BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25546_g1_i1 len=751 path=[1:0-48 2894:49-146 148:147-186
3835:187-188 190:189-189 191:190-209 211:210-285 3883:286-292
294:293-320 3911:321-325 3916:326-344 3935:345-418 420:419-419
421:420-445 447:446-470 472:471-515 517:516-750]

Length=751
                                                                      Score     E

ref|XP_009589815.1|  PREDICTED: RING-H2 finger protein ATL17-like       174   2e-50   
ref|XP_009628650.1|  PREDICTED: RING-H2 finger protein ATL18-like       173   6e-50   
ref|XP_009589816.1|  PREDICTED: RING-H2 finger protein ATL17-like       173   8e-50   
ref|XP_009799165.1|  PREDICTED: E3 ubiquitin-protein ligase Os06g...    171   3e-49   
ref|XP_009594226.1|  PREDICTED: RING-H2 finger protein ATL18-like       169   3e-48   
ref|XP_009608788.1|  PREDICTED: probable E3 ubiquitin-protein lig...    160   2e-45   
ref|XP_009778641.1|  PREDICTED: probable E3 ubiquitin-protein lig...    160   4e-45   
ref|XP_010320794.1|  PREDICTED: RING finger protein 150-like            160   8e-45   
ref|XP_009613668.1|  PREDICTED: probable E3 ubiquitin-protein lig...    158   3e-44   
ref|XP_009591206.1|  PREDICTED: probable E3 ubiquitin-protein lig...    152   2e-42   
ref|XP_006348599.1|  PREDICTED: E3 ubiquitin-protein ligase Arkad...    150   1e-41   
gb|EYU28931.1|  hypothetical protein MIMGU_mgv1a022671mg                146   6e-40   
ref|XP_011078506.1|  PREDICTED: probable E3 ubiquitin-protein lig...    147   7e-40   
ref|XP_011071265.1|  PREDICTED: probable E3 ubiquitin-protein lig...    144   2e-39   
ref|XP_011078516.1|  PREDICTED: RING-H2 finger protein ATL14-like       145   2e-39   
ref|XP_009619231.1|  PREDICTED: probable E3 ubiquitin-protein lig...    141   6e-38   
ref|XP_006366058.1|  PREDICTED: E3 ubiquitin-protein ligase RHA2A...    132   2e-34   
ref|XP_011078524.1|  PREDICTED: putative RING-H2 finger protein A...    130   4e-34   
ref|XP_006348600.1|  PREDICTED: RING-H2 finger protein ATL74-like       131   5e-34   
emb|CBI27117.3|  unnamed protein product                                131   7e-34   
ref|XP_010648263.1|  PREDICTED: E3 ubiquitin-protein ligase RNF38...    130   2e-33   
ref|XP_010648268.1|  PREDICTED: probable E3 ubiquitin-protein lig...    126   5e-32   
ref|XP_010648283.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    123   1e-30   
ref|XP_010319436.1|  PREDICTED: probable E3 ubiquitin-protein lig...    121   3e-30   
emb|CAN82925.1|  hypothetical protein VITISV_039591                     123   1e-29   Vitis vinifera
gb|EYU28932.1|  hypothetical protein MIMGU_mgv1a024839mg                117   6e-29   
ref|XP_010648258.1|  PREDICTED: probable E3 ubiquitin-protein lig...    118   7e-29   
ref|XP_009775194.1|  PREDICTED: RING-H2 zinc finger protein RHA1a...    117   1e-28   
ref|XP_010648275.1|  PREDICTED: RING-H2 finger protein ATL51-like       114   3e-27   
gb|EYU28933.1|  hypothetical protein MIMGU_mgv1a018816mg                112   7e-27   
emb|CAN82924.1|  hypothetical protein VITISV_039590                     113   8e-26   Vitis vinifera
ref|XP_010648272.1|  PREDICTED: RING-H2 finger protein ATL13-like       108   2e-25   
ref|XP_011078534.1|  PREDICTED: probable E3 ubiquitin-protein lig...    105   2e-24   
ref|XP_007044741.1|  RING/U-box superfamily protein, putative           106   2e-24   
gb|KDP29327.1|  hypothetical protein JCGZ_18248                         104   3e-24   
gb|KDP43269.1|  hypothetical protein JCGZ_22821                         100   9e-23   
emb|CBI27118.3|  unnamed protein product                              99.8    1e-22   
ref|XP_010262120.1|  PREDICTED: E3 ubiquitin-protein ligase RHA2A...  99.8    5e-22   
emb|CBI27119.3|  unnamed protein product                              97.1    1e-21   
gb|ABK95295.1|  unknown                                               96.7    3e-21   Populus trichocarpa [western balsam poplar]
ref|XP_006378513.1|  hypothetical protein POPTR_0010s14320g           96.3    5e-21   
ref|XP_002314901.1|  hypothetical protein POPTR_0010s14330g           95.9    6e-21   Populus trichocarpa [western balsam poplar]
ref|XP_004490372.1|  PREDICTED: RING-H2 finger protein ATL54-like     95.5    9e-21   
ref|XP_002514525.1|  conserved hypothetical protein                   93.2    6e-20   Ricinus communis
ref|XP_004516175.1|  PREDICTED: RING-H2 finger protein ATL54-like     93.2    7e-20   
ref|XP_003613638.1|  E3 ubiquitin-protein ligase                      93.2    1e-19   
ref|XP_007045658.1|  RING/U-box superfamily protein, putative         92.4    1e-19   
gb|KEH34204.1|  zinc finger, C3HC4 type (RING finger) protein         92.0    2e-19   
ref|XP_011015548.1|  PREDICTED: probable E3 ubiquitin-protein lig...  91.7    2e-19   
gb|AFK42024.1|  unknown                                               91.7    2e-19   
ref|XP_003613640.1|  E3 ubiquitin-protein ligase                      91.3    3e-19   
ref|XP_003615334.1|  E3 ubiquitin-protein ligase                      90.9    5e-19   
ref|XP_002314902.1|  hypothetical protein POPTR_0010s14370g           90.5    5e-19   Populus trichocarpa [western balsam poplar]
ref|XP_003613639.1|  RING finger protein                              90.9    5e-19   
ref|XP_007022349.1|  RING/U-box superfamily protein, putative         91.7    7e-19   
ref|XP_007225990.1|  hypothetical protein PRUPE_ppa012865mg           90.1    1e-18   
gb|AFK45483.1|  unknown                                               89.7    1e-18   
ref|XP_003615333.1|  E3 ubiquitin-protein ligase                      89.7    1e-18   
ref|XP_010091703.1|  E3 ubiquitin-protein ligase RHA2A                90.5    2e-18   
ref|XP_010321171.1|  PREDICTED: E3 ubiquitin-protein ligase RHA2A...  87.4    2e-18   
ref|XP_004490371.1|  PREDICTED: RING-H2 finger protein ATL47-like     89.0    2e-18   
gb|KEH34205.1|  anaphase-promoting complex subunit 11 RING-H2 fin...  89.0    1e-17   
ref|XP_010068769.1|  PREDICTED: RING-H2 finger protein ATL46-like     86.7    3e-17   
ref|XP_006437778.1|  hypothetical protein CICLE_v10033401mg           85.5    4e-17   
ref|XP_004490370.1|  PREDICTED: RING-H2 finger protein ATL47-like     85.1    6e-17   
ref|XP_010068767.1|  PREDICTED: NEP1-interacting protein-like 2       85.9    7e-17   
ref|XP_008389340.1|  PREDICTED: probable E3 ubiquitin-protein lig...  85.1    7e-17   
gb|KDO70160.1|  hypothetical protein CISIN_1g042112mg                 84.7    7e-17   
ref|XP_011008959.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  84.3    1e-16   
ref|XP_007153423.1|  hypothetical protein PHAVU_003G034000g           83.6    3e-16   
ref|XP_008243400.1|  PREDICTED: E3 ubiquitin-protein ligase Os03g...  84.3    4e-16   
gb|KCW64814.1|  hypothetical protein EUGRSUZ_G02385                   82.4    5e-16   
ref|XP_008339729.1|  PREDICTED: RING-H2 finger protein ATL11-like     82.8    5e-16   
gb|KHN17843.1|  RING-H2 finger protein ATL47                          80.9    9e-16   
ref|XP_006437779.1|  hypothetical protein CICLE_v10033150mg           79.7    2e-15   
ref|XP_010068768.1|  PREDICTED: NEP1-interacting protein-like 2       80.9    3e-15   
ref|XP_010091706.1|  E3 ubiquitin-protein ligase RHA2A                82.0    5e-15   
gb|KCW64815.1|  hypothetical protein EUGRSUZ_G02386                   79.3    7e-15   
ref|XP_007163619.1|  hypothetical protein PHAVU_001G249600g           77.0    6e-14   
gb|KEH41382.1|  zinc finger, C3HC4 type (RING finger) protein         77.8    7e-14   
ref|XP_009407107.1|  PREDICTED: RING-H2 zinc finger protein RHA1a...  75.5    1e-13   
ref|XP_003169396.1|  RING finger protein                              80.1    2e-13   
gb|KCW64816.1|  hypothetical protein EUGRSUZ_G02387                   75.5    2e-13   
ref|XP_010068771.1|  PREDICTED: NEP1-interacting protein-like 2       75.9    2e-13   
emb|CDP01401.1|  unnamed protein product                              75.5    2e-13   
ref|XP_007048067.1|  RING-H2 zinc finger protein RHA2a                75.1    2e-13   
ref|XP_009336385.1|  PREDICTED: probable E3 ubiquitin-protein lig...  75.1    3e-13   
ref|XP_006591402.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  74.7    3e-13   
ref|XP_002309999.1|  hypothetical protein POPTR_0007s06120g           74.3    5e-13   Populus trichocarpa [western balsam poplar]
ref|XP_008792459.1|  PREDICTED: probable E3 ubiquitin-protein lig...  73.6    6e-13   
ref|XP_010053738.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  73.6    9e-13   
ref|XP_011005645.1|  PREDICTED: probable E3 ubiquitin-protein lig...  73.6    9e-13   
ref|XP_006829206.1|  hypothetical protein AMTR_s00001p00271850        73.2    1e-12   
ref|XP_002306334.2|  hypothetical protein POPTR_0005s08300g           73.2    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_003233722.1|  RING finger protein                              77.0    1e-12   
ref|XP_006601942.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  72.8    2e-12   
ref|XP_010068773.1|  PREDICTED: NEP1-interacting protein-like 2       72.8    2e-12   
ref|XP_007224697.1|  hypothetical protein PRUPE_ppa025457mg           72.0    2e-12   
ref|XP_002789519.1|  RING finger protein                              76.3    2e-12   Paracoccidioides lutzii Pb01
gb|AEI84328.1|  ubiquitin-protein ligase E3                           72.4    2e-12   
gb|EEH18624.2|  hypothetical protein PABG_07684                       76.3    2e-12   Paracoccidioides brasiliensis Pb03
gb|EEH38840.2|  RING finger protein                                   76.3    2e-12   Paracoccidioides lutzii Pb01
ref|XP_010756818.1|  hypothetical protein PADG_01194                  76.3    2e-12   
ref|XP_009416377.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    2e-12   
gb|KDP28595.1|  hypothetical protein JCGZ_14366                       72.4    2e-12   
ref|XP_008805361.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  73.2    3e-12   
ref|XP_009631296.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    3e-12   
ref|XP_009356505.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...  72.0    3e-12   
ref|XP_009797902.1|  PREDICTED: probable E3 ubiquitin-protein lig...  71.6    4e-12   
ref|XP_009356559.1|  PREDICTED: E3 ubiquitin-protein ligase EL5-like  71.6    4e-12   
gb|EGD94093.1|  hypothetical protein TESG_01619                       75.5    4e-12   
gb|EZF36301.1|  hypothetical protein H101_00177                       75.5    4e-12   
gb|EGE06657.1|  RING finger protein                                   75.5    4e-12   
emb|CCX29987.1|  Similar to Uncharacterized RING finger protein P...  75.5    4e-12   
emb|CDP00531.1|  unnamed protein product                              72.0    5e-12   
emb|CDM80745.1|  unnamed protein product                              72.0    5e-12   
gb|AEW09142.1|  hypothetical protein CL4264Contig1_01                 68.9    6e-12   
dbj|BAJ92167.1|  predicted protein                                    71.6    6e-12   
gb|KCW64817.1|  hypothetical protein EUGRSUZ_G02389                   70.9    6e-12   
dbj|BAJ92172.1|  predicted protein                                    70.9    6e-12   
ref|XP_010261166.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  71.2    7e-12   
ref|XP_002530038.1|  protein binding protein, putative                70.5    7e-12   Ricinus communis
ref|XP_004502459.1|  PREDICTED: RING-H2 finger protein ATL58-like     71.2    7e-12   
ref|XP_008245902.1|  PREDICTED: probable E3 ubiquitin-protein lig...  70.9    7e-12   
ref|NP_001052301.1|  Os04g0243700                                     69.7    8e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002511894.1|  zinc finger protein, putative                    70.9    8e-12   Ricinus communis
ref|XP_002304513.2|  hypothetical protein POPTR_0003s13080g           71.2    8e-12   Populus trichocarpa [western balsam poplar]
ref|XP_010682265.1|  PREDICTED: probable E3 ubiquitin-protein lig...  70.9    8e-12   
ref|XP_009385846.1|  PREDICTED: E3 ubiquitin-protein ligase ATL4-...  70.5    9e-12   
gb|AFG51138.1|  hypothetical protein CL4264Contig1_01                 68.6    9e-12   
ref|XP_010068770.1|  PREDICTED: uncharacterized protein LOC104455727  72.0    9e-12   
gb|KDP25403.1|  hypothetical protein JCGZ_20559                       70.5    1e-11   
emb|CDM27538.1|  Zinc finger, RING-CH-type                            74.3    1e-11   
ref|XP_007206044.1|  hypothetical protein PRUPE_ppa012579mg           70.5    1e-11   
gb|AFG51127.1|  hypothetical protein CL4264Contig1_01                 68.2    1e-11   
emb|CDP01174.1|  unnamed protein product                              70.5    1e-11   
ref|XP_002849653.1|  RING finger protein                              74.3    1e-11   Arthroderma otae CBS 113480
gb|AFK46654.1|  unknown                                               70.5    1e-11   
ref|XP_010652845.1|  PREDICTED: probable E3 ubiquitin-protein lig...  70.1    1e-11   
gb|AFG58067.1|  hypothetical protein 0_13343_01                       68.9    1e-11   
ref|XP_002509838.1|  zinc finger protein, putative                    70.1    2e-11   Ricinus communis
ref|XP_009419702.1|  PREDICTED: putative RING-H2 finger protein A...  70.1    2e-11   
ref|XP_009356506.1|  PREDICTED: NEP1-interacting protein-like 1 i...  69.7    2e-11   
gb|ABK24048.1|  unknown                                               70.5    2e-11   Picea sitchensis
ref|XP_002543170.1|  predicted protein                                73.2    2e-11   Uncinocarpus reesii 1704
ref|XP_003517474.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  69.3    2e-11   
gb|AFK38846.1|  unknown                                               69.3    2e-11   
ref|XP_006354695.1|  PREDICTED: probable E3 ubiquitin-protein lig...  69.7    2e-11   
ref|XP_004237431.1|  PREDICTED: probable E3 ubiquitin-protein lig...  69.7    2e-11   
ref|XP_002566014.1|  Pc22g21170                                       73.2    2e-11   Penicillium rubens Wisconsin 54-1255
gb|KGO67007.1|  Zinc finger, RING-type                                73.2    2e-11   
gb|KGO41483.1|  Zinc finger, RING-type                                73.2    2e-11   
gb|KGO77004.1|  Zinc finger, RING-type                                73.2    2e-11   
ref|XP_008347458.1|  PREDICTED: LOW QUALITY PROTEIN: probable E3 ...  68.9    2e-11   
ref|XP_003559771.1|  PREDICTED: E3 ubiquitin-protein ligase Os03g...  69.7    2e-11   
gb|AFK38566.1|  unknown                                               69.3    2e-11   
ref|XP_009349813.1|  PREDICTED: probable E3 ubiquitin-protein lig...  69.3    3e-11   
ref|XP_001399411.2|  RING finger protein                              73.2    3e-11   Aspergillus niger CBS 513.88
ref|XP_011005646.1|  PREDICTED: probable E3 ubiquitin-protein lig...  69.3    3e-11   
emb|CAK47555.1|  unnamed protein product                              73.2    3e-11   Aspergillus niger CBS 513.88
ref|XP_001208857.1|  conserved hypothetical protein                   73.2    3e-11   Aspergillus terreus NIH2624
gb|EKV09699.1|  RING finger protein                                   72.8    3e-11   
ref|XP_001260560.1|  RING finger protein                              72.8    3e-11   Aspergillus fischeri NRRL 181
ref|XP_006428110.1|  hypothetical protein CICLE_v100269541mg          68.6    3e-11   
ref|XP_003624004.1|  RING-H2 finger protein ATL5F                     70.9    3e-11   
gb|KDP35198.1|  hypothetical protein JCGZ_09357                       69.3    3e-11   
ref|XP_004302206.1|  PREDICTED: E3 ubiquitin-protein ligase RHA2A...  69.3    3e-11   
gb|EQL36403.1|  hypothetical protein BDFG_02136                       72.8    3e-11   
gb|ABD28706.1|  Zinc finger, RING-type                                69.3    3e-11   Medicago truncatula
gb|EGE78527.1|  RING finger protein                                   72.8    3e-11   
gb|EEQ92195.1|  RING finger protein                                   72.8    3e-11   Blastomyces dermatitidis ER-3
ref|XP_002622617.1|  RING finger protein                              72.8    3e-11   Blastomyces gilchristii SLH14081
gb|KEY82908.1|  RING finger                                           72.8    3e-11   
ref|XP_001481667.1|  RING finger protein                              72.8    3e-11   Aspergillus fumigatus Af293
gb|EPS28917.1|  hypothetical protein PDE_03863                        72.8    3e-11   
ref|NP_001042675.1|  Os01g0266100                                     69.7    4e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002320813.2|  brassinosteroid-responsive ring-H2 family pr...  68.9    4e-11   Populus trichocarpa [western balsam poplar]
gb|KDO44151.1|  hypothetical protein CISIN_1g047964mg                 68.9    4e-11   
ref|XP_010531543.1|  PREDICTED: probable E3 ubiquitin-protein lig...  68.6    4e-11   
ref|XP_011090632.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13...  68.6    5e-11   
gb|EAZ11351.1|  hypothetical protein OsJ_01218                        70.1    5e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001275379.1|  RING finger protein                              72.0    5e-11   Aspergillus clavatus NRRL 1
ref|XP_009391629.1|  PREDICTED: putative RING-H2 finger protein A...  68.6    5e-11   
ref|XP_003581640.1|  PREDICTED: E3 ubiquitin-protein ligase ATL23...  67.4    6e-11   
ref|XP_004306753.1|  PREDICTED: RING-H2 zinc finger protein RHA1a...  68.6    6e-11   
ref|XP_003551995.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...  67.8    6e-11   
emb|CDP08780.1|  unnamed protein product                              68.6    6e-11   
ref|XP_002838644.1|  hypothetical protein                             71.6    6e-11   Tuber melanosporum Mel28
ref|XP_004134321.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  68.2    6e-11   
ref|XP_002310001.2|  hypothetical protein POPTR_0007s06140g           68.2    7e-11   Populus trichocarpa [western balsam poplar]
gb|KGN56500.1|  Zinc finger protein                                   68.6    7e-11   
ref|XP_003525383.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  68.2    7e-11   
ref|XP_011005648.1|  PREDICTED: receptor homology region, transme...  68.2    7e-11   
gb|EFW17913.1|  conserved hypothetical protein                        71.6    8e-11   
ref|XP_003070564.1|  C3HC4 type (RING finger) zinc finger contain...  71.6    8e-11   
dbj|BAJ95364.1|  predicted protein                                    68.6    8e-11   
ref|XP_006852368.1|  hypothetical protein AMTR_s00049p00223430        67.8    8e-11   
ref|XP_004503686.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  68.2    8e-11   
ref|XP_008438014.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  68.2    8e-11   
gb|EYE97541.1|  hypothetical protein EURHEDRAFT_298165                71.6    8e-11   
ref|XP_003565628.1|  PREDICTED: E3 ubiquitin-protein ligase EL5-like  68.9    8e-11   
ref|XP_002278353.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B     67.8    9e-11   Vitis vinifera
ref|XP_011042399.1|  PREDICTED: probable E3 ubiquitin-protein lig...  67.4    9e-11   
tpe|CBF70565.1|  TPA: RING finger protein (AFU_orthologue; AFUA_2...  71.2    9e-11   
gb|KDP35200.1|  hypothetical protein JCGZ_09359                       67.8    1e-10   
gb|ACJ86080.1|  unknown                                               67.8    1e-10   Medicago truncatula
ref|XP_002480992.1|  RING finger protein                              71.2    1e-10   Talaromyces stipitatus ATCC 10500
gb|KDP26691.1|  hypothetical protein JCGZ_17849                       67.0    1e-10   
ref|XP_008377473.1|  PREDICTED: probable E3 ubiquitin-protein lig...  67.4    1e-10   
ref|NP_001147218.1|  RING zinc finger protein-like                    68.6    1e-10   Zea mays [maize]
ref|XP_002314594.1|  zinc finger family protein                       67.0    1e-10   Populus trichocarpa [western balsam poplar]
gb|KGN50076.1|  hypothetical protein Csa_5G152910                     67.8    1e-10   
ref|XP_009104310.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  67.8    1e-10   
ref|XP_008437313.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  67.8    1e-10   
ref|XP_003602018.1|  RING finger family protein                       67.0    1e-10   
ref|XP_009389777.1|  PREDICTED: RING-H2 zinc finger protein RHA1a...  67.4    1e-10   
ref|XP_008723920.1|  hypothetical protein G647_09705                  70.9    1e-10   
tpg|DAA38422.1|  TPA: putative RING zinc finger domain superfamil...  66.2    2e-10   
gb|EAZ05189.1|  hypothetical protein OsI_27387                        67.4    2e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_007051746.1|  Zinc finger protein, putative                    67.4    2e-10   
ref|NP_001060682.1|  Os07g0686300                                     67.4    2e-10   Oryza sativa Japonica Group [Japonica rice]
gb|KGN44779.1|  hypothetical protein Csa_7G387140                     67.0    2e-10   
ref|XP_007160094.1|  hypothetical protein PHAVU_002G291800g           67.0    2e-10   
ref|XP_006846910.1|  hypothetical protein AMTR_s00152p00054630        65.9    2e-10   
ref|XP_002310000.1|  hypothetical protein POPTR_0007s06130g           67.0    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_009385928.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  67.4    2e-10   
gb|KGN65722.1|  hypothetical protein Csa_1G521990                     65.9    2e-10   
ref|XP_003611072.1|  RING zinc finger protein-like protein            66.2    2e-10   
ref|XP_003532420.1|  PREDICTED: RING-H2 zinc finger protein RHA1a...  66.6    2e-10   
ref|XP_011036824.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B     66.6    2e-10   
ref|XP_002533929.1|  conserved hypothetical protein                   66.2    2e-10   Ricinus communis
gb|KHN38206.1|  E3 ubiquitin-protein ligase RHA2A                     66.6    2e-10   
ref|NP_001148030.1|  LOC100281639                                     65.9    2e-10   Zea mays [maize]
ref|XP_003834029.1|  hypothetical protein LEMA_P056980.1              70.1    2e-10   
gb|KFX48105.1|  putative RING finger protein P4H10.07                 70.1    2e-10   
ref|XP_002151977.1|  RING finger protein                              70.1    2e-10   Talaromyces marneffei ATCC 18224
ref|XP_003607396.1|  RING finger family protein                       66.6    2e-10   
ref|XP_006585295.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.6    2e-10   
ref|XP_009398972.1|  PREDICTED: E3 ubiquitin-protein ligase RHA2A...  66.2    2e-10   
ref|XP_010511752.1|  PREDICTED: probable E3 ubiquitin-protein lig...  65.9    2e-10   
ref|XP_002377830.1|  RING finger protein                              70.1    3e-10   Aspergillus flavus NRRL3357
ref|XP_001826162.2|  RING finger protein                              70.1    3e-10   Aspergillus oryzae RIB40
ref|XP_009117848.1|  PREDICTED: E3 ubiquitin-protein ligase RHA2A...  66.2    3e-10   
ref|XP_010279400.1|  PREDICTED: E3 ubiquitin-protein ligase RHA2A...  66.6    3e-10   
dbj|GAA82395.1|  RING finger protein                                  69.7    3e-10   
gb|KGN65717.1|  hypothetical protein Csa_1G514470                     66.2    3e-10   
ref|XP_006580294.1|  PREDICTED: RING-H2 finger protein ATL16-like     66.2    3e-10   
ref|XP_006652133.1|  PREDICTED: E3 ubiquitin-protein ligase RHA2A...  65.5    3e-10   
gb|KCW72619.1|  hypothetical protein EUGRSUZ_E01080                   65.1    3e-10   
ref|XP_011045970.1|  PREDICTED: RING-H2 finger protein ATL52-like     67.0    3e-10   
ref|XP_002306335.2|  hypothetical protein POPTR_0005s08310g           66.2    3e-10   Populus trichocarpa [western balsam poplar]
gb|EYU30627.1|  hypothetical protein MIMGU_mgv1a015982mg              65.9    3e-10   
ref|XP_004143977.1|  PREDICTED: RING-H2 zinc finger protein RHA1a...  65.5    3e-10   
ref|NP_001085602.1|  E3 ubiquitin-protein ligase RNF181               66.2    3e-10   Xenopus laevis [clawed frog]
gb|AES89593.2|  zinc finger, C3HC4 type (RING finger) protein         64.3    4e-10   
ref|XP_004167491.1|  PREDICTED: E3 ubiquitin-protein ligase ATL9-...  65.9    4e-10   
gb|EYU31059.1|  hypothetical protein MIMGU_mgv1a025402mg              65.9    4e-10   
ref|XP_006439498.1|  hypothetical protein CICLE_v10024600mg           66.2    4e-10   
ref|XP_010676446.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B     66.2    4e-10   
ref|XP_007757738.1|  hypothetical protein A1O7_05539                  69.3    4e-10   
ref|XP_010316436.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13     65.1    4e-10   
ref|XP_011034058.1|  PREDICTED: probable E3 ubiquitin-protein lig...  65.5    4e-10   
gb|KEQ96285.1|  hypothetical protein AUEXF2481DRAFT_28982             69.3    4e-10   
ref|XP_009382802.1|  PREDICTED: RING-H2 zinc finger protein RHA1a...  65.5    4e-10   
ref|XP_007135103.1|  hypothetical protein PHAVU_010G101100g           66.6    4e-10   
ref|XP_006444986.1|  hypothetical protein CICLE_v10024594mg           65.9    4e-10   
ref|XP_008440648.1|  PREDICTED: probable E3 ubiquitin-protein lig...  66.2    5e-10   
ref|XP_004494894.1|  PREDICTED: RING-H2 finger protein ATL3-like      67.8    5e-10   
ref|XP_007223707.1|  hypothetical protein PRUPE_ppa013029mg           65.5    5e-10   
ref|XP_001241541.1|  hypothetical protein CIMG_08704                  68.9    5e-10   Coccidioides immitis RS
gb|KGN48781.1|  hypothetical protein Csa_6G501220                     65.9    5e-10   
gb|EAS27791.2|  RING finger protein                                   68.9    5e-10   
ref|XP_002279473.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  65.9    5e-10   Vitis vinifera
ref|XP_002308266.1|  hypothetical protein POPTR_0006s14650g           66.2    5e-10   Populus trichocarpa [western balsam poplar]
ref|XP_004153928.1|  PREDICTED: RING-H2 finger protein ATL65-like     64.3    6e-10   
gb|KEH17501.1|  zinc finger, C3HC4 type (RING finger) protein         65.1    6e-10   
gb|AFK35856.1|  unknown                                               65.5    6e-10   
gb|EPS62085.1|  hypothetical protein M569_12708                       63.9    6e-10   
ref|XP_010545532.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  65.5    6e-10   
ref|XP_004958761.1|  PREDICTED: E3 ubiquitin-protein ligase EL5-like  65.9    7e-10   
gb|KDO71313.1|  hypothetical protein CISIN_1g048466mg                 64.7    7e-10   
ref|XP_002892849.1|  ring-H2 finger A2A                               65.1    7e-10   
dbj|BAK07063.1|  predicted protein                                    64.3    7e-10   
ref|NP_565253.1|  putative E3 ubiquitin-protein ligase RHA2B          65.1    8e-10   
ref|XP_009400588.1|  PREDICTED: RING-H2 finger protein ATL44-like     64.7    8e-10   
ref|XP_006352270.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  65.1    8e-10   
ref|XP_010099926.1|  E3 ubiquitin-protein ligase RHA2A                65.1    8e-10   
emb|CDY57513.1|  BnaC07g48760D                                        65.1    8e-10   
ref|XP_003299366.1|  hypothetical protein PTT_10342                   68.6    8e-10   
ref|XP_006300419.1|  hypothetical protein CARUB_v10021695mg           64.7    8e-10   
ref|XP_002452750.1|  hypothetical protein SORBIDRAFT_04g031740        65.5    8e-10   
ref|XP_008663464.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  65.5    9e-10   
ref|XP_002461249.1|  hypothetical protein SORBIDRAFT_02g043600        65.5    9e-10   
ref|XP_010052502.1|  PREDICTED: RING-H2 finger protein ATL40-like     66.2    9e-10   
ref|NP_001238215.1|  uncharacterized protein LOC100527069             64.7    9e-10   
ref|XP_010242154.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  65.1    1e-09   
ref|XP_009367791.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  65.1    1e-09   
ref|XP_008238938.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B     65.1    1e-09   
ref|XP_006438251.1|  hypothetical protein CICLE_v10032987mg           64.7    1e-09   
ref|XP_004160161.1|  PREDICTED: RING finger protein 150-like          65.5    1e-09   
gb|KCW72617.1|  hypothetical protein EUGRSUZ_E01078                   65.1    1e-09   
ref|NP_001235495.1|  uncharacterized protein LOC100500261             65.1    1e-09   
gb|KGN65715.1|  hypothetical protein Csa_1G512470                     64.3    1e-09   
ref|XP_010544753.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  65.1    1e-09   
ref|XP_002311762.1|  zinc finger family protein                       64.3    1e-09   
dbj|GAM88366.1|  hypothetical protein ANO11243_063990                 65.9    1e-09   
ref|XP_011022635.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  64.7    1e-09   
ref|XP_008775840.1|  PREDICTED: RING-H2 zinc finger protein RHA1a...  64.7    1e-09   
ref|XP_010470718.1|  PREDICTED: probable E3 ubiquitin-protein lig...  63.9    1e-09   
dbj|GAD93799.1|  hypothetical protein PVAR5_2414                      67.8    1e-09   
ref|XP_006483954.1|  PREDICTED: uncharacterized RING finger prote...  64.3    1e-09   
emb|CEL62384.1|  putative RING finger protein P4H10,07 OS=Schizos...  67.8    1e-09   
ref|XP_006590507.1|  PREDICTED: RING-H2 zinc finger protein RHA1a...  64.3    1e-09   
ref|XP_007218525.1|  hypothetical protein PRUPE_ppa012584mg           64.3    1e-09   
ref|XP_002879982.1|  zinc finger family protein                       65.5    2e-09   
ref|XP_010496835.1|  PREDICTED: E3 ubiquitin-protein ligase RHA2A     64.3    2e-09   
dbj|BAJ92872.1|  predicted protein                                    64.7    2e-09   
ref|XP_003528843.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  64.3    2e-09   
ref|XP_007156323.1|  hypothetical protein PHAVU_003G276800g           64.7    2e-09   
gb|EYU30022.1|  hypothetical protein MIMGU_mgv1a014929mg              64.3    2e-09   
ref|XP_003601903.1|  RING-H2 finger protein                           63.9    2e-09   
gb|ENI00179.1|  hypothetical protein COCC4DRAFT_116448                67.4    2e-09   
ref|XP_007709566.1|  hypothetical protein COCCADRAFT_58447            67.4    2e-09   
gb|KEQ63991.1|  hypothetical protein M437DRAFT_45956                  67.4    2e-09   
ref|XP_007005904.1|  hypothetical protein TREMEDRAFT_74232            67.4    2e-09   
ref|XP_007699041.1|  hypothetical protein COCSADRAFT_25649            67.4    2e-09   
ref|XP_007209705.1|  hypothetical protein PRUPE_ppa012459mg           64.3    2e-09   
ref|XP_010214728.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  66.6    2e-09   
ref|XP_010476589.1|  PREDICTED: E3 ubiquitin-protein ligase RHA2A...  63.9    2e-09   
gb|EMD85345.1|  hypothetical protein COCHEDRAFT_1119296               67.0    2e-09   
ref|XP_007690534.1|  hypothetical protein COCMIDRAFT_102184           67.0    2e-09   
ref|XP_007040308.1|  RING-H2 zinc finger protein RHA1a, putative      65.5    2e-09   
ref|XP_006425388.1|  hypothetical protein CICLE_v10027145mg           63.9    2e-09   
gb|EUN24389.1|  hypothetical protein COCVIDRAFT_40099                 67.0    2e-09   
ref|XP_004298823.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  64.3    2e-09   
ref|XP_011086652.1|  PREDICTED: probable E3 ubiquitin-protein lig...  63.9    2e-09   
ref|XP_001536936.1|  predicted protein                                67.0    2e-09   
ref|NP_001011200.1|  E3 ubiquitin-protein ligase RNF181               63.9    2e-09   
ref|XP_010112947.1|  E3 ubiquitin-protein ligase RHA1B                64.3    2e-09   
ref|XP_004167492.1|  PREDICTED: E3 ubiquitin-protein ligase ATL9-...  63.2    2e-09   
emb|CDY51570.1|  BnaCnng20990D                                        63.9    2e-09   
gb|ACR36207.1|  unknown                                               63.9    2e-09   
gb|EEH04513.1|  RING finger domain-containing protein                 67.0    2e-09   
emb|CDY65489.1|  BnaA03g57680D                                        63.9    2e-09   
ref|XP_009138770.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  64.3    2e-09   
ref|XP_006658982.1|  PREDICTED: E3 ubiquitin-protein ligase RHA2A...  63.9    2e-09   
ref|XP_006416944.1|  hypothetical protein EUTSA_v10008995mg           63.9    2e-09   
gb|EGC48581.1|  RING finger protein                                   67.0    2e-09   
gb|KHN44371.1|  E3 ubiquitin-protein ligase                           63.5    2e-09   
ref|XP_001933425.1|  conserved hypothetical protein                   67.0    2e-09   
gb|EER40207.1|  RING finger domain-containing protein                 67.0    2e-09   
dbj|BAE65029.1|  unnamed protein product                              64.7    2e-09   
ref|XP_002312419.1|  RING-H2 zinc finger protein RHA2a                63.9    2e-09   
ref|XP_010275692.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  63.9    2e-09   
emb|CDP12054.1|  unnamed protein product                              63.9    2e-09   
gb|AEQ67396.1|  RING finger protein                                   63.5    2e-09   
ref|XP_002283507.1|  PREDICTED: E3 ubiquitin-protein ligase RHA2A     63.9    2e-09   
dbj|BAD73152.1|  hypothetical protein                                 65.1    3e-09   
gb|KFH66416.1|  hypothetical protein MVEG_06941                       67.0    3e-09   
ref|XP_004244617.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  63.5    3e-09   
emb|CDY68559.1|  BnaAnng27640D                                        63.5    3e-09   
ref|XP_004975095.1|  PREDICTED: E3 ubiquitin-protein ligase RHA2A...  62.8    3e-09   
ref|XP_009136131.1|  PREDICTED: E3 ubiquitin-protein ligase ATL4-...  63.5    3e-09   
ref|XP_007158517.1|  hypothetical protein PHAVU_002G158800g           64.7    3e-09   
gb|EKD02884.1|  hypothetical protein A1Q2_02828                       66.6    3e-09   
gb|EJT51707.1|  hypothetical protein A1Q1_07119                       66.6    3e-09   
ref|XP_009764969.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  63.5    3e-09   
ref|XP_007271795.1|  hypothetical protein FOMMEDRAFT_162307           67.0    3e-09   
ref|XP_004243404.1|  PREDICTED: RING-H2 finger protein ATL40-like     64.7    3e-09   
gb|AEW07554.1|  hypothetical protein 0_5030_02                        61.6    3e-09   
gb|EME43848.1|  hypothetical protein DOTSEDRAFT_44183                 66.6    3e-09   
ref|XP_008783522.1|  PREDICTED: putative RING-H2 finger protein A...  63.5    3e-09   
ref|XP_006303368.1|  hypothetical protein CARUB_v10010511mg           63.5    3e-09   
ref|NP_172962.1|  E3 ubiquitin-protein ligase RHA2A                   63.5    3e-09   
ref|XP_006652689.1|  PREDICTED: E3 ubiquitin-protein ligase EL5-like  63.5    3e-09   
ref|XP_007039326.1|  Brassinosteroid-responsive RING-H2, putative     63.5    3e-09   
gb|EYU23457.1|  hypothetical protein MIMGU_mgv1a015010mg              63.5    3e-09   
ref|XP_010919096.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B     63.9    3e-09   
ref|XP_010506058.1|  PREDICTED: E3 ubiquitin-protein ligase ATL41...  64.7    3e-09   
ref|XP_009153429.1|  hypothetical protein HMPREF1120_01169            66.6    3e-09   
ref|XP_006348844.1|  PREDICTED: E3 ubiquitin-protein ligase ATL41...  64.7    3e-09   
ref|XP_010055679.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  63.5    4e-09   
ref|XP_008457568.1|  PREDICTED: RING-H2 finger protein ATL64-like     62.4    4e-09   
ref|XP_008449472.1|  PREDICTED: RING-H2 finger protein ATL40-like     64.3    4e-09   
ref|XP_002989820.1|  hypothetical protein SELMODRAFT_19757            61.2    4e-09   
ref|NP_001053650.1|  Os04g0580800                                     63.2    4e-09   
ref|XP_008245200.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...  62.4    4e-09   
gb|KHN17844.1|  RING-H2 finger protein ATL5                           63.2    4e-09   
ref|XP_010255270.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B     63.2    4e-09   
ref|XP_010517755.1|  PREDICTED: E3 ubiquitin-protein ligase ATL41     64.3    4e-09   
gb|KFK44486.1|  hypothetical protein AALP_AA1G263000                  62.8    4e-09   
ref|XP_007159736.1|  hypothetical protein PHAVU_002G263000g           63.2    4e-09   
ref|XP_011107100.1|  hypothetical protein H072_1108                   66.2    4e-09   
gb|EAY73006.1|  hypothetical protein OsI_00879                        64.3    4e-09   
ref|XP_007044820.1|  RING/U-box superfamily protein                   62.8    4e-09   
ref|XP_002298018.2|  hypothetical protein POPTR_0001s09700g           63.2    4e-09   
gb|EAZ31565.1|  hypothetical protein OsJ_15708                        63.5    4e-09   
ref|NP_001150893.1|  RING zinc finger protein-like                    63.9    4e-09   
ref|XP_008458180.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  63.2    4e-09   
gb|EMF13796.1|  hypothetical protein SEPMUDRAFT_125484                66.2    4e-09   
ref|XP_010023460.1|  PREDICTED: probable E3 ubiquitin-protein lig...  62.8    4e-09   
ref|XP_007163682.1|  hypothetical protein PHAVU_001G255200g           62.4    5e-09   
ref|XP_007907116.1|  PREDICTED: RING finger protein 165               63.9    5e-09   
ref|XP_011029328.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  63.2    5e-09   
ref|XP_006627171.1|  PREDICTED: RING finger protein 165-like isof...  65.5    5e-09   
ref|XP_002317051.1|  hypothetical protein POPTR_0011s15390g           63.2    5e-09   
ref|XP_006627172.1|  PREDICTED: RING finger protein 165-like isof...  65.5    5e-09   
ref|XP_004299221.1|  PREDICTED: RING finger protein 150-like          62.4    5e-09   
ref|XP_004135490.1|  PREDICTED: E3 ubiquitin-protein ligase RHA2A...  62.4    5e-09   
gb|ACR37714.1|  unknown                                               63.5    5e-09   
gb|KEQ73644.1|  hypothetical protein M436DRAFT_17540                  65.9    5e-09   
ref|XP_005161046.1|  PREDICTED: RING finger protein 165               65.1    5e-09   
ref|XP_007873938.1|  hypothetical protein PNEG_01961                  65.9    5e-09   
ref|XP_010920205.1|  PREDICTED: E3 ubiquitin-protein ligase RHA2A...  62.0    5e-09   
ref|XP_008670675.1|  PREDICTED: E3 ubiquitin-protein ligase EL5-like  63.2    5e-09   
emb|CBI21948.3|  unnamed protein product                              63.2    5e-09   
ref|XP_006402478.1|  hypothetical protein EUTSA_v10006258mg           63.2    5e-09   
gb|KEQ80600.1|  hypothetical protein M438DRAFT_281442                 65.9    5e-09   
gb|AEP25855.1|  putative ring zinc finger protein                     63.5    5e-09   
ref|XP_003852556.1|  hypothetical protein MYCGRDRAFT_104591           62.8    6e-09   
gb|EMT32136.1|  RING finger protein 165                               62.0    6e-09   
ref|XP_004167620.1|  PREDICTED: E3 ubiquitin-protein ligase ATL9-...  62.4    6e-09   
gb|ABK26550.1|  unknown                                               63.2    6e-09   
ref|XP_006294919.1|  hypothetical protein CARUB_v10023972mg           63.9    6e-09   
ref|XP_010662936.1|  PREDICTED: probable E3 ubiquitin-protein lig...  63.2    6e-09   
emb|CDY47965.1|  BnaA04g24430D                                        63.2    6e-09   
ref|XP_008221903.1|  PREDICTED: RING-H2 finger protein ATL47          62.4    6e-09   
emb|CCJ31220.1|  unnamed protein product                              65.9    6e-09   
ref|XP_002279296.2|  PREDICTED: RING-H2 finger protein ATL40-like     64.3    6e-09   
ref|XP_010089068.1|  RING-H2 zinc finger protein RHA1a                62.8    6e-09   
ref|XP_006291934.1|  hypothetical protein CARUB_v10018120mg           62.8    6e-09   
gb|ABK96609.1|  unknown                                               62.8    6e-09   
ref|NP_001137079.1|  LOC100217252                                     62.8    7e-09   
ref|XP_010523766.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B     62.8    7e-09   
ref|XP_009142056.1|  PREDICTED: RING-H2 finger protein ATL40-like     63.2    7e-09   
ref|XP_010459031.1|  PREDICTED: E3 ubiquitin-protein ligase RHA2A...  62.4    7e-09   
emb|CDY00851.1|  BnaCnng00510D                                        62.0    7e-09   
ref|XP_002302597.1|  brassinosteroid-responsive ring-H2 family pr...  62.4    7e-09   
ref|XP_011040639.1|  PREDICTED: E3 ubiquitin-protein ligase ATL59...  62.8    7e-09   
ref|XP_009142828.1|  PREDICTED: RING-H2 finger protein ATL40-like     63.5    7e-09   
ref|XP_005998785.1|  PREDICTED: E3 ubiquitin-protein ligase Arkad...  65.5    7e-09   
emb|CDY53487.1|  BnaC04g02690D                                        63.2    8e-09   
ref|XP_009410936.1|  PREDICTED: RING-H2 finger protein ATL39-like     63.5    8e-09   
ref|XP_008457566.1|  PREDICTED: RING-H2 finger protein ATL64-like     62.4    8e-09   
gb|ACG28545.1|  protein binding protein                               62.4    8e-09   
gb|KEH18831.1|  RING-H2 zinc finger RHA1a-like protein, putative      62.4    8e-09   
ref|XP_010099417.1|  RING-H2 finger protein ATL1                      62.4    8e-09   
ref|NP_001148352.1|  protein binding protein                          62.0    8e-09   
ref|XP_007044161.1|  RING-H2 finger A2A, putative                     62.4    9e-09   
gb|EKG10301.1|  Zinc finger RING-type protein                         65.1    9e-09   
gb|KHN38173.1|  E3 ubiquitin-protein ligase RNF181                    61.2    9e-09   
ref|XP_007247274.1|  PREDICTED: RING finger protein 165-like isof...  64.7    9e-09   
ref|XP_007247273.1|  PREDICTED: RING finger protein 165-like isof...  64.7    9e-09   
ref|XP_006584168.1|  PREDICTED: RING-H2 finger protein ATL52-like     62.0    9e-09   
ref|XP_008350938.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  61.6    9e-09   
ref|XP_007204439.1|  hypothetical protein PRUPE_ppa027002mg           61.2    9e-09   
ref|XP_007679380.1|  hypothetical protein BAUCODRAFT_76082            61.6    9e-09   
emb|CDY27877.1|  BnaA07g04670D                                        61.6    9e-09   
gb|ETL81239.1|  hypothetical protein L917_18380                       65.1    1e-08   
gb|AAZ73388.1|  At1g63840-like protein                                61.6    1e-08   
emb|CDP15904.1|  unnamed protein product                              63.5    1e-08   
ref|XP_003561224.1|  PREDICTED: E3 ubiquitin-protein ligase Os03g...  62.0    1e-08   
ref|XP_003890670.1|  hypothetical protein, variant                    63.9    1e-08   
ref|XP_010942890.1|  PREDICTED: probable E3 ubiquitin-protein lig...  62.0    1e-08   
ref|XP_010104909.1|  putative E3 ubiquitin-protein ligase RHA2B       62.0    1e-08   
ref|XP_006360432.1|  PREDICTED: E3 ubiquitin-protein ligase RHA2A...  62.0    1e-08   
emb|CDY36528.1|  BnaA06g09810D                                        62.0    1e-08   
ref|XP_009375028.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  62.0    1e-08   
ref|XP_010319406.1|  PREDICTED: E3 ubiquitin-protein ligase RHA2A     62.0    1e-08   
ref|XP_003320432.2|  hypothetical protein PGTG_01344                  64.3    1e-08   
ref|XP_009116810.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B     62.0    1e-08   
emb|CDX71735.1|  BnaC08g31390D                                        62.0    1e-08   
emb|CDY15083.1|  BnaC03g44440D                                        62.0    1e-08   
gb|EYU40076.1|  hypothetical protein MIMGU_mgv1a022249mg              62.0    1e-08   
ref|XP_009114249.1|  PREDICTED: probable E3 ubiquitin-protein lig...  61.6    1e-08   
gb|KCW77490.1|  hypothetical protein EUGRSUZ_D01827                   62.4    1e-08   
ref|XP_006302889.1|  hypothetical protein CARUB_v10021019mg           62.4    1e-08   
ref|XP_011080924.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  62.0    1e-08   
gb|KFK35332.1|  hypothetical protein AALP_AA5G271300                  62.0    1e-08   
ref|NP_191705.1|  brassinosteroid-responsive RING-H2                  62.0    1e-08   
ref|XP_007051422.1|  Binding protein, putative                        62.4    1e-08   
gb|EPZ32411.1|  hypothetical protein O9G_001313                       62.4    1e-08   
ref|XP_008793160.1|  PREDICTED: RING-H2 finger protein ATL39-like     62.8    1e-08   
ref|XP_009101366.1|  PREDICTED: probable E3 ubiquitin-protein lig...  61.6    1e-08   
ref|XP_009800798.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B     61.6    1e-08   
emb|CDY17693.1|  BnaA06g35120D                                        61.6    1e-08   
gb|AAZ73370.1|  At1g63840                                             61.2    1e-08   
ref|XP_004156099.1|  PREDICTED: E3 ubiquitin-protein ligase ATL41...  62.8    1e-08   
emb|CDX72540.1|  BnaC07g45620D                                        62.0    1e-08   
ref|XP_009400205.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  62.4    1e-08   
ref|XP_010533638.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  62.0    1e-08   
ref|XP_008644825.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  61.2    1e-08   
ref|XP_002515082.1|  protein binding protein, putative                61.6    1e-08   
ref|XP_001698236.1|  hypothetical protein CHLREDRAFT_120741           59.3    1e-08   
ref|XP_010053226.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  61.6    1e-08   
ref|XP_009607425.1|  PREDICTED: E3 ubiquitin-protein ligase RHA2A...  61.6    1e-08   
ref|XP_003633623.1|  PREDICTED: uncharacterized protein LOC100257890  63.5    2e-08   
ref|XP_004140242.1|  PREDICTED: E3 ubiquitin-protein ligase ATL41...  63.2    2e-08   
emb|CDX79876.1|  BnaA05g02800D                                        62.4    2e-08   
ref|XP_010469081.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  61.6    2e-08   



>ref|XP_009589815.1| PREDICTED: RING-H2 finger protein ATL17-like [Nicotiana tomentosiformis]
Length=181

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 115/175 (66%), Gaps = 9/175 (5%)
 Frame = +1

Query  112  AFIIVFIALICTFIFKKLLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQD-PYKFNV  288
            A    F+ +I ++IF K  QMFPQS++LNC+  +   LKWAW+ +L QS      Y F  
Sbjct  7    AISFFFLCIIFSYIFNKAFQMFPQSKLLNCIDFIVTHLKWAWNVVLFQSFSHSCNYNFTT  66

Query  289  VTGIM--SPENAASEVGVRVFEGESDG---AVECAVCLCKIEEGEEVRDLKCKHIFHRAC  453
            ++  +  +P +  +E+ VR FE +S     +VECA+CLCKIEEGEEVR+L+C H+FHR C
Sbjct  67   ISEDLARTPHDHNNELRVRHFEHDSGSNLDSVECAICLCKIEEGEEVRELRCDHLFHRVC  126

Query  454  LDRWVGTGRN-SCPLCRTHVKPAARLFGE-DLHQEVIVFDFCS-RRRDRCSWWLR  609
            LD W+  GRN +CPLCR H+KP A  F E   HQEVI  DF S R RDRC WWLR
Sbjct  127  LDNWMNCGRNMTCPLCRNHLKPNAVFFSELHHHQEVIHLDFLSGRSRDRCQWWLR  181



>ref|XP_009628650.1| PREDICTED: RING-H2 finger protein ATL18-like [Nicotiana tomentosiformis]
Length=178

 Score =   173 bits (438),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 116/174 (67%), Gaps = 15/174 (9%)
 Frame = +1

Query  115  FIIVFIALICTFIFKKLLQMFPQSR---VLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFN  285
            FI +FI++   +I KK L+ FP+S    VLN VV +A QLKWAW+ LLLQS    PY  +
Sbjct  11   FIFLFISI---YILKKTLKTFPRSSITIVLNYVVFIANQLKWAWEILLLQSFSH-PYNLS  66

Query  286  VVTGIMSPENAASEVGVRVF----EGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRAC  453
             ++     ++   E  + V     E ES G+VECAVCLCKIEEGEEVR+L+C H+FHR C
Sbjct  67   SISRNAHDQDQDHEHELEVMHYEPESESSGSVECAVCLCKIEEGEEVRELRCDHLFHRVC  126

Query  454  LDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEVIVFDFCS--RRRDRCSWWLR  609
            LDRW+GTG  +CPLCR H+KP   +   +LHQEVI FDF S  R RDR  WWLR
Sbjct  127  LDRWLGTGHMTCPLCRNHLKPPPLV--ANLHQEVISFDFVSGTRSRDRYHWWLR  178



>ref|XP_009589816.1| PREDICTED: RING-H2 finger protein ATL17-like [Nicotiana tomentosiformis]
Length=181

 Score =   173 bits (438),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 115/175 (66%), Gaps = 9/175 (5%)
 Frame = +1

Query  112  AFIIVFIALICTFIFKKLLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQD-PYKFNV  288
            A    F+++I + IFK+  QMFPQS++LN +  +   LKWAW+ +L QS      Y F  
Sbjct  7    AVSFFFLSIIFSSIFKRTFQMFPQSKILNYIDFIVTHLKWAWNVVLFQSFSHSCNYNFTT  66

Query  289  VT--GIMSPENAASEVGVRVFEGESDG---AVECAVCLCKIEEGEEVRDLKCKHIFHRAC  453
            ++     +P +  +E+ VR FE +S     AVECA+CLCKIEEGEEVR+L+C H+FHR C
Sbjct  67   ISEDAATTPHDHNNELRVRRFEHDSGSNLDAVECAICLCKIEEGEEVRELRCDHLFHRVC  126

Query  454  LDRWVGTGRN-SCPLCRTHVKPAARLFGE-DLHQEVIVFDFCS-RRRDRCSWWLR  609
            LD W+  GRN +CPLCR H+KP A  F E + HQEVI  +F S R RDRC WWLR
Sbjct  127  LDNWMNCGRNMTCPLCRNHLKPNAVFFSELNHHQEVIHLEFLSGRSRDRCQWWLR  181



>ref|XP_009799165.1| PREDICTED: E3 ubiquitin-protein ligase Os06g0535400-like [Nicotiana 
sylvestris]
Length=181

 Score =   171 bits (434),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 116/175 (66%), Gaps = 9/175 (5%)
 Frame = +1

Query  112  AFIIVFIALICTFIFKKLLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQD-PYKFNV  288
            A  I F+ +I ++IFKK  QMFPQS++L  +  +   LKWAW+ +L QS      Y F  
Sbjct  7    AISIFFLCIIFSYIFKKAFQMFPQSKLLKYIDFIVINLKWAWNVVLFQSFSHSCNYNFTA  66

Query  289  VT--GIMSPENAASEVGVRVFEGESDG---AVECAVCLCKIEEGEEVRDLKCKHIFHRAC  453
            ++     +P +  +E+ +R FE +S     +VECA+CLCKIEEGEEVR+L+C H+FHR C
Sbjct  67   ISEDAATTPHDHNNELRIRRFEHDSGSNLDSVECAICLCKIEEGEEVRELRCDHVFHRVC  126

Query  454  LDRWVGTGRN-SCPLCRTHVKPAARL-FGEDLHQEVIVFDFCS-RRRDRCSWWLR  609
            LDRW+  GRN +CPLCR H+KP A L F  + HQEVI  DF S R RDRC WW+R
Sbjct  127  LDRWINCGRNMTCPLCRNHLKPNAVLSFELNHHQEVIHLDFLSGRSRDRCQWWIR  181



>ref|XP_009594226.1| PREDICTED: RING-H2 finger protein ATL18-like [Nicotiana tomentosiformis]
Length=180

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 119/181 (66%), Gaps = 16/181 (9%)
 Frame = +1

Query  106  PHAFIIVFIAL--ICTFIFKKLLQMFPQSRV---LNCVVSVAAQLKWAWDCLLLQSLCQD  270
            P + +I F  L  I  +I KK L+ FP+S +   LN VV +A QLKWAW+ LLLQS    
Sbjct  3    PASSVITFFLLLFISIYILKKTLKKFPKSSITIALNYVVFMANQLKWAWEILLLQSFSH-  61

Query  271  PYKFNVVT----GIMSPENAASEVGVRVFE--GESDGAVECAVCLCKIEEGEEVRDLKCK  432
            PY  + ++         ++   E+ +  +E   ES G+VECAVCLCKIEEGEEVR+L+C 
Sbjct  62   PYNLSSISRNTHDQDQDQDQDHELEIMHYEPESESSGSVECAVCLCKIEEGEEVRELRCD  121

Query  433  HIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEVIVFDFCS--RRRDRCSWWL  606
            H+FHR CLDRW+GTGR +CPLCR H+KP   +   +LHQEVI+FDF S  R RDR  WW+
Sbjct  122  HLFHRVCLDRWLGTGRMTCPLCRNHLKPPPLV--ANLHQEVILFDFASGTRSRDRYEWWI  179

Query  607  R  609
            R
Sbjct  180  R  180



>ref|XP_009608788.1| PREDICTED: probable E3 ubiquitin-protein ligase RHA2B, partial 
[Nicotiana tomentosiformis]
Length=165

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 105/162 (65%), Gaps = 10/162 (6%)
 Frame = +1

Query  112  AFIIVFIALICTFIFKKLLQMFPQSR---VLNCVVSVAAQLKWAWDCLLLQSLCQDPYKF  282
            A   + +  I  +I KK L+ FP+S    VLN VV +A QLKWAW+ LLLQS    PY  
Sbjct  7    AITFLILLFISIYILKKTLKKFPRSSITIVLNYVVFIATQLKWAWEILLLQSFSH-PYNL  65

Query  283  NVVTGIMSPENAASEVGVRVF----EGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRA  450
            + ++     ++   +  + V     E ES G+VECAVCLCKIEEGEEVR+L+C H+FHR 
Sbjct  66   SSISRNAHDQDQDHDHELEVMHYEPESESSGSVECAVCLCKIEEGEEVRELRCDHLFHRV  125

Query  451  CLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEVIVFDFCS  576
            CLDRW+GTGR +CPLCR H+KP       +LHQEVI FDF S
Sbjct  126  CLDRWLGTGRMTCPLCRNHLKPPP--LVANLHQEVISFDFVS  165



>ref|XP_009778641.1| PREDICTED: probable E3 ubiquitin-protein ligase RHA2B [Nicotiana 
sylvestris]
Length=151

 Score =   160 bits (404),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 105/155 (68%), Gaps = 10/155 (6%)
 Frame = +1

Query  163  LLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRV  342
            +L MFP+S+V+N V S A +LKW WD LL QS     + +N+ T I    +A  E+GVR+
Sbjct  1    MLPMFPRSKVINFVYSTATKLKWIWDFLLFQSF---SHSYNINT-ISENSSAHDELGVRI  56

Query  343  FEGESDG---AVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVK  513
            FE ES     +VECAVCLCKIEEGEEVR+L+C H+FHR CLDRW+G GR +CPLCR ++ 
Sbjct  57   FEAESGSLLDSVECAVCLCKIEEGEEVRELRCNHLFHRVCLDRWLGYGRMTCPLCRNYLN  116

Query  514  --PAARLFGEDLHQEVIVFDFCS-RRRDRCSWWLR  609
              P       D++QEVI+FDF   R  DR  WWLR
Sbjct  117  NTPYCSHHFTDIYQEVILFDFIKVRSSDRRQWWLR  151



>ref|XP_010320794.1| PREDICTED: RING finger protein 150-like [Solanum lycopersicum]
Length=178

 Score =   160 bits (404),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 112/176 (64%), Gaps = 14/176 (8%)
 Frame = +1

Query  112  AFIIVFIALICTFIFKKLLQMFPQSR----VLNCVVSVAAQLKWAWDCLLLQSLCQDPYK  279
            A  I    L   +I KK L+M  +S     VLN VV +  QLKWAW+ LLLQS    P+ 
Sbjct  7    AITIFMFFLASIYILKKTLKMVHRSSSITIVLNYVVFIVTQLKWAWNVLLLQSFTH-PHN  65

Query  280  FNVVTGIMSPENAASEVGVRVFEGE----SDGAVECAVCLCKIEEGEEVRDLKCKHIFHR  447
               ++   + ++   E+ V  +E E    + G++EC+VCLCKIEEGEEVR+L+C H+FHR
Sbjct  66   LYTISS-QNDDDDDHELEVMHYEPEPGSSNSGSIECSVCLCKIEEGEEVRELRCDHLFHR  124

Query  448  ACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEVIVFDFC--SRRRDRCSWWLR  609
             CLDRW+G GR +CPLCR H+K    L   +LHQEV++FDF   +R RDRC WWLR
Sbjct  125  VCLDRWLGMGRMTCPLCRNHLKQPRLLV--NLHQEVVLFDFVEGTRSRDRCQWWLR  178



>ref|XP_009613668.1| PREDICTED: probable E3 ubiquitin-protein ligase RHA2B [Nicotiana 
tomentosiformis]
Length=166

 Score =   158 bits (399),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 112/175 (64%), Gaps = 18/175 (10%)
 Frame = +1

Query  106  PHAFIIVFIAL--ICTFIFKKLLQMFPQSRV---LNCVVSVAAQLKWAWDCLLLQSLCQD  270
            P + +I F  L  I  +I KK L+ FP+S +   LN VV +  QLKWAW+ LLLQS    
Sbjct  3    PASSVITFFLLLFISIYILKKTLKKFPRSSITIALNYVVFIVNQLKWAWEILLLQSFSH-  61

Query  271  PYKFNVVTGIMSPENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRA  450
            PY  +       P++    +     E ES G+VECAVCLCKIEEGEEVR+L+C H+FHR 
Sbjct  62   PYNLD-------PDHELKIMHYEP-ESESSGSVECAVCLCKIEEGEEVRELRCDHLFHRV  113

Query  451  CLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEVIVFDFCSRRRD--RCSWWLR  609
            CLDRW+G GR +CPLCR H+KP+  +   +L+QEVI+FDF S  R   R  WW+R
Sbjct  114  CLDRWLGRGRMTCPLCRNHLKPSPLV--ANLYQEVILFDFVSGTRSIYRYQWWIR  166



>ref|XP_009591206.1| PREDICTED: probable E3 ubiquitin-protein ligase RHA2B [Nicotiana 
tomentosiformis]
Length=142

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 105/145 (72%), Gaps = 14/145 (10%)
 Frame = +1

Query  172  MFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEG  351
            MFPQS++LN +V +AAQLKWA + +LLQS     Y +N  T I +P+    E+G+R F+ 
Sbjct  1    MFPQSKILNHIVFIAAQLKWALNYVLLQSF---SYPYNPTTNISTPQ----ELGIRRFQE  53

Query  352  ESDGA---VECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAA  522
            +  G+   VECAVCLCKIEEGEE+R+L+C H+FH+ CLDRW+G GR +CPLCR H+K + 
Sbjct  54   DELGSSESVECAVCLCKIEEGEEIRELRCDHLFHKVCLDRWMGCGRKTCPLCRNHLK-SP  112

Query  523  RLFGEDLHQEVIVFDFCS--RRRDR  591
             +F E LHQEVIV DF S   RRDR
Sbjct  113  TVFSE-LHQEVIVLDFFSGKSRRDR  136



>ref|XP_006348599.1| PREDICTED: E3 ubiquitin-protein ligase Arkadia-like [Solanum 
tuberosum]
Length=148

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 102/155 (66%), Gaps = 16/155 (10%)
 Frame = +1

Query  172  MFPQSR---VLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRV  342
            MF +S    VLN VV +  QLKWAW+ LLLQS    PY    +    S +N   E+ V  
Sbjct  1    MFHRSSITIVLNYVVFIITQLKWAWNILLLQSFTH-PYNLYTI----SSQNHDHELEVMH  55

Query  343  FEGE----SDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHV  510
            +E E    +  +VEC+VCLCKIEEGEEVR+L+C H+FHR CLDRW+G GR +CPLCR H+
Sbjct  56   YEPEPGSSNSDSVECSVCLCKIEEGEEVRELRCDHLFHRVCLDRWLGMGRMTCPLCRNHL  115

Query  511  KPAARLFGEDLHQEVIVFDFC--SRRRDRCSWWLR  609
            K    L   +LHQEV++FDF   +R RDRC WWLR
Sbjct  116  KQPRLLV--NLHQEVVLFDFVEGTRSRDRCQWWLR  148



>gb|EYU28931.1| hypothetical protein MIMGU_mgv1a022671mg [Erythranthe guttata]
Length=138

 Score =   146 bits (368),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 98/147 (67%), Gaps = 10/147 (7%)
 Frame = +1

Query  172  MFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEG  351
            M PQS VLN VV + AQLKWAWD LL QS       FN   G+  PE    ++ V + E 
Sbjct  1    MVPQSAVLNYVVWITAQLKWAWDYLLHQS-------FNP-NGVGLPEYTDDDLIVTIHES  52

Query  352  ESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLF  531
            E   + ECAVCLC+IEEG+EVR+L+C+H+FHRACLDRW+G G  +CPLCR +++    L 
Sbjct  53   EDSESDECAVCLCRIEEGDEVRELRCEHLFHRACLDRWLGYGHMTCPLCRNNLR-LPPLE  111

Query  532  GEDLHQEVIVFDF-CSRRRDRCSWWLR  609
              +LH E++V DF  +R  DRC WWLR
Sbjct  112  AAELHHELVVIDFGATRYSDRCVWWLR  138



>ref|XP_011078506.1| PREDICTED: probable E3 ubiquitin-protein ligase RHA2B [Sesamum 
indicum]
Length=182

 Score =   147 bits (371),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 111/176 (63%), Gaps = 13/176 (7%)
 Frame = +1

Query  97   PQYPHAFIIVFIALICTFIFKKLLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPY  276
            P+    F+ +FIALI     +++LQ+ P+S VLN ++ +A QLKWAWD +L QS  Q   
Sbjct  15   PKKQLQFLSLFIALIQN-PDEEMLQIMPKSLVLNYMILIATQLKWAWDYILYQSFFQP--  71

Query  277  KFNVVTGIMSPENAAS-EVGVRVFEGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRAC  453
                  GIM  E+  +  V     + +S+   ECAVCLC+IEEG+EVR+L+C H+FHR C
Sbjct  72   ---RAAGIMLHEHVDNFRVTHYTKDAKSEELEECAVCLCRIEEGDEVRELRCGHLFHRVC  128

Query  454  LDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEVIVFDFCS----RRRDRCSWWLR  609
            LDRW+G G  +CPLCR ++KP    F  +LH E++V +F +     R D C+WWLR
Sbjct  129  LDRWIGYGHVTCPLCRNNLKPPP--FAAELHHELVVINFYTAATRSRDDGCTWWLR  182



>ref|XP_011071265.1| PREDICTED: probable E3 ubiquitin-protein ligase RHA2B [Sesamum 
indicum]
Length=143

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 103/153 (67%), Gaps = 14/153 (9%)
 Frame = +1

Query  163  LLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRV  342
            +L++ PQS +LN VV +A QLKWAWD LL QS  Q             PE    E+ +R 
Sbjct  1    MLRIVPQSTLLNYVVLIATQLKWAWDYLLHQSFFQH-------HATRLPE-YVDELSIRE  52

Query  343  FEGES--DGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            FE ++  D  +ECAVCLCKI+EG+EVR+L+C H+FHR CLDRW+G G  +CPLCR+++K 
Sbjct  53   FESKNPEDHVIECAVCLCKIDEGDEVRELRCGHLFHRVCLDRWIGCGHGTCPLCRSNLKQ  112

Query  517  AARLFGEDLHQEVIVFDFCSRRR--DRCSWWLR  609
                F  +LH+E+IVFDFC+ R   +R +WWLR
Sbjct  113  PK--FVAELHRELIVFDFCTVRSGGERYTWWLR  143



>ref|XP_011078516.1| PREDICTED: RING-H2 finger protein ATL14-like [Sesamum indicum]
Length=172

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 104/155 (67%), Gaps = 16/155 (10%)
 Frame = +1

Query  154  FKKLLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVG  333
              ++LQM PQ  VLN VV+++ +LKWAWDCLL  S       F+   G+      A  + 
Sbjct  31   LPRMLQMVPQWVVLNYVVAISLRLKWAWDCLLFHS-------FSHPNGLRLQPEYADGLN  83

Query  334  VRVFEGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVK  513
            V+ +E +S+   ECAVCLCKI+E E+VR+L+C H FHRACLDRW+G G  +CPLCR++++
Sbjct  84   VKCYENDSE---ECAVCLCKIDEREDVRELRCNHSFHRACLDRWLGYGHMTCPLCRSNLR  140

Query  514  -PAARLFGEDLHQEVIVFDFC--SRRRDRCSWWLR  609
             P   +   DLHQE+I+ +FC  SR  DRC+WWLR
Sbjct  141  LPPGTV---DLHQELILINFCAASRYSDRCAWWLR  172



>ref|XP_009619231.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Nicotiana 
tomentosiformis]
Length=150

 Score =   141 bits (355),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 102/155 (66%), Gaps = 11/155 (7%)
 Frame = +1

Query  163  LLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRV  342
            +L MFP+S+VLN V S A +L+W WD   LQ+    PY  N V+   S   A  E+GVR+
Sbjct  1    MLPMFPRSKVLNFVYSTATKLEWTWD-FFLQTFSH-PYNINTVSENSS---ARDELGVRI  55

Query  343  FEGESDG---AVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVK  513
            FE ES     +V+CAVCLCKIEE EEVR+L+C H+FHR CLDRW+G GR +CPLCR ++ 
Sbjct  56   FEAESRSLLDSVKCAVCLCKIEEEEEVRELRCNHLFHRVCLDRWLGYGRMTCPLCRNNLN  115

Query  514  --PAARLFGEDLHQEVIVFDFCS-RRRDRCSWWLR  609
              P       D++QEVI+FDF   R  DR  WWLR
Sbjct  116  NTPYCSHHFTDIYQEVILFDFFKVRLSDRRQWWLR  150



>ref|XP_006366058.1| PREDICTED: E3 ubiquitin-protein ligase RHA2A-like [Solanum tuberosum]
Length=155

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 99/157 (63%), Gaps = 13/157 (8%)
 Frame = +1

Query  172  MFPQSRVL-NCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFE  348
            M  +S++L N +V + +QLKWA + LLLQS    P    +V+ I +      E+ VR F 
Sbjct  1    MSSRSKLLFNYIVYITSQLKWALNYLLLQSFFSHPTYNFIVSDINNVITPRDELNVRCFR  60

Query  349  GESDGAVE--------CAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRT  504
             E   +          CAVCLCKIE+GEEVR+LKC+H+FH+ CLDRW+G GR +CPLCR 
Sbjct  61   EEEVESSSSLSLSSVECAVCLCKIEDGEEVRELKCEHLFHKVCLDRWMGCGRKTCPLCRN  120

Query  505  HVKPAARLFGEDLHQEVIVFDFCSR--RRDRCSWWLR  609
            ++K  A     +++QEVIV D  SR  RR+RC WWLR
Sbjct  121  YLKSPA--VYSEINQEVIVLDLFSRKSRRNRCEWWLR  155



>ref|XP_011078524.1| PREDICTED: putative RING-H2 finger protein ATL50 [Sesamum indicum]
Length=143

 Score =   130 bits (328),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 93/152 (61%), Gaps = 12/152 (8%)
 Frame = +1

Query  163  LLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRV  342
            ++Q+ PQS V N VVSV   LKWAWD LL QS  Q PY      GIM PE+   +  V  
Sbjct  1    MIQIVPQSVVFNYVVSVLMYLKWAWDYLLCQSFFQYPY------GIMLPEHV-DDFNVTF  53

Query  343  FEG--ESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            ++   +S  + ECAVCLCKI++ +EVR+L+C H FHR CLDRW+G G  +CP CR  +K 
Sbjct  54   YKNVVDSGESAECAVCLCKIDQDDEVRELRCDHFFHRVCLDRWLGYGHMTCPTCRNRLKL  113

Query  517  AARLFGEDLHQEVIVFDF-CSRRRDRCSWWLR  609
                   +LHQE++V +F  S    R  WWLR
Sbjct  114  PP--IAAELHQELVVINFHASGYGGRDRWWLR  143



>ref|XP_006348600.1| PREDICTED: RING-H2 finger protein ATL74-like [Solanum tuberosum]
Length=151

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 94/152 (62%), Gaps = 7/152 (5%)
 Frame = +1

Query  172  MFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMS---PENAASEVGVRV  342
            MFPQS++LN V  +  QLKWA + +  QS        N  T        ++  +E+ V  
Sbjct  1    MFPQSKLLNYVDFIFLQLKWACNVVFFQSFSCSRSNCNYFTSNSEGALHDHEHNELRVTH  60

Query  343  FEGES--DGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            FE ++  + +VECA+CLCKIE+GEEVR+L C H+FHRACLDRW+  GR +CPLCR H+  
Sbjct  61   FERDNLEESSVECAICLCKIEDGEEVRELNCDHLFHRACLDRWMNCGRMTCPLCRNHLIK  120

Query  517  AARLFGEDLHQEVIVFDFCS-RRRDRCSWWLR  609
               ++ E L  EVI  +  S R RDRC WWLR
Sbjct  121  PNTIYSE-LQHEVINLNLLSGRSRDRCEWWLR  151



>emb|CBI27117.3| unnamed protein product [Vitis vinifera]
Length=172

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 101/166 (61%), Gaps = 14/166 (8%)
 Frame = +1

Query  130  IALICTFIFKK---LLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGI  300
            I ++CTFIF +     +  PQS + N +   A+ L WAWD LL  SL  + +K NV    
Sbjct  15   ILMLCTFIFIRHELFPKFIPQSIMSNYITPTASHLAWAWDFLLHYSLFPNSHKINV----  70

Query  301  MSPENAASEVGVRVFEGE--SDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGT  474
               EN    + + ++E E  S+  VECAVCLCKIEEGEEVR+L+C H+FHR CLDRW+G 
Sbjct  71   --HENFDQGLNIGLYEPEEGSNEVVECAVCLCKIEEGEEVRELRCGHMFHRDCLDRWLGH  128

Query  475  GRNSCPLCRTHVKPAARLFGEDLHQEVIVFDFCSRR-RDRCSWWLR  609
               +CPLCR+   P +R+  E + +EVIV  F S    +R  WWLR
Sbjct  129  RNGTCPLCRSCTAP-SRMVNE-VGEEVIVVKFSSSSPGNRSMWWLR  172



>ref|XP_010648263.1| PREDICTED: E3 ubiquitin-protein ligase RNF38-like [Vitis vinifera]
 emb|CBI27116.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 102/174 (59%), Gaps = 14/174 (8%)
 Frame = +1

Query  97   PQYPHAFIIVFIALICTFIFKKLLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPY  276
            P +P   ++ F   IC  +F KL+   P+S + N ++  AA L WAWD LL  SL     
Sbjct  11   PLFP-VLMLCFFIFICYKLFPKLI---PRSIMSNYIIPTAAHLTWAWDFLLHHSL-----  61

Query  277  KFNVVTGIMSPENAASEVGVRVFEGE--SDGAVECAVCLCKIEEGEEVRDLKCKHIFHRA  450
              N    +  P+N    +G+ ++  E  S+   ECAVCLCKIEEGEE+R+L+C H+FHR 
Sbjct  62   FLNSHHNMNVPKNGDQGLGLGLYRPELGSNEVAECAVCLCKIEEGEEIRELRCDHMFHRD  121

Query  451  CLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEVIVFDFCS-RRRDRCSWWLR  609
            CLDRWVG    +CPLCR  + P  R+  E + +EVIVF +CS     R  WWLR
Sbjct  122  CLDRWVGHRNGTCPLCRGCLAP-PRMVNE-VGEEVIVFRYCSFSSSTRSMWWLR  173



>ref|XP_010648268.1| PREDICTED: probable E3 ubiquitin-protein ligase RHA2B [Vitis 
vinifera]
Length=173

 Score =   126 bits (317),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 100/174 (57%), Gaps = 14/174 (8%)
 Frame = +1

Query  97   PQYPHAFIIVFIALICTFIFKKLLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPY  276
            P +P   ++ F   IC  +F KL+   P+S + N ++  AA L WAWD LL  SL  + +
Sbjct  11   PLFP-VLMLCFFIFICYKLFPKLI---PRSIMSNYIIPTAAHLTWAWDFLLHHSLFPNSH  66

Query  277  KFNVVTGIMSPENAASEVGVRVFEGE--SDGAVECAVCLCKIEEGEEVRDLKCKHIFHRA  450
                   +  P+N    + + ++  E  S    ECAVCLCKIEEGEE+R+L+C H+FHR 
Sbjct  67   H-----NMNVPKNGDQGLRLGLYRPEPGSKEVAECAVCLCKIEEGEEIRELRCDHMFHRD  121

Query  451  CLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEVIVFDFCS-RRRDRCSWWLR  609
            CLDRWVG    +CPLCR  + P   + G  + +EVIVF +CS     R  WWLR
Sbjct  122  CLDRWVGHRNGTCPLCRGCLAPPRMVNG--VGEEVIVFRYCSFSSSTRSMWWLR  173



>ref|XP_010648283.1| PREDICTED: E3 ubiquitin-protein ligase RNF181-like [Vitis vinifera]
 emb|CBI27120.3| unnamed protein product [Vitis vinifera]
Length=174

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 96/172 (56%), Gaps = 9/172 (5%)
 Frame = +1

Query  97   PQYPHAFIIVFIALICTFIFKKLLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPY  276
            P +P      F   IC  +F K++   P+S + N ++  AA L  AWD LL  SL  + +
Sbjct  11   PLFPILMWSCFFIFICHKLFPKII---PRSILFNYIIPTAAHLSRAWDFLLHYSLFPNSH  67

Query  277  KFNVVTGIMSPENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACL  456
                   ++   +    +G+   +  S   VECAVCLC IEEGEE+R+L+C H+FHR CL
Sbjct  68   H---NMSVLENGDPGLSLGLYKPKPGSKEVVECAVCLCTIEEGEEIRELRCGHMFHRDCL  124

Query  457  DRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEVIVFDFCS-RRRDRCSWWLR  609
            DRWVG    +CPLCR  + P   +   D+ +EVIVF +CS   R R  WWLR
Sbjct  125  DRWVGHRNGTCPLCRGCLAPPRMV--NDVGEEVIVFRYCSFSSRTRSMWWLR  174



>ref|XP_010319436.1| PREDICTED: probable E3 ubiquitin-protein ligase RHA2B [Solanum 
lycopersicum]
Length=148

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 97/158 (61%), Gaps = 22/158 (14%)
 Frame = +1

Query  172  MFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEG  351
            MF  S++ N +      +KW WD LLLQS    P+  N  T I++ + + S   + V E 
Sbjct  1    MFQVSKIQNLI----QLIKWTWDFLLLQSF---PHYNN--TNILNFKVSTSRDELCVREE  51

Query  352  ES--------DGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTH  507
            +           +VECAVCLC+IEEGE+VR+L+C H+FHR CLDRW G G  +CPLCR +
Sbjct  52   DQLNSSSSSSSSSVECAVCLCEIEEGEQVRNLRCNHLFHRVCLDRWFGYGHMTCPLCRNN  111

Query  508  VKPAA---RLFGEDLHQEVIVFDFCSR-RRDRCSWWLR  609
            +  ++    LF  D+H+EVI+FDF SR  RDR  WWLR
Sbjct  112  INKSSIKNNLFF-DVHEEVILFDFFSRISRDRYQWWLR  148



>emb|CAN82925.1| hypothetical protein VITISV_039591 [Vitis vinifera]
Length=322

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 95/154 (62%), Gaps = 13/154 (8%)
 Frame = +1

Query  130  IALICTFIFKK---LLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGI  300
            I ++CTFIF +     +  PQS + N +   A+ L WAWD LL  SL  + +K NV    
Sbjct  15   ILMLCTFIFIRHELFPKFIPQSIMSNYITPTASHLAWAWDFLLHYSLFPNSHKINV----  70

Query  301  MSPENAASEVGVRVFEGE--SDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGT  474
               EN    + + ++E E  S+  VECAVCLCKIEEGEEVR+L+C H+FHR CLDRW+G 
Sbjct  71   --HENFDQGLNIGLYEPEEGSNEVVECAVCLCKIEEGEEVRELRCGHMFHRDCLDRWLGH  128

Query  475  GRNSCPLCRTHVKPAARLFGEDLHQEVIVFDFCS  576
               +CPLCR+   P +R+  E + +EVIV  F S
Sbjct  129  RNGTCPLCRSCTAP-SRMVNE-VGEEVIVVKFSS  160


 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 90/157 (57%), Gaps = 15/157 (10%)
 Frame = +1

Query  154  FKKLLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSP-ENAASEV  330
            F  L ++ P+  ++N +V      KWAW  L         ++F+  +  +   EN   E+
Sbjct  176  FLHLPEVIPRLIMVNYIVLPITHFKWAWSFLF--------HRFSFASYTLGMLENGEEEL  227

Query  331  GV---RVFEGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCR  501
             +   +V  G  +   ECAVCLCKIEEG+E+ DL+C H+FH+ CLDRWV   R++CPLCR
Sbjct  228  RIGHYKVKLGSEESEEECAVCLCKIEEGDEISDLRCDHLFHKVCLDRWVQYKRSTCPLCR  287

Query  502  THVKPAARLFGEDLHQEVIVFDFCS-RRRDRCSWWLR  609
              + P   +   +L QEV+VF FCS    DR SWWLR
Sbjct  288  DSLAPCRAV--AELGQEVLVFRFCSFSSGDRNSWWLR  322



>gb|EYU28932.1| hypothetical protein MIMGU_mgv1a024839mg [Erythranthe guttata]
Length=145

 Score =   117 bits (294),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 91/156 (58%), Gaps = 18/156 (12%)
 Frame = +1

Query  163  LLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRV  342
            ++Q+ P+S VL  +V   +QL  AWD +L QS  Q         GI+  E   + +    
Sbjct  1    MIQIIPKSAVLTYLVMFISQLNCAWDFILYQSFFQ-------TRGIVLQEYGVNTIKYNY  53

Query  343  FEGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAA  522
             E   + + ECAVCLC I+EG++V +L+C H+FHR CLDRWVG G  +CPLCR ++K  A
Sbjct  54   NEYSEESSEECAVCLCSIDEGDDVGELRCDHLFHRVCLDRWVGYGHATCPLCRNNLKQPA  113

Query  523  RLFGEDLHQEVIVFDFC-------SRRRDRCSWWLR  609
             L     HQE+I+ +FC       S R DR +WWLR
Sbjct  114  ELG----HQELILINFCAAAAAAVSSRDDRSTWWLR  145



>ref|XP_010648258.1| PREDICTED: probable E3 ubiquitin-protein ligase RHA2B [Vitis 
vinifera]
Length=179

 Score =   118 bits (296),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 93/171 (54%), Gaps = 11/171 (6%)
 Frame = +1

Query  112  AFIIVFIALICTFIF---KKLLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPYKF  282
            A  +  I ++C FIF   K   ++ P   + N ++  AA L WAWD LL  SL  + +  
Sbjct  15   ALPLSPILMLCFFIFICYKLFPKIIPHPIMSNYIIPTAAHLTWAWDFLLHYSLFPNSHHN  74

Query  283  NVVTGIMSPENAASEVGVRVFEGE--SDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACL  456
              V     PEN    +G+ +++ E  S  AV+C VCLCKIEEGEE+R+L+C H+FHR CL
Sbjct  75   TNV-----PENGDQGLGLGLYKPEPGSKEAVDCVVCLCKIEEGEEIRELRCGHMFHRDCL  129

Query  457  DRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEVIVFDFCSRRRDRCSWWLR  609
            DRWV     +CPLCR  + P  R+  E   + ++          R  WWLR
Sbjct  130  DRWVRQRNGTCPLCRGCLAP-PRMVNEAGEEAIVFNFCSFSSSSRTVWWLR  179



>ref|XP_009775194.1| PREDICTED: RING-H2 zinc finger protein RHA1a-like [Nicotiana 
sylvestris]
Length=150

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 78/109 (72%), Gaps = 7/109 (6%)
 Frame = +1

Query  304  SPENAASEVGV-RVFE---GESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVG  471
            +P +  +E+ + R FE   G +  +VECA+CLCKIEEGEEVR+L+C H+FHR CLDRW+ 
Sbjct  42   TPHDHNNELRIIRRFEHDLGTNLDSVECAICLCKIEEGEEVRELRCDHVFHRVCLDRWMN  101

Query  472  TGRN-SCPLCRTHVKPAARLFGE-DLHQEVIVFDFCS-RRRDRCSWWLR  609
             GRN +CPLCR H+ P A LF E + HQEVI  DF S R RD C WWLR
Sbjct  102  CGRNMTCPLCRNHLMPNAVLFSELNHHQEVIRLDFLSGRSRDLCQWWLR  150



>ref|XP_010648275.1| PREDICTED: RING-H2 finger protein ATL51-like [Vitis vinifera]
Length=166

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 97/173 (56%), Gaps = 13/173 (8%)
 Frame = +1

Query  106  PH--AFIIVFIALICTFIFKKLLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPYK  279
            PH  AF    ++   +     L ++FP S V + +V     L  AW+ LL+       Y 
Sbjct  2    PHISAFPSSLLSFCISIFHAVLPKVFPGSIVSSYMVLPTTHLSRAWN-LLIHHFSSAAYT  60

Query  280  FNVVTGIMSPENAASEVGVRVF--EGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRAC  453
             + + G    + + S+  V++   EGE     ECAVCLCKIE GEE+R+L+C H+FHR C
Sbjct  61   LDHMPGNDDEQPSISQYKVKLGCEEGE-----ECAVCLCKIEAGEEIRELRCDHLFHRVC  115

Query  454  LDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEVIVFDFCS-RRRDRCSWWLR  609
            LDRW+   R +CPLCR  + P  R  GE L ++ +VF FCS    DRC+WWLR
Sbjct  116  LDRWLQYKRATCPLCRGSLAP-RRAVGE-LGEQTLVFRFCSLSSSDRCNWWLR  166



>gb|EYU28933.1| hypothetical protein MIMGU_mgv1a018816mg, partial [Erythranthe 
guttata]
Length=138

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 83/145 (57%), Gaps = 12/145 (8%)
 Frame = +1

Query  190  VLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEGESDGAV  369
            VL  +V   +QL  AWD +L QS  Q         GI+  E   + +     E   + + 
Sbjct  1    VLTYLVMFISQLNCAWDFILYQSFFQ-------TRGIVLQEYGVNTIKYNYNEYSEESSE  53

Query  370  ECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQ  549
            ECAVCLC I+EG++V +L+C H+FHR CLDRWVG G  +CPLCR ++K       E  HQ
Sbjct  54   ECAVCLCSIDEGDDVGELRCDHLFHRVCLDRWVGYGHATCPLCRNNLKQQPLFTAELGHQ  113

Query  550  EVIVFDFC-----SRRRDRCSWWLR  609
            E+I+ +FC     S R DR +WWLR
Sbjct  114  ELIMINFCAAVAASSRDDRSTWWLR  138



>emb|CAN82924.1| hypothetical protein VITISV_039590 [Vitis vinifera]
Length=350

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 97/173 (56%), Gaps = 13/173 (8%)
 Frame = +1

Query  106  PH--AFIIVFIALICTFIFKKLLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPYK  279
            PH  AF    ++   +     L ++FP S V + +V     L  AW+ LL+       Y 
Sbjct  2    PHISAFPSSLLSFCISIFHAVLPKVFPGSIVSSYMVLPTTHLSRAWN-LLIHHFSSAAYT  60

Query  280  FNVVTGIMSPENAASEVGVRVF--EGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRAC  453
             + + G    + + S+  V++   EGE     ECAVCLCKIE GEE+R+L+C H+FHR C
Sbjct  61   LDHMPGNDDEQPSISQYKVKLGCEEGE-----ECAVCLCKIEAGEEIRELRCDHLFHRVC  115

Query  454  LDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEVIVFDFCS-RRRDRCSWWLR  609
            LDRW+   R +CPLCR  + P  R  GE L ++ +VF FCS    DRC+WWLR
Sbjct  116  LDRWLQYKRATCPLCRGSLAP-RRAVGE-LGEQTLVFRFCSLSSSDRCNWWLR  166



>ref|XP_010648272.1| PREDICTED: RING-H2 finger protein ATL13-like [Vitis vinifera]
Length=135

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 84/145 (58%), Gaps = 15/145 (10%)
 Frame = +1

Query  190  VLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSP-ENAASEVGV---RVFEGES  357
            ++N +V      KWAW  L         ++F+  +  +   EN   E+ +   +V  G  
Sbjct  1    MVNYIVLPITHFKWAWSFLF--------HRFSFASYTLGMLENGEEELRIGHYKVKLGSE  52

Query  358  DGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGE  537
            +   ECAVCLCKIEEG+E+ DL+C H+FH+ CLDRWV   R++CPLCR  + P   +   
Sbjct  53   ESEEECAVCLCKIEEGDEISDLRCDHLFHKVCLDRWVQYKRSTCPLCRDSLAPCRAV--A  110

Query  538  DLHQEVIVFDFCS-RRRDRCSWWLR  609
            +L QEV+VF FCS    DR SWWLR
Sbjct  111  ELGQEVLVFRFCSFSSGDRNSWWLR  135



>ref|XP_011078534.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Sesamum 
indicum]
Length=122

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 72/133 (54%), Gaps = 15/133 (11%)
 Frame = +1

Query  223  LKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEGESDGAVECAVCLCKIEE  402
            +K AWD LL QS        N +   + P         +       G+ EC VCLC I E
Sbjct  1    MKGAWDFLLHQSFFHSSSAPNTIVPNVEPYTVTRRSTCKT------GSDECTVCLCSIRE  54

Query  403  GEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGED--LHQEVIVFDFC-  573
            GEE+R+L C H+FHRAC DRW+G G  +CPLCR H++     FG D   HQ+V+VF+F  
Sbjct  55   GEEIRELMCGHVFHRACFDRWIGYGHWTCPLCRHHLR-----FGADHQFHQQVLVFNFAN  109

Query  574  -SRRRDRCSWWLR  609
             S R     WWLR
Sbjct  110  VSERSSSERWWLR  122



>ref|XP_007044741.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOY00573.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=172

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 92/174 (53%), Gaps = 15/174 (9%)
 Frame = +1

Query  112  AFIIVFIALICTFIFKKLLQMFP----QSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPYK  279
            AF I+ +     +    L +  P    +S + + V+ +A +L+WA D +L    C  P +
Sbjct  6    AFAILLLFSFPVYFVYHLRRCLPSFIRESTICSHVILIATRLEWALDFML--RYCLFP-R  62

Query  280  FNVVTGIMSPENAASEVGVRVFE---GESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRA  450
            +N    +  PE  A     R +E        A EC VCL K++EGEE+  L+C H+FHR 
Sbjct  63   YNFAPNM--PEIGAGRPSARDYEWKRAAPTDAGECPVCLFKVQEGEEIGQLRCSHVFHRL  120

Query  451  CLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEVIVFDFCS-RRRDRCSWWLR  609
            CL+ WVG    +CPLCR  V PA      +L +EV+ FDFCS   RDR  WWLR
Sbjct  121  CLETWVGYWNATCPLCRGSVAPAR--LDSELGEEVVAFDFCSLSSRDRGRWWLR  172



>gb|KDP29327.1| hypothetical protein JCGZ_18248 [Jatropha curcas]
Length=132

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 78/140 (56%), Gaps = 12/140 (9%)
 Frame = +1

Query  196  NCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEGESDGAVEC  375
            N +V +A+ LKWAW+ L       +            PE    E+ +  +E + D   EC
Sbjct  3    NYLVLIASYLKWAWNFLHCSFFSNNRLDI--------PE-ILQELNLSYYENKEDNPKEC  53

Query  376  AVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEV  555
            AVCL KI+ GEE+R+L+C H+FHR CLDRW+G    +CPLCR  + P   L  +    EV
Sbjct  54   AVCLSKIQNGEEIRELRCSHVFHRVCLDRWLGYKSTTCPLCRDLIGPRKTL-ADAAGIEV  112

Query  556  IVFDFCS--RRRDRCSWWLR  609
            +VF +CS   R D  +WWLR
Sbjct  113  LVFKYCSFNSRSDGETWWLR  132



>gb|KDP43269.1| hypothetical protein JCGZ_22821 [Jatropha curcas]
Length=129

 Score =   100 bits (250),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 85/142 (60%), Gaps = 15/142 (11%)
 Frame = +1

Query  190  VLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEGESDGAV  369
            + N +V+VA+ LKWAWD LL  S   + +  ++            E+ +  +E + + + 
Sbjct  1    MFNSLVTVASYLKWAWDFLLHYSFFSNHHHLDM-----------PELNLCCYEEKEEESK  49

Query  370  ECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQ  549
            ECAVCLCKIE GEE ++L+C H+FH  CLDRW+G   +SC LCR  ++   R F +   +
Sbjct  50   ECAVCLCKIENGEETKELRCSHVFHGVCLDRWLGYRSSSCSLCRDLIR--RRTFTDPDGR  107

Query  550  EVIVFDFC--SRRRDRCSWWLR  609
            EV+VF +C  S   DR +WWLR
Sbjct  108  EVLVFKYCSFSSGNDRETWWLR  129



>emb|CBI27118.3| unnamed protein product [Vitis vinifera]
Length=104

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 68/104 (65%), Gaps = 6/104 (6%)
 Frame = +1

Query  310  ENAASEVGV---RVFEGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGR  480
            EN   E+ +   +V  G  +   ECAVCLCKIEEG+E+ DL+C H+FH+ CLDRWV   R
Sbjct  3    ENGEEELRIGHYKVKLGSEESEEECAVCLCKIEEGDEISDLRCDHLFHKVCLDRWVQYKR  62

Query  481  NSCPLCRTHVKPAARLFGEDLHQEVIVFDFCS-RRRDRCSWWLR  609
            ++CPLCR  + P   +   +L QEV+VF FCS    DR SWWLR
Sbjct  63   STCPLCRDSLAPCRAV--AELGQEVLVFRFCSFSSGDRNSWWLR  104



>ref|XP_010262120.1| PREDICTED: E3 ubiquitin-protein ligase RHA2A-like [Nelumbo nucifera]
Length=171

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 79/133 (59%), Gaps = 17/133 (13%)
 Frame = +1

Query  256  SLCQDPYKFNVVTGIMSPENAASEVGVRVF--------EGESDGAVECAVCLCKIEEGEE  411
            SL    +  N   G  S ++   + GVR +        E E+  A ECA+CLCKIEEGEE
Sbjct  41   SLLLGFFHINSSNGDAS-DDVGGDPGVRRYFTLNQPAAESETKQA-ECAICLCKIEEGEE  98

Query  412  VRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLF-----GEDLHQEVIVFDFCS  576
            +R+L+C+H+FHR CLDRW+G  ++SCPLCR  + PA+R+      G +   E IVF F S
Sbjct  99   IRELRCEHLFHRVCLDRWIGYRQSSCPLCRGSIMPASRMTARLSGGNEEVVEEIVFMFSS  158

Query  577  RRRD--RCSWWLR  609
             +R   R  WWLR
Sbjct  159  FQRSDARERWWLR  171



>emb|CBI27119.3| unnamed protein product [Vitis vinifera]
Length=103

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 67/102 (66%), Gaps = 8/102 (8%)
 Frame = +1

Query  307  PENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNS  486
            P  +  +V +   EGE     ECAVCLCKIE GEE+R+L+C H+FHR CLDRW+   R +
Sbjct  9    PSISQYKVKLGCEEGE-----ECAVCLCKIEAGEEIRELRCDHLFHRVCLDRWLQYKRAT  63

Query  487  CPLCRTHVKPAARLFGEDLHQEVIVFDFCS-RRRDRCSWWLR  609
            CPLCR  + P  R  GE L ++ +VF FCS    DRC+WWLR
Sbjct  64   CPLCRGSLAP-RRAVGE-LGEQTLVFRFCSLSSSDRCNWWLR  103



>gb|ABK95295.1| unknown [Populus trichocarpa]
Length=133

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 76/135 (56%), Gaps = 12/135 (9%)
 Frame = +1

Query  211  VAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEGESDGAVECAVCLC  390
            ++A L+WA++      LC  P+ F           A + +G  +    ++   ECAVCL 
Sbjct  9    ISAHLRWAFN-----FLCYYPFSFQEHELF-----AVTAIGEELNTVINEAPAECAVCLS  58

Query  391  KIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEVIVFDF  570
             ++EGEE+R+L+C HIFHRACL RW+   +++CPLCR  + P   L  +    EV+ F F
Sbjct  59   DVQEGEEIRELRCGHIFHRACLYRWLDFRQSTCPLCRGSLTPRRTLILDQHQTEVLTFKF  118

Query  571  CS--RRRDRCSWWLR  609
            CS     +R +WWLR
Sbjct  119  CSFTSTDERDTWWLR  133



>ref|XP_006378513.1| hypothetical protein POPTR_0010s14320g [Populus trichocarpa]
 gb|ERP56310.1| hypothetical protein POPTR_0010s14320g [Populus trichocarpa]
Length=133

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 76/135 (56%), Gaps = 12/135 (9%)
 Frame = +1

Query  211  VAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEGESDGAVECAVCLC  390
            ++A L+WA++      LC  P+ F           A + +G  +    ++   ECAVCL 
Sbjct  9    ISAHLRWAFN-----FLCYYPFSFQEHELF-----AVTAIGEELNTVINEAPAECAVCLS  58

Query  391  KIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEVIVFDF  570
             ++EGEE+R+L+C HIFHRACL RW+   +++CPLCR  + P   L  +    EV+ F F
Sbjct  59   DVQEGEEIRELRCGHIFHRACLYRWLDFRQSTCPLCRGSLTPRRTLILDQHRTEVLTFKF  118

Query  571  CS--RRRDRCSWWLR  609
            CS     +R +WWLR
Sbjct  119  CSFTSTDERDTWWLR  133



>ref|XP_002314901.1| hypothetical protein POPTR_0010s14330g [Populus trichocarpa]
 gb|EEF01072.1| hypothetical protein POPTR_0010s14330g [Populus trichocarpa]
Length=133

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 76/135 (56%), Gaps = 12/135 (9%)
 Frame = +1

Query  211  VAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEGESDGAVECAVCLC  390
            ++A L+WA++      LC  P+ F           A + +G  +    ++   ECAVCL 
Sbjct  9    ISAHLRWAFN-----FLCYYPFSFQEHELF-----AVTAIGEELNTVINEAPAECAVCLS  58

Query  391  KIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEVIVFDF  570
             ++EGEE+R+L+C HIFHRACL RW+   +++CPLCR  + P   L  +    EV+ F F
Sbjct  59   DVQEGEEIRELRCGHIFHRACLYRWLDFRQSTCPLCRGSLAPRRTLILDQHRTEVLTFKF  118

Query  571  CS--RRRDRCSWWLR  609
            CS     +R +WWLR
Sbjct  119  CSFTSTDERDTWWLR  133



>ref|XP_004490372.1| PREDICTED: RING-H2 finger protein ATL54-like [Cicer arietinum]
Length=134

 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 64/87 (74%), Gaps = 4/87 (5%)
 Frame = +1

Query  355  SDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFG  534
            S+  V+C VCLCKI+EGEE+R L+C+H++HR CLD+W+   +++CPLCR  ++P  R   
Sbjct  50   SEEDVDCVVCLCKIKEGEEIRVLRCEHMYHRNCLDKWISFKKDTCPLCRESLRP--RRAT  107

Query  535  EDLHQEVIVFDFCSRR--RDRCSWWLR  609
             +L  EV++F++C+ R  RDR  WWLR
Sbjct  108  TELGAEVLLFNYCAIRTNRDRDDWWLR  134



>ref|XP_002514525.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47631.1| conserved hypothetical protein [Ricinus communis]
Length=137

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 78/143 (55%), Gaps = 9/143 (6%)
 Frame = +1

Query  190  VLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEGESDGAV  369
            +L  +  +A     A D +LLQ L    Y+ ++    ++ E+  S    +  E E   A 
Sbjct  1    MLKYLNLIATHFMRALD-ILLQILFFQNYQLDLPGSKINGEDQPSIYHHKAGESE---AT  56

Query  370  ECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWV-GTGRNSCPLCRTHVKPAARLFGEDLH  546
            ECAVCL KIEEGEE+R+ +C HIFHR CLDRW+   G  SCPLCR  + P  R    DL 
Sbjct  57   ECAVCLTKIEEGEEIREPRCNHIFHRVCLDRWMCSYGHTSCPLCRDSLVP--RRAITDLG  114

Query  547  QEVIVFDFCSRRRD--RCSWWLR  609
             +V+VF F     D  R  WWLR
Sbjct  115  HQVLVFKFSFTTADDGRDKWWLR  137



>ref|XP_004516175.1| PREDICTED: RING-H2 finger protein ATL54-like [Cicer arietinum]
Length=134

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 80/142 (56%), Gaps = 12/142 (8%)
 Frame = +1

Query  190  VLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEGESDGAV  369
            ++  +  V   LKW  D L+        Y F+     +  E+  +        G+ +  V
Sbjct  3    IMKYLSLVYTNLKWVLDFLVY-------YPFHYSHFPIIGEDYYNICNYDPTSGKKED-V  54

Query  370  ECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQ  549
            +CAVCLCKI+EGEE+  L+C+H++HR CLD+W+   +++CPLCR  ++P  R    +L  
Sbjct  55   DCAVCLCKIKEGEEIGVLRCQHMYHRTCLDKWISFKKDTCPLCRESLRP--RRATTELGA  112

Query  550  EVIVFDFCSRRRDR--CSWWLR  609
            EV+ F+FC+ R DR    WWLR
Sbjct  113  EVLSFNFCAIRTDRDPDDWWLR  134



>ref|XP_003613638.1| E3 ubiquitin-protein ligase [Medicago truncatula]
 gb|AES96596.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=153

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 76/145 (52%), Gaps = 12/145 (8%)
 Frame = +1

Query  184  SRVLNCVVSVAAQLKWAWDCLLLQSLCQ-DPYKFNVVTGIMSPENAASEVGVRVFEGESD  360
            + ++  +  V   +KW  D L      +     F ++  I    N     G       S+
Sbjct  18   TMIMKYLTLVYTHIKWVLDILTYYPFYKLHDSNFPIIGEIYDICNYEHTHG-------SN  70

Query  361  GAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGED  540
              VECAVCLCKIEEG+E+  L+C H++H+ CLD+W+    ++CPLCR  ++P   +   +
Sbjct  71   EDVECAVCLCKIEEGDEISVLRCDHMYHKYCLDKWISFKNHTCPLCRESLRPERAI--TE  128

Query  541  LHQEVIVFDFC--SRRRDRCSWWLR  609
            L  E++ F+FC     RDR  WWLR
Sbjct  129  LGAEILSFNFCVIHSDRDRDDWWLR  153



>ref|XP_007045658.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOY01490.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=145

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 85/152 (56%), Gaps = 19/152 (13%)
 Frame = +1

Query  190  VLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVF--------  345
            +LN ++   + LK+AW+ LL  SL  +   +N    +      A ++G+  +        
Sbjct  1    MLNYILWFVSHLKFAWNLLLNYSLFPN---YNQEQQLQHRPGVAEKLGLVTYKCKQQQGC  57

Query  346  --EGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRN-SCPLCRTHVKP  516
              + + +    CAVCLCKIEE +E+R+L+C H+FH+ CLDRW+G   + +CP+CRT + P
Sbjct  58   FDDNDEEEEEACAVCLCKIEEDDEMRELRCNHLFHKVCLDRWLGYSHSTTCPICRTFLTP  117

Query  517  AARLFGEDLHQEVIVFDFCS-RRRDRCSWWLR  609
            A  +       EV+ F++C+     R +WWLR
Sbjct  118  AKVIAS----VEVLTFNYCTFSPNHRDNWWLR  145



>gb|KEH34204.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
 gb|KEH34206.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=136

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 75/145 (52%), Gaps = 15/145 (10%)
 Frame = +1

Query  184  SRVLNCVVSVAAQLKWAWDCLLLQSLCQ-DPYKFNVVTGIMSPENAASEVGVRVFEGESD  360
            + ++N +      LKW  D L      +     F ++  +    N             ++
Sbjct  4    TMIMNYLTIFYTHLKWVLDILTYYPFYKLHDSNFPIIGEMYDIYNYE----------HTN  53

Query  361  GAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGED  540
              VEC VCLCKIEEG+E+  L+C H++H+ CLD+W+    ++CPLCR  ++P   +    
Sbjct  54   EDVECVVCLCKIEEGDEISVLRCDHMYHKHCLDKWLSFKNHTCPLCRESLRPERAITEHG  113

Query  541  LHQEVIVFDFCSRR--RDRCSWWLR  609
            +  EV+ FDFC+ R  RDR  WWLR
Sbjct  114  V--EVLSFDFCAIRSDRDRDDWWLR  136



>ref|XP_011015548.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Populus 
euphratica]
Length=133

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 79/143 (55%), Gaps = 15/143 (10%)
 Frame = +1

Query  187  RVLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEGESDGA  366
            + LN ++   A L+WA++      LC  P+ F           A + +G  +    ++  
Sbjct  4    KYLNLII---AHLRWAFN-----FLCYYPFSFQEHELF-----AVTAIGEELNTVINEAP  50

Query  367  VECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLH  546
             ECAVCL  +EEGEE+R+L+C HIFHRACL RW+   +++CPLCR  +     L  +   
Sbjct  51   AECAVCLDDVEEGEEIRELRCGHIFHRACLYRWLDFRQSTCPLCRGSLAFRRTLILDQRR  110

Query  547  QEVIVFDFCSRRR--DRCSWWLR  609
             EV+ F FCS +   +R +WWLR
Sbjct  111  TEVLTFKFCSFKSTDERDTWWLR  133



>gb|AFK42024.1| unknown [Lotus japonicus]
Length=140

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 75/148 (51%), Gaps = 17/148 (11%)
 Frame = +1

Query  190  VLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSP------ENAASEVGVRVFEG  351
            ++  +  +   LKW +D LL        Y F  + G   P      E    +       G
Sbjct  2    LMKYLTLLYTHLKWVFDFLLY-------YPFYTLHGSQFPIIGEEQEQGMCQFYEPNLIG  54

Query  352  ESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLF  531
              +  ++CAVCL KIE GEE+R L+C H FHR CLD W G    +CPLCR  + P   + 
Sbjct  55   SEEEEIDCAVCLSKIEGGEEIRVLRCDHFFHRDCLDTWFGFKNPTCPLCRGSMGPRRAI-  113

Query  532  GEDLHQEVIVFDFCSRRR--DRCSWWLR  609
              ++  +V++F+FC+ R   DR +WWLR
Sbjct  114  -NEVGAQVLLFEFCATRTHDDRDTWWLR  140



>ref|XP_003613640.1| E3 ubiquitin-protein ligase [Medicago truncatula]
 gb|AES96598.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=137

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 76/143 (53%), Gaps = 12/143 (8%)
 Frame = +1

Query  190  VLNCVVSVAAQLKWAWDCLLLQSLCQ-DPYKFNVVTGIMSPENAASEVGVRVFEGESDGA  366
            ++  +  V   LKW  D L      +     F +   +    N     G       S+  
Sbjct  4    IMKYLTIVYTHLKWVLDILTYYPFYKLHDSNFPIFGEMYDICNYEHNHG-------SNED  56

Query  367  VECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLH  546
            VECAVCLCKIEEG+E+  L+C H++H+ CLD+W+G   ++CPLCR  ++P   +   +L 
Sbjct  57   VECAVCLCKIEEGDEISVLRCDHMYHKYCLDKWIGFKNHTCPLCRESLRPERAI--TELG  114

Query  547  QEVIVFDFCSRR--RDRCSWWLR  609
             E++ F+FC  R  RDR  +WLR
Sbjct  115  AEILSFNFCVIRNDRDRDDFWLR  137



>ref|XP_003615334.1| E3 ubiquitin-protein ligase [Medicago truncatula]
 gb|AES98292.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=137

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 60/87 (69%), Gaps = 4/87 (5%)
 Frame = +1

Query  355  SDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFG  534
            SD  VEC VCL KIEEG+E+R L+C H++H+ CLD+WVG   ++CPLCR  ++P   +  
Sbjct  53   SDEDVECVVCLSKIEEGDEIRVLRCDHMYHKNCLDKWVGFKNHTCPLCRESLRPKRAI--  110

Query  535  EDLHQEVIVFDFCSRR--RDRCSWWLR  609
             +L  EV+ F+F + R  RDR  WWLR
Sbjct  111  TELGAEVLEFNFFAIRKDRDRDDWWLR  137



>ref|XP_002314902.1| hypothetical protein POPTR_0010s14370g [Populus trichocarpa]
 gb|EEF01073.1| hypothetical protein POPTR_0010s14370g [Populus trichocarpa]
Length=133

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 72/135 (53%), Gaps = 12/135 (9%)
 Frame = +1

Query  211  VAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEGESDGAVECAVCLC  390
            ++  L+W ++      LC  P+ F        P      +G  +    ++   ECAVCL 
Sbjct  9    ISVHLRWTFN-----FLCYYPFNFQEHELFAVPA-----IGEELNTVINEAPAECAVCLS  58

Query  391  KIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEVIVFDF  570
             +EEGEE+R+L+C HIFHRACL R +   +++CPLCR  + P   L  +    EV+ F F
Sbjct  59   DVEEGEEIRELRCGHIFHRACLYRLLDFRQSTCPLCRGSLTPRRTLILDQHQTEVLTFKF  118

Query  571  CS--RRRDRCSWWLR  609
            CS     +R +WWLR
Sbjct  119  CSFTSTDERDTWWLR  133



>ref|XP_003613639.1| RING finger protein [Medicago truncatula]
 gb|AES96597.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=135

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 75/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  190  VLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPE-NAASEVGVRVFEGESDGA  366
            ++  +  V   +KW  D L         Y F  + G   P      ++        S+  
Sbjct  2    IMKYLTIVYTHIKWVLDILTY-------YPFYKLHGSNFPIFGEMYDICNYEHNHGSNED  54

Query  367  VECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLH  546
            VECAVCLCKIEEG+E+  L+C H++H+ CLD+W+    ++CPLCR  ++P   +   +L 
Sbjct  55   VECAVCLCKIEEGDEISVLRCDHMYHKYCLDKWISFKNHTCPLCRESLRPERAI--TELG  112

Query  547  QEVIVFDFC--SRRRDRCSWWLR  609
             E++ F+FC     RDR  WWLR
Sbjct  113  AEILSFNFCVIHSDRDRDDWWLR  135



>ref|XP_007022349.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOY13874.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=186

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 78/135 (58%), Gaps = 13/135 (10%)
 Frame = +1

Query  211  VAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEGESDGAVECAVCLC  390
            + + LKWAW+ LL  SL   PY    + GI            +   GE    VECA+CLC
Sbjct  63   IVSPLKWAWNFLLHYSLF--PYH---MPGIGEDLKLGRCNYYKQESGEE--VVECAICLC  115

Query  391  KIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEVIVFDF  570
             I++ +E+R+L+C H+FH+ CLDRW+G   ++CP+CR+ + P   + G     EVI+F++
Sbjct  116  NIDDDDEIRELRCDHLFHKVCLDRWIGYRNSTCPICRSCMTPRRLVTG----MEVILFNY  171

Query  571  CSRR--RDRCSWWLR  609
             S    R R +WWLR
Sbjct  172  VSFDDCRHRDAWWLR  186



>ref|XP_007225990.1| hypothetical protein PRUPE_ppa012865mg [Prunus persica]
 gb|EMJ27189.1| hypothetical protein PRUPE_ppa012865mg [Prunus persica]
Length=151

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 57/95 (60%), Gaps = 8/95 (8%)
 Frame = +1

Query  349  GESDG-AVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAAR  525
            G SD    ECAVCLCKIEEG+EVR+L+C H+FH+ CLDRW G    +CPLCR+ + P   
Sbjct  57   GTSDEIPAECAVCLCKIEEGDEVRELRCAHLFHKQCLDRWTGFQHATCPLCRSFLAPPRS  116

Query  526  LFGEDLHQ----EVIVFDFCSRRRDR---CSWWLR  609
                   Q    EV++F FCS   D      WWLR
Sbjct  117  TLVSHSQQFVQSEVLLFKFCSFSSDSDDGGGWWLR  151



>gb|AFK45483.1| unknown [Medicago truncatula]
Length=136

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 59/88 (67%), Gaps = 4/88 (5%)
 Frame = +1

Query  352  ESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLF  531
             ++  VEC VCLCKIEEG+E+  L+C H++H+ CLD+W+    ++CPLCR  ++P   + 
Sbjct  51   HTNEDVECVVCLCKIEEGDEISVLRCDHMYHKHCLDKWLSFKNHTCPLCRESLRPERAIT  110

Query  532  GEDLHQEVIVFDFCSRR--RDRCSWWLR  609
               +  EV+ FDFC+ R  RDR  WWLR
Sbjct  111  EHGV--EVLSFDFCAIRSDRDRDDWWLR  136



>ref|XP_003615333.1| E3 ubiquitin-protein ligase [Medicago truncatula]
 gb|AES98291.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=137

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 60/87 (69%), Gaps = 4/87 (5%)
 Frame = +1

Query  355  SDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFG  534
            SD  VEC VCL KIEEG+E+R L+C H++H+ CLD+WVG   ++CPLCR  ++P   +  
Sbjct  53   SDEDVECVVCLSKIEEGDEIRVLRCDHMYHKNCLDKWVGFKNHTCPLCRESLRPKRAI--  110

Query  535  EDLHQEVIVFDFCSRRRDR--CSWWLR  609
             +L  EV+ F+F + R+DR    WWLR
Sbjct  111  TELGAEVLEFNFFAIRKDRDHDDWWLR  137



>ref|XP_010091703.1| E3 ubiquitin-protein ligase RHA2A [Morus notabilis]
 gb|EXB44969.1| E3 ubiquitin-protein ligase RHA2A [Morus notabilis]
Length=177

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 89/161 (55%), Gaps = 14/161 (9%)
 Frame = +1

Query  151  IFKKLLQMFPQSRVLNCVVSVAAQLKWAWDCLLL---QSLCQDPYKFNVVTGIMSPENAA  321
            IF KL  +   S +   VV +   LK ++D LLL    SL   P  ++V   +  P+ + 
Sbjct  23   IFLKLTTL--PSTIWYYVVLILTNLKCSFDVLLLCNHYSLLV-PLLYDV---LKIPQISE  76

Query  322  SEVGVRVFEGESDGAVE-CAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLC  498
              + +   E + +G  E CAVCL ++EEGEE+ +L+C H+FH+ CL+RWV     +CPLC
Sbjct  77   QALQITRHEHDKEGGSEHCAVCLDQVEEGEEIGELRCFHVFHKLCLERWVRLKHMTCPLC  136

Query  499  RTHVKPAAR-LFGEDLHQEVIVFDFC---SRRRDRCSWWLR  609
            R  + P  R    E++ +EV+ F FC   S   D  SWWLR
Sbjct  137  RGSLAPPMRNTTEEEIEREVLFFKFCFFDSEDDDLDSWWLR  177



>ref|XP_010321171.1| PREDICTED: E3 ubiquitin-protein ligase RHA2A-like [Solanum lycopersicum]
Length=90

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 57/78 (73%), Gaps = 2/78 (3%)
 Frame = +1

Query  310  ENAASEVGVRVFEGES--DGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRN  483
            ++  +E+ V  F+ ++  + + ECA+CLCKIE+GEEVR+L C H+FHRACLDRW+  GR 
Sbjct  8    DHEHNELRVTRFKHDNLEESSKECAICLCKIEDGEEVRELNCDHLFHRACLDRWMNCGRM  67

Query  484  SCPLCRTHVKPAARLFGE  537
            +CPLCR+H+     ++ E
Sbjct  68   TCPLCRSHLTKRNIIYSE  85



>ref|XP_004490371.1| PREDICTED: RING-H2 finger protein ATL47-like [Cicer arietinum]
Length=141

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 80/142 (56%), Gaps = 10/142 (7%)
 Frame = +1

Query  190  VLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEGESDGAV  369
            ++  +  V   LKW  D L+        YK +     +  E+ +     R    E D  V
Sbjct  8    IMQTLTLVYTHLKWILDFLVYHPF----YKLHDCHLPIFEEDYSIWNYKRTPGSEED--V  61

Query  370  ECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQ  549
            +CAVCLC+I+EG+E+R L+C+H++H  CLD+W+   +++CPLCR  ++P  R    +L  
Sbjct  62   DCAVCLCQIKEGDEIRILRCEHMYHINCLDKWISFKKDTCPLCRESLRP--RRDTTELGA  119

Query  550  EVIVFDFCSRRRDR--CSWWLR  609
            EV++F+F + R DR    WWLR
Sbjct  120  EVLLFNFGTFRTDRDCDDWWLR  141



>gb|KEH34205.1| anaphase-promoting complex subunit 11 RING-H2 finger protein 
[Medicago truncatula]
Length=250

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 57/83 (69%), Gaps = 4/83 (5%)
 Frame = +1

Query  367  VECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLH  546
            VEC VCLCKIEEG+E+  L+C H++H+ CLD+W+    ++CPLCR  ++P   +    + 
Sbjct  170  VECVVCLCKIEEGDEISVLRCDHMYHKHCLDKWLSFKNHTCPLCRESLRPERAITEHGV-  228

Query  547  QEVIVFDFCSRR--RDRCSWWLR  609
             EV+ FDFC+ R  RDR  WWLR
Sbjct  229  -EVLSFDFCAIRSDRDRDDWWLR  250



>ref|XP_010068769.1| PREDICTED: RING-H2 finger protein ATL46-like [Eucalyptus grandis]
Length=176

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 86/168 (51%), Gaps = 23/168 (14%)
 Frame = +1

Query  139  ICTFIFKKLLQMFP-QSRVLNCVVSVAAQLKWAWDCLLLQSLCQ------DPYKFNVVTG  297
            I + + +K+ ++ P ++ V   + ++   LKWA D  L  S+        +P  F ++ G
Sbjct  21   ISSSLSRKVPKLLPLKAAVAARLSALLGPLKWALDYSLRSSVLGHSHGYGEPGAFRIIHG  80

Query  298  IMSPENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDLKC-KHIFHRACLDRWVGT  474
            + + +                   ECAVCLC++  GEEVR+LKC  H+FHRACLD+W+G 
Sbjct  81   LDTAQYGGGP------------PAECAVCLCEVRAGEEVRELKCCDHVFHRACLDQWLGY  128

Query  475  GRNSCPLCRTHV-KPAARLFGEDLHQEVIVFDFC--SRRRDRCSWWLR  609
               +CPLCR  V + A+     +   E+I   FC      DR +WWLR
Sbjct  129  KNVTCPLCRRFVARRASMSVIAEAGVEIISLTFCDLGSGGDRETWWLR  176



>ref|XP_006437778.1| hypothetical protein CICLE_v10033401mg [Citrus clementina]
 gb|ESR51018.1| hypothetical protein CICLE_v10033401mg [Citrus clementina]
Length=132

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 69/131 (53%), Gaps = 12/131 (9%)
 Frame = +1

Query  223  LKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEGESDGAVECAVCLCKIEE  402
            LKWA  C LL       ++ N    +++      E+G R        AVECAVCL  IEE
Sbjct  12   LKWA--CNLLLHFSFFGHRINASDQLVNIWEDRFELGSRA------EAVECAVCLSHIEE  63

Query  403  GEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEVIVFDF--CS  576
            GEE+R+L C H+FH  CLD W+      CP+C   + P+  L G    +EVIV  F   +
Sbjct  64   GEEIRELSCHHLFHAVCLDTWISNNYAICPVCHDSIAPSRWLTGHG--EEVIVLKFRCFN  121

Query  577  RRRDRCSWWLR  609
             R +R +WWLR
Sbjct  122  SRTERDTWWLR  132



>ref|XP_004490370.1| PREDICTED: RING-H2 finger protein ATL47-like [Cicer arietinum]
Length=141

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 78/142 (55%), Gaps = 10/142 (7%)
 Frame = +1

Query  190  VLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEGESDGAV  369
            ++  +  V   LKW  D L+        YK +     +  E+       R     S+  V
Sbjct  8    IMQTLTLVYTHLKWILDFLVYHPF----YKLHDCHLPIFEEDYNIWNYKRT--PGSEEEV  61

Query  370  ECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQ  549
            +CAVCLC+I+EG+E+R L+C+H++H  CLD+W+    ++CPLCR  ++P  R    +L  
Sbjct  62   DCAVCLCQIKEGDEIRVLRCEHMYHINCLDKWISFKTDTCPLCRESLRP--RRDTTELGA  119

Query  550  EVIVFDFCSRRRDR--CSWWLR  609
            EV++F+F + R DR    WWLR
Sbjct  120  EVLLFNFGTFRTDRDCDDWWLR  141



>ref|XP_010068767.1| PREDICTED: NEP1-interacting protein-like 2 [Eucalyptus grandis]
Length=176

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 84/162 (52%), Gaps = 11/162 (7%)
 Frame = +1

Query  139  ICTFIFKKLLQMFP-QSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPEN  315
            I + + + + ++ P ++ V + + ++   LKWA D  L  S+    +      G   P  
Sbjct  21   ISSSLPRNVPKLLPLKAAVADRLSALVGPLKWALDYSLRSSVLGHSH------GHGEPGA  74

Query  316  AASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDLKC-KHIFHRACLDRWVGTGRNSCP  492
             A    +   +       EC+VCLC++  GEEVR+L C  H+FHRAC+D+W+G    +CP
Sbjct  75   LAIIHRLGTAQYGRGPPTECSVCLCEVRVGEEVRELNCCDHVFHRACMDQWLGYKNATCP  134

Query  493  LCRTHVKPAARL-FGEDLHQEVIVFDFC--SRRRDRCSWWLR  609
            LCR  V   A +    D+  EVI F FC    R DR +WWLR
Sbjct  135  LCRRFVALQASMSVIADVGAEVISFAFCDLGSRGDRETWWLR  176



>ref|XP_008389340.1| PREDICTED: probable E3 ubiquitin-protein ligase RHA2B [Malus 
domestica]
Length=150

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 77/149 (52%), Gaps = 26/149 (17%)
 Frame = +1

Query  217  AQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEGESD-------GAVEC  375
              L W  + ++  S  +    ++     + P + A+E+ +   + + +          EC
Sbjct  10   THLSWLLNFVVYHSFSK---HYDHYFDELLPADQATEISLTTVQYKPNPGPNSETSTAEC  66

Query  376  AVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQ--  549
            AVCLCKIEEGEE+R+L+C H+FH+ CLD+W G    +CP+CR+ + P      + LHQ  
Sbjct  67   AVCLCKIEEGEEIRELRCAHLFHKPCLDKWTGFKHATCPICRSRLAPPR---SKQLHQQF  123

Query  550  ----EVIVFD-----FCSRRRDRCSWWLR  609
                EV++F        S R DR  WWLR
Sbjct  124  DEQVEVLLFKFXSFSSDSDRGDR--WWLR  150



>gb|KDO70160.1| hypothetical protein CISIN_1g042112mg [Citrus sinensis]
Length=132

 Score = 84.7 bits (208),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 69/131 (53%), Gaps = 12/131 (9%)
 Frame = +1

Query  223  LKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEGESDGAVECAVCLCKIEE  402
            LKWA  C LL       ++ N    +++      E+G R        AVECAVCL  IEE
Sbjct  12   LKWA--CNLLLHFSFFGHRINASEQLVNIWEDRFELGSRA------EAVECAVCLSHIEE  63

Query  403  GEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEVIVFDF--CS  576
            GEE+R+L C H+FH  CLD W+      CP+C   + P+  L G    +EV+V  F   +
Sbjct  64   GEEIRELSCHHLFHAVCLDTWISNNYAICPVCHDSIAPSRWLTGHG--EEVLVLKFRCFN  121

Query  577  RRRDRCSWWLR  609
             R +R +WWLR
Sbjct  122  SRTERDTWWLR  132



>ref|XP_011008959.1| PREDICTED: E3 ubiquitin-protein ligase RNF126-like [Populus euphratica]
Length=133

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 71/135 (53%), Gaps = 12/135 (9%)
 Frame = +1

Query  211  VAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEGESDGAVECAVCLC  390
            ++A L+WA      +  C  P+ F           A + +G  +    ++   ECAVCL 
Sbjct  9    ISAHLRWA-----FKFWCYYPFSFQEHELF-----AVTAIGEELNTVINEAPAECAVCLD  58

Query  391  KIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLHQEVIVFDF  570
             +EEGEE+R+L+C HIFHRACL RW+    ++CPLCR  +     L  +    EV+ F F
Sbjct  59   DVEEGEEIRELRCGHIFHRACLYRWLDFRPSTCPLCRGSLAHRRTLILDQHRTEVVKFKF  118

Query  571  CS--RRRDRCSWWLR  609
            CS     +R +W LR
Sbjct  119  CSFTSTDERATWSLR  133



>ref|XP_007153423.1| hypothetical protein PHAVU_003G034000g [Phaseolus vulgaris]
 gb|ESW25417.1| hypothetical protein PHAVU_003G034000g [Phaseolus vulgaris]
Length=164

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 73/145 (50%), Gaps = 13/145 (9%)
 Frame = +1

Query  184  SRVLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEGESDG  363
            S ++  +    + +KW  D LL        + F  +     P   A +  +  +E   D 
Sbjct  30   SMLMKYLSEFYSHIKWVLDFLLF-------FPFYTLHDSQMP-MIAEDQSICYYEHTPDT  81

Query  364  AVE--CAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGE  537
              +  CAVCL KI +GEE+R L+C+H FHR CLD+WV     SCPLCR  V+P  R    
Sbjct  82   EEDDDCAVCLSKIGDGEEIRVLRCEHFFHRNCLDQWVALKNGSCPLCRDPVRP--RRAMN  139

Query  538  DLHQEVIVFDFCSRRRDRCS-WWLR  609
            ++  EV+ F FC+   +    WWLR
Sbjct  140  EVGAEVLWFQFCTVHTNEPDRWWLR  164



>ref|XP_008243400.1| PREDICTED: E3 ubiquitin-protein ligase Os03g0188200-like [Prunus 
mume]
Length=216

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 52/80 (65%), Gaps = 5/80 (6%)
 Frame = +1

Query  346  EGESD-GAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAA  522
             G SD    ECAVCLCKIEEG+EVR+L+C H+FH+ CLDRW G    +CPLCR+ + P  
Sbjct  56   SGTSDESPAECAVCLCKIEEGDEVRELRCAHLFHKQCLDRWTGFQHATCPLCRSFLAPPR  115

Query  523  RLF----GEDLHQEVIVFDF  570
                    + L  EV++F++
Sbjct  116  STLVSHSQQFLQSEVLLFNY  135



>gb|KCW64814.1| hypothetical protein EUGRSUZ_G02385, partial [Eucalyptus grandis]
Length=139

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 55/85 (65%), Gaps = 4/85 (5%)
 Frame = +1

Query  367  VECAVCLCKIEEGEEVRDLKC-KHIFHRACLDRWVGTGRNSCPLCRTHVKPAARL-FGED  540
             EC+VCLC++  GEEVR+L C  H+FHRAC+D+W+G    +CPLCR  V   A +    D
Sbjct  55   TECSVCLCEVRVGEEVRELNCCDHVFHRACMDQWLGYKNATCPLCRRFVALQASMSVIAD  114

Query  541  LHQEVIVFDFC--SRRRDRCSWWLR  609
            +  EVI F FC    R DR +WWLR
Sbjct  115  VGAEVISFAFCDLGSRGDRETWWLR  139



>ref|XP_008339729.1| PREDICTED: RING-H2 finger protein ATL11-like [Malus domestica]
Length=150

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 66/116 (57%), Gaps = 17/116 (15%)
 Frame = +1

Query  307  PENAASEVGVRVFEGESDGAV-------ECAVCLCKIEEGEEVRDLKCKHIFHRACLDRW  465
            P + A+E+ +     + +          EC+VCLCKI+EGEE+R+L+C H+FH  CLD W
Sbjct  37   PADQATELSLTTVRYKPNAGTNSESSTAECSVCLCKIDEGEEIRELRCAHLFHJPCLDGW  96

Query  466  VGTGRNSCPLCRTHVKP--AARLFGE-DLHQEVIVFDFC-----SRRRDRCSWWLR  609
             G    +CP+CR+ + P  + +L  + D   EV+ F FC     S R DR  WWLR
Sbjct  97   TGFKHATCPICRSRLAPPRSTQLQQQFDGQVEVLRFQFCSFSSDSDRGDR--WWLR  150



>gb|KHN17843.1| RING-H2 finger protein ATL47 [Glycine soja]
Length=110

 Score = 80.9 bits (198),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = +1

Query  307  PENAASEVGVRVFE--GESDGAVECAVCLCKIEEGEEV-RDLKCKHIFHRACLDRWVGTG  477
            P N  +E+    +E    S+  V+CAVCL K  EG+EV R ++C+H+FH+ CLDRWVG  
Sbjct  8    PINLGTELSTFHYEFSSGSEEHVDCAVCLSKFGEGDEVIRVMRCEHVFHKGCLDRWVGFE  67

Query  478  RNSCPLCRTHVKPAARLFGEDLHQEVIVFDFCSRRR-DRCSWWLR  609
              +CPLCR  + P   +       EV++F FCS ++ +  +WWLR
Sbjct  68   NATCPLCRGSLTPKRPITNSG--AEVVLFQFCSVQKCNDETWWLR  110



>ref|XP_006437779.1| hypothetical protein CICLE_v10033150mg [Citrus clementina]
 gb|ESR51019.1| hypothetical protein CICLE_v10033150mg [Citrus clementina]
Length=103

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 59/85 (69%), Gaps = 9/85 (11%)
 Frame = +1

Query  367  VECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLH  546
            +ECAVCLCKIEE EE+R+L+C H+FH++CLD W      +CP+CR  + P  RL  E L 
Sbjct  24   IECAVCLCKIEE-EEMRELRCSHLFHQSCLDAWTAYKYATCPICRDSIAP-PRLVTE-LG  80

Query  547  QEVIVFDFCS----RRRDRCSWWLR  609
            +E++ F+FCS     +RD+  WW+R
Sbjct  81   EEMLFFNFCSFSSTSQRDK--WWVR  103



>ref|XP_010068768.1| PREDICTED: NEP1-interacting protein-like 2 [Eucalyptus grandis]
Length=176

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 54/85 (64%), Gaps = 4/85 (5%)
 Frame = +1

Query  367  VECAVCLCKIEEGEEVRDLKC-KHIFHRACLDRWVGTGRNSCPLCRTHVKPAARL-FGED  540
             ECAVCLC++  GEEVR+LKC  H+FHRAC+D+W+G    +CPLCR  V   A +    D
Sbjct  92   TECAVCLCEVGVGEEVRELKCCDHVFHRACMDQWLGYKNATCPLCRRFVAHRASMSVIAD  151

Query  541  LHQEVIVFDF--CSRRRDRCSWWLR  609
            +  EVI F F       DR +WWLR
Sbjct  152  VGAEVISFAFWDLGSGGDRETWWLR  176



>ref|XP_010091706.1| E3 ubiquitin-protein ligase RHA2A [Morus notabilis]
 gb|EXB44972.1| E3 ubiquitin-protein ligase RHA2A [Morus notabilis]
Length=300

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/194 (29%), Positives = 86/194 (44%), Gaps = 31/194 (16%)
 Frame = +1

Query  106  PHAFIIVFIALICTFIFKKLLQMFPQSRVL-----NCVVSVAAQLKWAWDCLLLQSLCQD  270
            P     +       F+    L++   +  L     N +      LKWA+D LL      +
Sbjct  3    PSQMFYILTCFSLQFLCDSFLKLKTSTSTLPLTIWNYMAPTLTNLKWAFDTLLY-----N  57

Query  271  PYKFNVVTGIMSP-ENAASEVGVRV-------FEGE---SDGAVECAVCLCKIEEGEEVR  417
            P+ F+    +    +   +   +R+        EGE   ++ A +CAVCL +++EGEE+ 
Sbjct  58   PFSFSAPDRLYDNIQKTGTGELIRITRYERNPMEGEQCSAENAEQCAVCLGQVQEGEEIG  117

Query  418  DLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGE-------DLHQEVIVFDFC-  573
            +L+C H+FH  CL+RWV     +CPLCR  +                D   EV+ F FC 
Sbjct  118  ELRCSHVFHLLCLERWVQFKHKTCPLCRGSLAAPPLNAAAAAAAGVADFGVEVLFFKFCS  177

Query  574  --SRRRDRCSWWLR  609
              S   +R SWWLR
Sbjct  178  FGSNDDERDSWWLR  191



>gb|KCW64815.1| hypothetical protein EUGRSUZ_G02386 [Eucalyptus grandis]
Length=146

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 54/85 (64%), Gaps = 4/85 (5%)
 Frame = +1

Query  367  VECAVCLCKIEEGEEVRDLKC-KHIFHRACLDRWVGTGRNSCPLCRTHVKPAARL-FGED  540
             ECAVCLC++  GEEVR+LKC  H+FHRAC+D+W+G    +CPLCR  V   A +    D
Sbjct  62   TECAVCLCEVGVGEEVRELKCCDHVFHRACMDQWLGYKNATCPLCRRFVAHRASMSVIAD  121

Query  541  LHQEVIVFDF--CSRRRDRCSWWLR  609
            +  EVI F F       DR +WWLR
Sbjct  122  VGAEVISFAFWDLGSGGDRETWWLR  146



>ref|XP_007163619.1| hypothetical protein PHAVU_001G249600g [Phaseolus vulgaris]
 gb|ESW35613.1| hypothetical protein PHAVU_001G249600g [Phaseolus vulgaris]
Length=165

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +1

Query  337  RVFEGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            R+ + E     EC VCLC++EEGE+VR L+C H+FHR CLD+W+     +CPLCR  V P
Sbjct  62   RLLKAEQGCGAECRVCLCELEEGEKVRKLQCHHMFHRDCLDKWLQQYWATCPLCRKQVVP  121

Query  517  AARLFGEDLHQ  549
               +    LHQ
Sbjct  122  PDVVLKHRLHQ  132



>gb|KEH41382.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=220

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  352  ESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            +S+  VEC VCLCKIEEG+++R LKC H++HR CLD+WV    ++CPLCR  ++P
Sbjct  12   DSEKDVECVVCLCKIEEGDDIRVLKCDHMYHRHCLDKWVAFKNHTCPLCRESLRP  66



>ref|XP_009407107.1| PREDICTED: RING-H2 zinc finger protein RHA1a-like [Musa acuminata 
subsp. malaccensis]
Length=138

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  355  SDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            S  A EC  CLC IEEGEE+R+L+C H+FHR+CLDRW+   R +CPLCR  + P
Sbjct  48   SHEAAECVFCLCDIEEGEEIRELRCGHLFHRSCLDRWLVRRRATCPLCRDVLLP  101



>ref|XP_003169396.1| RING finger protein [Microsporum gypseum CBS 118893]
 gb|EFR05289.1| RING finger protein [Microsporum gypseum CBS 118893]
Length=823

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/77 (48%), Positives = 46/77 (60%), Gaps = 4/77 (5%)
 Frame = +1

Query  274  YKFNVVTGIMSPENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRA  450
            Y+    +G +  E+   E    V   ESD    C +CLC  E  EEVR L KCKH++HR 
Sbjct  731  YRLVEYSGALVAESIGEETQESVPIAESD---RCLICLCDYEAAEEVRILNKCKHVYHRE  787

Query  451  CLDRWVGTGRNSCPLCR  501
            C+D W+ TGRNSCPLCR
Sbjct  788  CIDEWLTTGRNSCPLCR  804



>gb|KCW64816.1| hypothetical protein EUGRSUZ_G02387, partial [Eucalyptus grandis]
Length=144

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 74/146 (51%), Gaps = 22/146 (15%)
 Frame = +1

Query  160  KLLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQ------DPYKFNVVTGIMSPENAA  321
            KLL +  ++ V   + ++   LKWA D  L  S+        +P  F ++ G+ + +   
Sbjct  3    KLLPL--KAAVAARLSALLGPLKWALDYSLRSSVLGHSHGYGEPGAFRIIHGLDTAQYGG  60

Query  322  SEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDLKC-KHIFHRACLDRWVGTGRNSCPLC  498
                            ECAVCLC++  GEEVR+LKC  H+FHRACLD+W+G    +CPLC
Sbjct  61   GP------------PAECAVCLCEVRAGEEVRELKCCDHVFHRACLDQWLGYKNVTCPLC  108

Query  499  RTHV-KPAARLFGEDLHQEVIVFDFC  573
            R  V + A+     +   E+I   FC
Sbjct  109  RRFVARRASMSVIAEAGVEIISLTFC  134



>ref|XP_010068771.1| PREDICTED: NEP1-interacting protein-like 2 [Eucalyptus grandis]
 gb|KCW64818.1| hypothetical protein EUGRSUZ_G02390 [Eucalyptus grandis]
Length=176

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 80/168 (48%), Gaps = 27/168 (16%)
 Frame = +1

Query  151  IFKKLLQMFPQSRVLNCVV-----SVAAQLKWAWDCLLLQSLCQ------DPYKFNVVTG  297
            I   L    P+  +L   V     ++   LKWA D  L  S+ +      +P  F ++  
Sbjct  21   ISSSLAPKVPKLLLLKATVAARLSTLVGPLKWALDYSLGSSVLRHSHGHGEPGAFGIIHR  80

Query  298  IMSPENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDLKC-KHIFHRACLDRWVGT  474
            +     + ++ G R          ECAVCLC++  GEEVR+LKC  H+FHRACLD+W+G 
Sbjct  81   L-----STAQYGDR-------SPTECAVCLCQVGAGEEVRELKCCDHVFHRACLDQWLGF  128

Query  475  GRNSCPLCRTHVKPAARL-FGEDLHQEVIVFDF--CSRRRDRCSWWLR  609
               +CPLCR  V   A +    +   E+I           DR +WWLR
Sbjct  129  KNVTCPLCRRLVAHRASMSIITEAGVEIICLALRDLGSGSDRETWWLR  176



>emb|CDP01401.1| unnamed protein product [Coffea canephora]
Length=162

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  358  DGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            D ++ECAVCL   EEGE VR L CKHIFH+ CLDRW+     +CPLCRT V P
Sbjct  71   DDSIECAVCLSLFEEGEFVRKLNCKHIFHKDCLDRWLQQDWATCPLCRTTVLP  123



>ref|XP_007048067.1| RING-H2 zinc finger protein RHA2a [Theobroma cacao]
 gb|EOX92224.1| RING-H2 zinc finger protein RHA2a [Theobroma cacao]
Length=162

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  370  ECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            ECAVCL ++EEGEEVR LKCKH FH+ CLDRW+     +CPLCRT V P
Sbjct  75   ECAVCLSELEEGEEVRKLKCKHTFHKDCLDRWLQQYWATCPLCRTKVLP  123



>ref|XP_009336385.1| PREDICTED: probable E3 ubiquitin-protein ligase RHA2B [Pyrus 
x bretschneideri]
Length=158

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  364  AVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            A EC+VCL   EEG+++R LKCKH FH+ CLD+W+   R +CPLCRT V P
Sbjct  69   ATECSVCLSDFEEGDKIRQLKCKHTFHQGCLDKWLQEYRATCPLCRTKVLP  119



>ref|XP_006591402.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max]
 gb|KHN04818.1| E3 ubiquitin-protein ligase RHA2A [Glycine soja]
Length=159

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  AVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDL  543
            A EC VCL + EEGE+VR LKC+H FHR CLD+W+     +CPLCR  V P   +F   L
Sbjct  71   ATECRVCLSEFEEGEKVRKLKCQHTFHRDCLDKWLQQYWATCPLCRKQVLPDDVVFKHRL  130

Query  544  HQ  549
            HQ
Sbjct  131  HQ  132



>ref|XP_002309999.1| hypothetical protein POPTR_0007s06120g [Populus trichocarpa]
 gb|EEE90449.1| hypothetical protein POPTR_0007s06120g [Populus trichocarpa]
Length=163

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +1

Query  364  AVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDL  543
            ++ECAVCL K  EGE VR L CKH FH+ CLD+W+     +CPLCR  V P   +   D 
Sbjct  73   SMECAVCLSKFSEGESVRKLNCKHTFHKDCLDKWLQQSLATCPLCRAKVLPDEIVAKYDR  132

Query  544  HQEVIVFD  567
             Q  I +D
Sbjct  133  MQNQIGYD  140



>ref|XP_008792459.1| PREDICTED: probable E3 ubiquitin-protein ligase RHA2B [Phoenix 
dactylifera]
 ref|XP_008792460.1| PREDICTED: probable E3 ubiquitin-protein ligase RHA2B [Phoenix 
dactylifera]
 ref|XP_008792461.1| PREDICTED: probable E3 ubiquitin-protein ligase RHA2B [Phoenix 
dactylifera]
Length=141

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 51/84 (61%), Gaps = 3/84 (4%)
 Frame = +1

Query  283  NVVTGIMSPENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDR  462
            +++  +M    A+S   + V   E    VEC VCL  IE+ E++RDLKC+H+FH+ CLDR
Sbjct  29   SILQRLMPAFLASSFRKILVSSVELSDEVECVVCLRSIEKSEKIRDLKCQHLFHKVCLDR  88

Query  463  WVGTGRNSCPLCRTH---VKPAAR  525
            WV     +CP+CR H   VK A R
Sbjct  89   WVEHQGRTCPICRDHLYLVKEAER  112



>ref|XP_010053738.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B-like [Eucalyptus 
grandis]
 gb|KCW78093.1| hypothetical protein EUGRSUZ_D02311 [Eucalyptus grandis]
Length=165

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 63/126 (50%), Gaps = 9/126 (7%)
 Frame = +1

Query  157  KKLLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAA---SE  327
            K L Q  P  R++  +VS   +L    D L +     DP      T +  P +A      
Sbjct  14   KLLFQTIPFLRLIRILVSSLLRLLGFPDFLEI-----DPPLPESRTPVRPPVSAVLIQEF  68

Query  328  VGVRVFEGESDGAVECAVCLCKIEEGEEVRDLK-CKHIFHRACLDRWVGTGRNSCPLCRT  504
            + +  +   SD    C VCL + E GEEVR+LK CKH+FHR CLDRW+   + +CPLCRT
Sbjct  69   LPLVKYRESSDPPESCTVCLYEFEAGEEVRELKNCKHVFHRGCLDRWMDCDQRTCPLCRT  128

Query  505  HVKPAA  522
               P  
Sbjct  129  QFLPKG  134



>ref|XP_011005645.1| PREDICTED: probable E3 ubiquitin-protein ligase RHA2B [Populus 
euphratica]
Length=162

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +1

Query  364  AVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDL  543
            ++ECAVCL K  EGE VR L CKH FH+ CLD+W+     +CPLCR  V P   +   D 
Sbjct  73   SMECAVCLSKFSEGESVRKLNCKHTFHKDCLDKWLQQSLATCPLCRAKVLPDEIVAKYDR  132

Query  544  HQEVIVFD  567
             Q  I +D
Sbjct  133  MQHQIGYD  140



>ref|XP_006829206.1| hypothetical protein AMTR_s00001p00271850 [Amborella trichopoda]
 gb|ERM96622.1| hypothetical protein AMTR_s00001p00271850 [Amborella trichopoda]
Length=148

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 55/92 (60%), Gaps = 16/92 (17%)
 Frame = +1

Query  322  SEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLC  498
            S++ V  +E E D   +C VCL  +E G++VR+L  CKH+FHR CLD+WV  G+ +CPLC
Sbjct  53   SKLAVVEYE-EKDEESDCVVCLNSLERGQKVRELCNCKHVFHRVCLDKWVDLGQTTCPLC  111

Query  499  RTHVKPA--------------ARLFGEDLHQE  552
            R+ + PA              + LFGEDL  E
Sbjct  112  RSSLLPAITGERKDSWLVDRISYLFGEDLGIE  143



>ref|XP_002306334.2| hypothetical protein POPTR_0005s08300g [Populus trichocarpa]
 gb|EEE93330.2| hypothetical protein POPTR_0005s08300g [Populus trichocarpa]
Length=162

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +1

Query  364  AVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDL  543
            ++ECAVCL +  EGE VR LKCKH FH+ CLD W+     +CPLCR  V P   L   D 
Sbjct  73   SIECAVCLSEFSEGESVRKLKCKHTFHKDCLDEWLQQCLATCPLCRAKVLPDEILAKYDR  132

Query  544  HQEVIVFD  567
             Q  I +D
Sbjct  133  MQSQIEYD  140



>ref|XP_003233722.1| RING finger protein [Trichophyton rubrum CBS 118892]
Length=821

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 45/77 (58%), Gaps = 4/77 (5%)
 Frame = +1

Query  274  YKFNVVTGIMSPENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRA  450
            Y+    +G +  E    E    V   E+D    C +CLC  E  EEVR L KCKH++HR 
Sbjct  729  YRLVEYSGALVAEIIGEETRENVPIAEND---RCLICLCDYEAAEEVRILNKCKHVYHRE  785

Query  451  CLDRWVGTGRNSCPLCR  501
            C+D W+ TGRNSCPLCR
Sbjct  786  CIDEWLTTGRNSCPLCR  802



>ref|XP_006601942.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max]
 gb|KHN31339.1| E3 ubiquitin-protein ligase RHA2A [Glycine soja]
Length=155

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = +1

Query  334  VRVFEGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVK  513
             + F  +++ A EC VCL + E+GE++R LKC+H FHR CLD+W+     +CPLCR  V 
Sbjct  58   TKRFNLKAEHATECRVCLSEFEQGEKLRKLKCQHTFHRDCLDKWLQQYWATCPLCRKQVL  117

Query  514  PAARLFGEDLHQ  549
            P   +F    HQ
Sbjct  118  PDDVVFKHRQHQ  129



>ref|XP_010068773.1| PREDICTED: NEP1-interacting protein-like 2 [Eucalyptus grandis]
Length=166

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 67/132 (51%), Gaps = 20/132 (15%)
 Frame = +1

Query  139  ICTFIFKKLLQMFP-QSRVLNCVVSVAAQLKWAWDCLLLQSLCQ------DPYKFNVVTG  297
            I + + + +  + P ++ V   + ++   LKWA D  L  S+         P  F ++ G
Sbjct  21   ISSSLARNVPMLLPLKAAVAARLSALLGPLKWALDYSLRSSVLGLSHGHGKPGAFRIIHG  80

Query  298  IMSPENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDLKC-KHIFHRACLDRWVGT  474
            +          G   + G      EC VCLC++  GEEVR+LKC  H+FHRACLD+W+G 
Sbjct  81   L----------GTAQYGGRPP--AECTVCLCEVRAGEEVRELKCCDHVFHRACLDQWLGY  128

Query  475  GRNSCPLCRTHV  510
               +CPLCR  V
Sbjct  129  KNATCPLCRKFV  140



>ref|XP_007224697.1| hypothetical protein PRUPE_ppa025457mg [Prunus persica]
 gb|EMJ25896.1| hypothetical protein PRUPE_ppa025457mg [Prunus persica]
Length=122

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 47/82 (57%), Gaps = 7/82 (9%)
 Frame = +1

Query  385  LCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLF----GEDLHQE  552
            L  IEEG+EVR+L+C H+FHR CLDRW G    +CPLC + + P          + L  E
Sbjct  41   LGTIEEGDEVRELRCVHLFHRQCLDRWTGFQHATCPLCHSFLAPHRSTLVSHSQQFLQSE  100

Query  553  VIVFDFCS---RRRDRCSWWLR  609
            V++F FCS      D   WWLR
Sbjct  101  VLLFKFCSFSLDSDDGDGWWLR  122



>ref|XP_002789519.1| RING finger protein [Paracoccidioides sp. 'lutzii' Pb01]
Length=797

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            C +CLC  E  EEVR L KC+HI+HR C+D W+ TGRNSCPLCR
Sbjct  731  CLICLCDYEAAEEVRQLTKCRHIYHRECIDEWLTTGRNSCPLCR  774



>gb|AEI84328.1| ubiquitin-protein ligase E3 [Jatropha curcas]
Length=171

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +1

Query  349  GESDGAVECAVCLCKIEEGEEVRDLK-CKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            GE D    CAVCL + +  +E+R LK CKHIFHRACLDRW+   RN+CPLCRT   P
Sbjct  84   GEGDLPESCAVCLYEFDGEDEIRWLKNCKHIFHRACLDRWMDHDRNTCPLCRTSFVP  140



>gb|EEH18624.2| hypothetical protein PABG_07684 [Paracoccidioides brasiliensis 
Pb03]
Length=851

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            C +CLC  E  EEVR L KC+HI+HR C+D W+ TGRNSCPLCR
Sbjct  785  CLICLCDYEAAEEVRQLTKCRHIYHRECIDEWLTTGRNSCPLCR  828



>gb|EEH38840.2| RING finger protein [Paracoccidioides sp. 'lutzii' Pb01]
Length=851

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            C +CLC  E  EEVR L KC+HI+HR C+D W+ TGRNSCPLCR
Sbjct  785  CLICLCDYEAAEEVRQLTKCRHIYHRECIDEWLTTGRNSCPLCR  828



>ref|XP_010756818.1| hypothetical protein PADG_01194 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH45044.2| hypothetical protein PADG_01194 [Paracoccidioides brasiliensis 
Pb18]
Length=851

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            C +CLC  E  EEVR L KC+HI+HR C+D W+ TGRNSCPLCR
Sbjct  785  CLICLCDYEAAEEVRQLTKCRHIYHRECIDEWLTTGRNSCPLCR  828



>ref|XP_009416377.1| PREDICTED: probable E3 ubiquitin-protein ligase RHA2B [Musa acuminata 
subsp. malaccensis]
Length=165

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 46/65 (71%), Gaps = 4/65 (6%)
 Frame = +1

Query  337  RVFEGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHV--  510
            R  EG+ + A EC  CL  IEEGEE+R+L+CKH+FHR CLDRW+   R +CPLCR  +  
Sbjct  73   RPSEGQKEPA-ECVFCLSDIEEGEEIRELRCKHLFHRRCLDRWLVHRRATCPLCRDTLLQ  131

Query  511  -KPAA  522
             +PAA
Sbjct  132  REPAA  136



>gb|KDP28595.1| hypothetical protein JCGZ_14366 [Jatropha curcas]
Length=171

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +1

Query  349  GESDGAVECAVCLCKIEEGEEVRDLK-CKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            GE D    CAVCL + +  +E+R LK CKHIFHRACLDRW+   RN+CPLCRT   P
Sbjct  84   GEGDLPESCAVCLYEFDGEDEIRWLKNCKHIFHRACLDRWMDHDRNTCPLCRTSFVP  140



>ref|XP_008805361.1| PREDICTED: E3 ubiquitin-protein ligase RNF126-like, partial [Phoenix 
dactylifera]
Length=214

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +1

Query  343  FEGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHV  510
             EG ++  V C  CL  IEEGEE+R+L+C+H+FH++C DRW+  GR +CPLCR  +
Sbjct  97   LEGSNEQVV-CVFCLSNIEEGEEIRELRCRHLFHKSCFDRWIEHGRAACPLCRNSL  151



>ref|XP_009631296.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Nicotiana 
tomentosiformis]
Length=164

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            CAVCL   EEGEEVR LKCKHIFH+ CLD W+     +CPLCR  V P
Sbjct  77   CAVCLSAFEEGEEVRKLKCKHIFHKDCLDTWLQQDSATCPLCRNKVLP  124



>ref|XP_009356505.1| PREDICTED: E3 ubiquitin-protein ligase RNF181-like isoform X1 
[Pyrus x bretschneideri]
Length=169

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 79/143 (55%), Gaps = 14/143 (10%)
 Frame = +1

Query  217  AQLKWAWDCLLLQSLCQ--DPYKFNVVTGIMSPENAASEVGVRVFEGESD--GAVECAVC  384
              L W  + ++  S  +  D Y   ++    + E + S V  +   G +      ECAVC
Sbjct  29   THLSWLLNFVVYHSFSKHYDHYFDELLPADQATEISLSTVQYKPNPGANSETSTAECAVC  88

Query  385  LCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP--AARLFGE-DLHQEV  555
            LCKIEEGEE+++L+C H+FH+ CLD+W G    +CP+CR+ + P  + +L  + D   EV
Sbjct  89   LCKIEEGEEIKELRCAHLFHKPCLDKWTGFKHATCPICRSRLAPPRSKQLHKQFDEQVEV  148

Query  556  IVFDFC-----SRRRDRCSWWLR  609
            ++F FC     S R DR  WWLR
Sbjct  149  LLFKFCSFSSDSDRGDR--WWLR  169



>ref|XP_009797902.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Nicotiana 
sylvestris]
Length=164

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            CAVCL   EEGEEVR LKCKHIFH+ CLD W+     +CPLCR  V P
Sbjct  77   CAVCLSPFEEGEEVRKLKCKHIFHKDCLDTWLQQDSATCPLCRNKVLP  124



>ref|XP_009356559.1| PREDICTED: E3 ubiquitin-protein ligase EL5-like [Pyrus x bretschneideri]
Length=150

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 79/143 (55%), Gaps = 14/143 (10%)
 Frame = +1

Query  217  AQLKWAWDCLLLQSLCQ--DPYKFNVVTGIMSPENAASEVGVRVFEGESD--GAVECAVC  384
              L W  + ++  S  +  D Y   ++    + E + S V  +   G +      ECAVC
Sbjct  10   THLSWLLNFVVYHSFSKHYDHYFDELLPADQATEISLSTVQYKPNPGANSETSTAECAVC  69

Query  385  LCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP--AARLFGE-DLHQEV  555
            LCKIEEGEE+++L+C H+FH+ CLD+W G    +CP+CR+ + P  + +L  + D   EV
Sbjct  70   LCKIEEGEEIKELRCAHLFHKPCLDKWTGFKHATCPICRSRLAPPRSKQLHKQFDEQVEV  129

Query  556  IVFDFC-----SRRRDRCSWWLR  609
            ++F FC     S R DR  WWLR
Sbjct  130  LLFKFCSFSSDSDRGDR--WWLR  150



>gb|EGD94093.1| hypothetical protein TESG_01619 [Trichophyton tonsurans CBS 112818]
Length=798

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            C +CLC  E  EEVR L KCKH++HR C+D W+ TGRNSCPLCR
Sbjct  736  CLICLCDYEAAEEVRILNKCKHVYHRECIDEWLTTGRNSCPLCR  779



>gb|EZF36301.1| hypothetical protein H101_00177 [Trichophyton interdigitale H6]
 gb|KDB26037.1| hypothetical protein H109_02135 [Trichophyton interdigitale MR816]
Length=821

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            C +CLC  E  EEVR L KCKH++HR C+D W+ TGRNSCPLCR
Sbjct  759  CLICLCDYEAAEEVRILNKCKHVYHRECIDEWLTTGRNSCPLCR  802



>gb|EGE06657.1| RING finger protein [Trichophyton equinum CBS 127.97]
Length=821

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            C +CLC  E  EEVR L KCKH++HR C+D W+ TGRNSCPLCR
Sbjct  759  CLICLCDYEAAEEVRILNKCKHVYHRECIDEWLTTGRNSCPLCR  802



>emb|CCX29987.1| Similar to Uncharacterized RING finger protein P4H10.07; acc. 
no. Q9P7E1 [Pyronema omphalodes CBS 100304]
Length=828

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 45/95 (47%), Positives = 54/95 (57%), Gaps = 12/95 (13%)
 Frame = +1

Query  238  DCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVF-EGESD----GAVE-CAVCLCKIE  399
            D  LL SL   P K  V     + E+  S  G+  F EG ++    G VE C +CL   E
Sbjct  697  DMTLLSSLL-GPAKLPVA----AKEDLESAGGIFTFAEGSAEQYGAGNVERCLICLSDYE  751

Query  400  EGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            +GE  R L KC HIFHR C+D W+ TGRNSCPLCR
Sbjct  752  QGESCRQLVKCNHIFHRECIDEWLTTGRNSCPLCR  786



>emb|CDP00531.1| unnamed protein product [Coffea canephora]
Length=190

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  349  GESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVK  513
             + +   ECAVCLC I E +E + L+C H+FH+ CLDRW G G+ +CPLCR   K
Sbjct  102  NQEESGEECAVCLCTIAESDEAKRLRCDHVFHKVCLDRWFGYGQVTCPLCRCSTK  156



>emb|CDM80745.1| unnamed protein product [Triticum aestivum]
Length=193

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  349  GESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            G+   AV+C  CL +I++GEEVR+L+C+H+FHR CLD W+   R +CPLCR  + P
Sbjct  97   GDKWAAVDCVFCLSRIDDGEEVRELRCRHVFHRECLDSWLLRPRATCPLCRDRLLP  152



>gb|AEW09142.1| hypothetical protein CL4264Contig1_01, partial [Pinus radiata]
 gb|AFG51124.1| hypothetical protein CL4264Contig1_01, partial [Pinus taeda]
 gb|AFG51125.1| hypothetical protein CL4264Contig1_01, partial [Pinus taeda]
 gb|AFG51126.1| hypothetical protein CL4264Contig1_01, partial [Pinus taeda]
 gb|AFG51128.1| hypothetical protein CL4264Contig1_01, partial [Pinus taeda]
 gb|AFG51129.1| hypothetical protein CL4264Contig1_01, partial [Pinus taeda]
 gb|AFG51130.1| hypothetical protein CL4264Contig1_01, partial [Pinus taeda]
 gb|AFG51131.1| hypothetical protein CL4264Contig1_01, partial [Pinus taeda]
 gb|AFG51132.1| hypothetical protein CL4264Contig1_01, partial [Pinus taeda]
 gb|AFG51134.1| hypothetical protein CL4264Contig1_01, partial [Pinus taeda]
 gb|AFG51136.1| hypothetical protein CL4264Contig1_01, partial [Pinus taeda]
 gb|AFG51137.1| hypothetical protein CL4264Contig1_01, partial [Pinus taeda]
 gb|AFG51139.1| hypothetical protein CL4264Contig1_01, partial [Pinus taeda]
 gb|AFG51140.1| hypothetical protein CL4264Contig1_01, partial [Pinus taeda]
Length=66

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  349  GESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRT  504
            G  +  VECAVCLCK EEG E+R L C H+FHR+CLD+W+   + +CPLCR+
Sbjct  7    GSDNTHVECAVCLCKFEEGVEIRQLPCCHLFHRSCLDKWLDHQQITCPLCRS  58



>dbj|BAJ92167.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92356.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=193

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  349  GESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            G+   AV+C  CL +I++GEEVR+L+C+H+FHR CLD W+   R +CPLCR  + P
Sbjct  96   GDKWAAVDCVFCLSRIDDGEEVRELRCRHVFHRECLDSWLLRPRATCPLCRDRLLP  151



>gb|KCW64817.1| hypothetical protein EUGRSUZ_G02389, partial [Eucalyptus grandis]
Length=153

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 67/126 (53%), Gaps = 19/126 (15%)
 Frame = +1

Query  172  MFPQSRVLNCVVSVAAQLKWAWDCLLLQSLC------QDPYKFNVVTGIMSPENAASEVG  333
            +  ++ V+  + ++   LKWA D  L  S+        +P  F ++  +     + ++ G
Sbjct  33   LLLKATVVARLSTLVGPLKWALDYSLGSSVLWHSHGHGEPGAFGIIHRL-----STAQYG  87

Query  334  VRVFEGESDGAVECAVCLCKIEEGEEVRDLKC-KHIFHRACLDRWVGTGRNSCPLCRTHV  510
             R          ECAVCLC++  GEEVR+LKC  H+FHRACLD+W+G    +CPLCR  V
Sbjct  88   DR-------SPTECAVCLCQVGAGEEVRELKCCDHVFHRACLDQWLGYKNVTCPLCRRLV  140

Query  511  KPAARL  528
               A +
Sbjct  141  AHRASM  146



>dbj|BAJ92172.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=147

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +1

Query  346  EGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAA  522
            +G  DGA  C VCL ++E  +EVR L  C H FHR C+D W+  GR +CPLCR+H+ P A
Sbjct  76   QGCHDGAAACIVCLERLEAADEVRRLGNCAHAFHRGCIDGWIDLGRTTCPLCRSHLLPRA  135

Query  523  RLFGEDLHQEV  555
            R     L   V
Sbjct  136  RRASPSLLTRV  146



>ref|XP_010261166.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like [Nelumbo nucifera]
Length=165

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  331  GVRVFEGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHV  510
             VR   G      EC VCL K EEGEEVR+L+CKH FH+ CLD+W+   + +CPLCR  V
Sbjct  63   AVRYRSGGRGEPKECVVCLSKFEEGEEVRELRCKHEFHKDCLDKWLQQRQATCPLCRRSV  122



>ref|XP_002530038.1| protein binding protein, putative [Ricinus communis]
 gb|EEF32338.1| protein binding protein, putative [Ricinus communis]
Length=139

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 11/80 (14%)
 Frame = +1

Query  298  IMSPENAASEVGVRVFEGESDGA-----------VECAVCLCKIEEGEEVRDLKCKHIFH  444
            + S +NA  E  + + + +S GA           VEC VCLC  EE EEV +L CKH FH
Sbjct  58   VFSQDNARRERRISITQFKSMGAAIGTSRSSSSTVECCVCLCGFEEDEEVSELSCKHFFH  117

Query  445  RACLDRWVGTGRNSCPLCRT  504
            + CLD+W     ++CPLCR+
Sbjct  118  KGCLDKWFDNKHSTCPLCRS  137



>ref|XP_004502459.1| PREDICTED: RING-H2 finger protein ATL58-like [Cicer arietinum]
Length=174

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  343  FEGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            +  +    VEC+VCL + EEGE+VR LKCKH FH+ CLD+W+     +CPLCR  V P
Sbjct  72   YNKKLKSHVECSVCLSEFEEGEKVRSLKCKHTFHKDCLDKWLQDYLATCPLCRNKVLP  129



>ref|XP_008245902.1| PREDICTED: probable E3 ubiquitin-protein ligase RHA2B [Prunus 
mume]
Length=163

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  364  AVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHV  510
            A EC+VCL + EEG+++R LKCKH FH+ CLDRW+     +CPLCRT V
Sbjct  74   ATECSVCLSEFEEGDKIRQLKCKHTFHQNCLDRWLQQYWATCPLCRTKV  122



>ref|NP_001052301.1| Os04g0243700 [Oryza sativa Japonica Group]
 emb|CAE01653.1| OSJNBb0043H09.3 [Oryza sativa Japonica Group]
 dbj|BAF14215.1| Os04g0243700 [Oryza sativa Japonica Group]
 gb|EAY93263.1| hypothetical protein OsI_15070 [Oryza sativa Indica Group]
 gb|EAZ29965.1| hypothetical protein OsJ_14022 [Oryza sativa Japonica Group]
 dbj|BAG86902.1| unnamed protein product [Oryza sativa Japonica Group]
Length=115

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 49/82 (60%), Gaps = 7/82 (9%)
 Frame = +1

Query  346  EGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHV-----  510
            +G S G  EC+VCL +I  GE  R L C+H FHR C+DRW+ + R +CPLCR +V     
Sbjct  26   DGGSGGLTECSVCLSRIRVGEATRRLPCRHAFHRDCVDRWLLSCRRTCPLCRVYVVVDGN  85

Query  511  KP--AARLFGEDLHQEVIVFDF  570
            KP  AA+  GE    E +V  F
Sbjct  86   KPGVAAKHTGEPPLAEDMVIWF  107



>ref|XP_002511894.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF50563.1| zinc finger protein, putative [Ricinus communis]
Length=171

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +1

Query  349  GESDGAVECAVCLCKIEEGEEVRDLK-CKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            G+++    CAVCL + E   E+R LK CKHIFHRACLDRW+   RN+CPLCRT   P
Sbjct  82   GDAELPESCAVCLYEFEREAEIRWLKNCKHIFHRACLDRWMDHDRNTCPLCRTSFVP  138



>ref|XP_002304513.2| hypothetical protein POPTR_0003s13080g [Populus trichocarpa]
 gb|EEE79492.2| hypothetical protein POPTR_0003s13080g [Populus trichocarpa]
Length=183

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = +1

Query  334  VRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHV  510
            V+  E     A  CAVCL + EE +E+R L  C+HIFH+ CLDRW+G  + +CPLCRTHV
Sbjct  81   VKFSELVDPSADSCAVCLYEFEESDEIRRLANCRHIFHKCCLDRWMGYDQITCPLCRTHV  140

Query  511  KP--AARLFGEDLHQEVIVFDF  570
             P      F E L     + DF
Sbjct  141  IPDDMQESFNERLWAASAITDF  162



>ref|XP_010682265.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Beta 
vulgaris subsp. vulgaris]
Length=160

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  343  FEGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRT  504
            F  E   ++EC VCLCK E+ EEV +L CKH FHR CLD+W     ++CPLCR+
Sbjct  105  FTLEGRTSIECCVCLCKFEDEEEVSELSCKHFFHRNCLDKWFDNHHSTCPLCRS  158



>ref|XP_009385846.1| PREDICTED: E3 ubiquitin-protein ligase ATL4-like [Musa acuminata 
subsp. malaccensis]
Length=147

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 48/74 (65%), Gaps = 5/74 (7%)
 Frame = +1

Query  352  ESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARL  528
            E D AV CAVCL  +EEG+EVR+L  C H FHR C+D+WV  GR +CPLCRT + P  R 
Sbjct  77   EGDEAV-CAVCLGTLEEGDEVRELGNCCHAFHRLCIDKWVDMGRVTCPLCRTQLLPRGR-  134

Query  529  FGEDLHQEVIVFDF  570
               +  Q V+  +F
Sbjct  135  --AEKQQLVMAVEF  146



>gb|AFG51138.1| hypothetical protein CL4264Contig1_01, partial [Pinus taeda]
Length=66

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  349  GESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRT  504
            G  +  VECAVCLCK EEG E+R L C H+FHR+CLD+W+   + +CP+CR+
Sbjct  7    GSDNTHVECAVCLCKFEEGVEIRQLPCCHLFHRSCLDKWLDHQQITCPMCRS  58



>ref|XP_010068770.1| PREDICTED: uncharacterized protein LOC104455727 [Eucalyptus grandis]
Length=256

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 67/126 (53%), Gaps = 19/126 (15%)
 Frame = +1

Query  172  MFPQSRVLNCVVSVAAQLKWAWDCLLLQSLC------QDPYKFNVVTGIMSPENAASEVG  333
            +  ++ V+  + ++   LKWA D  L  S+        +P  F ++  +     + ++ G
Sbjct  33   LLLKATVVARLSTLVGPLKWALDYSLGSSVLWHSHGHGEPGAFGIIHRL-----STAQYG  87

Query  334  VRVFEGESDGAVECAVCLCKIEEGEEVRDLKC-KHIFHRACLDRWVGTGRNSCPLCRTHV  510
             R          ECAVCLC++  GEEVR+LKC  H+FHRACLD+W+G    +CPLCR  V
Sbjct  88   DR-------SPTECAVCLCQVGAGEEVRELKCCDHVFHRACLDQWLGYKNVTCPLCRRLV  140

Query  511  KPAARL  528
               A +
Sbjct  141  AHRASM  146



>gb|KDP25403.1| hypothetical protein JCGZ_20559 [Jatropha curcas]
Length=164

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = +1

Query  358  DGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            D    CAVCL + E+ +E+R L  C+HIFHR+CLDRWVG  + +CPLCRT V P
Sbjct  81   DPPDSCAVCLYEFEDQDEIRQLTNCRHIFHRSCLDRWVGYDQKTCPLCRTPVIP  134



>emb|CDM27538.1| Zinc finger, RING-CH-type [Penicillium roqueforti FM164]
Length=830

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 44/70 (63%), Gaps = 6/70 (9%)
 Frame = +1

Query  295  GIMSPENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVG  471
            G +  E       +++ +GE      C +CL   E  EEVR+L KCKH+FH+ C+D+W+ 
Sbjct  732  GSLVAEAVEGAASIQIQDGE-----RCLICLSDYEVAEEVRELNKCKHVFHKDCIDQWLT  786

Query  472  TGRNSCPLCR  501
            TGRNSCPLCR
Sbjct  787  TGRNSCPLCR  796



>ref|XP_007206044.1| hypothetical protein PRUPE_ppa012579mg [Prunus persica]
 gb|EMJ07243.1| hypothetical protein PRUPE_ppa012579mg [Prunus persica]
Length=163

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +1

Query  364  AVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHV  510
            A EC+VCL   EEG+++R LKCKH FH+ CLDRW+     +CPLCRT V
Sbjct  74   ATECSVCLSDFEEGDKIRQLKCKHTFHQNCLDRWLQQYWATCPLCRTKV  122



>gb|AFG51127.1| hypothetical protein CL4264Contig1_01, partial [Pinus taeda]
 gb|AFG51133.1| hypothetical protein CL4264Contig1_01, partial [Pinus taeda]
 gb|AFG51135.1| hypothetical protein CL4264Contig1_01, partial [Pinus taeda]
Length=66

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  349  GESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRT  504
            G  +  VECAVCLCK EEG E+R L C H+FHR CLD+W+   + +CPLCR+
Sbjct  7    GSDNTHVECAVCLCKFEEGVEIRQLPCCHLFHRPCLDKWLDHQQITCPLCRS  58



>emb|CDP01174.1| unnamed protein product [Coffea canephora]
Length=168

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  364  AVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            A+EC++CLC+IEEG+E R+L C H+FH+ CL++W+     +CPLCR+ V P
Sbjct  74   AMECSICLCEIEEGDEARELHCNHVFHKNCLEKWLQRCHATCPLCRSLVVP  124



>ref|XP_002849653.1| RING finger protein [Arthroderma otae CBS 113480]
 gb|EEQ29768.1| RING finger protein [Arthroderma otae CBS 113480]
Length=826

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            C +CLC  E  +EVR L KCKH++HR C+D W+ TGRNSCPLCR
Sbjct  765  CLICLCDYEAADEVRILNKCKHVYHRECIDEWLTTGRNSCPLCR  808



>gb|AFK46654.1| unknown [Lotus japonicus]
Length=167

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = +1

Query  358  DGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            D    C VCL + EE +E+R L  C+HIFHRACLDRWVG  +++CPLCRT + P
Sbjct  81   DPPESCVVCLSEFEESDEIRRLANCRHIFHRACLDRWVGYDQSTCPLCRTPLIP  134



>ref|XP_010652845.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Vitis 
vinifera]
Length=159

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  367  VECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLH  546
            +ECAVCL + E+GEE+R L+CKHIFH+ CLD W+     +CPLCR  V P   +    L 
Sbjct  72   LECAVCLSRFEDGEEIRKLQCKHIFHKGCLDMWLQQDCPTCPLCRRRVLPEEIVTKYHLQ  131

Query  547  QEV  555
             +V
Sbjct  132  NQV  134



>gb|AFG58067.1| hypothetical protein 0_13343_01, partial [Pinus taeda]
Length=102

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +1

Query  325  EVGVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            E GV + EG  DG V CAVCL  +E+ EE+R L  C+HIFHR CLD+W+   + +CPLCR
Sbjct  10   EFGV-LAEGAEDGDVMCAVCLNNMEKFEEIRRLTNCRHIFHRGCLDKWLDHDQRTCPLCR  68

Query  502  THVKP  516
            + + P
Sbjct  69   SPLLP  73



>ref|XP_002509838.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF51225.1| zinc finger protein, putative [Ricinus communis]
Length=164

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +1

Query  343  FEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            F    D    CAVCL + E+ +E+R L  C+HIFH+ACLDRWVG  + +CPLCRT V P
Sbjct  76   FSDLVDPPDSCAVCLYEFEDHDEIRRLTNCRHIFHKACLDRWVGYDQKTCPLCRTPVIP  134



>ref|XP_009419702.1| PREDICTED: putative RING-H2 finger protein ATL50 [Musa acuminata 
subsp. malaccensis]
Length=167

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  367  VECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            V+C  CLC IEE +EVR+L+C+H+FHR CLDRW+   R  CPLCR  + P
Sbjct  86   VDCVFCLCGIEEDDEVRELRCQHLFHRRCLDRWLAHRRAVCPLCRDALVP  135



>ref|XP_009356506.1| PREDICTED: NEP1-interacting protein-like 1 isoform X2 [Pyrus 
x bretschneideri]
Length=147

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 78/142 (55%), Gaps = 18/142 (13%)
 Frame = +1

Query  217  AQLKWAWDCLLLQSLCQD-PYKFNVVTGIMSPENAASEVGVRVFEGESD--GAVECAVCL  387
                W ++ LL  S  +   + F+  T I     + + V  +   G +      ECAVCL
Sbjct  13   THFSWLFNFLLYHSFSKHYDHYFDEATDI-----SLTTVQYKPNPGANSETSTAECAVCL  67

Query  388  CKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP--AARLFGE-DLHQEVI  558
            CKIEEGEE+++L+C H+FH+ CLD+W G    +CP+CR+ + P  + +L  + D   EV+
Sbjct  68   CKIEEGEEIKELRCAHLFHKPCLDKWTGFKHATCPICRSRLAPPRSKQLHKQFDEQVEVL  127

Query  559  VFDFC-----SRRRDRCSWWLR  609
            +F FC     S R DR  WWLR
Sbjct  128  LFKFCSFSSDSDRGDR--WWLR  147



>gb|ABK24048.1| unknown [Picea sitchensis]
Length=189

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  343  FEGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRT  504
            F G  +  VECAVCL K EEG E+R L C H+FHR CLD+W+   + +CPLCR+
Sbjct  95   FVGSDNSHVECAVCLSKFEEGVEIRQLTCCHLFHRPCLDKWLDHQQITCPLCRS  148



>ref|XP_002543170.1| predicted protein [Uncinocarpus reesii 1704]
 gb|EEP77837.1| predicted protein [Uncinocarpus reesii 1704]
Length=539

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 45/77 (58%), Gaps = 6/77 (8%)
 Frame = +1

Query  274  YKFNVVTGIMSPENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRA  450
            Y+     G +  EN      +RV E E      C +CLC  E  EEVR L KC+HI+HR 
Sbjct  447  YRLIQYPGSLIAENMEDGTSIRVNENE-----RCLICLCDYEAEEEVRLLAKCRHIYHRE  501

Query  451  CLDRWVGTGRNSCPLCR  501
            C+D W+ TGRNSCPLCR
Sbjct  502  CIDEWLTTGRNSCPLCR  518



>ref|XP_003517474.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B-like [Glycine max]
Length=141

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 50/85 (59%), Gaps = 10/85 (12%)
 Frame = +1

Query  292  TGIMSPENAASEVGVR-----VFEGESDGAVE----CAVCLCKIEEGEEVRDL-KCKHIF  441
            + I  PE A S V +R     V   E + AVE    CAVCL + E  +E+R L  C+HIF
Sbjct  45   SDIAGPERAVSAVLMREILPVVKFSEMEMAVEAAESCAVCLYEFEGEDEIRRLTNCRHIF  104

Query  442  HRACLDRWVGTGRNSCPLCRTHVKP  516
            HR CLDRW+G  + +CPLCRT   P
Sbjct  105  HRGCLDRWMGYDQRTCPLCRTPFIP  129



>gb|AFK38846.1| unknown [Medicago truncatula]
Length=149

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 3/71 (4%)
 Frame = +1

Query  346  EGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAA  522
            EG+S   V CAVCL +    EE+R +  C+H+FHR C+DRW+   + +CPLCRTH  P  
Sbjct  81   EGDSSPPVGCAVCLNEFAGEEEIRCMANCRHMFHRTCVDRWIDHDQKTCPLCRTHFVPYH  140

Query  523  RLFGEDLHQEV  555
            ++  ED +Q +
Sbjct  141  KM--EDYNQRL  149



>ref|XP_006354695.1| PREDICTED: probable E3 ubiquitin-protein ligase RHA2B-like [Solanum 
tuberosum]
Length=165

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = +1

Query  346  EGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            +G SD    CAVCL   E+GE+VR LKCKHIFH+ CLD W+     +CPLCR  V P
Sbjct  72   DGFSDT---CAVCLSAFEDGEQVRKLKCKHIFHKDCLDTWLQQDSATCPLCRNKVLP  125



>ref|XP_004237431.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Solanum 
lycopersicum]
Length=165

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            CAVCL   E+GE+VR LKCKHIFH+ CLD W+     +CPLCR  V P
Sbjct  78   CAVCLSAFEDGEQVRKLKCKHIFHKDCLDTWLQQDSATCPLCRNKVLP  125



>ref|XP_002566014.1| Pc22g21170 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP99405.1| Pc22g21170 [Penicillium rubens Wisconsin 54-1255]
Length=842

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 7/57 (12%)
 Frame = +1

Query  352  ESDGAVE------CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            E  GA++      C +CL   E  EEVR+L KCKH+FH+ C+D+W+ TGRNSCPLCR
Sbjct  752  EGAGAIQIQDGERCLICLSDYEVAEEVRELGKCKHVFHKDCIDQWLTTGRNSCPLCR  808



>gb|KGO67007.1| Zinc finger, RING-type [Penicillium expansum]
Length=859

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 7/57 (12%)
 Frame = +1

Query  352  ESDGAVE------CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            E  GA++      C +CL   E  EEVR+L KCKH+FH+ C+D+W+ TGRNSCPLCR
Sbjct  769  EGAGAIQIQDGERCLICLSDYEVAEEVRELGKCKHVFHKDCIDQWLTTGRNSCPLCR  825



>gb|KGO41483.1| Zinc finger, RING-type [Penicillium expansum]
 gb|KGO62497.1| Zinc finger, RING-type [Penicillium expansum]
Length=859

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 7/57 (12%)
 Frame = +1

Query  352  ESDGAVE------CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            E  GA++      C +CL   E  EEVR+L KCKH+FH+ C+D+W+ TGRNSCPLCR
Sbjct  769  EGAGAIQIQDGERCLICLSDYEVAEEVRELGKCKHVFHKDCIDQWLTTGRNSCPLCR  825



>gb|KGO77004.1| Zinc finger, RING-type [Penicillium italicum]
Length=860

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 7/57 (12%)
 Frame = +1

Query  352  ESDGAVE------CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            E  GA++      C +CL   E  EEVR+L KCKH+FH+ C+D+W+ TGRNSCPLCR
Sbjct  752  EGAGAIQIQDGERCLICLSDYEVAEEVRELGKCKHVFHKDCIDQWLTTGRNSCPLCR  808



>ref|XP_008347458.1| PREDICTED: LOW QUALITY PROTEIN: probable E3 ubiquitin-protein 
ligase RHA2B, partial [Malus domestica]
Length=141

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  364  AVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHV  510
            A EC+VCL   EEG++VR+LKCKH FH+ CLD+W+     +CPLCRT V
Sbjct  69   ATECSVCLSDFEEGDKVRELKCKHTFHKHCLDKWLQQYWATCPLCRTKV  117



>ref|XP_003559771.1| PREDICTED: E3 ubiquitin-protein ligase Os03g0188200-like [Brachypodium 
distachyon]
Length=188

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  367  VECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAA  522
            VEC VCL  +EEG+E R+L C+H+FHRACLD W+     +CPLCR  +  AA
Sbjct  100  VECVVCLSGVEEGDETRELACRHVFHRACLDAWLARPPATCPLCRARLSSAA  151



>gb|AFK38566.1| unknown [Medicago truncatula]
 gb|KEH21110.1| RING-H2 zinc finger protein [Medicago truncatula]
Length=163

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +1

Query  358  DGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            D    CAVCL + EE +E+R L  C+HIFHR CLDRW+G  + +CPLCRT   P
Sbjct  81   DPPESCAVCLTEFEENDEIRRLANCRHIFHRGCLDRWMGYDQRTCPLCRTPFIP  134



>ref|XP_009349813.1| PREDICTED: probable E3 ubiquitin-protein ligase RHA2B [Pyrus 
x bretschneideri]
Length=154

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  364  AVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHV  510
            A EC+VCL   EEG++VR+LKCKH FH+ CLD+W+     +CPLCRT V
Sbjct  65   ATECSVCLSDFEEGDKVRELKCKHTFHQDCLDKWLQQYWATCPLCRTKV  113



>ref|XP_001399411.2| RING finger protein [Aspergillus niger CBS 513.88]
Length=846

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = +1

Query  331  GVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
             +++ EGE      C +CL   E  EE+R L KCKH+FHR C+D+W+ TGRNSCPLCR
Sbjct  772  AIQLPEGE-----RCLICLSDYEAAEELRQLTKCKHLFHRDCIDQWLTTGRNSCPLCR  824



>ref|XP_011005646.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Populus 
euphratica]
Length=164

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +1

Query  370  ECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            ECAVCL +  EGE VR LKC H FH+ CLD+W+     +CPLCRT V P
Sbjct  77   ECAVCLSEFTEGERVRKLKCDHTFHQECLDKWLQQSMATCPLCRTTVLP  125



>emb|CAK47555.1| unnamed protein product [Aspergillus niger]
Length=864

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = +1

Query  331  GVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
             +++ EGE      C +CL   E  EE+R L KCKH+FHR C+D+W+ TGRNSCPLCR
Sbjct  790  AIQLPEGE-----RCLICLSDYEAAEELRQLTKCKHLFHRDCIDQWLTTGRNSCPLCR  842



>ref|XP_001208857.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gb|EAU38249.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
Length=838

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/77 (43%), Positives = 46/77 (60%), Gaps = 6/77 (8%)
 Frame = +1

Query  274  YKFNVVTGIMSPENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRA  450
            Y+     G +  E+A     + + +G+      C +CL   E  EE+R L KCKH+FHR 
Sbjct  742  YRLVEYAGSLVAESADGAGTIPIPDGD-----RCLICLSDYEAAEELRQLTKCKHVFHRD  796

Query  451  CLDRWVGTGRNSCPLCR  501
            C+D+W+ TGRNSCPLCR
Sbjct  797  CIDQWLTTGRNSCPLCR  813



>gb|EKV09699.1| RING finger protein [Penicillium digitatum Pd1]
 gb|EKV14977.1| RING finger protein [Penicillium digitatum PHI26]
Length=773

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            C +CL   E  EEVR+L KCKH+FH+ C+D+W+ TGRNSCPLCR
Sbjct  700  CLICLSDYEVAEEVRELGKCKHVFHKDCIDQWLTTGRNSCPLCR  743



>ref|XP_001260560.1| RING finger protein [Neosartorya fischeri NRRL 181]
 gb|EAW18663.1| RING finger protein [Neosartorya fischeri NRRL 181]
Length=842

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            C +CL   E  EE+R L KCKH+FHR C+D+W+ TGRNSCPLCR
Sbjct  777  CLICLSDYEAAEELRQLTKCKHVFHRDCIDQWLTTGRNSCPLCR  820



>ref|XP_006428110.1| hypothetical protein CICLE_v100269541mg, partial [Citrus clementina]
 gb|ESR41350.1| hypothetical protein CICLE_v100269541mg, partial [Citrus clementina]
Length=131

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +1

Query  370  ECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            +CAVCL   E+GE VR L CKH FHR CLD+W+     +CPLCRT V P
Sbjct  79   DCAVCLSDFEDGEMVRKLNCKHTFHRDCLDKWLQEYLATCPLCRTKVLP  127



>ref|XP_003624004.1| RING-H2 finger protein ATL5F [Medicago truncatula]
Length=279

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 3/71 (4%)
 Frame = +1

Query  346  EGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAA  522
            EG+S   V CAVCL +    EE+R +  C+H+FHR C+DRW+   + +CPLCRTH  P  
Sbjct  81   EGDSSPPVGCAVCLNEFAGEEEIRCMANCRHMFHRTCVDRWIDHDQKTCPLCRTHFVPYH  140

Query  523  RLFGEDLHQEV  555
            ++  ED +Q +
Sbjct  141  KM--EDYNQRL  149



>gb|KDP35198.1| hypothetical protein JCGZ_09357 [Jatropha curcas]
Length=162

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  367  VECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            VECAVCL +   GE VR LKCKH FHR CLD+W+     +CPLCRT V P
Sbjct  73   VECAVCLSEFLVGESVRKLKCKHTFHRDCLDKWLQQYLATCPLCRTKVLP  122



>ref|XP_004302206.1| PREDICTED: E3 ubiquitin-protein ligase RHA2A-like [Fragaria vesca 
subsp. vesca]
Length=163

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  370  ECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            EC+VCL + EEGE++R LKCKH FH+ C+D+W+     +CPLCRT V P
Sbjct  76   ECSVCLSEFEEGEKIRQLKCKHRFHKDCVDKWLQQYWATCPLCRTKVVP  124



>gb|EQL36403.1| hypothetical protein BDFG_02136 [Blastomyces dermatitidis ATCC 
26199]
Length=814

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 6/70 (9%)
 Frame = +1

Query  295  GIMSPENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVG  471
            G +  E+A +   + + E E      C +CL   E  EEVR L KC+HI+HR C+D W+ 
Sbjct  728  GSLIAESADTTPKIPIAESE-----RCLICLSDYEAAEEVRQLTKCQHIYHRECIDEWLT  782

Query  472  TGRNSCPLCR  501
            TGRNSCPLCR
Sbjct  783  TGRNSCPLCR  792



>gb|ABD28706.1| Zinc finger, RING-type [Medicago truncatula]
 gb|AES80222.2| anaphase-promoting complex subunit 11 RING-H2 finger protein 
[Medicago truncatula]
Length=180

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 3/71 (4%)
 Frame = +1

Query  346  EGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAA  522
            EG+S   V CAVCL +    EE+R +  C+H+FHR C+DRW+   + +CPLCRTH  P  
Sbjct  81   EGDSSPPVGCAVCLNEFAGEEEIRCMANCRHMFHRTCVDRWIDHDQKTCPLCRTHFVPYH  140

Query  523  RLFGEDLHQEV  555
            ++  ED +Q +
Sbjct  141  KM--EDYNQRL  149



>gb|EGE78527.1| RING finger protein [Blastomyces dermatitidis ATCC 18188]
Length=868

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 6/70 (9%)
 Frame = +1

Query  295  GIMSPENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVG  471
            G +  E+A +   + + E E      C +CL   E  EEVR L KC+HI+HR C+D W+ 
Sbjct  782  GSLIAESADTTPKIPIAESE-----RCLICLSDYEAAEEVRQLTKCQHIYHRECIDEWLT  836

Query  472  TGRNSCPLCR  501
            TGRNSCPLCR
Sbjct  837  TGRNSCPLCR  846



>gb|EEQ92195.1| RING finger protein [Blastomyces dermatitidis ER-3]
Length=868

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 6/70 (9%)
 Frame = +1

Query  295  GIMSPENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVG  471
            G +  E+A +   + + E E      C +CL   E  EEVR L KC+HI+HR C+D W+ 
Sbjct  782  GSLIAESADTTPKIPIAESE-----RCLICLSDYEAAEEVRQLTKCQHIYHRECIDEWLT  836

Query  472  TGRNSCPLCR  501
            TGRNSCPLCR
Sbjct  837  TGRNSCPLCR  846



>ref|XP_002622617.1| RING finger protein [Blastomyces dermatitidis SLH14081]
 gb|EEQ72135.1| RING finger protein [Blastomyces dermatitidis SLH14081]
Length=868

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 6/70 (9%)
 Frame = +1

Query  295  GIMSPENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVG  471
            G +  E+A +   + + E E      C +CL   E  EEVR L KC+HI+HR C+D W+ 
Sbjct  782  GSLIAESADTTPKIPIAESE-----RCLICLSDYEAAEEVRQLTKCQHIYHRECIDEWLT  836

Query  472  TGRNSCPLCR  501
            TGRNSCPLCR
Sbjct  837  TGRNSCPLCR  846



>gb|KEY82908.1| RING finger [Aspergillus fumigatus var. RP-2014]
Length=842

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/77 (43%), Positives = 46/77 (60%), Gaps = 6/77 (8%)
 Frame = +1

Query  274  YKFNVVTGIMSPENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRA  450
            Y+   + G +  E       +++ +GE      C +CL   E  EE+R L KCKH+FHR 
Sbjct  749  YRLVELAGSLVAEALDGAGTIQIPDGE-----RCLICLGDYEAAEELRQLTKCKHVFHRD  803

Query  451  CLDRWVGTGRNSCPLCR  501
            C+D+W+ TGRNSCPLCR
Sbjct  804  CIDQWLTTGRNSCPLCR  820



>ref|XP_001481667.1| RING finger protein [Aspergillus fumigatus Af293]
 gb|EBA27491.1| RING finger protein [Aspergillus fumigatus Af293]
 gb|EDP54606.1| hypothetical protein AFUB_026650 [Aspergillus fumigatus A1163]
Length=842

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/77 (43%), Positives = 46/77 (60%), Gaps = 6/77 (8%)
 Frame = +1

Query  274  YKFNVVTGIMSPENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRA  450
            Y+   + G +  E       +++ +GE      C +CL   E  EE+R L KCKH+FHR 
Sbjct  749  YRLVELAGSLVAEALDGAGTIQIPDGE-----RCLICLGDYEAAEELRQLTKCKHVFHRD  803

Query  451  CLDRWVGTGRNSCPLCR  501
            C+D+W+ TGRNSCPLCR
Sbjct  804  CIDQWLTTGRNSCPLCR  820



>gb|EPS28917.1| hypothetical protein PDE_03863 [Penicillium oxalicum 114-2]
Length=844

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 36/84 (43%), Positives = 48/84 (57%), Gaps = 13/84 (15%)
 Frame = +1

Query  292  TGIMSPENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWV  468
            +G +  E+      + + EGE      C +CL   E  EEVR L KCKH+FH+ C+D+W+
Sbjct  750  SGSLVAESDDGAGTIHIQEGE-----RCLICLSDYEVAEEVRKLAKCKHMFHKDCIDQWL  804

Query  469  GTGRNSCPLCR-------THVKPA  519
             TGRNSCPLCR       TH  P+
Sbjct  805  TTGRNSCPLCRGQGVKETTHEDPS  828



>ref|NP_001042675.1| Os01g0266100 [Oryza sativa Japonica Group]
 dbj|BAA90357.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04589.1| Os01g0266100 [Oryza sativa Japonica Group]
 gb|EAY73420.1| hypothetical protein OsI_01302 [Oryza sativa Indica Group]
 dbj|BAG88608.1| unnamed protein product [Oryza sativa Japonica Group]
Length=204

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  EGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCR  501
             G     V+C  CL ++++GEEVR+L+C+H+FHRACLD W+   R +CPLCR
Sbjct  94   RGRDAAPVDCVFCLSRVDDGEEVRELRCRHVFHRACLDAWLVLPRATCPLCR  145



>ref|XP_002320813.2| brassinosteroid-responsive ring-H2 family protein [Populus trichocarpa]
 gb|EEE99128.2| brassinosteroid-responsive ring-H2 family protein [Populus trichocarpa]
Length=165

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDLK-CKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            CAVCL + E  +E+R LK CKHIFHRACLDRW+   RN+CPLCRT   P
Sbjct  93   CAVCLYEFEGEDEIRWLKNCKHIFHRACLDRWMDHNRNTCPLCRTSFVP  141



>gb|KDO44151.1| hypothetical protein CISIN_1g047964mg [Citrus sinensis]
Length=168

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +1

Query  370  ECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            +CAVCL   E+GE VR L CKH FHR CLD+W+     +CPLCRT V P
Sbjct  79   DCAVCLSDFEDGEMVRKLNCKHTFHRDCLDKWLQEYLATCPLCRTKVLP  127



>ref|XP_010531543.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Tarenaya 
hassleriana]
Length=148

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = +1

Query  349  GESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRT  504
            GE  G  EC VCLC  +E EE+ +L  C+H FHRACLDRW+G+   +CPLCR+
Sbjct  94   GEGTGVAECCVCLCGYKEEEEISELDSCRHFFHRACLDRWLGSRHTTCPLCRS  146



>ref|XP_011090632.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Sesamum indicum]
Length=157

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = +1

Query  337  RVFEGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            R   G+    +EC VCL   EEG+EVR LKCKH FH+ C+D W+     +CPLCR  V P
Sbjct  59   RYKTGQGIDPLECRVCLSLYEEGDEVRKLKCKHTFHKGCVDMWLQQDLATCPLCRRAVLP  118

Query  517  AARLFGEDLHQ  549
               +    LH+
Sbjct  119  EEVVVKHRLHR  129



>gb|EAZ11351.1| hypothetical protein OsJ_01218 [Oryza sativa Japonica Group]
Length=274

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  EGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCR  501
             G     V+C  CL ++++GEEVR+L+C+H+FHRACLD W+   R +CPLCR
Sbjct  164  RGRDAAPVDCVFCLSRVDDGEEVRELRCRHVFHRACLDAWLVLPRATCPLCR  215



>ref|XP_001275379.1| RING finger protein [Aspergillus clavatus NRRL 1]
 gb|EAW13953.1| RING finger protein [Aspergillus clavatus NRRL 1]
Length=846

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            C +CL   E  EEVR L KCKH++HR C+D+W+ TGRNSCPLCR
Sbjct  780  CLICLSDYEVAEEVRQLTKCKHVYHRDCIDQWLTTGRNSCPLCR  823



>ref|XP_009391629.1| PREDICTED: putative RING-H2 finger protein ATL49 [Musa acuminata 
subsp. malaccensis]
Length=175

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +1

Query  370  ECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLH  546
            +C VCLCK E G+EVR L  C+H++HR CLD+WV   R +CPLCRT + P  +    D H
Sbjct  110  DCTVCLCKFEHGDEVRLLTNCRHVYHRQCLDKWVELRRRTCPLCRTPLIPVEKRDVVDYH  169

Query  547  Q  549
             
Sbjct  170  D  170



>ref|XP_003581640.1| PREDICTED: E3 ubiquitin-protein ligase ATL23-like [Brachypodium 
distachyon]
Length=112

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 47/79 (59%), Gaps = 8/79 (10%)
 Frame = +1

Query  352  ESDGA-VECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHV------  510
            + DGA  EC VCL +I  GE  R L C+H FHR C+DRW+   + +CPLCR +V      
Sbjct  25   DVDGAPTECCVCLSRIRAGEATRRLPCRHAFHRDCVDRWLALCKRTCPLCRVYVVDANSR  84

Query  511  -KPAARLFGEDLHQEVIVF  564
               AA+  GE L  +++++
Sbjct  85   QAAAAKHSGEPLADDLVIW  103



>ref|XP_004306753.1| PREDICTED: RING-H2 zinc finger protein RHA1a-like [Fragaria vesca 
subsp. vesca]
Length=169

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 66/141 (47%), Gaps = 17/141 (12%)
 Frame = +1

Query  103  YPHAFI--IVFIALICTFIFKKLLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPY  276
            +P+ F+  +  +  I + IF  L      S  L+   SV     W      L S CQ P 
Sbjct  11   FPNLFLHTLSLLGFIRSLIFS-LFHFLGLSDFLDTDASV-----WPETRTHLLSGCQTPA  64

Query  277  KFNVVTGIMSPENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRAC  453
               ++   +          +R  E E D    CAVCL + E  EE+R L  CKHIFHRAC
Sbjct  65   SVLLMREFLPV--------IRFEEIEGDTPESCAVCLYEFEGSEEIRCLPNCKHIFHRAC  116

Query  454  LDRWVGTGRNSCPLCRTHVKP  516
            +DRW+   + +CPLCRT   P
Sbjct  117  VDRWMDHDQKTCPLCRTAFVP  137



>ref|XP_003551995.1| PREDICTED: E3 ubiquitin-protein ligase RNF181-like [Glycine max]
 gb|KHN43984.1| E3 ubiquitin-protein ligase RNF181 [Glycine soja]
Length=134

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  349  GESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRT  504
            G S   VEC VCLC+ E  +EV +L CKH FHR CLD+W      +CPLCR+
Sbjct  81   GTSMAMVECCVCLCRFEANQEVSELPCKHYFHRGCLDKWFDNKHTTCPLCRS  132



>emb|CDP08780.1| unnamed protein product [Coffea canephora]
Length=183

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDLK-CKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            CAVCL + E GEE+R LK CKHIFHR+CLDRW+   + +CPLCRT   P
Sbjct  94   CAVCLSEFEGGEEIRWLKNCKHIFHRSCLDRWMDHDQKTCPLCRTPFVP  142



>ref|XP_002838644.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ82835.1| unnamed protein product [Tuber melanosporum]
Length=770

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 6/59 (10%)
 Frame = +1

Query  328  VGVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            +G  + EG+      C +CL   E+GE+ R L KC+H+FH+ C+D W+ TGRNSCPLCR
Sbjct  684  LGAEIAEGD-----RCLICLGDYEDGEQCRQLTKCQHVFHKDCIDEWLTTGRNSCPLCR  737



>ref|XP_004134321.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B-like [Cucumis sativus]
Length=159

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDLK-CKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARL  528
            CAVCLC+ ++ +EVR LK CKHIFH+ CLDRW+   + SCPLCRT + P   +
Sbjct  90   CAVCLCEFQDDDEVRFLKNCKHIFHKECLDRWMIRDQRSCPLCRTLIVPEESI  142



>ref|XP_002310001.2| hypothetical protein POPTR_0007s06140g [Populus trichocarpa]
 gb|EEE90451.2| hypothetical protein POPTR_0007s06140g [Populus trichocarpa]
Length=164

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +1

Query  370  ECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            ECAVCL +  EGE +R LKCKH FH+ CLD+W+     +CPLCRT V P
Sbjct  77   ECAVCLSEFLEGESLRKLKCKHTFHKDCLDKWLEEYLATCPLCRTRVLP  125



>gb|KGN56500.1| Zinc finger protein [Cucumis sativus]
Length=186

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDLK-CKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            CAVCLC+ ++ +EVR LK CKHIFH+ CLDRW+   + SCPLCRT + P
Sbjct  117  CAVCLCEFQDDDEVRFLKNCKHIFHKECLDRWMIRDQRSCPLCRTLIVP  165



>ref|XP_003525383.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B-like [Glycine max]
 gb|KHM99954.1| E3 ubiquitin-protein ligase RHA1B [Glycine soja]
Length=156

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +1

Query  358  DGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            D    CAVCL + EE +E+R L  C+HIFHR CLDRW+G  + +CPLCRT   P
Sbjct  82   DPPETCAVCLSEFEENDEIRRLANCRHIFHRGCLDRWMGYDQRTCPLCRTAFIP  135



>ref|XP_011005648.1| PREDICTED: receptor homology region, transmembrane domain- and 
RING domain-containing protein 1-like [Populus euphratica]
Length=164

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +1

Query  370  ECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            ECAVCL +  EGE +R LKCKH FH+ CLD+W+     +CPLCRT V P
Sbjct  77   ECAVCLSEFLEGESLRKLKCKHTFHKDCLDKWLEEYLATCPLCRTRVLP  125



>gb|EFW17913.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira]
Length=849

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 6/65 (9%)
 Frame = +1

Query  310  ENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNS  486
            ENA  E G R+   E+D    C +CL      EEVR L KC+HI+HR C+D W+ TGRNS
Sbjct  769  ENA--EDGERIHISEND---RCLICLSNYAAEEEVRLLAKCRHIYHRECIDEWLTTGRNS  823

Query  487  CPLCR  501
            CPLCR
Sbjct  824  CPLCR  828



>ref|XP_003070564.1| C3HC4 type (RING finger) zinc finger containing protein [Coccidioides 
posadasii C735 delta SOWgp]
 gb|EER28419.1| C3HC4 type (RING finger) zinc finger containing protein [Coccidioides 
posadasii C735 delta SOWgp]
Length=849

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 6/65 (9%)
 Frame = +1

Query  310  ENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNS  486
            ENA  E G R+   E+D    C +CL      EEVR L KC+HI+HR C+D W+ TGRNS
Sbjct  769  ENA--EDGERIHISEND---RCLICLSNYAAEEEVRLLAKCRHIYHRECIDEWLTTGRNS  823

Query  487  CPLCR  501
            CPLCR
Sbjct  824  CPLCR  828



>dbj|BAJ95364.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=207

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +1

Query  361  GAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARL  528
            G  +CAVCLC I  G+EVR L  C+H+FHR C+DRW+G  + +CPLCR  + P   L
Sbjct  110  GDGDCAVCLCGIGGGDEVRRLSNCRHVFHRGCIDRWMGHRQRTCPLCRAPLMPGDAL  166



>ref|XP_006852368.1| hypothetical protein AMTR_s00049p00223430 [Amborella trichopoda]
 gb|ERN13835.1| hypothetical protein AMTR_s00049p00223430 [Amborella trichopoda]
Length=146

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 3/70 (4%)
 Frame = +1

Query  310  ENAASEVGVRVFE---GESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGR  480
            E     V V +F+     S   VEC VCL K EE EE+  L+C H+FHR CLD+W+    
Sbjct  69   EEVRESVSVTLFKCLPMNSGCPVECTVCLYKFEEEEEISKLRCNHVFHRDCLDKWLDHWH  128

Query  481  NSCPLCRTHV  510
            ++CPLCRT V
Sbjct  129  STCPLCRTSV  138



>ref|XP_004503686.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B-like [Cicer arietinum]
Length=161

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +1

Query  358  DGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            D    CAVCL + EE +E+R L  C+HIFHR CLDRW+G  + +CPLCRT   P
Sbjct  81   DPPESCAVCLTEFEENDEIRRLANCRHIFHRCCLDRWMGYDQRTCPLCRTPFIP  134



>ref|XP_008438014.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B-like [Cucumis melo]
Length=186

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDLK-CKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARL  528
            CAVCLC+  + EEVR LK CKHIFH+ CLDRW+   + SCPLCRT + P   +
Sbjct  117  CAVCLCEFHDDEEVRFLKNCKHIFHKECLDRWMIRDQRSCPLCRTLIVPEESI  169



>gb|EYE97541.1| hypothetical protein EURHEDRAFT_298165 [Aspergillus ruber CBS 
135680]
Length=844

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            C +CL   E  EE+R L KC+H+FHR C+D+W+ TGRNSCPLCR
Sbjct  779  CLICLSDYEAAEELRQLTKCQHVFHRDCIDQWLTTGRNSCPLCR  822



>ref|XP_003565628.1| PREDICTED: E3 ubiquitin-protein ligase EL5-like [Brachypodium 
distachyon]
Length=217

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +1

Query  367  VECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGT-GRNSCPLCRTHVKPA  519
            V+C  CL +IEEG+EVR+L+C+H+FHRACLD W+    R +CPLCR  + PA
Sbjct  111  VDCVFCLSRIEEGDEVRELRCRHVFHRACLDAWLLIRPRATCPLCRDRLLPA  162



>ref|XP_002278353.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B [Vitis vinifera]
Length=167

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  355  SDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
             D    CAVCL   E GEE+R L  CKHIFHR+CLDRW+   + +CPLCRT   P
Sbjct  83   GDAPESCAVCLYDFEVGEEIRRLTNCKHIFHRSCLDRWMDHDQKTCPLCRTPFVP  137



>ref|XP_011042399.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Populus 
euphratica]
Length=134

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +1

Query  355  SDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHV  510
            ++ A+EC VCLC  E  EEV +L CKH FHR CLD+W      +CPLCR+++
Sbjct  83   TNSAMECCVCLCGFEAEEEVSELSCKHFFHRGCLDKWFDNIHTTCPLCRSNL  134



>tpe|CBF70565.1| TPA: RING finger protein (AFU_orthologue; AFUA_2G10860) [Aspergillus 
nidulans FGSC A4]
Length=831

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 41/57 (72%), Gaps = 6/57 (11%)
 Frame = +1

Query  334  VRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            +++ EGE      C +CL + E  EE+R L KC+H++HR C+D+W+ TGRNSCPLCR
Sbjct  756  IQISEGE-----RCLICLSEYEVAEELRQLTKCEHLYHRDCIDQWLTTGRNSCPLCR  807



>gb|KDP35200.1| hypothetical protein JCGZ_09359 [Jatropha curcas]
Length=167

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 39/55 (71%), Gaps = 3/55 (5%)
 Frame = +1

Query  352  ESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            ES G   CAVCL +  E E VR+LKCKH+FH+ C+D+W    R++CPLCRT V P
Sbjct  74   ESPG---CAVCLSEFVEDESVRNLKCKHLFHKDCVDQWFQQCRSTCPLCRTMVLP  125



>gb|ACJ86080.1| unknown [Medicago truncatula]
Length=163

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +1

Query  358  DGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            D    CAVCL + EE +E+R L  C++IFHR CLDRW+G  + +CPLCRT   P
Sbjct  81   DPPESCAVCLTEFEENDEIRRLANCRYIFHRGCLDRWMGYDQRTCPLCRTPFIP  134



>ref|XP_002480992.1| RING finger protein [Talaromyces stipitatus ATCC 10500]
 gb|EED20558.1| RING finger protein [Talaromyces stipitatus ATCC 10500]
Length=824

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 4/52 (8%)
 Frame = +1

Query  349  GESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            GES+    C +CL   E  +EVR L KCKH++H+ C+D+W+ TGRNSCPLCR
Sbjct  755  GESE---RCLICLSDYEAADEVRQLAKCKHLYHKECIDQWLTTGRNSCPLCR  803



>gb|KDP26691.1| hypothetical protein JCGZ_17849 [Jatropha curcas]
Length=139

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +1

Query  367  VECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRT  504
            VEC VCLC  E  EEV +L CKH FHR CLD+W+    ++CPLCR+
Sbjct  92   VECCVCLCGFEAEEEVSELSCKHFFHRGCLDKWIDNKHSTCPLCRS  137



>ref|XP_008377473.1| PREDICTED: probable E3 ubiquitin-protein ligase RHA2B [Malus 
domestica]
Length=158

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +1

Query  364  AVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHV  510
            A EC+VCL   EEG++VR+L CKH FH+ CLD+W+     +CPLCRT V
Sbjct  69   ATECSVCLSDFEEGDKVRELXCKHTFHKHCLDKWLQQYWATCPLCRTKV  117



>ref|NP_001147218.1| RING zinc finger protein-like [Zea mays]
 gb|ACG26154.1| RING zinc finger protein-like [Zea mays]
 gb|AFW63381.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=220

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = +1

Query  346  EGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAA  522
            +G  D   +CAVCL  I  G+EVR L  C+H FHRACLDRW+  G+ +CPLCR  + P A
Sbjct  108  DGYGDCDCDCAVCLDGIGGGDEVRRLGNCRHAFHRACLDRWMAHGQRTCPLCRAPLVPGA  167

Query  523  RLFGE  537
               G+
Sbjct  168  AAAGD  172



>ref|XP_002314594.1| zinc finger family protein [Populus trichocarpa]
 gb|EEF00765.1| zinc finger family protein [Populus trichocarpa]
Length=133

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +1

Query  349  GESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHV  510
            G  + A+EC VCLC  E  EEV +L CKH FHR CLD+W      +CPLCR+++
Sbjct  80   GARNSAMECCVCLCGFEAEEEVSELSCKHFFHRGCLDKWFDNIHATCPLCRSNL  133



>gb|KGN50076.1| hypothetical protein Csa_5G152910 [Cucumis sativus]
Length=179

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKPA  519
            CAVCL + E  +E+R L  C+HIFHR CLDRW+G G+ +CPLCRT   P 
Sbjct  91   CAVCLYEFESDDEIRRLANCRHIFHRGCLDRWIGYGQRTCPLCRTVFIPP  140



>ref|XP_009104310.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B-like [Brassica rapa]
 emb|CDY58798.1| BnaA07g38110D [Brassica napus]
Length=173

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +1

Query  349  GESDGAVECAVCLCKIEEGEEVRDLK-CKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            GE D    CAVCL + E  EE+R L+ C+HIFHR+CLDRW+   + +CPLCRT   P
Sbjct  87   GEDDLPGNCAVCLYEFEGEEEIRWLRNCRHIFHRSCLDRWMDHDQKTCPLCRTPFVP  143



>ref|XP_008437313.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B-like [Cucumis melo]
Length=185

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKPA  519
            CAVCL + E  +E+R L  C+HIFHR CLDRW+G G+ +CPLCRT   P 
Sbjct  91   CAVCLYEFESDDEIRRLANCRHIFHRGCLDRWIGYGQRTCPLCRTVFIPP  140



>ref|XP_003602018.1| RING finger family protein [Medicago truncatula]
 gb|AES72269.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=157

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +1

Query  370  ECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            +C+VCL + EEGE+VR LKCKH FH+ CLD+W+     +CPLCR  V P
Sbjct  68   DCSVCLSEFEEGEKVRRLKCKHTFHKDCLDKWLQDYFATCPLCREQVLP  116



>ref|XP_009389777.1| PREDICTED: RING-H2 zinc finger protein RHA1a-like [Musa acuminata 
subsp. malaccensis]
Length=163

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            CAVCLC++E G+EVR L  C+H+FHR CLDRWV   +++CPLCR  + P
Sbjct  84   CAVCLCELEHGDEVRRLSNCRHVFHRGCLDRWVEHDQSTCPLCRAPLVP  132



>ref|XP_008723920.1| hypothetical protein G647_09705 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI27514.1| hypothetical protein G647_09705 [Cladophialophora carrionii CBS 
160.54]
Length=847

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            C +CL   E  EEVR L KCKH++HR C+D W+ TGRNSCP+CR
Sbjct  781  CLICLADYEVSEEVRRLDKCKHVYHRECIDEWLTTGRNSCPMCR  824



>tpg|DAA38422.1| TPA: putative RING zinc finger domain superfamily protein isoform 
1 [Zea mays]
 tpg|DAA38423.1| TPA: putative RING zinc finger domain superfamily protein isoform 
2 [Zea mays]
Length=115

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +1

Query  349  GESDG--AVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHV  510
            GE  G  A EC VCL KI  GE  R L C+H+FHR C+DRW+ + + +CPLCR +V
Sbjct  24   GEDSGCPADECRVCLSKIRLGEATRRLPCRHVFHRDCVDRWLSSCKRTCPLCRVYV  79



>gb|EAZ05189.1| hypothetical protein OsI_27387 [Oryza sativa Indica Group]
Length=181

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +1

Query  370  ECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGR--NSCPLCR  501
            +CAVCL  IEEG+EVR+L+C+H+FHR CLDRW  + R   +CPLCR
Sbjct  96   QCAVCLSDIEEGDEVRELRCRHLFHRGCLDRWWLSARPPATCPLCR  141



>ref|XP_007051746.1| Zinc finger protein, putative [Theobroma cacao]
 gb|EOX95903.1| Zinc finger protein, putative [Theobroma cacao]
Length=168

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +1

Query  355  SDGAVECAVCLCKIEEGEEVRDLK-CKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
             D    CAVCL + E GEE+R L+ C+H+FHRACLDRW+   + +CPLCRT   P
Sbjct  84   GDPPESCAVCLYEFEGGEEIRWLRNCRHVFHRACLDRWMDHDQKTCPLCRTPFVP  138



>ref|NP_001060682.1| Os07g0686300 [Oryza sativa Japonica Group]
 dbj|BAC10343.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD30283.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22596.1| Os07g0686300 [Oryza sativa Japonica Group]
 dbj|BAG88394.1| unnamed protein product [Oryza sativa Japonica Group]
Length=181

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +1

Query  370  ECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGR--NSCPLCR  501
            +CAVCL  IEEG+EVR+L+C+H+FHR CLDRW  + R   +CPLCR
Sbjct  96   QCAVCLSGIEEGDEVRELRCRHLFHRGCLDRWWLSARPPATCPLCR  141



>gb|KGN44779.1| hypothetical protein Csa_7G387140 [Cucumis sativus]
Length=159

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 2/69 (3%)
 Frame = +1

Query  307  PENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDLK-CKHIFHRACLDRWVGTGRN  483
            PEN   E  +  + G      ECA+CLC+IEEGE+ R +K C H+FH+ C+DRW     +
Sbjct  66   PENLDIEAPIFHYNGVEGDEQECAICLCEIEEGEKCRKMKTCGHVFHKDCIDRWFKVDGH  125

Query  484  SCPLCRTHV  510
             CP+CRT V
Sbjct  126  -CPICRTSV  133



>ref|XP_007160094.1| hypothetical protein PHAVU_002G291800g [Phaseolus vulgaris]
 gb|ESW32088.1| hypothetical protein PHAVU_002G291800g [Phaseolus vulgaris]
Length=160

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 50/100 (50%), Gaps = 20/100 (20%)
 Frame = +1

Query  277  KFNVVTGIMSPENAASEVGVRVFEGES-------------------DGAVECAVCLCKIE  399
            +F  +   + P+ A  E   R+ E ES                   D    CAVCL + E
Sbjct  35   RFMGLHDFLEPDIAWPEAHTRMPEFESVSATLIREILPVVKFRDLLDPPETCAVCLTEFE  94

Query  400  EGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            + +E+R L  C+HIFHR CLDRW+G  + +CPLCRT   P
Sbjct  95   KNDEIRRLANCRHIFHRGCLDRWMGYDQRTCPLCRTPFIP  134



>ref|XP_006846910.1| hypothetical protein AMTR_s00152p00054630 [Amborella trichopoda]
 gb|ERN08491.1| hypothetical protein AMTR_s00152p00054630 [Amborella trichopoda]
Length=112

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = +1

Query  340  VFEGES---DGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHV  510
            V EG S   DG  +C VCL +++EGE++R L C H+FHR C+DRW+   R +CPLCR  +
Sbjct  27   VIEGSSSSGDGVDKCCVCLSRLKEGEKMRRLPCYHVFHRVCVDRWLNLCRKTCPLCRFAI  86

Query  511  KPAARLFGEDLHQEVIVFD  567
                   G    + VI F 
Sbjct  87   DGKGCGEGPLTEEMVIWFS  105



>ref|XP_002310000.1| hypothetical protein POPTR_0007s06130g [Populus trichocarpa]
 gb|EEE90450.1| hypothetical protein POPTR_0007s06130g [Populus trichocarpa]
Length=164

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +1

Query  370  ECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            ECAVCL +  EGE VR LKC H FH  CLD+W+     +CPLCRT V P
Sbjct  77   ECAVCLSEFTEGERVRTLKCHHTFHNECLDKWLHQSMATCPLCRTVVLP  125



>ref|XP_009385928.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B-like [Musa acuminata 
subsp. malaccensis]
Length=202

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 49/84 (58%), Gaps = 3/84 (4%)
 Frame = +1

Query  265  QDPYKFNVVTGIMSPEN-AASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHI  438
            Q P +F  V+ ++  E          V  G+  G   CAVCLC+ E+ EEVR L  C+H+
Sbjct  67   QQPSQFRSVSAMLIQEALPVVRYEELVAAGQHVGG-SCAVCLCEFEDAEEVRRLTNCRHV  125

Query  439  FHRACLDRWVGTGRNSCPLCRTHV  510
            FHR CLDRW+   + +CPLCRT +
Sbjct  126  FHRGCLDRWLEYDQRTCPLCRTQL  149



>gb|KGN65722.1| hypothetical protein Csa_1G521990 [Cucumis sativus]
Length=122

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = +1

Query  307  PENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDLK-CKHIFHRACLDRWVGTGRN  483
            P+N   E  V  + G+  G  E A+CLC+IEEGE+ R +K C H+FH+ C+DRW     +
Sbjct  31   PKNVDLEALVFHYNGDEGGEQEYAICLCEIEEGEKCRKMKTCGHVFHKDCIDRWFKVD-D  89

Query  484  SCPLCRTHV  510
             CP+CRT V
Sbjct  90   HCPICRTSV  98



>ref|XP_003611072.1| RING zinc finger protein-like protein [Medicago truncatula]
 gb|AES94030.1| anaphase-promoting complex subunit 11 RING-H2 finger protein 
[Medicago truncatula]
 gb|AFK45091.1| unknown [Medicago truncatula]
Length=135

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = +1

Query  364  AVE-CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARL  528
            AVE CAVCLC+ +  +E++ L  C+HIFHR+CLDRW+G    +CPLCRT   P   L
Sbjct  77   AVESCAVCLCEFKAEDEIQRLTNCRHIFHRSCLDRWMGYDHTTCPLCRTTFLPHHML  133



>ref|XP_003532420.1| PREDICTED: RING-H2 zinc finger protein RHA1a-like [Glycine max]
 gb|KHN16800.1| RING-H2 zinc finger protein RHA1a [Glycine soja]
Length=160

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = +1

Query  358  DGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            D    CAVCL + EE +E+R L  C+HIFHR CLDRW+G  + +CPLCR    P
Sbjct  81   DPPETCAVCLSEFEENDEIRQLANCRHIFHRGCLDRWMGYDQRTCPLCRMPFIP  134



>ref|XP_011036824.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B [Populus euphratica]
Length=165

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDLK-CKHIFHRACLDRWVGTGRNSCPLCRTHVKP  516
            CAVCL + +  +E+R LK CKHIFHRACLDRW+   RN+CPLCRT   P
Sbjct  93   CAVCLYEFKGEDEIRWLKNCKHIFHRACLDRWMDHDRNTCPLCRTSFVP  141



>ref|XP_002533929.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28458.1| conserved hypothetical protein [Ricinus communis]
Length=129

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +1

Query  352  ESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHV  510
            E      CAVCL +  EGE VR+L+CKH+FH  CLD+W+   +++CPLCR  V
Sbjct  33   EEQETAACAVCLSEFTEGESVRNLECKHLFHNGCLDKWLQQCKSTCPLCRNKV  85



>gb|KHN38206.1| E3 ubiquitin-protein ligase RHA2A [Glycine soja]
Length=156

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  367  VECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLH  546
            ++C VCL + +EGE+VR+L C+H FH+ CLD+W+     +CPLCR  V P   +   +L 
Sbjct  67   IDCRVCLSEFQEGEKVRNLNCRHTFHKDCLDQWLQQYCATCPLCRNQVLPDDVVANYNLL  126

Query  547  QEVIVFD  567
            Q    +D
Sbjct  127  QNQAEYD  133



>ref|NP_001148030.1| LOC100281639 [Zea mays]
 gb|ACG29513.1| zinc finger, C3HC4 type family protein [Zea mays]
Length=115

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +1

Query  349  GESDG--AVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHV  510
            GE  G  A EC VCL KI  GE  R L C+H+FHR C+DRW+ + + +CPLCR +V
Sbjct  24   GEDGGCPADECRVCLSKIRLGEATRRLPCRHVFHRDCVDRWLSSCKRTCPLCRVYV  79



>ref|XP_003834029.1| hypothetical protein LEMA_P056980.1 [Leptosphaeria maculans JN3]
 emb|CBX90664.1| hypothetical protein LEMA_P056980.1 [Leptosphaeria maculans JN3]
Length=634

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 69/136 (51%), Gaps = 22/136 (16%)
 Frame = +1

Query  145  TFIFKKLLQMFPQSRVLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAAS  324
            ++I   L   +P++  L    S+        D +LL SL   P K  V     S E+ AS
Sbjct  477  SWIIYVLGGSYPENHPLLTTPSLFTDSPTYEDMMLLSSLL-GPAKPPVA----SEEDVAS  531

Query  325  EVGV-RVFEG------ESDGAVE---------CAVCLCKIEEGEEVRDL-KCKHIFHRAC  453
              G+ R+  G      E+   VE         C VCLC+ E  EE R L KC+H+FHR C
Sbjct  532  APGLFRIRGGPGTLIAEATEGVETLNLATDARCLVCLCEFEAEEEARKLVKCEHLFHRIC  591

Query  454  LDRWVGTGRNSCPLCR  501
            +D+W+ TGRNSCPLCR
Sbjct  592  IDQWLTTGRNSCPLCR  607



>gb|KFX48105.1| putative RING finger protein P4H10.07 [Talaromyces marneffei 
PM1]
Length=832

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 38/52 (73%), Gaps = 4/52 (8%)
 Frame = +1

Query  349  GESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            GE++    C +CL   E  E+VR L KCKH++H+ C+D+W+ TGRNSCPLCR
Sbjct  763  GETE---RCLICLSDYEAAEDVRQLTKCKHLYHKECIDQWLTTGRNSCPLCR  811



>ref|XP_002151977.1| RING finger protein [Talaromyces marneffei ATCC 18224]
 gb|EEA20977.1| RING finger protein [Talaromyces marneffei ATCC 18224]
Length=832

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 38/52 (73%), Gaps = 4/52 (8%)
 Frame = +1

Query  349  GESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            GE++    C +CL   E  E+VR L KCKH++H+ C+D+W+ TGRNSCPLCR
Sbjct  763  GETE---RCLICLSDYEAAEDVRQLTKCKHLYHKECIDQWLTTGRNSCPLCR  811



>ref|XP_003607396.1| RING finger family protein [Medicago truncatula]
Length=155

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 48/89 (54%), Gaps = 7/89 (8%)
 Frame = +1

Query  307  PENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRN-  483
            P+    +   R      +  V+CAVCLC ++E EE+R LKC+H+FH+ CLD W     N 
Sbjct  63   PQGRPWQRVSRYMCQSQEEEVDCAVCLCTMKEREEIRVLKCEHVFHKDCLDTWYSFKYNN  122

Query  484  -SCPLCRTHVKPAARLFGEDLHQEVIVFD  567
             +CPLCR  V P       DL  +V + D
Sbjct  123  TTCPLCRVSVGPL-----RDLDAKVTIHD  146



>ref|XP_006585295.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max]
 gb|KHN29097.1| E3 ubiquitin-protein ligase RHA2A [Glycine soja]
Length=156

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  367  VECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLH  546
            ++C VCL + +EGE+VR+L C+H FH+ CLD+W+     +CPLCR  V P   +   +L 
Sbjct  67   IDCRVCLSEFQEGEKVRNLNCRHTFHKDCLDQWLQQYCATCPLCRNKVLPDDVVANHNLL  126

Query  547  QEVIVFD  567
            Q    +D
Sbjct  127  QNQAEYD  133



>ref|XP_009398972.1| PREDICTED: E3 ubiquitin-protein ligase RHA2A-like [Musa acuminata 
subsp. malaccensis]
Length=136

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 54/96 (56%), Gaps = 16/96 (17%)
 Frame = +1

Query  355  SDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPA-----  519
            S G+ +CA+CLC++E GEE R+L+C+H FH++CLD+W+      CP+CR           
Sbjct  46   SIGSSDCAICLCRMERGEETRELRCRHPFHKSCLDKWLEQPGRCCPVCREDAGAGEKASE  105

Query  520  ARLFGEDLHQEVIVF------DFCSRRRDRCSWWLR  609
            +R   E     VIVF      DF   R D  +WW+R
Sbjct  106  SRKRAELRDGGVIVFFPWEEEDF---RSD--AWWIR  136



>ref|XP_010511752.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Camelina 
sativa]
Length=131

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 59/113 (52%), Gaps = 9/113 (8%)
 Frame = +1

Query  190  VLNCVVSVAAQLKWAWDCLLLQSLCQDPYKFNVVTGIMSPENAASEVGVRVFEG------  351
            V+N VVSV+         L + S   +  + N+  G+   ++  S + +  F+       
Sbjct  18   VMNTVVSVSILKNMVRSVLQVVSSDNNEAR-NIEDGVDHEDSERSRILITHFDTLCVKGS  76

Query  352  -ESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRT  504
             +   A+EC VCLC  +E EEV +L  CKH FH ACLD+W G    +CPLCR+
Sbjct  77   MKEREALECCVCLCGFKEKEEVSELVSCKHYFHTACLDKWFGNNHTTCPLCRS  129



>ref|XP_002377830.1| RING finger protein [Aspergillus flavus NRRL3357]
 gb|EED52666.1| RING finger protein [Aspergillus flavus NRRL3357]
Length=835

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            C +CL   E  EE+R L KC H+FHR C+D+W+ TGRNSCPLCR
Sbjct  772  CLICLGDYEAAEELRQLTKCAHVFHRDCIDQWLTTGRNSCPLCR  815



>ref|XP_001826162.2| RING finger protein [Aspergillus oryzae RIB40]
 gb|EIT74219.1| putative E3 ubiquitin ligase [Aspergillus oryzae 3.042]
 gb|KDE75948.1| putative E3 ubiquitin ligase [Aspergillus oryzae 100-8]
Length=835

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +1

Query  373  CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCR  501
            C +CL   E  EE+R L KC H+FHR C+D+W+ TGRNSCPLCR
Sbjct  772  CLICLGDYEAAEELRQLTKCAHVFHRDCIDQWLTTGRNSCPLCR  815



>ref|XP_009117848.1| PREDICTED: E3 ubiquitin-protein ligase RHA2A-like [Brassica rapa]
Length=156

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 6/71 (8%)
 Frame = +1

Query  349  GESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTH------V  510
            G  DG  +C VCL K+ EGEEVR L+C+H+FH+ CL+ W+     +CPLCR+       V
Sbjct  79   GGEDGGSDCVVCLSKLREGEEVRKLECRHVFHKRCLEGWLHCLNFTCPLCRSALVADGCV  138

Query  511  KPAARLFGEDL  543
                R  G DL
Sbjct  139  SKTQRRVGRDL  149



>ref|XP_010279400.1| PREDICTED: E3 ubiquitin-protein ligase RHA2A-like [Nelumbo nucifera]
Length=165

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (67%), Gaps = 3/69 (4%)
 Frame = +1

Query  331  GVRVFEGESDGA---VECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCR  501
            GV  + G  DG    ++C VCLC++++G++VR L+C+H+FH+ CLD W+     +CPLCR
Sbjct  79   GVSSYCGSDDGEGTELDCVVCLCRLKDGDQVRRLECRHVFHKDCLDGWLNHLNWNCPLCR  138

Query  502  THVKPAARL  528
            + +    RL
Sbjct  139  SPLVSEERL  147



>dbj|GAA82395.1| RING finger protein [Aspergillus kawachii IFO 4308]
Length=482

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 43/66 (65%), Gaps = 8/66 (12%)
 Frame = +1

Query  328  VGVRVFEG-ESDGAVE------CAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRN  483
             G  V EG E  GA++      C +CL   E  EE+R L KCKH+FHR C+D+W+ TGRN
Sbjct  395  AGSLVAEGLEGAGAIQLPEGERCLICLSDYEAAEELRQLTKCKHLFHRDCIDQWLTTGRN  454

Query  484  SCPLCR  501
            SCPLCR
Sbjct  455  SCPLCR  460



>gb|KGN65717.1| hypothetical protein Csa_1G514470 [Cucumis sativus]
Length=147

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 43/69 (62%), Gaps = 2/69 (3%)
 Frame = +1

Query  307  PENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDLK-CKHIFHRACLDRWVGTGRN  483
            PEN   E  +  + G+  G  +CA+CLC+IEEGE+ R +K C H+FH+ C+ RW      
Sbjct  56   PENVDIEAPIFHYGGDEGGEQDCAICLCEIEEGEKCRKMKTCGHVFHKDCIGRWFKVD-G  114

Query  484  SCPLCRTHV  510
             CP+CRT V
Sbjct  115  HCPICRTSV  123



>ref|XP_006580294.1| PREDICTED: RING-H2 finger protein ATL16-like [Glycine max]
Length=156

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  367  VECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTGRNSCPLCRTHVKPAARLFGEDLH  546
            ++C VCL + +EGE+VR+L C+H FH+ CLD+W+     +CPLCR  V P   +   +L 
Sbjct  67   IDCRVCLSEFQEGEKVRNLNCRHTFHKDCLDQWLQQYCATCPLCRNKVLPDDVVANYNLL  126

Query  547  QEVIVFD  567
            Q    +D
Sbjct  127  QNQAEYD  133



>ref|XP_006652133.1| PREDICTED: E3 ubiquitin-protein ligase RHA2A-like [Oryza brachyantha]
Length=114

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 50/97 (52%), Gaps = 10/97 (10%)
 Frame = +1

Query  298  IMSPENAASEVGVRVFEGESDGAVECAVCLCKIEEGEEVRDLKCKHIFHRACLDRWVGTG  477
            I  P  A  + G    E       EC VCL +I  GE  R L C+H FHR C+DRW+ + 
Sbjct  14   IKIPSEAKQQAG----EDGGGPTTECCVCLSRIRVGEATRRLPCRHAFHRDCVDRWLLSC  69

Query  478  RNSCPLCRTHV-----KP-AARLFGEDLHQEVIVFDF  570
            R +CPLCR +V     KP AA+  GE    E +V  F
Sbjct  70   RRTCPLCRVYVVVDGNKPAAAKHAGEQPLAEDMVIWF  106



>gb|KCW72619.1| hypothetical protein EUGRSUZ_E01080 [Eucalyptus grandis]
Length=100

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 43/66 (65%), Gaps = 2/66 (3%)
 Frame = +1

Query  331  GVRVFEGESDGAVECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTH  507
            G+ V +G SD    CAVCL  IEE +EVR+L  C H FHR CLDRWV     +CPLCR+ 
Sbjct  19   GLGVDKGASDDGG-CAVCLSSIEERDEVRELSNCSHAFHRECLDRWVDYNLAACPLCRSL  77

Query  508  VKPAAR  525
            + P+ R
Sbjct  78   LFPSKR  83



>ref|XP_011045970.1| PREDICTED: RING-H2 finger protein ATL52-like [Populus euphratica]
Length=198

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 65/121 (54%), Gaps = 17/121 (14%)
 Frame = +1

Query  202  VVSVAAQLKWAWDCLLLQ-------SLCQDPYKFNVVTGIMSPENAASEV--GVRVFEGE  354
            VV  AA +  A++ ++++          Q P  F  VT   S EN+ S +    +  +G+
Sbjct  46   VVGTAAIVLAAYNLIIIKWCAQRGGRSGQGPNVFIEVTASQSFENSNSNLPSSFKYKKGK  105

Query  355  SDGA------VECAVCLCKIEEGEEVRDL-KCKHIFHRACLDRWVGTGRNSCPLCRTHVK  513
            + G        ECAVCL   EEGEEVR L +CKH+FH  C+D W+ +  + CPLCR+ + 
Sbjct  106  TGGDQDQGSDYECAVCLSAFEEGEEVRQLPRCKHLFHAPCIDMWLYS-HSDCPLCRSSID  164

Query  514  P  516
            P
Sbjct  165  P  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1327603072635