405   AACENMISGTGMRPGDVVTASNGKTIE-----------------------------VNNT  435

Query  1481  DAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             DAEGRL LADALVYA   GV+K++DLATLTGAC+ ALG S+AG+
Sbjct  436   DAEGRLTLADALVYACNQGVDKIIDLATLTGACVVALGPSIAGV  479


 Score = 88.6 bits (218),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP + LAKE+  A++  GEK WRMPLE++YWE+MKS +ADM+N G   G AITA+LF
Sbjct  478   GVFTPDDALAKELFAASEATGEKFWRMPLEDNYWESMKSGVADMVNTGGRQGGAITAALF  537

Query  1866  MK  1871
             +K
Sbjct  538   LK  539



>ref|NP_194820.1| cytosol aminopeptidase family protein [Arabidopsis thaliana]
 sp|Q8RX72.1|AMPL2_ARATH RecName: Full=Leucine aminopeptidase 2, chloroplastic; AltName: 
Full=Leucyl aminopeptidase 2; Short=LAP 2; AltName: Full=Proline 
aminopeptidase 2; AltName: Full=Prolyl aminopeptidase 
2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL91252.1| AT4g30910/F6I18_180 [Arabidopsis thaliana]
 gb|AAM78047.1| AT4g30910/F6I18_180 [Arabidopsis thaliana]
 gb|AEE85829.1| cytosol aminopeptidase family protein [Arabidopsis thaliana]
Length=581

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/477 (64%), Positives = 365/477 (77%), Gaps = 30/477 (6%)
 Frame = +2

Query  182   LKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEW  361
             ++F+  S   +SF+++PL C   +  AH+IA ATLGLT  N ++ PKISF+ KE+D+ EW
Sbjct  32    VRFQLLSRLRVSFAITPLYCSS-KATAHTIAHATLGLTQANSVDHPKISFSGKEIDVTEW  90

Query  362   KGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLP  541
             KGDILAVGVTEKDM KD NSKF+N IL+KLD+ LGGLL++ S+EEDFSGK GQS VLRLP
Sbjct  91    KGDILAVGVTEKDMAKDANSKFENPILKKLDAHLGGLLADVSAEEDFSGKPGQSTVLRLP  150

Query  542   ALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAA  721
              LG KR+GL+GLG   S+  A+++LGE +AAAAK++QASSVAV LAS+E  S ESKLS+A
Sbjct  151   GLGSKRVGLIGLGKSASTPSAFQSLGEAVAAAAKASQASSVAVVLASSESFSDESKLSSA  210

Query  722   SAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKEL  901
             S +A+G V G FED+R+K E K P+LKSV  +G GTGPE+E KLKY+E VS GVIF KEL
Sbjct  211   SDIASGTVLGLFEDSRYKSESKKPSLKSVVFIGFGTGPELENKLKYAEHVSYGVIFTKEL  270

Query  902   VNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFI  1081
             VN+PANVL+P  LAEEA N+AS+YS+V+TA IL  EQCKELKMGS+L VAAA+ NP +FI
Sbjct  271   VNSPANVLSPAVLAEEASNLASMYSNVMTANILKEEQCKELKMGSYLAVAAASANPPHFI  330

Query  1082  HLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaia  1261
             HL YKPSSG VKTKLAL+GKG+TFDSGGYN+KIG    IELMK D+ G+A V GAAKAI 
Sbjct  331   HLIYKPSSGPVKTKLALVGKGLTFDSGGYNIKIGPELIIELMKIDVGGSAAVLGAAKAIG  390

Query  1262  QIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVL  1441
             +IKP GVEVHFIV ACENMISGTGMRPGD++TASNGK IE                    
Sbjct  391   EIKPPGVEVHFIVAACENMISGTGMRPGDVITASNGKTIE--------------------  430

Query  1442  GVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                      V DTD+EGRL LADALVYA   GV+K+VD+ATLTG  I ALG S+AGM
Sbjct  431   ---------VNDTDSEGRLTLADALVYACNQGVDKIVDIATLTGEIIVALGPSMAGM  478


 Score = 85.5 bits (210),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 60/79 (76%), Gaps = 2/79 (3%)
 Frame = +3

Query  1641  IESLT-EMYMIMGGKL-GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIAD  1814
             I +LT E+ + +G  + G++T S++LAKEV+ A+   GEKLWRMP+EESYWE MKS +AD
Sbjct  460   IATLTGEIIVALGPSMAGMYTASDELAKEVIAASQRSGEKLWRMPMEESYWEMMKSGVAD  519

Query  1815  MINAGSLDGDAITASLFMK  1871
             M+N G   G +ITA+LF+K
Sbjct  520   MVNFGGRAGGSITAALFLK  538



>ref|XP_004144730.1| PREDICTED: leucine aminopeptidase 1-like [Cucumis sativus]
 ref|XP_004168114.1| PREDICTED: leucine aminopeptidase 1-like [Cucumis sativus]
 gb|KGN61048.1| hypothetical protein Csa_2G035480 [Cucumis sativus]
Length=585

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/465 (64%), Positives = 359/465 (77%), Gaps = 29/465 (6%)
 Frame = +2

Query  218   FSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEK  397
             F+  P   RR + MAHS+A+A LGLT+P+  E P+ISF AK++D+LEWKGD+LAVGVTEK
Sbjct  47    FAFDPFSSRRGKFMAHSLAQANLGLTNPSPNETPQISFGAKDIDVLEWKGDLLAVGVTEK  106

Query  398   DMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGL  577
             D+ KDENSKF+N IL KLDS+LGGLL+EAS+EEDF+GK+GQS VLR P LG KR+ L+GL
Sbjct  107   DVAKDENSKFKNPILNKLDSRLGGLLAEASAEEDFTGKAGQSTVLRFPGLGTKRVSLIGL  166

Query  578   GSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTF  757
             G   S+  A+R+LGE +A+AAK++QAS VA++LAS E LS ESK + ASA+A+G + G F
Sbjct  167   GQSASNVAAFRSLGEAVASAAKASQASEVAISLASPEELSSESKPNFASAIASGTILGIF  226

Query  758   EDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGA  937
             ED R+K E K   LKSVEI+GLG+G E+EKKLK+++ VSSG+I  +ELVN+PANVLTPGA
Sbjct  227   EDTRYKSESKKSALKSVEIIGLGSGAEVEKKLKFAQDVSSGIILGRELVNSPANVLTPGA  286

Query  938   LAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVK  1117
             LA EA  IAS YSDVL+ATIL+ EQCKEL MGS+LGVAAA+TNP +FIHL YKP SG V 
Sbjct  287   LAAEASKIASTYSDVLSATILNEEQCKELNMGSYLGVAAASTNPPHFIHLHYKPPSGPVS  346

Query  1118  TKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFI  1297
              KL L+GKG+TFDSGGYN+K G   SIE+MK DM G+A V GAAKAI QIKP GVE+HF+
Sbjct  347   VKLGLVGKGLTFDSGGYNIKTGPGCSIEIMKTDMGGSAAVLGAAKAIGQIKPLGVEIHFV  406

Query  1298  VPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTD  1477
             + ACENMISGTGMRPGDI+TASNGK IE                             V +
Sbjct  407   IAACENMISGTGMRPGDIITASNGKTIE-----------------------------VNN  437

Query  1478  TDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             TDAEGRL LADALVY  K GV+K++DLATLTGACI ALG S+AG+
Sbjct  438   TDAEGRLTLADALVYTCKQGVDKVIDLATLTGACIVALGPSIAGI  482


 Score = 99.8 bits (247),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GIFTPS+DLAKEVL A+++ GEK WRMP+E+SYWE+MKSS+ADM+N G   G AITA+LF
Sbjct  481   GIFTPSDDLAKEVLAASEISGEKFWRMPMEDSYWESMKSSVADMVNTGGRPGGAITAALF  540

Query  1866  MK  1871
             +K
Sbjct  541   LK  542



>ref|XP_010929163.1| PREDICTED: leucine aminopeptidase 1-like [Elaeis guineensis]
Length=604

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/457 (67%), Positives = 351/457 (77%), Gaps = 33/457 (7%)
 Frame = +2

Query  254   RMAHSIA--RATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKF  427
             RM H  A  RATLGLT P  +E P+I+FAAKE+D  EWKGDILAV V+EKDM KD NS F
Sbjct  74    RMGHVTAATRATLGLTKPAVVEIPQITFAAKEIDFAEWKGDILAVAVSEKDMSKDSNSTF  133

Query  428   QNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLG--SVVSSTI  601
             +N IL++LD KLGGLL+EAS EEDF+GK+GQS VLRLP LGFKRIGLVGLG  S  S+T 
Sbjct  134   ENSILKRLDEKLGGLLAEASVEEDFTGKAGQSTVLRLPGLGFKRIGLVGLGQCSPSSTTT  193

Query  602   AYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLE  781
             AYR++GE+IA  AK+AQAS+ AV LAS   +S E KL+ ASA+A+G V G +EDNRFK +
Sbjct  194   AYRSIGESIAVVAKAAQASNAAVVLASCNEISEEFKLNTASAIASGTVLGVYEDNRFKSD  253

Query  782   PKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNI  961
              K   LK+V+I+GLG+GPE+++KLKY+  V SGVIF KELVNAPANVLTPG LAEEA  +
Sbjct  254   SKKTHLKAVDIIGLGSGPELDRKLKYASDVCSGVIFGKELVNAPANVLTPGVLAEEASKV  313

Query  962   ASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGK  1141
             AS YSDVLTATILD EQC ELKMGS+LGVAAA++NP +FIHLCYKP  G VK KLA++GK
Sbjct  314   ASSYSDVLTATILDAEQCTELKMGSYLGVAAASSNPPHFIHLCYKPPDGDVKRKLAIVGK  373

Query  1142  GITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMI  1321
             G+TFDSGGYN+K G   SIELMK DM G+A  FGAAKAIAQIKP GVEVHFIV ACENMI
Sbjct  374   GLTFDSGGYNIKTGPGCSIELMKFDMGGSAATFGAAKAIAQIKPPGVEVHFIVAACENMI  433

Query  1322  SGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLI  1501
             SGTGMRPGDI+TASNGK IE                             V +TDAEGRL 
Sbjct  434   SGTGMRPGDIVTASNGKTIE-----------------------------VNNTDAEGRLT  464

Query  1502  LADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             LADALVYA   GVEK+VDLATLTGACI ALG S+AG 
Sbjct  465   LADALVYACNQGVEKIVDLATLTGACIVALGPSIAGF  501


 Score = 96.7 bits (239),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G FTPS+DLAKE++ A+++ GEK WRMPLEESYWE+MKS +ADM+N G   G AITA+LF
Sbjct  500   GFFTPSDDLAKEIVAASEITGEKFWRMPLEESYWESMKSGVADMVNTGGRQGGAITAALF  559

Query  1866  MK  1871
             +K
Sbjct  560   LK  561



>ref|XP_009415506.1| PREDICTED: leucine aminopeptidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=591

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/463 (65%), Positives = 356/463 (77%), Gaps = 35/463 (8%)
 Frame = +2

Query  242   RRPRRMAHSIARAT------LGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDM  403
             RR  RM HS A A       LGLT P  +E P+I+FAA+E+D +EWKGDILAV V+EKDM
Sbjct  55    RRLGRMGHSTAAAAATTRATLGLTKPAAVEIPQIAFAARELDFVEWKGDILAVAVSEKDM  114

Query  404   VKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGS  583
              KD +SKF+NL+L++LD KLGG+L+EAS+EEDF+GKSGQS VLRLP LGFKR+GL+GLGS
Sbjct  115   KKDSDSKFENLVLKRLDEKLGGILAEASTEEDFTGKSGQSTVLRLPGLGFKRLGLLGLGS  174

Query  584   VVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFED  763
               SS  AY+ +GE +AA AK+AQAS+ AV LAS +G+S E+KL AASA+A+G V G +ED
Sbjct  175   PSSSVTAYQGIGEAVAAVAKAAQASNAAVCLASLDGMSEEAKLHAASAIASGTVLGVYED  234

Query  764   NRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALA  943
             NRFK E K P LK+V+I+G G+G ++++KLKY+  V SGVIF KELVNAPANVLTPG +A
Sbjct  235   NRFKSESKKPLLKTVDIIGFGSGEQVDQKLKYATDVCSGVIFGKELVNAPANVLTPGVMA  294

Query  944   EEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTK  1123
             EEA  IA+LYSDV T TILD EQCKELKMGS+LGVAAA++NP +FIHLCYKPSSG VK K
Sbjct  295   EEASKIATLYSDVFTVTILDAEQCKELKMGSYLGVAAASSNPPHFIHLCYKPSSGDVKRK  354

Query  1124  LALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVP  1303
             LA++GKG+TFDSGGYN+K G   SIELMK DM GAA   GAAKA+ +IKP GVEVHFIV 
Sbjct  355   LAIVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGAAATLGAAKALGEIKPPGVEVHFIVA  414

Query  1304  ACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTD  1483
             ACENMISGTGMRPGDI+TASNGK IE                             V +TD
Sbjct  415   ACENMISGTGMRPGDIVTASNGKTIE-----------------------------VNNTD  445

Query  1484  AEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             AEGRL LADAL+YA   G+EK+VDLATLTGAC+ ALG S+AG 
Sbjct  446   AEGRLTLADALIYACNQGIEKVVDLATLTGACVVALGPSIAGF  488


 Score = 91.7 bits (226),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G F+P++DLAKE++ A++  GEK WRMPLE+SYWE+MKS +ADM+N G   G AITA+LF
Sbjct  487   GFFSPNDDLAKEIVAASEATGEKFWRMPLEDSYWESMKSGVADMVNTGGRQGGAITAALF  546

Query  1866  MK  1871
             +K
Sbjct  547   LK  548



>ref|XP_010447643.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like [Camelina 
sativa]
Length=579

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/477 (65%), Positives = 364/477 (76%), Gaps = 35/477 (7%)
 Frame = +2

Query  182   LKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEW  361
             ++F+  S   ++F+V+PL     R MAH+IA+ATLGLTH N ++ PKISF+ KE+D+ EW
Sbjct  34    VRFQLPSRLRLAFAVTPLYSSS-RAMAHTIAQATLGLTHANSVDHPKISFSGKEMDVTEW  92

Query  362   KGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLP  541
             KGDILAVGVTEKDM KD NSKF+N IL+KLD+ LGGLL++ SSEEDFSGK GQS VLRLP
Sbjct  93    KGDILAVGVTEKDMTKDANSKFENPILKKLDAHLGGLLADVSSEEDFSGKPGQSTVLRLP  152

Query  542   ALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAA  721
              LG KR+GL+GLG   SS  A+++LGE +AAAAK++QASSVAV LAS+E +S ESKLS+A
Sbjct  153   GLGSKRVGLIGLGKSASSPSAFQSLGEAVAAAAKASQASSVAVVLASSETVSNESKLSSA  212

Query  722   SAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKEL  901
             SA+A+G V G FED R+K E K P+L      G GTGPE+EKKLKY+E VS GVIF KEL
Sbjct  213   SAIASGTVLGLFEDCRYKSESKKPSLT-----GFGTGPELEKKLKYAEDVSYGVIFGKEL  267

Query  902   VNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFI  1081
             VN+PANVLTP  LAEEA  +AS+YSDV+TA IL+ EQCKELKMGS+L VAAA+ NP +FI
Sbjct  268   VNSPANVLTPAVLAEEASKLASMYSDVMTANILNEEQCKELKMGSYLAVAAASANPPHFI  327

Query  1082  HLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaia  1261
             HL YKPSSG VKTKLA++GKG+TFDSGGYN+K G    IELMK DM G+A V GAAKAI 
Sbjct  328   HLVYKPSSGPVKTKLAIVGKGLTFDSGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKAIG  387

Query  1262  QIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVL  1441
             QIKP GVEVHFIV ACENMISGTGMRPGDI+TASN K IE                    
Sbjct  388   QIKPPGVEVHFIVAACENMISGTGMRPGDIITASNRKTIE--------------------  427

Query  1442  GVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                      V +TDAEGRL LADALVYA   GV+K+VDLATLTGACI ALG S+A +
Sbjct  428   ---------VNNTDAEGRLTLADALVYACNQGVDKVVDLATLTGACIIALGTSMAAI  475


 Score = 85.9 bits (211),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  1689  IFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFM  1868
             I+T S++LAKEV+ A++  GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+LF+
Sbjct  475   IYTSSDELAKEVIAASERSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGSITAALFL  534

Query  1869  K  1871
             K
Sbjct  535   K  535



>gb|EPS65095.1| hypothetical protein M569_09684, partial [Genlisea aurea]
Length=557

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/471 (64%), Positives = 355/471 (75%), Gaps = 32/471 (7%)
 Frame = +2

Query  206   WAISF--SVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILA  379
             W +S   +V P      +RMAHS+ARA LGLT P +++ PKISFAAKE+DLLEWKGDILA
Sbjct  38    WDLSLLVAVGPFDRGATKRMAHSVARANLGLTEPTKLDLPKISFAAKEIDLLEWKGDILA  97

Query  380   VGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKR  559
             VGVTEKD+ KDENSKF+N +LQKLDSKLGGLLS+AS+EE+F+GK+GQS +LRL   G KR
Sbjct  98    VGVTEKDVAKDENSKFKNSLLQKLDSKLGGLLSDASAEEEFTGKAGQSTILRLSGFGAKR  157

Query  560   IGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATG  739
             +GL G+GS  SS++ YR LGE +A+AAKS+Q S VA+ +  ++  S ESK SAA ++A G
Sbjct  158   VGLFGIGSS-SSSLTYRNLGEAVASAAKSSQGSHVAIFVPLSDDSSAESKPSAAYSVAIG  216

Query  740   IVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPAN  919
                G F+D RFK E K   LKSV+ILG G GPEIEKKLK++  V SG+IF KELVNAPAN
Sbjct  217   AGLGLFDDVRFKSESKQVVLKSVDILGAGNGPEIEKKLKHAGDVISGIIFAKELVNAPAN  276

Query  920   VLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKP  1099
             VLTP  LA EA  IAS  SDVL+A ILDVEQCKELKMGS+LGVA A+ NP +FIHL YKP
Sbjct  277   VLTPAVLAAEATRIASENSDVLSAKILDVEQCKELKMGSYLGVAVASANPPHFIHLSYKP  336

Query  1100  SSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAG  1279
              +G VK KLAL+GKG+TFDSGGYN+K G   SIELMK DM G+A V GAAKA+AQ+KP+G
Sbjct  337   PTGDVKAKLALVGKGLTFDSGGYNIKTGPGCSIELMKIDMGGSAAVLGAAKALAQVKPSG  396

Query  1280  VEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPF  1459
             VEVHFIV ACENMISGTGMRPGDI+TASNGK IE                          
Sbjct  397   VEVHFIVAACENMISGTGMRPGDIVTASNGKTIE--------------------------  430

Query  1460  F**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                V +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG S+AG+
Sbjct  431   ---VNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGPSIAGI  478


 Score = 94.4 bits (233),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI++PS++LA EVL AA+  GEKLWR+PLEESYWETMKSS+ADM+N G   G +ITA+LF
Sbjct  477   GIYSPSDELAGEVLGAAEASGEKLWRLPLEESYWETMKSSVADMVNTGGRPGGSITAALF  536

Query  1866  MK  1871
             +K
Sbjct  537   LK  538



>ref|XP_008452840.1| PREDICTED: leucine aminopeptidase 1-like [Cucumis melo]
Length=585

 Score =   536 bits (1382),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 295/473 (62%), Positives = 363/473 (77%), Gaps = 29/473 (6%)
 Frame = +2

Query  194   STSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDI  373
             S+++  +SF+  P   RR + MAHS+A+A LGLT+P   E P+ISF AK++D+LEWKGD+
Sbjct  39    SSASRRVSFAFDPFSSRRGKFMAHSLAQANLGLTNPAPNESPQISFGAKDIDVLEWKGDL  98

Query  374   LAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGF  553
             LAVGVTEKD+ KDENSKF+N IL KLDS+LGGLL+EAS+EEDF+GK+GQS VLR P LG 
Sbjct  99    LAVGVTEKDVAKDENSKFKNPILNKLDSRLGGLLAEASAEEDFTGKAGQSTVLRFPGLGT  158

Query  554   KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMA  733
             KR+ L+GLG    +  A+R+LGE +A+AAK++QAS VA++LAS E LS ESK + ASA+A
Sbjct  159   KRVSLIGLGQSALNVAAFRSLGEAVASAAKASQASEVAISLASPEELSSESKPNFASAIA  218

Query  734   TGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAP  913
             +G + G F+D R+K E K   LKSVEI+GLG+G E++KKLK+++ VSSG+I  +ELVN+P
Sbjct  219   SGTILGIFDDTRYKSESKKSALKSVEIIGLGSGAEVDKKLKFAQDVSSGIILGRELVNSP  278

Query  914   ANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCY  1093
             ANVLTPGALA EA  IAS YSDVL+ATIL+ EQCKEL MGS+LGVAAA+TNP +FIHL Y
Sbjct  279   ANVLTPGALAAEASKIASTYSDVLSATILNEEQCKELNMGSYLGVAAASTNPPHFIHLRY  338

Query  1094  KPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKP  1273
             KP SG V  KL L+GKG+TFDSGGYN+K G   SIE+MK DM G+A V GAAKAI QIKP
Sbjct  339   KPPSGPVSVKLGLVGKGLTFDSGGYNIKTGPGCSIEIMKTDMGGSAAVLGAAKAIGQIKP  398

Query  1274  AGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVID  1453
              GVE+HF++ ACENMISGTGMRPGDI+TASNGK IE                        
Sbjct  399   LGVEIHFVIAACENMISGTGMRPGDIITASNGKTIE------------------------  434

Query  1454  PFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                  V +TDAEGRL LADALVY  K GV+K++DLATLTGACI ALG S+AG+
Sbjct  435   -----VNNTDAEGRLTLADALVYTCKQGVDKVIDLATLTGACIVALGPSIAGI  482


 Score =   101 bits (251),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GIFTPS+DLAKEVL AA++ GEK WRMP+E+SYWE+MKSS+ADM+N G   G AITA+LF
Sbjct  481   GIFTPSDDLAKEVLAAAEISGEKFWRMPMEDSYWESMKSSVADMVNTGGRPGGAITAALF  540

Query  1866  MK  1871
             +K
Sbjct  541   LK  542



>ref|XP_003610319.1| Leucine aminopeptidase [Medicago truncatula]
 gb|AES92516.1| cytosol aminopeptidase family protein [Medicago truncatula]
Length=567

 Score =   534 bits (1375),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 297/462 (64%), Positives = 349/462 (76%), Gaps = 36/462 (8%)
 Frame = +2

Query  248   PRRMAHSIAR-------ATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMV  406
             P+R  HS  +        TLGLTHP  IE PKISF+A +VD+ EWKGDILAVGVTEKD+ 
Sbjct  32    PKRSFHSTTKLMSQSRYTTLGLTHPTNIEAPKISFSATDVDVTEWKGDILAVGVTEKDLT  91

Query  407   KDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSV  586
             +D  S+F+N IL K+D KL GLLSEASSEEDFSGK GQS V+R+  LG KR+GL+GLG +
Sbjct  92    RDAKSRFENSILNKIDLKLDGLLSEASSEEDFSGKVGQSTVVRIKGLGSKRVGLIGLGQL  151

Query  587   VSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDN  766
              S+T  Y+ LGE + A AKSAQAS+VA+ LAS+EGLS ESKLS A A+A+G V G FED 
Sbjct  152   PSTTALYKGLGEAVVAVAKSAQASNVAIVLASSEGLSSESKLSTAYAIASGAVLGLFEDQ  211

Query  767   RFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAE  946
             R+K E K P ++S++I+GLGTGP++EKKLKY+  VSSG+IF +ELVN+PANVLTPG LAE
Sbjct  212   RYKSESKKPAVRSIDIIGLGTGPDLEKKLKYAGDVSSGIIFGRELVNSPANVLTPGVLAE  271

Query  947   EAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKL  1126
             EA  +AS YSDV TA ILD +QCKELKMGS+LGVAAA+ NP  FIHL YKP SGSVK KL
Sbjct  272   EASKVASTYSDVFTAKILDADQCKELKMGSYLGVAAASANPPRFIHLTYKPPSGSVKVKL  331

Query  1127  ALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPA  1306
             AL+GKG+TFDSGGYN+K G   SIELMK DM G+A V GAAKA+ QIKP GVEVHFIV A
Sbjct  332   ALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKALGQIKPLGVEVHFIVAA  391

Query  1307  CENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDA  1486
             CENMISGTGMRPGD++TASNGK IE                             V +TDA
Sbjct  392   CENMISGTGMRPGDVVTASNGKTIE-----------------------------VNNTDA  422

Query  1487  EGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             EGRL LADALVYA   GVEK++DLATLTGAC+ ALG S+AG+
Sbjct  423   EGRLTLADALVYACNQGVEKIIDLATLTGACVVALGPSIAGV  464


 Score = 94.4 bits (233),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+F+P+++L KEVLEA++V GEKLWR+P+EESYWE+MKS +ADM+N G   G +ITA+LF
Sbjct  463   GVFSPNDELVKEVLEASEVSGEKLWRLPIEESYWESMKSGVADMVNTGGRPGGSITAALF  522

Query  1866  MK  1871
             +K
Sbjct  523   LK  524



>gb|KHG12351.1| Leucine aminopeptidase 1 -like protein [Gossypium arboreum]
Length=522

 Score =   532 bits (1370),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 305/452 (67%), Positives = 349/452 (77%), Gaps = 34/452 (8%)
 Frame = +2

Query  257   MAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNL  436
             MAH     TLGLT P  IE PKISFAAKE+D+ EWKGD+LAVGVTEKDM KDENSKFQN 
Sbjct  1     MAH-----TLGLTQPANIELPKISFAAKEIDVAEWKGDLLAVGVTEKDMTKDENSKFQNP  55

Query  437   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTL  616
             IL+KLD  LG LL+EAS EEDF+GK+GQS+V RLP LG KR+GL GLG   SS  A+  L
Sbjct  56    ILKKLDGLLGSLLAEASFEEDFTGKAGQSLVHRLPGLGSKRVGLFGLGQSASSPAAFHGL  115

Query  617   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  796
             GE +AAAAK+AQASS AV LAS+E  SV SK + A+A+ +G V G +EDNR+K E K P 
Sbjct  116   GEAVAAAAKTAQASSAAVILASSECPSVMSKGNTAAAIVSGTVLGLYEDNRYKSESKKPQ  175

Query  797   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  976
             LKS++ILGLGTGPEIEKK+KY+EVVS  +IF +ELVN+PANVLTP ALA EA  IASLYS
Sbjct  176   LKSLDILGLGTGPEIEKKIKYAEVVSCAIIFGRELVNSPANVLTPAALAAEASKIASLYS  235

Query  977   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1156
             DVL+A IL  EQC+ELKMGS+LGVAAA+ NP +FIHLCYKP SGSVKTKLAL+GKG+TFD
Sbjct  236   DVLSANILTEEQCRELKMGSYLGVAAASANPPHFIHLCYKPPSGSVKTKLALVGKGLTFD  295

Query  1157  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1336
             SGGYN+K G  SSIE MK DM G+A VFGAAKA+ QIKP+GVEVHFIV +CENMISG GM
Sbjct  296   SGGYNIKTGPGSSIETMKVDMGGSAAVFGAAKALGQIKPSGVEVHFIVASCENMISGKGM  355

Query  1337  RPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADAL  1516
             RPGDI+TASNGK IE                             V +TDAEGRL LADAL
Sbjct  356   RPGDIVTASNGKTIE-----------------------------VNNTDAEGRLTLADAL  386

Query  1517  VYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             VYA   GVEK+VDLATLTGAC+ ALG S+AG+
Sbjct  387   VYACNQGVEKIVDLATLTGACVVALGPSIAGV  418


 Score = 96.3 bits (238),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP++DLAKE+ +A++  GEKLWRMPLEESYWE+MKS +ADM+N G   G AI A+LF
Sbjct  417   GVFTPNDDLAKELFQASEASGEKLWRMPLEESYWESMKSGVADMVNTGGRQGGAINAALF  476

Query  1866  MK  1871
             +K
Sbjct  477   LK  478



>ref|XP_010942088.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Elaeis 
guineensis]
Length=530

 Score =   531 bits (1368),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 300/456 (66%), Positives = 351/456 (77%), Gaps = 33/456 (7%)
 Frame = +2

Query  257   MAHSIAR--ATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQ  430
             M H  A   ATLGLT P  +E P+ISF+ KE+D  EWKGDIL V V+EKDM KD +SKF+
Sbjct  1     MEHVTAATPATLGLTKPAPVEIPQISFSVKEIDFAEWKGDILVVAVSEKDMSKDLDSKFE  60

Query  431   NLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLG--SVVSSTIA  604
             N IL++LD KLGGLL EAS+EEDF+GK+GQS VLRLP LGFKR+GLVGLG  S  S+  A
Sbjct  61    NSILRRLDEKLGGLLVEASTEEDFTGKAGQSTVLRLPGLGFKRVGLVGLGQCSPSSTATA  120

Query  605   YRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEP  784
             YR++GE +A  AK+AQAS+ AV LAS+ G+S E KL+AASA+A+G V G +EDNRFK + 
Sbjct  121   YRSIGEAVAGVAKAAQASNAAVVLASSNGISEEFKLNAASAIASGTVLGVYEDNRFKSDS  180

Query  785   KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIA  964
             K   LK+V+I+GLG+GP+++KKLKY+  V SGVIF KELVNAPANVLTPG LAEEA  +A
Sbjct  181   KKTHLKAVDIIGLGSGPQLDKKLKYASDVCSGVIFGKELVNAPANVLTPGVLAEEASKVA  240

Query  965   SLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKG  1144
             SLYSDVL+ATILDVEQCKELKMGS+LGVAAA++NP +FIHLCYKP  G VK KLA++GKG
Sbjct  241   SLYSDVLSATILDVEQCKELKMGSYLGVAAASSNPPHFIHLCYKPPGGDVKRKLAIVGKG  300

Query  1145  ITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMIS  1324
             +TFDSGGYN+K G    IELMK DM G+A  FGAAKA+AQIKP GVEVHFIV ACENMIS
Sbjct  301   LTFDSGGYNIKTGPGCLIELMKFDMGGSAAAFGAAKALAQIKPPGVEVHFIVAACENMIS  360

Query  1325  GTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLIL  1504
             GTGMRPGDI+TASNGK IE                             V +TDAEGRL L
Sbjct  361   GTGMRPGDIVTASNGKTIE-----------------------------VNNTDAEGRLTL  391

Query  1505  ADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             ADALVYA   GVEK+VDLATLTGAC+ ALG S+AG 
Sbjct  392   ADALVYACNQGVEKIVDLATLTGACVVALGPSIAGF  427


 Score = 91.7 bits (226),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G FT S+DLAKE+ EA+++ GEK WRMPLEESYWE+MKS +ADM+N G   G AI A+LF
Sbjct  426   GFFTSSDDLAKEIAEASEITGEKFWRMPLEESYWESMKSGVADMVNTGGRQGGAILAALF  485

Query  1866  MK  1871
             +K
Sbjct  486   LK  487



>ref|XP_008794352.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Phoenix 
dactylifera]
Length=584

 Score =   533 bits (1372),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 302/457 (66%), Positives = 349/457 (76%), Gaps = 33/457 (7%)
 Frame = +2

Query  254   RMAHSIA--RATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKF  427
             RM H  A  RATLGLT P  +E P+I+FAAKE+D  EWKGD+LAV V+EKDM KD NSKF
Sbjct  54    RMGHVTAATRATLGLTKPAVVEIPQITFAAKEIDFAEWKGDMLAVAVSEKDMSKDSNSKF  113

Query  428   QNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLG--SVVSSTI  601
             +N IL++LD KLGGLL+EAS EEDF+GK+GQS VLRLP LGFKR+GLVGLG  S  S+T 
Sbjct  114   ENSILKRLDEKLGGLLAEASIEEDFTGKAGQSTVLRLPGLGFKRVGLVGLGQCSPPSTTT  173

Query  602   AYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLE  781
             AYR +GE +AA AKSAQAS+ AV LAS+ G+S E KL+ ASA+A+G + G +EDNRFK +
Sbjct  174   AYRGIGEAVAAVAKSAQASNAAVVLASSNGISEEFKLNTASAIASGTMLGVYEDNRFKSD  233

Query  782   PKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNI  961
              K   LK+V+I+GLG+GPE+++KLKY+  V SGVIF KELVNAPANVLTPG LAEEA  +
Sbjct  234   SKKTHLKAVDIIGLGSGPELDRKLKYASDVCSGVIFGKELVNAPANVLTPGVLAEEASKV  293

Query  962   ASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGK  1141
             AS Y DVLTATI D E CKELKMGS+LGVAAA++NP +FIHLCYKP  G  K KLA++GK
Sbjct  294   ASSYRDVLTATIFDAELCKELKMGSYLGVAAASSNPPHFIHLCYKPPDGDAKRKLAIVGK  353

Query  1142  GITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMI  1321
             G+TFDSGGYN+K G   SIELMK DM G+A  FGAAKAIAQIKP GVEVHFIV ACENMI
Sbjct  354   GLTFDSGGYNIKTGPGCSIELMKFDMGGSAAAFGAAKAIAQIKPPGVEVHFIVAACENMI  413

Query  1322  SGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLI  1501
             SGTGMRPGDI+TASNGK IE                             V +TDAEGRL 
Sbjct  414   SGTGMRPGDIVTASNGKTIE-----------------------------VNNTDAEGRLT  444

Query  1502  LADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             LADALVYA   GVEK+VDLATLTGAC  ALG S+AG 
Sbjct  445   LADALVYACNQGVEKVVDLATLTGACRVALGPSIAGF  481


 Score = 96.7 bits (239),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G FTPS+DLAKE++ A+++ GEK WRMPLEESYWE+MKS +ADM+N G   G AITA+LF
Sbjct  480   GFFTPSDDLAKEIVAASEITGEKFWRMPLEESYWESMKSGVADMVNTGGRQGGAITAALF  539

Query  1866  MK  1871
             +K
Sbjct  540   LK  541



>ref|XP_008803713.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=450

 Score =   528 bits (1359),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 298/455 (65%), Positives = 350/455 (77%), Gaps = 33/455 (7%)
 Frame = +2

Query  257   MAH--SIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQ  430
             M H  S  RATLGLT P  +E P+ISF+AKE+D   WKGDILAV V+E DM KD +SKF+
Sbjct  1     MGHVTSATRATLGLTKPALVEIPQISFSAKEIDFAVWKGDILAVAVSENDMSKDLDSKFE  60

Query  431   NLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLG--SVVSSTIA  604
             N IL++LD KLGGLL+EAS+EEDF+GK+GQS+VLRLP LGFKR+GLVGLG  S  S+  A
Sbjct  61    NSILKRLDEKLGGLLAEASTEEDFTGKAGQSMVLRLPGLGFKRVGLVGLGQCSPSSTATA  120

Query  605   YRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEP  784
             YR++GE +A  AK+AQA + AV LAS+ G+S E KL+AASA+A+G V G +ED+RFK + 
Sbjct  121   YRSIGEAVAVVAKAAQAINAAVILASSNGISEEFKLNAASAIASGTVLGVYEDSRFKSDS  180

Query  785   KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIA  964
             K   LK+V+I+GLG+GPE++KK+KY+  V SGVIF KEL NAPANVLTPG LAEEA  +A
Sbjct  181   KKTHLKAVDIIGLGSGPELDKKIKYASDVCSGVIFGKELANAPANVLTPGVLAEEASKVA  240

Query  965   SLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKG  1144
             S YSDVL ATILDVEQCKELKMGS+LGVAAA++NP +FIHLCYKP  G VK KLA++GKG
Sbjct  241   SSYSDVLMATILDVEQCKELKMGSYLGVAAASSNPPHFIHLCYKPPGGDVKRKLAIVGKG  300

Query  1145  ITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMIS  1324
             +TFDSGGYN+K G   SIELMK DM G+A  FGAAKAIAQIKP GVEVHFIV ACENMIS
Sbjct  301   LTFDSGGYNIKTGPGCSIELMKFDMGGSAAAFGAAKAIAQIKPPGVEVHFIVAACENMIS  360

Query  1325  GTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLIL  1504
             GTGMRPGDI+TASNGK IE                             V +TDAEGRL L
Sbjct  361   GTGMRPGDIVTASNGKTIE-----------------------------VNNTDAEGRLTL  391

Query  1505  ADALVYASKLGVEKMVDLATLTGACITALGRSVAG  1609
             ADALVYA   GVEK+VDLATLTGAC+ ALG S+ G
Sbjct  392   ADALVYACNQGVEKIVDLATLTGACVVALGPSIGG  426



>ref|XP_008803712.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=530

 Score =   528 bits (1359),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 298/456 (65%), Positives = 350/456 (77%), Gaps = 33/456 (7%)
 Frame = +2

Query  257   MAH--SIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQ  430
             M H  S  RATLGLT P  +E P+ISF+AKE+D   WKGDILAV V+E DM KD +SKF+
Sbjct  1     MGHVTSATRATLGLTKPALVEIPQISFSAKEIDFAVWKGDILAVAVSENDMSKDLDSKFE  60

Query  431   NLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLG--SVVSSTIA  604
             N IL++LD KLGGLL+EAS+EEDF+GK+GQS+VLRLP LGFKR+GLVGLG  S  S+  A
Sbjct  61    NSILKRLDEKLGGLLAEASTEEDFTGKAGQSMVLRLPGLGFKRVGLVGLGQCSPSSTATA  120

Query  605   YRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEP  784
             YR++GE +A  AK+AQA + AV LAS+ G+S E KL+AASA+A+G V G +ED+RFK + 
Sbjct  121   YRSIGEAVAVVAKAAQAINAAVILASSNGISEEFKLNAASAIASGTVLGVYEDSRFKSDS  180

Query  785   KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIA  964
             K   LK+V+I+GLG+GPE++KK+KY+  V SGVIF KEL NAPANVLTPG LAEEA  +A
Sbjct  181   KKTHLKAVDIIGLGSGPELDKKIKYASDVCSGVIFGKELANAPANVLTPGVLAEEASKVA  240

Query  965   SLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKG  1144
             S YSDVL ATILDVEQCKELKMGS+LGVAAA++NP +FIHLCYKP  G VK KLA++GKG
Sbjct  241   SSYSDVLMATILDVEQCKELKMGSYLGVAAASSNPPHFIHLCYKPPGGDVKRKLAIVGKG  300

Query  1145  ITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMIS  1324
             +TFDSGGYN+K G   SIELMK DM G+A  FGAAKAIAQIKP GVEVHFIV ACENMIS
Sbjct  301   LTFDSGGYNIKTGPGCSIELMKFDMGGSAAAFGAAKAIAQIKPPGVEVHFIVAACENMIS  360

Query  1325  GTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLIL  1504
             GTGMRPGDI+TASNGK IE                             V +TDAEGRL L
Sbjct  361   GTGMRPGDIVTASNGKTIE-----------------------------VNNTDAEGRLTL  391

Query  1505  ADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             ADALVYA   GVEK+VDLATLTGAC+ ALG S+ G 
Sbjct  392   ADALVYACNQGVEKIVDLATLTGACVVALGPSIGGF  427


 Score = 93.2 bits (230),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G FTPS+DLAKE+ EA+++ GEK WRMPLEESYWE+M S +ADM+N+G   G AI A+LF
Sbjct  426   GFFTPSDDLAKEIAEASEITGEKFWRMPLEESYWESMTSGVADMVNSGGRQGGAILAALF  485

Query  1866  MK  1871
             +K
Sbjct  486   LK  487



>ref|XP_004253490.2| PREDICTED: leucine aminopeptidase 1, chloroplastic-like, partial 
[Solanum lycopersicum]
Length=505

 Score =   526 bits (1355),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 298/479 (62%), Positives = 364/479 (76%), Gaps = 33/479 (7%)
 Frame = +2

Query  176   IFLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLL  355
             +F K++S+  WA SF V+PLC +R +R+ H IA  TLGLT PN+ + PKIS  AK+  ++
Sbjct  23    VFTKYQSSPKWAFSFPVTPLCSKRSKRIVHCIAGDTLGLTRPNESDAPKISIGAKDTAVV  82

Query  356   EWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  535
             +W+GD+LA+G TE DM +DENSKF+N +LQ+LDS+L GLLS ASSEEDFSGKSGQS+ LR
Sbjct  83    QWQGDLLAIGATENDMARDENSKFKNPLLQQLDSELNGLLSAASSEEDFSGKSGQSVNLR  142

Query  536   LPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLS  715
              P     RI LVGLGS  SS  +Y +LG+  AAAAKS+QA ++AVALAS +GLS ESK++
Sbjct  143   FPG---GRITLVGLGSSASSPTSYHSLGQAAAAAAKSSQARNIAVALASTDGLSAESKIN  199

Query  716   AASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVK  895
             +ASA+ATG+V G+FEDNRF+ E K  TL+S++ILGLGTGPEIE+K+KY+E V +GVI  +
Sbjct  200   SASAIATGVVLGSFEDNRFRSESKKSTLESLDILGLGTGPEIERKIKYAEHVCAGVILGR  259

Query  896   ELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAAT-NPS  1072
             ELVNAPAN++TP  LAEEAK IAS YSDV++  ILD EQCKELKMG++L VAAAAT NP 
Sbjct  260   ELVNAPANIVTPAVLAEEAKKIASTYSDVISVNILDAEQCKELKMGAYLAVAAAATENPP  319

Query  1073  YFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaak  1252
             YFIHLC+K  +   KTKLAL+GKG+TFDSGGYNLK+GA S IELMK DM GAA V GAAK
Sbjct  320   YFIHLCFKTPTKERKTKLALVGKGLTFDSGGYNLKVGAGSRIELMKNDMGGAAAVLGAAK  379

Query  1253  aiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYI  1432
             A+ +I+P+ VEVHFIV ACENMIS  GMRPGDI+TASNGK IE                 
Sbjct  380   ALGEIRPSRVEVHFIVAACENMISAEGMRPGDIVTASNGKTIE-----------------  422

Query  1433  VVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAG  1609
                         V +TDAEGRL LADAL+YA   GVEK++DLATLTGA + ALG SVAG
Sbjct  423   ------------VNNTDAEGRLTLADALIYACNQGVEKIIDLATLTGAIMVALGPSVAG  469


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETM  1796
             G FTP++DLA+EV+EAA+  GEKLWRMP+EESYWE+M
Sbjct  469   GAFTPNDDLAREVVEAAEASGEKLWRMPMEESYWESM  505



>ref|XP_006404921.1| hypothetical protein EUTSA_v10000127mg [Eutrema salsugineum]
 dbj|BAJ33647.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46374.1| hypothetical protein EUTSA_v10000127mg [Eutrema salsugineum]
Length=520

 Score =   526 bits (1356),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 293/445 (66%), Positives = 343/445 (77%), Gaps = 33/445 (7%)
 Frame = +2

Query  281   TLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSK  460
             TLGLT PN  E PKISFAAKE+D+ EWKGD L VGVTEKD+ KD++SKF+N IL KLD+ 
Sbjct  4     TLGLTQPNSTELPKISFAAKEIDVTEWKGDTLVVGVTEKDLAKDDHSKFENPILNKLDAH  63

Query  461   LGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLG-SVVSSTIAYRTLGETIaaa  637
             L GLL+  SSEEDF+GK GQS VLRLP LG KRIGL+GLG S  SS +AY++LGE +A  
Sbjct  64    LSGLLALVSSEEDFTGKPGQSTVLRLPGLGSKRIGLIGLGKSASSSPVAYQSLGEAVATV  123

Query  638   aksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEIL  817
             +K++Q+SSVA+ LAS E   +ESKL++ASA+A+G+V G FED R+K E K P+LKSV+I+
Sbjct  124   SKASQSSSVAIVLASPE---IESKLASASAIASGVVLGLFEDGRYKSESKKPSLKSVDII  180

Query  818   GLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATI  997
             G GTGPE+EKKLKY+E VS GVIF +EL N+PANVLTP  LAEEA  +AS YSDV TA I
Sbjct  181   GFGTGPELEKKLKYAEDVSYGVIFGRELTNSPANVLTPAVLAEEAAKVASTYSDVFTANI  240

Query  998   LDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLK  1177
             L+ EQCKELKMGS+L VAAA+ NP YFIHL YKP SGSVKTKLAL+GKG+TFDSGGYN+K
Sbjct  241   LNEEQCKELKMGSYLAVAAASANPPYFIHLVYKPPSGSVKTKLALVGKGLTFDSGGYNIK  300

Query  1178  IGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILT  1357
              G   SIELMK DM G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGMRPGD++T
Sbjct  301   TGPGCSIELMKFDMGGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTGMRPGDVIT  360

Query  1358  ASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLG  1537
             ASNGK IE                             V +TDAEGRL LADALVYA   G
Sbjct  361   ASNGKTIE-----------------------------VNNTDAEGRLTLADALVYACNQG  391

Query  1538  VEKMVDLATLTGACITALGRSVAGM  1612
             V+K+VDLATLTGAC+ ALG S+AG+
Sbjct  392   VDKIVDLATLTGACVIALGTSMAGI  416


 Score = 91.7 bits (226),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI+TP+++LAKEV+ A++  GEKLWRMPLEESYWE MKS +ADM+N G   G +ITA+LF
Sbjct  415   GIYTPNDELAKEVIAASEKSGEKLWRMPLEESYWEMMKSGVADMVNTGGRAGGSITAALF  474

Query  1866  MK  1871
             +K
Sbjct  475   LK  476



>emb|CAA18201.1| leucyl aminopeptidase-like protein [Arabidopsis thaliana]
 emb|CAB79810.1| leucyl aminopeptidase-like protein [Arabidopsis thaliana]
Length=525

 Score =   526 bits (1355),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 300/452 (66%), Positives = 352/452 (78%), Gaps = 31/452 (7%)
 Frame = +2

Query  257   MAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNL  436
             MAH+I+ ATLGLT  N ++ PKISF+ KE+D+ EWKGDILAVGVTEKDM KD NSKF+N 
Sbjct  1     MAHTISHATLGLTQANSVDHPKISFSGKEIDVTEWKGDILAVGVTEKDMAKDVNSKFENP  60

Query  437   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTL  616
             IL+KLD+ LGGLL++ SSEEDFSGK GQS VLRLP LG KR+GL+GLG   S+  A+++L
Sbjct  61    ILKKLDAHLGGLLADVSSEEDFSGKPGQSTVLRLPGLGSKRVGLIGLGKSASTPSAFQSL  120

Query  617   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  796
             GE +AAAAK++QASSVAV LAS+E +S ESKL +ASA+A+  V G FED+R+K E K P+
Sbjct  121   GEAVAAAAKASQASSVAVVLASSESVSNESKLCSASAIAS--VLGLFEDSRYKSESKKPS  178

Query  797   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  976
             LKSV+I+G G+GPE+EKKLKY+E VS GVIF KELVN+PANVLTP  LAEEA N+AS+YS
Sbjct  179   LKSVDIIGFGSGPELEKKLKYAEHVSYGVIFGKELVNSPANVLTPAVLAEEALNLASMYS  238

Query  977   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1156
             DV+TA IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKPSSG VKTKLAL+GK +   
Sbjct  239   DVMTANILNEEQCKELKMGSYLAVAAASANPPHFIHLIYKPSSGPVKTKLALVGKMVFVH  298

Query  1157  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1336
             SGGYN+K G    IELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISGTGM
Sbjct  299   SGGYNIKTGPGCLIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTGM  358

Query  1337  RPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADAL  1516
             RPGD+LTASNGK IE                             V +TDAEGRL LADAL
Sbjct  359   RPGDVLTASNGKTIE-----------------------------VNNTDAEGRLTLADAL  389

Query  1517  VYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             VYA   GV+K+VDLATLTGACI ALG S+AG+
Sbjct  390   VYACNQGVDKVVDLATLTGACIIALGTSMAGI  421


 Score = 91.3 bits (225),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI+TPS+ LAKEV+ A++  GEKLWRMP+EESYWE MKS +ADM+N G   G +ITA+LF
Sbjct  420   GIYTPSDKLAKEVIAASERSGEKLWRMPMEESYWEMMKSGVADMVNTGGRAGGSITAALF  479

Query  1866  MK  1871
             +K
Sbjct  480   LK  481



>ref|XP_006350102.1| PREDICTED: leucine aminopeptidase, chloroplastic-like [Solanum 
tuberosum]
Length=574

 Score =   527 bits (1357),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 304/479 (63%), Positives = 363/479 (76%), Gaps = 33/479 (7%)
 Frame = +2

Query  176   IFLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLL  355
             +F K +S+  WA SFSV+PLC RR +R+ H IA  TLGLT PN+ + PKIS  AK+ D++
Sbjct  24    VFTKCQSSPRWAFSFSVTPLCSRRSKRIVHCIAGDTLGLTRPNESDAPKISIGAKDTDVV  83

Query  356   EWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  535
             +W+GD+LA+G TE D+ +DENSKF+N +LQ+LDSKL GLLS ASSEEDFSGKSGQSI LR
Sbjct  84    QWQGDLLAIGATENDLARDENSKFKNPLLQQLDSKLNGLLSAASSEEDFSGKSGQSINLR  143

Query  536   LPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLS  715
             LP     RI LVGLGS  SS  +Y +LGE  AAAAKSAQA ++AV+LAS +GLS ESK+S
Sbjct  144   LPG---GRITLVGLGSSASSPTSYHSLGEAAAAAAKSAQARNIAVSLASTDGLSAESKIS  200

Query  716   AASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVK  895
             +ASA+ATG+V G FEDNRF+ + K   L+S++ILGLGTGPEIE K+KY+E V +GVI  +
Sbjct  201   SASAIATGVVLGIFEDNRFRSDSKKAALESLDILGLGTGPEIESKIKYAEHVCAGVILGR  260

Query  896   ELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAAT-NPS  1072
             ELVNAPAN++TPG LAEEAK IAS YSDV+T  ILD EQCKELKMG++L VAAAAT NP 
Sbjct  261   ELVNAPANIVTPGVLAEEAKKIASTYSDVITVNILDAEQCKELKMGAYLAVAAAATENPP  320

Query  1073  YFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaak  1252
             YFIHLC+K  +   KTK+AL+GKG+TFDSGGYNLK GA S IELMK DM GAA V GAAK
Sbjct  321   YFIHLCFKTLTKERKTKIALVGKGLTFDSGGYNLKTGAGSKIELMKYDMGGAAAVLGAAK  380

Query  1253  aiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYI  1432
             A+ +I+P GVEVHFIV ACENMISG GMRPGDI+TA+  K IE                 
Sbjct  381   ALGEIRPFGVEVHFIVAACENMISGAGMRPGDIVTANKSKTIE-----------------  423

Query  1433  VVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAG  1609
                         V +TDAEGRL LADAL+YA   GVEK++DLATLTGA +TALG SVAG
Sbjct  424   ------------VNNTDAEGRLTLADALIYACNQGVEKIIDLATLTGAIVTALGPSVAG  470


 Score = 94.4 bits (233),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G FTPS+ LA+EV+ AA+  GEKLWRMP+EESYWE+MKS +ADMIN G  DG AIT +LF
Sbjct  470   GAFTPSDGLAREVVVAAEASGEKLWRMPMEESYWESMKSGVADMINTGPRDGGAITGALF  529

Query  1866  MK  1871
             +K
Sbjct  530   LK  531



>dbj|BAH57215.1| AT4G30910 [Arabidopsis thaliana]
Length=478

 Score =   523 bits (1347),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 292/454 (64%), Positives = 355/454 (78%), Gaps = 7/454 (2%)
 Frame = +2

Query  182   LKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEW  361
             ++F+  S   +SF+++PL C   +  AH+IA ATLGLT  N ++ PKISF+ KE+D+ EW
Sbjct  32    VRFQLLSRLRVSFAITPLYCSS-KATAHTIAHATLGLTQANSVDHPKISFSGKEIDVTEW  90

Query  362   KGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLP  541
             KGDILAVGVTEKDM KD NSKF+N IL+KLD+ LGGLL++ S+EEDFSGK GQS VLRLP
Sbjct  91    KGDILAVGVTEKDMAKDANSKFENPILKKLDAHLGGLLADVSAEEDFSGKPGQSTVLRLP  150

Query  542   ALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAA  721
              LG KR+GL+GLG   S+  A+++LGE +AAAAK++QASSVAV LAS+E  S ESKLS+A
Sbjct  151   GLGSKRVGLIGLGKSASTPSAFQSLGEAVAAAAKASQASSVAVVLASSESFSDESKLSSA  210

Query  722   SAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKEL  901
             S +A+G V G FED+R+K E K P+LKSV  +G GTGPE+E KLKY+E VS GVIF KEL
Sbjct  211   SDIASGTVLGLFEDSRYKSESKKPSLKSVVFIGFGTGPELENKLKYAEHVSYGVIFTKEL  270

Query  902   VNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFI  1081
             VN+PANVL+P  LAEEA N+AS+YS+V+TA IL  EQCKELKMGS+L VAAA+ NP +FI
Sbjct  271   VNSPANVLSPAVLAEEASNLASMYSNVMTANILKEEQCKELKMGSYLAVAAASANPPHFI  330

Query  1082  HLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaia  1261
             HL YKPSSG VKTKLAL+GKG+TFDSGGYN+KIG    IELMK D+ G+A V GAAKAI 
Sbjct  331   HLIYKPSSGPVKTKLALVGKGLTFDSGGYNIKIGPELIIELMKIDVGGSAAVLGAAKAIG  390

Query  1262  QIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVL  1441
             +IKP GVEVHFIV ACENMISGTGMRPGD++TASNGK IEV+     +   S+     +L
Sbjct  391   EIKPPGVEVHFIVAACENMISGTGMRPGDVITASNGKTIEVSLHRFHMNSASKGSSFPLL  450

Query  1442  GVIDPFF**VTDTDAEGRLILADALVYASKLGVE  1543
              V+      V DTD+EGRL LADALVYA   GV+
Sbjct  451   -VLQ-----VNDTDSEGRLTLADALVYACNQGVD  478



>ref|XP_002880560.1| cytosol aminopeptidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56819.1| cytosol aminopeptidase [Arabidopsis lyrata subsp. lyrata]
Length=520

 Score =   523 bits (1348),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 293/452 (65%), Positives = 345/452 (76%), Gaps = 36/452 (8%)
 Frame = +2

Query  257   MAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNL  436
             MAH     TLGLT PN IE  KISF+AKE+D+  WKGDI+ VGVTEKD+ KD NSKF+N 
Sbjct  1     MAH-----TLGLTQPNSIEPHKISFSAKEIDVTAWKGDIIVVGVTEKDLAKDGNSKFENP  55

Query  437   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTL  616
             IL KLD+ L GLL++ SSEEDF+GK GQS VLRLP LG KRIGL+GLG  VSS +A+ +L
Sbjct  56    ILNKLDTHLSGLLAQVSSEEDFTGKPGQSTVLRLPGLGSKRIGLIGLGQSVSSPVAFHSL  115

Query  617   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  796
             GE +A  +K++Q+SS A+ LAS+  +S ESKLS+ASA+A+GIV G FED R+K E K P+
Sbjct  116   GEAVATVSKASQSSSAAIVLASS--VSDESKLSSASALASGIVLGLFEDGRYKSESKKPS  173

Query  797   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  976
             LKSV+I+G GTG E+EKKLKY+E VS GVIF +EL N+PANVLTP  LAEEA  +AS YS
Sbjct  174   LKSVDIIGFGTGAELEKKLKYAEDVSYGVIFGRELTNSPANVLTPAVLAEEAAKVASTYS  233

Query  977   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1156
             DV TA IL+ EQC++LKMGS+L VAAA+ NP YFIHL YKPSSGSVKTKLAL+GKG+TFD
Sbjct  234   DVFTANILNEEQCRKLKMGSYLAVAAASANPPYFIHLVYKPSSGSVKTKLALVGKGLTFD  293

Query  1157  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1336
             SGGYN+K G   SIELMK DM G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGM
Sbjct  294   SGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTGM  353

Query  1337  RPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADAL  1516
             RPGD++TASNGK IE                             V +TDAEGRL LADAL
Sbjct  354   RPGDVITASNGKTIE-----------------------------VNNTDAEGRLTLADAL  384

Query  1517  VYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             VYA   GV+K+VDLATLTGAC+ ALG S+AG+
Sbjct  385   VYACNQGVDKIVDLATLTGACVIALGTSMAGI  416


 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI+TPS++LAKEV+ A++  GEKLWRMPLEESYWE MKS +ADM+N G   G +ITA+LF
Sbjct  415   GIYTPSDELAKEVIAASERSGEKLWRMPLEESYWEMMKSGVADMVNTGGRAGGSITAALF  474

Query  1866  MK  1871
             +K
Sbjct  475   LK  476



>ref|NP_001233862.1| leucine aminopeptidase 1, chloroplastic [Solanum lycopersicum]
 sp|Q10712.1|AMPL1_SOLLC RecName: Full=Leucine aminopeptidase 1, chloroplastic; AltName: 
Full=DR57; AltName: Full=Leucyl aminopeptidase 1; Short=LAP 
1; AltName: Full=Proline aminopeptidase 1; AltName: Full=Prolyl 
aminopeptidase 1; Flags: Precursor [Solanum lycopersicum]
 gb|AAC49456.1| leucine aminopeptidase [Solanum lycopersicum]
Length=571

 Score =   525 bits (1351),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 298/479 (62%), Positives = 364/479 (76%), Gaps = 33/479 (7%)
 Frame = +2

Query  176   IFLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLL  355
             +F K++S+  WA SF V+PLC +R +R+ H IA  TLGLT PN+ + PKIS  AK+  ++
Sbjct  23    VFTKYQSSPKWAFSFPVTPLCSKRSKRIVHCIAGDTLGLTRPNESDAPKISIGAKDTAVV  82

Query  356   EWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  535
             +W+GD+LA+G TE DM +DENSKF+N +LQ+LDS+L GLLS ASSEEDFSGKSGQS+ LR
Sbjct  83    QWQGDLLAIGATENDMARDENSKFKNPLLQQLDSELNGLLSAASSEEDFSGKSGQSVNLR  142

Query  536   LPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLS  715
              P     RI LVGLGS  SS  +Y +LG+  AAAAKS+QA ++AVALAS +GLS ESK++
Sbjct  143   FPG---GRITLVGLGSSASSPTSYHSLGQAAAAAAKSSQARNIAVALASTDGLSAESKIN  199

Query  716   AASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVK  895
             +ASA+ATG+V G+FEDNRF+ E K  TL+S++ILGLGTGPEIE+K+KY+E V +GVI  +
Sbjct  200   SASAIATGVVLGSFEDNRFRSESKKSTLESLDILGLGTGPEIERKIKYAEHVCAGVILGR  259

Query  896   ELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAAT-NPS  1072
             ELVNAPAN++TP  LAEEAK IAS YSDV++  ILD EQCKELKMG++L VAAAAT NP 
Sbjct  260   ELVNAPANIVTPAVLAEEAKKIASTYSDVISVNILDAEQCKELKMGAYLAVAAAATENPP  319

Query  1073  YFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaak  1252
             YFIHLC+K  +   KTKLAL+GKG+TFDSGGYNLK+GA S IELMK DM GAA V GAAK
Sbjct  320   YFIHLCFKTPTKERKTKLALVGKGLTFDSGGYNLKVGARSRIELMKNDMGGAAAVLGAAK  379

Query  1253  aiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYI  1432
             A+ +I+P+ VEVHFIV ACENMIS  GMRPGDI+TASNGK IE                 
Sbjct  380   ALGEIRPSRVEVHFIVAACENMISAEGMRPGDIVTASNGKTIE-----------------  422

Query  1433  VVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAG  1609
                         V +TDAEGRL LADAL+YA   GVEK++DLATLTGA + ALG SVAG
Sbjct  423   ------------VNNTDAEGRLTLADALIYACNQGVEKIIDLATLTGAIMVALGPSVAG  469


 Score = 96.7 bits (239),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G FTP++DLA+EV+EAA+  GEKLWRMP+EESYWE+MKS +ADMIN G  +G AIT +LF
Sbjct  469   GAFTPNDDLAREVVEAAEASGEKLWRMPMEESYWESMKSGVADMINTGPGNGGAITGALF  528

Query  1866  MK  1871
             +K
Sbjct  529   LK  530



>gb|AAC49457.1| leucine aminopeptidase, partial [Solanum lycopersicum]
Length=566

 Score =   525 bits (1351),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 298/479 (62%), Positives = 364/479 (76%), Gaps = 33/479 (7%)
 Frame = +2

Query  176   IFLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLL  355
             +F K++S+  WA SF V+PLC +R +R+ H IA  TLGLT PN+ + PKIS  AK+  ++
Sbjct  18    VFTKYQSSPKWAFSFPVTPLCSKRSKRIVHCIAGDTLGLTRPNESDAPKISIGAKDTAVV  77

Query  356   EWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  535
             +W+GD+LA+G TE DM +DENSKF+N +LQ+LDS+L GLLS ASSEEDFSGKSGQS+ LR
Sbjct  78    QWQGDLLAIGATENDMARDENSKFKNPLLQQLDSELNGLLSAASSEEDFSGKSGQSVNLR  137

Query  536   LPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLS  715
              P     RI LVGLGS  SS  +Y +LG+  AAAAKS+QA ++AVALAS +GLS ESK++
Sbjct  138   FPG---GRITLVGLGSSASSPTSYHSLGQAAAAAAKSSQARNIAVALASTDGLSAESKIN  194

Query  716   AASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVK  895
             +ASA+ATG+V G+FEDNRF+ E K  TL+S++ILGLGTGPEIE+K+KY+E V +GVI  +
Sbjct  195   SASAIATGVVLGSFEDNRFRSESKKSTLESLDILGLGTGPEIERKIKYAEHVCAGVILGR  254

Query  896   ELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAAT-NPS  1072
             ELVNAPAN++TP  LAEEAK IAS YSDV++  ILD EQCKELKMG++L VAAAAT NP 
Sbjct  255   ELVNAPANIVTPAVLAEEAKKIASTYSDVISVNILDAEQCKELKMGAYLAVAAAATENPP  314

Query  1073  YFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaak  1252
             YFIHLC+K  +   KTKLAL+GKG+TFDSGGYNLK+GA S IELMK DM GAA V GAAK
Sbjct  315   YFIHLCFKTPTKERKTKLALVGKGLTFDSGGYNLKVGAGSRIELMKNDMGGAAAVLGAAK  374

Query  1253  aiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYI  1432
             A+ +I+P+ VEVHFIV ACENMIS  GMRPGDI+TASNGK IE                 
Sbjct  375   ALGEIRPSRVEVHFIVAACENMISAEGMRPGDIVTASNGKTIE-----------------  417

Query  1433  VVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAG  1609
                         V +TDAEGRL LADAL+YA   GVEK++DLATLTGA + ALG SVAG
Sbjct  418   ------------VNNTDAEGRLTLADALIYACNQGVEKIIDLATLTGAIMVALGPSVAG  464


 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G FTP++DLA+EV+EAA+  GEKLWRMP+EESYWE+MKS +ADMIN G  +G AIT +LF
Sbjct  464   GAFTPNDDLAREVVEAAEASGEKLWRMPMEESYWESMKSGVADMINLGPGNGGAITGALF  523

Query  1866  MK  1871
             +K
Sbjct  524   LK  525



>ref|XP_007138276.1| hypothetical protein PHAVU_009G195000g [Phaseolus vulgaris]
 gb|ESW10270.1| hypothetical protein PHAVU_009G195000g [Phaseolus vulgaris]
Length=577

 Score =   524 bits (1349),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 294/449 (65%), Positives = 348/449 (78%), Gaps = 30/449 (7%)
 Frame = +2

Query  269   IARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQK  448
             +A A+LGLT P+  E PK+SFA+KEVD+++WKGD+LA+GVTEKD+  +  +KFQN IL  
Sbjct  55    MACASLGLTRPSNTETPKVSFASKEVDVVQWKGDLLAIGVTEKDLAPNAEAKFQNAILNA  114

Query  449   LDSKLGGLLSEASSEEDFSGKSGQSIVLRLP-ALGFKRIGLVGLGSVVSSTIAYRTLGET  625
             LDSKLGGLL +ASSEEDF+GK GQS+VLR+   LG KR+ L+GLG+  SS  A+++LGE 
Sbjct  115   LDSKLGGLLGQASSEEDFTGKPGQSVVLRIADGLGSKRVALLGLGASASSFAAFKSLGEA  174

Query  626   IaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKS  805
             +AAAAKSAQA  VAVALAS++  SVESKL+AASA+A+G V GTFEDNR++ E K   LKS
Sbjct  175   VAAAAKSAQAGHVAVALASSDAFSVESKLNAASAIASGTVLGTFEDNRYRSESKKSALKS  234

Query  806   VEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVL  985
             V+I+GLG+GPE+EKKLK++  VSSG+IF +ELVN+PANVLTPG LAEEA  IA+ YSDV 
Sbjct  235   VDIIGLGSGPELEKKLKFATDVSSGIIFGRELVNSPANVLTPGVLAEEASKIAATYSDVF  294

Query  986   TATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGG  1165
             TA ILD EQCKELKMGS+LGVAAA+ NP +FIHLCYKP +G V  KLAL+GKG+TFDSGG
Sbjct  295   TAKILDAEQCKELKMGSYLGVAAASANPPHFIHLCYKPPTGPVNVKLALVGKGLTFDSGG  354

Query  1166  YNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPG  1345
             YN+K G    IELMK DM G+A V GAAKA+ QIKP GVEVHFIV ACENMISGTGMRPG
Sbjct  355   YNIKTGPGCLIELMKFDMGGSAAVLGAAKALGQIKPLGVEVHFIVAACENMISGTGMRPG  414

Query  1346  DILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYA  1525
             DILTASNGK IE                             V +TDAEGRL LADALVYA
Sbjct  415   DILTASNGKTIE-----------------------------VNNTDAEGRLTLADALVYA  445

Query  1526  SKLGVEKMVDLATLTGACITALGRSVAGM  1612
                G EK+VDLATLTGACI ALG S+AG+
Sbjct  446   CNQGAEKIVDLATLTGACIIALGSSIAGV  474


 Score =   102 bits (254),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV EA++  GEKLWR+PLEESYWE+MKS +ADM+N GS  G AITA+LF
Sbjct  473   GVFTPSDDLAKEVFEASEASGEKLWRLPLEESYWESMKSGVADMVNTGSRPGSAITAALF  532

Query  1866  MK  1871
             +K
Sbjct  533   LK  534



>ref|NP_179997.1| aminopeptidase family protein [Arabidopsis thaliana]
 ref|NP_001118375.1| aminopeptidase family protein [Arabidopsis thaliana]
 sp|P30184.1|AMPL1_ARATH RecName: Full=Leucine aminopeptidase 1; AltName: Full=Leucyl 
aminopeptidase 1; Short=LAP 1; AltName: Full=Proline aminopeptidase 
1; AltName: Full=Prolyl aminopeptidase 1 [Arabidopsis 
thaliana]
 emb|CAA45040.1| leucine aminopeptidase [Arabidopsis thaliana]
 gb|AAD03381.1| putative leucine aminopeptidase [Arabidopsis thaliana]
 gb|AAL32980.1| At2g24200/F27D4.11 [Arabidopsis thaliana]
 gb|AAP21153.1| At2g24200/F27D4.11 [Arabidopsis thaliana]
 gb|AEC07539.1| aminopeptidase family protein [Arabidopsis thaliana]
 gb|AEC07540.1| aminopeptidase family protein [Arabidopsis thaliana]
Length=520

 Score =   520 bits (1339),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 288/452 (64%), Positives = 343/452 (76%), Gaps = 36/452 (8%)
 Frame = +2

Query  257   MAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNL  436
             MAH     TLGLT PN  E  KISF AKE+D++EWKGDIL VGVTEKD+ KD NSKF+N 
Sbjct  1     MAH-----TLGLTQPNSTEPHKISFTAKEIDVIEWKGDILVVGVTEKDLAKDGNSKFENP  55

Query  437   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTL  616
             IL K+D+ L GLL++ SSEEDF+GK GQS VLRLP LG KRI L+GLG  VSS +A+ +L
Sbjct  56    ILSKVDAHLSGLLAQVSSEEDFTGKPGQSTVLRLPGLGSKRIALIGLGQSVSSPVAFHSL  115

Query  617   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  796
             GE +A  +K++Q++S A+ LAS+  +S ESKLS+ SA+A+GIV G FED R+K E K P+
Sbjct  116   GEAVATVSKASQSTSAAIVLASS--VSDESKLSSVSALASGIVLGLFEDGRYKSESKKPS  173

Query  797   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  976
             LK+V+I+G GTG E+EKKLKY+E VS GVIF +EL+N+PANVLTP  LAEEA  +AS YS
Sbjct  174   LKAVDIIGFGTGAEVEKKLKYAEDVSYGVIFGRELINSPANVLTPAVLAEEAAKVASTYS  233

Query  977   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1156
             DV TA IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKP +GSVKTKLAL+GKG+TFD
Sbjct  234   DVFTANILNEEQCKELKMGSYLAVAAASANPPHFIHLVYKPPNGSVKTKLALVGKGLTFD  293

Query  1157  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1336
             SGGYN+K G   SIELMK DM G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGM
Sbjct  294   SGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTGM  353

Query  1337  RPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADAL  1516
             RPGD++TASNGK IE                             V +TDAEGRL LADAL
Sbjct  354   RPGDVITASNGKTIE-----------------------------VNNTDAEGRLTLADAL  384

Query  1517  VYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             VYA   GV+K+VDLATLTGAC+ ALG S+AG+
Sbjct  385   VYACNQGVDKIVDLATLTGACVIALGTSMAGI  416


 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI+TPS++LAKEV+ A++  GEKLWRMPLEESYWE MKS +ADM+N G   G +ITA+LF
Sbjct  415   GIYTPSDELAKEVIAASERSGEKLWRMPLEESYWEMMKSGVADMVNTGGRAGGSITAALF  474

Query  1866  MK  1871
             +K
Sbjct  475   LK  476



>emb|CAA69614.1| lap17.1a [Solanum lycopersicum]
Length=571

 Score =   522 bits (1344),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 297/479 (62%), Positives = 364/479 (76%), Gaps = 33/479 (7%)
 Frame = +2

Query  176   IFLKFRSTSAWAISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKEVDLL  355
             +F K++S+  WA SF V+PLC +R +R+ H IA  TLGLT PN+ + PKIS  AK+  ++
Sbjct  23    VFTKYQSSPKWAFSFPVTPLCSKRSKRIVHCIAGDTLGLTRPNESDAPKISIGAKDTAVV  82

Query  356   EWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  535
             +W+GD+LA+G TE DM +DENSKF+N +LQ+LDS+L GLLS ASSEEDFSGKSGQS+ LR
Sbjct  83    QWQGDLLAIGATENDMARDENSKFKNPLLQQLDSELNGLLSAASSEEDFSGKSGQSVNLR  142

Query  536   LPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLS  715
              P     RI LVGLGS  SS  +Y +LG+  AAAA+S+QA ++AVALAS +GLS ESK++
Sbjct  143   FPG---GRISLVGLGSSASSPTSYHSLGQAAAAAARSSQARNIAVALASTDGLSAESKIN  199

Query  716   AASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVK  895
             +ASA+ATG+V G+FEDNRF+ E K  TL+S++ILGLGTGPEIE+K+KY+E V +GVI  +
Sbjct  200   SASAIATGVVLGSFEDNRFRSESKKSTLESLDILGLGTGPEIERKIKYAEHVCAGVILGR  259

Query  896   ELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAAT-NPS  1072
             ELVNAPAN++TP  LAEEAK IAS YSDV++  ILD EQCKELKMG++L VAAAAT NP 
Sbjct  260   ELVNAPANIVTPAVLAEEAKKIASTYSDVISVNILDAEQCKELKMGAYLAVAAAATENPP  319

Query  1073  YFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaak  1252
             YFIHLC+K  +   KTKLAL+GKG+TFDSGGYNLK+GA S IELMK DM GAA V GAAK
Sbjct  320   YFIHLCFKTPTKERKTKLALVGKGLTFDSGGYNLKVGAGSRIELMKNDMGGAAAVLGAAK  379

Query  1253  aiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYI  1432
             A+ +I+P+ VEVHFIV ACENMIS  GMRPGDI+TASNGK IE                 
Sbjct  380   ALGEIRPSRVEVHFIVAACENMISAEGMRPGDIVTASNGKTIE-----------------  422

Query  1433  VVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAG  1609
                         V +TDAEGRL LADAL+YA   GVEK++DLATLTGA + ALG SVAG
Sbjct  423   ------------VNNTDAEGRLTLADALIYACNQGVEKIIDLATLTGAIMVALGPSVAG  469


 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G FTP++ LA EV+ AA+  GEKLWRMP+EESYWE+MKS +ADMIN G  +G AIT +LF
Sbjct  469   GAFTPNDGLANEVVAAAEASGEKLWRMPMEESYWESMKSGVADMINLGPGNGGAITGALF  528

Query  1866  MK  1871
             +K
Sbjct  529   LK  530



>ref|XP_006293400.1| hypothetical protein CARUB_v10024476mg [Capsella rubella]
 gb|EOA26298.1| hypothetical protein CARUB_v10024476mg [Capsella rubella]
Length=490

 Score =   516 bits (1329),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 288/444 (65%), Positives = 341/444 (77%), Gaps = 31/444 (7%)
 Frame = +2

Query  281   TLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSK  460
             TLGLT PN  E  KISFAAKE+D++ WKGDIL VGVT+KD+ KD NSKF+N IL KLD  
Sbjct  4     TLGLTQPNSTEPHKISFAAKEIDVIAWKGDILVVGVTDKDLSKDGNSKFENPILNKLDGH  63

Query  461   LGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaa  640
             L GLL++ SSEEDF+GK GQS VLRLP LG KRIGL+GLG  VSS +A+ +LG+ +A  +
Sbjct  64    LSGLLAQVSSEEDFTGKPGQSTVLRLPGLGAKRIGLIGLGQSVSSPLAFHSLGDGVATVS  123

Query  641   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  820
             K++Q+SS A+ LAS+  +S ESKLS+ASA+A+GIV G FED+R+K E K  +LKSV+I+G
Sbjct  124   KASQSSSAAIVLASS--VSDESKLSSASALASGIVLGLFEDSRYKSESKKASLKSVDIIG  181

Query  821   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1000
              GTGPE+EKKLKY++ VS GVIF +EL N+PANVLTP  LAEEA  +AS YSDV TA IL
Sbjct  182   FGTGPEVEKKLKYAQDVSYGVIFGRELTNSPANVLTPAVLAEEAAKVASTYSDVFTANIL  241

Query  1001  DVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKI  1180
             + EQCKELKMGS+L VAAA+ NP +FIHL YKP+SGSVKTKLAL+GKG+TFDSGGYN+K 
Sbjct  242   NEEQCKELKMGSYLAVAAASANPPHFIHLIYKPASGSVKTKLALVGKGLTFDSGGYNIKT  301

Query  1181  GANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTA  1360
             G    IELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISGTGMRPGD++TA
Sbjct  302   GPGCLIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTGMRPGDVITA  361

Query  1361  SNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGV  1540
             SNGK IE                             V +TDAEGRL LADALVYA   GV
Sbjct  362   SNGKTIE-----------------------------VNNTDAEGRLTLADALVYACNQGV  392

Query  1541  EKMVDLATLTGACITALGRSVAGM  1612
             +K+VDLATLTGAC+ ALG S+AG+
Sbjct  393   DKIVDLATLTGACVIALGPSMAGI  416


 Score = 93.2 bits (230),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI+TPS++LAKEV+ A++  GEKLWRMPLEESYWE MKS +ADM+N G   G +ITA+LF
Sbjct  415   GIYTPSDELAKEVISASERSGEKLWRMPLEESYWEMMKSGVADMVNTGGRAGGSITAALF  474

Query  1866  MK  1871
             +K
Sbjct  475   LK  476



>emb|CDX76828.1| BnaC08g34140D [Brassica napus]
Length=519

 Score =   516 bits (1330),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 288/452 (64%), Positives = 341/452 (75%), Gaps = 37/452 (8%)
 Frame = +2

Query  257   MAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNL  436
             MAHS     LGLT P   + PKISFAAKE+D+ EWKGD+L VG TEKD  KD  SKF+N 
Sbjct  1     MAHS-----LGLTQPKPTDHPKISFAAKEIDVTEWKGDLLVVGATEKDSTKDSASKFENP  55

Query  437   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTL  616
             IL KLD++L GLL+  SSEEDFSGK GQS VLRLP LG KRIGL+GLG   SS  A+++L
Sbjct  56    ILNKLDARLSGLLALVSSEEDFSGKPGQSTVLRLPGLGSKRIGLIGLGKSASSPAAFQSL  115

Query  617   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  796
             GE +A  AK++Q+S+VAVALAS +    ESKLS+ASA+A+G+V G FED RFK E K P+
Sbjct  116   GEAVATVAKASQSSTVAVALASHDN---ESKLSSASALASGVVLGLFEDGRFKSESKKPS  172

Query  797   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  976
             L SV+I+G GTGPE+EKKLKY++ VS GVIF +EL+N+PANVLTP  LA+EA  +AS YS
Sbjct  173   LSSVDIIGFGTGPELEKKLKYAQDVSYGVIFGRELINSPANVLTPAVLADEAAKVASTYS  232

Query  977   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1156
             DV TA IL+ EQC+ELKMGS+L VAAA+ NP +FIHL Y+P SG VKTKLAL+GKG+TFD
Sbjct  233   DVFTANILNEEQCRELKMGSYLAVAAASANPPFFIHLVYRPPSGDVKTKLALVGKGLTFD  292

Query  1157  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1336
             SGGYN+K G  SSIELMK DM G+A V GAAKA+ +IKP GVEVHFIV ACENMISGTGM
Sbjct  293   SGGYNIKAGPGSSIELMKFDMGGSAAVLGAAKAVGEIKPPGVEVHFIVAACENMISGTGM  352

Query  1337  RPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADAL  1516
             RPGD++TASNGK IE                             V +TDAEGRL LADAL
Sbjct  353   RPGDVITASNGKTIE-----------------------------VNNTDAEGRLTLADAL  383

Query  1517  VYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             VYA   GV+K+VDLATLTGAC+ ALG S+AG+
Sbjct  384   VYACNQGVDKIVDLATLTGACVIALGTSMAGI  415


 Score = 88.2 bits (217),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI+TP+++LA EV+ A++  GEKLWRMPLEESYWE MKS  ADM+N G   G +ITA+LF
Sbjct  414   GIYTPNDELATEVIAASEKSGEKLWRMPLEESYWEMMKSGCADMVNTGGRAGGSITAALF  473

Query  1866  MK  1871
             +K
Sbjct  474   LK  475



>emb|CDY20284.1| BnaC04g36720D [Brassica napus]
Length=521

 Score =   515 bits (1326),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 289/446 (65%), Positives = 338/446 (76%), Gaps = 34/446 (8%)
 Frame = +2

Query  281   TLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSK  460
             TLGLT PN  + PKISFAAKE+D+ EWKGD+L VGVTEKD+ KD+ SKF+N IL KLD+ 
Sbjct  4     TLGLTKPNSTDHPKISFAAKEIDVTEWKGDLLVVGVTEKDLTKDDGSKFENPILNKLDAH  63

Query  461   LGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSST--IAYRTLGETIaa  634
               GLL   SSEEDF+GK GQS VLRLP L  KRIGL+GLG   SS+   A+ +LGE +A 
Sbjct  64    TIGLLGLVSSEEDFAGKPGQSTVLRLPGLATKRIGLIGLGKTASSSSPAAFHSLGEGVAT  123

Query  635   aaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEI  814
              +K++Q+S+VAVALAS E    ESKLS+ASA+A+G+V G FED R+K E K P+L SV+I
Sbjct  124   VSKASQSSTVAVALASPES---ESKLSSASALASGVVLGLFEDGRYKSESKKPSLSSVDI  180

Query  815   LGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTAT  994
             +G GTGPE+EKKLKY+E VS GVIF +EL+N+PANVLTP  LAEEA  +AS YSDV TA 
Sbjct  181   IGFGTGPEVEKKLKYAEDVSYGVIFGRELINSPANVLTPAVLAEEAAKVASTYSDVFTAN  240

Query  995   ILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNL  1174
             IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKPSSG VKTKLAL+GKG+TFDSGGYN+
Sbjct  241   ILNEEQCKELKMGSYLAVAAASANPPFFIHLVYKPSSGDVKTKLALVGKGLTFDSGGYNI  300

Query  1175  KIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDIL  1354
             K G   SIELMK DM G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGMRPGD++
Sbjct  301   KTGPGCSIELMKFDMGGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTGMRPGDVI  360

Query  1355  TASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKL  1534
             TASNGK IE                             V +TDAEGRL LADALVYA   
Sbjct  361   TASNGKTIE-----------------------------VNNTDAEGRLTLADALVYACNQ  391

Query  1535  GVEKMVDLATLTGACITALGRSVAGM  1612
             GV+K+VDLATLTGAC+ ALG SVAG+
Sbjct  392   GVDKIVDLATLTGACVIALGTSVAGI  417


 Score = 90.5 bits (223),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI+TP+++LAKEV+ A++  GEKLWRMPLEESYWE MKS  ADM+N G   G +ITA+LF
Sbjct  416   GIYTPNDELAKEVIAASEKSGEKLWRMPLEESYWEMMKSGCADMVNTGGRAGGSITAALF  475

Query  1866  MK  1871
             +K
Sbjct  476   LK  477



>ref|XP_006857233.1| hypothetical protein AMTR_s00065p00209640 [Amborella trichopoda]
 gb|ERN18700.1| hypothetical protein AMTR_s00065p00209640 [Amborella trichopoda]
Length=525

 Score =   514 bits (1324),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 282/449 (63%), Positives = 341/449 (76%), Gaps = 30/449 (7%)
 Frame = +2

Query  266   SIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQ  445
             ++A   LGLT P  +  P+I  + K++D  EWKGD+LAVGV+EKDM +DE   F+NL+LQ
Sbjct  3     AMANVNLGLTKPATVSLPEIDLSVKDIDFAEWKGDVLAVGVSEKDMARDEKGAFENLVLQ  62

Query  446   KLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGET  625
             KLD  L GLL+EAS EEDF+GK GQS VLR P LGF+R+GL+GLG    +T  ++  GE 
Sbjct  63    KLDGLLSGLLAEASKEEDFTGKPGQSTVLRFPGLGFRRVGLIGLGQGSLTTATFKGFGEA  122

Query  626   IaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKS  805
             +A++AK+AQA++V V LAS++ LS E+KL+ ASA+ +G + G +EDNRFK E K P LKS
Sbjct  123   VASSAKAAQAANVGVLLASSDCLSSEAKLNTASAIVSGTILGIYEDNRFKSESKKPVLKS  182

Query  806   VEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVL  985
             ++I+GLGTGP+IEKKLKY+E   SGVI  +ELVNAPANVLTPGALAEEA+ IAS YSDVL
Sbjct  183   LDIIGLGTGPDIEKKLKYTEEFCSGVILARELVNAPANVLTPGALAEEAQKIASTYSDVL  242

Query  986   TATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGG  1165
             TATIL+ +QC+ELKMGS+LGVAAA+ NP +FIH+CYKP  G+ KTKLA++GKG+TFDSGG
Sbjct  243   TATILNEDQCRELKMGSYLGVAAASANPPHFIHICYKPPGGNAKTKLAIVGKGLTFDSGG  302

Query  1166  YNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPG  1345
             YNLK G  SSIELMK DM G+A   GAAKAI QIKP GVEVHFIV ACENMISGTGMRPG
Sbjct  303   YNLKTGG-SSIELMKFDMGGSAAALGAAKAIGQIKPPGVEVHFIVAACENMISGTGMRPG  361

Query  1346  DILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYA  1525
             DI+TASNGK IE                             V +TDAEGRL LADALVYA
Sbjct  362   DIVTASNGKTIE-----------------------------VNNTDAEGRLTLADALVYA  392

Query  1526  SKLGVEKMVDLATLTGACITALGRSVAGM  1612
                GVEK+VDLATLTGAC+ ALG S+AG+
Sbjct  393   CNQGVEKIVDLATLTGACVVALGGSIAGV  421


 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +3

Query  1671  MGGKL-GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDA  1847
             +GG + G+FTPS+DLA E+  A+++ GEK WR+PLEESYWE+MKS +ADM+N G   G +
Sbjct  414   LGGSIAGVFTPSDDLANEIYLASEISGEKFWRLPLEESYWESMKSGVADMVNTGGRQGGS  473

Query  1848  ITASLFMK  1871
             ITA+LF+K
Sbjct  474   ITAALFLK  481



>gb|KFK32675.1| hypothetical protein AALP_AA6G274200 [Arabis alpina]
Length=523

 Score =   514 bits (1323),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 288/453 (64%), Positives = 338/453 (75%), Gaps = 35/453 (8%)
 Frame = +2

Query  257   MAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDEN-SKFQN  433
             M+H     TLGLT  N    PKISFAAKE+ + EWKGDIL VGVTEKD+ KD + SKF N
Sbjct  1     MSH-----TLGLTQANSTHSPKISFAAKEIGVTEWKGDILVVGVTEKDLTKDSSTSKFLN  55

Query  434   LILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRT  613
              IL KLD+ L GLL+E +SEEDF+GK GQSIVLRLP L  KR+GL+GLG  VSS  A+++
Sbjct  56    PILNKLDTHLSGLLTEVTSEEDFTGKPGQSIVLRLPGLASKRVGLIGLGQSVSSPAAFQS  115

Query  614   LGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTP  793
              GE +    K++Q+S+VA+ LAS E ++ ESKLS+ASA+A+GIV G FED R+K E K P
Sbjct  116   FGEAVGVTTKASQSSTVAIVLASPESVADESKLSSASAIASGIVLGLFEDGRYKSESKKP  175

Query  794   TLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLY  973
              LKSV+I+G GTGPE+EKKLKY+E VS GVIF +EL N+PANVLTP  LAEEA  +AS Y
Sbjct  176   ALKSVDIIGFGTGPELEKKLKYAEDVSYGVIFGRELTNSPANVLTPAVLAEEAAKLASTY  235

Query  974   SDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITF  1153
             SDV TA IL+ EQCKELKMGS+L VA A+ N  +FIHL YKPSSGSVKTKLAL+GKG+TF
Sbjct  236   SDVFTANILNEEQCKELKMGSYLAVAEASANRPHFIHLVYKPSSGSVKTKLALVGKGLTF  295

Query  1154  DSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTG  1333
             DSGGYN+K G   SIELMK DM G+A V GAAKAI +IKP GVEVHFIV ACENMISGTG
Sbjct  296   DSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTG  355

Query  1334  MRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADA  1513
             MRPGD++TASNGK IE                             V +TDAEGRL LADA
Sbjct  356   MRPGDVITASNGKTIE-----------------------------VNNTDAEGRLTLADA  386

Query  1514  LVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             LVYA   GV+K+VDLATLTGAC+ ALG S+AG+
Sbjct  387   LVYACNQGVDKIVDLATLTGACVIALGTSIAGI  419


 Score = 91.3 bits (225),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI+TPS++LAKEV+ A++  GEKLWRMPLE+SYWE MKS +ADM+N G   G +ITA+LF
Sbjct  418   GIYTPSDELAKEVIAASEKSGEKLWRMPLEDSYWEMMKSGVADMVNTGGRAGGSITAALF  477

Query  1866  MK  1871
             +K
Sbjct  478   LK  479



>ref|XP_003553879.1| PREDICTED: leucine aminopeptidase 3, chloroplastic-like isoform 
1 [Glycine max]
Length=582

 Score =   515 bits (1327),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 304/484 (63%), Positives = 360/484 (74%), Gaps = 42/484 (9%)
 Frame = +2

Query  176   IFLK---FRSTSAWA-ISFSVSPLCCRRPRRMAHSIARATLGLTHPNQIERPKISFAAKE  343
             +FLK    RS++ +  +SF+  PL     RR+   +ARATLGLT P   E  K+SFAAKE
Sbjct  33    LFLKTLTLRSSTPFQRLSFASQPL-----RRL---MARATLGLTLPANTESLKVSFAAKE  84

Query  344   VDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQS  523
             +D+ EWKGD+LAVGVTEKD+ ++  S+F+N IL  LDSKLGGLL + SSEEDFSGK GQS
Sbjct  85    LDVAEWKGDLLAVGVTEKDVARNVESRFENAILSALDSKLGGLLGQVSSEEDFSGKLGQS  144

Query  524   IVLRLPA-LGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV  700
              VLR+ + LGFKR+ L+GLG+  S+T A+++LGE +AAAAKSAQA  VAVALAS + LS 
Sbjct  145   TVLRIASGLGFKRVALLGLGASASTTSAFKSLGEAVAAAAKSAQAGHVAVALASPDALST  204

Query  701   ESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSG  880
             ESK   ASA+A+G + GTFEDNR+K E K   L SV+I+GLGTGPE+EKKLKY+  +SSG
Sbjct  205   ESKPKTASAIASGTLLGTFEDNRYKSESKKSVLSSVDIIGLGTGPELEKKLKYAADISSG  264

Query  881   VIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAA  1060
             +I  +ELVN+PANVLTPG LAEEA  IAS Y+DV TA ILD EQCKELKMGS+LGVAAA+
Sbjct  265   IILGRELVNSPANVLTPGVLAEEASKIASTYNDVFTAKILDAEQCKELKMGSYLGVAAAS  324

Query  1061  TNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvf  1240
              NP +FIHLCYKP +G V  KLAL+GKG+TFDSGGYN+K G    IELMK DM G+A VF
Sbjct  325   ANPPHFIHLCYKPPTGPVNVKLALVGKGLTFDSGGYNIKTGPGCLIELMKFDMGGSAAVF  384

Query  1241  gaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSR  1420
             GAAKA+ QIKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IE             
Sbjct  385   GAAKALGQIKPLGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIE-------------  431

Query  1421  SDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1600
                             V +TDAEGRL LADALVYA   G EK+VDLATLTGACI  LG S
Sbjct  432   ----------------VNNTDAEGRLTLADALVYACNQGAEKIVDLATLTGACIIGLGSS  475

Query  1601  VAGM  1612
             +AG+
Sbjct  476   IAGV  479


 Score = 99.0 bits (245),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV +A++  GEKLWR+PLEESYWE+MKS +ADM+N G   G AITA+LF
Sbjct  478   GVFTPSDDLAKEVFDASEASGEKLWRLPLEESYWESMKSGVADMVNTGGRPGSAITAALF  537

Query  1866  MK  1871
             +K
Sbjct  538   LK  539



>ref|XP_009410189.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=530

 Score =   513 bits (1322),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 281/438 (64%), Positives = 339/438 (77%), Gaps = 29/438 (7%)
 Frame = +2

Query  299   PNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLS  478
             P  IE P+I+F  KE+D  EWKGD+LAV V+EKD  KD +SKFQN+ L++LD K+GGLL+
Sbjct  20    PADIEIPQIAFTVKEMDFSEWKGDLLAVAVSEKDTKKDSDSKFQNVFLKRLDDKIGGLLA  79

Query  479   EASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqas  658
             EA +EEDF+GK+GQS  LRLP LGFKR+GLVGLGS  S+  AYR +GE +A  AK+AQA+
Sbjct  80    EAVTEEDFTGKAGQSTFLRLPGLGFKRLGLVGLGSSSSTAAAYRGIGEAVAGVAKAAQAN  139

Query  659   svavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPE  838
             SVAV LAS++G+S E K++AASA+A+G + G +EDNRF+ + K P LK+V+++G G+G  
Sbjct  140   SVAVCLASSDGISEELKINAASAIASGTILGVYEDNRFRSDSKKPLLKTVDVIGFGSGTV  199

Query  839   IEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCK  1018
             +++KLKY+  V SGVIF KELVNAPANVLTPGALAEEA  IA+LYSDVLTATILD EQCK
Sbjct  200   VDQKLKYATDVCSGVIFGKELVNAPANVLTPGALAEEASKIATLYSDVLTATILDAEQCK  259

Query  1019  ELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSI  1198
             ELKMGS+LGVAAA++NP +FIHLCYKP +G VK KLA++GKG+TFDSGGYN+K G   SI
Sbjct  260   ELKMGSYLGVAAASSNPPHFIHLCYKPPNGDVKRKLAIVGKGLTFDSGGYNIKTGPGCSI  319

Query  1199  ELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRI  1378
             E MK DM GAA  FGAAK++AQIKP GVEVHFI  ACENMISGTGMRPGDI+TASNGK I
Sbjct  320   ETMKVDMGGAAAAFGAAKSLAQIKPPGVEVHFISAACENMISGTGMRPGDIVTASNGKTI  379

Query  1379  EVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDL  1558
             E                             V +TDAEGRL LADALVYA   G++K+VDL
Sbjct  380   E-----------------------------VNNTDAEGRLTLADALVYACNQGIDKVVDL  410

Query  1559  ATLTGACITALGRSVAGM  1612
             ATLTGACI ALG S+AG 
Sbjct  411   ATLTGACIVALGPSIAGF  428


 Score = 93.2 bits (230),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G ++PS+DLAKE++ A++V GEK WRMPLEESYWE+MKS +ADM+N G   G +ITA+LF
Sbjct  427   GFYSPSDDLAKEIVTASEVTGEKFWRMPLEESYWESMKSGVADMVNTGGRQGGSITAALF  486

Query  1866  MK  1871
             +K
Sbjct  487   LK  488



>ref|XP_009140523.1| PREDICTED: leucine aminopeptidase 1 [Brassica rapa]
Length=521

 Score =   513 bits (1320),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 287/446 (64%), Positives = 338/446 (76%), Gaps = 34/446 (8%)
 Frame = +2

Query  281   TLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSK  460
             TLGLT PN  + PKISFAAKE+D+ EWKGD+L VGV E+D+ KD+ SKF+N IL KLD+ 
Sbjct  4     TLGLTKPNSTDHPKISFAAKEIDVTEWKGDLLVVGVREQDLTKDDGSKFENPILNKLDAH  63

Query  461   LGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSST--IAYRTLGETIaa  634
               GLL+  SSEEDF+GK GQS VLRLP L  KRIGL+GLG  VSS+   A+ +LGE +A 
Sbjct  64    TSGLLALVSSEEDFTGKPGQSTVLRLPGLATKRIGLIGLGKTVSSSSPAAFHSLGEGVAN  123

Query  635   aaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEI  814
              +K++Q+S+VAVALAS E    ESKLS+ASA+A+G+V G FED R+K E K P+L SV+I
Sbjct  124   VSKASQSSTVAVALASPES---ESKLSSASALASGVVLGLFEDGRYKSESKKPSLSSVDI  180

Query  815   LGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTAT  994
             +G GTGPE+EKKLKY+E VS GVIF +EL+N+PANVLTP  LAEEA  +AS YSDV TA 
Sbjct  181   IGFGTGPEVEKKLKYAEDVSYGVIFGRELINSPANVLTPAVLAEEAAKVASTYSDVFTAN  240

Query  995   ILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNL  1174
             IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKP SG VKTKLAL+GKG+TFDSGGYN+
Sbjct  241   ILNEEQCKELKMGSYLAVAAASANPPFFIHLVYKPKSGDVKTKLALVGKGLTFDSGGYNI  300

Query  1175  KIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDIL  1354
             K G   SIELMK DM G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGMRPGD++
Sbjct  301   KTGPGCSIELMKFDMGGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTGMRPGDVI  360

Query  1355  TASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKL  1534
             TASNGK IE                             V +TDAEGRL LADALVYA   
Sbjct  361   TASNGKTIE-----------------------------VNNTDAEGRLTLADALVYACNQ  391

Query  1535  GVEKMVDLATLTGACITALGRSVAGM  1612
             GV+K+VDLATLTGAC+ ALG SVAG+
Sbjct  392   GVDKIVDLATLTGACVIALGTSVAGI  417


 Score = 90.1 bits (222),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI+TP+++LAKEV+ A++  GEKLWRMPLEESYWE MKS  ADM+N G   G +ITA+LF
Sbjct  416   GIYTPNDELAKEVIAASEKSGEKLWRMPLEESYWEMMKSGCADMVNTGGRAGGSITAALF  475

Query  1866  MK  1871
             +K
Sbjct  476   LK  477



>sp|Q6K669.1|AMPL2_ORYSJ RecName: Full=Leucine aminopeptidase 2, chloroplastic; AltName: 
Full=Leucyl aminopeptidase 2; Short=LAP 2; AltName: Full=Proline 
aminopeptidase 2; AltName: Full=Prolyl aminopeptidase 
2; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD19264.1| putative leucine aminopeptidase [Oryza sativa Japonica Group]
 dbj|BAD19673.1| putative leucine aminopeptidase [Oryza sativa Japonica Group]
 gb|EAY87845.1| hypothetical protein OsI_09267 [Oryza sativa Indica Group]
 gb|EAZ24923.1| hypothetical protein OsJ_08704 [Oryza sativa Japonica Group]
Length=598

 Score =   515 bits (1326),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 291/476 (61%), Positives = 357/476 (75%), Gaps = 37/476 (8%)
 Frame = +2

Query  203   AWAISFSVSPLCCRRPRRMAHSIARA-----TLGLTHPNQIERPKISFAAKEVDLLEWKG  367
             A A++    PL  R   RM H+ A A      LGLT PN +E P++SFAAK+V+  EWKG
Sbjct  51    AAAVALGRQPLGHRA--RMGHTAAAAAAAGPALGLTKPNAVEPPQVSFAAKDVEFSEWKG  108

Query  368   DILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPAL  547
             DILA+ VTE D+VK  +SKF+N +L+KLD +LGGLLSEAS+EEDF+GK+GQS+VLRLP  
Sbjct  109   DILAIAVTENDLVKGSDSKFENAVLKKLDGQLGGLLSEASAEEDFTGKAGQSVVLRLPGQ  168

Query  548   GFKRIGLVGLG-SVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAAS  724
             GFKR+GL+GLG +  S+T A + +GE++A+ AKSAQASS A+  AS  G+  + KL+AA+
Sbjct  169   GFKRVGLIGLGQNAPSTTTACKGIGESVASVAKSAQASSAAIVFASVGGIQEDFKLTAAA  228

Query  725   AMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELV  904
             A+A+G V G  ED+R+K E K   LK V+++G G+GPE+++KLKY+  +SSGVIF KELV
Sbjct  229   AIASGTVLGLHEDSRYKSESKKVHLKQVDLIGFGSGPEVDQKLKYANDLSSGVIFGKELV  288

Query  905   NAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIH  1084
             N+PANVLTP  LAEEA NIAS YSDV TATILDVE+CKELKMGS+LGVAAA+ NP +FIH
Sbjct  289   NSPANVLTPAVLAEEASNIASTYSDVFTATILDVEKCKELKMGSYLGVAAASANPPHFIH  348

Query  1085  LCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQ  1264
             LCYKP  G+ K KLA++GKG+TFDSGGYN+K G   SIELMK DM G+A VFGAAKA+ Q
Sbjct  349   LCYKPPGGNAKRKLAIVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVFGAAKALGQ  408

Query  1265  IKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLG  1444
             IKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IE                     
Sbjct  409   IKPPGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIE---------------------  447

Query  1445  VIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                     V +TDAEGRL LADALVYA   GV+K++DLATLTGAC+ ALG S+AG+
Sbjct  448   --------VNNTDAEGRLTLADALVYACNQGVDKIIDLATLTGACVVALGPSIAGI  495


 Score = 95.5 bits (236),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GIFTPS++LAKEV  A+++ GEK WRMPLEESYWE+MKS +ADM+N G   G +ITA+LF
Sbjct  494   GIFTPSDELAKEVAAASEISGEKFWRMPLEESYWESMKSGVADMVNTGGRQGGSITAALF  553

Query  1866  MK  1871
             +K
Sbjct  554   LK  555



>ref|XP_002454700.1| hypothetical protein SORBIDRAFT_04g035840 [Sorghum bicolor]
 gb|EES07676.1| hypothetical protein SORBIDRAFT_04g035840 [Sorghum bicolor]
Length=594

 Score =   512 bits (1318),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 287/460 (62%), Positives = 351/460 (76%), Gaps = 36/460 (8%)
 Frame = +2

Query  254   RMAHSIARAT------LGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDE  415
             RM H+ A A       LGLT PN IE P+++F+AK+V+  EWKGDILAV VTEKD+ KD 
Sbjct  60    RMGHTAAAAAVAAEPALGLTKPNAIEPPQVTFSAKDVEFSEWKGDILAVAVTEKDLSKDA  119

Query  416   NSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSS  595
             +SKF+N +L+KLD +LGGLLSEA++EEDF+GK+GQS+VLRL   GFKR+GL+GLG    S
Sbjct  120   DSKFENAVLKKLDGQLGGLLSEAAAEEDFTGKTGQSVVLRLAGQGFKRVGLIGLGQNAPS  179

Query  596   TIAY-RTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRF  772
             T A  R LGE++A+ AK+AQAS+ A+ LAS  G+  E KL+AA+A+A+G V G +ED+R+
Sbjct  180   TAAAGRGLGESVASVAKAAQASTAAIVLASPSGIQEEFKLTAAAAIASGTVLGLYEDSRY  239

Query  773   KLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEA  952
             K E K   LK V+I+GLG+G ++++KLKY+  +SSGVIF +ELVN+PANVLTP  LAEEA
Sbjct  240   KSESKKVHLKQVDIIGLGSGADVDQKLKYANDLSSGVIFGRELVNSPANVLTPAVLAEEA  299

Query  953   KNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLAL  1132
               IAS YSDV TATILDVE+CKELKMGS+LGVAAA+ NP +FIHLCYKP+ G+VK KLA+
Sbjct  300   SKIASTYSDVFTATILDVEKCKELKMGSYLGVAAASANPPHFIHLCYKPTDGNVKRKLAI  359

Query  1133  LGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACE  1312
             +GKG+TFDSGGYN+K G   SIELMK DM G+A VFGAAKA+ QIKP GVEVHFIV ACE
Sbjct  360   VGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVFGAAKALGQIKPPGVEVHFIVAACE  419

Query  1313  NMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEG  1492
             NMISGTGMRPGDI+TASNGK IE                             V +TDAEG
Sbjct  420   NMISGTGMRPGDIVTASNGKTIE-----------------------------VNNTDAEG  450

Query  1493  RLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             RL LADALVYA   GVEK++DLATLTGAC+ ALG S+AG+
Sbjct  451   RLTLADALVYACNQGVEKIIDLATLTGACVIALGPSIAGV  490


 Score = 94.7 bits (234),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS++LAKEV  A++V GEK WR+PLEESYWE+MKS +ADM+N G   G +ITA+LF
Sbjct  489   GVFTPSDELAKEVTAASEVSGEKFWRLPLEESYWESMKSGVADMVNTGGRQGGSITAALF  548

Query  1866  MK  1871
             +K
Sbjct  549   LK  550



>gb|AFW73857.1| hypothetical protein ZEAMMB73_599286 [Zea mays]
Length=596

 Score =   511 bits (1317),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 288/468 (62%), Positives = 354/468 (76%), Gaps = 38/468 (8%)
 Frame = +2

Query  230   PLCCRRPRRMAHSIA------RATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVT  391
             PL  R   RM H+ A         LGLT PN +E P+++F+AK+++  EWKGDILAV VT
Sbjct  55    PLGHRT--RMGHTAAAAAAAAEPALGLTKPNAVEPPQVTFSAKDIEFSEWKGDILAVAVT  112

Query  392   EKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLV  571
             EKD+ KD +SKF+N +L+KLD +LGGLLSEA++EEDF+GK+GQS+VLRL   GFKR+GL+
Sbjct  113   EKDLSKDADSKFENAVLKKLDGQLGGLLSEAAAEEDFTGKTGQSVVLRLAGQGFKRVGLI  172

Query  572   GLG-SVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVS  748
             GLG S  S+  A R LGE++A+ AK+AQASS A+ LAS  G+  E KL+AA+A+A+G V 
Sbjct  173   GLGQSAPSTAAASRGLGESVASVAKAAQASSAAIVLASPSGIQEEFKLTAAAAVASGTVL  232

Query  749   GTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLT  928
             G +ED+R+K E K   LK V+I+GLG+G E+++KLKY+  +SSGVIF +ELVN+PANVLT
Sbjct  233   GLYEDSRYKSESKKVHLKQVDIIGLGSGAEVDQKLKYANDLSSGVIFGRELVNSPANVLT  292

Query  929   PGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSG  1108
             P  LAEEA  IAS YSDV TAT+LDVE+CKELKMGS+LGVAAA+ NP +FIHLCYKP+ G
Sbjct  293   PAVLAEEASKIASTYSDVFTATVLDVEKCKELKMGSYLGVAAASANPPHFIHLCYKPTDG  352

Query  1109  SVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEV  1288
             +VK KLA++GKG+TFDSGGYN+K G   SIELMK DM G+A VFGAAKA+ QIKP GVEV
Sbjct  353   NVKRKLAIVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVFGAAKALGQIKPPGVEV  412

Query  1289  HFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**  1468
             HFIV ACENMISGTGMRPGDI+TASNGK IE                             
Sbjct  413   HFIVAACENMISGTGMRPGDIVTASNGKTIE-----------------------------  443

Query  1469  VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             V +TDAEGRL LADALVYA   GVEK++DLATLTGAC+ ALG S+AG+
Sbjct  444   VNNTDAEGRLTLADALVYACNQGVEKIIDLATLTGACVVALGPSIAGI  491


 Score = 95.1 bits (235),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GIFTPS++LAKEV  A++V GEK WR+PLEESYWE+MKS +ADM+N G   G +ITA+LF
Sbjct  490   GIFTPSDELAKEVAAASEVSGEKFWRLPLEESYWESMKSGVADMVNTGGRQGGSITAALF  549

Query  1866  MK  1871
             +K
Sbjct  550   LK  551



>ref|XP_010429381.1| PREDICTED: leucine aminopeptidase 1 [Camelina sativa]
Length=518

 Score =   508 bits (1309),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 287/444 (65%), Positives = 339/444 (76%), Gaps = 33/444 (7%)
 Frame = +2

Query  281   TLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSK  460
             TLGLT PN  E  KISFAAKE+D++EWKGD+L VGVT+KD+ KDE+SKF+N IL KLD  
Sbjct  4     TLGLTQPNSTEPHKISFAAKEIDVIEWKGDVLVVGVTDKDLSKDESSKFKNPILNKLDDH  63

Query  461   LGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaa  640
             L GLL + SSEEDF+GK GQS VLRLP LG KRI L+GLG  V S  A+ +LG+ +   +
Sbjct  64    LSGLLVQVSSEEDFNGKPGQSTVLRLPGLGAKRIALIGLGQSVPS--AFHSLGDAVVTVS  121

Query  641   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  820
             K++Q++SVAV LAS   +S ESK+S+ASA+A+GIV G FED+R+K E K P+LKSV+I+G
Sbjct  122   KASQSTSVAVVLAST--VSDESKISSASALASGIVLGLFEDSRYKSESKKPSLKSVDIIG  179

Query  821   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1000
              GTGPE+EKKLKY+E VS GVIF +EL N+PANVLTP  LAEEA  +AS YSDV TA IL
Sbjct  180   FGTGPELEKKLKYAEDVSYGVIFGRELTNSPANVLTPAVLAEEAAKLASSYSDVFTANIL  239

Query  1001  DVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKI  1180
             + EQCKELKMGS+L VAAA+ NP +FIHL YKP SGSVKTKLAL+GKG+TFDSGGYN+K 
Sbjct  240   NEEQCKELKMGSYLAVAAASANPPHFIHLVYKPPSGSVKTKLALVGKGLTFDSGGYNIKT  299

Query  1181  GANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTA  1360
             G    IELMK DM G+A VFGAAKAIA+IKP GVEVHFIV ACENMISGTGMRPGD++TA
Sbjct  300   GPGCLIELMKLDMGGSAAVFGAAKAIAEIKPPGVEVHFIVAACENMISGTGMRPGDVITA  359

Query  1361  SNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGV  1540
             SNGK IE                             V +TDAEGRL LADALVYA   GV
Sbjct  360   SNGKTIE-----------------------------VNNTDAEGRLTLADALVYACNQGV  390

Query  1541  EKMVDLATLTGACITALGRSVAGM  1612
             +K+VDLATLTGAC+ ALG S+A +
Sbjct  391   DKIVDLATLTGACVVALGPSMAAI  414


 Score = 89.4 bits (220),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  1689  IFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFM  1868
             I+TPS++LAKEV+ A++  GEKLWRMPLE+SYWE MKS +ADM+N G   G +ITA+LF+
Sbjct  414   IYTPSDELAKEVVSASERSGEKLWRMPLEDSYWEMMKSGVADMVNTGGRAGGSITAALFL  473

Query  1869  K  1871
             K
Sbjct  474   K  474



>ref|XP_004954213.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like isoform 
X2 [Setaria italica]
Length=592

 Score =   510 bits (1313),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 290/473 (61%), Positives = 357/473 (75%), Gaps = 40/473 (8%)
 Frame = +2

Query  224   VSPLCCRRP----RRMAHSIARA-----TLGLTHPNQIERPKISFAAKEVDLLEWKGDIL  376
             ++PL  R+P     RM H+ A A      LGLT PN +E P+I+F+AK+ +  EWKGDIL
Sbjct  46    LAPLA-RQPLGHRARMGHTAAAAAAAGPALGLTKPNAVEPPQITFSAKDFEFSEWKGDIL  104

Query  377   AVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFK  556
             AV VTEKD+ KD +SKF+N +L+KLDS+LGGLLSEA++EEDF+GK+GQS+VLR+   GFK
Sbjct  105   AVAVTEKDLSKDSDSKFENAVLKKLDSQLGGLLSEAAAEEDFTGKAGQSVVLRVAGQGFK  164

Query  557   RIGLVGLGSVVSSTIAY-RTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMA  733
             R+GL+GLG    ST A  R LGE++A+ AK+AQASS A+  AS  G+  E KL+AA+A+A
Sbjct  165   RVGLIGLGQNAPSTAAACRGLGESVASVAKAAQASSAAIVFASPSGIQEEFKLTAAAAIA  224

Query  734   TGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAP  913
             +G V G++ED+R+K E K   LK V+I+GLG+GPE+++KLKY+  +SSGVIF +ELVN+P
Sbjct  225   SGTVLGSYEDSRYKSESKKVHLKQVDIIGLGSGPEVDQKLKYANDLSSGVIFGRELVNSP  284

Query  914   ANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCY  1093
             ANVLTP  LAEEA  IAS YSDV TATILD E+CKELKMGS+L VAAA+ NP +FIHLCY
Sbjct  285   ANVLTPAVLAEEASKIASTYSDVFTATILDEEKCKELKMGSYLAVAAASANPPHFIHLCY  344

Query  1094  KPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKP  1273
             KP+ G+VK KLA++GKG+TFDSGGYN+K G   SIELMK DM G+A VFGAAKA+ QIKP
Sbjct  345   KPTDGNVKRKLAIVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVFGAAKALGQIKP  404

Query  1274  AGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVID  1453
              GVEVHFIV ACENMISGTGMRPGDI+TASNGK IE                        
Sbjct  405   PGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIE------------------------  440

Query  1454  PFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                  V +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG ++AG+
Sbjct  441   -----VNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGPNIAGI  488


 Score = 95.1 bits (235),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GIFTPS++LAKEV  A++V GEK WR+PLEESYWE+MKS +ADM+N G   G +ITA+LF
Sbjct  487   GIFTPSDELAKEVTAASEVSGEKFWRLPLEESYWESMKSGVADMVNTGGRQGGSITAALF  546

Query  1866  MK  1871
             +K
Sbjct  547   LK  548



>ref|XP_009117239.1| PREDICTED: leucine aminopeptidase 1 [Brassica rapa]
Length=515

 Score =   507 bits (1305),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 287/452 (63%), Positives = 339/452 (75%), Gaps = 41/452 (9%)
 Frame = +2

Query  257   MAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNL  436
             MAHS     LGLT P   + PKISF+AK++D+ EWKGD+L VGVTEKD  +D +SKF+N 
Sbjct  1     MAHS-----LGLTQPKPTDHPKISFSAKDIDVTEWKGDLLVVGVTEKDSTRDSSSKFENP  55

Query  437   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTL  616
             IL KLD+   GLL+  SSEEDF+GK GQS VLRLP LG KRIGL+GLG     + A+++L
Sbjct  56    ILNKLDAHSSGLLALVSSEEDFNGKPGQSTVLRLPGLGSKRIGLIGLGK----SAAFQSL  111

Query  617   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  796
             GE +A  AK++Q+SSV VALAS E    ESKLS+ASA+A+G+V G FED RFK E K P+
Sbjct  112   GEAVATVAKASQSSSVGVALASHE---TESKLSSASALASGVVLGLFEDGRFKSESKKPS  168

Query  797   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  976
             L SV+I+G GTGPE+EKKLKY+E VS GVIF +EL N+PANVLTP  LAEEA  +AS YS
Sbjct  169   LSSVDIIGFGTGPELEKKLKYAEDVSYGVIFGRELTNSPANVLTPAVLAEEAVKVASSYS  228

Query  977   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1156
             DV TA IL+ EQC+ELKMGS+L VAAA+ NP +FIHL Y+PSSG VKTKLAL+GKG+TFD
Sbjct  229   DVFTANILNEEQCRELKMGSYLAVAAASANPPFFIHLVYRPSSGDVKTKLALVGKGLTFD  288

Query  1157  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1336
             SGGYN+K G  SSIELMK DM G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGM
Sbjct  289   SGGYNIKAGPGSSIELMKFDMGGSAAVLGAAKAIGEIKPPGVEVHFIVSACENMISGTGM  348

Query  1337  RPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADAL  1516
             RPGD++TASNGK IE                             V +TDAEGRL LADAL
Sbjct  349   RPGDVITASNGKTIE-----------------------------VNNTDAEGRLTLADAL  379

Query  1517  VYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             VYA   GV+K+VDLATLTGAC+ ALG S+AG+
Sbjct  380   VYACNQGVDKIVDLATLTGACVIALGTSMAGI  411


 Score = 83.6 bits (205),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI+TP+++LA EV+ A++  GEKL RMPLEESYWE MKS  ADM+N G   G +ITA+LF
Sbjct  410   GIYTPNDELATEVIAASEKSGEKLRRMPLEESYWEMMKSGCADMVNTGGRAGGSITAALF  469

Query  1866  MK  1871
             +K
Sbjct  470   LK  471



>ref|XP_010472421.1| PREDICTED: leucine aminopeptidase 1-like [Camelina sativa]
Length=518

 Score =   505 bits (1301),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 288/452 (64%), Positives = 342/452 (76%), Gaps = 38/452 (8%)
 Frame = +2

Query  257   MAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNL  436
             MAH     TLGLT PN  E  KISF AKE+D++EWKGD+L VGVT+KD+ KDE+SKF+N 
Sbjct  1     MAH-----TLGLTQPNSTEPHKISFTAKEIDVIEWKGDVLVVGVTDKDLTKDESSKFKNP  55

Query  437   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTL  616
             IL KLD  L GLL++ SSEEDF+GK GQS VLRLP LG KRI L+GLG  V S  A+ +L
Sbjct  56    ILNKLDDHLNGLLAQVSSEEDFNGKPGQSTVLRLPGLGAKRIALIGLGQSVPS--AFHSL  113

Query  617   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  796
             G+++   +K++Q+SSVAV LAS+  +S ESK+S+ASA+A+GIV G FED+R+K E K P+
Sbjct  114   GDSVVTVSKASQSSSVAVVLASS--VSDESKISSASALASGIVLGLFEDSRYKSESKKPS  171

Query  797   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  976
             LKSV+I+G GTGP +EKKLKY + VS GVIF +EL N+PANVLTP  LAEEA  +AS YS
Sbjct  172   LKSVDIIGFGTGPALEKKLKYDDDVSYGVIFGRELTNSPANVLTPAVLAEEAAKLASSYS  231

Query  977   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1156
             DV TATIL+ EQCK LKMGS+L VAAA+ NP +FIHL YKP SGSVKTKLAL+GKG+TFD
Sbjct  232   DVFTATILNEEQCKVLKMGSYLAVAAASANPPHFIHLVYKPPSGSVKTKLALVGKGLTFD  291

Query  1157  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1336
             SGGYN+K G    IELMK DM G+A VFGAAKAIA+IKP GVEVHFIV ACENMISGTGM
Sbjct  292   SGGYNIKTGPGCLIELMKLDMGGSAAVFGAAKAIAEIKPPGVEVHFIVAACENMISGTGM  351

Query  1337  RPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADAL  1516
             RPGD++TASNGK IE                             V +TDAEGRL LADAL
Sbjct  352   RPGDVITASNGKTIE-----------------------------VNNTDAEGRLTLADAL  382

Query  1517  VYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             VYA   GV+K+VDLATLTGAC+ ALG S+A +
Sbjct  383   VYACNQGVDKIVDLATLTGACVVALGPSMAAI  414


 Score = 89.4 bits (220),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  1689  IFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFM  1868
             I+TPS++LAKEV+ A++  GEKLWRMPLE+SYWE MKS +ADM+N G   G +ITA+LF+
Sbjct  414   IYTPSDELAKEVVSASERSGEKLWRMPLEDSYWEMMKSGVADMVNTGGRAGGSITAALFL  473

Query  1869  K  1871
             K
Sbjct  474   K  474



>emb|CDY39696.1| BnaA04g14130D [Brassica napus]
Length=522

 Score =   505 bits (1300),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 287/447 (64%), Positives = 337/447 (75%), Gaps = 35/447 (8%)
 Frame = +2

Query  281   TLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSK  460
             TLGLT PN  + PKISFAAKE+D+ EWKGD+L VGVTEKD+ KD+ SKF+N IL KLD+ 
Sbjct  4     TLGLTKPNSTDHPKISFAAKEIDVTEWKGDLLVVGVTEKDLTKDDGSKFENPILNKLDAH  63

Query  461   LGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLG---SVVSSTIAYRTLGETIa  631
               GLL+  SSEEDF+GK GQS VLRLP L  KRIGL+GLG   S  SS  A+ +LGE +A
Sbjct  64    TSGLLALVSSEEDFTGKPGQSTVLRLPGLATKRIGLIGLGKPASSSSSPTAFHSLGEGVA  123

Query  632   aaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVE  811
               +K++Q+S+VAVALAS E    ESKLS+ASA+A+G+V G FED R+K + K P+L SV+
Sbjct  124   NVSKASQSSTVAVALASPES---ESKLSSASALASGVVLGLFEDGRYKSDSKKPSLSSVD  180

Query  812   ILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTA  991
             I+G GTG E+EKKLKY+E VS GVIF +EL+N+PANVLTP  LAEEA  +AS YSDV TA
Sbjct  181   IIGFGTGAEVEKKLKYAEDVSYGVIFGRELINSPANVLTPAVLAEEAAKVASTYSDVFTA  240

Query  992   TILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYN  1171
              IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKP SG VKTKLAL+GKG+TFDSGGYN
Sbjct  241   NILNEEQCKELKMGSYLAVAAASANPPFFIHLVYKPKSGDVKTKLALVGKGLTFDSGGYN  300

Query  1172  LKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDI  1351
             +K G   SIELMK DM G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGMRPGD+
Sbjct  301   IKTGPGCSIELMKFDMGGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTGMRPGDV  360

Query  1352  LTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASK  1531
             +TASNGK IE                             V +TDAEGRL LADALVYA  
Sbjct  361   ITASNGKTIE-----------------------------VNNTDAEGRLTLADALVYACN  391

Query  1532  LGVEKMVDLATLTGACITALGRSVAGM  1612
              GV+K+VDLATLTGAC+ ALG SVAG+
Sbjct  392   QGVDKIVDLATLTGACVIALGTSVAGI  418


 Score = 90.1 bits (222),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI+TP+++LAKEV+ A++  GEKLWRMPLEESYWE MKS  ADM+N G   G +ITA+LF
Sbjct  417   GIYTPNDELAKEVIAASEKSGEKLWRMPLEESYWEMMKSGCADMVNTGGRAGGSITAALF  476

Query  1866  MK  1871
             +K
Sbjct  477   LK  478



>ref|XP_004514667.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Cicer 
arietinum]
Length=575

 Score =   506 bits (1303),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 289/449 (64%), Positives = 341/449 (76%), Gaps = 33/449 (7%)
 Frame = +2

Query  269   IARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQK  448
             +ARA+LGLTHP   + PK+SF AKE D+ EWKGD+LAV VTEKD+ +D +S+FQN IL  
Sbjct  56    MARASLGLTHPANTQTPKVSFTAKETDVAEWKGDLLAVAVTEKDVARDGDSRFQNPILSA  115

Query  449   LDSKLGGLLSEASSEEDFSGKSGQSIVLRLPA-LGFKRIGLVGLGSVVSSTIAYRTLGET  625
             LD KLGGLL+EASSEEDF+GK GQS VLR+ A LG KR+ L+GLG+  S    +++LGE 
Sbjct  116   LDFKLGGLLAEASSEEDFTGKLGQSTVLRIAAGLGSKRVALLGLGASASGPATFKSLGEA  175

Query  626   IaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKS  805
             +AAAAKSAQA+ VAV LAS++GLS    ++ ASA+ATG V GTFEDNR+K E K   LKS
Sbjct  176   VAAAAKSAQAAHVAVVLASSQGLSA---INTASAIATGTVLGTFEDNRYKSESKKTALKS  232

Query  806   VEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVL  985
             V+I+GLGTGP++EKKLKY+  VSSG++  +ELVN+PANVLTPG LAEEA  IAS YSDV 
Sbjct  233   VDIIGLGTGPDLEKKLKYAGDVSSGILLGRELVNSPANVLTPGVLAEEASKIASTYSDVF  292

Query  986   TATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGG  1165
             TA ILD EQCKELKMGS+L VAAA+ NP  FIHLCYKP SG V  KLAL+GKG+TFDSGG
Sbjct  293   TAKILDAEQCKELKMGSYLAVAAASANPPQFIHLCYKPPSGPVNVKLALVGKGLTFDSGG  352

Query  1166  YNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPG  1345
             YN+K G    IELMK DM G+A VFGAAKA+ QIKP GVEVHFIV ACENMISGTGMRPG
Sbjct  353   YNIKTGPGCMIELMKFDMGGSAAVFGAAKALGQIKPLGVEVHFIVAACENMISGTGMRPG  412

Query  1346  DILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYA  1525
             D++TASNGK IE                             V +TDAEGRL LADALVYA
Sbjct  413   DVVTASNGKTIE-----------------------------VNNTDAEGRLTLADALVYA  443

Query  1526  SKLGVEKMVDLATLTGACITALGRSVAGM  1612
                GV+K++DLATLTGACI ALG ++AG+
Sbjct  444   CNQGVDKIIDLATLTGACIIALGPTIAGV  472


 Score = 99.8 bits (247),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV +A++V GEKLWR+P+EESYWE+MKS +ADM+N G   G AITA+LF
Sbjct  471   GVFTPSDDLAKEVFDASEVSGEKLWRLPIEESYWESMKSGVADMVNTGGRQGGAITAALF  530

Query  1866  MK  1871
             +K
Sbjct  531   LK  532



>emb|CDY34790.1| BnaA09g41570D [Brassica napus]
Length=515

 Score =   503 bits (1295),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 285/452 (63%), Positives = 338/452 (75%), Gaps = 41/452 (9%)
 Frame = +2

Query  257   MAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNL  436
             MAHS     LGLT P   + PKISF+AK++D+ EWKGD+L VGVTEKD  +D +SKF+N 
Sbjct  1     MAHS-----LGLTQPKPTDHPKISFSAKDIDVTEWKGDLLVVGVTEKDSKRDSSSKFENP  55

Query  437   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTL  616
             IL KLD+   GLL+  SSEEDF+GK GQS VLRLP LG KRIGL+GLG     + A+++L
Sbjct  56    ILNKLDAHSSGLLALVSSEEDFNGKPGQSTVLRLPGLGSKRIGLIGLGK----SAAFQSL  111

Query  617   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  796
             GE +A  AK++Q+SSV VALAS E    ESKLS+ASA+A+G+V G FED RFK E K P+
Sbjct  112   GEAVATVAKASQSSSVGVALASHE---TESKLSSASALASGVVLGLFEDGRFKSESKKPS  168

Query  797   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  976
             L SV+I+G GTGPE+EKKLKY+E VS GVIF +EL N+PANVLTP  LA+EA  +AS YS
Sbjct  169   LSSVDIIGFGTGPEVEKKLKYAEDVSYGVIFGRELTNSPANVLTPAVLADEAVKVASSYS  228

Query  977   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1156
             DV TA IL+ EQC+ELKMGS+L VAAA+ NP +FIHL Y+P SG VKTKLAL+GKG+TFD
Sbjct  229   DVFTANILNEEQCRELKMGSYLAVAAASANPPFFIHLVYRPPSGDVKTKLALVGKGLTFD  288

Query  1157  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1336
             SGGYN+K G  SSIELMK DM G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGM
Sbjct  289   SGGYNIKAGPGSSIELMKFDMGGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTGM  348

Query  1337  RPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADAL  1516
             RPGD++TASNGK IE                             V +TDAEGRL LADAL
Sbjct  349   RPGDVITASNGKTIE-----------------------------VNNTDAEGRLTLADAL  379

Query  1517  VYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             VYA   GV+K+VDLATLTGAC+ ALG S+AG+
Sbjct  380   VYACNQGVDKIVDLATLTGACVIALGTSMAGI  411


 Score = 88.2 bits (217),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI+TP+++LA EV+ A++  GEKLWRMPLEESYWE MKS  ADM+N G   G +ITA+LF
Sbjct  410   GIYTPNDELATEVIAASEKSGEKLWRMPLEESYWEMMKSGCADMVNTGGRAGGSITAALF  469

Query  1866  MK  1871
             +K
Sbjct  470   LK  471



>emb|CAA18202.1| leucyl aminopeptidase-like protein (partial) [Arabidopsis thaliana]
 emb|CAB79809.1| leucyl aminopeptidase-like protein (partial) [Arabidopsis thaliana]
Length=505

 Score =   500 bits (1287),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 284/431 (66%), Positives = 335/431 (78%), Gaps = 29/431 (7%)
 Frame = +2

Query  320   KISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEED  499
             +ISF+ KE+D+ EWKGDILAVGVTEKDM KD NSKF+N IL+KLD+ LGGLL++ S+EED
Sbjct  1     QISFSGKEIDVTEWKGDILAVGVTEKDMAKDANSKFENPILKKLDAHLGGLLADVSAEED  60

Query  500   FSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  679
             FSGK GQS VLRLP LG KR+GL+GLG   S+  A+++LGE +AAAAK++QASSVAV LA
Sbjct  61    FSGKPGQSTVLRLPGLGSKRVGLIGLGKSASTPSAFQSLGEAVAAAAKASQASSVAVVLA  120

Query  680   saEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKY  859
             S+E  S ESKLS+AS +A+G V G FED+R+K E K P+LKSV  +G GTGPE+E KLKY
Sbjct  121   SSESFSDESKLSSASDIASGTVLGLFEDSRYKSESKKPSLKSVVFIGFGTGPELENKLKY  180

Query  860   SEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSF  1039
             +E VS GVIF KELVN+PANVL+P  LAEEA N+AS+YS+V+TA IL  EQCKELKMGS+
Sbjct  181   AEHVSYGVIFTKELVNSPANVLSPAVLAEEASNLASMYSNVMTANILKEEQCKELKMGSY  240

Query  1040  LGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDM  1219
             L VAAA+ NP +FIHL YKPSSG VKTKLAL+GKG+TFDSGGYN+KIG    IELMK D+
Sbjct  241   LAVAAASANPPHFIHLIYKPSSGPVKTKLALVGKGLTFDSGGYNIKIGPELIIELMKIDV  300

Query  1220  agaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAAL  1399
              G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGMRPGD++TASNGK IE      
Sbjct  301   GGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTGMRPGDVITASNGKTIE------  354

Query  1400  VLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGAC  1579
                                    V DTD+EGRL LADALVYA   GV+K+VD+ATLTG  
Sbjct  355   -----------------------VNDTDSEGRLTLADALVYACNQGVDKIVDIATLTGEI  391

Query  1580  ITALGRSVAGM  1612
             I ALG S+AGM
Sbjct  392   IVALGPSMAGM  402


 Score = 85.1 bits (209),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 60/79 (76%), Gaps = 2/79 (3%)
 Frame = +3

Query  1641  IESLT-EMYMIMGGKL-GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIAD  1814
             I +LT E+ + +G  + G++T S++LAKEV+ A+   GEKLWRMP+EESYWE MKS +AD
Sbjct  384   IATLTGEIIVALGPSMAGMYTASDELAKEVIAASQRSGEKLWRMPMEESYWEMMKSGVAD  443

Query  1815  MINAGSLDGDAITASLFMK  1871
             M+N G   G +ITA+LF+K
Sbjct  444   MVNFGGRAGGSITAALFLK  462



>gb|EMS53149.1| Leucine aminopeptidase 2, chloroplastic [Triticum urartu]
Length=533

 Score =   498 bits (1282),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 284/457 (62%), Positives = 345/457 (75%), Gaps = 34/457 (7%)
 Frame = +2

Query  257   MAHSIARAT----LGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSK  424
             M H+ A A+    LGLT  N +E P+++F  K+++  +WKGDILAV VTEKD+ K  +SK
Sbjct  1     MGHTSAAASAVPALGLTKANAVELPQVAFTGKDIEFSDWKGDILAVAVTEKDLYKGSDSK  60

Query  425   FQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLG-SVVSSTI  601
             F+N +L+KLD++L GLLSEAS+EEDF+GK+GQS+VLRL   GFKR+ LVGLG S  S+  
Sbjct  61    FENAVLKKLDAQLSGLLSEASAEEDFTGKAGQSVVLRLSGQGFKRVALVGLGQSAPSTAA  120

Query  602   AYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLE  781
             A R +GE++A+ AKSAQASSVA+ LAS  G+    KL+AA+A+A+G V G  ED+RFK E
Sbjct  121   ACRGIGESVASVAKSAQASSVAIVLASPAGIQEGFKLNAAAAIASGTVLGLHEDSRFKAE  180

Query  782   PKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNI  961
              K   LK V+++GLG+G E+++KLKY   +SSGVIF KELVNAPANVLTP  LAEEA  I
Sbjct  181   SKKVHLKQVDLIGLGSGSELDQKLKYVNDLSSGVIFGKELVNAPANVLTPAVLAEEASKI  240

Query  962   ASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGK  1141
             AS YSDV TATILDVE+C+ELKMGS+LGVAAA+ NP +FIHLCYKP  G+VK KLA++GK
Sbjct  241   ASEYSDVFTATILDVEKCQELKMGSYLGVAAASANPPHFIHLCYKPVGGNVKRKLAIVGK  300

Query  1142  GITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMI  1321
             G+TFDSGGYN+K G   SIELMK DM G+A VFGAAKA+AQIKP GVEVHFIV ACENMI
Sbjct  301   GLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVFGAAKALAQIKPPGVEVHFIVAACENMI  360

Query  1322  SGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLI  1501
             SGTGMRPGDILTASNGK IE                             V +TDAEGRL 
Sbjct  361   SGTGMRPGDILTASNGKTIE-----------------------------VNNTDAEGRLT  391

Query  1502  LADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             LADALVYA   GV+K++DLATLTGAC+ ALG S+AG+
Sbjct  392   LADALVYACNQGVDKIIDLATLTGACVVALGPSIAGI  428


 Score = 90.9 bits (224),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GIFTPS++LA+EV  A+++ GEK WR+P+EESYWE MKS +ADM+N G   G +ITA+LF
Sbjct  427   GIFTPSDELAQEVTAASELSGEKFWRLPMEESYWEQMKSGVADMVNTGGRQGGSITAALF  486

Query  1866  MK  1871
             +K
Sbjct  487   LK  488



>ref|XP_004954212.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like isoform 
X1 [Setaria italica]
Length=601

 Score =   500 bits (1287),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 289/482 (60%), Positives = 356/482 (74%), Gaps = 49/482 (10%)
 Frame = +2

Query  224   VSPLCCRRP----RRMAHSIARA-----TLGLTHPNQIERPKISFAAKEVDLLEWKGDIL  376
             ++PL  R+P     RM H+ A A      LGLT PN +E P+I+F+AK+ +  EWKGDIL
Sbjct  46    LAPLA-RQPLGHRARMGHTAAAAAAAGPALGLTKPNAVEPPQITFSAKDFEFSEWKGDIL  104

Query  377   AVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFK  556
             AV VTEKD+ KD +SKF+N +L+KLDS+LGGLLSEA++EEDF+GK+GQS+VLR+   GFK
Sbjct  105   AVAVTEKDLSKDSDSKFENAVLKKLDSQLGGLLSEAAAEEDFTGKAGQSVVLRVAGQGFK  164

Query  557   RIGLVGLGSVVSSTIAY-RTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMA  733
             R+GL+GLG    ST A  R LGE++A+ AK+AQASS A+  AS  G+  E KL+AA+A+A
Sbjct  165   RVGLIGLGQNAPSTAAACRGLGESVASVAKAAQASSAAIVFASPSGIQEEFKLTAAAAIA  224

Query  734   TGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAP  913
             +G V G++ED+R+K E K   LK V+I+GLG+GPE+++KLKY+  +SSGVIF +ELVN+P
Sbjct  225   SGTVLGSYEDSRYKSESKKVHLKQVDIIGLGSGPEVDQKLKYANDLSSGVIFGRELVNSP  284

Query  914   ANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCY  1093
             ANVLTP  LAEEA  IAS YSDV TATILD E+CKELKMGS+L VAAA+ NP +FIHLCY
Sbjct  285   ANVLTPAVLAEEASKIASTYSDVFTATILDEEKCKELKMGSYLAVAAASANPPHFIHLCY  344

Query  1094  KPSSGSVKTKLALLGKGITFDS---------GGYNLKIGANSSIELMKKDMagaavvfga  1246
             KP+ G+VK KLA++GKG+TFD          GGYN+K G   SIELMK DM G+A VFGA
Sbjct  345   KPTDGNVKRKLAIVGKGLTFDRLVILSTYFIGGYNIKTGPGCSIELMKFDMGGSAAVFGA  404

Query  1247  akaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSD  1426
             AKA+ QIKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IE               
Sbjct  405   AKALGQIKPPGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIE---------------  449

Query  1427  YIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVA  1606
                           V +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ ALG ++A
Sbjct  450   --------------VNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVVALGPNIA  495

Query  1607  GM  1612
             G+
Sbjct  496   GI  497


 Score = 95.1 bits (235),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GIFTPS++LAKEV  A++V GEK WR+PLEESYWE+MKS +ADM+N G   G +ITA+LF
Sbjct  496   GIFTPSDELAKEVTAASEVSGEKFWRLPLEESYWESMKSGVADMVNTGGRQGGSITAALF  555

Query  1866  MK  1871
             +K
Sbjct  556   LK  557



>gb|KHN17492.1| Leucine aminopeptidase 3, chloroplastic [Glycine soja]
Length=554

 Score =   497 bits (1279),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 299/517 (58%), Positives = 352/517 (68%), Gaps = 85/517 (16%)
 Frame = +2

Query  176   IFLKFRSTSAW--------AISFSVSPLCCRRPRR--MAHSIARATLGLTHPNQIERPKI  325
             IF+ F +TS+          + F+  PL  R P R  M+H++ARATLGLTHP+ IE PKI
Sbjct  7     IFVSFTTTSSSLFLTRLTSRLHFAAFPL--RSPTRKLMSHTLARATLGLTHPSNIETPKI  64

Query  326   SFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFS  505
             SF AK+VD+ EWKGDILAVGVTEKD+ +D NSKF+N+IL K+DSKLGGLL+EASSEEDFS
Sbjct  65    SFGAKDVDVTEWKGDILAVGVTEKDLARDANSKFENVILSKIDSKLGGLLAEASSEEDFS  124

Query  506   GKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasa  685
             GK GQS VLR+  LG KR+GL+GLG   S+   ++ LGE +  AAKS+QASSVAV LAS+
Sbjct  125   GKVGQSTVLRITGLGSKRVGLIGLGQSPSTPSPFKGLGEAVVEAAKSSQASSVAVVLASS  184

Query  686   EGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSE  865
             EGLS +SKLS A A+A+GI    +                + I+G G GPE+EKKLKY+ 
Sbjct  185   EGLSAQSKLSTAYAIASGIEFVVY----------------IYIIGFGMGPELEKKLKYAG  228

Query  866   VVSSGVIFVKELVNAPANVLTP--------GALAEEAKNIASLYSDVLTATILDVEQCKE  1021
              VSSG+IF +ELVN+PANVLTP        G LAEEA  IAS YSDV TA IL+ EQC E
Sbjct  229   DVSSGIIFGRELVNSPANVLTPVLDDLFTSGVLAEEAAKIASTYSDVFTAKILNAEQCAE  288

Query  1022  LKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIE  1201
             LKMGS+LGVAAA+ NP +FIHLCYKP SG V  KLAL+GKG+TFDSGGYN+K G   SIE
Sbjct  289   LKMGSYLGVAAASENPPHFIHLCYKPLSGPVNVKLALVGKGLTFDSGGYNIKTGPGCSIE  348

Query  1202  LMKKDMagaavvfgaakaiaQIKPAGVE--------------------VHFIVPACENMI  1321
             LMK DM G+A V G AKA+ QIKP GVE                    VHFIV ACENMI
Sbjct  349   LMKFDMGGSAAVLGTAKALGQIKPLGVEALLRGGDGWDVANHGFIYIKVHFIVAACENMI  408

Query  1322  SGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLI  1501
             SGTGMRPGDI+T SNGK IE                             V +TDAEGRL 
Sbjct  409   SGTGMRPGDIVTTSNGKTIE-----------------------------VNNTDAEGRLT  439

Query  1502  LADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             LADALVYA   GVEK++DLATLTGAC+ ALG S+AG+
Sbjct  440   LADALVYACNQGVEKIIDLATLTGACVVALGPSIAGV  476


 Score =   100 bits (248),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV EA+DV GEKLWR+PL ESYWETMKS +ADM+N G   G AI A+LF
Sbjct  475   GVFTPSDDLAKEVFEASDVSGEKLWRLPLGESYWETMKSGVADMLNTGGRQGGAIVAALF  534

Query  1866  MK  1871
             +K
Sbjct  535   LK  536



>gb|KHN42824.1| Leucine aminopeptidase 3, chloroplastic [Glycine soja]
Length=541

 Score =   494 bits (1272),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 278/469 (59%), Positives = 325/469 (69%), Gaps = 62/469 (13%)
 Frame = +2

Query  212   ISFSVSPLCCRRPRR--MAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVG  385
             + F+  PL  R P R  M+H++ARATLGLTHP+ IE PKISF AK+VD+ EWKGDILAVG
Sbjct  27    LHFAAFPL--RSPTRKLMSHTLARATLGLTHPSNIETPKISFGAKDVDVTEWKGDILAVG  84

Query  386   VTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIG  565
             VTEKD+ +D NSKF+N+IL K+DSKLGGLL+EASSEEDF   SG+    R         G
Sbjct  85    VTEKDLARDANSKFENVILSKIDSKLGGLLAEASSEEDF---SGKVESWR------GHCG  135

Query  566   LVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIV  745
              V       ++     L  +                    EGLS +SKLS A A+A+G V
Sbjct  136   GVAAAKSSQASSVAVALASS--------------------EGLSAQSKLSTAYAIASGAV  175

Query  746   SGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVL  925
              G FEDNR+K E K  TL+S++ +GLGTGPE+EKKLKY+  VSSG+IF +ELVN+PANVL
Sbjct  176   LGLFEDNRYKSEAKKSTLRSIDFIGLGTGPELEKKLKYAGDVSSGIIFGRELVNSPANVL  235

Query  926   TPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSS  1105
             TPG LAEEA  IAS YSDV TA IL+ EQC ELKMGS+LGVAAA+ NP +FIHLCYKP S
Sbjct  236   TPGVLAEEAAKIASTYSDVFTAKILNSEQCAELKMGSYLGVAAASANPPHFIHLCYKPLS  295

Query  1106  GSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVE  1285
             G V  KLAL+GKG+TFDSGGYN+K G   SIELMK DM G+A V G AKA+ QIKP GVE
Sbjct  296   GPVNVKLALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGTAKALGQIKPLGVE  355

Query  1286  VHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF*  1465
             VHFIV ACENMISGTGMRPGDI+TASNGK IE                            
Sbjct  356   VHFIVAACENMISGTGMRPGDIVTASNGKTIE----------------------------  387

Query  1466  *VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
              V +TDAEGRL LADALVYA   GVEK++DLATLTGAC+ ALG S+AG+
Sbjct  388   -VNNTDAEGRLTLADALVYACNQGVEKIIDLATLTGACVVALGPSIAGV  435


 Score =   102 bits (254),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV EA+DV GEKLWR+PLEESYWETMKS +ADM+N G   G AI A+LF
Sbjct  434   GVFTPSDDLAKEVFEASDVSGEKLWRLPLEESYWETMKSGVADMLNTGGRQGGAIVAALF  493

Query  1866  MK  1871
             +K
Sbjct  494   LK  495



>ref|XP_006649129.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Oryza 
brachyantha]
Length=529

 Score =   492 bits (1267),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 270/432 (63%), Positives = 335/432 (78%), Gaps = 30/432 (7%)
 Frame = +2

Query  320   KISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEED  499
             ++SFAAK+V+  +WKGD+LA+ VTEKD++K  +S+F+N +L+KLD +LGGLLSEAS+EED
Sbjct  24    RVSFAAKDVEFSDWKGDVLAIAVTEKDLIKGSDSQFENAVLKKLDGQLGGLLSEASAEED  83

Query  500   FSGKSGQSIVLRLPALGFKRIGLVGLG-SVVSSTIAYRTLGETIaaaaksaqassvaval  676
             F+GK+GQS+VLRLP  GFKR+GL+GLG +  S+T A + +GE+IA+ AKS QASS A+  
Sbjct  84    FTGKAGQSVVLRLPGQGFKRVGLIGLGQNAPSTTAACKGIGESIASVAKSVQASSAAIVF  143

Query  677   asaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLK  856
             AS  G+  + KL+AA+A+A+G V G  ED+R+K E K   LK V+++G G+GPE++KKLK
Sbjct  144   ASGGGIQEDFKLTAAAAIASGTVLGLHEDSRYKSESKKVHLKQVDLIGFGSGPEVDKKLK  203

Query  857   YSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGS  1036
             Y+  +SSGVIF KELVN+PANVLTP  LAEEA  IAS YSDV+TATILDVE+CKELKMGS
Sbjct  204   YANDLSSGVIFGKELVNSPANVLTPAVLAEEASKIASEYSDVITATILDVEKCKELKMGS  263

Query  1037  FLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKD  1216
             +L VAAA+ NP +FIHLCYKP  G+ K KLA++GKG+TFDSGGYN+K G   SIELMK D
Sbjct  264   YLAVAAASANPPHFIHLCYKPPGGNAKRKLAIVGKGLTFDSGGYNIKTGPGCSIELMKFD  323

Query  1217  MagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAA  1396
             M G+A VFGAAKA+ QIKPAGVEVHFIV ACENMISGTGMRPGDI+TASNGK IE     
Sbjct  324   MGGSAAVFGAAKALGQIKPAGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIE-----  378

Query  1397  LVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGA  1576
                                     V +TDAEGRL LADALVYA   GV+K++DLATLTGA
Sbjct  379   ------------------------VNNTDAEGRLTLADALVYACNQGVDKIIDLATLTGA  414

Query  1577  CITALGRSVAGM  1612
             C+ ALG S+AG+
Sbjct  415   CVVALGPSIAGI  426


 Score = 94.7 bits (234),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GIFTPS++LAKEV  A++V GEK WR+PLEESYWE+MKS +ADM+N G   G +ITA+LF
Sbjct  425   GIFTPSDELAKEVAAASEVSGEKFWRLPLEESYWESMKSGVADMVNTGGRQGGSITAALF  484

Query  1866  MK  1871
             +K
Sbjct  485   LK  486



>dbj|BAK00954.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00974.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04996.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=538

 Score =   492 bits (1267),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 278/444 (63%), Positives = 339/444 (76%), Gaps = 30/444 (7%)
 Frame = +2

Query  284   LGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKL  463
             LGLT  N +E P+++F  K+++  +WKGDILAV VTEKD+ K  +SKF+N +L+KLD++L
Sbjct  17    LGLTKANAVELPQVAFTGKDIEFSDWKGDILAVAVTEKDLSKGSDSKFENAVLKKLDAQL  76

Query  464   GGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLG-SVVSSTIAYRTLGETIaaaa  640
              GLLSEAS+EEDF+GK+GQS+VLRL   GFKR+ LVGLG S  S+  A R +GE++A+ A
Sbjct  77    SGLLSEASAEEDFTGKAGQSVVLRLSGQGFKRVALVGLGQSAPSTAAACRGIGESVASVA  136

Query  641   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  820
             KSAQA+SVA+ LAS  G+    KL+AA+A+A+G V G  ED+RFK E K   LK V+++G
Sbjct  137   KSAQATSVAIVLASPAGIQEGFKLNAAAAIASGTVLGLHEDSRFKAESKKVHLKQVDLIG  196

Query  821   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1000
             LG+G E+++KLKY   +SSGVIF KELVNAPANVLTP  LAEEA  IAS +SDV TATIL
Sbjct  197   LGSGSELDQKLKYVNDLSSGVIFGKELVNAPANVLTPAVLAEEASKIASEFSDVFTATIL  256

Query  1001  DVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKI  1180
             DVE+C+ELKMGS+LGVAAA+ NP +FIHLCYKP  G+VK KLA++GKG+TFDSGGYN+K 
Sbjct  257   DVEKCQELKMGSYLGVAAASANPPHFIHLCYKPVGGNVKRKLAIVGKGLTFDSGGYNIKT  316

Query  1181  GANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTA  1360
             G   SIELMK DM G+A VFGAAKA+AQIKP GVEVHFIV ACENMISGTGMRPGDILTA
Sbjct  317   GPGCSIELMKFDMGGSAAVFGAAKALAQIKPPGVEVHFIVAACENMISGTGMRPGDILTA  376

Query  1361  SNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGV  1540
             SNGK IE                             V +TDAEGRL LADALVYA   GV
Sbjct  377   SNGKTIE-----------------------------VNNTDAEGRLTLADALVYACNQGV  407

Query  1541  EKMVDLATLTGACITALGRSVAGM  1612
             +K++DLATLTGAC+ ALG S+AG+
Sbjct  408   DKIIDLATLTGACVVALGPSIAGI  431


 Score = 90.9 bits (224),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GIFTPS++LA+EV  A+++ GEK WR+P+EESYWE MKS +ADM+N G   G +ITA+LF
Sbjct  430   GIFTPSDELAQEVTAASELSGEKFWRLPMEESYWEQMKSGVADMVNTGGRQGGSITAALF  489

Query  1866  MK  1871
             +K
Sbjct  490   LK  491



>dbj|BAJ92683.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=538

 Score =   492 bits (1267),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 278/444 (63%), Positives = 339/444 (76%), Gaps = 30/444 (7%)
 Frame = +2

Query  284   LGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKL  463
             LGLT  N +E P+++F  K+++  +WKGDILAV VTEKD+ K  +SKF+N +L+KLD++L
Sbjct  17    LGLTKANAVELPQVAFTGKDIEFSDWKGDILAVAVTEKDLSKGSDSKFENAVLKKLDAQL  76

Query  464   GGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLG-SVVSSTIAYRTLGETIaaaa  640
              GLLSEAS+EEDF+GK+GQS+VLRL   GFKR+ LVGLG S  S+  A R +GE++A+ A
Sbjct  77    SGLLSEASAEEDFTGKAGQSVVLRLSGQGFKRVALVGLGQSAPSTAAACRGIGESVASVA  136

Query  641   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  820
             KSAQA+SVA+ LAS  G+    KL+AA+A+A+G V G  ED+RFK E K   LK V+++G
Sbjct  137   KSAQATSVAIVLASPAGIQEGFKLNAAAAIASGTVLGLHEDSRFKAESKKVHLKQVDLIG  196

Query  821   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1000
             LG+G E+++KLKY   +SSGVIF KELVNAPANVLTP  LAEEA  IAS +SDV TATIL
Sbjct  197   LGSGSELDQKLKYVNDLSSGVIFGKELVNAPANVLTPAVLAEEASKIASEFSDVFTATIL  256

Query  1001  DVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKI  1180
             DVE+C+ELKMGS+LGVAAA+ NP +FIHLCYKP  G+VK KLA++GKG+TFDSGGYN+K 
Sbjct  257   DVEKCQELKMGSYLGVAAASANPPHFIHLCYKPVGGNVKRKLAIVGKGLTFDSGGYNIKT  316

Query  1181  GANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTA  1360
             G   SIELMK DM G+A VFGAAKA+AQIKP GVEVHFIV ACENMISGTGMRPGDILTA
Sbjct  317   GPGCSIELMKFDMGGSAAVFGAAKALAQIKPPGVEVHFIVAACENMISGTGMRPGDILTA  376

Query  1361  SNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGV  1540
             SNGK IE                             V +TDAEGRL LADALVYA   GV
Sbjct  377   SNGKTIE-----------------------------VNNTDAEGRLTLADALVYACNQGV  407

Query  1541  EKMVDLATLTGACITALGRSVAGM  1612
             +K++DLATLTGAC+ ALG S+AG+
Sbjct  408   DKIIDLATLTGACVVALGPSIAGI  431


 Score = 90.1 bits (222),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GIFTPS++LA+EV  A+++ GEK WR+P+EESYWE M+S +ADM+N G   G +ITA+LF
Sbjct  430   GIFTPSDELAQEVTAASELSGEKFWRLPMEESYWEQMRSGVADMVNTGGRQGGSITAALF  489

Query  1866  MK  1871
             +K
Sbjct  490   LK  491



>ref|XP_008643980.1| PREDICTED: uncharacterized protein LOC100381923 isoform X1 [Zea 
mays]
Length=2086

 Score =   510 bits (1314),  Expect(2) = 1e-163, Method: Compositional matrix adjust.
 Identities = 285/460 (62%), Positives = 351/460 (76%), Gaps = 36/460 (8%)
 Frame = +2

Query  254   RMAHSIA------RATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDE  415
             RM H+ A         LGLT PN +E P+++F+AK+++  EWKGDILAV VTEKD+ KD 
Sbjct  1551  RMGHTAAAAAAAAEPALGLTKPNAVEPPQVTFSAKDIEFSEWKGDILAVAVTEKDLSKDA  1610

Query  416   NSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLG-SVVS  592
             +SKF+N +L+KLD +LGGLLSEA++EEDF+GK+GQS+VLRL   GFKR+GL+GLG S  S
Sbjct  1611  DSKFENAVLKKLDGQLGGLLSEAAAEEDFTGKTGQSVVLRLAGQGFKRVGLIGLGQSAPS  1670

Query  593   STIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRF  772
             +  A R LGE++A+ AK+AQASS A+ LAS  G+  E KL+AA+A+A+G V G +ED+R+
Sbjct  1671  TAAASRGLGESVASVAKAAQASSAAIVLASPSGIQEEFKLTAAAAVASGTVLGLYEDSRY  1730

Query  773   KLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEA  952
             K E K   LK V+I+GLG+G E+++KLKY+  +SSGVIF +ELVN+PANVLTP  LAEEA
Sbjct  1731  KSESKKVHLKQVDIIGLGSGAEVDQKLKYANDLSSGVIFGRELVNSPANVLTPAVLAEEA  1790

Query  953   KNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLAL  1132
               IAS YSDV TAT+LDVE+CKELKMGS+LGVAAA+ NP +FIHLCYKP+ G+VK KLA+
Sbjct  1791  SKIASTYSDVFTATVLDVEKCKELKMGSYLGVAAASANPPHFIHLCYKPTDGNVKRKLAI  1850

Query  1133  LGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACE  1312
             +GKG+TFDSGGYN+K G   SIELMK DM G+A VFGAAKA+ QIKP GVEVHFIV ACE
Sbjct  1851  VGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVFGAAKALGQIKPPGVEVHFIVAACE  1910

Query  1313  NMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEG  1492
             NMISGTGMRPGDI+TASNGK IE                             V +TDAEG
Sbjct  1911  NMISGTGMRPGDIVTASNGKTIE-----------------------------VNNTDAEG  1941

Query  1493  RLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             RL LADALVYA   GVEK++DLATLTGAC+ ALG S+AG+
Sbjct  1942  RLTLADALVYACNQGVEKIIDLATLTGACVVALGPSIAGI  1981


 Score = 95.9 bits (237),  Expect(2) = 1e-163, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GIFTPS++LAKEV  A++V GEK WR+PLEESYWE+MKS +ADM+N G   G +ITA+LF
Sbjct  1980  GIFTPSDELAKEVAAASEVSGEKFWRLPLEESYWESMKSGVADMVNTGGRQGGSITAALF  2039

Query  1866  MK  1871
             +K
Sbjct  2040  LK  2041



>ref|XP_010236855.1| PREDICTED: formin-like protein 7 [Brachypodium distachyon]
Length=2049

 Score =   509 bits (1310),  Expect(2) = 3e-163, Method: Compositional matrix adjust.
 Identities = 292/474 (62%), Positives = 358/474 (76%), Gaps = 40/474 (8%)
 Frame = +2

Query  218   FSVSPLCCRRP----RRMAHSIARAT----LGLTHPNQIERPKISFAAKEVDLLEWKGDI  373
             F  +PL  RRP     RM H+ A A+    LGLT PN +E P+++F AK+++  +W GD+
Sbjct  1504  FGAAPL--RRPLGHRARMGHTSAAASAVPALGLTKPNVVEPPQVNFTAKDIEFSDWTGDV  1561

Query  374   LAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGF  553
             LAV VTEKD+ K  +SKF+N +L KLDS+LGG+LSEAS+EEDF+GK+GQS+VLRL   GF
Sbjct  1562  LAVAVTEKDLSKGSDSKFENALLNKLDSQLGGILSEASAEEDFTGKAGQSVVLRLSGQGF  1621

Query  554   KRIGLVGLG-SVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAM  730
             KR+GL+GLG +  S+T A R +GE+IA+ AKSAQASS AV LAS  G+  E KL+AA+A+
Sbjct  1622  KRVGLIGLGQNAPSTTSACRGIGESIASVAKSAQASSAAVLLASPGGIQQEFKLNAAAAI  1681

Query  731   ATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNA  910
             A+G V G  ED+RFK + K   LK V+++GLG+GPE+++KLKY+  +SSGVIF KELVN+
Sbjct  1682  ASGTVLGLHEDSRFKSDSKKVHLKQVDLIGLGSGPEVDQKLKYANDLSSGVIFGKELVNS  1741

Query  911   PANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLC  1090
             PANVLTP  LAEEA  IAS YSDV TATILDVE+C+ELKMGS+LGVAAA+ NP +FIHLC
Sbjct  1742  PANVLTPAVLAEEASKIASTYSDVFTATILDVEKCQELKMGSYLGVAAASANPPHFIHLC  1801

Query  1091  YKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIK  1270
             YKP  G+VK KLA++GKG+TFDSGGYN+K G   SIELMK DM G+A VFGAAKA+AQIK
Sbjct  1802  YKPVGGNVKRKLAIVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVFGAAKALAQIK  1861

Query  1271  PAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVI  1450
             P GVEVHFIV ACENMISGTGMRPGDI+TASNGK IE                       
Sbjct  1862  PPGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIE-----------------------  1898

Query  1451  DPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                   V +TDAEGRL LADALVYA   GV+K++DLATLTGAC+ ALG S+AG+
Sbjct  1899  ------VNNTDAEGRLTLADALVYACNQGVDKIIDLATLTGACVVALGPSIAGI  1946


 Score = 96.3 bits (238),  Expect(2) = 3e-163, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GIFTPS++LAKEV  A++V GEK WR+PLEESYWE+MKS +ADM+N G   G +ITA+LF
Sbjct  1945  GIFTPSDELAKEVTAASEVSGEKFWRLPLEESYWESMKSGVADMVNTGGRQGGSITAALF  2004

Query  1866  MK  1871
             +K
Sbjct  2005  LK  2006



>gb|AAA80498.1| leucine aminopeptidase, partial [Solanum lycopersicum]
Length=523

 Score =   488 bits (1256),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 285/453 (63%), Positives = 344/453 (76%), Gaps = 33/453 (7%)
 Frame = +2

Query  254   RMAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQN  433
             R+ H IA  TLGLT PN+ + PKIS  AK+  +++W+GD+LA+G TE DM +DENSKF+N
Sbjct  1     RIVHCIAGDTLGLTRPNESDAPKISIGAKDTAVVQWQGDLLAIGATENDMARDENSKFKN  60

Query  434   LILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRT  613
              +LQ+LDS+L GLLS ASSEEDFSGKSGQS+ LR P     RI LVGLGS  SS  +Y +
Sbjct  61    PLLQQLDSELNGLLSAASSEEDFSGKSGQSVNLRFPG---GRITLVGLGSSASSPTSYHS  117

Query  614   LGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTP  793
             LG+  AAAAKS+QA ++AVALAS +GLS ESK+++ASA+ATG+V G+FEDNRF+ E K  
Sbjct  118   LGQAAAAAAKSSQARNIAVALASTDGLSAESKINSASAIATGVVLGSFEDNRFRSESKKS  177

Query  794   TLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLY  973
             TL+S++ILGLGTGPEIE+K+KY+E V +GVI  +ELVNAPAN++T   LAEEAK IAS Y
Sbjct  178   TLESLDILGLGTGPEIERKIKYAEHVCAGVILGRELVNAPANIVTNAVLAEEAKKIASTY  237

Query  974   SDVLTATILDVEQCKELKMGSFLGVAAAAT-NPSYFIHLCYKPSSGSVKTKLALLGKGIT  1150
             SDV++  ILD EQCKELKMG++L VAAAAT NP YFIHLC+K  +   KTKLAL+GKG+T
Sbjct  238   SDVISVNILDAEQCKELKMGAYLAVAAAATENPPYFIHLCFKTPTKERKTKLALVGKGLT  297

Query  1151  FDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGT  1330
             FDSGGYNLK+GA S IELMK DM GAA V GAAKA+ +I+P+ VEVHFIV ACENMIS  
Sbjct  298   FDSGGYNLKVGAGSRIELMKNDMGGAAAVLGAAKALGEIRPSRVEVHFIVAACENMISAE  357

Query  1331  GMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILAD  1510
             GMRPGDI+TASNGK IE                             V +TDAEGRL LAD
Sbjct  358   GMRPGDIVTASNGKTIE-----------------------------VNNTDAEGRLTLAD  388

Query  1511  ALVYASKLGVEKMVDLATLTGACITALGRSVAG  1609
             AL+YA   GVEK++DLATLTGA + ALG SVAG
Sbjct  389   ALIYACNQGVEKIIDLATLTGAIMVALGPSVAG  421


 Score = 97.1 bits (240),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G FTP++DLA+EV+EAA+  GEKLWRMP+EESYWE+MKS +ADMIN G  +G AIT +LF
Sbjct  421   GAFTPNDDLAREVVEAAEASGEKLWRMPMEESYWESMKSGVADMINTGPGNGGAITGALF  480

Query  1866  MK  1871
             +K
Sbjct  481   LK  482



>pdb|4KSI|A Chain A, Crystal Structure Analysis Of The Acidic Leucine Aminopeptidase 
Of Tomato
Length=529

 Score =   487 bits (1253),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 284/448 (63%), Positives = 342/448 (76%), Gaps = 33/448 (7%)
 Frame = +2

Query  269   IARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQK  448
             IA  TLGLT PN+ + PKIS  AK+  +++W+GD+LA+G TE DM +DENSKF+N +LQ+
Sbjct  12    IAGDTLGLTRPNESDAPKISIGAKDTAVVQWQGDLLAIGATENDMARDENSKFKNPLLQQ  71

Query  449   LDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETI  628
             LDS+L GLLS ASSEEDFSGKSGQS+ LR P     RI LVGLGS  SS  +Y +LG+  
Sbjct  72    LDSELNGLLSAASSEEDFSGKSGQSVNLRFPG---GRITLVGLGSSASSPTSYHSLGQAA  128

Query  629   aaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSV  808
             AAAAKS+QA ++AVALAS +GLS ESK+++ASA+ATG+V G+FEDNRF+ E K  TL+S+
Sbjct  129   AAAAKSSQARNIAVALASTDGLSAESKINSASAIATGVVLGSFEDNRFRSESKKSTLESL  188

Query  809   EILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLT  988
             +ILGLGTGPEIE+K+KY+E V +GVI  +ELVNAPAN++TP  LAEEAK IAS YSDV++
Sbjct  189   DILGLGTGPEIERKIKYAEHVCAGVILGRELVNAPANIVTPAVLAEEAKKIASTYSDVIS  248

Query  989   ATILDVEQCKELKMGSFLGVAAAAT-NPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGG  1165
               ILD EQCKELKMG++L VAAAAT NP YFIHLC+K  +   KTKLAL+GKG+TFDSGG
Sbjct  249   VNILDAEQCKELKMGAYLAVAAAATENPPYFIHLCFKTPTKERKTKLALVGKGLTFDSGG  308

Query  1166  YNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPG  1345
             YNLK+GA S IELMK DM GAA V GAAKA+ +I+P+ VEVHFIV ACENMIS  GMRPG
Sbjct  309   YNLKVGARSRIELMKNDMGGAAAVLGAAKALGEIRPSRVEVHFIVAACENMISAEGMRPG  368

Query  1346  DILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYA  1525
             DI+TASNGK IE                             V +TDAEGRL LADAL+YA
Sbjct  369   DIVTASNGKTIE-----------------------------VNNTDAEGRLTLADALIYA  399

Query  1526  SKLGVEKMVDLATLTGACITALGRSVAG  1609
                GVEK++DLATLTGA + ALG SVAG
Sbjct  400   CNQGVEKIIDLATLTGAIMVALGPSVAG  427


 Score = 97.1 bits (240),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G FTP++DLA+EV+EAA+  GEKLWRMP+EESYWE+MKS +ADMIN G  +G AIT +LF
Sbjct  427   GAFTPNDDLAREVVEAAEASGEKLWRMPMEESYWESMKSGVADMINTGPGNGGAITGALF  486

Query  1866  MK  1871
             +K
Sbjct  487   LK  488



>gb|KGN61047.1| hypothetical protein Csa_2G035470 [Cucumis sativus]
Length=526

 Score =   486 bits (1252),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 276/444 (62%), Positives = 334/444 (75%), Gaps = 30/444 (7%)
 Frame = +2

Query  281   TLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSK  460
             TLGLT P     PKI+FAAK+ D+LEW GD+LAVGVTEKD+VKD+N+ F N +L+KLD+ 
Sbjct  8     TLGLTRPGPSNAPKITFAAKDTDVLEWNGDLLAVGVTEKDVVKDDNNNFTNSLLKKLDAV  67

Query  461   LGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaa  640
             LGGLL+EASSEEDFSGKSGQ+IVLR+  L FKR+GL GLG    S  A+  LGE IAAAA
Sbjct  68    LGGLLAEASSEEDFSGKSGQAIVLRVSGLSFKRVGLFGLGQSAYSAAAFVGLGEAIAAAA  127

Query  641   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  820
             ++++A S+AVALA +  LS ESK   AS++A GIV+G F+DNR++  PK   L+SV++LG
Sbjct  128   QASRAVSLAVALAFSADLSDESKPDIASSIAIGIVNGIFDDNRYRSNPKATVLQSVDVLG  187

Query  821   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1000
             LG+G  + KKLKY++ VSSG++FV+ELVN+PAN+LTPG LA E  NIA  YSDVL+A I 
Sbjct  188   LGSGAAMIKKLKYAQYVSSGIVFVRELVNSPANILTPGQLAAEVLNIARNYSDVLSARIF  247

Query  1001  DVEQCKELKMGSFLGVAAAAT-NPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLK  1177
             + ++  E+KMGS+LGV AAAT NP  FIHLCYKP SG V  KL L+GKGITFDSGGYNLK
Sbjct  248   NEDEIIEMKMGSYLGVTAAATANPPKFIHLCYKPPSGCVSAKLGLVGKGITFDSGGYNLK  307

Query  1178  IGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILT  1357
              GANS+IE MK DM GA  +FGAAKAIA+IKP GVE+HF+V ACENMIS TGMRP DI+T
Sbjct  308   TGANSNIETMKNDMGGAGAIFGAAKAIAEIKPLGVEIHFVVAACENMISATGMRPSDIVT  367

Query  1358  ASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLG  1537
             A+NGK IE                             V +TDAEGRL LADAL+Y  KLG
Sbjct  368   AANGKTIE-----------------------------VNNTDAEGRLCLADALIYTCKLG  398

Query  1538  VEKMVDLATLTGACITALGRSVAG  1609
             V+K++DLATLTGACI ALG SVAG
Sbjct  399   VDKIIDLATLTGACIIALGPSVAG  422


 Score = 90.9 bits (224),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G FTP+E+LA EVL AA+  GEKLWR+P+EESYW++MKS +ADM+N G   G AITA+LF
Sbjct  422   GAFTPNEELASEVLSAAERSGEKLWRLPIEESYWDSMKSGVADMLNTGPSQGGAITAALF  481

Query  1866  MK  1871
             +K
Sbjct  482   LK  483



>ref|XP_010234597.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Brachypodium 
distachyon]
Length=526

 Score =   485 bits (1248),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 275/453 (61%), Positives = 342/453 (75%), Gaps = 31/453 (7%)
 Frame = +2

Query  257   MAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNL  436
             MAH+ A ATLGLT PN IE  +++FAA +++  EWKGD+LAV VTE D+ +  +++F+N 
Sbjct  1     MAHTAA-ATLGLTKPNAIEPLQVTFAATDIESSEWKGDLLAVAVTENDLSRGPDARFENA  59

Query  437   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLG-SVVSSTIAYRT  613
             +L KLDS+LGGLLSEAS+EEDF+GK+GQ++VLRL   GFKR+ L+GLG S  S+  A R 
Sbjct  60    VLTKLDSQLGGLLSEASAEEDFAGKTGQAVVLRLQGQGFKRLALIGLGRSAPSTAAACRA  119

Query  614   LGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTP  793
             +GE++AAAAKSAQA + A+ +AS   +    KL+AA+A+A+G V G   D+R++ EP   
Sbjct  120   IGESVAAAAKSAQAGTAAIVIASPGAIQEGFKLNAAAAIASGTVLGLHVDSRYRSEPNNV  179

Query  794   TLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLY  973
              LK V+++GLG+GPE+E+KL+++  VSSGVIF K+LVN+PANVLTP  LAEEA  IAS Y
Sbjct  180   HLKHVDLIGLGSGPELERKLQHANYVSSGVIFGKDLVNSPANVLTPVVLAEEASKIASTY  239

Query  974   SDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITF  1153
             SDV TATILD E+CKELKMGS+LGVAAA+ NP  FIHLCYKP  G+VK KLA++GKG+TF
Sbjct  240   SDVFTATILDAERCKELKMGSYLGVAAASANPPRFIHLCYKPPGGNVKRKLAIVGKGLTF  299

Query  1154  DSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTG  1333
             DSGGYN+K+GA  SIELMK DM G+A VFGAAKA+ QIKP GVEVHFIV ACENMISGTG
Sbjct  300   DSGGYNIKVGAICSIELMKWDMGGSAAVFGAAKALGQIKPPGVEVHFIVAACENMISGTG  359

Query  1334  MRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADA  1513
             MRPGDI+TASNG  IE                             V +TDAEGRL LADA
Sbjct  360   MRPGDIVTASNGMTIE-----------------------------VNNTDAEGRLTLADA  390

Query  1514  LVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             LVYA K GV+K++DLATLTG C  ALG S+AG+
Sbjct  391   LVYACKQGVDKIIDLATLTGYCRIALGLSIAGI  423


 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GIFTPS++L KEV  A++V GEK WR+PLEESYWE+MKSS+ADM+N G+  G AITA+LF
Sbjct  422   GIFTPSDELDKEVAAASEVSGEKFWRLPLEESYWESMKSSVADMVNTGTPQGGAITAALF  481

Query  1866  MK  1871
             +K
Sbjct  482   LK  483



>ref|XP_008785917.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Phoenix 
dactylifera]
Length=385

 Score =   478 bits (1231),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 264/382 (69%), Positives = 314/382 (82%), Gaps = 4/382 (1%)
 Frame = +2

Query  257   MAH--SIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQ  430
             M H  S  RATLGLT P  +E P+ISF+AKE+D   WKGDILAV V+E DM KD +SKF+
Sbjct  1     MGHVTSATRATLGLTKPALVEIPQISFSAKEIDFAVWKGDILAVAVSENDMSKDLDSKFE  60

Query  431   NLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLG--SVVSSTIA  604
             N IL++LD KLGGLL+EAS+EEDF+GK+GQS+VLRLP LGFKR+GLVGLG  S  S+  A
Sbjct  61    NSILKRLDEKLGGLLAEASTEEDFTGKAGQSMVLRLPGLGFKRVGLVGLGQCSPSSTATA  120

Query  605   YRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEP  784
             YR++GE +A  AK+AQA + AV LAS+ G+S E KL+AASA+A+G V G +ED+RFK + 
Sbjct  121   YRSIGEAVAVVAKAAQAINAAVILASSNGISEEFKLNAASAIASGTVLGVYEDSRFKSDS  180

Query  785   KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIA  964
             K   LK+V+I+GLG+GPE++KK+KY+  V SGVIF KEL NAPANVLTPG LAEEA  +A
Sbjct  181   KKTHLKAVDIIGLGSGPELDKKIKYASDVCSGVIFGKELANAPANVLTPGVLAEEASKVA  240

Query  965   SLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKG  1144
             S YSDVL ATILDVEQCKELKMGS+LGVAAA++NP +FIHLCYKP  G VK KLA++GKG
Sbjct  241   SSYSDVLMATILDVEQCKELKMGSYLGVAAASSNPPHFIHLCYKPPGGDVKRKLAIVGKG  300

Query  1145  ITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMIS  1324
             +TFDSGGYN+K G   SIELMK DM G+A  FGAAKAIAQIKP GVEVHFIV ACENMIS
Sbjct  301   LTFDSGGYNIKTGPGCSIELMKFDMGGSAAAFGAAKAIAQIKPPGVEVHFIVAACENMIS  360

Query  1325  GTGMRPGDILTASNGKRIEVTY  1390
             GTGMRPGDI+TASNGK IEV++
Sbjct  361   GTGMRPGDIVTASNGKTIEVSF  382



>ref|XP_004144796.1| PREDICTED: leucine aminopeptidase 1-like [Cucumis sativus]
Length=526

 Score =   483 bits (1243),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 275/444 (62%), Positives = 333/444 (75%), Gaps = 30/444 (7%)
 Frame = +2

Query  281   TLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSK  460
             TLGLT+P     PKI+FAAK+ D+LEW GD+LAVGVTEKD+VKD+N+ F N +L+KLD+ 
Sbjct  8     TLGLTNPGPSNAPKITFAAKDTDVLEWNGDLLAVGVTEKDVVKDDNNNFTNSLLKKLDAV  67

Query  461   LGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaa  640
             LGGLL+EASSEEDFSGKSGQ+IVLR+  L FKR+GL GLG    S  A+  LGE IAAAA
Sbjct  68    LGGLLAEASSEEDFSGKSGQAIVLRVSGLSFKRVGLFGLGQSAYSAAAFVGLGEAIAAAA  127

Query  641   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  820
             ++++A S+AVALA +  LS ESK   AS++A GIV+G F+DNR++   K   L+SV++LG
Sbjct  128   QASRAVSLAVALAFSADLSDESKPDIASSIAIGIVNGIFDDNRYRSNSKATVLQSVDVLG  187

Query  821   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1000
             LG+G    KKLKY++ VSSG++FV+ELVN+PAN+LTPG LA E  NIA  YSDVL+A I 
Sbjct  188   LGSGASTIKKLKYAQYVSSGIVFVRELVNSPANILTPGQLAAEVLNIARNYSDVLSARIF  247

Query  1001  DVEQCKELKMGSFLGVAAAAT-NPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLK  1177
             + ++  E+KMGS+LGV AAAT NP  FIHLCYKP SG V  KL L+GKGITFDSGGYNLK
Sbjct  248   NEDEIIEMKMGSYLGVTAAATANPPKFIHLCYKPPSGCVSAKLGLVGKGITFDSGGYNLK  307

Query  1178  IGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILT  1357
              GANS+IE MK DM GA  +FGAAKAIA+IKP GVE+HF+V ACENMIS TGMRP DI+T
Sbjct  308   TGANSNIETMKNDMGGAGAIFGAAKAIAEIKPLGVEIHFVVAACENMISATGMRPSDIVT  367

Query  1358  ASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLG  1537
             A+NGK IE                             V +TDAEGRL LADAL+Y  KLG
Sbjct  368   AANGKTIE-----------------------------VNNTDAEGRLCLADALIYTCKLG  398

Query  1538  VEKMVDLATLTGACITALGRSVAG  1609
             V+K++DLATLTGACI ALG SVAG
Sbjct  399   VDKIIDLATLTGACIIALGPSVAG  422


 Score = 91.3 bits (225),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G FTP+E+LA EVL AA+  GEKLWR+P+EESYW++MKS +ADM+N G   G AITA+LF
Sbjct  422   GAFTPNEELASEVLSAAERSGEKLWRLPMEESYWDSMKSGVADMLNTGPSQGGAITAALF  481

Query  1866  MK  1871
             +K
Sbjct  482   LK  483



>gb|AFW73856.1| hypothetical protein ZEAMMB73_599286 [Zea mays]
Length=487

 Score =   481 bits (1238),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 271/442 (61%), Positives = 334/442 (76%), Gaps = 36/442 (8%)
 Frame = +2

Query  254   RMAHSIA------RATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDE  415
             RM H+ A         LGLT PN +E P+++F+AK+++  EWKGDILAV VTEKD+ KD 
Sbjct  61    RMGHTAAAAAAAAEPALGLTKPNAVEPPQVTFSAKDIEFSEWKGDILAVAVTEKDLSKDA  120

Query  416   NSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLG-SVVS  592
             +SKF+N +L+KLD +LGGLLSEA++EEDF+GK+GQS+VLRL   GFKR+GL+GLG S  S
Sbjct  121   DSKFENAVLKKLDGQLGGLLSEAAAEEDFTGKTGQSVVLRLAGQGFKRVGLIGLGQSAPS  180

Query  593   STIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRF  772
             +  A R LGE++A+ AK+AQASS A+ LAS  G+  E KL+AA+A+A+G V G +ED+R+
Sbjct  181   TAAASRGLGESVASVAKAAQASSAAIVLASPSGIQEEFKLTAAAAVASGTVLGLYEDSRY  240

Query  773   KLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEA  952
             K E K   LK V+I+GLG+G E+++KLKY+  +SSGVIF +ELVN+PANVLTP  LAEEA
Sbjct  241   KSESKKVHLKQVDIIGLGSGAEVDQKLKYANDLSSGVIFGRELVNSPANVLTPAVLAEEA  300

Query  953   KNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLAL  1132
               IAS YSDV TAT+LDVE+CKELKMGS+LGVAAA+ NP +FIHLCYKP+ G+VK KLA+
Sbjct  301   SKIASTYSDVFTATVLDVEKCKELKMGSYLGVAAASANPPHFIHLCYKPTDGNVKRKLAI  360

Query  1133  LGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACE  1312
             +GKG+TFDSGGYN+K G   SIELMK DM G+A VFGAAKA+ QIKP GVEVHFIV ACE
Sbjct  361   VGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVFGAAKALGQIKPPGVEVHFIVAACE  420

Query  1313  NMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEG  1492
             NMISGTGMRPGDI+TASNGK IE                             V +TDAEG
Sbjct  421   NMISGTGMRPGDIVTASNGKTIE-----------------------------VNNTDAEG  451

Query  1493  RLILADALVYASKLGVEKMVDL  1558
             RL LADALVYA   GVEK++ L
Sbjct  452   RLTLADALVYACNQGVEKVMKL  473



>gb|ABK24447.1| unknown [Picea sitchensis]
Length=613

 Score =   485 bits (1249),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 269/451 (60%), Positives = 332/451 (74%), Gaps = 31/451 (7%)
 Frame = +2

Query  266   SIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQ  445
             +++   LGLT P ++  P+++F+AKE+ + EWKGDILAVGV EKD+ KDE+  F+N  L+
Sbjct  89    AVSEPNLGLTKPAEVTLPELTFSAKEIHVTEWKGDILAVGVFEKDVTKDESGVFENPTLK  148

Query  446   KLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTI--AYRTLG  619
             KLDS +GG+LS+   EEDFSGK+GQ+  +RLP  GFKR+GL+GLG   S+++  + +   
Sbjct  149   KLDSHVGGVLSDVIKEEDFSGKAGQAAFVRLPGFGFKRVGLIGLGKNGSASLTKSLKGFA  208

Query  620   ETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTL  799
             E +A AAK+AQA+ VAV L+S E LS+  KL++   +A G++ G +ED RFK E K P L
Sbjct  209   ENLAGAAKTAQATEVAVTLSSTEDLSISLKLNSVLTIAAGVLLGIYEDTRFKSETKKPFL  268

Query  800   KSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSD  979
             K ++ LGLG+GPE E+K +Y + V SGVI  ++LVNAPANV+TP ALA EA NIAS YS+
Sbjct  269   KGLDFLGLGSGPEFEQKFEYIQQVCSGVILSRQLVNAPANVITPSALANEASNIASAYSN  328

Query  980   VLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDS  1159
             VLTA ILDVEQCKELKMGS+LGVAAA+ NP  FIHLCYKP +G VK KLA++GKG+TFDS
Sbjct  329   VLTAKILDVEQCKELKMGSYLGVAAASANPPKFIHLCYKPPTGDVKIKLAIVGKGLTFDS  388

Query  1160  GGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMR  1339
             GGYN+K G   SIELMK DM G+A V GAAKAI QIKP GVEVHFIV ACENMISGTGMR
Sbjct  389   GGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGQIKPPGVEVHFIVAACENMISGTGMR  448

Query  1340  PGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALV  1519
             PGDI+TASNGK IE                             V +TDAEGRL LADALV
Sbjct  449   PGDIVTASNGKTIE-----------------------------VNNTDAEGRLTLADALV  479

Query  1520  YASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             YA K GV+K+VDLATLTGAC+ ALG  +AGM
Sbjct  480   YACKQGVDKVVDLATLTGACVVALGNDIAGM  510


 Score = 90.5 bits (223),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP++++A+E+ +AA++ GEK WRMPLEE+YWE+MKS IADM+N G   G +ITA+LF
Sbjct  509   GMFTPNDEMAEEISKAAEIAGEKFWRMPLEENYWESMKSGIADMVNTGGRQGGSITAALF  568

Query  1866  MK  1871
             +K
Sbjct  569   LK  570



>dbj|BAJ85842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=529

 Score =   469 bits (1208),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 272/454 (60%), Positives = 333/454 (73%), Gaps = 31/454 (7%)
 Frame = +2

Query  257   MAHSIAR-ATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQN  433
             MAH+ A  A LGLT PN IE  ++SFAA + +  +W+GD+LAV VTEKD+ +   S F+N
Sbjct  1     MAHTTAAVAALGLTKPNVIEPLQVSFAAVDTEPSDWEGDVLAVAVTEKDVCRSPCSSFEN  60

Query  434   LILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLG-SVVSSTIAYR  610
              +L++LDS LGGLLSEAS+EEDF+GK+GQ +VLRL   G KR+GL+GLG S   +  A R
Sbjct  61    AVLKRLDSHLGGLLSEASAEEDFAGKAGQLVVLRLQGKGLKRLGLIGLGRSAPITAAACR  120

Query  611   TLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKT  790
             +LGE  A+ AKSA+A+S A+ LA+  G+  E K  AA+A+A+G V G +EDNR++  P  
Sbjct  121   SLGECFASVAKSARAASAALVLAAPGGIHEEFKPIAAAAIASGTVLGLYEDNRYRSVPNK  180

Query  791   PTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASL  970
               LK V ++G G GPE+++KL+ +  VSSGVIF K+LVN+PANVLTP  LAEEA  IAS 
Sbjct  181   VHLKQVNLIGFGYGPEVDRKLELANHVSSGVIFGKDLVNSPANVLTPVVLAEEASKIAST  240

Query  971   YSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGIT  1150
             YSDV TATILD E+C+ELKMGS+L VAAA+ NP  FIHLCYKP  GSVK KLA++GKG+T
Sbjct  241   YSDVFTATILDAEKCRELKMGSYLAVAAASANPPRFIHLCYKPPGGSVKRKLAIVGKGLT  300

Query  1151  FDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGT  1330
             FDSGGYN+K+GA  SIELMK DM G+A VFGAAKA+ QIKP GVEVHFIV ACENMISGT
Sbjct  301   FDSGGYNIKVGAVCSIELMKWDMGGSAAVFGAAKALGQIKPPGVEVHFIVAACENMISGT  360

Query  1331  GMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILAD  1510
             GMRPGDI+TASNGK IE                             V +TDAEGRL LAD
Sbjct  361   GMRPGDIVTASNGKTIE-----------------------------VDNTDAEGRLTLAD  391

Query  1511  ALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             ALVYA K GV+K++DLATLTG C  ALG S+AG+
Sbjct  392   ALVYACKQGVDKIIDLATLTGFCRVALGPSIAGI  425


 Score = 74.7 bits (182),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 47/63 (75%), Gaps = 1/63 (2%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSL-DGDAITASL  1862
             GI TPS++L  E   A++  GEK WR+PLEESYWETMKS +ADM+N G +  G  ITA+L
Sbjct  424   GILTPSDELHAEAAAASEASGEKFWRLPLEESYWETMKSGVADMLNTGVIPQGGVITAAL  483

Query  1863  FMK  1871
             F+K
Sbjct  484   FLK  486



>ref|XP_002308402.1| leucine aminopeptidase family protein [Populus trichocarpa]
 gb|EEE91925.1| leucine aminopeptidase family protein [Populus trichocarpa]
Length=478

 Score =   467 bits (1201),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 268/404 (66%), Positives = 308/404 (76%), Gaps = 29/404 (7%)
 Frame = +2

Query  401   MVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLG  580
             M KD++ KF+N +L+KLD+KLGG LSEASSEEDF+GK GQS+VLRLP LG KRIGL+GLG
Sbjct  1     MAKDDSKKFENSLLKKLDAKLGGQLSEASSEEDFTGKPGQSLVLRLPGLGSKRIGLIGLG  60

Query  581   SVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFE  760
                ++T  +R  GE IAAAAK+AQAS V + LAS   +S ESKL+ ASA+ +G V GT+E
Sbjct  61    QSATNTYNFRNFGEAIAAAAKTAQASDVGIVLASTGSISNESKLNTASAIVSGTVLGTYE  120

Query  761   DNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGAL  940
             DNR+K + K P LKSV+ILGLGTGPE+ KKLKY+E VSS VIF KELVN+PANVLTP  L
Sbjct  121   DNRYKSDSKRPVLKSVDILGLGTGPELVKKLKYAEDVSSAVIFGKELVNSPANVLTPAVL  180

Query  941   AEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKT  1120
             AEEA  IAS YSDVL+ATIL  EQC ELKMGS+LGVAAA+ NP +FIHLCYKPSSG VK 
Sbjct  181   AEEASKIASTYSDVLSATILSAEQCIELKMGSYLGVAAASANPPHFIHLCYKPSSGPVKA  240

Query  1121  KLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIV  1300
             KLAL+GKG+TFDSGGYN+K G   SIE MK DM G+A V GAAKAI Q+KP GVEVHFIV
Sbjct  241   KLALVGKGLTFDSGGYNIKTGPGCSIEFMKFDMGGSAAVLGAAKAIGQVKPRGVEVHFIV  300

Query  1301  PACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDT  1480
              ACENMISGTGMRPGDI+TASNGK IE                             V +T
Sbjct  301   AACENMISGTGMRPGDIVTASNGKTIE-----------------------------VNNT  331

Query  1481  DAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             DAEGRL LADALVYA   GVEK++DLATLTGAC  ALG S+AG+
Sbjct  332   DAEGRLTLADALVYACNQGVEKIIDLATLTGACRVALGPSIAGV  375


 Score = 97.8 bits (242),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS++LA EV  AA+  GEKLWRMPLEESYWE+MKS +ADM+N G+  G AITA+LF
Sbjct  374   GVFTPSDELANEVFTAAEASGEKLWRMPLEESYWESMKSGVADMVNTGARQGGAITAALF  433

Query  1866  MK  1871
             +K
Sbjct  434   LK  435



>ref|NP_001189587.1| aminopeptidase family protein [Arabidopsis thaliana]
 gb|AEC07541.1| aminopeptidase family protein [Arabidopsis thaliana]
Length=484

 Score =   452 bits (1164),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 263/452 (58%), Positives = 313/452 (69%), Gaps = 72/452 (16%)
 Frame = +2

Query  257   MAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNL  436
             MAH     TLGLT PN  E  KISF AKE+D++EWKGDIL VGVTEKD+ KD NSKF+N 
Sbjct  1     MAH-----TLGLTQPNSTEPHKISFTAKEIDVIEWKGDILVVGVTEKDLAKDGNSKFENP  55

Query  437   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTL  616
             IL K+D+ L GLL++ SSEEDF+GK GQS VLRLP LG KRI L+GLG  VSS +A+ +L
Sbjct  56    ILSKVDAHLSGLLAQVSSEEDFTGKPGQSTVLRLPGLGSKRIALIGLGQSVSSPVAFHSL  115

Query  617   GETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPT  796
             GE +A  +K++Q++S A+ LAS+  +S ESKLS+ SA+A+GIV G FED R+K E K P+
Sbjct  116   GEAVATVSKASQSTSAAIVLASS--VSDESKLSSVSALASGIVLGLFEDGRYKSESKKPS  173

Query  797   LKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  976
             LK+V+I+G GTG                                    AEEA  +AS YS
Sbjct  174   LKAVDIIGFGTG------------------------------------AEEAAKVASTYS  197

Query  977   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1156
             DV TA IL+ EQCKELKMGS+L VAAA+ NP +FIHL YKP +GSVKTKLAL+GKG+TFD
Sbjct  198   DVFTANILNEEQCKELKMGSYLAVAAASANPPHFIHLVYKPPNGSVKTKLALVGKGLTFD  257

Query  1157  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1336
             SGGYN+K G   SIELMK DM G+A V GAAKAI +IKP GVEVHFIV ACENMISGTGM
Sbjct  258   SGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGEIKPPGVEVHFIVAACENMISGTGM  317

Query  1337  RPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADAL  1516
             RPGD++TASNGK IE                             V +TDAEGRL LADAL
Sbjct  318   RPGDVITASNGKTIE-----------------------------VNNTDAEGRLTLADAL  348

Query  1517  VYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             VYA   GV+K+VDLATLTGAC+ ALG S+AG+
Sbjct  349   VYACNQGVDKIVDLATLTGACVIALGTSMAGI  380


 Score = 92.8 bits (229),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI+TPS++LAKEV+ A++  GEKLWRMPLEESYWE MKS +ADM+N G   G +ITA+LF
Sbjct  379   GIYTPSDELAKEVIAASERSGEKLWRMPLEESYWEMMKSGVADMVNTGGRAGGSITAALF  438

Query  1866  MK  1871
             +K
Sbjct  439   LK  440



>gb|EMT02487.1| Formin-like protein 7 [Aegilops tauschii]
Length=1819

 Score =   456 bits (1172),  Expect(2) = 7e-146, Method: Compositional matrix adjust.
 Identities = 254/430 (59%), Positives = 306/430 (71%), Gaps = 57/430 (13%)
 Frame = +2

Query  323   ISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDF  502
             I+F  K+++  +WKGDILAV VTEKD+ K  +SKF+N +L+KLD++L GLLSEAS+EEDF
Sbjct  1343  IAFTGKDIEFSDWKGDILAVAVTEKDLSKGSDSKFENAVLKKLDAQLSGLLSEASAEEDF  1402

Query  503   SGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalas  682
             +GK+GQS+VLRL   GFKR   V L S V+  +A  T                       
Sbjct  1403  TGKAGQSVVLRLSGQGFKR---VALASSVAVVLASPT-----------------------  1436

Query  683   aEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYS  862
               G+    KL+AA+A+A+G V G  ED+RFK E K   LK V+++GLG+G E+++KLKY 
Sbjct  1437  --GVQEGFKLNAAAAIASGTVLGLHEDSRFKAESKKVHLKQVDLIGLGSGSELDQKLKYV  1494

Query  863   EVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFL  1042
               +SSGVIF KELVNAPANVLTP  LAEEA  IAS +SDV TATILDVE+C+ELKMGS+L
Sbjct  1495  NDLSSGVIFGKELVNAPANVLTPAVLAEEASKIASEHSDVFTATILDVEKCQELKMGSYL  1554

Query  1043  GVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMa  1222
             GVAAA+ NP +FIHLCYKP  G+VK KLA++GKG+TFDSGGYN+K G   SIELMK DM 
Sbjct  1555  GVAAASANPPHFIHLCYKPVGGNVKRKLAIVGKGLTFDSGGYNIKTGPGCSIELMKFDMG  1614

Query  1223  gaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALV  1402
             G+A VFGAAKA+AQIKP GVEVHFIV ACENMISGTGMRPGDILTASNGK IE       
Sbjct  1615  GSAAVFGAAKALAQIKPPGVEVHFIVAACENMISGTGMRPGDILTASNGKTIE-------  1667

Query  1403  LRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACI  1582
                                   V +TDAEGRL LADALVYA   GV+K++DLATLTGAC+
Sbjct  1668  ----------------------VNNTDAEGRLTLADALVYACNQGVDKIIDLATLTGACV  1705

Query  1583  TALGRSVAGM  1612
              ALG S+AG+
Sbjct  1706  VALGPSIAGI  1715


 Score = 91.7 bits (226),  Expect(2) = 7e-146, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GIFTPS++LA+EV  A+++ GEK WR+P+EESYWE MKS +ADM+N G   G +ITA+LF
Sbjct  1714  GIFTPSDELAQEVAAASELSGEKFWRLPMEESYWEQMKSGVADMVNTGGRQGGSITAALF  1773

Query  1866  MK  1871
             +K
Sbjct  1774  LK  1775



>gb|EAY82956.1| hypothetical protein OsI_38175 [Oryza sativa Indica Group]
Length=525

 Score =   444 bits (1143),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 274/450 (61%), Positives = 335/450 (74%), Gaps = 41/450 (9%)
 Frame = +2

Query  299   PNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVK--DENSKFQNLI--LQKLDSKLG  466
             PN ++ P+ISFAAK++DL EW+GDILAV VTE D+ K    +S+F N    L KLD +LG
Sbjct  2     PNVVDPPQISFAAKDMDLTEWEGDILAVLVTETDVSKATSSSSRFTNAAAALAKLDGELG  61

Query  467   GLLSEASSEEDFSGKSGQSIVLRLPAL----GFKRIGLVGLGS-VVSSTIAYRTLGETIa  631
             GLLSEAS+EE+F+G++GQS+ LRLP      GFKR+ LVG+G+ + SS  A R+ GETIA
Sbjct  62    GLLSEASAEEEFAGRAGQSVALRLPTAPGLHGFKRVCLVGVGNNMPSSAAACRSTGETIA  121

Query  632   aaaksaqassvavalasaEGLSVES---KLSAASAMATGIVSGTFEDNRFKLEPKTPTLK  802
             A AKSAQA S AVALAS     V+    +L+AA+A+A+G+V G  ED R+K + K   LK
Sbjct  122   AVAKSAQARSAAVALASPPPGWVQGEDLRLNAAAAVASGVVLGLHEDRRYKSDSKKVHLK  181

Query  803   SVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDV  982
              V+++G G+G E+ +KL+Y+  VSS VIF KELVN+PANVLTP  LAEEA NIAS YSDV
Sbjct  182   QVDLIGFGSGQEMGRKLQYANHVSSAVIFAKELVNSPANVLTPAVLAEEASNIASSYSDV  241

Query  983   LTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSG  1162
             LTATILD E+C+ELKMGS+L VAAA+ NP +FIHLCYKP  G+VK KLA++GKG+TFDSG
Sbjct  242   LTATILDEEKCRELKMGSYLAVAAASANPPHFIHLCYKPPGGNVKRKLAIVGKGLTFDSG  301

Query  1163  GYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRP  1342
             GYN+KIGA ++IELMKKDM G+A +FGAAKA+ QIKP GVEVHFI  ACENMISGTGMRP
Sbjct  302   GYNIKIGAVTTIELMKKDMGGSAALFGAAKALGQIKPPGVEVHFISAACENMISGTGMRP  361

Query  1343  GDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVY  1522
             GDI+TASNGK IE                             V +TDAEGRL LADALVY
Sbjct  362   GDIVTASNGKTIE-----------------------------VDNTDAEGRLTLADALVY  392

Query  1523  ASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             A KLGV+K++DLATLTG C  ALG S+AG+
Sbjct  393   ACKLGVDKIIDLATLTGYCRIALGPSIAGI  422


 Score = 87.4 bits (215),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI TPS++L KEV  A +  GEK WR+PLEESYWE MKSS+ADM+N GS  G AITA LF
Sbjct  421   GILTPSDELDKEVAAAYEASGEKFWRLPLEESYWEQMKSSVADMLNTGSPLGGAITAGLF  480

Query  1866  MK  1871
             +K
Sbjct  481   LK  482



>ref|XP_004158743.1| PREDICTED: leucine aminopeptidase 1-like [Cucumis sativus]
Length=503

 Score =   442 bits (1136),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 260/431 (60%), Positives = 312/431 (72%), Gaps = 43/431 (10%)
 Frame = +2

Query  320   KISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEED  499
              I+FAAK+ D+LEW GD+LAVGVTEKD             ++KLD+ LGGLL+EASSEED
Sbjct  11    NITFAAKDTDVLEWNGDLLAVGVTEKD-------------VKKLDAVLGGLLAEASSEED  57

Query  500   FSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  679
             FSGKSGQ+IVLR+  L FKR+GL GLG    S  A+  LGE IAAAA++++A S+AVALA
Sbjct  58    FSGKSGQAIVLRVSGLSFKRVGLFGLGQSAYSAAAFVGLGEAIAAAAQASRAVSLAVALA  117

Query  680   saEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKY  859
              +  LS ESK   AS++A GIV+G F+DNR++  PK   L+SV +LGLG+G    KKLKY
Sbjct  118   FSADLSDESKPDIASSIAIGIVNGIFDDNRYRSNPKATVLQSVYVLGLGSGASTIKKLKY  177

Query  860   SEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSF  1039
             ++ VSSG++FV+ELVN+PAN+LTPG LA E  NI   YSDVL+A I + ++  E+KMGS+
Sbjct  178   AQYVSSGIVFVRELVNSPANILTPGQLAAEVLNITRNYSDVLSARIFNEDEIIEMKMGSY  237

Query  1040  LGVAAAAT-NPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKD  1216
             LGV AAAT NP  FIHLCYKP SG V  KL L+GKGITFDSGGYNLK GANS+IE MK D
Sbjct  238   LGVTAAATANPPKFIHLCYKPPSGCVSAKLGLVGKGITFDSGGYNLKTGANSNIETMKND  297

Query  1217  MagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAA  1396
             M GA  +FGAAKAIA+IKP GVE+HF+V ACENMIS TGMRP DI+TA+NGK IE     
Sbjct  298   MGGAGAIFGAAKAIAEIKPLGVEIHFVVAACENMISATGMRPSDIVTAANGKTIE-----  352

Query  1397  LVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGA  1576
                                     V +TDAEGRL LADAL+Y  K GV K++DLATLTGA
Sbjct  353   ------------------------VNNTDAEGRLCLADALLYTCKQGVAKIIDLATLTGA  388

Query  1577  CITALGRSVAG  1609
             CITALG SVAG
Sbjct  389   CITALGPSVAG  399


 Score = 90.1 bits (222),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G FTP+E+LA EVL AA+  GEKLWR+P+EESYW++MKS +ADM+N G   G AITA+LF
Sbjct  399   GAFTPNEELASEVLFAAERSGEKLWRLPMEESYWDSMKSGVADMLNTGPSQGGAITAALF  458

Query  1866  MK  1871
             +K
Sbjct  459   LK  460



>gb|EEE53139.1| hypothetical protein OsJ_35947 [Oryza sativa Japonica Group]
Length=554

 Score =   440 bits (1131),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 278/473 (59%), Positives = 339/473 (72%), Gaps = 58/473 (12%)
 Frame = +2

Query  281   TLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVK--DENSKFQNLI--LQK  448
             TLGLT PN ++ P+ISFAAK++DL EW+GDILAV VTE D+ K    +S+F N    L K
Sbjct  8     TLGLTMPNVVDPPQISFAAKDMDLTEWEGDILAVLVTETDVSKATSSSSRFTNAAAALAK  67

Query  449   LDSKLGGLLSEASSEEDFSGKSGQSIVLRLPAL----GFKRIGLVGLGS-VVSSTIAYRT  613
             LD +LGGLLSEAS+EE+F+G++GQS+ LRLP      GFKR+ LVG+G+ + SS  A R+
Sbjct  68    LDGELGGLLSEASAEEEFAGRAGQSVALRLPTAPGLHGFKRVCLVGVGNNMPSSAAACRS  127

Query  614   LGETIaaaaksaqassvavalasaEGLSVES---KLSAASAMATGIVSGTFEDNRFKLEP  784
              GETIAA AKSAQA S AVALAS     V+    +L+AA+A+A+G+V G  ED R+K + 
Sbjct  128   TGETIAAVAKSAQARSAAVALASPPPGWVQGEDLRLNAAAAVASGVVLGLHEDRRYKSDS  187

Query  785   KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIA  964
             K   LK V+++G G+G E+ +KL+Y+  VSS VIF KELVN+PANVLTP  LAEEA NIA
Sbjct  188   KKVHLKQVDLIGFGSGQEMGRKLQYANHVSSAVIFAKELVNSPANVLTPAVLAEEASNIA  247

Query  965   SLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKG  1144
             S YSDVLTATILD E+C+ELKMGS+L VAAA+ NP +FIHLCYKP  G+VK KLA++GKG
Sbjct  248   SSYSDVLTATILDEEKCRELKMGSYLAVAAASANPPHFIHLCYKPPGGNVKRKLAIVGKG  307

Query  1145  ITFDS-----------------GGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKP  1273
             +TFD                  GGYN+KIGA ++IELMKKDM G+A +FGAAKA+ QIKP
Sbjct  308   LTFDRFYLSLDNLLIVTKFVCIGGYNIKIGAVTTIELMKKDMGGSAALFGAAKALGQIKP  367

Query  1274  AGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVID  1453
              GVEVHFI  ACENMISGTGMRPGDI+TASNGK IE                        
Sbjct  368   PGVEVHFISAACENMISGTGMRPGDIVTASNGKTIE------------------------  403

Query  1454  PFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                  V +TDAEGRL LADALVYA KLGV+K++DLATLTG C  ALG S+AG+
Sbjct  404   -----VDNTDAEGRLTLADALVYACKLGVDKIIDLATLTGYCRIALGPSIAGI  451


 Score = 87.4 bits (215),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI TPS++L KEV  A +  GEK WR+PLEESYWE MKSS+ADM+N GS  G AITA LF
Sbjct  450   GILTPSDELDKEVAAAYEASGEKFWRLPLEESYWEQMKSSVADMLNTGSPLGGAITAGLF  509

Query  1866  MK  1871
             +K
Sbjct  510   LK  511



>ref|XP_002453876.1| hypothetical protein SORBIDRAFT_04g020460 [Sorghum bicolor]
 gb|EES06852.1| hypothetical protein SORBIDRAFT_04g020460 [Sorghum bicolor]
Length=537

 Score =   434 bits (1116),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 263/458 (57%), Positives = 330/458 (72%), Gaps = 40/458 (9%)
 Frame = +2

Query  266   SIARATLGLTHPNQ-IERPKISFAAKEVDLLEWKGDILAVGVTEKDMVK-----DENSK-  424
             + A  TLGLT PN  +E P+ISFAAK+++  +W GDILAV VTEKD+       D NSK 
Sbjct  5     ATAAPTLGLTRPNAALELPQISFAAKDIEFSDWHGDILAVAVTEKDVQPQQQALDSNSKS  64

Query  425   -FQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTI  601
              F+N +L+KLD +LGGLL  A++EE+F+GK GQS+V+R+    FKR+ LVG   V  S  
Sbjct  65    LFENAVLKKLDGQLGGLLRAAAAEEEFTGKPGQSVVIRVQGQRFKRVALVGF--VARSAG  122

Query  602   AYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLE  781
               + LGE++A+ A++AQA+S A+ +A+   +  E KL+AA+A+A+G V G +ED+R+K E
Sbjct  123   CLQGLGESVASLARAAQATSAAILVAAPAVIRQELKLNAAAAIASGAVLGLYEDSRYKSE  182

Query  782   PKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNI  961
              K   LK V+++GLG GPE+++KL +   +S+GV+  ++LVN+PANVLTP ALAEEA  I
Sbjct  183   WKKVHLKQVDLIGLGCGPEVDQKLHHGNHLSTGVMLARDLVNSPANVLTPAALAEEAAKI  242

Query  962   ASLYSDVLTATILDVEQCKELKMGSFLGVAAAA-TNPSYFIHLCYKPSSGSVKTKLALLG  1138
             AS YSDV TATILD E+CKELKMGS+L VAAA+ TNP YFIHLCYKP  G+VKTKLAL+G
Sbjct  243   ASTYSDVFTATILDAEKCKELKMGSYLAVAAASETNPPYFIHLCYKPPGGNVKTKLALIG  302

Query  1139  KGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENM  1318
             KGITFDSGGYN+K    ++IELMKKDM GAA VFGAAK + QIKP GVEVHFI  A ENM
Sbjct  303   KGITFDSGGYNIKAVPVATIELMKKDMGGAAAVFGAAKVLGQIKPPGVEVHFISAASENM  362

Query  1319  ISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRL  1498
             ISGTGMRPGDI+TASNGK IE                             V +TDAEGRL
Sbjct  363   ISGTGMRPGDIVTASNGKTIE-----------------------------VDNTDAEGRL  393

Query  1499  ILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
              LADALVYA   GV+K++DLATLTGA   ALG S+AG+
Sbjct  394   TLADALVYACNQGVDKIIDLATLTGAIRVALGPSIAGI  431


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLD--GDAITAS  1859
             GI TP+++LA+E   A +V GEK WR+P+EESYWE+M+SSIADM+ AG L     AITA+
Sbjct  430   GILTPNDELAEEFAAAYEVSGEKFWRLPMEESYWESMESSIADMLAAGPLQPKAGAITAA  489

Query  1860  LFMK  1871
             LF+K
Sbjct  490   LFLK  493



>ref|NP_001066684.1| Os12g0434400 [Oryza sativa Japonica Group]
 sp|Q2QSB9.2|AMPL1_ORYSJ RecName: Full=Putative leucine aminopeptidase 1; AltName: Full=Leucyl 
aminopeptidase 1; Short=LAP 1; AltName: Full=Proline 
aminopeptidase 1; AltName: Full=Prolyl aminopeptidase 1 [Oryza 
sativa Japonica Group]
 gb|ABA97701.2| Aminopeptidase, chloroplast precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29703.1| Os12g0434400 [Oryza sativa Japonica Group]
Length=542

 Score =   432 bits (1111),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 273/467 (58%), Positives = 334/467 (72%), Gaps = 58/467 (12%)
 Frame = +2

Query  299   PNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVK--DENSKFQNLI--LQKLDSKLG  466
             PN ++ P+ISFAAK++DL EW+GDILAV VTE D+ K    +S+F N    L KLD +LG
Sbjct  2     PNVVDPPQISFAAKDMDLTEWEGDILAVLVTETDVSKATSSSSRFTNAAAALAKLDGELG  61

Query  467   GLLSEASSEEDFSGKSGQSIVLRLPAL----GFKRIGLVGLGS-VVSSTIAYRTLGETIa  631
             GLLSEAS+EE+F+G++GQS+ LRLP      GFKR+ LVG+G+ + SS  A R+ GETIA
Sbjct  62    GLLSEASAEEEFAGRAGQSVALRLPTAPGLHGFKRVCLVGVGNNMPSSAAACRSTGETIA  121

Query  632   aaaksaqassvavalasaEGLSVES---KLSAASAMATGIVSGTFEDNRFKLEPKTPTLK  802
             A AKSAQA S AVALAS     V+    +L+AA+A+A+G+V G  ED R+K + K   LK
Sbjct  122   AVAKSAQARSAAVALASPPPGWVQGEDLRLNAAAAVASGVVLGLHEDRRYKSDSKKVHLK  181

Query  803   SVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDV  982
              V+++G G+G E+ +KL+Y+  VSS VIF KELVN+PANVLTP  LAEEA NIAS YSDV
Sbjct  182   QVDLIGFGSGQEMGRKLQYANHVSSAVIFAKELVNSPANVLTPAVLAEEASNIASSYSDV  241

Query  983   LTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDS-  1159
             LTATILD E+C+ELKMGS+L VAAA+ NP +FIHLCYKP  G+VK KLA++GKG+TFD  
Sbjct  242   LTATILDEEKCRELKMGSYLAVAAASANPPHFIHLCYKPPGGNVKRKLAIVGKGLTFDRF  301

Query  1160  ----------------GGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVH  1291
                             GGYN+KIGA ++IELMKKDM G+A +FGAAKA+ QIKP GVEVH
Sbjct  302   YLSLDNLLIVTKFVCIGGYNIKIGAVTTIELMKKDMGGSAALFGAAKALGQIKPPGVEVH  361

Query  1292  FIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**V  1471
             FI  ACENMISGTGMRPGDI+TASNGK IE                             V
Sbjct  362   FISAACENMISGTGMRPGDIVTASNGKTIE-----------------------------V  392

Query  1472  TDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
              +TDAEGRL LADALVYA KLGV+K++DLATLTG C  ALG S+AG+
Sbjct  393   DNTDAEGRLTLADALVYACKLGVDKIIDLATLTGYCRIALGPSIAGI  439


 Score = 87.4 bits (215),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI TPS++L KEV  A +  GEK WR+PLEESYWE MKSS+ADM+N GS  G AITA LF
Sbjct  438   GILTPSDELDKEVAAAYEASGEKFWRLPLEESYWEQMKSSVADMLNTGSPLGGAITAGLF  497

Query  1866  MK  1871
             +K
Sbjct  498   LK  499



>ref|XP_008666283.1| PREDICTED: LOW QUALITY PROTEIN: leucine aminopeptidase 2, chloroplastic-like 
[Zea mays]
Length=396

 Score =   425 bits (1093),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 238/367 (65%), Positives = 293/367 (80%), Gaps = 3/367 (1%)
 Frame = +2

Query  284   LGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKL  463
             LGLT PN +E P+++F AK++   EWKGDILAV VTEKD+ KD  SKF+N +L+KLD +L
Sbjct  16    LGLTKPNAVEPPQVTFFAKDIKFSEWKGDILAVTVTEKDLSKDAYSKFENAVLKKLDGQL  75

Query  464   GGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLG-SVVSSTIAYRTLGETIaaaa  640
             GGLLSEA+ EEDF+GK+GQS+VLRL   GFKR+GL+GLG S  S+  A R L E++A+ A
Sbjct  76    GGLLSEAAVEEDFTGKTGQSVVLRLAGQGFKRVGLIGLGQSAPSTAAASRGLRESVASVA  135

Query  641   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  820
             K+AQASS A+ LAS  G+  E KL+A  +  T  V G +EDNR+K E K   LK V+I+G
Sbjct  136   KAAQASSAAIVLASPSGIQEEFKLAALXSSRT--VLGLYEDNRYKSESKKVHLKQVDIIG  193

Query  821   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1000
             LG+G E+++K+KY+  +SSGVIF +ELVN+PANVLTP  LAEEA  IAS +SDV TAT+L
Sbjct  194   LGSGAEVDQKIKYANDLSSGVIFGRELVNSPANVLTPAVLAEEASKIASTFSDVFTATVL  253

Query  1001  DVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKI  1180
             DVE+CKELKMGS+LGVAAA+ NP +FIHLCYKP+ G++K KLA++GKG+TFDSGGYN+K 
Sbjct  254   DVEKCKELKMGSYLGVAAASANPPHFIHLCYKPTDGNIKRKLAIVGKGLTFDSGGYNIKT  313

Query  1181  GANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTA  1360
             G   SIELMK DM G+A VFGAAKA+ QIKP GVEVHFIV ACENMISGT MR GDI+TA
Sbjct  314   GPGCSIELMKFDMGGSAAVFGAAKALGQIKPPGVEVHFIVAACENMISGTDMRTGDIVTA  373

Query  1361  SNGKRIE  1381
             SNGK IE
Sbjct  374   SNGKTIE  380



>pir||A48788 leucyl aminopeptidase (EC 3.4.11.1) DR57 - tomato
 gb|AAB28717.1| leucine aminopeptidase, LAP=DR57 product {EC 3.4.11.1} [Lycopersicon 
esculentum=tomatoes, Peto 238R, leaves, Peptide, 469 
aa]
Length=469

 Score =   424 bits (1090),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 256/399 (64%), Positives = 305/399 (76%), Gaps = 33/399 (8%)
 Frame = +2

Query  416   NSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSS  595
             NSKF+N +LQ+LDS+L GLLS ASSEEDFSGKSGQS+ LR P     RI LVGLGS  SS
Sbjct  1     NSKFKNPLLQQLDSELNGLLSAASSEEDFSGKSGQSVNLRFPG---GRITLVGLGSSASS  57

Query  596   TIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFK  775
               +Y +LG+  AAAAKS+QA ++AVALAS +GLS ESK+++ASA+ATG+V G+FEDNRF+
Sbjct  58    PTSYHSLGQAAAAAAKSSQARNIAVALASTDGLSAESKINSASAIATGVVLGSFEDNRFR  117

Query  776   LEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAK  955
              E K  TL+S++ILGLGTGPEIE+K+KY+E V +GVI  +ELVNAPAN++TP  LAEEAK
Sbjct  118   SESKKSTLESLDILGLGTGPEIERKIKYAEHVCAGVILGRELVNAPANIVTPAVLAEEAK  177

Query  956   NIASLYSDVLTATILDVEQCKELKMGSFLGVAAAAT-NPSYFIHLCYKPSSGSVKTKLAL  1132
              IAS YSDV++  ILD EQCKELKMG++L VAAAA+ NP YFIHLC+K  +   KTKLAL
Sbjct  178   KIASTYSDVISVNILDAEQCKELKMGAYLAVAAAASENPPYFIHLCFKTPTKERKTKLAL  237

Query  1133  LGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACE  1312
             +GKG+TFDSGGYNLK+GA S IELMK DM GAA V GAAKA+ +I+P+ VEVHFIV ACE
Sbjct  238   VGKGLTFDSGGYNLKVGAGSRIELMKNDMGGAAAVLGAAKALGEIRPSRVEVHFIVAACE  297

Query  1313  NMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEG  1492
             NMIS  GMRPGDI+TASNGK IE                             V +TDAEG
Sbjct  298   NMISAEGMRPGDIVTASNGKTIE-----------------------------VNNTDAEG  328

Query  1493  RLILADALVYASKLGVEKMVDLATLTGACITALGRSVAG  1609
             RL LADAL+YA   GVEK++DLATLTGA + ALG SVAG
Sbjct  329   RLTLADALIYACNQGVEKIIDLATLTGAIMVALGPSVAG  367


 Score = 97.1 bits (240),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G FTP++DLA+EV+EAA+  GEKLWRMP+EESYWE+MKS +ADMIN G  +G AIT +LF
Sbjct  367   GAFTPNDDLAREVVEAAEASGEKLWRMPMEESYWESMKSGVADMINTGPGNGGAITGALF  426

Query  1866  MK  1871
             +K
Sbjct  427   LK  428



>ref|XP_002965045.1| hypothetical protein SELMODRAFT_167050 [Selaginella moellendorffii]
 gb|EFJ33883.1| hypothetical protein SELMODRAFT_167050 [Selaginella moellendorffii]
Length=538

 Score =   425 bits (1092),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 259/447 (58%), Positives = 316/447 (71%), Gaps = 41/447 (9%)
 Frame = +2

Query  278   ATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDS  457
             AT+GLT  ++   P++     E+D+ +WKGD+LA+ V E  M  DE           LD 
Sbjct  26    ATVGLTKASEQPIPELEVRVSELDVSQWKGDLLAIAVFEGGM-SDE-------AFGILDK  77

Query  458   KLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIA--YRTLGETIa  631
              L GLL++ ++EEDF+GKSGQ+  +R+P  GFKRIGLVGLG +  S++A  ++ +GE+IA
Sbjct  78    DLNGLLADVAAEEDFTGKSGQASFVRIPGQGFKRIGLVGLGKLEKSSLARPWKGVGESIA  137

Query  632   aaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVE  811
             AAAK+AQASSV + L++ +   V+S  + ASA+ +G++ G+FED RFK EPK P LK VE
Sbjct  138   AAAKTAQASSVGIVLSALDQEGVDSN-AGASAITSGVILGSFEDTRFKSEPKAPKLKRVE  196

Query  812   ILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTA  991
             ILGLG+ PE+EKKL+    V +GVI  ++LVNAPANVLTP ALAEEA +IAS +SDV TA
Sbjct  197   ILGLGSAPELEKKLQNLVKVCTGVISARQLVNAPANVLTPSALAEEAVSIASSHSDVFTA  256

Query  992   TILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYN  1171
              ILD  +CKELKMGS+LGVAAA+ NP  FIHL YKP SG VKTKLA++GKG+TFDSGGYN
Sbjct  257   KILDEAECKELKMGSYLGVAAASVNPPKFIHLQYKPPSGDVKTKLAIIGKGLTFDSGGYN  316

Query  1172  LKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDI  1351
             LKI   SSIELMK DM GAA   GAAKA+  I+P GVEVHFIV ACENMISG GMRPGDI
Sbjct  317   LKI-QGSSIELMKFDMGGAAAALGAAKALGAIQPLGVEVHFIVAACENMISGAGMRPGDI  375

Query  1352  LTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASK  1531
             LTASNGK IE                             V +TDAEGRL LADALVYA  
Sbjct  376   LTASNGKTIE-----------------------------VNNTDAEGRLTLADALVYACN  406

Query  1532  LGVEKMVDLATLTGACITALGRSVAGM  1612
             L V+K+VDLATLTGACI ALG  + GM
Sbjct  407   LKVDKIVDLATLTGACIIALGNEIGGM  433


 Score = 89.0 bits (219),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS++LA+E+ +A+   GEKLWRMP+EE+YWE MKS IADM+N G   G +ITASLF
Sbjct  432   GMFTPSDELAEELSQASSAAGEKLWRMPMEENYWEMMKSGIADMVNTGGRPGGSITASLF  491

Query  1866  MK  1871
             +K
Sbjct  492   LK  493



>ref|XP_002962141.1| hypothetical protein SELMODRAFT_140664 [Selaginella moellendorffii]
 gb|EFJ37401.1| hypothetical protein SELMODRAFT_140664 [Selaginella moellendorffii]
Length=538

 Score =   424 bits (1089),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 258/447 (58%), Positives = 315/447 (70%), Gaps = 41/447 (9%)
 Frame = +2

Query  278   ATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDS  457
             AT+GLT  ++   P++     E+D+ +WKGD+LA+ V E  M  DE           LD 
Sbjct  26    ATVGLTKASEQPIPELEVRVSELDVSQWKGDLLAIAVFEGGM-SDE-------AFGILDK  77

Query  458   KLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIA--YRTLGETIa  631
              L GLL++ ++EEDF+GKSGQ+  +R+P  GFKRIGLVGLG +  S++A  ++ +GE+IA
Sbjct  78    DLNGLLADVAAEEDFTGKSGQASFVRIPGQGFKRIGLVGLGKLEKSSLARPWKGVGESIA  137

Query  632   aaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVE  811
             AAAK+AQASSV + L++ +   V+S  + AS + +G++ G+FED RFK EPK P LK VE
Sbjct  138   AAAKTAQASSVGIVLSALDQEGVDSN-AGASGITSGVILGSFEDTRFKSEPKAPKLKRVE  196

Query  812   ILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTA  991
             ILGLG+ PE+EKKL+    V +GVI  ++LVNAPANVLTP ALAEEA +IAS +SDV TA
Sbjct  197   ILGLGSAPELEKKLQNLVKVCTGVISARQLVNAPANVLTPSALAEEAVSIASSHSDVFTA  256

Query  992   TILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYN  1171
              ILD  +CKELKMGS+LGVAAA+ NP  FIHL YKP SG VKTKLA++GKG+TFDSGGYN
Sbjct  257   KILDEAECKELKMGSYLGVAAASVNPPKFIHLQYKPPSGDVKTKLAIIGKGLTFDSGGYN  316

Query  1172  LKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDI  1351
             LKI   SSIELMK DM GAA   GAAKA+  I+P GVEVHFIV ACENMISG GMRPGDI
Sbjct  317   LKI-QGSSIELMKFDMGGAAAALGAAKALGAIQPLGVEVHFIVAACENMISGAGMRPGDI  375

Query  1352  LTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASK  1531
             LTASNGK IE                             V +TDAEGRL LADALVYA  
Sbjct  376   LTASNGKTIE-----------------------------VNNTDAEGRLTLADALVYACN  406

Query  1532  LGVEKMVDLATLTGACITALGRSVAGM  1612
             L V+K+VDLATLTGACI ALG  + GM
Sbjct  407   LKVDKIVDLATLTGACIIALGNEIGGM  433


 Score = 89.0 bits (219),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS++LA+E+ +A+   GEKLWRMP+EE+YWE MKS IADM+N G   G +ITASLF
Sbjct  432   GMFTPSDELAEELSQASSAAGEKLWRMPMEENYWEMMKSGIADMVNTGGRPGGSITASLF  491

Query  1866  MK  1871
             +K
Sbjct  492   LK  493



>gb|AFW71513.1| hypothetical protein ZEAMMB73_883672 [Zea mays]
Length=538

 Score =   401 bits (1030),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 249/450 (55%), Positives = 324/450 (72%), Gaps = 36/450 (8%)
 Frame = +2

Query  284   LGLTHPNQ-IERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDEN---SKFQNLILQKL  451
             LGLT PN  +E P+ISFAAK+ +  +W GDILAV VT+KD+    +   S+F+N +L++L
Sbjct  12    LGLTWPNAAVELPQISFAAKDSEFSDWDGDILAVAVTDKDVQVQPHVSGSEFENAVLRRL  71

Query  452   DSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIA--YRTLGET  625
             D +LGGLL  A++EE+F+G+ GQS+VLR+    FKR+ LVG  +      A     LGE+
Sbjct  72    DVQLGGLLRAAAAEEEFAGRPGQSVVLRVRGQRFKRVALVGFAARDRDRDAGCLHGLGES  131

Query  626   IaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKS  805
             +A+ A++A+A+S A+ +A    +  ES+L+AA+A+A+G V G +EDNR+K E +   LK 
Sbjct  132   VASVARAARATSAAILVADPAVVRPESRLNAAAAIASGTVLGLYEDNRYKSEWEKVHLKQ  191

Query  806   VEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVL  985
             V+++GLG+GPE+++KL+++  +SSGV+  ++LVN+PANVLTPGALAE A  IAS YSDV 
Sbjct  192   VDLIGLGSGPELDQKLRHANRLSSGVMLARDLVNSPANVLTPGALAEAAAKIASTYSDVF  251

Query  986   TATILDVEQCKELKMGSFLGVAAAA-TNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSG  1162
             TATILD  +C+ELKMGS+L VAAA+ TNP YFIHLCYKP  G V+ KLAL+GKGITFDSG
Sbjct  252   TATILDAAKCRELKMGSYLAVAAASETNPPYFIHLCYKPRGGDVRRKLALVGKGITFDSG  311

Query  1163  GYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRP  1342
             GYN+K    ++IELMKKDM GAA VFGAA+ + QIKP GVEVHFI  A ENMISG+GMRP
Sbjct  312   GYNIKAVPVATIELMKKDMGGAAAVFGAAEVLGQIKPPGVEVHFISAASENMISGSGMRP  371

Query  1343  GDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVY  1522
             GDI+TASNGK IE                             V +TDAEGRL LADALVY
Sbjct  372   GDIVTASNGKTIE-----------------------------VDNTDAEGRLTLADALVY  402

Query  1523  ASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             A   GV+K++DLATLTGA   ALG S+AG+
Sbjct  403   ACNQGVDKIIDLATLTGAIRVALGPSIAGI  432


 Score = 80.1 bits (196),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSL--DGDAITAS  1859
             GI TPS++LA+E   A +V GEK WR+P+EESYWE+M+SSIADM+ AG L     AITA+
Sbjct  431   GILTPSDELAEEFAAAYEVSGEKFWRLPMEESYWESMESSIADMLCAGPLQPQAGAITAA  490

Query  1860  LFMK  1871
             LF+K
Sbjct  491   LFLK  494



>ref|XP_006664532.1| PREDICTED: putative leucine aminopeptidase 1-like [Oryza brachyantha]
Length=568

 Score =   398 bits (1023),  Expect(2) = 4e-128, Method: Compositional matrix adjust.
 Identities = 268/478 (56%), Positives = 329/478 (69%), Gaps = 63/478 (13%)
 Frame = +2

Query  281   TLGLTHPNQI-ERP-KISFAAKEVDLLEWKGDILAVGVTEKDM--VKDENSKFQNLI-LQ  445
             +LGLT PN   + P +++FAAK+++L EW+GDILAV V E  +      +S F N   L 
Sbjct  17    SLGLTVPNAAADNPLQVTFAAKDMELTEWEGDILAVLVPESGVSGATPPSSTFANAAALA  76

Query  446   KLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPAL----GFKRIGLVGLGSV-----VSST  598
             +LD +LGGLLSEAS+EEDFSGK+GQ + LRLPA     GFKR+ LVG+G V      ++ 
Sbjct  77    RLDGQLGGLLSEASAEEDFSGKAGQLVALRLPAATGSHGFKRVCLVGVGKVDAPRSAAAA  136

Query  599   IAYRTLGETIaaaaksaqassvavalasaE---GLSVESKLSAASAMATGIVSGTFEDNR  769
              A R+ GE++AAAA++AQA S AVAL S +   G   + +  AA+A+A+ IV G  ED+R
Sbjct  137   AACRSAGESVAAAARAAQAHSAAVALGSPKPGWGHGEDFRPEAAAAVASVIVLGLHEDSR  196

Query  770   FKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEE  949
             +K E K   L+ V+ +G G G E+E KL+Y+  VSSGVI  KELVN+PANVLTP ALAEE
Sbjct  197   YKSESKKVHLERVDFIGFGAGDEVESKLQYANDVSSGVILCKELVNSPANVLTPAALAEE  256

Query  950   AKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLA  1129
             A  IAS YSDVLTATILD  +C+ELKMGS+L VAAA+ NP +FIHLCYKP  G+VK KLA
Sbjct  257   ASKIASTYSDVLTATILDQGKCRELKMGSYLAVAAASANPPHFIHLCYKPPGGNVKRKLA  316

Query  1130  LLGKGITFD-----------------SGGYNLKIGANSSIELMKKDMagaavvfgaakai  1258
             ++GKG+TFD                 SGGYN+KIGA ++IELMKKDM GAA VFGAAKA+
Sbjct  317   IVGKGLTFDRFYFYKQFLQLIQRFVCSGGYNIKIGAATNIELMKKDMGGAAAVFGAAKAL  376

Query  1259  aQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVV  1438
              QIKP GVEVHFI  ACENMISGTGMRPGDI+TASNGK IE                   
Sbjct  377   GQIKPPGVEVHFISAACENMISGTGMRPGDIVTASNGKTIE-------------------  417

Query  1439  LGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                       V +TDAEGRL LADAL+YA K GV+K++DLATLTG C  ALG S+AG+
Sbjct  418   ----------VDNTDAEGRLTLADALIYACKQGVDKILDLATLTGYCRIALGPSIAGV  465


 Score = 90.1 bits (222),  Expect(2) = 4e-128, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+ TPS++LAKEV  A +  GEK WR+P+EESYWE MKSS+ADMIN GS  G AITA+LF
Sbjct  464   GVLTPSDELAKEVAAAYEASGEKFWRLPMEESYWEQMKSSVADMINTGSPLGGAITAALF  523

Query  1866  MK  1871
             +K
Sbjct  524   LK  525



>gb|KGN61046.1| hypothetical protein Csa_2G035460 [Cucumis sativus]
Length=482

 Score =   384 bits (987),  Expect(2) = 4e-124, Method: Compositional matrix adjust.
 Identities = 244/444 (55%), Positives = 292/444 (66%), Gaps = 74/444 (17%)
 Frame = +2

Query  281   TLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSK  460
             TLGLT+P     PKI+FAAK+ D+LEW GD+LAVGVTEKD+VKD+N+ F NL+L+KLD+ 
Sbjct  8     TLGLTNPGPSNAPKITFAAKDTDVLEWNGDLLAVGVTEKDVVKDDNNNFTNLLLKKLDAV  67

Query  461   LGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaa  640
             LGGLL+EASSEEDFSGKSGQ+IVLR+  L FKR+GL G+G       A+  LGE IAAAA
Sbjct  68    LGGLLAEASSEEDFSGKSGQAIVLRVSGLCFKRVGLFGVGQSAYKAAAFVGLGEAIAAAA  127

Query  641   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  820
             ++++A S+AVALA +  LS ESK   AS++A GIV+G F+D                   
Sbjct  128   QASRAVSLAVALAFSADLSDESKPDIASSIAIGIVNGIFDD-------------------  168

Query  821   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1000
                         Y     S + F+             G LA E  NIA  YSDVL+A I 
Sbjct  169   ------------YILFCLSVIYFL-------------GQLAAEVLNIARNYSDVLSARIF  203

Query  1001  DVEQCKELKMGSFLGVAAAAT-NPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLK  1177
             + ++  E+KMGS+LGV AAAT NP  FIHLCYKP SGSV  KL L+GKGITFDSGGYNLK
Sbjct  204   NEDEIIEMKMGSYLGVTAAATANPPKFIHLCYKPPSGSVSAKLGLVGKGITFDSGGYNLK  263

Query  1178  IGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILT  1357
              G+ S+IE MK DM GA  +FGAAKAIA+IKP GVE+HF+V ACENMIS TGMRP DI+T
Sbjct  264   AGSGSNIETMKNDMGGAGTIFGAAKAIAEIKPLGVEIHFVVAACENMISATGMRPSDIVT  323

Query  1358  ASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLG  1537
             A+NGK IE                             V +TDAEGRL LADAL+Y  K G
Sbjct  324   AANGKTIE-----------------------------VNNTDAEGRLCLADALLYTCKQG  354

Query  1538  VEKMVDLATLTGACITALGRSVAG  1609
             V K++DLATLTGACITALG SVAG
Sbjct  355   VAKIIDLATLTGACITALGPSVAG  378


 Score = 90.9 bits (224),  Expect(2) = 4e-124, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G FTP+E+LA EVL AA+  GEKLWR+P+EESYW++MKS +ADM+N G   G AITA+LF
Sbjct  378   GAFTPNEELASEVLSAAERSGEKLWRLPIEESYWDSMKSGVADMLNTGPSQGGAITAALF  437

Query  1866  MK  1871
             +K
Sbjct  438   LK  439



>gb|ABY84519.1| leucine aminopeptidase, partial [Solanum nigrum]
Length=310

 Score =   380 bits (977),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 213/309 (69%), Positives = 239/309 (77%), Gaps = 29/309 (9%)
 Frame = +2

Query  686   EGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSE  865
             +GLS ESKLS+ASA+ATG V G FEDNRFK E K PTLKS++ILG GTGPEIEKK+KY+ 
Sbjct  9     DGLSAESKLSSASAIATGAVLGIFEDNRFKSESKKPTLKSLDILGTGTGPEIEKKIKYAA  68

Query  866   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLG  1045
              V +GVI  +ELVNAPANVLTP  LAEEAK IAS YSDV +A ILDVEQCKELKMGS+L 
Sbjct  69    DVCAGVILGRELVNAPANVLTPAVLAEEAKKIASTYSDVFSANILDVEQCKELKMGSYLA  128

Query  1046  VAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMag  1225
             VAAA+ NP++FIHLCYKPSSG +K K+AL+GKG+TFDSGGYN+K G   SIELMK DM G
Sbjct  129   VAAASANPAHFIHLCYKPSSGEIKKKIALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGG  188

Query  1226  aavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVL  1405
             AA V GAAKA+ QIKPAGVEVHFIV ACENMISGTGMRPGDI+TASNGK IE        
Sbjct  189   AAAVLGAAKALGQIKPAGVEVHFIVAACENMISGTGMRPGDIITASNGKTIE--------  240

Query  1406  RCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACIT  1585
                                  V +TDAEGRL LADALVYA   GVEK+VDLATLTGAC+ 
Sbjct  241   ---------------------VNNTDAEGRLTLADALVYACNQGVEKIVDLATLTGACVV  279

Query  1586  ALGRSVAGM  1612
             ALG S+AG+
Sbjct  280   ALGPSIAGI  288



>ref|XP_008666459.1| PREDICTED: LOW QUALITY PROTEIN: leucine aminopeptidase 2, chloroplastic-like 
[Zea mays]
Length=699

 Score =   393 bits (1010),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 226/355 (64%), Positives = 280/355 (79%), Gaps = 2/355 (1%)
 Frame = +2

Query  323   ISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDF  502
             ++F AK+++  EWKGDILA+ +TEKD+ KD  SKF+N +L+KLD +LGGLLSEA  EEDF
Sbjct  145   VTFFAKDIEFSEWKGDILAITITEKDLSKDAYSKFENAVLKKLDGQLGGLLSEAGVEEDF  204

Query  503   SGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAY-RTLGETIaaaaksaqassvavala  679
             +GK+GQS+VLRL   GFKR+GL+GLG   SST A  R L E++A+ AK+AQASS A+ LA
Sbjct  205   TGKTGQSVVLRLAGQGFKRVGLIGLGQSASSTAAASRGLRESVASVAKAAQASSAAIVLA  264

Query  680   saEGLSVES-KLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLK  856
             S  G+  +   L       TG V G +ED+R+K E K   LK V+I+G+ +G ++++KLK
Sbjct  265   SPSGIQEDGWMLKFLPVXITGTVLGLYEDSRYKSESKKVHLKHVDIIGVSSGAKVDQKLK  324

Query  857   YSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGS  1036
             Y+  +SSGVIF +ELVN+PANVLTP  LAEEA  IAS +SDV TAT+LDVE+CKELKMGS
Sbjct  325   YANDLSSGVIFGRELVNSPANVLTPAVLAEEASKIASTFSDVFTATVLDVEKCKELKMGS  384

Query  1037  FLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKD  1216
             +LGVAAA+ NP +FIHLCYKP+ G+VK KLA++GKG+TFDSGGYN+K G   SIELMK D
Sbjct  385   YLGVAAASANPPHFIHLCYKPTDGNVKRKLAIVGKGLTFDSGGYNIKTGPGYSIELMKFD  444

Query  1217  MagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIE  1381
             M G+A VFGAAKA+ QIKP GVEVHFIV ACENMISGTGMR GDI+TASNGK IE
Sbjct  445   MGGSAAVFGAAKALGQIKPPGVEVHFIVAACENMISGTGMRTGDIVTASNGKTIE  499



>ref|XP_008645704.1| PREDICTED: LOW QUALITY PROTEIN: leucine aminopeptidase 2, chloroplastic-like 
[Zea mays]
Length=559

 Score =   389 bits (998),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 249/471 (53%), Positives = 324/471 (69%), Gaps = 57/471 (12%)
 Frame = +2

Query  284   LGLTHPNQ-IERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDEN---SKFQNLILQKL  451
             LGLT PN  +E P+ISFAAK+ +  +W GDILAV VT+KD+    +   S+F+N +L++L
Sbjct  12    LGLTWPNAAVELPQISFAAKDSEFSDWDGDILAVAVTDKDVQVQPHVSGSEFENAVLRRL  71

Query  452   DSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIA--YRTLGET  625
             D +LGGLL  A++EE+F+G+ GQS+VLR+    FKR+ LVG  +      A     LGE+
Sbjct  72    DVQLGGLLRAAAAEEEFAGRPGQSVVLRVRGQRFKRVALVGFAARDRDRDAGCLHGLGES  131

Query  626   IaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKS  805
             +A+ A++A+A+S A+ +A    +  ES+L+AA+A+A+G V G +EDNR+K E +   LK 
Sbjct  132   VASVARAARATSAAILVADPAVVRPESRLNAAAAIASGTVLGLYEDNRYKSEWEKVHLKQ  191

Query  806   VEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVL  985
             V+++GLG+GPE+++KL+++  +SSGV+  ++LVN+PANVLTPGALAE A  IAS YSDV 
Sbjct  192   VDLIGLGSGPELDQKLRHANRLSSGVMLARDLVNSPANVLTPGALAEAAAKIASTYSDVF  251

Query  986   TATILDVEQCKELKMGSFLGVAAAA-TNPSYFIHLCYKPSSGSVKTKLALLGKGITFD--  1156
             TATILD  +C+ELKMGS+L VAAA+ TNP YFIHLCYKP  G V+ KLAL+GKGITFD  
Sbjct  252   TATILDAAKCRELKMGSYLAVAAASETNPPYFIHLCYKPRGGDVRRKLALVGKGITFDRF  311

Query  1157  -------------------SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAG  1279
                                SGGYN+K    ++IELMKKDM GAA VFGAA+ + QIKP G
Sbjct  312   ILSTPNTXFLDARFTSVVSSGGYNIKAVPVATIELMKKDMGGAAAVFGAAEVLGQIKPPG  371

Query  1280  VEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPF  1459
             VEVHFI  A ENMISG+GMRPGDI+TASNGK IE                          
Sbjct  372   VEVHFISAASENMISGSGMRPGDIVTASNGKTIE--------------------------  405

Query  1460  F**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                V +TDAEGRL LADALVYA   GV+K++DLATLTGA   ALG S+AG+
Sbjct  406   ---VDNTDAEGRLTLADALVYACNQGVDKIIDLATLTGAIRVALGPSIAGI  453


 Score = 80.1 bits (196),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSL--DGDAITAS  1859
             GI TPS++LA+E   A +V GEK WR+P+EESYWE+M+SSIADM+ AG L     AITA+
Sbjct  452   GILTPSDELAEEFAAAYEVSGEKFWRLPMEESYWESMESSIADMLCAGPLQPQAGAITAA  511

Query  1860  LFMK  1871
             LF+K
Sbjct  512   LFLK  515



>gb|AFW68884.1| hypothetical protein ZEAMMB73_253679 [Zea mays]
Length=690

 Score =   386 bits (991),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 217/382 (57%), Positives = 269/382 (70%), Gaps = 43/382 (11%)
 Frame = +2

Query  248   PRR---MAHSIARATLGLTHPNQIERPK-ISFAAKEVDLLEWKGDILAVGVTEKDMVKDE  415
             PR+   M  SIA     +     +  PK ++F AK+++  EWKGDILA+ VTEKD+ KD 
Sbjct  4     PRQGIDMRPSIAGVVPSVDVFTDLHNPKGVTFFAKDIEFSEWKGDILAITVTEKDLSKDA  63

Query  416   NSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSS  595
              SKF+N +L+KLD +LGGLLSEA  EEDF+GK+GQS+VLRL   GFKR+GL+GLG   SS
Sbjct  64    YSKFENAVLKKLDGQLGGLLSEAGVEEDFTGKTGQSVVLRLAGQGFKRVGLIGLGQSASS  123

Query  596   TIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFK  775
             T A                         ++ GL                V G +ED+R+K
Sbjct  124   TAA-------------------------ASRGLRT--------------VLGLYEDSRYK  144

Query  776   LEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAK  955
              E K   LK V+I+G+G+G ++++KLKY+  +SSGVIF +ELVN+PANVLTP  LAEEA 
Sbjct  145   SESKKVHLKHVDIIGVGSGAKVDQKLKYANDLSSGVIFGRELVNSPANVLTPAVLAEEAS  204

Query  956   NIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALL  1135
              IAS +SDV TAT+LDVE+CKELKMGS+LGVAAA+ NP +FIHLCYKP+ G+VK KLA++
Sbjct  205   KIASTFSDVFTATVLDVEKCKELKMGSYLGVAAASANPPHFIHLCYKPTDGNVKRKLAIV  264

Query  1136  GKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACEN  1315
             GKG+TFDSGGYN+K G   SIELMK DM G+  VFGAAKA+ QIKP GVEVHFI+ ACEN
Sbjct  265   GKGLTFDSGGYNIKTGPGYSIELMKFDMGGSTAVFGAAKALGQIKPPGVEVHFIIAACEN  324

Query  1316  MISGTGMRPGDILTASNGKRIE  1381
             MISGTGMR GDI+TASNGK IE
Sbjct  325   MISGTGMRTGDIVTASNGKTIE  346



>tpg|DAA39426.1| TPA: hypothetical protein ZEAMMB73_947180 [Zea mays]
Length=492

 Score =   379 bits (972),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 216/398 (54%), Positives = 274/398 (69%), Gaps = 47/398 (12%)
 Frame = +2

Query  284   LGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKL  463
             LGLT PN +E P+++F AK+++  EWKGDILAV VTEKD+ KD  SKF+N++L+KLD +L
Sbjct  16    LGLTKPNAVEPPQVTFFAKDIEFSEWKGDILAVTVTEKDLSKDAYSKFENVVLKKLDGQL  75

Query  464   GGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLG-SVVSSTIAYRTLGETIaaaa  640
             GGLLSEA+ EEDF+ K+GQS+VLRL   GFKR+GL+GLG S  S+  A R L E++A+ A
Sbjct  76    GGLLSEAAVEEDFTRKTGQSVVLRLAGQGFKRVGLIGLGQSAPSTAAASRGLRESVASVA  135

Query  641   ksaqassvavalasaEGLSVESKLSA--------------ASAMATGIVSGTFEDNRFKL  778
             K+AQASS A+ LAS  G+  E KL+A              ++ + TG V G +ED+R+K 
Sbjct  136   KAAQASSTAIVLASPSGIQEEFKLAALQSSSCFWWMDAEISAGLITGTVLGLYEDSRYKS  195

Query  779   EPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTP---------  931
             E K   LK V+I+GLG+G E+++K+KY+   SSGVIF +ELVN+PANVLTP         
Sbjct  196   ESKKVHLKQVDIIGLGSGAEVDQKIKYANDFSSGVIFGRELVNSPANVLTPDLLPVYLSQ  255

Query  932   ------GALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCY  1093
                     LAEEA  I S +SDV TAT+LDVE+CKELKMGS+LGV AA+ NP +FIHLCY
Sbjct  256   SSFVLSAMLAEEASKITSTFSDVFTATVLDVEKCKELKMGSYLGVVAASANPPHFIHLCY  315

Query  1094  KPSSGSVKTKLALLGKGITFDSGGYNLKIGAN-SSIELMKKDMagaavvfgaakaiaQIK  1270
             KP+ G+VK KLA++GKG+TFDSGGYN+K     + I L    M                 
Sbjct  316   KPTDGNVKRKLAIVGKGLTFDSGGYNIKTSRGFTQISLSVNSMFFPFS------------  363

Query  1271  PAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEV  1384
                 +VHFIV ACENMISGTGMR GDI+TASNGK IEV
Sbjct  364   ----QVHFIVAACENMISGTGMRTGDIVTASNGKTIEV  397



>ref|XP_008352214.1| PREDICTED: LOW QUALITY PROTEIN: leucine aminopeptidase 1-like 
[Malus domestica]
Length=439

 Score =   365 bits (938),  Expect(2) = 4e-120, Method: Compositional matrix adjust.
 Identities = 204/309 (66%), Positives = 230/309 (74%), Gaps = 31/309 (10%)
 Frame = +2

Query  686   EGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSE  865
             EGLSV+S  + ASA+A+G V G +ED R+K E K   LKSV+ILGLGTG E+EKKLKY E
Sbjct  59    EGLSVKS--NTASAIASGTVLGIYEDGRYKSESKKSALKSVDILGLGTGAEVEKKLKYXE  116

Query  866   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLG  1045
              V+SG+IF KELVN+PANVLTPG LAEEA  IAS YSDVL+A IL+ EQCKELKMGS+L 
Sbjct  117   DVTSGIIFGKELVNSPANVLTPGKLAEEASKIASTYSDVLSANILNEEQCKELKMGSYLA  176

Query  1046  VAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMag  1225
             VAAA+TNP +FIHL YKP  G  K KL L+GKG+TFDSGGYN+K G   SIE MK DM G
Sbjct  177   VAAASTNPPHFIHLIYKPPGGPAKVKLGLVGKGLTFDSGGYNIKTGPGCSIEQMKFDMGG  236

Query  1226  aavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVL  1405
             +A V GAAKAIAQIKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IE        
Sbjct  237   SAAVLGAAKAIAQIKPXGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIE--------  288

Query  1406  RCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACIT  1585
                                  V +TDAEGRL LADALVYA   GV+K+VDLATLTGACI 
Sbjct  289   ---------------------VNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACIV  327

Query  1586  ALGRSVAGM  1612
             ALG S+AG+
Sbjct  328   ALGPSIAGV  336


 Score = 96.3 bits (238),  Expect(2) = 4e-120, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV  A+++ GEK WR+P+EESYWE+MKS IADM+N G+  G +ITA+LF
Sbjct  335   GVFTPSDDLAKEVFAASEISGEKFWRLPMEESYWESMKSGIADMLNTGARQGGSITAALF  394

Query  1866  MK  1871
             +K
Sbjct  395   LK  396



>gb|AFW81180.1| hypothetical protein ZEAMMB73_308587 [Zea mays]
Length=617

 Score =   380 bits (977),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 208/368 (57%), Positives = 256/368 (70%), Gaps = 54/368 (15%)
 Frame = +2

Query  323   ISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDF  502
             ++F AK+++  EWKGDILA+ VTEKD+ KD  SKF+N +L+KLD +LGGLLSEA  EEDF
Sbjct  104   VTFFAKDIEFSEWKGDILAITVTEKDLSKDAYSKFENAVLKKLDGQLGGLLSEAGVEEDF  163

Query  503   SGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalas  682
             + K+GQS+VLRL   GFKR+GL+GLG    ST                            
Sbjct  164   TRKTGQSVVLRLAGQGFKRVGLIGLGQSAPST----------------------------  195

Query  683   aEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYS  862
                        AA++     V G +ED+R+K E K   LK V+I+G+G+G ++++KLKY+
Sbjct  196   -----------AAASRGLRTVLGLYEDSRYKSESKKVHLKHVDIIGVGSGAKVDQKLKYA  244

Query  863   EVVSSGVIFVKELVNAPANVLTP---------------GALAEEAKNIASLYSDVLTATI  997
               +SSGVIF +ELVN+PANVLTP                 LAEEA  IAS +SDV TAT+
Sbjct  245   NDLSSGVIFGRELVNSPANVLTPDLLPVYLSQSSFVLSAVLAEEASKIASTFSDVFTATV  304

Query  998   LDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLK  1177
             LDVE+CKELKMGS+LGVAAA+ NP +FIHLCYKP+ G+VK KLA++GKG+TFDSGGYN+K
Sbjct  305   LDVEKCKELKMGSYLGVAAASANPPHFIHLCYKPTDGNVKRKLAIVGKGLTFDSGGYNIK  364

Query  1178  IGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILT  1357
              G   SIELMK DM G+A VFGAAKA+ QIKP GVEVHFIV ACENMISGTGMR GDI+T
Sbjct  365   TGPGYSIELMKFDMGGSAAVFGAAKALGQIKPPGVEVHFIVAACENMISGTGMRTGDIVT  424

Query  1358  ASNGKRIE  1381
             ASNGK IE
Sbjct  425   ASNGKTIE  432



>gb|AFK42034.1| unknown [Medicago truncatula]
Length=392

 Score =   356 bits (914),  Expect(2) = 9e-117, Method: Compositional matrix adjust.
 Identities = 191/292 (65%), Positives = 219/292 (75%), Gaps = 29/292 (10%)
 Frame = +2

Query  737   GIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPA  916
             G V G FED R+K E K P ++S++I+GLGTGP++EKKLKY+  VSSG+IF  ELVN+PA
Sbjct  27    GAVLGLFEDQRYKSESKKPAVRSIDIIGLGTGPDLEKKLKYAGDVSSGIIFGGELVNSPA  86

Query  917   NVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYK  1096
             NVLTPG LAEEA  +AS YSDV TA ILD +QCKELKMGS+LGVAAA+ NP  FIHL YK
Sbjct  87    NVLTPGVLAEEASKVASTYSDVFTAKILDADQCKELKMGSYLGVAAASANPPRFIHLTYK  146

Query  1097  PSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPA  1276
             P SGSVK KLAL+GKG+TFDSGGYN+K G   SIELMK DM G+A V GAAKA+ QIKP 
Sbjct  147   PPSGSVKVKLALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKALGQIKPL  206

Query  1277  GVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDP  1456
             GVEVHFIV ACENMISGTGMRPGD++TASNGK IE                         
Sbjct  207   GVEVHFIVAACENMISGTGMRPGDVVTASNGKTIE-------------------------  241

Query  1457  FF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                 V +TDAEGRL LADALVYA   GVEK++DLATLTGAC+ ALG S+AG+
Sbjct  242   ----VNNTDAEGRLTLADALVYACNQGVEKIIDLATLTGACVVALGPSIAGV  289


 Score = 94.0 bits (232),  Expect(2) = 9e-117, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+F+P+++L KEVLEA++V GEKLWR+P+EESYWE+MKS +ADM+N G   G +ITA+LF
Sbjct  288   GVFSPNDELVKEVLEASEVSGEKLWRLPIEESYWESMKSGVADMVNTGGRPGGSITAALF  347

Query  1866  MK  1871
             +K
Sbjct  348   LK  349



>gb|ACJ85545.1| unknown [Medicago truncatula]
Length=392

 Score =   356 bits (913),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 190/292 (65%), Positives = 219/292 (75%), Gaps = 29/292 (10%)
 Frame = +2

Query  737   GIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPA  916
             G V G FED R+K E K P ++S++I+GLGTGP++EKKLKY+  VSSG+IF  ELVN+PA
Sbjct  27    GAVLGLFEDQRYKSESKKPAVRSIDIIGLGTGPDLEKKLKYAGDVSSGIIFGGELVNSPA  86

Query  917   NVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYK  1096
             NVLTPG LAEEA  +AS YSDV TA ILD +QCKELKMGS+LGVAAA+ NP  FIHL YK
Sbjct  87    NVLTPGVLAEEASKVASTYSDVFTAKILDADQCKELKMGSYLGVAAASANPPRFIHLTYK  146

Query  1097  PSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPA  1276
             P SGSVK KLAL+GKG+TFDSGGYN+K G   SIELMK DM G+A + GAAKA+ QIKP 
Sbjct  147   PPSGSVKVKLALVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAILGAAKALGQIKPL  206

Query  1277  GVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDP  1456
             GVEVHFIV ACENMISGTGMRPGD++TASNGK IE                         
Sbjct  207   GVEVHFIVAACENMISGTGMRPGDVVTASNGKTIE-------------------------  241

Query  1457  FF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
                 V +TDAEGRL LADALVYA   GVEK++DLATLTGAC+ ALG S+AG+
Sbjct  242   ----VNNTDAEGRLTLADALVYACNQGVEKIIDLATLTGACVVALGPSIAGV  289


 Score = 94.0 bits (232),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+F+P+++L KEVLEA++V GEKLWR+P+EESYWE+MKS +ADM+N G   G +ITA+LF
Sbjct  288   GVFSPNDELVKEVLEASEVSGEKLWRLPIEESYWESMKSGVADMVNTGGRPGGSITAALF  347

Query  1866  MK  1871
             +K
Sbjct  348   LK  349



>ref|XP_001758543.1| predicted protein [Physcomitrella patens]
 gb|EDQ76521.1| predicted protein [Physcomitrella patens]
Length=524

 Score =   366 bits (940),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 235/446 (53%), Positives = 301/446 (67%), Gaps = 33/446 (7%)
 Frame = +2

Query  284   LGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKL  463
             +GLT       P+I+  +  +++  W GD+L +GV E    K E+ KF N  L+ LD+ +
Sbjct  5     VGLTKTATPVVPEIAVKSSGLEVANWGGDLLVLGVFEGCATKSEDGKFSNSELEALDALV  64

Query  464   GGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGS---VVSSTIAYRTLGETIaa  634
             GGLLS  +SEE+F+GKSGQS   R+   GFKR+GLVGLG    V +++  +R+LGE+IA 
Sbjct  65    GGLLSVVASEEEFTGKSGQSTFHRVIGCGFKRVGLVGLGKSDKVETNSKVWRSLGESIAT  124

Query  635   aaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEI  814
             AA +A + S AV +  A  LS   K +AAS +ATG++ G+FED RFK + K P LK +E+
Sbjct  125   AAAAAHSGSAAVVVVDAGSLSDAVKKTAASMIATGVMLGSFEDMRFKSDFKKPQLKDLEL  184

Query  815   LGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTAT  994
              GLG+  ++E +L  +    +GVI  K+LVNAP NVL P  +A EA+ IA+ + DV+T  
Sbjct  185   FGLGSDADLEAQLAQTIQQCTGVILAKQLVNAPPNVLLPSVMACEAEAIAAAHGDVMTCK  244

Query  995   ILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNL  1174
             IL+ E+C++L MG++LGV+AA+TNP  FIHLCY P  G+V TKLA++GKG+TFDSGGYNL
Sbjct  245   ILEKEECEKLGMGAYLGVSAASTNPPKFIHLCYSP-LGAVTTKLAIVGKGLTFDSGGYNL  303

Query  1175  KIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDIL  1354
             K G    IELMK DM GAA V GAAKAIA IKP GVEV+F+V ACENMISG GMRPGDIL
Sbjct  304   KTGPGCMIELMKFDMGGAAAVLGAAKAIAAIKPEGVEVNFVVAACENMISGGGMRPGDIL  363

Query  1355  TASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKL  1534
             TASNGK IE                             V +TDAEGRL LADALVYA+ L
Sbjct  364   TASNGKTIE-----------------------------VNNTDAEGRLTLADALVYANNL  394

Query  1535  GVEKMVDLATLTGACITALGRSVAGM  1612
              V+K+VDLATLTGACI ALG  + GM
Sbjct  395   KVDKIVDLATLTGACIIALGNDIGGM  420


 Score = 83.2 bits (204),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP+++LA+E+ EA+  GGEK WRMP+E+SY+E +KS+IADM+N G   G +I ASLF
Sbjct  419   GMFTPNDELAQELTEASKKGGEKFWRMPMEDSYFEMLKSNIADMVNTGGRAGGSIIASLF  478

Query  1866  MK  1871
             +K
Sbjct  479   LK  480



>ref|XP_008376006.1| PREDICTED: LOW QUALITY PROTEIN: leucine aminopeptidase 1-like 
[Malus domestica]
Length=426

 Score =   355 bits (912),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 198/307 (64%), Positives = 225/307 (73%), Gaps = 31/307 (10%)
 Frame = +2

Query  686   EGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSE  865
             EGLS +S  + ASA+A+G V G +ED R+K E K   LKSV+ILGLGTG E+EKKLKY+E
Sbjct  46    EGLSAKS--NTASAIASGTVLGIYEDGRYKSESKKSALKSVDILGLGTGAEVEKKLKYTE  103

Query  866   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLG  1045
              V+SG+IF KELVN+PAN LTPG LAEEA  I S YSDVL+A IL+ EQCKELKMGS+L 
Sbjct  104   DVTSGIIFGKELVNSPANALTPGKLAEEASKITSTYSDVLSANILNEEQCKELKMGSYLA  163

Query  1046  VAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMag  1225
             VAAA+TNP +FIHL YKP     K KL L+GKG+TFDSGGYN+K G + SIE MK DM G
Sbjct  164   VAAASTNPPHFIHLIYKPPGXPAKVKLGLVGKGLTFDSGGYNIKTGPSCSIEQMKFDMGG  223

Query  1226  aavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVL  1405
             +A V GAAKAIAQIKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IE        
Sbjct  224   SAAVLGAAKAIAQIKPVGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIE--------  275

Query  1406  RCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACIT  1585
                                  V +TDAEGRL LADALVYA   GV+K+VDLAT TGACI 
Sbjct  276   ---------------------VNNTDAEGRLTLADALVYACNQGVDKIVDLATFTGACIV  314

Query  1586  ALGRSVA  1606
             ALG S+A
Sbjct  315   ALGPSIA  321


 Score = 90.5 bits (223),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  1689  IFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFM  1868
             +FTPS+DLA EV   +++ GEK WR+P+EESYWE+MKS IADM+N G+  G +ITA+LF+
Sbjct  323   VFTPSDDLANEVFTVSEISGEKFWRLPMEESYWESMKSGIADMLNTGARQGGSITAALFL  382

Query  1869  K  1871
             K
Sbjct  383   K  383



>gb|KHN18036.1| Leucine aminopeptidase 1, partial [Glycine soja]
Length=370

 Score =   361 bits (926),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 192/280 (69%), Positives = 229/280 (82%), Gaps = 0/280 (0%)
 Frame = +2

Query  320   KISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEED  499
             KISF AK+VD+ EWKGDILAVGVTEKD+ +D NSKF+N+IL K+DSKLGGLL+EASSEED
Sbjct  3     KISFGAKDVDVTEWKGDILAVGVTEKDLARDANSKFENVILSKIDSKLGGLLAEASSEED  62

Query  500   FSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  679
             FSGK GQS VLR+  LG KR+GL+GLG   S+   ++ LG+ +  AAKS+Q SS AV LA
Sbjct  63    FSGKVGQSTVLRITGLGSKRVGLIGLGQSPSTPSPFKGLGDAVVEAAKSSQESSAAVVLA  122

Query  680   saEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKY  859
             S+EGLS +SKLS A A+A+G V G FEDNR+K E K  TL+S++I+GLG GPE+EKKLKY
Sbjct  123   SSEGLSAQSKLSTAYAIASGAVLGLFEDNRYKSEAKKSTLRSIDIIGLGMGPELEKKLKY  182

Query  860   SEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSF  1039
             +  VSSG+IF +ELVN+PANVLTPG LAEEA  IAS YSDV TA IL+ EQC ELKMGS+
Sbjct  183   AGDVSSGIIFGRELVNSPANVLTPGVLAEEAAKIASTYSDVFTAKILNAEQCAELKMGSY  242

Query  1040  LGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDS  1159
             LGVAAA+ NP +FIHLCYKP SG V  KLAL+GKG+TFDS
Sbjct  243   LGVAAASENPPHFIHLCYKPLSGPVNVKLALVGKGLTFDS  282



>gb|EMT23101.1| Leucine aminopeptidase 2, chloroplastic [Aegilops tauschii]
Length=530

 Score =   358 bits (920),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 207/345 (60%), Positives = 265/345 (77%), Gaps = 3/345 (1%)
 Frame = +2

Query  257   MAHSIARATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNL  436
             MAH+ A   LGLT PN +E  ++SFAA  ++  +W+GD+LAV VTEKD+ +   S F+N 
Sbjct  1     MAHTAA--ALGLTKPNVVEPLQVSFAAIGIEPSDWEGDVLAVAVTEKDLCRSPCSSFENA  58

Query  437   ILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLG-SVVSSTIAYRT  613
             +L++LDS+LGGLLSEAS+EEDF+GK+GQ +VLRL   GFKR+GL+GLG S   +  A R 
Sbjct  59    VLKRLDSQLGGLLSEASAEEDFAGKAGQLVVLRLQGQGFKRLGLIGLGRSAPFTAAACRG  118

Query  614   LGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTP  793
             LGE+ A+ AKSA+A S A+ALAS  G+  E K +AA+A+A+G V G +EDNR++ E    
Sbjct  119   LGESFASVAKSARAGSAALALASPGGIHGEFKPNAAAAIASGTVLGLYEDNRYRSESNKV  178

Query  794   TLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLY  973
              LK V ++G G GPE++++L+ +  VSSGVIF K+LVN+PANVLTP  LAEEA  IAS Y
Sbjct  179   HLKHVHLIGFGYGPEVDRRLELANYVSSGVIFGKDLVNSPANVLTPVVLAEEASKIASTY  238

Query  974   SDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITF  1153
             SDV TATILD E+C+ELKMGS+L VAAA+ NP  FIHLCYKP  G+VK KLA++GKG+TF
Sbjct  239   SDVFTATILDEERCRELKMGSYLAVAAASANPPRFIHLCYKPPGGNVKRKLAIVGKGLTF  298

Query  1154  DSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEV  1288
             DSGGYN+KIGA  +IELMK DM G+A V GAAKA+ +IKP GVEV
Sbjct  299   DSGGYNIKIGAVCNIELMKWDMGGSAAVLGAAKALGEIKPPGVEV  343


 Score = 85.9 bits (211),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSL-DGDAITASL  1862
             GI TPS++L +EV  A++V GEK WR+PLEESYWETMKS +ADM+N G++  G  ITA+L
Sbjct  410   GILTPSDELHEEVAAASEVSGEKFWRLPLEESYWETMKSGVADMLNTGAIPQGGVITAAL  469

Query  1863  FMK  1871
             F+K
Sbjct  470   FLK  472


 Score = 68.2 bits (165),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  1439  LGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVA  1606
             LG I P    V +TDAEGRL LADALVYA K GV+K++DLATLTG C  ALG S+A
Sbjct  333   LGEIKPPGVEVDNTDAEGRLTLADALVYACKQGVDKIIDLATLTGFCRVALGPSIA  388



>gb|KEH38071.1| cytosol aminopeptidase family protein [Medicago truncatula]
Length=358

 Score =   352 bits (903),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 203/317 (64%), Positives = 239/317 (75%), Gaps = 12/317 (4%)
 Frame = +2

Query  233   LCCRR--PRRMAHSIARATLGLTHPNQIERPKISFAAKEVD--LLEWKGDILAVGVTEKD  400
             LC  R  P R      RATLG THP   E PKISFAAK++D  + EWKGD+LAV VTEKD
Sbjct  44    LCLTREVPVRNLIMPPRATLGFTHPANTETPKISFAAKDIDTDVAEWKGDLLAVAVTEKD  103

Query  401   MVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRL-PA--LGFKRIGLV  571
             + +D   KFQN IL+ LDSKLGGLL EASSEEDF+GK GQS +LR+ PA  LG KR+ L+
Sbjct  104   VTRDGELKFQNSILRTLDSKLGGLLGEASSEEDFTGKLGQSTLLRITPAAGLGSKRLALL  163

Query  572   GLGSVVSSTIAYRTLGETIaaaaksaqassvaval-asaEGLSVESKLSAASAMATGIVS  748
             GLG   SST A++TLGE++A+AA  AQA+ VAV +  +++GLS  +    ASA+ATG V 
Sbjct  164   GLGPSASSTAAFKTLGESVASAANFAQAAHVAVVVLPTSKGLSAPN---IASAIATGTVV  220

Query  749   GTFEDNRFKLEPKT-PTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVL  925
             GTFEDNRFK E K  P LKS++I+GLGTGPE EKKLKY+  VSSG+I  KELVN+P NVL
Sbjct  221   GTFEDNRFKSESKKKPVLKSLDIIGLGTGPEFEKKLKYAGDVSSGIILGKELVNSPPNVL  280

Query  926   TPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSS  1105
             TPG LAEEA  IAS YSDV TA +LD EQCKELKMGS+L VAAA+ NP  FIHLCYKP +
Sbjct  281   TPGVLAEEASKIASTYSDVFTAKVLDAEQCKELKMGSYLAVAAASANPPQFIHLCYKPPT  340

Query  1106  GSVKTKLALLGKGITFD  1156
             G V  KLAL+GKG+TFD
Sbjct  341   GPVNVKLALVGKGLTFD  357



>ref|XP_001783885.1| predicted protein [Physcomitrella patens]
 gb|EDQ51282.1| predicted protein [Physcomitrella patens]
Length=517

 Score =   348 bits (894),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 206/427 (48%), Positives = 271/427 (63%), Gaps = 35/427 (8%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             L EW+GD+LA+GV E+++ + E +KF +  L +LD  +GG+L E + E+DF+GK GQ  V
Sbjct  10    LYEWEGDVLALGVFEENLTRSEENKFLHPGLAELDYVMGGVLGELADEDDFTGKLGQLSV  69

Query  530   LRLPALGFKRIGLVGLG------SVVSSTIAYRTLGETIaaaaksaqassvavalasaEG  691
             +RL +   KR+ LVGLG        V ++ ++R LG T A  AK  +  S+ +A      
Sbjct  70    VRLASSKIKRLALVGLGRANNVMDAVYASDSWRILGFTAARIAKQLKMCSMGLAAMDTNL  129

Query  692   LSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVV  871
             +   SKL A  ++A+G + GT+ED RFK E K   L  V ++ LGTG + ++ L+ +  +
Sbjct  130   MDESSKLVAVESIASGAILGTYEDTRFKSEAKPSKLTQVAVMSLGTGSDRDEALRRAVCI  189

Query  872   SSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVA  1051
             ++GVI  K+LV APANVLTPGALA+ A +IA  +S+VLT TIL+   C+ L MG+FLGVA
Sbjct  190   TAGVIVAKQLVAAPANVLTPGALADAAVSIAMAHSEVLTCTILEKVDCEALGMGAFLGVA  249

Query  1052  AAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaa  1231
               +  P  FIHL Y P  G V  ++A++GKGI FDSGGYN+K GAN ++ELMK DM GA 
Sbjct  250   NGSDQPPKFIHLKYCPPDGVVYKRVAIVGKGICFDSGGYNIKTGANCAVELMKFDMGGAG  309

Query  1232  vvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRC  1411
                GAA AI  +KP GVEVHFI  ACENMISG GMRPGDI+TA NG  IE          
Sbjct  310   AALGAASAIGALKPKGVEVHFISAACENMISGKGMRPGDIVTAMNGITIE----------  359

Query  1412  LSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITAL  1591
                                V +TDAEGRL LAD+LVYA +L V+ +VDLATLTGAC+ AL
Sbjct  360   -------------------VNNTDAEGRLTLADSLVYACRLRVDAIVDLATLTGACVVAL  400

Query  1592  GRSVAGM  1612
             G  V G 
Sbjct  401   GHEVGGF  407


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G FTPS  +A+++  AA + GEK+WRMPL E Y +T++S IAD++N    DG +I A+LF
Sbjct  406   GFFTPSATMAQQLETAAQIAGEKIWRMPLVEQYKQTLESPIADLVNTSGRDGGSIKAALF  465

Query  1866  MK  1871
             +K
Sbjct  466   LK  467



>ref|XP_008358040.1| PREDICTED: LOW QUALITY PROTEIN: leucine aminopeptidase 1-like 
[Malus domestica]
Length=582

 Score =   347 bits (891),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 199/310 (64%), Positives = 226/310 (73%), Gaps = 33/310 (11%)
 Frame = +2

Query  686   EGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSE  865
             EGLSV+S  + ASA+A+G V G +ED R+K E K   LKSV+ILGLGTG E+EKKLKY E
Sbjct  232   EGLSVKS--NTASAIASGTVLGIYEDGRYKSESKKSALKSVDILGLGTGAEVEKKLKYXE  289

Query  866   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELK-MGSFL  1042
              V+SG+IF KELVN+PANVLTPG LAEEA  IAS YSDV +A IL+ EQCK+LK MGS+L
Sbjct  290   DVTSGIIFGKELVNSPANVLTPGKLAEEASKIASTYSDV-SANILNEEQCKKLKKMGSYL  348

Query  1043  GVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMa  1222
              VAAA+TNP +FIHL YKP  G  K KL L+GKG+TFDSGGYN+K G   SIE MK DM 
Sbjct  349   AVAAASTNPPHFIHLIYKPPGGPAKVKLGLVGKGLTFDSGGYNIKTGPGCSIEQMKFDMG  408

Query  1223  gaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALV  1402
             G+A V GAAKAIAQIKP GVEVHFIV ACENM+SGTGMRPGDI+TASNGK IE       
Sbjct  409   GSAAVLGAAKAIAQIKPTGVEVHFIVAACENMMSGTGMRPGDIVTASNGKTIE-------  461

Query  1403  LRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACI  1582
                                   V +TDAEG L LADALVYA   GV+K+ DLATLTGACI
Sbjct  462   ----------------------VNNTDAEGGLTLADALVYACNQGVDKIADLATLTGACI  499

Query  1583  TALGRSVAGM  1612
              A G SVAG+
Sbjct  500   VAFGPSVAGV  509



>ref|XP_008669992.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like isoform 
X2 [Zea mays]
Length=319

 Score =   338 bits (867),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 178/292 (61%), Positives = 231/292 (79%), Gaps = 1/292 (0%)
 Frame = +2

Query  284   LGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKL  463
             LGLT PN +E P+++F AK+++  EWKGDILAV VTEKD+ KD  SKF+N++L+KLD +L
Sbjct  16    LGLTKPNAVEPPQVTFFAKDIEFSEWKGDILAVTVTEKDLSKDAYSKFENVVLKKLDGQL  75

Query  464   GGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLG-SVVSSTIAYRTLGETIaaaa  640
             GGLLSEA+ EEDF+ K+GQS+VLRL   GFKR+GL+GLG S  S+  A R L E++A+ A
Sbjct  76    GGLLSEAAVEEDFTRKTGQSVVLRLAGQGFKRVGLIGLGQSAPSTAAASRGLRESVASVA  135

Query  641   ksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILG  820
             K+AQASS A+ LAS  G+  E KL+A + + TG V G +ED+R+K E K   LK V+I+G
Sbjct  136   KAAQASSTAIVLASPSGIQEEFKLAALAGLITGTVLGLYEDSRYKSESKKVHLKQVDIIG  195

Query  821   LGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATIL  1000
             LG+G E+++K+KY+   SSGVIF +ELVN+PANVLTP  LAEEA  I S +SDV TAT+L
Sbjct  196   LGSGAEVDQKIKYANDFSSGVIFGRELVNSPANVLTPAMLAEEASKITSTFSDVFTATVL  255

Query  1001  DVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1156
             DVE+CKELKMGS+LGV AA+ NP +FIHLCYKP+ G+VK KLA++GKG+TFD
Sbjct  256   DVEKCKELKMGSYLGVVAASANPPHFIHLCYKPTDGNVKRKLAIVGKGLTFD  307



>ref|NP_001048379.1| Os02g0794700 [Oryza sativa Japonica Group]
 dbj|BAF10293.1| Os02g0794700, partial [Oryza sativa Japonica Group]
Length=316

 Score =   301 bits (770),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 183/242 (76%), Gaps = 29/242 (12%)
 Frame = +2

Query  887   FVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATN  1066
             F KELVN+PANVLTP  LAEEA NIAS YSDV TATILDVE+CKELKMGS+LGVAAA+ N
Sbjct  1     FGKELVNSPANVLTPAVLAEEASNIASTYSDVFTATILDVEKCKELKMGSYLGVAAASAN  60

Query  1067  PSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfga  1246
             P +FIHLCYKP  G+ K KLA++GKG+TFDSGGYN+K G   SIELMK DM G+A VFGA
Sbjct  61    PPHFIHLCYKPPGGNAKRKLAIVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVFGA  120

Query  1247  akaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSD  1426
             AKA+ QIKP GVEVHFIV ACENMISGTGMRPGDI+TASNGK IE               
Sbjct  121   AKALGQIKPPGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIE---------------  165

Query  1427  YIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSVA  1606
                           V +TDAEGRL LADALVYA   GV+K++DLATLTGAC+ ALG S+A
Sbjct  166   --------------VNNTDAEGRLTLADALVYACNQGVDKIIDLATLTGACVVALGPSIA  211

Query  1607  GM  1612
             G+
Sbjct  212   GI  213


 Score = 95.1 bits (235),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GIFTPS++LAKEV  A+++ GEK WRMPLEESYWE+MKS +ADM+N G   G +ITA+LF
Sbjct  212   GIFTPSDELAKEVAAASEISGEKFWRMPLEESYWESMKSGVADMVNTGGRQGGSITAALF  271

Query  1866  MK  1871
             +K
Sbjct  272   LK  273



>emb|CDY22921.1| BnaA01g18590D [Brassica napus]
Length=407

 Score =   310 bits (794),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 190/343 (55%), Positives = 238/343 (69%), Gaps = 34/343 (10%)
 Frame = +2

Query  365   GDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPA  544
             G +  VGVTEKD  +D  SKF+N IL KLD+ + GLL   SSEEDF+GK G+S       
Sbjct  87    GFLTLVGVTEKDSTRDATSKFENPILNKLDAHVSGLLDLVSSEEDFAGKPGKS-------  139

Query  545   LGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAAS  724
                            SS  A++ LGE +A  AK++Q+SSVAVAL+S +    ESKLS+ S
Sbjct  140   --------------ASSPAAFQDLGEAVATIAKASQSSSVAVALSSHDN---ESKLSSVS  182

Query  725   AMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELV  904
             A+          D R+K E K P+L SV+I+G GTGPE+E KLKY+E VS GVIF +EL+
Sbjct  183   ALEL--------DCRYKSESKKPSLSSVDIIGFGTGPELENKLKYAEDVSYGVIFGRELI  234

Query  905   NAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAAT--NPSYF  1078
             N+PANVLTP  +++EA  +AS YSDV +A IL+ EQC+ELKMGS+L VA+A+   NP +F
Sbjct  235   NSPANVLTPAVISDEASKVASTYSDVFSANILNEEQCRELKMGSYLAVASASAKANPPFF  294

Query  1079  IHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakai  1258
             IHL Y+P SGSV+TK  L+GKG+TFDS GYN+K G  SSI LMK DM G+A +  AAKAI
Sbjct  295   IHLVYRPPSGSVRTKHVLIGKGLTFDSDGYNIKAGPGSSINLMKFDMGGSAAILCAAKAI  354

Query  1259  aQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVT  1387
              +IK  GVEVHFIV  CENMISGTGMR GD++TASN K IE+ 
Sbjct  355   GEIKHPGVEVHFIVAVCENMISGTGMRHGDVITASNEKTIELN  397



>emb|CAA68143.1| cytosol aminopeptidase [Petroselinum crispum]
Length=295

 Score =   272 bits (695),  Expect(2) = 4e-93, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 169/219 (77%), Gaps = 30/219 (14%)
 Frame = +2

Query  959   IASLYSDVLTATILDVEQCKELKMGSFLGVAAAAT-NPSYFIHLCYKPSSGSVKTKLALL  1135
             IASLYSDV++ATILDVEQCKELKMGS+LGVAAAA+ NP++FIHLCYKP SG+VK+KLAL+
Sbjct  2     IASLYSDVISATILDVEQCKELKMGSYLGVAAAASENPAHFIHLCYKPPSGTVKSKLALV  61

Query  1136  GKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACEN  1315
             GKG+TFDSGGYN+K G   SIELMK DM G+A V GAAKAI QIKPAGVEVHFIV ACEN
Sbjct  62    GKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVLGAAKAIGQIKPAGVEVHFIVAACEN  121

Query  1316  MISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGR  1495
             MISG GMRPGDILTASNGK IE                             V +TDAEGR
Sbjct  122   MISGAGMRPGDILTASNGKTIE-----------------------------VNNTDAEGR  152

Query  1496  LILADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             L LADALVYA   GV+K++DLATLTGAC+ ALG S+AG+
Sbjct  153   LTLADALVYACNQGVDKIIDLATLTGACVVALGPSIAGI  191


 Score = 99.8 bits (247),  Expect(2) = 4e-93, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GIFTPS+DLAKEV+EA+++ GEKLWR+P+EESYWE+MKS +ADM+N G   G +ITA+LF
Sbjct  190   GIFTPSDDLAKEVVEASEIAGEKLWRLPMEESYWESMKSGVADMVNTGGRQGGSITAALF  249

Query  1866  MK  1871
             +K
Sbjct  250   LK  251



>emb|CDX99645.1| BnaC04g34020D [Brassica napus]
Length=386

 Score =   295 bits (756),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 182/331 (55%), Positives = 228/331 (69%), Gaps = 34/331 (10%)
 Frame = +2

Query  365   GDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPA  544
             G +  VGVTEKD  +D  SKF+N IL KLD+ + GLL   SSEEDF+GK G+S       
Sbjct  87    GFLTLVGVTEKDSTRDATSKFENPILNKLDAHVSGLLDLVSSEEDFAGKPGKS-------  139

Query  545   LGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESKLSAAS  724
                            SS  A++ LGE +A  AK++Q+SSVAVAL+S +    ESKLS+ S
Sbjct  140   --------------ASSPAAFQDLGEAVATIAKASQSSSVAVALSSHDN---ESKLSSVS  182

Query  725   AMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELV  904
             A+          D R+K E K P+L SV+I+G GTGPE+E KLKY+E VS GVIF +EL+
Sbjct  183   ALEL--------DCRYKSESKKPSLSSVDIIGFGTGPELENKLKYAEDVSYGVIFGRELI  234

Query  905   NAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAA--TNPSYF  1078
             N+PANVLTP  +++EA  +AS YSDV +A IL+ EQC+ELKMGS+L VA+A+   NP +F
Sbjct  235   NSPANVLTPAVISDEASKVASTYSDVFSANILNEEQCRELKMGSYLAVASASAKANPPFF  294

Query  1079  IHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakai  1258
             IHL Y+P SGSV+TK  L+GKG+TFDS GYN+K G  SSI LMK DM G+A +  AAKAI
Sbjct  295   IHLVYRPPSGSVRTKHVLIGKGLTFDSDGYNIKAGPGSSINLMKFDMGGSAAILCAAKAI  354

Query  1259  aQIKPAGVEVHFIVPACENMISGTGMRPGDI  1351
              +IK  GVE HFIV  CENMISGTGMR GD+
Sbjct  355   GEIKHPGVEAHFIVAVCENMISGTGMRHGDV  385



>ref|WP_039713603.1| aminopeptidase A [Scytonema millei]
 gb|KIF21277.1| aminopeptidase A [Scytonema millei VB511283]
Length=491

 Score =   272 bits (696),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 198/434 (46%), Positives = 255/434 (59%), Gaps = 60/434 (14%)
 Frame = +2

Query  335   AKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKS  514
             A +  LL+W GD LA+G+ E D V+          L +LD K  G ++E +++ +F  K 
Sbjct  5     AIDTPLLDWAGDALALGLFE-DAVELTGE------LAELDGKFAGAIAELTADTEFKAKE  57

Query  515   GQSIVLRLPA-LGFKRIGLVGLGSVVSSTIA-YRTLGETIaaaaksaqassvavalasaE  688
             G + V R+      +++ LVGLG      I  +R     +A  AK  +  +V        
Sbjct  58    GSTAVTRVGGGSAVRKVILVGLGKPEGLKIDNWRKAAAVVARLAKKERCKTV--------  109

Query  689   GLSV----ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKK  850
             G+S+        + A A+A GI    F+DNRFK EP  K PT++ V++LGLG+    +  
Sbjct  110   GISLPAWNNDPAATAQALAEGIQLALFQDNRFKSEPEDKPPTVERVDLLGLGSQ---DDA  166

Query  851   LKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKM  1030
             +  +  ++SGVI  +ELV APAN +TP  +AE A+ IAS Y   L   IL+ E C++L M
Sbjct  167   VTRASQIASGVILARELVAAPANAVTPVTMAETAQAIASEYG--LAVEILEREDCEKLGM  224

Query  1031  GSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMK  1210
             G+FLGVA A+  P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K GA S IE MK
Sbjct  225   GAFLGVAQASELPPKFIHLTYKPD-GTPKRKLAIIGKGLTFDSGGLNIK-GAGSGIETMK  282

Query  1211  KDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTY  1390
              DM GAA   GAAKAIAQ+KP  VEVHFI  A ENMISG  M PGDIL ASNGK IE   
Sbjct  283   MDMGGAAATLGAAKAIAQLKP-DVEVHFISAATENMISGRAMHPGDILKASNGKTIE---  338

Query  1391  AALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLT  1570
                                       V +TDAEGRL LADALV+A KLGV+ +VDLATLT
Sbjct  339   --------------------------VNNTDAEGRLTLADALVFAEKLGVDAIVDLATLT  372

Query  1571  GACITALGRSVAGM  1612
             GACI ALG  +AG+
Sbjct  373   GACIVALGDEIAGL  386


 Score = 79.3 bits (194),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP +DLA E+  AA   GEK WR+P+EE Y+E +KS IADM N G   G +ITA+LF
Sbjct  385   GLFTPHDDLANEIQAAAQTAGEKFWRLPMEEKYFEGLKSGIADMKNTGPRAGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>emb|CEF97939.1| Leucine aminopeptidase/peptidase B [Ostreococcus tauri]
Length=506

 Score =   276 bits (705),  Expect(2) = 8e-87, Method: Compositional matrix adjust.
 Identities = 184/417 (44%), Positives = 240/417 (58%), Gaps = 49/417 (12%)
 Frame = +2

Query  368   DILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPAL  547
             D +   V E+D V  E S  ++  L+  D++ GG +SE  +E +F GK+G S   R    
Sbjct  34    DAIVFAVCEED-VNAETSAIESEALRAFDARSGGAVSEMMAEGEFKGKAGSSAFSRARGG  92

Query  548   GFKRIGLVGLGSVVSSTIA-YRTLGETIaaaaksaqassvavalasaEGLSVESKLSAAS  724
               K +G+VGLG      ++    LG T AA A+ ++ ++          L +       +
Sbjct  93    NAKHVGVVGLGKREERGVSVMMALGSTAAAHAQKSKCAT----------LGIAGAAGFEN  142

Query  725   AMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELV  904
             A+A G   G  +D RFK +P+  TLK+V +L      ++   +   +  + GV   KELV
Sbjct  143   AVAAGAYLGATDDQRFKSKPQAKTLKTVSLL------DVTADVSAGKARAVGVQLTKELV  196

Query  905   NAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIH  1084
              AP NV+TP ALAE AK IA+ +SD +T  IL+   C++L MGS+LGV+ A+  P  FIH
Sbjct  197   AAPPNVVTPTALAETAKEIAAKHSDCMTVKILEKADCEKLGMGSYLGVSEASDEPPKFIH  256

Query  1085  LCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQ  1264
             L YK  +GS   K+A++GKG+TFDSGGYNLK GA S IE+MK DM G+    GAAK IAQ
Sbjct  257   LTYK-GAGSDLKKVAVVGKGLTFDSGGYNLKAGAGSMIEMMKFDMGGSGATLGAAKIIAQ  315

Query  1265  IKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLG  1444
              KPAGVE HFI+ ACENMI   G+RPGDILTASNGK IE                     
Sbjct  316   TKPAGVEAHFIIAACENMIGSRGLRPGDILTASNGKTIE---------------------  354

Query  1445  VIDPFF**VTDTDAEGRLILADALVYASK-LGVEKMVDLATLTGACITALGRSVAGM  1612
                     V +TDAEGRL LADALVYA K  G   +VD ATLTGA I ALG  +AG+
Sbjct  355   --------VNNTDAEGRLTLADALVYADKTCGATAIVDCATLTGAIIVALGDEMAGL  403


 Score = 74.7 bits (182),  Expect(2) = 8e-87, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+F+P +D AK V  AA   GE LWRMP+ +S W  MKS IADM N G+  G +ITA+LF
Sbjct  402   GLFSPKDDAAKRVEAAAKAAGEDLWRMPMPDSMWAIMKSEIADMKNTGTRGGGSITAALF  461

Query  1866  MK  1871
             +K
Sbjct  462   LK  463



>ref|WP_035153350.1| aminopeptidase A [Calothrix sp. 336/3]
 gb|KFB83598.1| aminopeptidase A [Calothrix sp. 336/3]
Length=491

 Score =   267 bits (682),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 193/429 (45%), Positives = 254/429 (59%), Gaps = 60/429 (14%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEK--DMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQS  523
             L +W GD LAVG+ E+  ++  D         L  LD KLGG ++E  +EE+F GK G  
Sbjct  10    LFDWTGDGLAVGLFEETTELTGD---------LVALDGKLGGAIAELIAEEEFKGKVGSL  60

Query  524   IVLRLPA-LGFKRIGLVGLG---SVVSSTIAYRTLGETIaaaaksaqassvavalasaEG  691
             I  R+      +++ LVGLG    + + T+  R    T+A +A+  +  ++ + L    G
Sbjct  61    ISTRISGNTSIRKVILVGLGKGEGLTAETL--RKTAATVAKSARKQKCKTLGIYLPIYNG  118

Query  692   LSVESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSE  865
              +     + A A+  GI  G ++D RFK EP  K+P ++++++LGLG     E  +    
Sbjct  119   DAA----TTAQAITEGIELGLYQDTRFKSEPEEKSPQIETIDLLGLGG---QEAAITRGT  171

Query  866   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLG  1045
              ++SGVI  ++LV APAN +TP  +A+ A  IA  Y   L  TIL+  +C++L MG+FLG
Sbjct  172   QIASGVILARQLVAAPANEVTPITMADTASAIAKDYG--LELTILEQAECEQLGMGAFLG  229

Query  1046  VAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMag  1225
             VA A+  P  FIHL YKP  G+ + KLA++GKG+TFDSGG N+K GA S IE MK DM G
Sbjct  230   VAQASDLPPKFIHLTYKPQ-GTPRKKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGG  287

Query  1226  aavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVL  1405
             AA   GAAKAIAQ+KP  VEVHFI    ENMISG  M PGDIL ASNGK IE        
Sbjct  288   AAATLGAAKAIAQLKPD-VEVHFISAVTENMISGHAMHPGDILKASNGKTIE--------  338

Query  1406  RCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACIT  1585
                                  V +TDAEGRL LADALVYA KLGV+ MVDLATLTGAC+ 
Sbjct  339   ---------------------VNNTDAEGRLTLADALVYADKLGVDAMVDLATLTGACVI  377

Query  1586  ALGRSVAGM  1612
             ALG  +AG+
Sbjct  378   ALGDDIAGL  386


 Score = 82.4 bits (202),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP + LAKE+ +AAD GGEK+WRMP+E+ Y++ +KS IADM N G   G +ITASLF
Sbjct  385   GLFTPHDGLAKELEQAADKGGEKIWRMPMEDKYFDGLKSGIADMKNTGPRAGGSITASLF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_013191100.1| aminopeptidase A [Trichormus azollae]
 ref|YP_003721206.1| leucyl aminopeptidase ['Nostoc azollae' 0708]
 gb|ADI64083.1| Leucyl aminopeptidase ['Nostoc azollae' 0708]
Length=490

 Score =   276 bits (707),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 200/429 (47%), Positives = 260/429 (61%), Gaps = 60/429 (14%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEK--DMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQS  523
             LL+W GD LAVG+ E   D+  D         L  L+  LGGLL E  +EE+F+GK+  +
Sbjct  10    LLDWTGDTLAVGLFEDAVDLTGD---------LAILNDNLGGLLKELIAEEEFTGKANST  60

Query  524   IVLRLPA-LGFKRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEGLS  697
             IV R+ A    +++ LVGLG   +  +   R L  T+A  AK  +  ++A++      L 
Sbjct  61    IVARVGAGHPVRKVILVGLGKPDALKLETLRCLAATVARTAKKQKTKTLAIS------LP  114

Query  698   VESKLSAAS--AMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSE  865
             V +   AA+  A+A G     ++D RFK EP  K P ++++++LGLG     E  +  +E
Sbjct  115   VWNNDQAATGQAIAEGTQLALYQDIRFKSEPEDKNPPIETIDLLGLGGQ---EAAITRAE  171

Query  866   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLG  1045
              + SGVI  ++LV APAN +TP  +AE AK IA  +   L   IL+ E+C++L MG+FLG
Sbjct  172   QIVSGVILARQLVAAPANAVTPITMAETAKAIAKDHG--LHLEILEQEECEKLGMGAFLG  229

Query  1046  VAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMag  1225
             VA A+  P  FIHL YKP++ + K KLA++GKG+TFDSGG N+K GA S IE MK DM G
Sbjct  230   VAQASDLPPKFIHLIYKPAT-TPKRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGG  287

Query  1226  aavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVL  1405
             AA   GAAKAI Q+KP  VEVHFI    ENMISG  MRPGDILTASNGK IE        
Sbjct  288   AAATLGAAKAIGQLKP-DVEVHFISAVTENMISGRAMRPGDILTASNGKTIE--------  338

Query  1406  RCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACIT  1585
                                  V +TDAEGRL LADALVYA KLGV+ +VDLATLTGAC+ 
Sbjct  339   ---------------------VNNTDAEGRLTLADALVYADKLGVDAIVDLATLTGACVV  377

Query  1586  ALGRSVAGM  1612
             ALG  +AG+
Sbjct  378   ALGDDIAGL  386


 Score = 72.0 bits (175),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP + +A ++  A++  GEKLWR+P+EE Y+E +KS IADM N G   G +ITA+LF
Sbjct  385   GLFTPDDAVASQLQTASESAGEKLWRLPMEEKYFEGLKSGIADMKNTGPRYGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>tpg|DAA46815.1| TPA: hypothetical protein ZEAMMB73_269181 [Zea mays]
Length=762

 Score =   296 bits (759),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 184/392 (47%), Positives = 228/392 (58%), Gaps = 112/392 (29%)
 Frame = +2

Query  284   LGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKL  463
             LGLT PN +E P+++F AK++   EWKGDILAV VTEKD+ KD  SKF+N +L+KLD +L
Sbjct  16    LGLTKPNAVEPPQVTFFAKDIKFSEWKGDILAVTVTEKDLSKDAYSKFENAVLKKLDGQL  75

Query  464   GGLLSEASSEEDFSGKSGQSIVLRL----------PALGFKRIGLVGLGSVVSSTIAYRT  613
             GGLLSEA+ EEDF+G      VL L            +  K++ ++GLGS          
Sbjct  76    GGLLSEAAVEEDFTG-----TVLGLYEDNRYKSESKKVHLKQVDIIGLGS----------  120

Query  614   LGETIaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTP  793
                                      G  V+ K+  A+ +++G++ G              
Sbjct  121   -------------------------GAEVDQKIKYANDLSSGVIFG--------------  141

Query  794   TLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTP--------------  931
                                    E+V+S           PANVLTP              
Sbjct  142   ----------------------RELVNS-----------PANVLTPDLLPVYLSQSSFVL  168

Query  932   -GALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSG  1108
                LAEEA  IAS +SDV TAT+LDVE+CKELKMGS+LGVAAA+ NP +FIHLCYKP+ G
Sbjct  169   SAVLAEEASKIASTFSDVFTATVLDVEKCKELKMGSYLGVAAASANPPHFIHLCYKPTDG  228

Query  1109  SVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEV  1288
             ++K KLA++GKG+TFDSGGYN+K G   SIELMK DM G+A VFGAAKA+ QIKP GVEV
Sbjct  229   NIKRKLAIVGKGLTFDSGGYNIKTGPGCSIELMKFDMGGSAAVFGAAKALGQIKPPGVEV  288

Query  1289  HFIVPACENMISGTGMRPGDILTASNGKRIEV  1384
             HFIV ACENMISGT MR GDI+TASNGK IEV
Sbjct  289   HFIVAACENMISGTDMRTGDIVTASNGKTIEV  320



>ref|WP_015217123.1| cytosol aminopeptidase [Anabaena cylindrica]
 ref|YP_007159418.1| cytosol aminopeptidase [Anabaena cylindrica PCC 7122]
 gb|AFZ60508.1| cytosol aminopeptidase [Anabaena cylindrica PCC 7122]
Length=490

 Score =   274 bits (701),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 197/425 (46%), Positives = 253/425 (60%), Gaps = 52/425 (12%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             LL+W GD LA+ + E D V+          L  LD K GG+L E  +EE+F+GK   +IV
Sbjct  10    LLDWTGDTLAIALFE-DAVELTGD------LATLDEKCGGILKELIAEEEFTGKLNSTIV  62

Query  530   LRLPA-LGFKRIGLVGLGSV-VSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVE  703
             +R  A    +++ LVGLG   V      R +  T+A  AK  +  ++A++L         
Sbjct  63    MRAGAGHPVRKVILVGLGKPEVLKLETLRRVAATVARTAKKQKTKTLAMSLPVWN----N  118

Query  704   SKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVVSS  877
                + A A+A G     ++D RFK EP  K P ++++++LGLG     E  +  +E + S
Sbjct  119   DPTATAQAIAEGTQLALYQDTRFKSEPEDKNPQIETIDLLGLGGQ---EAAITRAEQIVS  175

Query  878   GVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAA  1057
             GVI  ++LV APAN +TP  +AE A  IA  Y   L   IL+ E+C++L MG+FLGVA A
Sbjct  176   GVILARQLVAAPANAVTPITMAETAIAIAKDYG--LEIQILEKEECEKLGMGAFLGVAQA  233

Query  1058  ATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavv  1237
             +  P  FIHL YKP +G+ K KLA++GKG+TFDSGG N+K GA S IE MK DM GAA  
Sbjct  234   SDLPPKFIHLTYKP-AGTPKRKLAIIGKGVTFDSGGLNIK-GAGSGIETMKMDMGGAAAT  291

Query  1238  fgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLS  1417
              GAAKAI Q+KP  VEVHFI    ENMISG  MRPGDILTASNGK IE            
Sbjct  292   LGAAKAIGQLKP-DVEVHFISAVTENMISGRAMRPGDILTASNGKTIE------------  338

Query  1418  RSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGR  1597
                              V +TDAEGRL LADALVYA KLGV+ +VDLATLTGAC+ ALG 
Sbjct  339   -----------------VNNTDAEGRLTLADALVYADKLGVDAIVDLATLTGACVVALGD  381

Query  1598  SVAGM  1612
              +AG+
Sbjct  382   DIAGL  386


 Score = 72.8 bits (177),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP + +A ++  A++ GGEK+WRMP+E+ Y++ +KS IADM N G   G +ITA+LF
Sbjct  385   GLFTPDDAVASQLQTASEAGGEKIWRMPMEDKYFDGLKSGIADMKNTGPRYGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_019494406.1| aminopeptidase A [Calothrix sp. PCC 7103]
Length=491

 Score =   266 bits (679),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 198/431 (46%), Positives = 251/431 (58%), Gaps = 54/431 (13%)
 Frame = +2

Query  335   AKEVDLLEWKGDILAVGVTEK--DMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSG  508
             A    LLEW GD LAVG+ E+  ++  D         L  LD KL G+L E  +EEDF G
Sbjct  5     ATNTPLLEWTGDGLAVGLFEEATELAGD---------LAALDEKLAGVLKELITEEDFKG  55

Query  509   KSGQSIVLRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasa  685
             K G + V R+ A    ++I LVGLG     T+   TL    AA A+ A+         S 
Sbjct  56    KLGSTAVTRVGAGSPVRKIILVGLGK--PDTLKAETLRRAAAAIARLAKKQKCKTLGISL  113

Query  686   EGLSVESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKY  859
               +  +  +SA  A+  G+    ++D RFK EP  K P L++V++LGL      E  ++ 
Sbjct  114   PVVDSDPAISA-QAITEGVQLALYQDIRFKSEPEDKGPQLETVDLLGLNGQ---EAAIER  169

Query  860   SEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSF  1039
             +  ++SGV   ++LV APAN +TP  +AE A+ IA+ Y   L   IL+ E C++L MG+F
Sbjct  170   ANHIASGVFLARQLVAAPANAVTPITMAETAQTIANDYG--LQLQILEQEDCEKLGMGAF  227

Query  1040  LGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDM  1219
             LGVA A+  P  FIHL YKP  G+ K K+A++GKG+TFDSGG N+K GA S IE MK DM
Sbjct  228   LGVAQASEIPPKFIHLTYKPE-GTPKRKVAIIGKGLTFDSGGLNIK-GAGSGIETMKIDM  285

Query  1220  agaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAAL  1399
              GAA   GAAKAI Q+KP  VEVHFI    ENMISG  M PGDILTASNGK IE      
Sbjct  286   GGAAATLGAAKAIGQLKP-DVEVHFISAVTENMISGRAMHPGDILTASNGKTIE------  338

Query  1400  VLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGAC  1579
                                    V +TDAEGRL LADALVY  KLGV+ +VDLATLTGAC
Sbjct  339   -----------------------VNNTDAEGRLTLADALVYTDKLGVDAIVDLATLTGAC  375

Query  1580  ITALGRSVAGM  1612
             + ALG  +AG+
Sbjct  376   VIALGDDIAGL  386


 Score = 80.1 bits (196),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP ++LAK++ EA+   GEKLWRMP+EE Y+E +KS IADM N G   G +ITA+LF
Sbjct  385   GLFTPDDNLAKQLEEASTSAGEKLWRMPMEEKYFEGLKSGIADMKNTGPRPGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_017315758.1| aminopeptidase A [Mastigocladopsis repens]
Length=500

 Score =   274 bits (700),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 199/428 (46%), Positives = 250/428 (58%), Gaps = 58/428 (14%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             LL+W GD LA+G+ E D V+          L  LD  L G + E  +EE+F GK G SIV
Sbjct  10    LLKWTGDGLAIGLFE-DAVELTGE------LATLDENLAGSIKELITEEEFKGKQGSSIV  62

Query  530   LRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV--  700
              R+ A    ++I LVGLG   + TI      ET+  AA      +      +  G+S+  
Sbjct  63    TRVGAGSPVRKIILVGLGKPEALTI------ETLRRAAAVVGRLAKKQKCRTL-GISLPI  115

Query  701   --ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEV  868
                 +   A A+A G+    ++DNRFK EP  K P ++ V++LGLG     E  +  +  
Sbjct  116   WNNDRAQTAQALAEGVQLALYQDNRFKSEPEDKGPQVEQVDLLGLGGQ---EAAITRANQ  172

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             +SSGV   ++LV APAN +TP  +AE A  IAS +S  L   IL+ E C+ L MG+FLGV
Sbjct  173   ISSGVFLARQLVAAPANSVTPITMAETAVAIASEHS--LQVEILEQEDCERLGMGAFLGV  230

Query  1049  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1228
             A A+  P  FIHL YKP+ G+ K K+A++GKG+TFDSGG N+K GA S IE MK DM GA
Sbjct  231   AKASELPPKFIHLTYKPA-GAPKRKIAIIGKGVTFDSGGLNIK-GAGSGIETMKMDMGGA  288

Query  1229  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLR  1408
             A   GAAKAI Q+KP  VEVHFI    ENMISG  M PGDILTASNGK IE         
Sbjct  289   AATLGAAKAIGQLKP-DVEVHFISAVTENMISGHAMHPGDILTASNGKTIE---------  338

Query  1409  CLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1588
                                 V +TDAEGRL LADALV+A KLGV+ +VDLATLTGACI A
Sbjct  339   --------------------VNNTDAEGRLTLADALVFAEKLGVDAIVDLATLTGACIIA  378

Query  1589  LGRSVAGM  1612
             LG  +AG+
Sbjct  379   LGDEIAGL  386


 Score = 72.0 bits (175),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+F+P + LA ++ +A +  GEK WR+P+EE Y+E +KS IADM N G   G +ITA+LF
Sbjct  385   GLFSPDDALAGQLQKAGETAGEKFWRLPMEEKYFEGLKSGIADMKNTGPRAGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_027842357.1| aminopeptidase A [Mastigocoleus testarum]
Length=492

 Score =   268 bits (685),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 187/433 (43%), Positives = 251/433 (58%), Gaps = 58/433 (13%)
 Frame = +2

Query  335   AKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKS  514
             A   + LEWKGD LA+G+ E       ++      L  LD KLGG+L E  +EE+F  K+
Sbjct  5     ASNTNFLEWKGDALAIGLFE-------DATELTGQLTSLDEKLGGILKEIITEEEFKAKA  57

Query  515   GQSIVLRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEG  691
             G SI  R+P +   K++ ++GLG++ S T+        +   A +  A +         G
Sbjct  58    GSSIFTRVPGVSPIKKLLVIGLGTIESLTL-------EVLRKAAATAARNAKKQKCKTLG  110

Query  692   LSV----ESKLSAASAMATGIVSGTFEDNRFKLEPKTP--TLKSVEILGLGTGPEIEKKL  853
             +S      +      A+A G+    ++DNRFK EP+T    ++ V++LGL      E  +
Sbjct  111   ISFPYGEHNPEDVTQALAEGVQLALYQDNRFKSEPETKETQVEEVDLLGLADN---EAAI  167

Query  854   KYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMG  1033
               +  + SGV   ++LV APAN LTP  +AE A+ IAS ++  L   IL+ + C++L MG
Sbjct  168   VRANQICSGVFLARQLVAAPANDLTPVTMAEIAQEIASTHN--LELEILEQKDCEKLGMG  225

Query  1034  SFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKK  1213
             +FLGVA A+  P  FIHL YKP + + + KLA++GKG+TFDSGG N+K GA S IE MK 
Sbjct  226   AFLGVAKASDLPPKFIHLTYKPQA-TPRRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKI  283

Query  1214  DMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYA  1393
             DM GAA   GAAKAI Q++P  VEVHFI  A ENMISG  M PGDIL ASNGK IE    
Sbjct  284   DMGGAAATLGAAKAIGQLQP-DVEVHFISAATENMISGHAMHPGDILKASNGKTIE----  338

Query  1394  ALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTG  1573
                                      V +TDAEGRL LADALV+A KLG++ +VDLATLTG
Sbjct  339   -------------------------VNNTDAEGRLTLADALVFADKLGLDAIVDLATLTG  373

Query  1574  ACITALGRSVAGM  1612
             AC+ ALG  +AG+
Sbjct  374   ACVVALGNDIAGL  386


 Score = 77.8 bits (190),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS++LA E+ +AA+  GEK+WRMP+E+ Y+E +KS IADM N G   G +ITA+LF
Sbjct  385   GLFTPSDELASELEKAAEGAGEKIWRMPMEDKYFEGLKSGIADMKNTGPRAGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>tpg|DAA46938.1| TPA: hypothetical protein ZEAMMB73_710024 [Zea mays]
Length=545

 Score =   288 bits (737),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 167/354 (47%), Positives = 209/354 (59%), Gaps = 103/354 (29%)
 Frame = +2

Query  320   KISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEED  499
             K++F+ K+++  EWKGDIL V +T+KD+ KD +SKF+N                A++EED
Sbjct  279   KVTFSVKDIEFSEWKGDILVVAITKKDLSKDADSKFEN----------------ATAEED  322

Query  500   FSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  679
             F+GK+GQS+VLRL   GFKR+GL+GL                                  
Sbjct  323   FTGKTGQSVVLRLAGQGFKRVGLIGL----------------------------------  348

Query  680   saEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKY  859
                                G + G +ED+R+K E K   LK V+I+GLG+          
Sbjct  349   -------------------GTMLGLYEDSRYKSESKKVHLKQVDIIGLGSA---------  380

Query  860   SEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSF  1039
                                       LAEEA  IAS  SDV TAT+LDVE+CKELKMGS+
Sbjct  381   -------------------------VLAEEASKIASTSSDVFTATVLDVEKCKELKMGSY  415

Query  1040  LGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDM  1219
             LGVAAA+TNP +FIHLCYKP+ G++K KLA++GKG+TFDSGGYN+K G   +IELMK DM
Sbjct  416   LGVAAASTNPPHFIHLCYKPTDGNIKRKLAIVGKGLTFDSGGYNIKTGPGCNIELMKFDM  475

Query  1220  agaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIE  1381
              G+A +FGAAK + QIKP  VEVHFIV ACENMISGTGMRPGDI+TASNGK IE
Sbjct  476   GGSAAIFGAAKDLGQIKPPRVEVHFIVAACENMISGTGMRPGDIVTASNGKTIE  529



>ref|WP_008318986.1| leucyl aminopeptidase [Leptolyngbya sp. PCC 6406]
Length=491

 Score =   280 bits (716),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 201/432 (47%), Positives = 256/432 (59%), Gaps = 56/432 (13%)
 Frame = +2

Query  353   LEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVL  532
             L W GD LA+GV + D+  D        +L ++D +  GL+ E   E DF GKSG S ++
Sbjct  11    LTWTGDCLALGVLDTDLPLDG-------LLAEMDGQFSGLVQELIDETDFKGKSGTSAII  63

Query  533   RLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESK  709
             RL + G  +++ LVGLG+    T+    L    A AA+ ++     +   S    S+E+ 
Sbjct  64    RLGSGGPVRKLALVGLGAAADLTV--DGLRRATAIAARLSKKEKCKILGLSLPLGSLETA  121

Query  710   LSAASAMATGIVSGTFEDNRFKLE--PKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGV  883
             + AA A+A GI     ED RFK E  PK  TL+ V++LGL    +    ++  + ++SGV
Sbjct  122   I-AAQAIAEGITLTLHEDTRFKSEPDPKAFTLERVDLLGLA---QQAASVQRGQQIASGV  177

Query  884   IFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAAT  1063
             I  +ELV AP NV+TP  LA+ A+ IA  +   LT  IL+   C  L MG+FLGVA A+ 
Sbjct  178   ILARELVAAPPNVVTPQVLADTAQAIADDHG--LTVEILEQAACAALGMGAFLGVAQASD  235

Query  1064  NPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfg  1243
              P  FIHL Y+PSS   + KLA++GKG+TFDSGG N+K GA S IELMK DM GAA   G
Sbjct  236   LPPKFIHLTYRPSS-PPRRKLAIVGKGLTFDSGGLNIKAGAGSMIELMKFDMGGAAATLG  294

Query  1244  aakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRS  1423
             AAKAIAQ++P  VEVHFI  A ENMISG  MRPGDILTASNGK IE              
Sbjct  295   AAKAIAQLQP-DVEVHFISAAAENMISGGAMRPGDILTASNGKTIE--------------  339

Query  1424  DYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1603
                            V +TDAEGRL LADALV+A KL V+ +VDLATLTGACI ALG ++
Sbjct  340   ---------------VNNTDAEGRLTLADALVFAEKLEVDAIVDLATLTGACIVALGENI  384

Query  1604  AGMPL*IMYLWS  1639
             AG       LWS
Sbjct  385   AG-------LWS  389


 Score = 64.3 bits (155),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++ S +LA  +  A+ V GEK W MPLE+ Y++ +KS +ADM N G   G AITA+LF
Sbjct  386   GLWSSSNELATAIQSASTVAGEKFWTMPLEDQYFDGLKSIVADMKNTGPRFGGAITAALF  445

Query  1866  MK  1871
             +K
Sbjct  446   LK  447



>ref|WP_015156822.1| leucyl aminopeptidase [Chroococcidiopsis thermalis]
 ref|YP_007094151.1| leucyl aminopeptidase [Chroococcidiopsis thermalis PCC 7203]
 gb|AFY90282.1| leucyl aminopeptidase [Chroococcidiopsis thermalis PCC 7203]
Length=491

 Score =   266 bits (681),  Expect(2) = 7e-85, Method: Compositional matrix adjust.
 Identities = 195/435 (45%), Positives = 252/435 (58%), Gaps = 62/435 (14%)
 Frame = +2

Query  335   AKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKS  514
             A +  LL+W GD LA+G+ E D V+          L +LD K  G ++E  ++ +F  K 
Sbjct  5     AIDTPLLDWAGDALALGLFE-DAVELTGE------LAELDGKFAGAIAELIADTEFKAKE  57

Query  515   GQSIVLRLPA-LGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEG  691
             G + V R+      +++ LVGLG         +  G  I +  K+A A +        + 
Sbjct  58    GSTAVTRVSGGSAVRKVILVGLG---------KPDGLKIDSWRKAAAAVARLAKKERCKT  108

Query  692   LSV------ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEK  847
             L +          + A A+A GI    F+DNRFK EP  K PT++ V++LGLG+    + 
Sbjct  109   LGISLPAWNNDPTATAQALAEGIQLALFQDNRFKSEPEEKPPTVERVDLLGLGSQ---DD  165

Query  848   KLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELK  1027
              +  +  ++SGVI  +ELV APAN +TP  +AE A+ IAS +   L   IL+ E C++L 
Sbjct  166   AVTRASQIASGVILARELVAAPANAVTPVTMAETAQAIASEHG--LAVEILEREDCEKLG  223

Query  1028  MGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELM  1207
             MG+FLGVA A+  P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K GA S IE M
Sbjct  224   MGAFLGVAQASELPPKFIHLTYKPD-GTPKRKLAIIGKGLTFDSGGLNIK-GAGSGIETM  281

Query  1208  KKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVT  1387
             K DM GAA   GAAKAIAQ+KP  VEVHFI  A ENMISG  M PGDIL ASNGK IE  
Sbjct  282   KMDMGGAAATLGAAKAIAQLKP-DVEVHFISAATENMISGRAMHPGDILKASNGKTIE--  338

Query  1388  YAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATL  1567
                                        V +TDAEGRL LADALV+A KLGV+ +VDLATL
Sbjct  339   ---------------------------VNNTDAEGRLTLADALVFAEKLGVDAIVDLATL  371

Query  1568  TGACITALGRSVAGM  1612
             TGACI ALG  +AG+
Sbjct  372   TGACIVALGDEIAGL  386


 Score = 77.4 bits (189),  Expect(2) = 7e-85, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP + LA E+  AA++ GEK WR+P+EE Y+E +KS IADM N G   G +ITA+LF
Sbjct  385   GLFTPHDALAHEIQAAAEIAGEKFWRLPMEEKYFEGLKSGIADMKNTGPRAGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_037216500.1| hypothetical protein [Richelia intracellularis]
 emb|CDN10349.1| Cytosol aminopeptidase PepA [Richelia intracellularis]
Length=490

 Score =   262 bits (670),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 189/430 (44%), Positives = 254/430 (59%), Gaps = 53/430 (12%)
 Frame = +2

Query  335   AKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKS  514
             A    L++W GD LA+G+ E  +    +       L+ L+ KL G + E  +EE+F GK+
Sbjct  5     ASNTPLVQWTGDGLAIGLFEDHLELTSD-------LEALNDKLAGTIQELITEEEFKGKA  57

Query  515   GQSIVLRLPA-LGFKRIGLVGLGSVVSSTIA-YRTLGETIaaaaksaqassvavalasaE  688
             G +I  R+      +++ +VGLG      +   R  G +I+   K  +  ++A++L    
Sbjct  58    GSTIFTRVGGGSQVRKLIVVGLGKAEDLNLERLRGAGASISRLGKKQKCKTLAISLP---  114

Query  689   GLSVESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYS  862
               +  S    A A+A G+  G +ED RFK +P  K  T+++V++LGL      +  +  +
Sbjct  115   --TCNSPAETAQAIAEGVELGLYEDTRFKSDPEDKKTTVETVDLLGLAGQ---KTAIALA  169

Query  863   EVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFL  1042
             + + SGVI  KELV APAN +TP  +AE A+++A+     L   IL+ E+C++L MG+FL
Sbjct  170   QKICSGVILAKELVAAPANEVTPVTMAETAQSLATECG--LHLEILEQEECEKLGMGAFL  227

Query  1043  GVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMa  1222
             GVA A+  P  FIHL YKP  GS + KLA++GKG+TFDSGG N+K GANS IE MK DMA
Sbjct  228   GVAKASDLPPKFIHLTYKPQ-GSPRRKLAIIGKGLTFDSGGLNIK-GANSGIETMKIDMA  285

Query  1223  gaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALV  1402
             GA   FGAAKAI QIKP  VEVHF+    ENMISG  M PGDIL ASNGK IE       
Sbjct  286   GAGATFGAAKAIGQIKP-DVEVHFVSAVTENMISGHAMHPGDILKASNGKTIE-------  337

Query  1403  LRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACI  1582
                                   V +TDAEGRL LADALV+  KLGV+ +VDLATLTGAC+
Sbjct  338   ----------------------VNNTDAEGRLTLADALVFTDKLGVDAIVDLATLTGACV  375

Query  1583  TALGRSVAGM  1612
              ALG  +AGM
Sbjct  376   VALGNDIAGM  385


 Score = 80.1 bits (196),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP+++LAKE+  A D  GEKLWRMP+E+ Y+E +KSSIADM N G   G +I+A+LF
Sbjct  384   GMFTPNDELAKELDAAGDKAGEKLWRMPMEDKYFEGLKSSIADMKNTGPRPGGSISAALF  443

Query  1866  MK  1871
             +K
Sbjct  444   LK  445



>ref|WP_002766908.1| aminopeptidase A [Microcystis aeruginosa]
 emb|CCI01558.1| putative cytosol aminopeptidase [Microcystis aeruginosa PCC 9443]
Length=490

 Score =   270 bits (691),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 196/436 (45%), Positives = 246/436 (56%), Gaps = 59/436 (14%)
 Frame = +2

Query  341   EVDLLEWKGDILAVGVTEKDM-VKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSG  517
             +  LL W GD LA+G+ E  + +  E        L +L+ KLGG L +  SE +F GK G
Sbjct  7     DTSLLTWTGDTLALGLPEGAIEIAGE--------LAELNDKLGGNLEDLISETEFEGKLG  58

Query  518   QSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLS  697
              S   RL     +++ LVGLG      +    L     A     Q S          G  
Sbjct  59    SSAATRLGGGPIRKLILVGLGKTTDFDLQTLRLAAAAIARLAKQQKSQALAISLPVVG--  116

Query  698   VESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLKYSEVV  871
                + + A A+A G++  T +D RFK   E K   L++VE+LGLG   E    +  +E +
Sbjct  117   --DQSATAGAIAEGLLLATHQDTRFKSTKEEKGVKLETVELLGLG---EQTSAIAKAEQI  171

Query  872   SSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVA  1051
              SGVI  +ELVNAPAN +TP  +AE A+ IA+ Y   L+  IL+ E+C+ L MG+FLGVA
Sbjct  172   CSGVILARELVNAPANTVTPLTMAETAEQIAAEYG--LSLKILEQEECESLGMGAFLGVA  229

Query  1052  AAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaa  1231
              A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK DM G A
Sbjct  230   KASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMDMGGGA  287

Query  1232  vvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRC  1411
                GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IE          
Sbjct  288   ATLGAAKAIAQLRPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIE----------  336

Query  1412  LSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITAL  1591
                                V +TDAEGRL LADALV+A KL V+ +VDLATLTGAC+ AL
Sbjct  337   -------------------VNNTDAEGRLTLADALVFAEKLEVDAIVDLATLTGACVVAL  377

Query  1592  GRSVAGMPL*IMYLWS  1639
             G  +AG       LWS
Sbjct  378   GEDIAG-------LWS  386


 Score = 72.0 bits (175),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E LA ++ EAA + GEK W MPLEE Y+E MKS IADM N G   G +ITA+LF
Sbjct  383   GLWSSDESLAAQIQEAAKLAGEKFWPMPLEEKYFEGMKSQIADMKNTGPRPGGSITAALF  442

Query  1866  MK  1871
             +K
Sbjct  443   LK  444



>ref|WP_035993085.1| aminopeptidase A [Leptolyngbya sp. KIOST-1]
Length=496

 Score =   273 bits (697),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 195/433 (45%), Positives = 260/433 (60%), Gaps = 49/433 (11%)
 Frame = +2

Query  323   ISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDF  502
             + F A     L+W GD L +G++E  +            L +L+S++ GLL E   E +F
Sbjct  1     MEFHAPGNSCLDWSGDALILGLSEAALPLSGT-------LAELNSQVAGLLQELIDEVEF  53

Query  503   SGKSGQSIVLRL-PALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  679
             +GK+G + + R+      +++G+VGLG++    I   TL    AAAA+ A+    A    
Sbjct  54    TGKAGSTAITRVGTGANIRKLGIVGLGAI--DAITGDTLRRAAAAAARLAKKEKCASLGL  111

Query  680   saEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKT--PTLKSVEILGLGTGPEIEKKL  853
             S   L  ++ L+A  A+A G +    +DNRFK E K   PT++ + IL L    +    L
Sbjct  112   SFPNLQHDAALTA-QAIAEGAILALHQDNRFKSEDKNGKPTVEHIHILDLAG--QDSSSL  168

Query  854   KYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMG  1033
             + ++ +  GVI  +ELV+APAN++TP  LA+ A+ IAS +   L   IL+ EQC+ L MG
Sbjct  169   QTAQAICDGVILARELVSAPANIVTPELLAQTAQEIASAHG--LELEILEREQCEALGMG  226

Query  1034  SFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKK  1213
             ++LGVA A+  P  FIHL YKP +G+   KLA++GKG+TFDSGG N+K GA S IE+MK 
Sbjct  227   AYLGVARASDLPPKFIHLTYKP-TGTPTRKLAIVGKGLTFDSGGLNIK-GAGSGIEMMKI  284

Query  1214  DMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYA  1393
             DM GAA   GAAKAIAQ+KP+  EVHFI  A ENMISG  MRPGDILTASNGK IE    
Sbjct  285   DMGGAAATLGAAKAIAQLKPS-AEVHFISAAAENMISGNAMRPGDILTASNGKTIE----  339

Query  1394  ALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTG  1573
                                      V +TDAEGRL LADALV+A KLGV+ +VDLATLTG
Sbjct  340   -------------------------VNNTDAEGRLTLADALVFAEKLGVDAIVDLATLTG  374

Query  1574  ACITALGRSVAGM  1612
             ACI ALG  +AG+
Sbjct  375   ACIIALGDDIAGL  387


 Score = 69.3 bits (168),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+F+ +E+LA+ +  AA   GEK WR+P+EE Y++ +KS +ADM N G   G +ITA+LF
Sbjct  386   GLFSENEELAEAIATAAKTAGEKFWRLPMEEKYFDGLKSIVADMKNTGPRPGGSITAALF  445

Query  1866  MK  1871
             +K
Sbjct  446   LK  447



>ref|WP_017742946.1| aminopeptidase A [Scytonema hofmanni]
Length=493

 Score =   268 bits (684),  Expect(2) = 4e-84, Method: Compositional matrix adjust.
 Identities = 191/424 (45%), Positives = 249/424 (59%), Gaps = 50/424 (12%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             LLEW GD LA+G+ E D V+          L  LD KL G + E  +EE+F GK G S  
Sbjct  10    LLEWTGDGLAIGLFE-DAVELTGE------LATLDEKLAGSIKELIAEEEFKGKQGSSTS  62

Query  530   LRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVES  706
             +R+ +    +++ +VGLG      +   TL    A AA++A+             L+ + 
Sbjct  63    IRVGSHSPVRKVIVVGLGK--PEALKLETLRRAAAVAARTAKKQRCKTLAIHLPILN-DD  119

Query  707   KLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSG  880
             +   A A+A G+    ++DNRFK EP  K+P ++ V++LGLG     E  +  +  ++SG
Sbjct  120   QAQTAQALAEGVQLALYQDNRFKSEPEDKSPQVEQVDLLGLGGQ---EAAITRANQIASG  176

Query  881   VIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAA  1060
             V   ++LV APAN +TP  +AE A  IAS +   L   IL+ E C++L MG+FLGVA A+
Sbjct  177   VFLARQLVAAPANSVTPITMAETATQIASDHG--LQLEILEQEDCEKLNMGAFLGVAKAS  234

Query  1061  TNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvf  1240
               P  FIHL YKP  G+ + KLA++GKG+TFDSGG N+K GA S IE MK DM GAA   
Sbjct  235   DLPPKFIHLTYKP-EGTPRRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGGAAATL  292

Query  1241  gaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSR  1420
             GAAKAI Q+KP  VEVHFI    ENMISG  M PGDILTASNGK IE             
Sbjct  293   GAAKAIGQLKP-DVEVHFISAVTENMISGHAMHPGDILTASNGKTIE-------------  338

Query  1421  SDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1600
                             V +TDAEGRL LADALV+A KLGV+ ++DLATLTGAC+ ALG  
Sbjct  339   ----------------VNNTDAEGRLTLADALVFADKLGVDAIIDLATLTGACVVALGED  382

Query  1601  VAGM  1612
             +AG+
Sbjct  383   IAGL  386


 Score = 73.6 bits (179),  Expect(2) = 4e-84, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP + LA ++ +A+++ GEK+WR+P+EE Y+E +KS +ADM N G   G +ITA+LF
Sbjct  385   GLFTPDDALATQLEKASEISGEKIWRLPMEEKYFEGLKSGLADMKNTGPRAGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_038084500.1| aminopeptidase A [Tolypothrix bouteillei]
 gb|KIE07840.1| aminopeptidase A [Tolypothrix bouteillei VB521301]
Length=493

 Score =   266 bits (680),  Expect(2) = 4e-84, Method: Compositional matrix adjust.
 Identities = 192/424 (45%), Positives = 248/424 (58%), Gaps = 50/424 (12%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             LLEW GD LA+G+ E D V+          L  LD KL G + E  +EE+F GK G S  
Sbjct  10    LLEWVGDGLAIGLFE-DAVELTGE------LATLDEKLAGSIKELIAEEEFKGKQGSSSS  62

Query  530   LRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVES  706
             +R+ +    +++ +VGLG      +   TL    AAAA++A+              +   
Sbjct  63    IRVGSQSPVRKVIVVGLGK--PEALKLETLRRAAAAAARTAKKQKCKTLAIHLPIFN-ND  119

Query  707   KLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSG  880
             K   A A+A G+    ++DNRFK EP  K+P ++ V++LGLG     E  +  +  ++SG
Sbjct  120   KAQTAQAIAEGVQLALYQDNRFKSEPEDKSPQIEQVDLLGLGGQ---EAAITRANQIASG  176

Query  881   VIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAA  1060
             V   ++LV APAN +TP  +AE A  IAS +   L   IL+ E C++L MG+FLGVA A+
Sbjct  177   VFLARQLVAAPANSVTPITMAETATQIASEHG--LQLEILEQEDCEKLNMGAFLGVAKAS  234

Query  1061  TNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvf  1240
               P  FIHL YKP  G+ + KLA++GKG+TFDSGG N+K GA S IE MK DM GAA   
Sbjct  235   DLPPKFIHLTYKPE-GTPRRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGGAAATL  292

Query  1241  gaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSR  1420
             GAAKAI Q+KP  VEVHFI    ENMISG  M PGDILTASNGK IE             
Sbjct  293   GAAKAIGQLKP-DVEVHFISAVTENMISGHAMHPGDILTASNGKTIE-------------  338

Query  1421  SDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1600
                             V +TDAEGRL LADALV+A KLGV+ ++DLATLTGAC+ ALG  
Sbjct  339   ----------------VNNTDAEGRLTLADALVFADKLGVDAIIDLATLTGACVVALGED  382

Query  1601  VAGM  1612
             +AG+
Sbjct  383   IAGL  386


 Score = 75.5 bits (184),  Expect(2) = 4e-84, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP + LA ++ +A++V GEK+WR+P+EE Y+E +KS IADM N G   G +ITA+LF
Sbjct  385   GLFTPDDALATQLEKASEVSGEKIWRLPMEEKYFEGLKSGIADMKNTGPRAGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>gb|AFW71516.1| hypothetical protein ZEAMMB73_883672 [Zea mays]
Length=321

 Score =   261 bits (666),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 154/244 (63%), Positives = 177/244 (73%), Gaps = 30/244 (12%)
 Frame = +2

Query  884   IFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAA-  1060
             +  ++LVN+PANVLTPGALAE A  IAS YSDV TATILD  +C+ELKMGS+L VAAA+ 
Sbjct  1     MLARDLVNSPANVLTPGALAEAAAKIASTYSDVFTATILDAAKCRELKMGSYLAVAAASE  60

Query  1061  TNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvf  1240
             TNP YFIHLCYKP  G V+ KLAL+GKGITFDSGGYN+K    ++IELMKKDM GAA VF
Sbjct  61    TNPPYFIHLCYKPRGGDVRRKLALVGKGITFDSGGYNIKAVPVATIELMKKDMGGAAAVF  120

Query  1241  gaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSR  1420
             GAA+ + QIKP GVEVHFI  A ENMISG+GMRPGDI+TASNGK IE             
Sbjct  121   GAAEVLGQIKPPGVEVHFISAASENMISGSGMRPGDIVTASNGKTIE-------------  167

Query  1421  SDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1600
                             V +TDAEGRL LADALVYA   GV+K++DLATLTGA   ALG S
Sbjct  168   ----------------VDNTDAEGRLTLADALVYACNQGVDKIIDLATLTGAIRVALGPS  211

Query  1601  VAGM  1612
             +AG+
Sbjct  212   IAGI  215


 Score = 80.5 bits (197),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSL--DGDAITAS  1859
             GI TPS++LA+E   A +V GEK WR+P+EESYWE+M+SSIADM+ AG L     AITA+
Sbjct  214   GILTPSDELAEEFAAAYEVSGEKFWRLPMEESYWESMESSIADMLCAGPLQPQAGAITAA  273

Query  1860  LFMK  1871
             LF+K
Sbjct  274   LFLK  277



>ref|WP_015165714.1| cytosol aminopeptidase [Pseudanabaena sp. PCC 7367]
 ref|YP_007103186.1| cytosol aminopeptidase [Pseudanabaena sp. PCC 7367]
 gb|AFY70758.1| cytosol aminopeptidase [Pseudanabaena sp. PCC 7367]
Length=512

 Score =   270 bits (691),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 189/431 (44%), Positives = 255/431 (59%), Gaps = 49/431 (11%)
 Frame = +2

Query  356   EWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  535
             +W GD LA+    ++ V    +     +L    + L G L E  +E ++ G SG  +  R
Sbjct  12    DWTGDGLAIATFGQETVA---AALNQQLLNLDQTTLLGTLQEIVTEAEYKGDSGSMVSGR  68

Query  536   LP-ALGFKRIGLVGLGSVVSSTIA-YRTLGETIaaaaksaqassvavalasaEGLSVESK  709
             +  +   +++ LVGLG     TI  +R   +  A A K A  +       S    +++ +
Sbjct  69    VGGSAAIRKVMLVGLGDPAQGTIDNWR---KAAAQAVKWANGAKCKTLALSFPLYNLDQE  125

Query  710   LSAASAMATGIVSGTFEDNRFK---LEPKTP----TLKSVEILGLGTGPEIEKKLKYSEV  868
             L+A  A+A G +    +DNRFK   ++ +TP    +L+ VEILGL +    +  L  ++ 
Sbjct  126   LTA-QAIAEGALLAAHQDNRFKSQDIDDETPKNGDSLELVEILGLDS-DAAQAGLTRAKQ  183

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             ++ GVI  +ELV+APANV+TP ALAE A  IAS YSD +T  +L+ EQC+ + MG++LGV
Sbjct  184   IADGVILTRELVSAPANVITPEALAETALAIASDYSDCMTVEVLEREQCEAMGMGAYLGV  243

Query  1049  AAAATNPSYFIHLCYK-PSSG--SVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDM  1219
             + A+  P  FIHL Y   SSG  + K KLA++GKG+TFDSGG N+K GANS I +MK DM
Sbjct  244   SQASELPPKFIHLTYSGKSSGDEAAKRKLAIVGKGVTFDSGGLNIKAGANSGIAMMKTDM  303

Query  1220  agaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAAL  1399
              GA    GAAKAIAQIKP  +E+HFIV ACENMISG  + PGDILTASNGK IE      
Sbjct  304   GGAGATLGAAKAIAQIKPQDIEIHFIVAACENMISGRAIHPGDILTASNGKTIE------  357

Query  1400  VLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGAC  1579
                                    V +TDAEGRL LADALV+A KL ++ +VDLATLTGAC
Sbjct  358   -----------------------VNNTDAEGRLTLADALVFADKLELDGIVDLATLTGAC  394

Query  1580  ITALGRSVAGM  1612
             + ALG  +AGM
Sbjct  395   VVALGDEIAGM  405


 Score = 70.5 bits (171),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  +DLA  +  AA + GEK WRMPLEE Y+E MKS +AD  N G+  G AITA+LF
Sbjct  404   GMWSNDDDLAGTIHAAAKLAGEKFWRMPLEEPYFEAMKSVVADFKNTGNRAGGAITAALF  463

Query  1866  MK  1871
             +K
Sbjct  464   LK  465



>ref|WP_013323896.1| aminopeptidase A [Cyanothece sp. PCC 7822]
 ref|YP_003889103.1| leucyl aminopeptidase [Cyanothece sp. PCC 7822]
 gb|ADN15828.1| Leucyl aminopeptidase [Cyanothece sp. PCC 7822]
Length=489

 Score =   263 bits (673),  Expect(2) = 6e-84, Method: Compositional matrix adjust.
 Identities = 191/448 (43%), Positives = 253/448 (56%), Gaps = 78/448 (17%)
 Frame = +2

Query  335   AKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKS  514
             A E   L W G+ LA+G+ E   +  E        L +L+ KL G++ E  +EE+F GK+
Sbjct  5     ATEQTKLNWTGEALALGIFEGTDLSGE--------LAELNEKLAGVIQELITEEEFEGKA  56

Query  515   GQSIVLRL-PALGFKRIGLVGLGS-----VVSSTIAYRTLGETIaaaaksaqassvaval  676
             G S++ R+   L  +++ LVGLG      + S  IA  ++  T                 
Sbjct  57    GTSVISRIGNELSIRKLILVGLGKAEDFKLNSLRIAAASIARTAKKQKIKTL--------  108

Query  677   asaEGLSV-----ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGP  835
                 G+S+     E  L+   A+  G +     DNRFK +P  K P L++V++L LG   
Sbjct  109   ----GISLPLVNDEPALTTG-AIVEGFLLALHTDNRFKSDPEDKGPKLETVDLLELGGQ-  162

Query  836   EIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQC  1015
               +  +  +++++ GVI  +ELVNAPAN LTP  +AE A+ IAS Y  VL   +L+ E C
Sbjct  163   --QAAITKAQIIADGVILARELVNAPANTLTPVTMAETAQKIASDYGLVLE--VLEKEDC  218

Query  1016  KELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSS  1195
             + L MG+FLGVA A+  P  FIHL YKP  G+ K KLA++GK +TFDSGG N+K+ + S 
Sbjct  219   ENLGMGAFLGVAQASDLPPKFIHLTYKPE-GTPKRKLAIVGKSLTFDSGGLNIKV-SGSG  276

Query  1196  IELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKR  1375
             IE MK DM G A   GAAKAIAQ+KP  VEVHF+  A ENMISG  + PGDILTASNGK 
Sbjct  277   IETMKMDMGGGAATLGAAKAIAQLKP-DVEVHFVCAATENMISGKAIHPGDILTASNGKT  335

Query  1376  IEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVD  1555
             IE                             V +TDAEGRL LADALV+  KLGV+ +VD
Sbjct  336   IE-----------------------------VNNTDAEGRLTLADALVFTEKLGVDAIVD  366

Query  1556  LATLTGACITALGRSVAGMPL*IMYLWS  1639
             LATLTGAC+ ALG ++AG       LWS
Sbjct  367   LATLTGACVIALGDNIAG-------LWS  387


 Score = 77.4 bits (189),  Expect(2) = 6e-84, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++P+E+LA ++ E+A++ GEK W+MPLEE Y+E MKS IADM N G   G +ITA+LF
Sbjct  384   GLWSPNEELANQIKESAELAGEKFWQMPLEEKYFEGMKSPIADMKNTGPRAGGSITAALF  443

Query  1866  MK  1871
             +K
Sbjct  444   LK  445



>ref|WP_026734312.1| aminopeptidase A [Fischerella sp. PCC 9605]
Length=493

 Score =   262 bits (669),  Expect(2) = 7e-84, Method: Compositional matrix adjust.
 Identities = 194/430 (45%), Positives = 245/430 (57%), Gaps = 62/430 (14%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEK--DMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQS  523
             LLEW GD LA+G  E   D+  +         L  LD K  G L E  +EE+F GK+G S
Sbjct  10    LLEWGGDGLAIGFFEDGVDLTGE---------LAALDEKFAGCLKELIAEEEFKGKTGSS  60

Query  524   IVLRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV  700
             +  R+ +    ++I LVGLG      +   TL    A  A+ A+            G+S+
Sbjct  61    VFTRVGSGSPVRKIMLVGLGK--PEAVKLDTLRRAAAVVARIAKKQKCKTL-----GISL  113

Query  701   ----ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYS  862
                       A A+A G+    ++DNRFK EP  K   L++VE+LGLG     E  + ++
Sbjct  114   PVWNNDPAQTAQALAEGVQLSLYQDNRFKSEPEDKGAQLETVELLGLGGQ---EAAITHA  170

Query  863   EVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFL  1042
               + SGVI  ++LV APAN +TP  +AE A  IAS +   L   IL+ E C++L MG+FL
Sbjct  171   NQICSGVILARQLVAAPANEVTPITMAETAMAIASEHG--LQVEILEQEDCEKLGMGAFL  228

Query  1043  GVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMa  1222
             GVA A+  P  FIHL YKP + + K KLA++GKG+TFDSGG N+K GA S IE MK DM 
Sbjct  229   GVAKASDLPPKFIHLTYKPEA-TPKRKLAIIGKGLTFDSGGLNIK-GAGSGIENMKIDMG  286

Query  1223  gaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALV  1402
             GAA   GAAKAI Q+KP  VEVHFI    ENMISG  M PGDIL ASNGK IE       
Sbjct  287   GAAATLGAAKAIGQLKP-DVEVHFISAVTENMISGRAMHPGDILKASNGKTIE-------  338

Query  1403  LRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACI  1582
                                   V +TDAEGRL LADALV+A KLGV+ +VDLATLTGAC+
Sbjct  339   ----------------------VNNTDAEGRLTLADALVFADKLGVDAIVDLATLTGACV  376

Query  1583  TALGRSVAGM  1612
              ALG  +AG+
Sbjct  377   IALGDEIAGL  386


 Score = 78.6 bits (192),  Expect(2) = 7e-84, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP + LAK++  AA+  GEK+WRMP+EE Y+E MKS IADM N G   G +ITA+LF
Sbjct  385   GLFTPDDALAKQLETAAESAGEKIWRMPMEEKYFEGMKSGIADMKNTGPRPGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_017294075.1| hypothetical protein [Geminocystis herdmanii]
Length=490

 Score =   269 bits (688),  Expect(2) = 9e-84, Method: Compositional matrix adjust.
 Identities = 199/427 (47%), Positives = 258/427 (60%), Gaps = 58/427 (14%)
 Frame = +2

Query  353   LEWKGDILAVG--VTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSI  526
             L W GD LA+G    + ++  D         L+ LD KL G +SE  +E +F GKSG + 
Sbjct  11    LNWSGDALAIGFFADKVELTGD---------LKLLDQKLDGTISELIAETEFKGKSGTTS  61

Query  527   VLRLPALG-FKRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEGLSV  700
             + R+      ++I LVGLG     T+ ++R  G +IA  AK A+  ++++AL   +G   
Sbjct  62    IERIGGKNALRKIILVGLGKEEDLTLDSFRQAGGSIARVAKQAKLKTLSIALNH-DGYDN  120

Query  701   ESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPE-IEKKLKYSEVV  871
             E     A  ++ G++    +DNRFK   E +  TL+++E+L L   P+ IEK    +E +
Sbjct  121   EI---LAQVISEGVILALHQDNRFKSDTENQKITLETIELLDLPASPQAIEK----AEKI  173

Query  872   SSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVA  1051
             +SGVI  +ELVNAPAN L P  +AE A+N+AS Y   L  TIL+ E C++L MG+FLGVA
Sbjct  174   ASGVILARELVNAPANALNPVTMAEMAENLASEYG--LELTILEQEDCEKLGMGAFLGVA  231

Query  1052  AAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaa  1231
              A+  P  FIHL YKP + + K KLA++GKG+TFDSGG NLK+ + S IE MK DM GAA
Sbjct  232   KASDLPPKFIHLVYKPQN-TPKRKLAIVGKGLTFDSGGLNLKV-SGSGIETMKMDMGGAA  289

Query  1232  vvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRC  1411
               FGAAKAIAQ+KP  VE+HFI    ENMISG  M PGDIL ASN K IE          
Sbjct  290   ATFGAAKAIAQLKP-DVEIHFISAVTENMISGKAMHPGDILIASNDKTIE----------  338

Query  1412  LSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITAL  1591
                                V +TDAEGRL LADALVY  KLGV+ MVDLATLTGACI AL
Sbjct  339   -------------------VNNTDAEGRLTLADALVYTDKLGVDAMVDLATLTGACIVAL  379

Query  1592  GRSVAGM  1612
             G  +AG+
Sbjct  380   GNDIAGL  386


 Score = 71.2 bits (173),  Expect(2) = 9e-84, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G++T  +DLA ++  +A   GEK W+MPLE  Y+E MKSSIADM N GS  G +ITA+LF
Sbjct  385   GLWTSDDDLATQLKASAQTAGEKFWQMPLETKYFEQMKSSIADMKNTGSRAGGSITAALF  444

Query  1866  MK  1871
             ++
Sbjct  445   LQ  446



>ref|WP_012268315.1| aminopeptidase A [Microcystis aeruginosa]
 ref|YP_001661214.1| leucyl aminopeptidase [Microcystis aeruginosa NIES-843]
 sp|B0JL23.1|AMPA_MICAN RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Microcystis aeruginosa NIES-843]
 dbj|BAG06022.1| leucine aminopeptidase [Microcystis aeruginosa NIES-843]
Length=490

 Score =   268 bits (686),  Expect(2) = 9e-84, Method: Compositional matrix adjust.
 Identities = 195/436 (45%), Positives = 244/436 (56%), Gaps = 59/436 (14%)
 Frame = +2

Query  341   EVDLLEWKGDILAVGVTEKDM-VKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSG  517
             +  LL W GD LA+G+ E  + +  E        L +L+ KLGG L +  SE +F GK G
Sbjct  7     DTSLLTWTGDTLALGLPEGAIEIAGE--------LAELNDKLGGNLGDLISETEFEGKLG  58

Query  518   QSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLS  697
              S   RL     +++ LVGLG      +    L     A     Q S          G  
Sbjct  59    SSAATRLGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISLPVVG--  116

Query  698   VESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLKYSEVV  871
                + + A A+  G++  T +D RFK   E K   L++VE+LGLG   E    +  SE +
Sbjct  117   --DQSATAGAITEGLLLATHQDTRFKSTKEEKGAKLETVELLGLG---EQASAIAKSEQI  171

Query  872   SSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVA  1051
              SGVI  +ELVNAPAN +TP  +AE A+ IA+ Y   L+  IL+ E+C+ L MG+FLGVA
Sbjct  172   CSGVILARELVNAPANTVTPLTMAETAEQIAAEYG--LSLNILEQEECESLGMGAFLGVA  229

Query  1052  AAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaa  1231
              A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK DM G A
Sbjct  230   KASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMDMGGGA  287

Query  1232  vvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRC  1411
                GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IE          
Sbjct  288   ATLGAAKAIAQLQPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIE----------  336

Query  1412  LSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITAL  1591
                                V +TDAEGRL LAD LV+A KL V+ +VDLATLTGAC+ AL
Sbjct  337   -------------------VNNTDAEGRLTLADGLVFAEKLEVDAIVDLATLTGACVIAL  377

Query  1592  GRSVAGMPL*IMYLWS  1639
             G  +AG       LWS
Sbjct  378   GDDIAG-------LWS  386


 Score = 72.0 bits (175),  Expect(2) = 9e-84, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E LA ++ EAA + GEK W MPLEE Y+E MKS IADM N G   G +ITA+LF
Sbjct  383   GLWSSDESLAAQIQEAAKLAGEKFWPMPLEEKYFEGMKSQIADMKNTGPRPGGSITAALF  442

Query  1866  MK  1871
             +K
Sbjct  443   LK  444



>ref|WP_009342536.1| aminopeptidase A [Raphidiopsis brookii]
 gb|EFA73521.1| Peptidase M17, leucyl aminopeptidase-like protein [Raphidiopsis 
brookii D9]
Length=494

 Score =   264 bits (674),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 189/436 (43%), Positives = 254/436 (58%), Gaps = 68/436 (16%)
 Frame = +2

Query  341   EVDLLEWKGDILAVGVTEKDM-VKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSG  517
             + +LL W GD L +G+ E  + +KD+        L  L+ K GG+ SE  +EE+F+GK+ 
Sbjct  10    DTELLNWTGDTLGIGLFEDAVELKDD--------LATLNQKYGGVFSEVIAEEEFTGKAN  61

Query  518   QSIVLRLPALG-FKRIGLVGLGSVVSSTIAYRTL---GETIaaaaksaqassvavalasa  685
              ++V+R+      +++  +GLG V   T+   TL   G T+A  AK  +   +       
Sbjct  62    TTVVIRVGTHSPIRKVIFIGLGKV--DTLKLETLRIAGATLARTAKKQKTKIL-------  112

Query  686   EGLSVESKLSAASAMATGIVSGT----FEDNRFKLEP--KTPTLKSVEILGL-GTGPEIE  844
              G+S     +  +A A  I  G     ++D RFK EP  K P+++++++L L G  P I 
Sbjct  113   -GISFPIYNNQPAATAQAITEGAQLALYQDIRFKSEPEDKNPSIETIDLLNLSGQQPAIT  171

Query  845   KKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKEL  1024
             +    +E + SGVI  +ELV APAN +TP  +A+ A+ IA  +   L   IL+ E C++L
Sbjct  172   R----AEQIVSGVILARELVAAPANAVTPITMAQTAQAIAQEHG--LELKILEQEDCEKL  225

Query  1025  KMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIEL  1204
              MG++LGVA A+  P  FIHL YKP + + K KLA++GKG+TFDSGG N+K GA S IE 
Sbjct  226   GMGAYLGVAQASDLPPKFIHLIYKPPT-TPKRKLAIIGKGLTFDSGGLNIK-GAGSGIET  283

Query  1205  MKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEV  1384
             MK DM GAA   GAAKAI QIKP  VEVHFI    ENMISG  M PGDIL ASNGK IE 
Sbjct  284   MKIDMGGAAATLGAAKAIGQIKP-DVEVHFISAVTENMISGKAMHPGDILKASNGKTIE-  341

Query  1385  TYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLAT  1564
                                         V +TDAEGRL LADALVY  +LG++ MVDLAT
Sbjct  342   ----------------------------VNNTDAEGRLTLADALVYTDQLGLDAMVDLAT  373

Query  1565  LTGACITALGRSVAGM  1612
             LTGAC+ ALG  +AG+
Sbjct  374   LTGACVVALGDDIAGL  389


 Score = 76.3 bits (186),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP++++A ++  AA+  GEK+WRMP+EE Y+E +KS IADM N G   G +ITA+LF
Sbjct  388   GLFTPNDNIASQLQTAAESSGEKIWRMPMEEKYFEGLKSGIADMKNTGPRYGGSITAALF  447

Query  1866  MK  1871
             +K
Sbjct  448   LK  449



>ref|WP_002782251.1| putative cytosol aminopeptidase [Microcystis aeruginosa]
 emb|CCI12027.1| putative cytosol aminopeptidase [Microcystis aeruginosa PCC 9806]
Length=491

 Score =   268 bits (685),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 197/437 (45%), Positives = 246/437 (56%), Gaps = 60/437 (14%)
 Frame = +2

Query  341   EVDLLEWKGDILAVGVTEKDM-VKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSG  517
             +  LL W GD LA+G+ E  + +  E        L +L+ KLGG L +  SE +F GK G
Sbjct  7     DTSLLTWTGDTLALGLPEGAIEIAGE--------LAELNDKLGGNLGDLISETEFEGKLG  58

Query  518   QSIVLRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGL  694
              S   RL   G  +++ LVGLG      +    L     A     Q S          G 
Sbjct  59    SSAATRLGGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISLPVVG-  117

Query  695   SVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLKYSEV  868
                 + + A A+  G++  T +D RFK   E K   L++VE+LGLG   E    +  +E 
Sbjct  118   ---DQSATAGAITEGLLLATHQDTRFKSTKEEKGAKLETVELLGLG---EQTSAIAKAEQ  171

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             + SGVI  +ELVNAPAN +TP  +AE A+ IAS Y   L+  IL+ E+C+ L MG+FLGV
Sbjct  172   ICSGVILARELVNAPANTVTPLTMAETAEQIASEYG--LSLKILEQEECESLGMGAFLGV  229

Query  1049  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1228
             A A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK DM G 
Sbjct  230   AKASDIPPKFLHLIYKPE-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMDMGGG  287

Query  1229  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLR  1408
             A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IE         
Sbjct  288   AATLGAAKAIAQLQPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIE---------  337

Query  1409  CLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1588
                                 V +TDAEGRL LADALV+A KL V+ +VDLATLTGAC+ A
Sbjct  338   --------------------VNNTDAEGRLTLADALVFAEKLEVDAIVDLATLTGACVVA  377

Query  1589  LGRSVAGMPL*IMYLWS  1639
             LG  +AG       LWS
Sbjct  378   LGDDIAG-------LWS  387


 Score = 72.0 bits (175),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E LA ++ EAA + GEK W MPLEE Y+E MKS IADM N G   G +ITA+LF
Sbjct  384   GLWSSDESLAAQIQEAAKLAGEKFWPMPLEEKYFEGMKSQIADMKNTGPRPGGSITAALF  443

Query  1866  MK  1871
             +K
Sbjct  444   LK  445



>ref|WP_016874221.1| aminopeptidase A [Chlorogloeopsis fritschii]
Length=490

 Score =   259 bits (663),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 191/430 (44%), Positives = 245/430 (57%), Gaps = 62/430 (14%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEK--DMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQS  523
             +LEW GD LA+G+ E   D+  D         L  LD K  G+L E  +EE+F GK+G +
Sbjct  10    VLEWAGDGLAIGLFEDAVDLTGD---------LAALDEKFAGVLKELIAEEEFKGKTGST  60

Query  524   IVLRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV  700
              V R+ +    +++ LVGLG           L       A +A A           G+S+
Sbjct  61    AVTRVGSGSPVRKLILVGLGK-------PEALKLDTLRRAAAAVARLAKKQKCKTLGISL  113

Query  701   ----ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYS  862
                       A A+A GI    ++DNRFK EP  K   +++V++LGLG     E  +  +
Sbjct  114   PVWNNDPAQTAQAIAEGIQLALYQDNRFKSEPEDKGVQVETVDLLGLGGQ---EAAITRA  170

Query  863   EVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFL  1042
               ++SGVI  ++LV APAN +TP  +AE A  IAS +   L   IL+ E+C++L MG+FL
Sbjct  171   NQIASGVILARQLVAAPANEVTPITMAETAMAIASEHG--LQVEILEQEECEKLGMGAFL  228

Query  1043  GVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMa  1222
             GVA A+  P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K GA S IE MK DM 
Sbjct  229   GVAKASDLPPKFIHLTYKPE-GTPKRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMG  286

Query  1223  gaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALV  1402
             G A   GAAKAIAQ+KP  VEVHFI    ENMISG  M PGDIL ASNGK IE       
Sbjct  287   GGAATLGAAKAIAQLKP-DVEVHFISAVTENMISGHAMHPGDILKASNGKTIE-------  338

Query  1403  LRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACI  1582
                                   V +TDAEGRL LADALV+A KLGV+ ++DLATLTGAC+
Sbjct  339   ----------------------VNNTDAEGRLTLADALVFAEKLGVDAIIDLATLTGACV  376

Query  1583  TALGRSVAGM  1612
              ALG  +AG+
Sbjct  377   IALGDDIAGL  386


 Score = 80.1 bits (196),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP + LAKE+  AA+  GEK+WRMP+EE Y+E +KSSIADM N G   G +ITA+LF
Sbjct  385   GLFTPDDALAKELETAAETSGEKIWRMPMEEKYFEGLKSSIADMKNTGPRAGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_026722318.1| aminopeptidase A [Fischerella sp. PCC 9431]
Length=493

 Score =   264 bits (674),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 198/428 (46%), Positives = 244/428 (57%), Gaps = 58/428 (14%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             LLEW GD LAVG+ E       +    N  L  LD K  G + E  +EE+F GK G + V
Sbjct  10    LLEWTGDGLAVGLFE-------DGTELNGELATLDEKFAGYIKELITEEEFKGKVGSTAV  62

Query  530   LRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV--  700
              RL +    +++ LVGLG      +   TL    AA A+ A+            G+S+  
Sbjct  63    TRLASGSPVRKLILVGLGK--PDAVKLDTLRRAAAAIARQAKKQKCKTL-----GISLPV  115

Query  701   --ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEV  868
                     A A+A G+    ++DNRFK EP  K P +++VE+LGL      E  +  +  
Sbjct  116   WNHDPAQTAQALAEGVQLALYQDNRFKSEPEDKGPQVETVELLGLSGQ---EAAIARANQ  172

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             +SSGVI  +ELV APAN +TP  +AE A  IAS     +   IL+ E C+ L MG+FLGV
Sbjct  173   ISSGVILARELVAAPANEVTPITMAETATAIASQTG--MHIEILEQEDCERLGMGAFLGV  230

Query  1049  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1228
             A A+  P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K GA S IE MK DM GA
Sbjct  231   AKASDLPPKFIHLTYKPD-GTPKRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKMDMGGA  288

Query  1229  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLR  1408
             A  FGAAKAI Q+KP  VEVHFI    ENMISG  M PGDIL ASNGK IE         
Sbjct  289   AATFGAAKAIGQLKP-DVEVHFISAVTENMISGRAMHPGDILKASNGKTIE---------  338

Query  1409  CLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1588
                                 V +TDAEGRL LADALV+A KLGV+ +VDLATLTGACI A
Sbjct  339   --------------------VNNTDAEGRLTLADALVFAEKLGVDAIVDLATLTGACIIA  378

Query  1589  LGRSVAGM  1612
             LG  +AG+
Sbjct  379   LGDEIAGL  386


 Score = 75.9 bits (185),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP + LA+E+  AA   GEK+WR+P+EE Y+E +KS IADM N G   G +ITA+LF
Sbjct  385   GLFTPDDTLAQELETAAQSAGEKIWRLPMEEKYFEGLKSGIADMKNTGPRPGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_008207180.1| aminopeptidase A [Microcystis sp. T1-4]
 emb|CCI34585.1| putative cytosol aminopeptidase [Microcystis sp. T1-4]
Length=491

 Score =   269 bits (688),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 196/437 (45%), Positives = 246/437 (56%), Gaps = 60/437 (14%)
 Frame = +2

Query  341   EVDLLEWKGDILAVGVTEKDM-VKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSG  517
             +  LL W GD LA+G+ E  + +  E        L +L++KLGG L E  SE +F GK G
Sbjct  7     DTSLLTWTGDTLALGLPEGAVEIAGE--------LAELNNKLGGTLEELISETEFEGKLG  58

Query  518   QSIVLRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGL  694
              S   RL   G  +++ LVGLG      +    L     A     Q S          G 
Sbjct  59    SSAATRLGGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISLPVVG-  117

Query  695   SVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLKYSEV  868
                 + + A A+  G++  T +D RFK   E K   L++VE+LGLG   E    +  +E 
Sbjct  118   ---DQSATAGAITEGLLLATHQDTRFKSTKEEKGAKLETVELLGLG---EQTSAIAKAEQ  171

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             + SGVI  +ELVNAPAN +TP  +AE A+ IA+ Y   L+  IL+ E+C+ L MG+FLGV
Sbjct  172   ICSGVILARELVNAPANTVTPLTMAETAEQIAAEYG--LSLKILEQEECESLGMGAFLGV  229

Query  1049  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1228
             A A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK DM G 
Sbjct  230   AKASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMDMGGG  287

Query  1229  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLR  1408
             A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IE         
Sbjct  288   AATLGAAKAIAQLRPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIE---------  337

Query  1409  CLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1588
                                 V +TDAEGRL LAD LV+A KL V+ +VDLATLTGAC+ A
Sbjct  338   --------------------VNNTDAEGRLTLADGLVFAEKLAVDAIVDLATLTGACVVA  377

Query  1589  LGRSVAGMPL*IMYLWS  1639
             LG  +AG       LWS
Sbjct  378   LGDDIAG-------LWS  387


 Score = 70.1 bits (170),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E LA ++ +AA + GEK W MPLEE Y+E MKS IADM N G   G +ITA+LF
Sbjct  384   GLWSSDESLADQLQQAAKLAGEKFWPMPLEEKYFEGMKSQIADMKNTGPRPGGSITAALF  443

Query  1866  MK  1871
             +K
Sbjct  444   LK  445



>ref|WP_039726207.1| aminopeptidase A [Lyngbya confervoides]
 gb|KIF14452.1| aminopeptidase A [Aphanocapsa montana BDHKU210001]
 gb|KIF39382.1| aminopeptidase A [Lyngbya confervoides BDU141951]
Length=491

 Score =   270 bits (690),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 190/428 (44%), Positives = 248/428 (58%), Gaps = 57/428 (13%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             +L+W GD LA+GVTE D+            L  LDSKL G++ E   E +F   +  S V
Sbjct  10    VLDWTGDCLAIGVTEADLPLSGG-------LADLDSKLSGVVQELIDESEFKAAADSSAV  62

Query  530   LRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVES  706
             +R+ + G  +++ L+GLG   + T+      ET+  A   A   +         G+S+ +
Sbjct  63    IRVGSSGPVRKLALIGLGKPEAMTL------ETLRRAGAIAARLAKKEKCKVV-GMSLPT  115

Query  707   KLSAASAMATGIVSGTF----EDNRFKLE--PKTPTLKSVEILGLGTGPEIEKKLKYSEV  868
               +  S  A GI  G      EDNRFK E   K+  ++ +E++G    P     +  ++ 
Sbjct  116   WNADTSLSAQGICEGALLALHEDNRFKSESDDKSFAIERIELIGY---PNEAPAIARAQQ  172

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             V+ GVI  +ELV AP NV TP  LAE A+ IA  +   +   IL+ E C+ L MG+FLGV
Sbjct  173   VADGVILARELVAAPPNVATPAMLAETAEAIARDHG--IEVEILEKEACEALGMGAFLGV  230

Query  1049  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1228
             A A+  P  FIHL YKP+ G+ + KLA++GKG+TFDSGG N+K GA S IE+MK DM GA
Sbjct  231   AQASDLPPKFIHLTYKPT-GTPRRKLAIIGKGLTFDSGGLNIKAGAGSMIEMMKFDMGGA  289

Query  1229  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLR  1408
             A   GAAKAIAQIKP  VEVHFI  A ENMISG  + PGDI+TASNGK IE         
Sbjct  290   AATLGAAKAIAQIKP-DVEVHFISAAAENMISGNALHPGDIITASNGKTIE---------  339

Query  1409  CLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1588
                                 V +TDAEGRL LADALV+A KLG++ M+DLATLTGACI A
Sbjct  340   --------------------VNNTDAEGRLTLADALVFAEKLGLDAMIDLATLTGACIVA  379

Query  1589  LGRSVAGM  1612
             LG S+AG+
Sbjct  380   LGDSIAGL  387


 Score = 68.9 bits (167),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++P + LA E+  A+   GEKLWRMPLEE Y+E MKS  ADM N G   G +ITA+LF
Sbjct  386   GLWSPDDTLAGEIEAASVTAGEKLWRMPLEEKYFEGMKSLAADMKNTGPRFGGSITAALF  445

Query  1866  MK  1871
             +K
Sbjct  446   LK  447



>ref|WP_002773226.1| aminopeptidase A [Microcystis aeruginosa]
 emb|CCI06078.1| putative cytosol aminopeptidase [Microcystis aeruginosa PCC 7941]
Length=491

 Score =   269 bits (687),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 197/437 (45%), Positives = 246/437 (56%), Gaps = 60/437 (14%)
 Frame = +2

Query  341   EVDLLEWKGDILAVGVTEKDM-VKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSG  517
             +  LL W GD LA+G+ E  + +  E        L +L++KLGG L E  SE +F GKSG
Sbjct  7     DTSLLTWTGDTLALGLPEGAVEIAGE--------LAELNNKLGGTLGELISETEFEGKSG  58

Query  518   QSIVLRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGL  694
              S   RL   G  +++ LVGLG      +    L     A     Q S          G 
Sbjct  59    SSAATRLGGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISLPVVG-  117

Query  695   SVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLKYSEV  868
                 + + A A+  G++    +D RFK   E K   L++VE+LGLG   E    +  +E 
Sbjct  118   ---DQSATAGAITEGLLLANHQDTRFKSTKEEKGAKLETVELLGLG---EQASAIAKAEQ  171

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             + SGVI  +ELVNAPAN +TP  +AE A+ IAS Y   L+  IL+ E+C+ L MG+FLGV
Sbjct  172   ICSGVILARELVNAPANTVTPLTMAETAEQIASEYG--LSLKILEQEECESLGMGAFLGV  229

Query  1049  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1228
             A A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK DM G 
Sbjct  230   AKASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMDMGGG  287

Query  1229  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLR  1408
             A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IE         
Sbjct  288   AATLGAAKAIAQLQPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIE---------  337

Query  1409  CLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1588
                                 V +TDAEGRL LAD LV+A KL V+ +VDLATLTGAC+ A
Sbjct  338   --------------------VNNTDAEGRLTLADGLVFAEKLEVDAIVDLATLTGACVIA  377

Query  1589  LGRSVAGMPL*IMYLWS  1639
             LG  +AG       LWS
Sbjct  378   LGDDIAG-------LWS  387


 Score = 69.7 bits (169),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E LA ++ EAA + GEK W MPLEE Y+E +KS IADM N G   G +ITA+LF
Sbjct  384   GLWSSDESLAAQLQEAAKLAGEKFWPMPLEEKYFEGLKSPIADMKNTGPRPGGSITAALF  443

Query  1866  MK  1871
             +K
Sbjct  444   LK  445



>ref|WP_006277890.1| aminopeptidase A [Cylindrospermopsis raciborskii]
 gb|EFA69277.1| Peptidase M17, leucyl aminopeptidase-like protein [Cylindrospermopsis 
raciborskii CS-505]
Length=494

 Score =   262 bits (670),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 188/436 (43%), Positives = 251/436 (58%), Gaps = 68/436 (16%)
 Frame = +2

Query  341   EVDLLEWKGDILAVGVTEKDM-VKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSG  517
             + +LL W GD L +G+ E  + +KD+        L  L+ K GG+ SE  +EE+F+GK+ 
Sbjct  10    DTELLNWTGDTLGIGLFEDAVELKDD--------LATLNQKYGGVFSEVIAEEEFTGKAN  61

Query  518   QSIVLRLPALG-FKRIGLVGLGSV-----VSSTIAYRTLGETIaaaaksaqassvavala  679
              ++V+R+ A    +++  +GLG V      +  IA  TL  T         A S      
Sbjct  62    TTVVIRVGANSPIRKVIFIGLGKVDTLKLETLRIAAATLARTAKKQKTKTLAIS------  115

Query  680   saEGLSVESKLSAASAMA--TGIVSGTFEDNRFKLEP--KTPTLKSVEILGL-GTGPEIE  844
                   + +   AA+A A   G     ++D RFK EP  K P ++++++L L G  P I 
Sbjct  116   ----FPIYNNQPAATAQAITEGAQLALYQDIRFKSEPEDKNPPIETIDLLNLSGQQPAIT  171

Query  845   KKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKEL  1024
             +    +E + SGVI  +ELV APAN +TP  +A+ A+ IA    + L   IL+ E C++L
Sbjct  172   R----AEQIVSGVILARELVAAPANAVTPITMAQTAQAIAQ--ENGLELKILEQEDCEKL  225

Query  1025  KMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIEL  1204
              MG++LGVA A+  P  FIHL YKP++ + K KLA++GKG+TFDSGG N+K GA S IE 
Sbjct  226   GMGAYLGVAQASDLPPKFIHLIYKPAT-TPKRKLAIIGKGLTFDSGGLNIK-GAGSGIET  283

Query  1205  MKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEV  1384
             MK DM GAA   GAAKAI QIKP  VEVHFI    ENMISG  M PGDIL ASNGK IE 
Sbjct  284   MKIDMGGAAATLGAAKAIGQIKP-DVEVHFISAVTENMISGKAMHPGDILKASNGKTIE-  341

Query  1385  TYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLAT  1564
                                         V +TDAEGRL LADALVY  +LG++ MVDLAT
Sbjct  342   ----------------------------VNNTDAEGRLTLADALVYTDQLGLDAMVDLAT  373

Query  1565  LTGACITALGRSVAGM  1612
             LTGAC+ ALG ++AG+
Sbjct  374   LTGACVVALGDNIAGL  389


 Score = 76.3 bits (186),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP++++A ++  AA+  GEK+WRMP+EE Y+E +KS IADM N G   G +ITA+LF
Sbjct  388   GLFTPNDNIASQLQTAAESSGEKIWRMPMEEKYFEGLKSGIADMKNTGPRYGGSITAALF  447

Query  1866  MK  1871
             +K
Sbjct  448   LK  449



>ref|WP_015185013.1| leucyl aminopeptidase [Microcoleus sp. PCC 7113]
 ref|YP_007124286.1| leucyl aminopeptidase [Microcoleus sp. PCC 7113]
 gb|AFZ20880.1| leucyl aminopeptidase [Microcoleus sp. PCC 7113]
Length=492

 Score =   279 bits (713),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 201/434 (46%), Positives = 256/434 (59%), Gaps = 60/434 (14%)
 Frame = +2

Query  335   AKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKS  514
             A +   +EW GD LAVG+ E+      +       L +LD KLGG L E   E +F G +
Sbjct  5     ATDTPRIEWTGDALAVGLLEEATTLTGD-------LAQLDEKLGGTLQELIEETEFKGSA  57

Query  515   GQSIVLRLPALG--FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaE  688
             G + V R+  +G   ++I LVGLG     T++  +L    AA A++A+   +        
Sbjct  58    GSTAVTRV-GVGSSIRKIILVGLGK--PDTLSLNSLRRAAAAIARTAKQQKIKTL-----  109

Query  689   GLSV----ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKK  850
             G+S+    E + +   A+  GIV    +DNRFK EP  K   L+ VE+LGLG     E  
Sbjct  110   GISLPVVNEDQAATTQAITEGIVLALHQDNRFKSEPEDKGAKLEQVELLGLGNQ---ETA  166

Query  851   LKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKM  1030
             +  +  + SGVI  +ELV APAN++TP +LAE A+ IAS Y   L+  +L+ E C++L M
Sbjct  167   INRAHGICSGVILARELVAAPANIVTPISLAETAEAIASQYG--LSLEVLEWEDCEKLGM  224

Query  1031  GSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMK  1210
             G+FLGVA A+  P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K GA S IE MK
Sbjct  225   GAFLGVAQASEMPPKFIHLTYKPE-GTAKRKLAIVGKGLTFDSGGLNIK-GAGSGIETMK  282

Query  1211  KDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTY  1390
              DM GAA   GAAKAI  +KP  VEVHFI  A ENMISGT M PGDILTASNGK IE   
Sbjct  283   MDMGGAAATLGAAKAIGHLKP-DVEVHFISAATENMISGTAMHPGDILTASNGKTIE---  338

Query  1391  AALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLT  1570
                                       V +TDAEGRL LADALV+A KLGV+ +VDLATLT
Sbjct  339   --------------------------VNNTDAEGRLTLADALVFAEKLGVDAIVDLATLT  372

Query  1571  GACITALGRSVAGM  1612
             GACI ALG  + G+
Sbjct  373   GACIVALGNDIGGI  386


 Score = 59.7 bits (143),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             GI+   + +A ++  AA+  GEK W+MP+EE Y+E +KS IADM N G   G +ITA+LF
Sbjct  385   GIWATDDTVASQLKAAAEAAGEKFWQMPMEEKYFEGLKSPIADMKNTGPRAGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_016515741.1| Cytosol aminopeptidase [Microcystis aeruginosa]
 gb|EPF21780.1| Cytosol aminopeptidase [Microcystis aeruginosa SPC777]
Length=491

 Score =   269 bits (687),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 197/437 (45%), Positives = 245/437 (56%), Gaps = 60/437 (14%)
 Frame = +2

Query  341   EVDLLEWKGDILAVGVTEKDM-VKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSG  517
             +  LL W GD LA+G+ E  + +  E        L +L+ KLGG L E  SE +F GKSG
Sbjct  7     DTSLLTWTGDTLALGLPEGAIEIAGE--------LAELNDKLGGTLGELISETEFEGKSG  58

Query  518   QSIVLRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGL  694
              S   RL   G  +++ LVGLG      +    L     A     Q S          G 
Sbjct  59    SSAATRLGGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISLPVVG-  117

Query  695   SVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLKYSEV  868
                 + + A A+  G++    +D RFK   E K   L++VE+LGLG   E    +  +E 
Sbjct  118   ---DQSATAGAITEGLLLANHQDTRFKSTKEEKGAKLETVELLGLG---EQASAIAKAEQ  171

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             + SGVI  +ELVNAPAN +TP  +AE A+ IAS Y   L+  IL+ E+C+ L MG+FLGV
Sbjct  172   ICSGVILARELVNAPANTVTPLTMAETAEQIASEYG--LSLKILEQEECESLGMGAFLGV  229

Query  1049  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1228
             A A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK DM G 
Sbjct  230   AKASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMDMGGG  287

Query  1229  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLR  1408
             A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IE         
Sbjct  288   AATLGAAKAIAQLQPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIE---------  337

Query  1409  CLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1588
                                 V +TDAEGRL LAD LV+A KL V+ +VDLATLTGAC+ A
Sbjct  338   --------------------VNNTDAEGRLTLADGLVFAEKLEVDAIVDLATLTGACVIA  377

Query  1589  LGRSVAGMPL*IMYLWS  1639
             LG  +AG       LWS
Sbjct  378   LGDDIAG-------LWS  387


 Score = 69.7 bits (169),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E LA ++ EAA + GEK W MPLEE Y+E +KS IADM N G   G +ITA+LF
Sbjct  384   GLWSSDESLAAQLQEAAKLAGEKFWPMPLEEKYFEGLKSPIADMKNTGPRPGGSITAALF  443

Query  1866  MK  1871
             +K
Sbjct  444   LK  445



>ref|WP_012629140.1| aminopeptidase A [Cyanothece sp. PCC 7425]
 ref|YP_002484445.1| leucyl aminopeptidase [Cyanothece sp. PCC 7425]
 sp|B8HTK3.1|AMPA_CYAP4 RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Cyanothece sp. PCC 7425]
 gb|ACL46084.1| Leucyl aminopeptidase [Cyanothece sp. PCC 7425]
Length=493

 Score =   262 bits (669),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 191/437 (44%), Positives = 251/437 (57%), Gaps = 67/437 (15%)
 Frame = +2

Query  356   EWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  535
             +W GD+LA+G  E D V+   S      L +LD KL G+L E  +E +F GK+G+S + R
Sbjct  12    DWAGDLLALGFFE-DQVELSGS------LAELDQKLDGILQELIAETEFKGKAGKSAIAR  64

Query  536   LPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV----  700
             + +    ++I ++GLG   +      TL  T A  A+SA+            G+S+    
Sbjct  65    ISSKSPIRKIMILGLGK--AEDFKLDTLRRTAATIARSAKKEKGKTL-----GISLPLWN  117

Query  701   ESKLSAASAMATGIVSGTFEDNRFKLEPK----TPTLKSVEILGLGTGPEIEKKLKYSEV  868
                 S   A+A GI     +D+RFK   +        + +++LGLG   +    ++ ++ 
Sbjct  118   NDPTSTTQAIAEGIELALHQDHRFKSNSEDNNDNHAPEQIQLLGLG---DQTTAIERAQR  174

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             + SGVI  +ELV APANV+TP  LAE A+++A  Y   L   +L   +C+ L MG+FLGV
Sbjct  175   ICSGVILARELVAAPANVVTPVTLAETARDLAQEYG--LDVEVLGQAECEALGMGAFLGV  232

Query  1049  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1228
             A A+  P  FIHL Y+PS G+ + KLA++GKG+TFDSGG NLK G  S IE MK DMAG+
Sbjct  233   ALASDLPPQFIHLTYRPS-GTPRRKLAIIGKGLTFDSGGLNLKTGG-SGIETMKMDMAGS  290

Query  1229  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLR  1408
             A   GAAK + Q+KP  VEVHFIV A ENMISG  M PGDILTASNGK IE         
Sbjct  291   AATLGAAKVVGQLKP-DVEVHFIVAATENMISGRAMHPGDILTASNGKTIE---------  340

Query  1409  CLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1588
                                 V +TDAEGRL LADALV+A KLGV+ +VDLATLTGACI A
Sbjct  341   --------------------VNNTDAEGRLTLADALVFAEKLGVDALVDLATLTGACIVA  380

Query  1589  LGRSVAGMPL*IMYLWS  1639
             LG  +AG       LWS
Sbjct  381   LGDDIAG-------LWS  390


 Score = 76.3 bits (186),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  + LA+++L+AAD  GEKLWRMP+EE Y+E MKS IADM N G   G +ITA+LF
Sbjct  387   GLWSSDDALAEQILQAADHSGEKLWRMPMEEKYFEGMKSQIADMKNTGPRAGGSITAALF  446

Query  1866  MK  1871
             +K
Sbjct  447   LK  448



>ref|WP_002744501.1| leucine aminopeptidase 1 [Microcystis aeruginosa]
 emb|CAO90152.1| pepA [Microcystis aeruginosa PCC 7806]
 gb|ELS47529.1| leucine aminopeptidase 1 [Microcystis aeruginosa DIANCHI905]
Length=490

 Score =   267 bits (683),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 194/436 (44%), Positives = 244/436 (56%), Gaps = 59/436 (14%)
 Frame = +2

Query  341   EVDLLEWKGDILAVGVTEKDM-VKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSG  517
             +  LL W GD LA+G+ E  + +  E        L +L+ KLGG L +  SE +F GK G
Sbjct  7     DTSLLTWTGDTLALGLPEGAIEIAGE--------LAELNDKLGGNLGDLISETEFEGKLG  58

Query  518   QSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLS  697
              S   RL     +++ LVGLG      +    L     A     Q S          G  
Sbjct  59    SSAATRLGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISLPVVG--  116

Query  698   VESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLKYSEVV  871
                + + A A+A G++    +D RFK   E K   L++VE+LGLG   E    +  +E +
Sbjct  117   --DRSATAGAIAEGLLLANHQDTRFKSTKEEKGAKLETVELLGLG---EQTSAIAKAEQI  171

Query  872   SSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVA  1051
              SGVI  +ELVNAPAN +TP  +AE A+ IA+ Y   L+  IL+ E+C+ L MG+FLGVA
Sbjct  172   CSGVILARELVNAPANTVTPLTMAETAEQIAAEYG--LSLKILEQEECESLGMGAFLGVA  229

Query  1052  AAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaa  1231
              A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK DM G A
Sbjct  230   KASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMDMGGGA  287

Query  1232  vvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRC  1411
                GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IE          
Sbjct  288   ATLGAAKAIAQLRPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIE----------  336

Query  1412  LSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITAL  1591
                                V +TDAEGRL LAD LV+A KL V+ +VDLATLTGAC+ AL
Sbjct  337   -------------------VNNTDAEGRLTLADGLVFAEKLEVDAIVDLATLTGACVVAL  377

Query  1592  GRSVAGMPL*IMYLWS  1639
             G  +AG       LWS
Sbjct  378   GDDIAG-------LWS  386


 Score = 70.5 bits (171),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E LA ++ EAA + GEK W MPLEE Y+E +KS IADM N G   G +ITA+LF
Sbjct  383   GLWSSDESLASQIQEAAKLAGEKFWPMPLEEKYFEGLKSPIADMKNTGPRPGGSITAALF  442

Query  1866  MK  1871
             +K
Sbjct  443   LK  444



>ref|WP_002785587.1| aminopeptidase A [Microcystis aeruginosa]
 emb|CCI20322.1| putative cytosol aminopeptidase [Microcystis aeruginosa PCC 9807]
Length=490

 Score =   266 bits (680),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 197/437 (45%), Positives = 245/437 (56%), Gaps = 61/437 (14%)
 Frame = +2

Query  341   EVDLLEWKGDILAVGVTEKDM-VKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSG  517
             +  LL W GD LA+G+ E  + +  E        L +L+ KLGG L +  SE +F GK G
Sbjct  7     DTSLLTWTGDTLALGLPEGTIEIAGE--------LAELNDKLGGNLGDLISETEFEGKLG  58

Query  518   QSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLS  697
              S   RL     +++ LVGLG      +    L     A     Q S           L 
Sbjct  59    SSAATRLGGGPIRKLILVGLGKTTDFDLQTLRLAAAAIARLAKQQKSQALAIS-----LP  113

Query  698   VESKLSA-ASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLKYSEV  868
             V    SA A A+A G++    +D RFK   E K   L++VE+LGLG   E    +  +E 
Sbjct  114   VVGDHSATAGAIAEGLLLANHQDTRFKSTKEEKGAKLETVELLGLG---EQTSAIAKAEQ  170

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             + SGVI  +ELVNAPAN +TP  +AE A+ IA+ Y   L+  IL+ E+C+ L MG+FLGV
Sbjct  171   ICSGVILARELVNAPANTVTPLTMAETAEQIAAEYG--LSLKILEQEECESLGMGAFLGV  228

Query  1049  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1228
             A A+  P  F+HL YKP   + K KLA++GK +TFDSGG N+K GA S IE MK DM G 
Sbjct  229   AKASDIPPKFLHLIYKPQV-APKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMDMGGG  286

Query  1229  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLR  1408
             A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IE         
Sbjct  287   AATLGAAKAIAQLRPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIE---------  336

Query  1409  CLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1588
                                 V +TDAEGRL LADALV+A KL V+ +VDLATLTGAC+ A
Sbjct  337   --------------------VNNTDAEGRLTLADALVFAEKLEVDAIVDLATLTGACVVA  376

Query  1589  LGRSVAGMPL*IMYLWS  1639
             LG  +AG       LWS
Sbjct  377   LGEDIAG-------LWS  386


 Score = 72.0 bits (175),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E LA ++ EAA + GEK W MPLEE Y+E MKS IADM N G   G +ITA+LF
Sbjct  383   GLWSSDESLADQIQEAAKLAGEKFWPMPLEEKYFEGMKSQIADMKNTGPRPGGSITAALF  442

Query  1866  MK  1871
             +K
Sbjct  443   LK  444



>ref|WP_015211045.1| leucyl aminopeptidase [Cylindrospermum stagnale]
 ref|YP_007150491.1| leucyl aminopeptidase [Cylindrospermum stagnale PCC 7417]
 gb|AFZ27811.1| leucyl aminopeptidase [Cylindrospermum stagnale PCC 7417]
Length=490

 Score =   265 bits (678),  Expect(2) = 6e-83, Method: Compositional matrix adjust.
 Identities = 195/428 (46%), Positives = 249/428 (58%), Gaps = 58/428 (14%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             LLEW GD LAVG+ E D V+          L  LD K  G+  E  +EE+F+ K+  +I 
Sbjct  10    LLEWAGDTLAVGLFE-DAVELTGD------LAALDQKFAGIFKELIAEEEFTAKANSTIF  62

Query  530   LRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV--  700
              R+ A+   K++ LVGLG      +   TL    AA AK A+            G+S+  
Sbjct  63    TRVGAVNQVKKVILVGLGK--PEALKLDTLRRVAAAVAKVAKKQKTKTL-----GISLPL  115

Query  701   --ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEV  868
                   + A A+A G     ++DNRFK EP  K P ++++++LGL      E  +  +  
Sbjct  116   WNNDPAATAQAIAEGAQLALYQDNRFKSEPEDKGPQIETIDLLGLSGQ---EAAVTRANQ  172

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             + SGV   ++LV APAN +TP  LAE A+ IA+ +   L   IL+ E C++L MG+FLGV
Sbjct  173   IVSGVNLARQLVAAPANAVTPITLAETAQAIATEHG--LQVEILEREDCEKLGMGAFLGV  230

Query  1049  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1228
             A A+  P  FIHL YKP + + K KLA++GKG+TFDSGG N+K GA S IE MK DM GA
Sbjct  231   AQASDLPPKFIHLTYKPET-TAKRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGGA  288

Query  1229  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLR  1408
             A   GAAKAIAQIKP  VEVHFI  A ENMISG  M PGD+LTASNGK IE         
Sbjct  289   AATLGAAKAIAQIKP-DVEVHFISAATENMISGHAMHPGDVLTASNGKTIE---------  338

Query  1409  CLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1588
                                 V +TDAEGRL LADALVYA KLG++ +VDLATLTGAC+ A
Sbjct  339   --------------------VNNTDAEGRLTLADALVYADKLGLDAIVDLATLTGACVVA  378

Query  1589  LGRSVAGM  1612
             LG  +AG+
Sbjct  379   LGNDIAGL  386


 Score = 72.4 bits (176),  Expect(2) = 6e-83, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP + +A ++ +AA+  GEK+WR+P+E+ Y+E +KS IADM N G   G +ITA+LF
Sbjct  385   GLFTPDDAVASQLEKAAESAGEKIWRLPMEDKYFEGLKSGIADMKNTGPRPGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>dbj|GAL91486.1| cytosol aminopeptidase PepA [Microcystis aeruginosa NIES-44]
Length=491

 Score =   268 bits (684),  Expect(2) = 6e-83, Method: Compositional matrix adjust.
 Identities = 197/437 (45%), Positives = 245/437 (56%), Gaps = 60/437 (14%)
 Frame = +2

Query  341   EVDLLEWKGDILAVGVTEKDM-VKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSG  517
             +  LL W GD LA+G+ E  + +  E        L +L+ KLGG L +  SE +F GK G
Sbjct  7     DTSLLTWTGDTLALGLPEGAIEIAGE--------LAELNDKLGGNLGDLISETEFEGKLG  58

Query  518   QSIVLRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGL  694
              S   RL   G  +++ LVGLG      +    L     A     Q S          G 
Sbjct  59    SSAATRLGGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISLPVVG-  117

Query  695   SVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLKYSEV  868
                 + + A A+  G++  T +D RFK   E K   L++VE+LGLG   E    +  SE 
Sbjct  118   ---DQSATAGAITEGLLLATHQDTRFKSTKEEKGAKLETVELLGLG---EQSSAIAKSEQ  171

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             + SGVI  +ELVNAPAN +TP  +AE A+ IAS Y   L+  IL+ E+C+ L MG+FLGV
Sbjct  172   ICSGVILARELVNAPANTVTPLTMAETAEQIASEYG--LSLKILEQEECESLGMGAFLGV  229

Query  1049  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1228
             A A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK DM G 
Sbjct  230   AKASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMDMGGG  287

Query  1229  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLR  1408
             A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IE         
Sbjct  288   AATLGAAKAIAQLRPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIE---------  337

Query  1409  CLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1588
                                 V +TDAEGRL LAD LV+A KL V+ +VDLATLTGAC+ A
Sbjct  338   --------------------VNNTDAEGRLTLADGLVFAEKLEVDAIVDLATLTGACVVA  377

Query  1589  LGRSVAGMPL*IMYLWS  1639
             LG  +AG       LWS
Sbjct  378   LGDDIAG-------LWS  387


 Score = 69.7 bits (169),  Expect(2) = 6e-83, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E LA ++ EAA + GEK W MPLEE Y+E +KS IADM N G   G +ITA+LF
Sbjct  384   GLWSSDESLADQLQEAAKLAGEKFWPMPLEEKYFEGLKSQIADMKNTGPRPGGSITAALF  443

Query  1866  MK  1871
             +K
Sbjct  444   LK  445



>ref|XP_002502369.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63627.1| predicted protein [Micromonas sp. RCC299]
Length=633

 Score =   266 bits (680),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 180/418 (43%), Positives = 240/418 (57%), Gaps = 42/418 (10%)
 Frame = +2

Query  371   ILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRLPALG  550
             +L + V E D    E     + +L+     L  ++ +   E++F G +G S+  R+  L 
Sbjct  148   MLVLSVCEADA---EKLSADDKVLEGYAPGLAAVVKDMCDEQEFKGAAGSSVFTRVAGLP  204

Query  551   FKRIGLVGLGSVVS-STIAYRTLGE--TIaaaaksaqassvavalasaEGLSVESKLSAA  721
             FK +GLVGLG   + +  A+ +LG+  T AAA     + +V       E  +   K   A
Sbjct  205   FKHVGLVGLGKADAIAGDAWMSLGKEATAAAAKSKCTSVAVGKYWMGDEEAAFRGK---A  261

Query  722   SAMATGIVSGTFEDNRFKLEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGVIFVKEL  901
               +A G   G+FED+RFK + K   LK+V +L    G ++  ++   +  +SGV   K+L
Sbjct  262   EGIAAGAFLGSFEDSRFKSDAKPGPLKTVHVL-TQPGVDVASEIAAGKAKASGVALTKQL  320

Query  902   VNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFI  1081
             V AP NV+TP ALA  A  IA+ + D  +  IL+ E+C+ + MGS+LGVA A+  P  FI
Sbjct  321   VAAPPNVVTPSALARIANEIAAQFPDTCSVKILEKEECEAMGMGSYLGVAEASDEPPKFI  380

Query  1082  HLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaia  1261
             HL YK   G+ KT +A++GKG+TFDSGGYN+K GA S IE+MK DM GA    GAA+ IA
Sbjct  381   HLTYK-GEGAKKT-VAVVGKGLTFDSGGYNIKAGAGSMIEMMKFDMGGAGATLGAARIIA  438

Query  1262  QIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVL  1441
             +  PAGVE HFIV +CENMI   G+RPGDILTASNGK IE                    
Sbjct  439   ETAPAGVEAHFIVASCENMIGSRGLRPGDILTASNGKTIE--------------------  478

Query  1442  GVIDPFF**VTDTDAEGRLILADALVYASKL-GVEKMVDLATLTGACITALGRSVAGM  1612
                      V +TDAEGRL LADALVYA K  G   +VD+ATLTGACI  LG  VAG+
Sbjct  479   ---------VNNTDAEGRLTLADALVYAEKTAGATSIVDVATLTGACIVGLGPEVAGV  527


 Score = 71.2 bits (173),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 2/64 (3%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWET--MKSSIADMINAGSLDGDAITAS  1859
             G+FTP +DLA E+  +A   GE  WRMP++E+YW++  M S  ADM N GS  G AITA+
Sbjct  526   GVFTPDDDLAAELEASAKEAGELFWRMPMQETYWKSCGMTSEYADMKNTGSRGGGAITAA  585

Query  1860  LFMK  1871
             LF+K
Sbjct  586   LFLK  589



>ref|WP_002797316.1| aminopeptidase A [Microcystis aeruginosa]
 emb|CCI25250.1| putative cytosol aminopeptidase [Microcystis aeruginosa PCC 9809]
Length=490

 Score =   268 bits (686),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 195/436 (45%), Positives = 244/436 (56%), Gaps = 59/436 (14%)
 Frame = +2

Query  341   EVDLLEWKGDILAVGVTEKDM-VKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSG  517
             +  LL W GD LA+G+ E  + +  E        L +L+ KLGG L +  SE +F GK G
Sbjct  7     DTSLLTWTGDTLALGLPEGAIEIAGE--------LAELNDKLGGNLGDLISETEFEGKLG  58

Query  518   QSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLS  697
              S   RL     +++ LVGLG      +    L     A     Q S          G  
Sbjct  59    SSAATRLGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISLPVVG--  116

Query  698   VESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLKYSEVV  871
                + + A A+  G++  T +D RFK   E K   L++VE+LGLG   E    +  SE +
Sbjct  117   --DQSATAGAITEGLLLATHQDTRFKSTKEEKGAKLETVELLGLG---EQASAIAKSEQI  171

Query  872   SSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVA  1051
              SGVI  +ELVNAPAN +TP  +AE A+ IA+ Y   L+  IL+ E+C+ L MG+FLGVA
Sbjct  172   CSGVILARELVNAPANTVTPLTMAETAEQIAAEYG--LSLNILEQEECESLGMGAFLGVA  229

Query  1052  AAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaa  1231
              A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK DM G A
Sbjct  230   KASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMDMGGGA  287

Query  1232  vvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRC  1411
                GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IE          
Sbjct  288   ATLGAAKAIAQLQPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIE----------  336

Query  1412  LSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITAL  1591
                                V +TDAEGRL LAD LV+A KL V+ +VDLATLTGAC+ AL
Sbjct  337   -------------------VNNTDAEGRLTLADGLVFAEKLEVDAIVDLATLTGACVIAL  377

Query  1592  GRSVAGMPL*IMYLWS  1639
             G  +AG       LWS
Sbjct  378   GDDIAG-------LWS  386


 Score = 68.9 bits (167),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E L  ++ EAA + GEK W MPLEE Y+E MKS IADM N G   G +ITA+LF
Sbjct  383   GLWSSDESLTVQLQEAAKLAGEKFWPMPLEEKYFEGMKSQIADMKNTGPRPGGSITAALF  442

Query  1866  MK  1871
             +K
Sbjct  443   LK  444



>ref|WP_028083384.1| aminopeptidase A [Dolichospermum circinale]
Length=490

 Score =   266 bits (680),  Expect(2) = 9e-83, Method: Compositional matrix adjust.
 Identities = 186/424 (44%), Positives = 245/424 (58%), Gaps = 50/424 (12%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             LL+W GD LA+G+ E D V+          L  LD KL G+ +E  +EE+F+GK   +I 
Sbjct  10    LLDWTGDTLAIGLFE-DAVQLTGD------LATLDQKLAGIFTELIAEEEFTGKVNSTIF  62

Query  530   LRLPALGF-KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVES  706
              R+ A    +++ LVGLG      +   TL   +AA             L  +  L    
Sbjct  63    TRVGAGNLVRKVILVGLGK--PEALQLETL-RRVAATVARTAKKQKTKTLGISLPLWSND  119

Query  707   KLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSG  880
               + A A+  GI    ++D RFK EP  K+P ++++++LGL    E +  +  ++ + SG
Sbjct  120   PAATAQAITEGIELALYQDIRFKSEPEDKSPNIETIDLLGLA---EQQAAITRADQIVSG  176

Query  881   VIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAA  1060
             VI  ++LV APAN +TP  +AE A  IA  Y   L   +L+  +C++L MG+FLGVA A+
Sbjct  177   VILARQLVAAPANAVTPITMAETAGAIAHEYG--LQLEVLEQAECQKLGMGAFLGVAQAS  234

Query  1061  TNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvf  1240
               P  FIHL YKP++ + + KLA++GKG+TFDSGG N+K GA S IE MK DM GAA   
Sbjct  235   ELPPKFIHLIYKPAT-TPRRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGGAAATL  292

Query  1241  gaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSR  1420
             GAAK I Q+KP  VEVHFI    ENMISG  M PGDILTASNGK IE             
Sbjct  293   GAAKVIGQLKP-DVEVHFISAVTENMISGKAMHPGDILTASNGKTIE-------------  338

Query  1421  SDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1600
                             V +TDAEGRL LADALVYA KLGV+ +VDLATLTGAC+ ALG  
Sbjct  339   ----------------VNNTDAEGRLTLADALVYADKLGVDAIVDLATLTGACVVALGED  382

Query  1601  VAGM  1612
             +AG+
Sbjct  383   IAGL  386


 Score = 70.9 bits (172),  Expect(2) = 9e-83, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP + +A ++  AA+  GEK+WR+P+E+ Y++ +KS IADM N G   G +ITA+LF
Sbjct  385   GLFTPDDAMASQLQTAAETAGEKIWRLPMEDKYFDGLKSGIADMKNTGPRYGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_002735635.1| leucine aminopeptidase 1 [Microcystis aeruginosa]
 gb|ELP53501.1| leucine aminopeptidase 1 [Microcystis aeruginosa TAIHU98]
Length=491

 Score =   268 bits (684),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 196/437 (45%), Positives = 244/437 (56%), Gaps = 60/437 (14%)
 Frame = +2

Query  341   EVDLLEWKGDILAVGVTEKDM-VKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSG  517
             +  LL W GD LA+G+ E  + +  E        L +L+ KLGG+L +  SE +F GK G
Sbjct  7     DTSLLTWTGDTLALGLPEGAIEIAGE--------LAELNDKLGGILEDLISETEFEGKLG  58

Query  518   QSIVLRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGL  694
              S   RL   G  +++ LVGLG      +    L     A     Q S          G 
Sbjct  59    SSAATRLGGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISLPVVG-  117

Query  695   SVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLKYSEV  868
                 + + A A+  G++    +D RFK   E K   L +VE+LGLG   E    +  +E 
Sbjct  118   ---DQSATAGAITEGLLLANHQDTRFKSTKEEKGAKLATVELLGLG---EQASAIAKAEQ  171

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             + SGVI  +ELVNAPAN +TP  +AE A+ IAS Y   L+  IL+ E+C+ L MG+FLGV
Sbjct  172   ICSGVILARELVNAPANTVTPLTMAETAEQIASEYG--LSLNILEQEECESLGMGAFLGV  229

Query  1049  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1228
             A A+  P  FIHL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK DM G 
Sbjct  230   AKASDIPPKFIHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMDMGGG  287

Query  1229  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLR  1408
             A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IE         
Sbjct  288   AATLGAAKAIAQLRPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIE---------  337

Query  1409  CLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1588
                                 V +TDAEGRL LAD LV+A KL V+ +VDLATLTGAC+ A
Sbjct  338   --------------------VNNTDAEGRLTLADGLVFAEKLEVDAIVDLATLTGACVIA  377

Query  1589  LGRSVAGMPL*IMYLWS  1639
             LG  +AG       LWS
Sbjct  378   LGDDIAG-------LWS  387


 Score = 68.9 bits (167),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E L  ++ EAA + GEK W MPLEE Y+E MKS IADM N G   G +ITA+LF
Sbjct  384   GLWSSDESLTVQLQEAAKLAGEKFWPMPLEEKYFEGMKSQIADMKNTGPRPGGSITAALF  443

Query  1866  MK  1871
             +K
Sbjct  444   LK  445



>ref|WP_009545951.1| MULTISPECIES: aminopeptidase A [Cyanothece]
 ref|YP_001802125.1| leucyl aminopeptidase [Cyanothece sp. ATCC 51142]
 sp|B1WR01.1|AMPA_CYAA5 RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Cyanothece sp. ATCC 51142]
 gb|ACB50059.1| leucine aminopeptidase [Cyanothece sp. ATCC 51142]
Length=490

 Score =   270 bits (691),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 192/434 (44%), Positives = 256/434 (59%), Gaps = 59/434 (14%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             LL+W G+ +A+G+ E       N       L +LD K+GG ++E   E +F GKSG S+ 
Sbjct  10    LLDWSGEAIALGIFE-------NETALTGELTQLDEKIGGTIAELIEEAEFEGKSGSSVA  62

Query  530   LRLPALG-FKRIGLVGLGSVVSSTIAYRTLGE-TIaaaaksaqassvavalasaEGLSVE  703
              R+      +++ LVGLG     T+    LG  T+A   K  +  ++A+     +  + +
Sbjct  63    TRIGGKSPIRKLILVGLGKKEELTLETVRLGAATVARLGKKEKVKTLAIQFPVVDNDAAQ  122

Query  704   SKLSAASAMATGIVSGTFEDNRFKLEPKTPTLK--SVEILGLGTGPEIEKKLKYSEVVSS  877
             +     +A+A G++    +DNRFK EP+   LK  +V+ILG+G   E  + +  +E V S
Sbjct  123   T----TAAIAEGMILSLHQDNRFKSEPEDKPLKLETVDILGVG---EQSEAINQAETVCS  175

Query  878   GVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAA  1057
             GVI  +ELV APAN +TP   AE A+N+A  Y   L   IL+ ++C++ KMG+FLGVA A
Sbjct  176   GVILARELVAAPANTVTPVTFAETAQNLAKDYG--LDLEILEKDECEKRKMGAFLGVAKA  233

Query  1058  ATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavv  1237
             +  P  FIHL YKPS G+ K KLA++GK +TFDSGG NLK+ + S IE MK DM G A  
Sbjct  234   SDLPPKFIHLTYKPS-GTPKRKLAIVGKSLTFDSGGLNLKV-SGSGIETMKMDMGGGAAT  291

Query  1238  fgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLS  1417
              GAAKAIAQ+KP  VEVHF+  A ENMISG  M PGDILTASNGK IE            
Sbjct  292   LGAAKAIAQLKP-DVEVHFVCAATENMISGKAMHPGDILTASNGKTIE------------  338

Query  1418  RSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGR  1597
                              V +TDAEGRL LADALV+A +L V+ +VDLATLTGACI ALG 
Sbjct  339   -----------------VNNTDAEGRLTLADALVFAEQLEVDAIVDLATLTGACIVALGD  381

Query  1598  SVAGMPL*IMYLWS  1639
             +++G       LWS
Sbjct  382   NISG-------LWS  388


 Score = 66.2 bits (160),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E LA+E+  A++  GEK W MP+EE Y+E +KS IADM N G   G +ITA+LF
Sbjct  385   GLWSTDETLAEEIKTASEAAGEKFWIMPMEEKYFEGLKSPIADMKNTGPRAGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_019502106.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=527

 Score =   266 bits (681),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 195/454 (43%), Positives = 261/454 (57%), Gaps = 70/454 (15%)
 Frame = +2

Query  356   EWKGDILAVGVTEKDMVKDENSKFQNLI---LQKLDS-KLGGLLSEASSEEDFSGKSGQS  523
             +W GD LA+ + +KD    E+++  +++   L +LD+ KL G L E  SE  F  ++G +
Sbjct  12    DWSGDGLAIALFQKDRTDGESTETSSVLSTALLELDANKLAGTLQELVSEAAFKAEAGST  71

Query  524   IVLRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV  700
             I  R+ A    +++ L+GLG    +T       E     A +  A     +   +  +SV
Sbjct  72    IGGRVGANATIRKVLLMGLGEPAKAT-------EDTWRKAAAQAAKWATQSKCQSLAISV  124

Query  701   ----ESKLSAASAMATGIVSGTFEDNRFK---------LEPKTPT-LKSVEILGLGTGPE  838
                 + +   A A+A GI+    +D RFK          EPK  T L+ V++LG    P 
Sbjct  125   PLYNQDEALTAQALAEGILLAAHQDKRFKSKSEDKAEGKEPKPETKLEQVDLLGFSL-PA  183

Query  839   IEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCK  1018
              +  L+ ++ + SG I  +ELV+APANV+TP  LAE A  IA+ Y D ++  IL+ E+C 
Sbjct  184   AQTGLETAQKICSGAIAARELVSAPANVVTPITLAEIASAIAAEYKDCMSVKILEKEECD  243

Query  1019  ELKMGSFLGVAAAATNPSYFIHLCYK-PS------SGSVKTKLALLGKGITFDSGGYNLK  1177
              L MG+FLGV+ A+  P  FIHL Y  P+      +GS K KLA++GKGITFDSGG N+K
Sbjct  244   ALGMGAFLGVSQASDLPPKFIHLTYSSPTKSATEGNGSPKRKLAIIGKGITFDSGGLNIK  303

Query  1178  IGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILT  1357
              G  SSIE+MK DM GAA   GAA+AIAQ++P  +EVHFI+ ACENMISG  + PGDILT
Sbjct  304   AGVGSSIEMMKTDMGGAAATLGAAQAIAQLRPHDIEVHFIIAACENMISGKAIHPGDILT  363

Query  1358  ASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLG  1537
             ASNGK IE                             V +TDAEGRL LADALVYA KLG
Sbjct  364   ASNGKTIE-----------------------------VNNTDAEGRLTLADALVYADKLG  394

Query  1538  VEKMVDLATLTGACITALGRSVAGMPL*IMYLWS  1639
             V+ +VDLATLTGAC+ ALG S+AG       LWS
Sbjct  395   VDAIVDLATLTGACVVALGDSIAG-------LWS  421


 Score = 69.7 bits (169),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++ S++LA ++  A+   GEK WRMPLEE Y+E MKS +AD  N GS  G +ITA+LF
Sbjct  418   GLWSNSDELAAQIESASQKAGEKFWRMPLEEPYFEQMKSVVADFKNTGSRAGGSITAALF  477

Query  1866  MK  1871
             +K
Sbjct  478   LK  479



>ref|WP_024970899.1| aminopeptidase A [Microcystis aeruginosa]
Length=491

 Score =   267 bits (682),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 196/437 (45%), Positives = 244/437 (56%), Gaps = 60/437 (14%)
 Frame = +2

Query  341   EVDLLEWKGDILAVGVTEKDM-VKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSG  517
             +  LL W GD LA+G+ E  + +  E        L +L+ KLGG L E  SE +F GK G
Sbjct  7     DTSLLTWTGDTLALGLPEGAVEIAGE--------LAELNDKLGGTLGELISETEFEGKLG  58

Query  518   QSIVLRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGL  694
              S   RL   G  +++ LVGLG      +    L     A     Q S          G 
Sbjct  59    SSAATRLGGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISLPVVG-  117

Query  695   SVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLKYSEV  868
                 + + A A+  G++    +D RFK   E K   L++VE+LGLG   E    +  +E 
Sbjct  118   ---DQSATAGAITEGLLLANHQDTRFKSTKEEKGAKLETVELLGLG---EQASAIAKAEQ  171

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             + SGVI  +ELVNAPAN +TP  +AE A+ IAS Y   L+  IL+ E+C+ L MG+FLGV
Sbjct  172   ICSGVILARELVNAPANTVTPLTMAETAEQIASEYG--LSLKILEQEECESLGMGAFLGV  229

Query  1049  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1228
             A A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK DM G 
Sbjct  230   AKASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMDMGGG  287

Query  1229  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLR  1408
             A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IE         
Sbjct  288   AATLGAAKAIAQLRPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIE---------  337

Query  1409  CLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1588
                                 V +TDAEGRL LAD LV+A KL V+ +VDLATLTGAC+ A
Sbjct  338   --------------------VNNTDAEGRLTLADGLVFAEKLEVDAIVDLATLTGACVVA  377

Query  1589  LGRSVAGMPL*IMYLWS  1639
             LG  +AG       LWS
Sbjct  378   LGDDIAG-------LWS  387


 Score = 69.7 bits (169),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E LA ++ EAA + GEK W MPLEE Y+E +KS IADM N G   G +ITA+LF
Sbjct  384   GLWSSDESLAAQLQEAAKLAGEKFWPMPLEEKYFEGLKSPIADMKNTGPRPGGSITAALF  443

Query  1866  MK  1871
             +K
Sbjct  444   LK  445



>ref|WP_002751572.1| aminopeptidase A [Microcystis aeruginosa]
 emb|CCH95427.1| putative cytosol aminopeptidase [Microcystis aeruginosa PCC 9432]
Length=491

 Score =   266 bits (680),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 194/437 (44%), Positives = 244/437 (56%), Gaps = 60/437 (14%)
 Frame = +2

Query  341   EVDLLEWKGDILAVGVTEKDM-VKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSG  517
             +  LL W GD LA+G+ E  + +  E        L +L+ KLGG+L +  SE +F GK G
Sbjct  7     DTSLLTWTGDTLALGLPEGAIEIAGE--------LAELNDKLGGILEDLISETEFEGKLG  58

Query  518   QSIVLRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGL  694
              S   RL   G  +++ LVGLG      +    L     A     Q S          G 
Sbjct  59    SSAATRLGGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISLPVVG-  117

Query  695   SVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLKYSEV  868
                 + + A A+  G++    +D RFK   E K   L +VE+LGLG   E    +  +E 
Sbjct  118   ---DQSATAGAITEGLLLANHQDTRFKSTKEEKGAKLATVELLGLG---EQASAIAKAEQ  171

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             + SGVI  +ELVNAPAN +TP  +AE A+ IA+ Y   L+  IL+ E+C+ L MG+FLGV
Sbjct  172   ICSGVILARELVNAPANTVTPLTMAETAEQIATEYG--LSLNILEQEECESLGMGAFLGV  229

Query  1049  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1228
             A A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK DM G 
Sbjct  230   AKASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKTDMGGG  287

Query  1229  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLR  1408
             A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IE         
Sbjct  288   AATLGAAKAIAQLRPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIE---------  337

Query  1409  CLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1588
                                 V +TDAEGRL LAD LV+A KL V+ +VDLATLTGAC+ A
Sbjct  338   --------------------VNNTDAEGRLTLADGLVFAEKLEVDAIVDLATLTGACVVA  377

Query  1589  LGRSVAGMPL*IMYLWS  1639
             LG  +AG       LWS
Sbjct  378   LGDDIAG-------LWS  387


 Score = 69.7 bits (169),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E LA ++ EAA + GEK W MPLEE Y+E +KS IADM N G   G +ITA+LF
Sbjct  384   GLWSSDESLAAQLQEAAKLAGEKFWPMPLEEKYFEGLKSPIADMKNTGPRPGGSITAALF  443

Query  1866  MK  1871
             +K
Sbjct  444   LK  445



>ref|XP_005835498.1| hypothetical protein GUITHDRAFT_68651 [Guillardia theta CCMP2712]
 gb|EKX48518.1| hypothetical protein GUITHDRAFT_68651 [Guillardia theta CCMP2712]
Length=496

 Score =   279 bits (714),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 191/455 (42%), Positives = 259/455 (57%), Gaps = 56/455 (12%)
 Frame = +2

Query  293   THPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQ-NLILQKLDSKLGG  469
              HP   + PK++         EWKGD+L     E    +D+N+         +LD+ + G
Sbjct  7     NHPVFTDSPKLAVRQSTSSPKEWKGDLLFFPFPEVGG-EDKNALVSLTGAAAELDASIDG  65

Query  470   LLSEASSEEDFSGKSGQSIVLRLP-ALGFKRIGLVGLGSVVSSTIAYR-TLGETIaaaak  643
             LLSE   E +F GKSG S++ RL  +  FK++ LVG+G+V  + +A    LG+ I  A+ 
Sbjct  66    LLSEIIKENEFKGKSGSSVLTRLAKSSSFKKLSLVGMGNVTQAAMASGFALGKQI--ASS  123

Query  644   saqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKL---EPKTPTLKSVEI  814
             +    +   A+   +G       +A  AMA  ++ G + D RFK    + K   L+S+E+
Sbjct  124   AKTEKAKTAAVVVPQGFDS----TAVKAMAQAVLEGIYHDVRFKSGDDKEKGCLLESLEV  179

Query  815   LGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTAT  994
             +        E++ K   V SSGV   ++LV AP+N +TP  LAE A+NIA  +   ++ T
Sbjct  180   I----ASNDEERCKILTVCSSGVKMARDLVGAPSNYVTPSTLAETARNIAKEHG--MSCT  233

Query  995   ILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNL  1174
             IL+ ++C+   MG++L V+  +  P  FIH+ YKP  G VK K+A++GKG+ FDSGGYNL
Sbjct  234   ILERDECERRGMGAYLAVSRGSAQPPKFIHVTYKP-KGEVKKKIAIVGKGLCFDSGGYNL  292

Query  1175  KIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDIL  1354
             K GA S IELMK DM G+A   G AKA+  +KP GVEVHFIV ACENMIS   MRPGDIL
Sbjct  293   KAGAGSMIELMKFDMGGSAATLGCAKAVGMMKPEGVEVHFIVAACENMISSDAMRPGDIL  352

Query  1355  TASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKL  1534
             TASNGK IE                             V +TDAEGRL LADALVYA + 
Sbjct  353   TASNGKTIE-----------------------------VLNTDAEGRLTLADALVYAEQA  383

Query  1535  GVEKMVDLATLTGACITALGRSVAGMPL*IMYLWS  1639
             G +++VD+ATLTGACI +LG   AG       LWS
Sbjct  384   GAQEIVDIATLTGACIISLGDEYAG-------LWS  411



>ref|WP_002790963.1| aminopeptidase A [Microcystis aeruginosa]
 emb|CCI28498.1| putative cytosol aminopeptidase [Microcystis aeruginosa PCC 9808]
Length=491

 Score =   266 bits (679),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 194/437 (44%), Positives = 245/437 (56%), Gaps = 60/437 (14%)
 Frame = +2

Query  341   EVDLLEWKGDILAVGVTEKDM-VKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSG  517
             +  LL W GD LA+G+ E  + +  E        L +L+ KLGG+L +  SE +F GK G
Sbjct  7     DTSLLTWTGDTLALGLPEGAIEIAGE--------LAELNDKLGGILEDLISETEFEGKLG  58

Query  518   QSIVLRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGL  694
              S   RL   G  +++ LVGLG      +    L     A     Q S          G 
Sbjct  59    SSAATRLGGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISLPVVG-  117

Query  695   SVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLKYSEV  868
                 + + A A+  G++    +D RFK   E K   L++VE+LGLG   E    +  +E 
Sbjct  118   ---DQSATAGAITEGLLLANHQDTRFKSTKEEKGAKLETVELLGLG---EQASAIAKAEQ  171

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             + SGVI  +ELVNAPAN +TP  +AE A+ IA+ Y   L+  IL+ E+C+ L MG+FLGV
Sbjct  172   ICSGVILARELVNAPANTVTPLTMAETAEQIAAEYG--LSLKILEQEECESLGMGAFLGV  229

Query  1049  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1228
             A A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK DM G 
Sbjct  230   AKASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMDMGGG  287

Query  1229  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLR  1408
             A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IE         
Sbjct  288   AATLGAAKAIAQLRPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIE---------  337

Query  1409  CLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1588
                                 V +TDAEGRL LAD LV+A KL V+ +VDLATLTGAC+ A
Sbjct  338   --------------------VNNTDAEGRLTLADGLVFAEKLEVDAIVDLATLTGACVVA  377

Query  1589  LGRSVAGMPL*IMYLWS  1639
             LG  +AG       LWS
Sbjct  378   LGDDIAG-------LWS  387


 Score = 69.7 bits (169),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E LA ++ EAA + GEK W MPLEE Y+E +KS IADM N G   G +ITA+LF
Sbjct  384   GLWSSDESLAAQLQEAAKLAGEKFWPMPLEEKYFEGLKSPIADMKNTGPRPGGSITAALF  443

Query  1866  MK  1871
             +K
Sbjct  444   LK  445



>ref|WP_008275582.1| aminopeptidase A [Cyanothece sp. CCY0110]
 gb|EAZ91456.1| leucyl aminopeptidase [Cyanothece sp. CCY0110]
Length=490

 Score =   269 bits (688),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 190/433 (44%), Positives = 245/433 (57%), Gaps = 57/433 (13%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             LL+W GD +A+G  E ++   E        L +LD K+G  ++E   E +F GKSG S+V
Sbjct  10    LLDWSGDAIALGFFENEIALTEE-------LSQLDEKIGKTMTELIEETEFEGKSGSSMV  62

Query  530   LRLPAL-GFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVES  706
              R+      +++ LVGLG     T+    LG    A     +             L    
Sbjct  63    TRIGGKSAIRKLILVGLGKKDEFTLDTVRLGAAAVARLGKKEKVKSLGIHFP---LMDND  119

Query  707   KLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSG  880
                  +A+A G++    +DNRFK EP  K   L++VEILG+G   E    +  +E V SG
Sbjct  120   AAKTTAAIAEGMILSLHQDNRFKSEPEDKPSKLETVEILGVGDQSE---AINQAETVCSG  176

Query  881   VIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAA  1060
             VI  +ELV APAN + P   A+ A+++A  Y   L   IL+ ++C++  MG+FLGVA A+
Sbjct  177   VILARELVAAPANAINPVTFAKTAQDLAKEYG--LDIEILEKDECEKRGMGAFLGVAKAS  234

Query  1061  TNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvf  1240
               P  FIHL YKPS G+ K KLA++GK +TFDSGG NLK G+ S IE MK DM G A   
Sbjct  235   DLPPKFIHLIYKPS-GTPKRKLAIVGKSLTFDSGGLNLK-GSGSGIETMKMDMGGGAATL  292

Query  1241  gaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSR  1420
             GAAKAIAQ+KP  VEVHF+  A ENMISG  MRPGDILTASNGK IE             
Sbjct  293   GAAKAIAQLKP-DVEVHFVCAATENMISGHAMRPGDILTASNGKTIE-------------  338

Query  1421  SDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1600
                             V +TDAEGRL LADALV+A +L V+ +VDLATLTGACI ALG +
Sbjct  339   ----------------VNNTDAEGRLTLADALVFAEQLAVDAIVDLATLTGACIVALGDN  382

Query  1601  VAGMPL*IMYLWS  1639
             ++G       LWS
Sbjct  383   ISG-------LWS  388


 Score = 65.9 bits (159),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E LA+E+  A++  GEK W MP+EE Y+E +KS IADM N G   G +ITA+LF
Sbjct  385   GLWSTDETLAEEIKTASEAAGEKFWIMPMEEKYFEGLKSPIADMKNTGPRAGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|XP_008337029.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Malus 
domestica]
Length=378

 Score =   240 bits (613),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 150/211 (71%), Gaps = 29/211 (14%)
 Frame = +2

Query  980   VLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDS  1159
             +L+A ILD EQCKELKMGS+L VAAA+TNPS+FIHL YKP  G  K KL L+GKG+TFDS
Sbjct  94    LLSANILDEEQCKELKMGSYLAVAAASTNPSHFIHLIYKPPGGPAKVKLGLVGKGLTFDS  153

Query  1160  GGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMR  1339
             GGYN+K G   SIE MK DM G+A V GAAKAIAQIKP GV VHFIV ACENM+SGTGMR
Sbjct  154   GGYNIKTGPGCSIEQMKXDMGGSAAVLGAAKAIAQIKPTGVXVHFIVAACENMMSGTGMR  213

Query  1340  PGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALV  1519
             PGDI+TASNGK IE                             V +TDAEGRL LAD LV
Sbjct  214   PGDIVTASNGKTIE-----------------------------VNNTDAEGRLTLADTLV  244

Query  1520  YASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             YA   GV+K+VDLATLTGACI A G S+AG+
Sbjct  245   YACNQGVDKIVDLATLTGACIVAFGPSIAGV  275


 Score = 94.4 bits (233),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTPS+DLAKEV  A+++ GEK WR+P+EESYWE+MKS IADM+N G+  G +IT +LF
Sbjct  274   GVFTPSDDLAKEVFAASEISGEKFWRLPMEESYWESMKSGIADMLNTGARQGGSITVALF  333

Query  1866  MK  1871
             +K
Sbjct  334   LK  335



>ref|WP_015784948.1| aminopeptidase A [Cyanothece sp. PCC 8802]
 ref|YP_003139549.1| leucyl aminopeptidase [Cyanothece sp. PCC 8802]
 gb|ACV02714.1| Leucyl aminopeptidase [Cyanothece sp. PCC 8802]
Length=491

 Score =   267 bits (683),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 193/433 (45%), Positives = 252/433 (58%), Gaps = 57/433 (13%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
              L+W GD LA+G+ E      E ++     L +LD KL G L E   E +F GK+G   V
Sbjct  10    FLDWTGDALALGIFE------EGTQITGE-LSQLDGKLTGTLQELIQEAEFEGKAGTKAV  62

Query  530   LRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVES  706
              R+ +    +++ LVGLG   +  +   ++ E   A A+ A+   V     +   ++ + 
Sbjct  63    TRVGSNSPIRKVMLVGLGK--AEDLQLNSVREAAGAIARLAKLEKVKTLGINLPVVNNDG  120

Query  707   KLSAASAMATGIVSGTFEDNRFKLEPKTPTLK--SVEILGLGTGPEIEKKLKYSEVVSSG  880
                 ASA+A GI+    +DNRFK +P+   LK  +V+ILG G   E  + +  ++ +SSG
Sbjct  121   A-KTASAIAEGILLALHQDNRFKSDPQENALKLENVDILGCG---EATEAINRAQTLSSG  176

Query  881   VIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAA  1060
             VI  +ELVN+PAN +TP   AE A+ IA      LT  IL+ E C++L MGSFLGVA A+
Sbjct  177   VILARELVNSPANTITPVTFAETAQEIAQTSG--LTCEILEQEDCEKLGMGSFLGVAKAS  234

Query  1061  TNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvf  1240
               P  FIHL YKPS G+ K KLA++GK +TFD GG NLK+ A +SIE+MK DM G A   
Sbjct  235   DLPPKFIHLTYKPS-GTPKKKLAIVGKSLTFDCGGLNLKV-AGASIEMMKMDMGGGAATL  292

Query  1241  gaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSR  1420
             GAAK I Q+KP  VEVHFI  A ENMISG  + PGDILTASNGK IE             
Sbjct  293   GAAKVIGQLKP-DVEVHFICAATENMISGRAIHPGDILTASNGKTIE-------------  338

Query  1421  SDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1600
                             V +TDAEGRL LADALV+A KL V+ +VDLATLTGACI ALG +
Sbjct  339   ----------------VNNTDAEGRLTLADALVFAEKLEVDAIVDLATLTGACIIALGDN  382

Query  1601  VAGMPL*IMYLWS  1639
             ++G       LWS
Sbjct  383   ISG-------LWS  388


 Score = 67.0 bits (162),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  + LA ++  AA+  GEK W+MPLEE Y+E +KS IADM N G   G +ITA+LF
Sbjct  385   GLWSTDQTLADQLKAAAETAGEKFWQMPLEEKYFEGLKSPIADMKNTGPRAGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_016949514.1| aminopeptidase A [Anabaena sp. PCC 7108]
Length=490

 Score =   264 bits (674),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 190/429 (44%), Positives = 253/429 (59%), Gaps = 60/429 (14%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             LL+W GD LA+ + E D V+          L  LD K  G+L E  +EE+F+GK   +I 
Sbjct  10    LLDWSGDTLAIALFE-DAVELTGE------LAALDEKFAGILQEIIAEEEFTGKVNSTIF  62

Query  530   LRLPA-LGFKRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEGLSV-  700
              R+ A    +++ LVGLG      +  +R +  T+A  AK  +  ++        G+S+ 
Sbjct  63    TRVGAGNNVRKLILVGLGKPDGLKLETFRRVAATVARTAKKQKTKTL--------GISLP  114

Query  701   ---ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSE  865
                    + A A+A G     ++D RFK EP  K+P ++++++LGL TG E    +  + 
Sbjct  115   VFNNDPAATAQAIAEGAQLALYQDTRFKSEPEDKSPNIETIDLLGL-TGQE--AAITRAN  171

Query  866   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLG  1045
              + SGVI  ++LV APAN +TP  +AE A+ IA+ Y   L   IL+  +C++L MG+FLG
Sbjct  172   QIVSGVILARQLVAAPANAVTPITMAETAQAIANEYG--LQLEILEQAECEKLGMGAFLG  229

Query  1046  VAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMag  1225
             VA A+  P  FIHL YKP++ + + KLA++GKG+TFDSGG N+K GA S IE MK DM G
Sbjct  230   VAQASDLPPKFIHLIYKPAT-TPRRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGG  287

Query  1226  aavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVL  1405
             AA   GAAKAI Q+KP  VEVHFI    ENMISG  M PGDILTASNGK IE        
Sbjct  288   AAATLGAAKAIGQLKP-DVEVHFISAVTENMISGRAMHPGDILTASNGKTIE--------  338

Query  1406  RCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACIT  1585
                                  V +TDAEGRL LADALVYA KLGV+ +VDLATLTGAC+ 
Sbjct  339   ---------------------VNNTDAEGRLTLADALVYADKLGVDAIVDLATLTGACVV  377

Query  1586  ALGRSVAGM  1612
             ALG  +AG+
Sbjct  378   ALGDDIAGL  386


 Score = 70.5 bits (171),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP + +A ++  A++  GEK+WRMP+E+ Y++ +KS IADM N G   G +ITA+LF
Sbjct  385   GLFTPDDAVASQLQTASEAAGEKIWRMPMEDKYFDGLKSGIADMKNTGPRYGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_006515687.1| leucyl aminopeptidase [Leptolyngbya sp. PCC 7375]
 gb|EKV01290.1| leucyl aminopeptidase [Leptolyngbya sp. PCC 7375]
Length=491

 Score =   263 bits (673),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 194/436 (44%), Positives = 244/436 (56%), Gaps = 57/436 (13%)
 Frame = +2

Query  323   ISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDF  502
             + F A +   L W GD L VG++E+ +           +L +L+ ++ GLL E   E DF
Sbjct  1     MKFVASDKSCLTWSGDCLVVGLSEESLP-------LTGLLSELNERVSGLLQELIDETDF  53

Query  503   SGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalas  682
               K+G S V+R+     +++ +VGLG       A   L       A +A A        +
Sbjct  54    KAKAGSSAVIRV-GNDVRKLAIVGLG-------ASEDLKLESLRRAAAAAAKLAKREKCA  105

Query  683   aEGLSV----ESKLSAASAMATGIVSGTFEDNRFKLEPKTP--TLKSVEILGLGTGPEIE  844
             + G+S      S       +A G+     ED RFK +   P   L  + +L L  G   E
Sbjct  106   SLGISFPIWNNSPERTTQTIAEGVTLAMHEDKRFKSDTDAPKVVLSDISLLDL-VG--YE  162

Query  845   KKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKEL  1024
               L+ +  V  GVI  +ELV AP NV+TP ++AE A +IA  +   LT  +L+  +C+EL
Sbjct  163   AALETAAHVCDGVILARELVAAPPNVVTPTSMAETAADIAKEHG--LTLKVLEQAECEEL  220

Query  1025  KMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIEL  1204
              MG++LGVA A+  P  FIHL Y P  G+ K KLAL+GKG+TFDSGG N+K GA S IEL
Sbjct  221   GMGAYLGVAMASEMPPKFIHLTYTPE-GTPKRKLALIGKGLTFDSGGLNIKAGAGSMIEL  279

Query  1205  MKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEV  1384
             MK DM GAA V GAAKAIAQIKP  VEVHFI  A ENMISG  M PGDILTASNGK IE 
Sbjct  280   MKMDMGGAAAVLGAAKAIAQIKP-DVEVHFISAATENMISGHAMHPGDILTASNGKTIE-  337

Query  1385  TYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLAT  1564
                                         V +TDAEGRL LADALVYA KLGV+ MVDLAT
Sbjct  338   ----------------------------VNNTDAEGRLTLADALVYADKLGVDAMVDLAT  369

Query  1565  LTGACITALGRSVAGM  1612
             LTGACI ALG  +AG+
Sbjct  370   LTGACIVALGNDLAGL  385


 Score = 70.5 bits (171),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+F+P ++LA  +  A++  GEKLWRMP+EE Y++ +KS +ADM N G   G +ITA+LF
Sbjct  384   GLFSPDDELAGALANASEEAGEKLWRMPMEEKYFDGLKSIVADMKNTGPRPGGSITAALF  443

Query  1866  MK  1871
             +K
Sbjct  444   LK  445



>ref|WP_002801043.1| aminopeptidase A [Microcystis aeruginosa]
 emb|CCI38639.1| putative cytosol aminopeptidase [Microcystis aeruginosa PCC 9701]
Length=491

 Score =   263 bits (673),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 194/437 (44%), Positives = 242/437 (55%), Gaps = 60/437 (14%)
 Frame = +2

Query  341   EVDLLEWKGDILAVGVTEKDM-VKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSG  517
             +  LL W GD LA+G+ E  + +  E        L +L+ KLGG L +  SE +F GK G
Sbjct  7     DTSLLTWTGDTLALGLPEGAVEIAGE--------LAELNDKLGGTLEDLISETEFEGKLG  58

Query  518   QSIVLRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGL  694
              S   RL      +++ LVGLG      +    L     A     Q S          G 
Sbjct  59    SSAATRLGGGDPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISLPVVG-  117

Query  695   SVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLKYSEV  868
                 + + A A+  G++    +D RFK   E K   L +VE+LGLG   E    +  +E 
Sbjct  118   ---DQSATAGAITEGLLLANHQDTRFKSTKEEKGAKLATVELLGLG---EQASAIAKAEQ  171

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             + SGVI  +ELVNAPAN +TP  +AE A+ IA+ Y   L+  IL+ E+C+ L MG+FLGV
Sbjct  172   ICSGVILARELVNAPANAVTPLTMAETAEQIATEYG--LSLNILEQEECESLGMGAFLGV  229

Query  1049  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1228
             A A+  P  FIHL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK DM G 
Sbjct  230   AKASDIPPKFIHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKTDMGGG  287

Query  1229  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLR  1408
             A   GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IE         
Sbjct  288   AATLGAAKAIAQLRPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIE---------  337

Query  1409  CLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1588
                                 V +TDAEGRL LAD LV+A KL V+ +VDLATLTGAC+ A
Sbjct  338   --------------------VNNTDAEGRLTLADGLVFAEKLEVDAIVDLATLTGACVVA  377

Query  1589  LGRSVAGMPL*IMYLWS  1639
             LG  +AG       LWS
Sbjct  378   LGDDIAG-------LWS  387


 Score = 70.5 bits (171),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E LA ++ EAA + GEK W MPLEE Y+E +KS IADM N G   G +ITA+LF
Sbjct  384   GLWSSDESLAAQIQEAAKLAGEKFWPMPLEEKYFEGLKSPIADMKNTGPRPGGSITAALF  443

Query  1866  MK  1871
             +K
Sbjct  444   LK  445



>ref|WP_021830390.1| Cytosol aminopeptidase PepA [Crocosphaera watsonii]
 emb|CCQ50872.1| Cytosol aminopeptidase PepA [Crocosphaera watsonii WH 8502]
Length=503

 Score =   270 bits (689),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 186/424 (44%), Positives = 246/424 (58%), Gaps = 51/424 (12%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             LL+W GD +A+G+ E + +           L +LD K GG L+E   E +F GKSG S V
Sbjct  24    LLDWSGDAIALGLFEDETILTGE-------LSQLDEKTGGTLAELIEETEFKGKSGSSAV  76

Query  530   LRLPA-LGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVES  706
              R+      +++ L+GLG     ++    LG    A     +               VE+
Sbjct  77    TRIGGGSAIRKLILIGLGKKDELSLDSLRLGAAAVARLGKKEKVKSLGINFPV----VEN  132

Query  707   KLSAASAMATGIVSGTFEDNRFKLEPKTPTLK--SVEILGLGTGPEIEKKLKYSEVVSSG  880
             + S  +A+A G++    +DNRFK EP+   LK  +V ILG+G   E    ++ ++ ++SG
Sbjct  133   EASTTTAIAEGMILSLHQDNRFKSEPEDKPLKLETVHILGVGAQSE---AVEQAQTITSG  189

Query  881   VIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAA  1060
             VI  +ELV APAN + P   AE A+ +A+ Y   L   IL+ E+C++L MG+FLGVA A+
Sbjct  190   VILARELVAAPANSVNPVTFAETAQTLATDYG--LDIEILEQEECEKLGMGAFLGVAKAS  247

Query  1061  TNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvf  1240
               P  FIHL YKP++ + K KLA++GK +TFDSGG NLK G+ S IE MK DM G A   
Sbjct  248   DLPPKFIHLTYKPAA-TPKRKLAIVGKSLTFDSGGLNLK-GSGSGIETMKMDMGGGAATL  305

Query  1241  gaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSR  1420
             GAAKAIAQ+KP  VEVHF+  A ENMISG  M PGDILTASNGK IE             
Sbjct  306   GAAKAIAQLKP-DVEVHFVCAATENMISGRAMHPGDILTASNGKTIE-------------  351

Query  1421  SDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1600
                             V +TDAEGRL LADALVYA KL V+ +VDLATLTGAC+ ALG  
Sbjct  352   ----------------VNNTDAEGRLTLADALVYAEKLEVDAIVDLATLTGACLVALGND  395

Query  1601  VAGM  1612
             ++G+
Sbjct  396   ISGL  399


 Score = 63.9 bits (154),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E L +E+  A++  GEK W MP+EE Y+E +KS IADM N G   G +ITA+LF
Sbjct  398   GLWSTDETLTEELKTASETAGEKFWVMPMEEKYFEGLKSPIADMKNTGPRAGGSITAALF  457

Query  1866  MK  1871
             +K
Sbjct  458   LK  459



>ref|WP_012406927.1| aminopeptidase A [Nostoc punctiforme]
 ref|YP_001863841.1| leucyl aminopeptidase [Nostoc punctiforme PCC 73102]
 sp|B2J3G8.1|AMPA_NOSP7 RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Nostoc punctiforme PCC 73102]
 gb|ACC78898.1| peptidase M17, leucyl aminopeptidase domain protein [Nostoc punctiforme 
PCC 73102]
Length=493

 Score =   255 bits (652),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 194/424 (46%), Positives = 244/424 (58%), Gaps = 50/424 (12%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             LLEW GD LA+G+ E D V+          L  LD K  G+L E  +EE+F GK+  +I 
Sbjct  10    LLEWAGDSLAIGLFE-DAVELTGE------LATLDQKFSGVLKELIAEEEFKGKANSTIF  62

Query  530   LRL-PALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVES  706
              R+ P    +++ LVGLG      +   TL    AA A+ A+     +   S   L    
Sbjct  63    TRVNPGRPVRKLILVGLGK--PDALKLDTLRRAAAAVARVAKKQKSKILGFSFP-LWNND  119

Query  707   KLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSG  880
               ++A A+A G+    ++D RFK EP  K   +++V++LG       E  +  +  + SG
Sbjct  120   PAASAQAIAEGVELALYQDIRFKSEPEDKGSQIETVDLLGFSGQ---EAAITLANQIVSG  176

Query  881   VIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAA  1060
             V   +ELV APAN +TP  LAE A+ IA  Y   L   IL+ E C++L MG+FLGVA A+
Sbjct  177   VNLARELVAAPANAVTPITLAETAQAIAKDYG--LQVEILEKEDCEKLGMGAFLGVAQAS  234

Query  1061  TNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvf  1240
               P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K GA S IE MK DM GAA   
Sbjct  235   ELPPKFIHLTYKPE-GTPKKKLAIIGKGVTFDSGGLNIK-GAGSGIETMKMDMGGAAATL  292

Query  1241  gaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSR  1420
             GAAKAIAQIKP  VEVHFI    ENMISG  M PGDILTASNGK IE             
Sbjct  293   GAAKAIAQIKP-DVEVHFISAVAENMISGRAMHPGDILTASNGKTIE-------------  338

Query  1421  SDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1600
                             V +TDAEGRL LADALVYA KLG++ +VDLATLTGA + ALG  
Sbjct  339   ----------------VNNTDAEGRLTLADALVYAEKLGLDAIVDLATLTGANVIALGDD  382

Query  1601  VAGM  1612
             +AG+
Sbjct  383   IAGL  386


 Score = 78.2 bits (191),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G++TP +D+A ++ +AA   GEK+WRMP+EE Y+E +KS IADM N G   G AITA+LF
Sbjct  385   GLYTPDDDVASQIEKAAQTSGEKIWRMPMEEKYFEGLKSGIADMKNTGPRPGGAITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_009556547.1| leucyl aminopeptidase [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ69637.1| leucyl aminopeptidase [Oscillatoriales cyanobacterium JSC-12]
Length=492

 Score =   254 bits (649),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 194/432 (45%), Positives = 250/432 (58%), Gaps = 56/432 (13%)
 Frame = +2

Query  353   LEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVL  532
             LEW GD LAVG+ E     D      +L++  LD KL G + E  +E +F GK+  S+  
Sbjct  11    LEWSGDALAVGLFE-----DHVELTDDLVV--LDEKLSGTIQELIAEGEFKGKASSSVSA  63

Query  533   RL-PALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESK  709
             R+      ++I LVGLG      +    L    A AAK+A+             +  E  
Sbjct  64    RVGRGSNIRKIILVGLGK--PDDLKLEGLRRAGAVAAKTAKKEKAKTLGIRLP-ICHEDA  120

Query  710   LSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSGV  883
              ++A A+A GI     +D RFK +P  K   L+ +E+LGLG     E  +  +  + SGV
Sbjct  121   AASAQAIAEGIELALHQDTRFKSDPEDKGAKLEMIELLGLGGQ---EAAITRARQLCSGV  177

Query  884   IFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAAT  1063
             I  +ELV APAN++TP  LAE A  IA+ Y   L   IL+ ++C++L MG+FLGVA A+ 
Sbjct  178   ILARELVAAPANIVTPITLAETALAIANEYG--LDVEILERDECEKLGMGAFLGVAQASD  235

Query  1064  NPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvfg  1243
              P  FIHL Y+P+S + + KLA++GKG+TFDSGG N+K  + S IE+MK DM GAA   G
Sbjct  236   LPPKFIHLTYRPAS-TPRRKLAIIGKGLTFDSGGLNIK-PSGSGIEMMKTDMGGAAATLG  293

Query  1244  aakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSRS  1423
             AAKAIAQ+KPA VEVHFI  A ENMISG  M PGDILTASNGK IE              
Sbjct  294   AAKAIAQLKPADVEVHFISAATENMISGHAMHPGDILTASNGKTIE--------------  339

Query  1424  DYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRSV  1603
                            + +TDAEGRL LADALV+A KLGV+ +VDLATLTGAC+ ALG  +
Sbjct  340   ---------------INNTDAEGRLTLADALVFAEKLGVDAIVDLATLTGACVIALGDDI  384

Query  1604  AGMPL*IMYLWS  1639
             AG       LWS
Sbjct  385   AG-------LWS  389


 Score = 79.7 bits (195),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++P++DLA E++ AAD  GEKLW+MP+EE Y+E MKS +ADM N G   G AITA+LF
Sbjct  386   GLWSPNDDLAAELVAAADRAGEKLWKMPMEEKYFEGMKSVVADMKNTGPRPGGAITAALF  445

Query  1866  MK  1871
             +K
Sbjct  446   LK  447



>ref|WP_010994414.1| aminopeptidase A [Nostoc sp. PCC 7120]
 ref|NP_484281.1| leucyl aminopeptidase [Nostoc sp. PCC 7120]
 sp|Q8Z064.1|AMPA_NOSS1 RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Nostoc sp. PCC 7120]
 dbj|BAB77761.1| leucine aminopeptidase [Nostoc sp. PCC 7120]
Length=491

 Score =   259 bits (663),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 192/428 (45%), Positives = 247/428 (58%), Gaps = 58/428 (14%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             LLEW GD LA+ + E D V+          L  LD K  G+L E  +EE+F+GK+  ++ 
Sbjct  10    LLEWAGDTLAIALFE-DAVELTGE------LGSLDEKFAGILKELITEEEFTGKANSTVF  62

Query  530   LRLPA-LGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV--  700
              R+ + +  ++I LVGLG     T A++   ET+  AA +              GLS   
Sbjct  63    TRVSSNIPVRKIILVGLG----KTEAFKI--ETLRRAAAAVGKVGKKQKSKVI-GLSFPL  115

Query  701   --ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEV  868
                   ++A A+A G+    ++DNRFK +P  K   +++VE+LG       E  +  +  
Sbjct  116   WNNDPTASAQAIAEGLQLALYQDNRFKSDPEDKGSQVETVELLGFAGQ---EAAINRANQ  172

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             + SGVI  ++LV APAN +TP  +AE A+ IA  Y   L   IL+ E C++L MG+FLGV
Sbjct  173   IVSGVILARQLVAAPANSVTPITMAETAQQIAQDYG--LQIEILEQEDCEKLGMGAFLGV  230

Query  1049  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1228
             A A+  P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K GA S IE MK DM GA
Sbjct  231   ALASDLPPKFIHLTYKP-EGTPKRKLAIVGKGLTFDSGGLNIK-GAGSGIETMKIDMGGA  288

Query  1229  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLR  1408
             A   GAAKAIAQIKP  VEVHFI    ENMISG  M PGDILTASNGK IE         
Sbjct  289   AATLGAAKAIAQIKP-NVEVHFISAVTENMISGKAMHPGDILTASNGKTIE---------  338

Query  1409  CLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1588
                                 V +TDAEGRL LADALVY  KLG++ +VDLATLTGA + A
Sbjct  339   --------------------VNNTDAEGRLTLADALVYTDKLGLDAIVDLATLTGANVIA  378

Query  1589  LGRSVAGM  1612
             LG  +AG+
Sbjct  379   LGDDIAGL  386


 Score = 74.3 bits (181),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G++TP + LA ++ +AA   GEK+WRMPLEE Y+E +KS IADM N G   G +ITA+LF
Sbjct  385   GLYTPDDALAGQLEQAASESGEKIWRMPLEEKYFEGLKSGIADMKNTGPRPGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_007311314.1| aminopeptidase A [Crocosphaera watsonii]
 gb|EHJ12052.1| Cytosol aminopeptidase PepA [Crocosphaera watsonii WH 0003]
 emb|CCQ62417.1| Cytosol aminopeptidase PepA [Crocosphaera watsonii WH 0401]
 emb|CCQ57768.1| Cytosol aminopeptidase PepA [Crocosphaera watsonii WH 0005]
 emb|CCQ66088.1| Cytosol aminopeptidase PepA [Crocosphaera watsonii WH 0402]
Length=489

 Score =   270 bits (689),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 189/433 (44%), Positives = 248/433 (57%), Gaps = 58/433 (13%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             LL+W GD +A+G+ E + +           L +LD K GG L+E   E +F GKSG S V
Sbjct  10    LLDWSGDAIALGLFEDETILTGE-------LSQLDEKTGGTLAELIEETEFKGKSGSSAV  62

Query  530   LRLPA-LGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVES  706
              R+      +++ L+GLG     ++    LG    A     +               VE+
Sbjct  63    TRIGGGSAIRKLILIGLGKKDELSLDSLRLGAAAVARLGKKEKVKSLGINFPV----VEN  118

Query  707   KLSAASAMATGIVSGTFEDNRFKLEPKTPTLK--SVEILGLGTGPEIEKKLKYSEVVSSG  880
             + S  +A+A G++    +DNRFK EP+   LK  +V ILG+G   E    ++ ++ ++SG
Sbjct  119   EASTTTAIAEGMILSLHQDNRFKSEPEDKPLKLETVHILGVGAQSE---AVEQAQTITSG  175

Query  881   VIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAA  1060
             VI  +ELV APAN + P   AE A+ +A+ Y   L   IL+ E+C++L MG+FLGVA A+
Sbjct  176   VILARELVAAPANSVNPVTFAETAQTLATDYG--LDIEILEQEECEKLGMGAFLGVAKAS  233

Query  1061  TNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvf  1240
               P  FIHL YKP++ + K KLA++GK +TFDSGG NLK G+ S IE MK DM G A   
Sbjct  234   DLPPKFIHLTYKPAA-TPKRKLAIVGKSLTFDSGGLNLK-GSGSGIETMKMDMGGGAATL  291

Query  1241  gaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSR  1420
             GAAKAIAQ+KP  VEVHF+  A ENMISG  M PGDILTASNGK IE             
Sbjct  292   GAAKAIAQLKP-DVEVHFVCAATENMISGRAMHPGDILTASNGKTIE-------------  337

Query  1421  SDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1600
                             V +TDAEGRL LADALVYA KL V+ +VDLATLTGAC+ ALG  
Sbjct  338   ----------------VNNTDAEGRLTLADALVYAEKLEVDAIVDLATLTGACLVALGND  381

Query  1601  VAGMPL*IMYLWS  1639
             ++G       LWS
Sbjct  382   ISG-------LWS  387


 Score = 63.9 bits (154),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E L +E+  A++  GEK W MP+EE Y+E +KS IADM N G   G +ITA+LF
Sbjct  384   GLWSTDETLTEELKTASETAGEKFWVMPMEEKYFEGLKSPIADMKNTGPRAGGSITAALF  443

Query  1866  MK  1871
             +K
Sbjct  444   LK  445



>ref|WP_012597067.1| aminopeptidase A [Cyanothece sp. PCC 8801]
 ref|YP_002373966.1| leucyl aminopeptidase [Cyanothece sp. PCC 8801]
 sp|B7K4A4.1|AMPA_CYAP8 RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Cyanothece sp. PCC 8801]
 gb|ACK67810.1| Leucyl aminopeptidase [Cyanothece sp. PCC 8801]
Length=491

 Score =   266 bits (680),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 192/433 (44%), Positives = 252/433 (58%), Gaps = 57/433 (13%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
              L+W GD LA+G+ E      E ++     L +LD KL G + E   E +F GK+G   V
Sbjct  10    FLDWTGDALALGIFE------EGTQITGE-LSQLDGKLTGTVQELIQEAEFEGKAGTKAV  62

Query  530   LRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVES  706
              R+ +    +++ LVGLG   +  +   ++ E   A A+ A+   V     +   ++ + 
Sbjct  63    TRVGSNSPIRKVMLVGLGK--AEDLQLNSVREAAGAIARLAKLEKVKTLGINLPVVNNDG  120

Query  707   KLSAASAMATGIVSGTFEDNRFKLEPKTPTLK--SVEILGLGTGPEIEKKLKYSEVVSSG  880
                 ASA+A GI+    +DNRFK +P+   LK  +V+ILG G   E  + +  ++ +SSG
Sbjct  121   A-KTASAIAEGILLALHQDNRFKSDPQENALKLENVDILGCG---EATEAINRAQTLSSG  176

Query  881   VIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAA  1060
             VI  +ELVN+PAN +TP   AE A+ IA      LT  IL+ E C++L MGSFLGVA A+
Sbjct  177   VILARELVNSPANTITPVTFAETAQEIAQTSG--LTCEILEQEDCEKLGMGSFLGVAKAS  234

Query  1061  TNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvf  1240
               P  FIHL YKPS G+ K KLA++GK +TFD GG NLK+ A +SIE+MK DM G A   
Sbjct  235   DLPPKFIHLTYKPS-GTPKKKLAIVGKSLTFDCGGLNLKV-AGASIEMMKMDMGGGAATL  292

Query  1241  gaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSR  1420
             GAAK I Q+KP  VEVHFI  A ENMISG  + PGDILTASNGK IE             
Sbjct  293   GAAKVIGQLKP-DVEVHFICAATENMISGRAIHPGDILTASNGKTIE-------------  338

Query  1421  SDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1600
                             V +TDAEGRL LADALV+A KL V+ +VDLATLTGACI ALG +
Sbjct  339   ----------------VNNTDAEGRLTLADALVFAEKLEVDAIVDLATLTGACIIALGDN  382

Query  1601  VAGMPL*IMYLWS  1639
             ++G       LWS
Sbjct  383   ISG-------LWS  388


 Score = 67.4 bits (163),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  + LA ++  AA+  GEK W+MPLEE Y+E +KS IADM N G   G +ITA+LF
Sbjct  385   GLWSTDQTLADQLKAAAETAGEKFWQMPLEEKYFEGLKSPIADMKNTGPRAGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_002757690.1| aminopeptidase A [Microcystis aeruginosa]
 emb|CCI00627.1| putative cytosol aminopeptidase [Microcystis aeruginosa PCC 9717]
Length=490

 Score =   265 bits (676),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 193/436 (44%), Positives = 242/436 (56%), Gaps = 59/436 (14%)
 Frame = +2

Query  341   EVDLLEWKGDILAVGVTEKDM-VKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSG  517
             +  LL W GD LA+G+ E  + +  E        L +L+ KLGG L +  SE +F GK G
Sbjct  7     DTSLLTWTGDTLALGLPEGTIEIAGE--------LAELNDKLGGNLGDLISETEFEGKLG  58

Query  518   QSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLS  697
              S   RL     +++ LVGLG      +    L     A     Q S          G  
Sbjct  59    SSAATRLGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISLPVVG--  116

Query  698   VESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLKYSEVV  871
                + + A A+  G++    +D RFK   E K   L +VE+LGLG   E    +  +E +
Sbjct  117   --DQSATAGAITEGLLLANHQDTRFKSTKEEKGAKLATVELLGLG---EQTSAIAKAEQI  171

Query  872   SSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVA  1051
              SGVI  +ELVNAPAN +TP  +AE A+ IA+ Y   L+  IL+ E+C+ L MG+FLGVA
Sbjct  172   CSGVILARELVNAPANTVTPLTMAETAEQIAAEYG--LSLKILEQEECESLGMGAFLGVA  229

Query  1052  AAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaa  1231
              A+  P  F+HL YKP  G+ K KLA++GK +TFDSGG N+K GA S IE MK DM G A
Sbjct  230   KASDIPPKFLHLIYKPQ-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMDMGGGA  287

Query  1232  vvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRC  1411
                GAAKAIAQ++P  VEVHFI PA ENMISG  M PGDILTASNGK IE          
Sbjct  288   ATLGAAKAIAQLQPE-VEVHFICPATENMISGRAMHPGDILTASNGKTIE----------  336

Query  1412  LSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITAL  1591
                                V +TDAEGRL LAD LV+A KL V+ +VDLATLTGAC+ AL
Sbjct  337   -------------------VNNTDAEGRLTLADGLVFAEKLEVDAIVDLATLTGACVIAL  377

Query  1592  GRSVAGMPL*IMYLWS  1639
             G  +AG       LWS
Sbjct  378   GDDIAG-------LWS  386


 Score = 68.9 bits (167),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E L  ++ EAA + GEK W MPLEE Y+E MKS IADM N G   G +ITA+LF
Sbjct  383   GLWSSDESLTVQLQEAAKLAGEKFWPMPLEEKYFEGMKSQIADMKNTGPRPGGSITAALF  442

Query  1866  MK  1871
             +K
Sbjct  443   LK  444



>ref|WP_011319481.1| aminopeptidase A [Anabaena variabilis]
 ref|YP_323235.1| leucyl aminopeptidase [Anabaena variabilis ATCC 29413]
 sp|Q3M9J6.1|AMPA_ANAVT RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Anabaena variabilis ATCC 29413]
 gb|ABA22340.1| leucyl aminopeptidase, Metallo peptidase, MEROPS family M17 [Anabaena 
variabilis ATCC 29413]
Length=491

 Score =   259 bits (662),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 190/428 (44%), Positives = 245/428 (57%), Gaps = 58/428 (14%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             LLEW GD LA+ + E D V+          L  LD K  G+L E  +EE+F+GK+  ++ 
Sbjct  10    LLEWAGDTLAIALFE-DAVELTGE------LASLDEKFAGILKELIAEEEFTGKANSTVF  62

Query  530   LRLPA-LGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV--  700
              R+ A +  ++I LVGLG   +  I      +T+  AA +              GLS   
Sbjct  63    TRVSANIPVRKIILVGLGKTEAFNI------DTLRRAAAAVGKVGKKQKSKVI-GLSFPL  115

Query  701   --ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEV  868
                   +++ A+A G+    ++DNRFK +P  K   +++VE+LG       E  +  +  
Sbjct  116   WNNDPTASSQAIAEGVQLALYQDNRFKSDPDDKGSQVETVELLGFAGQ---EAAINRANQ  172

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             + SGVI  ++LV APAN +TP  +AE A+ IA  Y   L   IL+ E C++L MG+FLGV
Sbjct  173   IVSGVILARQLVAAPANSVTPITMAETAQQIAQDYG--LQIEILEQEDCEKLGMGAFLGV  230

Query  1049  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1228
             A A+  P  FIHL YKP S + K KLA++GKG+TFDSGG N+K GA S IE MK DM GA
Sbjct  231   ALASDLPPKFIHLTYKPES-TPKRKLAIVGKGLTFDSGGLNIK-GAGSGIETMKIDMGGA  288

Query  1229  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLR  1408
             A   GAAKAIAQIKP  VEVHFI    ENMISG  M PGDILTASNGK IE         
Sbjct  289   AATLGAAKAIAQIKP-NVEVHFISAVTENMISGKAMHPGDILTASNGKTIE---------  338

Query  1409  CLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1588
                                 V +TDAEGRL LADALVY  KLG++ +VDLATLTGA + A
Sbjct  339   --------------------VNNTDAEGRLTLADALVYTDKLGLDAIVDLATLTGANVIA  378

Query  1589  LGRSVAGM  1612
             LG  +AG+
Sbjct  379   LGDDIAGL  386


 Score = 73.9 bits (180),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G++TP + LA ++ +AA   GEK+WRMPLEE Y+E +KS IADM N G   G +ITA+LF
Sbjct  385   GLYTPDDALAGQLEQAASESGEKIWRMPLEEKYFEGLKSGIADMKNTGPRPGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_011431320.1| aminopeptidase A [Synechococcus sp. JA-3-3Ab]
 ref|YP_475910.1| leucyl aminopeptidase [Synechococcus sp. JA-3-3Ab]
 sp|Q2JRU4.1|AMPA_SYNJA RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Synechococcus sp. JA-3-3Ab]
 gb|ABD00647.1| peptidase, M17 (leucyl aminopeptidase) family [Synechococcus 
sp. JA-3-3Ab]
Length=510

 Score =   251 bits (640),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 177/397 (45%), Positives = 227/397 (57%), Gaps = 46/397 (12%)
 Frame = +2

Query  449   LDSKL-GGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIAYRTLGET  625
             LD K+  GL++EA+ E+ F GK   S+ LRLP    +++ LVGLG   + T+        
Sbjct  39    LDEKVWSGLVAEAAQEQKFQGKPNSSLALRLPG-PIRKLVLVGLGDPAALTLEALRRATA  97

Query  626   IaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLK-  802
                    +  +   V      GL    ++ A  A+A   +    +DNRFK  PK    + 
Sbjct  98    NGLRQAHSLKAKQVVLSLPDTGLD---QVRAVQAVAEASLLVAHQDNRFKSPPKPEEERG  154

Query  803   -SVE-----ILGLGTG-PEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNI  961
              SVE     + GL     + E  L+ +  +++G I  +ELV APANV+TP ALAE A+ +
Sbjct  155   FSVEEVTLLVPGLAQARQDYENALQRATEMAAGTILARELVAAPANVVTPPALAETARQL  214

Query  962   ASLYSDVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGK  1141
             A  Y   L   IL  E+C+ L MG+FLGVA A+  P  FIHL YKP  G    KLAL+GK
Sbjct  215   AQDYG--LEVEILGREECQALGMGAFLGVAQASDLPPQFIHLTYKPKEGDPVAKLALVGK  272

Query  1142  GITFDSGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMI  1321
             G+TFDSGG N+K  +  SI +MK DM GAA V GAA+A+A +KP  VEVHFIV A ENMI
Sbjct  273   GLTFDSGGLNIKTDSR-SIAMMKTDMGGAAAVLGAARALAALKPQ-VEVHFIVAATENMI  330

Query  1322  SGTGMRPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLI  1501
             SG  + PGDILTASNGK IE                             V +TDAEGRL 
Sbjct  331   SGRALHPGDILTASNGKTIE-----------------------------VNNTDAEGRLT  361

Query  1502  LADALVYASKLGVEKMVDLATLTGACITALGRSVAGM  1612
             LADALV+A KLGV+ +VDLATLTGAC+ ALG  +AG+
Sbjct  362   LADALVFAEKLGVDAIVDLATLTGACVIALGEEIAGL  398


 Score = 82.4 bits (202),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP E LA+E+ +AA++ GEK+WR+PLEESY+E + S++ADM N G   G +ITA+LF
Sbjct  397   GLFTPDEKLAQELQQAANLSGEKIWRLPLEESYFEGLSSTVADMKNTGPRSGGSITAALF  456

Query  1866  MK  1871
             +K
Sbjct  457   LK  458



>ref|WP_015124149.1| leucyl aminopeptidase [Synechococcus sp. PCC 6312]
 ref|YP_007061148.1| leucyl aminopeptidase [Synechococcus sp. PCC 6312]
 gb|AFY60605.1| leucyl aminopeptidase [Synechococcus sp. PCC 6312]
Length=492

 Score =   265 bits (676),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 191/437 (44%), Positives = 253/437 (58%), Gaps = 57/437 (13%)
 Frame = +2

Query  323   ISFAAKEVDLLEWKGDILAVGV-TEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEED  499
             ++  A    +L W GD++A G  TE D V           L +L     G+L E   +  
Sbjct  1     MNIQAPTTAVLNWSGDLIAFGFFTESDAV------VWPAELAELPQAWDGILPELIHDAK  54

Query  500   FSGKSGQSIVLRL-PALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvaval  676
             F GK+G S+ +RL P    K+I LVGLG+    T+      ET+  AA +   S+     
Sbjct  55    FQGKAGTSLTVRLSPKSPVKKIMLVGLGAASDFTL------ETLRRAAATVVKSARKDHD  108

Query  677   asaEGLSVE-SKLSAASAMATGIVSGTFEDNRFKLEPKTPT----LKSVEILGLGTGPEI  841
              +  GL V         A+A GI  G  +D RFK +P+        +S+++LG G    +
Sbjct  109   KTV-GLYVPIYDNDPTQALAEGIHLGLHQDLRFKSDPEAKENLAFPESIDLLGPGV---V  164

Query  842   EKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKE  1021
             ++ L  + + + GVI  +ELVNAPANV+TP  LAE+A+ IAS Y   L + IL+   C+ 
Sbjct  165   QEALPIAAIRAEGVILARELVNAPANVITPVTLAEKAQAIASTYG--LESEILEQADCEA  222

Query  1022  LKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIE  1201
             L MG++LGVA A+  P  FIHL Y+P  G+   KLA++GKG+TFDSGG NLK+ + S IE
Sbjct  223   LGMGAYLGVAQASDLPPKFIHLTYRPQ-GTATRKLAIIGKGLTFDSGGLNLKV-SGSGIE  280

Query  1202  LMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIE  1381
              MK DMAG+A V GAA+ IAQ+KP+  EVHFIV A ENMISG  M PGDILTA+NGK IE
Sbjct  281   TMKMDMAGSAAVLGAAQVIAQLKPS-AEVHFIVAATENMISGKAMHPGDILTAANGKTIE  339

Query  1382  VTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLA  1561
                                          + +TDAEGRL LADAL++A KLGV+ +VDLA
Sbjct  340   -----------------------------INNTDAEGRLTLADALIFAEKLGVDAIVDLA  370

Query  1562  TLTGACITALGRSVAGM  1612
             TLTGACI ALG S+AG+
Sbjct  371   TLTGACIVALGESIAGL  387


 Score = 68.6 bits (166),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G++   + LA  +L AA+  GEK W+MP+EE Y+E MKS IADM N G   G +ITA+LF
Sbjct  386   GLWATDQPLADHLLTAANQAGEKFWQMPMEEKYFEGMKSPIADMKNTGPRAGGSITAALF  445

Query  1866  MK  1871
             +K
Sbjct  446   LK  447



>ref|WP_010469501.1| aminopeptidase A [Acaryochloris sp. CCMEE 5410]
Length=492

 Score =   258 bits (659),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 191/425 (45%), Positives = 246/425 (58%), Gaps = 56/425 (13%)
 Frame = +2

Query  359   WKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLRL  538
             W GD L +G  E     D         L +LDS L  +L +  SE +F GK G+    R+
Sbjct  13    WSGDYLGIGFFEDSAAIDAG-------LTQLDSSLRDILQDLVSETEFQGKVGEQPWTRI  65

Query  539   PALG-FKRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEGLSVESKL  712
               LG  +++ L+GLGS  + T+ + R      A AA+  +A+S  + L     L  +   
Sbjct  66    AGLGSIRKVMLIGLGSQEAFTLDSLRQAAAAFAKAAQKQKAASAGLQLP----LWHDDAP  121

Query  713   SAASAMATGIVSGTFEDNRFKLEP--KTPT--LKSVEILGLGT-GPEIEKKLKYSEVVSS  877
             ++  AMA G+     +D RFK +P  K P    + V +LGL      IEK    ++ + +
Sbjct  122   ASTQAMAEGVELALHQDIRFKSDPDAKKPGEFPQEVHVLGLANQAAAIEK----AQQICA  177

Query  878   GVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAA  1057
             GVI  +ELV APANV+TP ALAE A  IA  +   LT  +L+ E+C+   MG+FLGV+ A
Sbjct  178   GVILTRELVAAPANVVTPSALAETAAQIAEDHG--LTLEVLEREECEAQGMGAFLGVSLA  235

Query  1058  ATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavv  1237
             +  P  FIHL YKPS G+ + KLA++GKG+TFDSGG NLK+G  S IE MK DMAG+   
Sbjct  236   SELPPKFIHLTYKPS-GTPRRKLAIVGKGVTFDSGGLNLKVGG-SGIETMKMDMAGSGAT  293

Query  1238  fgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLS  1417
              GAAKAI Q+KP  VEVHFIV A ENMISG  + PGDILTASNGK IE            
Sbjct  294   LGAAKAIGQLKP-DVEVHFIVAAAENMISGHALHPGDILTASNGKTIE------------  340

Query  1418  RSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGR  1597
                              + +TDAEGRL LADALV+A K GV+ +VDLATLTGACI ALG 
Sbjct  341   -----------------INNTDAEGRLTLADALVFAEKQGVDAIVDLATLTGACIVALGN  383

Query  1598  SVAGM  1612
              +AGM
Sbjct  384   DIAGM  388


 Score = 74.7 bits (182),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G++TP + LA+E+ +A++  GEK WRMPLEE Y+E +KS IADM N G   G +ITA+LF
Sbjct  387   GMWTPEDSLAEELNQASEQAGEKFWRMPLEEKYFEGLKSPIADMKNTGPRPGGSITAALF  446

Query  1866  MK  1871
             +K
Sbjct  447   LK  448



>ref|WP_017321976.1| aminopeptidase A [cyanobacterium PCC 7702]
Length=492

 Score =   259 bits (661),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 186/425 (44%), Positives = 242/425 (57%), Gaps = 54/425 (13%)
 Frame = +2

Query  356   EWKGDILAVGVTEK--DMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             EW GD LA+G+ E   D+  +         L +LD+KL G L E  +EE+F GK+G S V
Sbjct  12    EWTGDGLAIGLFEDAVDLTGE---------LAELDTKLAGNLKELIAEEEFKGKTGSSAV  62

Query  530   LRLPALG--FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVE  703
              R+       +++ LVGLG   +  +         AA     Q    A        +   
Sbjct  63    TRIATNNSLVRKVMLVGLGKAEALKLDTLRRAAATAARLAKKQKCKTAGIFLP---IWNH  119

Query  704   SKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVVSS  877
             +    A A+A G+  G ++D+RFK EP  K P ++ +++LGLG     E  +  +  + S
Sbjct  120   APAQTAQALAEGVQLGLYQDHRFKSEPEDKGPQVERIDLLGLGGQ---EAAVNRANQIIS  176

Query  878   GVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAA  1057
             GV   ++LV APAN +TP  +AE A  IAS +   L   IL+ E C++L MG+FLGVA  
Sbjct  177   GVTLARQLVAAPANEVTPITMAETAMAIASEHK--LQVEILEQEDCEKLGMGAFLGVAKG  234

Query  1058  ATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavv  1237
             +  P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K+ A S IE MK DM GAA +
Sbjct  235   SDLPPKFIHLTYKP-EGTPKRKLAVIGKGLTFDSGGLNIKV-AGSGIENMKIDMGGAAAI  292

Query  1238  fgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLS  1417
              GAAKAIAQ++P  VEVHFI    ENMISG  M PGDIL ASNGK IE            
Sbjct  293   LGAAKAIAQLQPEDVEVHFISAVTENMISGHAMHPGDILKASNGKTIE------------  340

Query  1418  RSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGR  1597
                              V +TDAEGRL LADALV+A KLGV+ +VDLATLTGAC+ ALG 
Sbjct  341   -----------------VNNTDAEGRLTLADALVFAEKLGVDAIVDLATLTGACVIALGD  383

Query  1598  SVAGM  1612
              +AG+
Sbjct  384   DIAGL  388


 Score = 73.9 bits (180),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP + LA+++  AA+  GEK+WRMP+EE Y+E +KS+IADM N G     +ITA+LF
Sbjct  387   GLFTPDDTLAQQLEAAAESTGEKIWRMPMEEKYFEGLKSNIADMKNTGPRAAGSITAALF  446

Query  1866  MK  1871
             +K
Sbjct  447   LK  448



>dbj|BAP18524.1| leucyl aminopeptidase [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=491

 Score =   267 bits (682),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 193/440 (44%), Positives = 240/440 (55%), Gaps = 65/440 (15%)
 Frame = +2

Query  341   EVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQ  520
             E  LL W GD LA+G  E  M   E        LQKLD KL   L E  +E +F GKS  
Sbjct  7     ETPLLNWTGDALALGFFEDSMELTET-------LQKLDEKLNRNLRELITETEFEGKSSN  59

Query  521   SIVLRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLS  697
             ++V R+ +    ++I LVGLG     T+    LG    A                  G++
Sbjct  60    NVVTRIGSGSPVQKIILVGLGKTEDLTLDTVRLGAATIARLAKQAKVKTL-------GIN  112

Query  698   V----ESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLK--SVEILGLGTGPEIEKKLKY  859
             +    +   S  SA+  G++    +DNRFK EP    LK   VEILG G   E  + +  
Sbjct  113   LPVVNDDAASTVSAITQGVILPLHQDNRFKSEPDKNELKLEKVEILGCG---EHREAINK  169

Query  860   SEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSF  1039
             ++ + SGVI  +ELV APAN +TP   AE A+ IA  +   L   IL+ ++C+ L MG+F
Sbjct  170   AQTLCSGVILARELVAAPANSVTPVTFAEIAQTIAQDHG--LDIEILERKECQNLGMGAF  227

Query  1040  LGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDM  1219
             LGVA A+  P  FIH+ YKPS    K KLA++GK +TFDSGG NLK G+ S IE MK DM
Sbjct  228   LGVAQASDLPPKFIHITYKPSETPQK-KLAIVGKSLTFDSGGLNLK-GSQSGIETMKMDM  285

Query  1220  agaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAAL  1399
              G A   GAAK I Q+KP  VEVHFI    ENMISG  M PGDILTASNGK IE      
Sbjct  286   GGGAATLGAAKVIGQLKP-DVEVHFICAVTENMISGRAMHPGDILTASNGKTIE------  338

Query  1400  VLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGAC  1579
                                    V +TDAEGRL LADALV+A KLGV+ +VDLATLTGAC
Sbjct  339   -----------------------VNNTDAEGRLTLADALVFAEKLGVDAIVDLATLTGAC  375

Query  1580  ITALGRSVAGMPL*IMYLWS  1639
             + ALG +++G       LWS
Sbjct  376   VVALGDNISG-------LWS  388


 Score = 65.9 bits (159),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E LA ++ +A  + GEK+W MPLEE Y+E +KS IAD+ N G   G AITA+LF
Sbjct  385   GLWSTDETLATQIKKAGAMAGEKVWEMPLEEKYFEGLKSPIADIKNTGPRAGGAITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_015191783.1| cytosol aminopeptidase [Stanieria cyanosphaera]
 ref|YP_007131076.1| cytosol aminopeptidase [Stanieria cyanosphaera PCC 7437]
 gb|AFZ34110.1| cytosol aminopeptidase [Stanieria cyanosphaera PCC 7437]
Length=490

 Score =   261 bits (666),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 192/443 (43%), Positives = 252/443 (57%), Gaps = 68/443 (15%)
 Frame = +2

Query  335   AKEVDLLEWKGDILAVGVTE-KDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGK  511
             A +  LL+W GD LA+G+ E +  +  E        L +L+ +L G + E  + E+F GK
Sbjct  5     ATDRSLLDWTGDTLAIGIFEGQTELTGE--------LAQLNEQLAGTIQELIAVEEFEGK  56

Query  512   SGQSIVLRLPALG---FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalas  682
             SG + V RL  +G    +++ LVGLG   S          T A   + A+          
Sbjct  57    SGTTAVTRL--MGNSSLRKLILVGLGK--SDKFKLENYQNTAATVVRLAKKDHSLAISFP  112

Query  683   aEGLSVESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLK  856
              +G    S  + A  M  GI+    +DNRFK EP  K   L+++++LGL      +  +K
Sbjct  113   IQG----SPDAVAQTMTEGILLALHQDNRFKSEPEEKEIKLETIDLLGLNGQ---DAAIK  165

Query  857   YSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELK--M  1030
              +E+V+SGVI  +ELVNAPAN +TP  +A  A+ IAS Y   L+  IL+ E C++ +  M
Sbjct  166   RAEIVASGVILARELVNAPANEVTPLTMAATAEAIASEYG--LSLEILEQEDCEQFEQGM  223

Query  1031  GSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMK  1210
             G+FLGVA A+  P  FIHL YKP+  + K K+A++GK +TFDSGG NLK+ + S IE MK
Sbjct  224   GAFLGVAKASDIPPKFIHLTYKPTE-TPKRKVAIVGKSLTFDSGGLNLKV-SGSGIETMK  281

Query  1211  KDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTY  1390
              DM G A   GAAKAIAQ+KP  VEVHFI  A ENMISG  M PGDIL A+NGK IE   
Sbjct  282   MDMGGGAATLGAAKAIAQLKP-NVEVHFICAATENMISGRAMHPGDILKAANGKTIE---  337

Query  1391  AALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLT  1570
                                       V +TDAEGRL LADAL+YA KLG++ +VDLATLT
Sbjct  338   --------------------------VNNTDAEGRLTLADALIYAEKLGLDAIVDLATLT  371

Query  1571  GACITALGRSVAGMPL*IMYLWS  1639
             GACI ALG  +AG       LWS
Sbjct  372   GACIIALGDQIAG-------LWS  387


 Score = 71.6 bits (174),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  +DLA ++  AA++ GEK W+MPLEE Y++ MKS+IADM N G   G +ITA+LF
Sbjct  384   GLWSTDDDLANQIKTAAELAGEKFWQMPLEEPYFDGMKSAIADMKNTGPRAGGSITAALF  443

Query  1866  MK  1871
             +K
Sbjct  444   LK  445



>ref|WP_028091351.1| aminopeptidase A [Dolichospermum circinale]
Length=490

 Score =   261 bits (668),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 184/424 (43%), Positives = 244/424 (58%), Gaps = 50/424 (12%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             LL+W GD LA+G+ E D V+          L  LD KL G+ +E  +EE+F+GK   +I 
Sbjct  10    LLDWTGDTLAIGLFE-DAVQLTGD------LATLDQKLAGIFTELIAEEEFTGKVNSTIF  62

Query  530   LRLPALGF-KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVES  706
              R+ A    +++ LVGLG      +   TL   +AA             L  +  L    
Sbjct  63    TRVGAGNLVRKVILVGLGK--PEALQLETL-RRVAATVARTAKKQKTKTLGISLPLWNND  119

Query  707   KLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVVSSG  880
               + A A+  GI    ++D RFK EP  K+P ++++++LGL      +  +  ++ + SG
Sbjct  120   PAATAQAITEGIELALYQDIRFKSEPEDKSPNIETIDLLGLAGQ---QAAITRADQIVSG  176

Query  881   VIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAA  1060
             VI  ++LV APAN +TP  +AE A  IA  Y   L   +L+  +C++L MG+FLGVA A+
Sbjct  177   VILARQLVAAPANAVTPITMAETAGAIAQEYG--LQLEVLEQAECEKLGMGAFLGVAQAS  234

Query  1061  TNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvf  1240
               P  FIHL YKP++ + + KLA++GKG+TFDSGG N+K GA S IE MK DM GAA   
Sbjct  235   ELPPKFIHLIYKPAT-TPRRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGGAAATL  292

Query  1241  gaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSR  1420
             GAAK I Q+KP  VEVHFI    ENMISG  M PGDILTASNGK IE             
Sbjct  293   GAAKVIGQLKP-DVEVHFISAVTENMISGKAMHPGDILTASNGKTIE-------------  338

Query  1421  SDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1600
                             V +TDAEGRL LADALVYA KLGV+ ++DLATLTGAC+ ALG  
Sbjct  339   ----------------VNNTDAEGRLTLADALVYADKLGVDAILDLATLTGACVVALGED  382

Query  1601  VAGM  1612
             +AG+
Sbjct  383   IAGL  386


 Score = 70.9 bits (172),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP + +A ++  AA+  GEK+WR+P+E+ Y++ +KS IADM N G   G +ITA+LF
Sbjct  385   GLFTPDDAMASQLQTAAETAGEKIWRLPMEDKYFDGLKSGIADMKNTGPRYGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_026099711.1| aminopeptidase A [Prochlorothrix hollandica]
Length=491

 Score =   260 bits (664),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 186/436 (43%), Positives = 248/436 (57%), Gaps = 55/436 (13%)
 Frame = +2

Query  323   ISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDF  502
             + F    +  L+W+G  LA+GV+  D+  D +       LQ LD  L GL+SE   + DF
Sbjct  1     MDFTTSTLGALDWQGHGLAIGVSSADLNPDGSLGES---LQPLDQSLDGLVSELVKDVDF  57

Query  503   SGKSGQSIVLRLPALGFKRIGLVGLG-SVVSSTIAYRTLGETIaaaaksaqassvavala  679
             + K G S V R+     +++ LVGLG S + S    R    T    A   Q  ++     
Sbjct  58    TAKLGSSAVSRVRGAQIRKLILVGLGDSKIPSLDTLRQGAATAVRLAAQEQCETL-----  112

Query  680   saEGLSVESKLSAAS---AMATGIVSGTFEDNRF--KLEPKTPTLKSVEILGLGTGPEIE  844
                GL +   ++AA+   A+  G +   + D+RF  K+EP  P+L  V +LGLG   + +
Sbjct  113   ---GLQMPPGVTAAATVQALCEGGILALYRDDRFRSKIEP-IPSLSQVTVLGLG---DHQ  165

Query  845   KKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKEL  1024
               +  ++ +  GVIF ++ V APAN L P  LA   + +A      L   IL+ + C  L
Sbjct  166   AAIATAQQICEGVIFARQWVAAPANSLNPVTLAAAVEELAQTQG--LELRILERDDCAAL  223

Query  1025  KMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIEL  1204
              MG+FLGVA A+  P  F+HL YKP  G+ + K+A++GKG+TFDSGG NLK+G NSSIE+
Sbjct  224   GMGAFLGVAQASDLPPKFLHLIYKPE-GTPRRKVAIVGKGLTFDSGGLNLKVG-NSSIEM  281

Query  1205  MKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEV  1384
             MK DM GA   FGAAKAIA +KP  VEVHFI    ENM+SG  MRPGD+LTASNGK IE 
Sbjct  282   MKTDMGGAGATFGAAKAIALLKP-DVEVHFISAVTENMVSGRAMRPGDVLTASNGKTIE-  339

Query  1385  TYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLAT  1564
                                         V +TDAEGRL LADALVYA  LG++ +VDLAT
Sbjct  340   ----------------------------VNNTDAEGRLTLADALVYADGLGLDAIVDLAT  371

Query  1565  LTGACITALGRSVAGM  1612
             LTGAC+ ALG S+AG+
Sbjct  372   LTGACVVALGESIAGL  387


 Score = 72.4 bits (176),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  + LA ++L A+D  GEKLWRMPLE  Y+E+MKS +ADM N GS  G +ITA+LF
Sbjct  386   GLWSSDDTLAAQLLAASDKSGEKLWRMPLEPPYFESMKSVVADMKNTGSRAGGSITATLF  445

Query  1866  MK  1871
             ++
Sbjct  446   LQ  447



>ref|WP_009457386.1| MULTISPECIES: aminopeptidase A [Fischerella]
 gb|EHC12054.1| cytosol aminopeptidase [Fischerella sp. JSC-11]
Length=493

 Score =   252 bits (643),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 193/426 (45%), Positives = 244/426 (57%), Gaps = 54/426 (13%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             +LEW GD LAVG+ E      +N++     L  L+ K  G + E  +EE+F GK G +  
Sbjct  10    ILEWTGDGLAVGLFE------DNTELTGE-LATLNEKFAGYIKELIAEEEFKGKVGSTAF  62

Query  530   LRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVES  706
              RL +    ++I LVGLG   +  +   TL    AA A+ A+         S   L V +
Sbjct  63    TRLGSSSPVRKIILVGLGK--ADALKLDTLRRAAAAIARQAKKQKCKTLAIS---LPVWN  117

Query  707   KLSA--ASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVVS  874
                A  A A+A G+    ++DNRFK EP  K P ++ VE+LGL      E  +  +  + 
Sbjct  118   NDPAQTAQALAEGVQLALYQDNRFKSEPEDKGPQVEIVELLGLNGQ---EAAIARANQIC  174

Query  875   SGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAA  1054
             SGVI  ++LV APAN +TP  +AE A  IAS     +   IL+ E C++L MG+FLGVA 
Sbjct  175   SGVILARQLVAAPANEVTPITMAETAMAIASEAG--MHIEILEREDCEKLGMGAFLGVAK  232

Query  1055  AATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaav  1234
             A+  P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K G  S IE MK DM GAA 
Sbjct  233   ASDLPPKFIHLTYKPE-GTPKRKLAIIGKGLTFDSGGLNIK-GPGSGIENMKIDMGGAAA  290

Query  1235  vfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCL  1414
              FGAAK I Q+KP  VEVHFI    ENMISG  M PGDIL ASNGK IE           
Sbjct  291   TFGAAKVIGQLKP-DVEVHFISAVTENMISGHAMHPGDILKASNGKTIE-----------  338

Query  1415  SRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALG  1594
                               V +TDAEGRL LADALV+A KLGV+ +VDLATLTGAC+ ALG
Sbjct  339   ------------------VNNTDAEGRLTLADALVFADKLGVDAIVDLATLTGACVIALG  380

Query  1595  RSVAGM  1612
               +AG+
Sbjct  381   DDIAGL  386


 Score = 80.1 bits (196),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP + LAKE+  AAD  GEK+WR+P+EE Y+E MKS IADM N G   G +ITA+LF
Sbjct  385   GLFTPDDALAKELETAADSAGEKIWRLPMEEKYFEGMKSGIADMKNTGPRPGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_006197752.1| aminopeptidase A [Nodularia spumigena]
 gb|EAW44110.1| leucyl aminopeptidase [Nodularia spumigena CCY9414]
 gb|AHJ29248.1| Cytosol aminopeptidase PepA [Nodularia spumigena CCY9414]
Length=491

 Score =   256 bits (655),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 196/428 (46%), Positives = 247/428 (58%), Gaps = 58/428 (14%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             LLE  GD LA+G+ E D V+          L KLD + GG+L E  +EE+F+ K+  SI 
Sbjct  10    LLELSGDTLAIGLFE-DAVELTGE------LAKLDEQFGGVLKELIAEEEFTAKAYSSIF  62

Query  530   LRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV--  700
              R+ A    ++I LVGLG      +   TL    AA A+ A+            GLS+  
Sbjct  63    TRVSAGSPIRKIILVGLGK--PDALKLETLRRAAAAVARVAKKQKSKNL-----GLSLPL  115

Query  701   --ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEV  868
                     A A+A G+    ++D RFK EP  K   +++V++LGL      E  +  +  
Sbjct  116   CDNKPAETAQAIAEGLQLALYQDIRFKSEPEDKGAKIETVDLLGLAGQ---EAAITRANH  172

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             + SGV   +ELV APAN +TP  LAE A+ IA+ +   +   IL+ E C++L MG+FLGV
Sbjct  173   IVSGVNLARELVAAPANEVTPITLAETAQAIATEHG--IEIQILEREDCEKLGMGAFLGV  230

Query  1049  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1228
             A A+  P  FIHL YKP+ G+ + KLA++GKG+TFDSGG N+K GA S IE MK DM GA
Sbjct  231   AQASDLPPKFIHLTYKPA-GTPRRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKMDMGGA  288

Query  1229  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLR  1408
                 GAAKAIAQIKP  VEVHFI  A ENMISG  M PGDIL ASNGK IE         
Sbjct  289   GTTLGAAKAIAQIKP-DVEVHFISAATENMISGHAMHPGDILKASNGKTIE---------  338

Query  1409  CLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1588
                                 V +TDAEGRL LADALVYA KLGV+ +VDLATLTGACI A
Sbjct  339   --------------------VNNTDAEGRLTLADALVYADKLGVDAIVDLATLTGACIVA  378

Query  1589  LGRSVAGM  1612
             LG  +AG+
Sbjct  379   LGDDIAGL  386


 Score = 74.3 bits (181),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP + +A ++ +AA   GEKLWR+P+EE Y+E +KS IADM N G   G +ITA+LF
Sbjct  385   GLFTPDDAVAAQLEQAAQSAGEKLWRLPMEEKYFEGLKSGIADMKNTGPRAGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_009631961.1| leucyl aminopeptidase [Synechocystis sp. PCC 7509]
Length=490

 Score =   258 bits (660),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 186/434 (43%), Positives = 253/434 (58%), Gaps = 60/434 (14%)
 Frame = +2

Query  335   AKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKS  514
             A +  LL+W GD +A+G+ E  + + E        L +LD+K  G+L E  +E +F GK 
Sbjct  5     AVDTPLLDWAGDAIALGLFEDTLEQSEE-------LTQLDAKFAGVLKEVIAETEFKGKD  57

Query  515   GQSIVLRLP-ALGFKRIGLVGLGSVVSSTIA-YRTLGETIaaaaksaqassvavalasaE  688
             G S+V R+  +   +++ LVGLG      +  +R     IA  AK  +  +V        
Sbjct  58    GSSVVTRVGGSSSVRKVLLVGLGKPDKLKLDNWRRCAAAIAKLAKKEKCQTV--------  109

Query  689   GLSV----ESKLSAASAMATGIVSGTFEDNRFKLEPKTPT--LKSVEILGLGTGPEIEKK  850
             G+S+        + A A++ GI     +D RFK EP+  +  L+ V+++G       E  
Sbjct  110   GISLPIWNNEPGATAGAISEGIELALHQDRRFKSEPEENSFNLERVDLIGFSGQ---ENA  166

Query  851   LKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKM  1030
             +  ++ + SGVI  ++LV APAN +TP ++A+ A+ IAS +   L   IL+ E+C++L M
Sbjct  167   ISRAQQICSGVILARQLVTAPANTVTPMSMAQTAEEIASTHG--LQVEILEREECEQLGM  224

Query  1031  GSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMK  1210
             G+FLGVA A+  P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K GA S IE MK
Sbjct  225   GAFLGVAQASEMPPKFIHLTYKPE-GTPKRKLAIIGKGVTFDSGGLNIK-GAGSGIETMK  282

Query  1211  KDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTY  1390
              DM GAA   GAAKAI+Q+KP  VEVHFI    ENMISG  + PGDILTASNGK IE   
Sbjct  283   MDMGGAAATLGAAKAISQLKP-DVEVHFISAVTENMISGRAIHPGDILTASNGKTIE---  338

Query  1391  AALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLT  1570
                                       V +TDAEGRL LADALV+  KLGV+ +VDLATLT
Sbjct  339   --------------------------VNNTDAEGRLTLADALVFTEKLGVDAIVDLATLT  372

Query  1571  GACITALGRSVAGM  1612
             GAC+ ALG  +AG+
Sbjct  373   GACVIALGDDIAGL  386


 Score = 72.4 bits (176),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  ++LA ++++ AD  GEK+WRMP+EE Y+E +KSSIADM N G   G +ITA+LF
Sbjct  385   GLWSSDDELANQLVQGADKAGEKIWRMPMEEKYFEGLKSSIADMKNTGPRPGGSITAALF  444

Query  1866  MK  1871
             ++
Sbjct  445   LQ  446



>ref|WP_009784389.1| aminopeptidase A [Lyngbya sp. PCC 8106]
 gb|EAW37149.1| leucyl aminopeptidase [Lyngbya sp. PCC 8106]
Length=489

 Score =   260 bits (664),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 194/443 (44%), Positives = 252/443 (57%), Gaps = 60/443 (14%)
 Frame = +2

Query  323   ISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDF  502
             + F   +   ++W GD LAVG+ E ++  D + +     L +LD KL G L E   E +F
Sbjct  1     MEFRVIDTPRIDWTGDALAVGIFEHEV--DLSGE-----LAQLDEKLAGTLKELIEETEF  53

Query  503   SGKSGQSIVLRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  679
              GK   S   R+ +    +++ LVGLGS  S  ++  TL   +AAA     A ++     
Sbjct  54    DGKPNSSASTRVGSNSPIRKVILVGLGS--SENLSLDTL--RLAAATAGRLAKTIKCKTL  109

Query  680   saEGLSVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGL-GTGPEIEKK  850
             +      E+      A+  G+    ++DNRFK   E K P ++ VE+LGL GT    E+ 
Sbjct  110   ALSLPVYETPDQTTQALVEGVELALYQDNRFKSETEDKGPAIERVELLGLAGT----EEA  165

Query  851   LKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKM  1030
             +  ++ + SGV   +ELV APAN + P  +AE A+ +A+ Y       IL+ E C++L M
Sbjct  166   IIRAQNICSGVFLARELVAAPANEINPITMAEMAEALATEYG--FDIEILEKEDCEKLGM  223

Query  1031  GSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMK  1210
             G+FLGVA A+  P  FIHL YKPS G+ K KLA++GKG+TFDSGG NLK+GA SSIE+MK
Sbjct  224   GAFLGVAQASDMPPKFIHLTYKPS-GTPKRKLAIIGKGLTFDSGGLNLKVGA-SSIEMMK  281

Query  1211  KDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTY  1390
              DM GA   FGAAKAI  +KP  VEVHFI    ENMISG  M PGD LTASNGK IE   
Sbjct  282   TDMGGAGATFGAAKAIGLLKP-DVEVHFISAVTENMISGRAMHPGDFLTASNGKTIE---  337

Query  1391  AALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLT  1570
                                       V +TDAEGRL LADALV+  KLGV+ MVDLATLT
Sbjct  338   --------------------------VNNTDAEGRLTLADALVFTDKLGVDAMVDLATLT  371

Query  1571  GACITALGRSVAGMPL*IMYLWS  1639
             GAC+ ALG  +AG       LWS
Sbjct  372   GACVVALGNDIAG-------LWS  387


 Score = 70.5 bits (171),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++P++DLA ++  A+   GEKLWRMP+EE Y+E +K+  ADM N G   G AITA+LF
Sbjct  384   GLWSPNDDLASQLETASKSTGEKLWRMPIEEKYFEGLKAVHADMKNTGPRQGGAITATLF  443

Query  1866  MK  1871
             +K
Sbjct  444   LK  445



>ref|WP_017312999.1| aminopeptidase A [Fischerella sp. PCC 9339]
Length=493

 Score =   254 bits (650),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 195/430 (45%), Positives = 244/430 (57%), Gaps = 62/430 (14%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEK--DMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQS  523
             L +W GD LAVG+ E   D+  +         L  LD K  G + E  +EE+F GK G  
Sbjct  10    LTDWTGDGLAVGLFEDATDLTGE---------LATLDEKFAGYIKELIAEEEFKGKVGSI  60

Query  524   IVLRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV  700
              V RL +    +++ LVGLG      +   TL    AA A+ A+   +        G+S+
Sbjct  61    AVTRLASGSPVRKVILVGLGK--PDAVKLDTLRRAAAAIARQAKKQKIKTL-----GISL  113

Query  701   ----ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYS  862
                       A A+A G+    ++DNRFK EP  KTP L++VE+L L      E  +  +
Sbjct  114   PVWNNDPDQTAQALAEGVQLALYQDNRFKSEPEDKTPQLETVELLRLNGQ---EAAIARA  170

Query  863   EVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFL  1042
               +SSGVI  ++LV APAN +TP  +AE A  IAS     +   IL+ E C++L MG+FL
Sbjct  171   NKISSGVILARQLVAAPANEVTPITMAETATAIASETG--MHIEILEQEDCEKLGMGAFL  228

Query  1043  GVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMa  1222
             GVA A+  P  FIHL YKP  G+   KLA++GKG+TFDSGG N+K GA S IE MK DM 
Sbjct  229   GVAKASDLPPKFIHLTYKPD-GTPTRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMG  286

Query  1223  gaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALV  1402
             GAA  FGAAKAI Q+KP  VEVHFI    ENMISG  M PGDIL ASNGK IE       
Sbjct  287   GAAATFGAAKAIGQLKP-DVEVHFISAVTENMISGRAMHPGDILKASNGKTIE-------  338

Query  1403  LRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACI  1582
                                   V +TDAEGRL LADALV+A KLGV+ +VDLATLTGACI
Sbjct  339   ----------------------VNNTDAEGRLTLADALVFAEKLGVDAIVDLATLTGACI  376

Query  1583  TALGRSVAGM  1612
              ALG  +AG+
Sbjct  377   IALGDDIAGL  386


 Score = 75.5 bits (184),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP++ LA+E+  AA   GEK+WR+P+EE Y+E +KS IADM N G   G +ITA+LF
Sbjct  385   GLFTPNDTLAQELETAAQGAGEKIWRLPMEEKYFEGLKSGIADMKNTGPRPGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_017656226.1| aminopeptidase A [Microchaete sp. PCC 7126]
Length=493

 Score =   257 bits (657),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 198/428 (46%), Positives = 250/428 (58%), Gaps = 58/428 (14%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             LLEW GD LA+G+ E D V+          L  LD +L G+L E  +EE+F GK+  SI 
Sbjct  10    LLEWAGDTLAIGLFE-DAVELTGE------LATLDERLAGVLKELIAEEEFKGKANSSIF  62

Query  530   LRLPALGF-KRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSV--  700
              R+ A    K++ LVGLG   +  +   TL  T A  A+  +            GLS+  
Sbjct  63    TRVAAGSLIKKVILVGLGK--TEALKLDTLRRTAATVARVGKKLKSKTL-----GLSLPL  115

Query  701   --ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEV  868
                   +AA A+A GI    ++D RFK EP  K   L++V++LGL      E  +  ++ 
Sbjct  116   GNHQADAAAQAIAEGIQLALYQDIRFKSEPEDKGTQLETVDLLGLSGQ---EAAITRADQ  172

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             V SGVI  ++LV APAN +TP  LAE A+ IA+ +   L   IL+ E C++L MG+FLGV
Sbjct  173   VVSGVILARQLVAAPANEVTPITLAETAQAIANEHG--LQLEILEREDCEKLGMGAFLGV  230

Query  1049  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1228
             A A+  P  FIHL YKP +G+   KLA++GKG+TFDSGG N+K GA S IE MK DM GA
Sbjct  231   AQASDLPPKFIHLTYKP-NGTPTRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGGA  288

Query  1229  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLR  1408
             A   GAAKAIAQIKP   EVHFI  A ENMISG  M PGDIL ASNGK IE         
Sbjct  289   AATLGAAKAIAQIKP-DAEVHFISAATENMISGKAMHPGDILKASNGKTIE---------  338

Query  1409  CLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1588
                                 V +TDAEGRL LADALV+A KLG++ +VDLATLTGAC+ A
Sbjct  339   --------------------VNNTDAEGRLTLADALVFADKLGLDAIVDLATLTGACVVA  378

Query  1589  LGRSVAGM  1612
             LG  +AG+
Sbjct  379   LGEDMAGL  386


 Score = 72.8 bits (177),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP + +A ++ +AA   GEK+WRMP+EE Y+E +KS +ADM N G   G +ITA+LF
Sbjct  385   GLFTPDDAVASQLEKAAQSSGEKIWRMPMEEKYFEGLKSGLADMKNTGPRAGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_018397622.1| aminopeptidase A [filamentous cyanobacterium ESFC-1]
Length=485

 Score =   275 bits (702),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 193/429 (45%), Positives = 248/429 (58%), Gaps = 67/429 (16%)
 Frame = +2

Query  353   LEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVL  532
             L+W+G+ LA+GV E D                LD +LGG+L+E  +E +F GKSG S+V 
Sbjct  11    LKWEGETLALGVFEGDTE-----------CADLDKRLGGVLAEVMAEAEFEGKSGSSVVT  59

Query  533   RLPALG-FKRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEGLSV--  700
             R+ +    +++ LVGLG      +   R+   +I          +        +GL V  
Sbjct  60    RVGSSSPIRKVILVGLGKAEDWQLEGMRSAAASI----------ARLAKQNYVKGLGVCL  109

Query  701   ---ESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLK--SVEILGLGTGPEIEKKLKYSE  865
                ES  + ASA+A GI+     D RFK EP+   LK  +VEILG+    +    +  +E
Sbjct  110   PPLESDNATASAIAQGIILALHSDRRFKSEPEEQKLKLETVEILGINDAGD---AIAQAE  166

Query  866   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLG  1045
              +SSG I  +ELV APAN +TP  LAE A+ +A+ Y   L   IL+  +C++L MG++LG
Sbjct  167   ALSSGTILARELVAAPANSVTPITLAETAQQLAADYG--LELEILEKAECEKLGMGAYLG  224

Query  1046  VAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMag  1225
             VA A+  P  FIHL YKP S + + KLA++GKG+TFDSGG NLK G  S IE MK DM G
Sbjct  225   VAQASDLPPKFIHLTYKPQS-TPRRKLAIVGKGLTFDSGGLNLKTGG-SGIETMKMDMGG  282

Query  1226  aavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVL  1405
             A    GAAKAI QIKP  VEVHFIV A ENMISG  M PGDILTASNGK IE        
Sbjct  283   AGATLGAAKAIGQIKP-DVEVHFIVAATENMISGHAMHPGDILTASNGKTIE--------  333

Query  1406  RCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACIT  1585
                                  V +TDAEGRL LADALV+A KL V+ +VDLATLTGAC+ 
Sbjct  334   ---------------------VNNTDAEGRLTLADALVFAEKLEVDAIVDLATLTGACMV  372

Query  1586  ALGRSVAGM  1612
             ALG ++AG+
Sbjct  373   ALGNNIAGL  381


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 2/79 (3%)
 Frame = +3

Query  1641  IESLTEMYMIMGGK--LGIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIAD  1814
             + +LT   M+  G    G+++  + LA E+ +AA+  GEK W+MP+EE Y+E MKS  AD
Sbjct  363   LATLTGACMVALGNNIAGLWSTDDTLADELKKAAEAAGEKFWQMPIEEKYFEGMKSQYAD  422

Query  1815  MINAGSLDGDAITASLFMK  1871
             M N G   G +ITA+LF+K
Sbjct  423   MKNTGPRAGGSITATLFLK  441



>ref|WP_017658914.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=488

 Score =   252 bits (643),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 191/438 (44%), Positives = 245/438 (56%), Gaps = 62/438 (14%)
 Frame = +2

Query  323   ISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDF  502
             + F A    LL+W GD LA+G+ E       N+      L +LD KL G L E   E +F
Sbjct  1     MKFNAIATALLDWSGDALAIGLPE-------NAVELTGELAQLDEKLAGTLKELIEETEF  53

Query  503   SGKSGQSIVLRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  679
              GK   S V R+      +++ LVGLG        +R     +   AK  +  ++     
Sbjct  54    DGKRDNSAVTRVGGGSTVRKVILVGLGKA-DHLDDWRRCAAMMGRLAKQEKCKTL-----  107

Query  680   saEGLSV----ESKLSAASAMATGIVSGTFEDNRFKLE--PKTPTLKSVEILGL-GTGPE  838
                G+SV        S   ++  GI     +D RFK E   K   +++V++L L G    
Sbjct  108   ---GVSVPQWNNDPASTVRSLVEGIELALHQDTRFKSETDDKGAIVETVDLLELDGQDEA  164

Query  839   IEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCK  1018
             ++K LK    + SGV+  +ELV APANV+ P  LAE A+ +A+ Y   L   IL+ E C+
Sbjct  165   VDKSLK----ICSGVLLARELVAAPANVVNPITLAETAQAMANEYG--LELEILEKEDCE  218

Query  1019  ELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSI  1198
             +L MG+FLGVA A+  P  F+HL YKP  G+ + KLA++GKG+TFDSGG NLK G  S I
Sbjct  219   KLGMGAFLGVAQASALPPKFVHLAYKPE-GTPRKKLAIVGKGLTFDSGGLNLKTGG-SGI  276

Query  1199  ELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRI  1378
             E MK DM GA   FGAAKAIAQ+KP  VEVHFI    ENMISG  MRPGDILTASNGK I
Sbjct  277   ETMKIDMGGAGATFGAAKAIAQLKP-DVEVHFISAVTENMISGHAMRPGDILTASNGKTI  335

Query  1379  EVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDL  1558
             E                             V +TDAEGRL LADALV+A KLGV+ +VDL
Sbjct  336   E-----------------------------VNNTDAEGRLTLADALVFADKLGVDAIVDL  366

Query  1559  ATLTGACITALGRSVAGM  1612
             ATLTGAC+ ALG ++AG+
Sbjct  367   ATLTGACVVALGNTIAGL  384


 Score = 77.8 bits (190),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++P +++A  ++ A+DV GEKLWRMPLEE Y+E MKS  ADM NAGS  G AITA+LF
Sbjct  383   GLWSPDDEVANGLMAASDVAGEKLWRMPLEEPYFELMKSLHADMKNAGSRAGGAITAALF  442

Query  1866  MK  1871
             +K
Sbjct  443   LK  444



>ref|WP_007306122.1| aminopeptidase A [Crocosphaera watsonii]
 gb|EAM50183.1| Leucyl aminopeptidase [Crocosphaera watsonii WH 8501]
Length=489

 Score =   265 bits (678),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 188/433 (43%), Positives = 247/433 (57%), Gaps = 58/433 (13%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             LL+W GD +A+G+ E + +           L +LD K GG L+E   E +F GKSG S V
Sbjct  10    LLDWSGDAIALGLFEDETILTGE-------LSQLDEKTGGTLAELIEETEFKGKSGSSAV  62

Query  530   LRLPA-LGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVES  706
              R+      +++ L+GLG     ++    L     A     +               VE+
Sbjct  63    TRIGGGSAIRKLILIGLGKKDELSLDSLRLAAAAVARLGKKEKVKSLGINFPV----VEN  118

Query  707   KLSAASAMATGIVSGTFEDNRFKLEPKTPTLK--SVEILGLGTGPEIEKKLKYSEVVSSG  880
             + S  +A+A G++    +DNRFK EP+   LK  +V ILG+G   E    ++ ++ ++SG
Sbjct  119   EASTTTAIAEGMILSLHQDNRFKSEPEDKPLKLETVHILGVGAQSE---AVEQAQTITSG  175

Query  881   VIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAAA  1060
             VI  +ELV APAN + P   AE A+ +A+ Y   L   IL+ E+C++L MG+FLGVA A+
Sbjct  176   VILARELVAAPANSVNPVTFAETAQTLATDYG--LDIEILEQEECEKLGMGAFLGVAKAS  233

Query  1061  TNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavvf  1240
               P  FIHL YKP++ + K KLA++GK +TFDSGG NLK G+ S IE MK DM G A   
Sbjct  234   DLPPKFIHLTYKPAA-TPKRKLAIVGKSLTFDSGGLNLK-GSGSGIETMKMDMGGGAATL  291

Query  1241  gaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLSR  1420
             GAAKAIAQ+KP  VEVHF+  A ENMISG  M PGDILTASNGK IE             
Sbjct  292   GAAKAIAQLKP-DVEVHFVCAATENMISGRAMHPGDILTASNGKTIE-------------  337

Query  1421  SDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGRS  1600
                             V +TDAEGRL LADALVYA KL V+ +VDLATLTGAC+ ALG  
Sbjct  338   ----------------VNNTDAEGRLTLADALVYAEKLEVDAIVDLATLTGACLVALGND  381

Query  1601  VAGMPL*IMYLWS  1639
             ++G       LWS
Sbjct  382   ISG-------LWS  387


 Score = 63.9 bits (154),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E L +E+  A++  GEK W MP+EE Y+E +KS IADM N G   G +ITA+LF
Sbjct  384   GLWSTDETLTEELKTASETAGEKFWVMPMEEKYFEGLKSPIADMKNTGPRAGGSITAALF  443

Query  1866  MK  1871
             +K
Sbjct  444   LK  445



>ref|WP_015187371.1| leucyl aminopeptidase [Gloeocapsa sp. PCC 7428]
 ref|YP_007126654.1| leucyl aminopeptidase [Gloeocapsa sp. PCC 7428]
 gb|AFZ29494.1| leucyl aminopeptidase [Gloeocapsa sp. PCC 7428]
Length=491

 Score =   266 bits (681),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 192/429 (45%), Positives = 251/429 (59%), Gaps = 50/429 (12%)
 Frame = +2

Query  335   AKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKS  514
             A +  LL+W GD LA+G+ E      E  + Q  + Q L+ K  G L E   E +F GK 
Sbjct  5     AIDTPLLDWTGDCLAIGLFE------EAEELQGDVAQ-LNDKFAGALKEIIEETEFKGKE  57

Query  515   GQSIVLRLP-ALGFKRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaE  688
             G S V R+  A   +++ L+GLG+  +  + + R  G T+A  AK  +  +V V L + +
Sbjct  58    GSSAVTRIGGASPVRKVFLIGLGNQETLRLDSLRRAGATVARLAKKEKCKTVGVNLPTVD  117

Query  689   GLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTL-KSVEILGLGTGPEIEKKLKYSE  865
                     +   A+A G+   +++DNRFK EP+   L + V++LG       E  +  + 
Sbjct  118   ----NDPAATVQAIAEGLQLASYQDNRFKSEPEEKVLVERVDLLGFAGQ---EAAIARAN  170

Query  866   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLG  1045
              + SGV   +ELV AP N +TP  LAE A+ IA  +   L   IL+ E+C++L MG+FLG
Sbjct  171   SICSGVNLARELVAAPPNEVTPITLAETAQKIAEDHG--LQVEILEREECEKLGMGAFLG  228

Query  1046  VAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMag  1225
             VA A+  P  FIHL YKP  G+ K +LA++GKG+TFDSGG N+K GA SSIE+MK DM G
Sbjct  229   VAQASDLPPKFIHLTYKPE-GTPKRRLAIIGKGLTFDSGGLNIKAGAGSSIEMMKMDMGG  287

Query  1226  aavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVL  1405
             A    GAAKAIAQ+KP  VEVHFI  A ENMISG  M PGDIL ASNGK IE        
Sbjct  288   AGATLGAAKAIAQLKP-DVEVHFISAATENMISGRAMHPGDILKASNGKTIE--------  338

Query  1406  RCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACIT  1585
                                  V +TDAEGRL LADALV+A KLGV+ +VDLATLTGACI 
Sbjct  339   ---------------------VNNTDAEGRLTLADALVFAEKLGVDAIVDLATLTGACII  377

Query  1586  ALGRSVAGM  1612
             ALG  +AG+
Sbjct  378   ALGDEIAGL  386


 Score = 62.8 bits (151),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+F+P ++LA+++ +AA+  GEKLWRMP EE Y+E +KS IAD  N G   G +ITA+LF
Sbjct  385   GLFSPDDELAQQLAQAAEAAGEKLWRMPFEEKYFEGLKSGIADFKNTGPRGGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_008226312.1| Cytosol aminopeptidase PepA [Richelia intracellularis]
 emb|CCH64879.1| Cytosol aminopeptidase PepA [Richelia intracellularis HM01]
Length=490

 Score =   254 bits (648),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 188/428 (44%), Positives = 250/428 (58%), Gaps = 57/428 (13%)
 Frame = +2

Query  347   DLLEWKGDILAVGVTEK--DMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQ  520
             +LL+W GD LA+G  E   +++ D         L+ L+ KL G + E  +EE F  K   
Sbjct  9     NLLQWTGDGLAIGFFEGKLELIGD---------LENLNDKLAGAIQEIITEEKFEAKINS  59

Query  521   SIVLRL-PALGFKRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEGL  694
              I  RL      ++I +VGLG      + + RT   +I   AK  +  S+A++L     L
Sbjct  60    IIFTRLIGGSQVRKIIVVGLGKAEDFNLESLRTAAASIIRVAKKQKCKSLAISLPICNNL  119

Query  695   SVESKLSAASAMATGIVSGTFEDNRFKLEPKTP--TLKSVEILGLGTGPEIEKKLKYSEV  868
             +       A  +   +    +EDNRFK EP+    T+++V+++GL  G E  + +  +  
Sbjct  120   A-----ETAKTITESVELAVYEDNRFKSEPENEKNTIETVDLIGL-VGQE--EAINLAHQ  171

Query  869   VSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGV  1048
             + SGVI  +ELV APAN +TP  +AE A+ +A+ Y+  L   +L+  +C+ L MG+FLGV
Sbjct  172   ICSGVILARELVAAPANEVTPITMAETAQKLATEYN--LHLEVLEHGECENLGMGAFLGV  229

Query  1049  AAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMaga  1228
             A A+  P  FIHL Y+P  G  + KLA++GKG+TFDSGG N+K  A+SSIE+MK DMAGA
Sbjct  230   AKASDIPPKFIHLTYQPQ-GIPRRKLAIIGKGLTFDSGGLNIK-SASSSIEIMKIDMAGA  287

Query  1229  avvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLR  1408
                FGAAKAI QIKP  VEVHFI    ENMISG  M PGDIL ASNGK IE         
Sbjct  288   GATFGAAKAIGQIKP-DVEVHFISAVTENMISGCAMHPGDILKASNGKTIE---------  337

Query  1409  CLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITA  1588
                                 V +TDAEGRL LADALV+A KLGV+ +VDLATLTGACI A
Sbjct  338   --------------------VNNTDAEGRLTLADALVFADKLGVDAIVDLATLTGACIVA  377

Query  1589  LGRSVAGM  1612
             LG ++AGM
Sbjct  378   LGNNIAGM  385


 Score = 75.1 bits (183),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP+++LAK++  A    GEKLWRMP+E  Y+E +KSSIADM N+G   G +ITASLF
Sbjct  384   GMFTPNDELAKQLDIAGYKAGEKLWRMPMENKYFEGLKSSIADMKNSGPSAGSSITASLF  443

Query  1866  MK  1871
             ++
Sbjct  444   LQ  445



>ref|WP_026085699.1| aminopeptidase A [Fischerella muscicola]
Length=493

 Score =   251 bits (640),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 193/426 (45%), Positives = 244/426 (57%), Gaps = 54/426 (13%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             +LEW GD LAVG+ E      +N++     L  L+ K  G + E  +EE+F GK G +  
Sbjct  10    ILEWTGDGLAVGLFE------DNTELTGE-LATLNEKFAGYIKELIAEEEFKGKVGSTAF  62

Query  530   LRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVES  706
              RL +    ++I LVGLG   +  +   TL    AA A+ A+         S   L V +
Sbjct  63    TRLGSGSPVRKIILVGLGK--ADALKLDTLRRAAAAIARQAKKQKCKTLAIS---LPVWN  117

Query  707   KLSA--ASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVVS  874
                A  A A+A G+    ++DNRFK EP  K P ++ VE+LGL      E  +  +  + 
Sbjct  118   NDPAQTAQALAEGVQLALYQDNRFKSEPEDKGPQVEIVELLGLNGQ---EAAIARANQIC  174

Query  875   SGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAA  1054
             SGVI  ++LV APAN +TP  +AE A  IAS     +   IL+ E C++L MG+FLGVA 
Sbjct  175   SGVILARQLVAAPANEVTPITMAETAMAIASEAG--MHIEILEREDCEKLGMGAFLGVAK  232

Query  1055  AATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaav  1234
             A+  P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K G  S IE MK DM GAA 
Sbjct  233   ASDLPPKFIHLTYKPE-GTPKRKLAIIGKGLTFDSGGLNIK-GPGSGIENMKIDMGGAAA  290

Query  1235  vfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCL  1414
              FGAAK I Q+KP  VEVHFI    ENMISG  M PGDIL ASNGK IE           
Sbjct  291   TFGAAKVIGQLKP-DVEVHFISAVTENMISGHAMHPGDILKASNGKTIE-----------  338

Query  1415  SRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALG  1594
                               V +TDAEGRL LADALV+A KLGV+ +VDLATLTGAC+ ALG
Sbjct  339   ------------------VNNTDAEGRLTLADALVFADKLGVDAIVDLATLTGACVIALG  380

Query  1595  RSVAGM  1612
               +AG+
Sbjct  381   DDIAGL  386


 Score = 77.8 bits (190),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP + LAKE+  AA   GEK+WR+P+EE Y+E MKS IADM N G   G +ITA+LF
Sbjct  385   GLFTPDDGLAKELETAAHSAGEKIWRLPMEEKYFEGMKSGIADMKNTGPRPGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_006100918.1| aminopeptidase A [Coleofasciculus chthonoplastes]
 gb|EDX75780.1| Cytosol aminopeptidase family, catalytic domain [Coleofasciculus 
chthonoplastes PCC 7420]
Length=490

 Score =   263 bits (671),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 191/430 (44%), Positives = 257/430 (60%), Gaps = 52/430 (12%)
 Frame = +2

Query  335   AKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKS  514
             A +   ++W GD LA+G  E D+V+          L +LD KL G L E   E +F G  
Sbjct  5     ATDTPRVDWTGDALALGFFE-DVVELTGD------LAQLDQKLSGTLKELIEETEFKGSV  57

Query  515   GQSIVLRLPA-LGFKRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaE  688
             G S V R+ A    +++ LVGLG   + T+ + R +G  IA  AK  ++ ++ ++L +A 
Sbjct  58    GSSAVTRVGAGSSVRKVILVGLGKSDALTVDSLRRVGAAIARMAKQQKSKTLGISLPAAN  117

Query  689   GLSVESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYS  862
                 ++ LSA  A+A GI      DNRFK EP  K   L+ VE+LGLG   +++  +   
Sbjct  118   N---DTALSA-QAIAEGITLALHLDNRFKSEPEDKGAKLEQVELLGLG---DVQAAINQG  170

Query  863   EVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFL  1042
               +  GVI  +ELV AP N +TP  LA+ A++IAS Y   +T  +L+ ++C++L MG+FL
Sbjct  171   NAICQGVILARELVAAPPNSVTPMTLAQTAQDIASAYG--MTLEVLEKDECEKLGMGAFL  228

Query  1043  GVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMa  1222
             GVA A+  P  FIHL YKP  G+ + KLA++GKG+TFDSGG NLK+ + S IE MK DM 
Sbjct  229   GVAQASEMPPKFIHLTYKPQ-GTPRRKLAIVGKGLTFDSGGLNLKV-SGSGIETMKMDMG  286

Query  1223  gaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALV  1402
             GA   FGAAKAI ++KP  VEVHFI  A ENMISG  + PGDI+TASNGK IE       
Sbjct  287   GAGATFGAAKAIGELKP-DVEVHFISAATENMISGHALHPGDIITASNGKTIE-------  338

Query  1403  LRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACI  1582
                                   V +TDAEGRL LADALV+A KL V+ +VDLATLTGAC+
Sbjct  339   ----------------------VNNTDAEGRLTLADALVFAEKLEVDAIVDLATLTGACV  376

Query  1583  TALGRSVAGM  1612
              ALG ++ G+
Sbjct  377   VALGNNIGGL  386


 Score = 65.9 bits (159),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G++T  + LA +   A++  GEK W+MP+EE Y+E MKS IADM N G   G +ITA+LF
Sbjct  385   GLWTTDDTLATQFKTASEKAGEKFWQMPMEEKYFEGMKSPIADMKNTGPRAGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_012163418.1| aminopeptidase A [Acaryochloris marina]
 ref|YP_001517301.1| leucyl aminopeptidase [Acaryochloris marina MBIC11017]
 sp|B0CCF6.1|AMPA_ACAM1 RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Acaryochloris marina MBIC11017]
 gb|ABW27985.1| cytosol aminopeptidase family protein [Acaryochloris marina MBIC11017]
Length=492

 Score =   253 bits (647),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 189/426 (44%), Positives = 246/426 (58%), Gaps = 56/426 (13%)
 Frame = +2

Query  356   EWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVLR  535
             +W GD L +G  E     D         L +LD  L  +L +  SE +F GK G+    R
Sbjct  12    DWSGDYLGIGFFEDSAAIDAG-------LTQLDQSLQDILQDLVSETEFQGKVGEQPWTR  64

Query  536   LPALG-FKRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEGLSVESK  709
             +   G  +++ L+GLGS  + T+ + R      A AA+  +A+S  + L S +    +  
Sbjct  65    IAGPGSIRKVMLIGLGSPDAFTLDSLRQAAAAFAKAAQKQKAASAGLQLPSWD----DDA  120

Query  710   LSAASAMATGIVSGTFEDNRFKLEP--KTPT--LKSVEILGLGT-GPEIEKKLKYSEVVS  874
              ++  AMA GI     ++ RFK +P  K P    + V +LGL      IEK    ++ + 
Sbjct  121   AASTQAMAEGIELALHQEIRFKSDPDAKKPGEFPQEVHLLGLANQAAAIEK----AQQIC  176

Query  875   SGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAA  1054
             +GVI  +ELV APANV+TP ALAE A  IA  +   LT  +L+ E+C+   MG+FLGV+ 
Sbjct  177   AGVILTRELVAAPANVVTPSALAETAAQIAEDHG--LTLEVLEREECEAQGMGAFLGVSL  234

Query  1055  AATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaav  1234
             A+  P  FIHL YKPS G+ + KLA++GKG+TFDSGG NLK+G  S IE MK DMAG+  
Sbjct  235   ASELPPKFIHLTYKPS-GTPRRKLAIVGKGVTFDSGGLNLKVG-GSGIETMKMDMAGSGA  292

Query  1235  vfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCL  1414
               GAAKAI Q+KP  VEVHFIV A ENMISG  + PGDILTASNGK IE           
Sbjct  293   TLGAAKAIGQLKP-DVEVHFIVAAAENMISGHALHPGDILTASNGKTIE-----------  340

Query  1415  SRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALG  1594
                               + +TDAEGRL LADALV+A K GV+ +VDLATLTGACI ALG
Sbjct  341   ------------------INNTDAEGRLTLADALVFAEKQGVDAIVDLATLTGACIVALG  382

Query  1595  RSVAGM  1612
               +AGM
Sbjct  383   NDIAGM  388


 Score = 74.7 bits (182),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G++TP + LA+E+ +A++  GEK WRMPLEE Y+E +KS IADM N G   G +ITA+LF
Sbjct  387   GMWTPEDSLAEELSQASEQAGEKFWRMPLEEKYFEGLKSPIADMKNTGPRPGGSITAALF  446

Query  1866  MK  1871
             +K
Sbjct  447   LK  448



>ref|WP_015230084.1| leucyl aminopeptidase [Dactylococcopsis salina]
 ref|YP_007172451.1| leucyl aminopeptidase [Dactylococcopsis salina PCC 8305]
 gb|AFZ51094.1| leucyl aminopeptidase [Dactylococcopsis salina PCC 8305]
Length=500

 Score =   253 bits (646),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 196/448 (44%), Positives = 254/448 (57%), Gaps = 61/448 (14%)
 Frame = +2

Query  311   ERPKISFAAKEVDLLEWKGDILAVGVTEKDM-VKDENSKFQNLILQKLDSKLGGLLSEAS  487
             ++ K+   A E   L W GD LAVG+    + V  E        L +LD KL G + E  
Sbjct  7     KKAKMKVQATEQTTLSWSGDTLAVGLFVGGVTVTGE--------LAELDEKLAGTIKELI  58

Query  488   SEEDFSGKSGQSIVLRLPA-LGFKRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqass  661
             +E +F GK+G ++V R+      ++I LVGLG      +   R  G +IA  AKS  + +
Sbjct  59    AETNFEGKAGSNVVTRVGGNTPVRKIMLVGLGETKDFKLDTVRVAGGSIARLAKSQHSKN  118

Query  662   vavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLK--SVEILGLGTGP  835
             +A++L   +     ++   A A+  GI    +ED RFK EP+   LK  SVE+L LG   
Sbjct  119   LAISLPIVD----NNQALTAQAITEGITLALYEDRRFKSEPEENPLKLESVELLELG---  171

Query  836   EIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQC  1015
             +    +  +E +  GVI  K+LV APAN +T   LA  A+ +A+ +   L   IL+ E C
Sbjct  172   DQAAAITKAEQICDGVILAKQLVAAPANSVTSVTLANLAEELAAEHG--LEVEILEKEDC  229

Query  1016  KELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSS  1195
             ++L MG++LGVA A+  P  FIHL YKP  G+ + K+A++GKG+TFDSGG NLK  A S 
Sbjct  230   EKLGMGAYLGVAQASDIPPKFIHLTYKPQ-GTPRRKVAIVGKGVTFDSGGLNLK-PAGSG  287

Query  1196  IELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKR  1375
             IE MK DM GA    GAAKAIAQ+KP  VEVHFI  A ENMISG  M PGDILTASNGK 
Sbjct  288   IETMKMDMGGAGATLGAAKAIAQLKP-DVEVHFISAATENMISGHAMHPGDILTASNGKT  346

Query  1376  IEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVD  1555
             IE                             V +TDAEGRL LADALV+A KLGV+ +VD
Sbjct  347   IE-----------------------------VNNTDAEGRLTLADALVFAEKLGVDAIVD  377

Query  1556  LATLTGACITALGRSVAGMPL*IMYLWS  1639
             LATLTGAC+ ALG  + G       LWS
Sbjct  378   LATLTGACVIALGDDIGG-------LWS  398


 Score = 75.1 bits (183),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  + LA ++  AADVGGEK+W+MPLEE Y+E MKS IADM N G   G +ITA+LF
Sbjct  395   GLWSTDDLLADQLKNAADVGGEKIWQMPLEEKYFEAMKSEIADMKNVGPRQGGSITAALF  454

Query  1866  MK  1871
             +K
Sbjct  455   LK  456



>ref|WP_036484522.1| aminopeptidase A [Myxosarcina sp. GI1]
Length=490

 Score =   263 bits (671),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 196/443 (44%), Positives = 255/443 (58%), Gaps = 77/443 (17%)
 Frame = +2

Query  350   LLEWKGDILAVGV--TEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQS  523
             LL+W GD+LAVG+   E ++  D         L KLD KL G++ E  +EE+F GK+G +
Sbjct  10    LLDWTGDLLAVGIFEGETELAGD---------LAKLDDKLAGIVKELIAEEEFEGKAGST  60

Query  524   IVLRLPALG-FKRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEGLS  697
             I  R+      ++I LVGLG +    + ++R+    IA  A   ++           G+S
Sbjct  61    ITSRVGNKNPVRKIALVGLGKLEDLKLDSWRSAAAAIARLAAKEKSL----------GIS  110

Query  698   V----ESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGL-GTGPEIEKKLK  856
             +    E+    A AMA  IV    +DNRFK EP  K   L++V+++GL G    + K   
Sbjct  111   LPVGSEAADKIAQAMAEAIVLALHQDNRFKSEPEDKQTKLETVDLIGLNGQDGAVAK---  167

Query  857   YSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELK--M  1030
               E ++SGVI  +ELVNAPAN + P A+AE A+ +A      L   IL+ + C++ +  M
Sbjct  168   -GETIASGVILARELVNAPANAIDPVAMAETAQKLAEECG--LAIEILERDACEQFEQGM  224

Query  1031  GSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMK  1210
             G++LGVA A+  P  FIHL YKP  G+ K KLA++GK +TFDSGG NLK+ + S IE MK
Sbjct  225   GAYLGVAQASDLPPKFIHLTYKPD-GTPKKKLAIVGKSVTFDSGGLNLKV-SGSGIETMK  282

Query  1211  KDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTY  1390
              DM G A   GAAKAIAQ+KP  VEVHFI  A ENMISG  M PGDIL ASNGK IE   
Sbjct  283   MDMGGGAATLGAAKAIAQLKP-DVEVHFICAAAENMISGHAMHPGDILKASNGKTIE---  338

Query  1391  AALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLT  1570
                                       V +TDAEGRL LADALV+A KL V+ +VDLATLT
Sbjct  339   --------------------------VNNTDAEGRLTLADALVFAEKLEVDAIVDLATLT  372

Query  1571  GACITALGRSVAGMPL*IMYLWS  1639
             GACI ALG ++AG       LWS
Sbjct  373   GACIVALGNNIAG-------LWS  388


 Score = 65.5 bits (158),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  + LA+++  AA+  GEK W++P+EE Y+E +KS IADM N G   G +ITA+LF
Sbjct  385   GLWSTDDSLAEQIKTAAESAGEKFWQLPMEEKYFEGLKSQIADMKNTGPRAGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_039199262.1| aminopeptidase A [Aphanizomenon flos-aquae]
 gb|KHG42686.1| aminopeptidase A [Aphanizomenon flos-aquae 2012/KM/D3]
 gb|KHG43244.1| aminopeptidase A [Aphanizomenon flos-aquae 2012/KM/D3]
Length=490

 Score =   255 bits (651),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 189/425 (44%), Positives = 252/425 (59%), Gaps = 52/425 (12%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             LL+W GD LA G+ E D V+          L  L+ K  G+L E  +EE+F+GK+  ++V
Sbjct  10    LLDWTGDTLAFGLFE-DAVELTGD------LVNLNDKFAGILKEVIAEEEFTGKANSTVV  62

Query  530   LRLPALG-FKRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEGLSVE  703
             +RL   G  K++ +VGLG   +  + + R +  T+A  AK  +  ++ ++L     L  +
Sbjct  63    IRLAGTGSVKKVIVVGLGKPDALKLDSLRRVAATVAKTAKKQKTKTLGISLP----LWND  118

Query  704   SKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVVSS  877
                + A A+  GI    ++D RFK EP  K P ++++++LGL      E  +  +  + S
Sbjct  119   DPAATAQALTEGIELALYQDIRFKSEPEDKNPNIETIDLLGLAGQ---EAAITCANQIVS  175

Query  878   GVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAAA  1057
             GVI  ++LV APAN +TP  +AE A+ IA  +   L       E+C++L MG+FLGVA A
Sbjct  176   GVILARQLVAAPANAVTPITMAETAQAIAHEHGLELEILE--QEECEKLGMGAFLGVAQA  233

Query  1058  ATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaavv  1237
             +  P  FIHL YKP+ G+ K KLA++GKG+TFDSGG N+K GA S IE MK DM GAA  
Sbjct  234   SDLPPKFIHLIYKPA-GTPKRKLAIIGKGVTFDSGGLNIK-GAGSGIETMKMDMGGAAAT  291

Query  1238  fgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCLS  1417
              GAAKAI Q+KP  VEVHFI    ENMISG  M PGDILTASNGK IE            
Sbjct  292   LGAAKAIGQLKP-DVEVHFISAVTENMISGKAMHPGDILTASNGKTIE------------  338

Query  1418  RSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALGR  1597
                              V +TDAEGRL LADALVYA KLGV+ +VDLATLTGAC+ ALG 
Sbjct  339   -----------------VNNTDAEGRLTLADALVYADKLGVDAIVDLATLTGACVVALGE  381

Query  1598  SVAGM  1612
              +AG+
Sbjct  382   DIAGL  386


 Score = 72.8 bits (177),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP + +A ++  AAD  GEK+WRMP+E+ Y++ +KS IADM N G   G +ITA+LF
Sbjct  385   GLFTPDDTVASQLKTAADNAGEKIWRMPMEDKYFDGLKSGIADMKNTGPRYGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_010872664.1| aminopeptidase A [Synechocystis sp. PCC 6803]
 ref|NP_441359.1| leucyl aminopeptidase [Synechocystis sp. PCC 6803]
 ref|YP_007451241.1| leucine aminopeptidase [Synechocystis sp. PCC 6803]
 dbj|BAA18039.1| leucine aminopeptidase [Synechocystis sp. PCC 6803]
 gb|AGF51727.1| leucine aminopeptidase [Synechocystis sp. PCC 6803]
Length=508

 Score =   258 bits (658),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 195/461 (42%), Positives = 256/461 (56%), Gaps = 66/461 (14%)
 Frame = +2

Query  278   ATLGLTHPNQIERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDS  457
             A  G   P+  ++  +     +   L W+GD LA+G  E       N+      L +LD 
Sbjct  2     AKWGTDSPSTEKQTAMQIRGTDYTALTWQGDALALGFFE-------NATEITGDLTQLDD  54

Query  458   KLGGLLSEASSEEDFSGKSGQSIVLRLPA-LGFKRIGLVGLGSVVSSTIAYRTLGETIaa  634
             +L G+L E   E++F GK+GQ +V R+ +    K++ LVGLG +       + LG+  AA
Sbjct  55    RLEGVLRELIEEKEFKGKAGQKLVSRVGSKTPIKKLILVGLGEI--EKFNSQVLGDGAAA  112

Query  635   aaksaqassvavalasaEGLSVESK----LSAASAMATGIVSGTFEDNRFKLEPKTPTLK  802
              A+ A+   V        G+S+  +       A+ +  GI+    +DNRFK +P+   +K
Sbjct  113   IARLAKGEKVKTL-----GVSLPQREHDPAQTAAILTEGILLALHQDNRFKSDPEDKEIK  167

Query  803   --SVEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYS  976
               +VE+LGLG   E    +  +E + SGVI  +E+V APAN +TP    E A  +A  Y 
Sbjct  168   LTTVELLGLG---EQSTAIGKAEKIVSGVILAREMVAAPANEVTPLTFTEIATELAQTYG  224

Query  977   DVLTATILDVEQCKELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFD  1156
               L   +L   +C+ L MG+FLGVA A+  P  FIHL Y+P++  VK KLA++GK +TFD
Sbjct  225   --LELEVLGQTECEALGMGAFLGVAKASELPPQFIHLTYRPAN-PVK-KLAIIGKSLTFD  280

Query  1157  SGGYNLKIGANSSIELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGM  1336
             SGG N+K GA S IE MK DM G     GAAKAIAQ+KP  VE+HFI  A ENMISGT M
Sbjct  281   SGGLNIK-GAGSGIETMKMDMGGGGATLGAAKAIAQLKP-NVEIHFICAATENMISGTAM  338

Query  1337  RPGDILTASNGKRIEVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADAL  1516
              PGDILTASNGK IE                             V +TDAEGRL LADAL
Sbjct  339   HPGDILTASNGKTIE-----------------------------VNNTDAEGRLTLADAL  369

Query  1517  VYASKLGVEKMVDLATLTGACITALGRSVAGMPL*IMYLWS  1639
             V+A KLGVE +VDLATLTGACI ALG  + G       LWS
Sbjct  370   VFAEKLGVEAIVDLATLTGACIVALGDDIGG-------LWS  403


 Score = 70.1 bits (170),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++P+++LA E+  AAD  GEK W+MP+E  Y+E +KS IADM N G   G +ITA+LF
Sbjct  400   GLWSPNQELADELKVAADKAGEKFWQMPMESKYFEGLKSPIADMKNTGPRSGGSITAALF  459

Query  1866  MK  1871
             ++
Sbjct  460   LQ  461



>ref|WP_016859555.1| aminopeptidase A [Fischerella muscicola]
Length=493

 Score =   253 bits (645),  Expect(2) = 6e-80, Method: Compositional matrix adjust.
 Identities = 192/426 (45%), Positives = 245/426 (58%), Gaps = 54/426 (13%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIV  529
             LLEW GD LAVG+ E       ++      L  LD K  G + E  +EE+F GK G + V
Sbjct  10    LLEWTGDGLAVGLFE-------DATELTGELATLDEKFAGYIKELITEEEFKGKVGSTAV  62

Query  530   LRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVES  706
              RL +    +++ LVGLG      +   T     AA A+ A+   +     S   L V +
Sbjct  63    TRLASGSPVRKLILVGLGK--PDAVKLDTWRRAAAAIARQAKKQKIKTLAIS---LPVWN  117

Query  707   KLSAASA--MATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSEVVS  874
                A +A  +A G+    ++DNRFK EP  K P +++VE+LG+      E  +  +  +S
Sbjct  118   NDPAQTAQVLAEGVQLALYQDNRFKSEPEDKGPQVETVELLGVSGQ---ESAIARANQIS  174

Query  875   SGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAA  1054
             SGVI  ++LV APAN +TP  +AE A  IAS     +   IL+ + C++L MG+FLGVA 
Sbjct  175   SGVILARQLVAAPANEVTPITMAETATAIASETG--MHIEILEQQDCEKLGMGAFLGVAK  232

Query  1055  AATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaav  1234
             A+  P  FIHL YKP  G+ K KLA++GKG+TFDSGG N+K GA S IE MK DM GAA 
Sbjct  233   ASDLPPKFIHLTYKPD-GTPKRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGGAAA  290

Query  1235  vfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCL  1414
              FGAAKAI Q+KP  VEVHFI    ENMISG  M PGDIL ASNGK IE           
Sbjct  291   TFGAAKAIGQLKP-DVEVHFISAVTENMISGRAMHPGDILKASNGKTIE-----------  338

Query  1415  SRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALG  1594
                               V +TDAEGRL LADALV+  KLGV+ +VDLATLTGAC+ ALG
Sbjct  339   ------------------VNNTDAEGRLTLADALVFTEKLGVDAIVDLATLTGACVIALG  380

Query  1595  RSVAGM  1612
               +AG+
Sbjct  381   DDIAGL  386


 Score = 75.1 bits (183),  Expect(2) = 6e-80, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+FTP + LA+E+  AA   GEK+WR+P+EE Y+E +KS IADM N G   G +ITA+LF
Sbjct  385   GLFTPDDTLAQELETAAQGAGEKIWRLPMEEKYFEGLKSGIADMKNTGPRPGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>gb|AFW71514.1| hypothetical protein ZEAMMB73_883672 [Zea mays]
Length=347

 Score =   268 bits (684),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 162/302 (54%), Positives = 224/302 (74%), Gaps = 7/302 (2%)
 Frame = +2

Query  284   LGLTHPNQ-IERPKISFAAKEVDLLEWKGDILAVGVTEKDMVKDEN---SKFQNLILQKL  451
             LGLT PN  +E P+ISFAAK+ +  +W GDILAV VT+KD+    +   S+F+N +L++L
Sbjct  12    LGLTWPNAAVELPQISFAAKDSEFSDWDGDILAVAVTDKDVQVQPHVSGSEFENAVLRRL  71

Query  452   DSKLGGLLSEASSEEDFSGKSGQSIVLRLPALGFKRIGLVGLGSVVSSTIA--YRTLGET  625
             D +LGGLL  A++EE+F+G+ GQS+VLR+    FKR+ LVG  +      A     LGE+
Sbjct  72    DVQLGGLLRAAAAEEEFAGRPGQSVVLRVRGQRFKRVALVGFAARDRDRDAGCLHGLGES  131

Query  626   IaaaaksaqassvavalasaEGLSVESKLSAASAMATGIVSGTFEDNRFKLEPKTPTLKS  805
             +A+ A++A+A+S A+ +A    +  ES+L+AA+A+A+G V G +EDNR+K E +   LK 
Sbjct  132   VASVARAARATSAAILVADPAVVRPESRLNAAAAIASGTVLGLYEDNRYKSEWEKVHLKQ  191

Query  806   VEILGLGTGPEIEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVL  985
             V+++GLG+GPE+++KL+++  +SSGV+  ++LVN+PANVLTPGALAE A  IAS YSDV 
Sbjct  192   VDLIGLGSGPELDQKLRHANRLSSGVMLARDLVNSPANVLTPGALAEAAAKIASTYSDVF  251

Query  986   TATILDVEQCKELKMGSFLGVAAAA-TNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSG  1162
             TATILD  +C+ELKMGS+L VAAA+ TNP YFIHLCYKP  G V+ KLAL+GKGITFD  
Sbjct  252   TATILDAAKCRELKMGSYLAVAAASETNPPYFIHLCYKPRGGDVRRKLALVGKGITFDRF  311

Query  1163  GY  1168
              Y
Sbjct  312   VY  313



>ref|WP_012599158.1| aminopeptidase A [Cyanothece sp. PCC 7424]
 ref|YP_002377083.1| leucyl aminopeptidase [Cyanothece sp. PCC 7424]
 sp|B7KCB0.1|AMPA_CYAP7 RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Cyanothece sp. PCC 7424]
 gb|ACK70215.1| Leucyl aminopeptidase [Cyanothece sp. PCC 7424]
Length=490

 Score =   252 bits (643),  Expect(2) = 9e-80, Method: Compositional matrix adjust.
 Identities = 191/447 (43%), Positives = 251/447 (56%), Gaps = 67/447 (15%)
 Frame = +2

Query  323   ISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDF  502
             +   A E  +L W G+ LA+G+ E      E        L +L+ +LGG L E  +EE+F
Sbjct  1     MDIRATEQTILNWTGETLALGIFEGATELTEE-------LGELNERLGGTLQELITEEEF  53

Query  503   SGKSGQSIVLRLPALG-FKRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvaval  676
               K+G S V RL      +++ LVGLG      + + R     IA +AK  +  ++    
Sbjct  54    EAKTGTSAVTRLGKDSPIRKLILVGLGKPEDFKLHSLRNAAANIARSAKKLKIKTL----  109

Query  677   asaEGLSVESKLSAASAMATGIVSGTF----EDNRFKLEP--KTPTLKSVEILGLGTGPE  838
                 G+S+    +A +     IV G       D RFK EP  K   L++V++LGL     
Sbjct  110   ----GISLPVFNNAPTLTTGAIVEGVLLALHTDLRFKSEPEDKGAKLETVDLLGLAGQ--  163

Query  839   IEKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCK  1018
              E  +  ++++  GVI  +ELVN PAN +TP  +A+ A+ +AS Y   LT TIL+ E C+
Sbjct  164   -ETAINQAQIICDGVILARELVNGPANSVTPITMAQTAETLASDYG--LTLTILEQEDCE  220

Query  1019  ELKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSI  1198
             +L MG++LGVA A+  P  FIHL YKP  G+ K KLA++GK +TFDSGG N+K+ + S I
Sbjct  221   KLGMGAYLGVAKASDLPPKFIHLTYKPE-GTPKRKLAIVGKSLTFDSGGLNIKV-SGSGI  278

Query  1199  ELMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRI  1378
             E MK DM G A   GAAKAIAQ+KP  VEVHFI  A ENMISG  M PGDILTASNGK I
Sbjct  279   ETMKMDMGGGAATLGAAKAIAQLKP-DVEVHFICAATENMISGKAMHPGDILTASNGKTI  337

Query  1379  EVTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDL  1558
             E                             V +TDAEGRL LADALV+A +L V+ +VDL
Sbjct  338   E-----------------------------VNNTDAEGRLTLADALVFAEQLEVDAIVDL  368

Query  1559  ATLTGACITALGRSVAGMPL*IMYLWS  1639
             ATLTGACI ALG  ++G       LWS
Sbjct  369   ATLTGACIIALGDDISG-------LWS  388


 Score = 75.1 bits (183),  Expect(2) = 9e-80, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++P+E+LA ++  AA++ GEK W+MPLEE Y+E MKS IADM N G   G +ITA+LF
Sbjct  385   GLWSPNEELATQLKTAAELAGEKFWQMPLEEKYFEGMKSPIADMKNTGPRAGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_015129473.1| leucyl aminopeptidase [Calothrix sp. PCC 7507]
 ref|YP_007066498.1| leucyl aminopeptidase [Calothrix sp. PCC 7507]
 gb|AFY33664.1| leucyl aminopeptidase [Calothrix sp. PCC 7507]
Length=493

 Score =   257 bits (657),  Expect(2) = 9e-80, Method: Compositional matrix adjust.
 Identities = 196/429 (46%), Positives = 247/429 (58%), Gaps = 50/429 (12%)
 Frame = +2

Query  335   AKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKS  514
             A +  LLEW GD LA+G+ E D V+          L   D KL G+L E  +EE+F GK+
Sbjct  5     ASDTPLLEWAGDTLAIGLFE-DAVELTGE------LATFDGKLAGVLKELIAEEEFKGKA  57

Query  515   GQSIVLRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEG  691
               +I  R+ A    K++ +VGLG   +  +   TL    AA A+ A+     +   S   
Sbjct  58    NSTIFTRVAAGSPVKKVIVVGLGK--AEALKLDTLRRAAAAVARVAKKQKSKILGFSFPL  115

Query  692   LSVESKLSAASAMATGIVSGTFEDNRFKLEP--KTPTLKSVEILGLGTGPEIEKKLKYSE  865
              + E   S A A+A GI    ++D RFK EP  K   +++V++LG       E  +  + 
Sbjct  116   WNNEPTAS-AQAIAEGIELALYQDIRFKSEPEDKGSQIETVDLLGFAGQ---EAAIARAN  171

Query  866   VVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLG  1045
              + SGVI  ++LV APAN +TP  LAE A+ IA  Y   L   IL+ E C++L MG+FLG
Sbjct  172   QIVSGVILARQLVAAPANEVTPITLAETAQAIAKEYG--LQVEILEREDCEKLGMGAFLG  229

Query  1046  VAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMag  1225
             VA A+  P  FIHL YKP  G+   KLA++GKG+TFDSGG N+K GA S IE MK DM G
Sbjct  230   VAQASDLPPKFIHLTYKP-DGTPTRKLAIIGKGLTFDSGGLNIK-GAGSGIETMKIDMGG  287

Query  1226  aavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVL  1405
             AA   GAAKAIAQIKP   EVHFI  A ENMISG  M PGDIL ASNGK IE        
Sbjct  288   AAATLGAAKAIAQIKP-DAEVHFISAATENMISGKAMHPGDILKASNGKTIE--------  338

Query  1406  RCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACIT  1585
                                  V +TDAEGRL LADALV+A KLGV+ +VDLATLTGAC+ 
Sbjct  339   ---------------------VNNTDAEGRLTLADALVFADKLGVDAIVDLATLTGACVV  377

Query  1586  ALGRSVAGM  1612
             ALG  +AG+
Sbjct  378   ALGEDMAGL  386


 Score = 69.7 bits (169),  Expect(2) = 9e-80, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+F+P + +A ++ +AA   GEK+WRMP+EE Y+E +KS +ADM N G   G +ITA+LF
Sbjct  385   GLFSPDDAVASQLEKAAAGSGEKIWRMPMEEKYFEGLKSGLADMKNTGPRAGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_015142479.1| leucyl aminopeptidase [Pleurocapsa minor]
 ref|YP_007079728.1| leucyl aminopeptidase [Pleurocapsa sp. PCC 7327]
 gb|AFY76171.1| leucyl aminopeptidase [Pleurocapsa sp. PCC 7327]
Length=492

 Score =   256 bits (654),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 188/435 (43%), Positives = 253/435 (58%), Gaps = 61/435 (14%)
 Frame = +2

Query  350   LLEWKGDILAVGVTEKDM-VKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSI  526
             +L+W GD LA+G+ E ++ +  E        L  LD KL G + E  +E +F GKS  + 
Sbjct  10    VLDWTGDALAIGLFESNIELTGE--------LAHLDEKLAGTIQELIAETEFEGKSSSTA  61

Query  527   VLRLPALG-FKRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEGLSV  700
             V R+ +    ++I LVGLG      + A R  G  IA  AK  +  ++ ++L   +    
Sbjct  62    VTRVGSNSPVRKIILVGLGKAEDLKLNAVRLAGAAIARIAKKEKVKTLGISLPVVD----  117

Query  701   ESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKLKYSEVVS  874
                 + A A+A G++    +D RFK  +E K   L++V+++GLG+  E    + ++E + 
Sbjct  118   NDPAATAGAIAEGMLLALHQDTRFKSEVEDKGLKLETVDLIGLGSQDE---AIAHAEAIC  174

Query  875   SGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVAA  1054
             +GVI  +ELVNAPAN +T   +A+ A+ IA+     L   IL+ E C++L MG+FLGVA 
Sbjct  175   AGVILARELVNAPANSVTAITMAQTAEQIAA--EGGLAVEILEKEDCEKLGMGAFLGVAM  232

Query  1055  AATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaav  1234
             A+  P  FIHL YKP+ G+ K KLA++GK +TFDSGG N+K GA S IE MK DM G A 
Sbjct  233   ASDLPPKFIHLTYKPA-GTPKRKLAIVGKSLTFDSGGLNIK-GAGSGIETMKMDMGGGAA  290

Query  1235  vfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRCL  1414
               G AKAIAQ+KP  VE+HFI  A ENMISG  + PGDIL ASNGK IE           
Sbjct  291   ALGTAKAIAQLKPE-VEIHFICAATENMISGHALHPGDILRASNGKTIE-----------  338

Query  1415  SRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITALG  1594
                               V +TDAEGRL LADALV+A KLGV+ +VDLATLTGAC+ ALG
Sbjct  339   ------------------VNNTDAEGRLTLADALVFAEKLGVDAIVDLATLTGACVVALG  380

Query  1595  RSVAGMPL*IMYLWS  1639
               +AG       LWS
Sbjct  381   NDIAG-------LWS  388


 Score = 70.5 bits (171),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++  E LA ++ EA+D  GEK W+MP+EE Y+E +KS IADM N G   G +ITA+LF
Sbjct  385   GLWSTDETLANQLKEASDKAGEKFWQMPMEEKYFEGLKSQIADMKNTGPCAGGSITAALF  444

Query  1866  MK  1871
             +K
Sbjct  445   LK  446



>ref|WP_023064677.1| leucine aminopeptidase 1 [Lyngbya aestuarii]
 gb|ERT09132.1| leucine aminopeptidase 1 [Lyngbya aestuarii BL J]
Length=489

 Score =   256 bits (654),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 194/446 (43%), Positives = 249/446 (56%), Gaps = 66/446 (15%)
 Frame = +2

Query  323   ISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDF  502
             + F   +   ++W GD LAVG+ E ++  D   +     L +LD KL G L E   E +F
Sbjct  1     MEFRVIDTPRIDWTGDALAVGIFEHEV--DLPGE-----LAQLDEKLAGTLKELIEETEF  53

Query  503   SGKSGQSIVLRLPALG-FKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  679
              GK   S   R+ +    +++ LVGLGS  S  ++  TL       A +           
Sbjct  54    DGKPSSSASSRVGSSSPIRKVILVGLGS--SENLSLDTL-----RLAAATAGRLAKTIKC  106

Query  680   saEGLSV---ESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGL-GTGPEI  841
                G+S+   E+  +   A+  G+    ++DNRFK   E K P ++ VE+LGL GT    
Sbjct  107   KTLGISLPVFETPEATTQALVEGVELALYQDNRFKSETEDKGPAIERVELLGLAGT----  162

Query  842   EKKLKYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKE  1021
             E  +  ++ + SGV   +ELV APAN + P  +AE A+ +AS Y       IL+ E C++
Sbjct  163   EDAITRAQNICSGVFLARELVAAPANEINPITMAEMAEALASEYG--FDIEILEKEDCEK  220

Query  1022  LKMGSFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIE  1201
             L MG+FLGVA A+  P  FIHL YKPS G+ K KLA++GKG+TFDSGG NLK+GA SSIE
Sbjct  221   LGMGAFLGVAQASDLPPKFIHLTYKPS-GTPKRKLAIIGKGLTFDSGGLNLKVGA-SSIE  278

Query  1202  LMKKDMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIE  1381
             +MK DM GA   FGAAKAI  +KP  VEVHFI    ENMISG  M PGD LTASNGK IE
Sbjct  279   MMKTDMGGAGATFGAAKAIGLLKP-DVEVHFISAVTENMISGRAMHPGDFLTASNGKTIE  337

Query  1382  VTYAALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLA  1561
                                          V +TDAEGRL LADALV+  KLGV+ MVDLA
Sbjct  338   -----------------------------VNNTDAEGRLTLADALVFTDKLGVDAMVDLA  368

Query  1562  TLTGACITALGRSVAGMPL*IMYLWS  1639
             TLTGAC+ ALG  +AG       LWS
Sbjct  369   TLTGACVVALGNDIAG-------LWS  387


 Score = 70.5 bits (171),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++P++DLA ++  A+   GEKLWRMP+EE Y+E +K+  ADM N G   G AITA+LF
Sbjct  384   GLWSPNDDLASQLETASKSTGEKLWRMPIEEKYFEGLKAVHADMKNTGPRQGGAITATLF  443

Query  1866  MK  1871
             +K
Sbjct  444   LK  445



>ref|WP_006456950.1| aminopeptidase A [Synechococcus sp. PCC 7335]
 gb|EDX87166.1| Cytosol aminopeptidase family, catalytic domain [Synechococcus 
sp. PCC 7335]
Length=495

 Score =   252 bits (643),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 192/433 (44%), Positives = 249/433 (58%), Gaps = 51/433 (12%)
 Frame = +2

Query  323   ISFAAKEVDLLEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDF  502
             + F A     LEW+GD L VG++E+ +           IL  L+ + GGLL     EE F
Sbjct  1     MDFIASGKSCLEWQGDCLVVGLSEESLP-------LTGILSDLNDQSGGLLQMLIDEEAF  53

Query  503   SGKSGQSIVLRL-PALGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavala  679
              GK+G + V RL P    K+IGLVGLGS  S ++   +L +  AAAA+ AQ +   +   
Sbjct  54    KGKAGSTAVTRLAPDSNIKKIGLVGLGS--SDSMGLESLRKGAAAAARLAQKAKCPILGV  111

Query  680   saEGLSVESKLSAASAMATGIVSGTFEDNRFK--LEPKTPTLKSVEILGLGTGPEIEKKL  853
             S    +    L+ A A+  GI     +DNRFK  LE     L +V +L        E  +
Sbjct  112   SFPVWNNNPSLT-AQALVEGIALALNQDNRFKSELETDKTELSAVHLLSF---EGQEAAV  167

Query  854   KYSEVVSSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMG  1033
             + ++ V  GVI  +ELV+AP NV+TP  LA+ A  IA  +   L   +L+ + C+ L MG
Sbjct  168   ETAKTVCEGVILARELVSAPPNVVTPEKLADTAAEIARDFG--LQLEVLERDDCEALGMG  225

Query  1034  SFLGVAAAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKK  1213
             ++LGVA A+  P  FIHL Y P   + K KLA++GKG+TFDSGG NLK  + S IE+MK 
Sbjct  226   AYLGVAQASDLPPKFIHLTYAPE--NPKRKLAIIGKGLTFDSGGLNLKP-SGSGIEMMKI  282

Query  1214  DMagaavvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYA  1393
             DM GAA V GAA+AIAQ+KP  VEVHFI  A ENM+SG  MRPGDILTA NGK IE    
Sbjct  283   DMGGAAAVLGAARAIAQLKP-DVEVHFISAAAENMVSGHAMRPGDILTAGNGKTIE----  337

Query  1394  ALVLRCLSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTG  1573
                                      V +TDAEGRL LADAL++A KLGV+ M+DLATLTG
Sbjct  338   -------------------------VNNTDAEGRLTLADALIFADKLGVDAMIDLATLTG  372

Query  1574  ACITALGRSVAGM  1612
             AC+ ALG  +A +
Sbjct  373   ACVVALGDDIAAL  385


 Score = 74.3 bits (181),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +3

Query  1689  IFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLFM  1868
             +F+P E LA+ +  AA++ GEKLWRMP+EE Y+E +KS +ADM N G   G +ITA+LF+
Sbjct  385   LFSPDEQLAQSLSSAAELSGEKLWRMPMEEKYFEGLKSVVADMKNTGPRAGGSITAALFL  444

Query  1869  K  1871
             K
Sbjct  445   K  445



>ref|WP_011609979.1| aminopeptidase A [Trichodesmium erythraeum]
 ref|YP_720051.1| leucyl aminopeptidase [Trichodesmium erythraeum IMS101]
 sp|Q11A96.1|AMPA_TRIEI RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Trichodesmium erythraeum IMS101]
 gb|ABG49578.1| leucyl aminopeptidase. Metallo peptidase. MEROPS family M17 [Trichodesmium 
erythraeum IMS101]
Length=496

 Score =   253 bits (646),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 183/436 (42%), Positives = 246/436 (56%), Gaps = 59/436 (14%)
 Frame = +2

Query  353   LEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVL  532
             L+W GD LA+G+ E  +   E++      + +LD  L G LSE   E +F GK+  S+  
Sbjct  11    LKWAGDALAIGLFEDAIKLTEDAIELTEEMAELDEMLSGTLSELIKETEFKGKANSSVST  70

Query  533   RLP-ALGFKRIGLVGLGSVVSSTI-AYRTLGETIaaaaksaqassvavalasaEGLSV--  700
             R+      ++I +VGLG +    + + R    T    AK  +  ++        G+S+  
Sbjct  71    RVGIKTSIRKIIVVGLGKLEKFKLDSLRQAAATCGRLAKKERCKTL--------GISLPM  122

Query  701   -ESKLSAASAMATGIVSGTFEDNRFKLEPKT--PTLKSVEILGLGTGPEIEKKLKYSEVV  871
              +   S A A+  GI     +DNRFK EP+   P L+ VE++GL    E    + ++  +
Sbjct  123   CQDADSTAIAITEGIELALHQDNRFKSEPENLGPDLEKVELIGLAASDE---AIAHARKI  179

Query  872   SSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVA  1051
              SGVIF +ELV APAN  TP  +AE A+ +A  +   LT  IL+ E C++L MG+FLGVA
Sbjct  180   CSGVIFARELVAAPANSCTPITMAETAQTLAKEFG--LTLEILEKEDCEKLGMGAFLGVA  237

Query  1052  AAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaa  1231
               +  P  FIH+ YKP   + + KLA++GKG+TFDSGG NLK+ + S IE+MK DM GA 
Sbjct  238   QGSDLPPKFIHVTYKPEV-TPRRKLAIVGKGLTFDSGGLNLKV-SGSGIEMMKIDMGGAG  295

Query  1232  vvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRC  1411
               FG  KAIAQ+KP  VEVHFI    ENM+SG  + PGD LTASNGK IE          
Sbjct  296   TTFGTIKAIAQLKP-DVEVHFISAVTENMVSGHAIHPGDFLTASNGKIIE----------  344

Query  1412  LSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITAL  1591
                                V +TDAEGRL LADALV+A KLGV+ ++DLATLTGAC+ AL
Sbjct  345   -------------------VNNTDAEGRLTLADALVFAEKLGVDAIIDLATLTGACVVAL  385

Query  1592  GRSVAGMPL*IMYLWS  1639
             G  +AG       LWS
Sbjct  386   GNDIAG-------LWS  394


 Score = 73.2 bits (178),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++P+++LA E+  AA+  GEK+WRMPLEE Y+E +K+  ADM N G   G AITA+LF
Sbjct  391   GLWSPNDNLAAEITAAAEKAGEKMWRMPLEEKYFEGLKAMHADMKNTGPRPGGAITAALF  450

Query  1866  MK  1871
             +K
Sbjct  451   LK  452



>ref|WP_014407105.1| aminopeptidase A [Synechocystis sp. PCC 6803]
 ref|YP_005383225.1| leucine aminopeptidase [Synechocystis sp. PCC 6803 substr. GT-I]
 ref|YP_005386394.1| leucine aminopeptidase [Synechocystis sp. PCC 6803 substr. PCC-P]
 ref|YP_005409101.1| leucine aminopeptidase [Synechocystis sp. PCC 6803 substr. PCC-N]
 ref|YP_005651416.1| leucine aminopeptidase [Synechocystis sp. PCC 6803]
 sp|P73971.2|AMPA_SYNY3 RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine 
aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase 
[Synechocystis sp. PCC 6803 substr. Kazusa]
 dbj|BAK50211.1| leucine aminopeptidase [Synechocystis sp. PCC 6803]
 dbj|BAL29210.1| leucine aminopeptidase [Synechocystis sp. PCC 6803 substr. GT-I]
 dbj|BAL32379.1| leucine aminopeptidase [Synechocystis sp. PCC 6803 substr. PCC-N]
 dbj|BAL35548.1| leucine aminopeptidase [Synechocystis sp. PCC 6803 substr. PCC-P]
Length=492

 Score =   256 bits (653),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 192/436 (44%), Positives = 248/436 (57%), Gaps = 66/436 (15%)
 Frame = +2

Query  353   LEWKGDILAVGVTEKDMVKDENSKFQNLILQKLDSKLGGLLSEASSEEDFSGKSGQSIVL  532
             L W+GD LA+G  E       N+      L +LD +L G+L E   E++F GK+GQ +V 
Sbjct  11    LTWQGDALALGFFE-------NATEITGDLTQLDDRLEGVLRELIEEKEFKGKAGQKLVS  63

Query  533   RLPA-LGFKRIGLVGLGSVVSSTIAYRTLGETIaaaaksaqassvavalasaEGLSVESK  709
             R+ +    K++ LVGLG +       + LG+  AA A+ A+   V        G+S+  +
Sbjct  64    RVGSKTPIKKLILVGLGEI--EKFNSQVLGDGAAAIARLAKGEKVKTL-----GVSLPQR  116

Query  710   ----LSAASAMATGIVSGTFEDNRFKLEPKTPTLK--SVEILGLGTGPEIEKKLKYSEVV  871
                    A+ +  GI+    +DNRFK +P+   +K  +VE+LGLG   E    +  +E +
Sbjct  117   EHDPAQTAAILTEGILLALHQDNRFKSDPEDKEIKLTTVELLGLG---EQSTAIGKAEKI  173

Query  872   SSGVIFVKELVNAPANVLTPGALAEEAKNIASLYSDVLTATILDVEQCKELKMGSFLGVA  1051
              SGVI  +E+V APAN +TP    E A  +A  Y   L   +L   +C+ L MG+FLGVA
Sbjct  174   VSGVILAREMVAAPANEVTPLTFTEIATELAQTYG--LELEVLGQTECEALGMGAFLGVA  231

Query  1052  AAATNPSYFIHLCYKPSSGSVKTKLALLGKGITFDSGGYNLKIGANSSIELMKKDMagaa  1231
              A+  P  FIHL Y+P++  VK KLA++GK +TFDSGG N+K GA S IE MK DM G  
Sbjct  232   KASELPPQFIHLTYRPAN-PVK-KLAIIGKSLTFDSGGLNIK-GAGSGIETMKMDMGGGG  288

Query  1232  vvfgaakaiaQIKPAGVEVHFIVPACENMISGTGMRPGDILTASNGKRIEVTYAALVLRC  1411
                GAAKAIAQ+KP  VE+HFI  A ENMISGT M PGDILTASNGK IE          
Sbjct  289   ATLGAAKAIAQLKP-NVEIHFICAATENMISGTAMHPGDILTASNGKTIE----------  337

Query  1412  LSRSDYIVVLGVIDPFF**VTDTDAEGRLILADALVYASKLGVEKMVDLATLTGACITAL  1591
                                V +TDAEGRL LADALV+A KLGVE +VDLATLTGACI AL
Sbjct  338   -------------------VNNTDAEGRLTLADALVFAEKLGVEAIVDLATLTGACIVAL  378

Query  1592  GRSVAGMPL*IMYLWS  1639
             G  + G       LWS
Sbjct  379   GDDIGG-------LWS  387


 Score = 70.5 bits (171),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  1686  GIFTPSEDLAKEVLEAADVGGEKLWRMPLEESYWETMKSSIADMINAGSLDGDAITASLF  1865
             G+++P+++LA E+  AAD  GEK W+MP+E  Y+E +KS IADM N G   G +ITA+LF
Sbjct  384   GLWSPNQELADELKVAADKAGEKFWQMPMESKYFEGLKSPIADMKNTGPRSGGSITAALF  443

Query  1866  MK  1871
             ++
Sbjct  444   LQ  445



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5509808335512