BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25534_g1_i1 len=902 path=[4299:0-35 10184:36-581 380:582-901]

Length=902
                                                                      Score     E

ref|XP_009786123.1|  PREDICTED: uncharacterized protein LOC104234287    289   1e-90   
ref|XP_009610723.1|  PREDICTED: uncharacterized protein LOC104104364    286   2e-89   
ref|XP_011073282.1|  PREDICTED: uncharacterized protein LOC105158282    285   3e-89   
ref|XP_011073597.1|  PREDICTED: uncharacterized protein LOC105158512    280   1e-87   
ref|XP_004504713.1|  PREDICTED: uncharacterized protein LOC101499286    277   2e-86   
ref|XP_006346625.1|  PREDICTED: uncharacterized protein LOC102590754    277   6e-86   
ref|XP_011073281.1|  PREDICTED: uncharacterized protein LOC105158280    276   1e-85   
emb|CDO98292.1|  unnamed protein product                                276   1e-85   
ref|XP_009802236.1|  PREDICTED: uncharacterized protein LOC104247817    275   4e-85   
ref|XP_011073598.1|  PREDICTED: uncharacterized protein LOC105158513    273   5e-85   
gb|KEH31347.1|  stress up-regulated Nod 19 protein                      273   9e-85   
emb|CDO98291.1|  unnamed protein product                                275   1e-84   
ref|XP_006368006.1|  PREDICTED: uncharacterized protein LOC102587597    273   2e-84   
ref|XP_004252289.1|  PREDICTED: uncharacterized protein LOC101252852    272   4e-84   
gb|EYU21767.1|  hypothetical protein MIMGU_mgv1a005580mg                272   6e-84   
gb|KEH26244.1|  stress up-regulated Nod 19 protein                      270   7e-84   
ref|XP_006346626.1|  PREDICTED: uncharacterized protein LOC102591330    271   1e-83   
ref|XP_009360279.1|  PREDICTED: uncharacterized protein LOC103950769    269   2e-83   
gb|KEH26246.1|  stress up-regulated Nod 19 protein                      269   3e-83   
ref|XP_009596902.1|  PREDICTED: uncharacterized protein LOC104092914    269   7e-83   
ref|XP_004242193.1|  PREDICTED: uncharacterized protein LOC101264834    269   8e-83   
gb|AAU14999.2|  MtN19-like protein                                      268   1e-82   Pisum sativum [garden pea]
ref|XP_007147472.1|  hypothetical protein PHAVU_006G127400g             266   1e-82   
ref|XP_006346659.1|  PREDICTED: uncharacterized protein LOC102603832    268   1e-82   
gb|KHG10977.1|  G2/mitotic-specific cyclin-B                            268   1e-82   
ref|XP_008392684.1|  PREDICTED: uncharacterized protein LOC103454870    265   2e-82   
ref|XP_011073280.1|  PREDICTED: uncharacterized protein LOC105158279    267   3e-82   
gb|KEH31355.1|  stress up-regulated Nod 19 protein                      265   8e-82   
ref|XP_008375426.1|  PREDICTED: uncharacterized protein LOC103438663    264   1e-81   
ref|XP_009373663.1|  PREDICTED: uncharacterized protein LOC103962645    265   1e-81   
gb|KEH31349.1|  stress up-regulated Nod 19 protein                      265   1e-81   
ref|XP_008246210.1|  PREDICTED: uncharacterized protein LOC103344390    259   1e-81   
ref|XP_010255828.1|  PREDICTED: uncharacterized protein LOC104596...    266   1e-81   
ref|XP_011016694.1|  PREDICTED: uncharacterized protein LOC105120200    265   2e-81   
ref|XP_007038175.1|  MtN19-like protein, putative isoform 2             267   3e-81   
ref|XP_006844650.1|  hypothetical protein AMTR_s00016p00236100          265   4e-81   
ref|XP_006485063.1|  PREDICTED: uncharacterized protein LOC102618549    264   4e-81   
ref|XP_004300379.1|  PREDICTED: uncharacterized protein LOC101300825    263   5e-81   
ref|XP_010255827.1|  PREDICTED: uncharacterized protein LOC104596...    266   5e-81   
ref|XP_010255826.1|  PREDICTED: uncharacterized protein LOC104596...    267   6e-81   
ref|XP_006376935.1|  hypothetical protein POPTR_0012s11210g             264   7e-81   
ref|XP_010909090.1|  PREDICTED: uncharacterized protein LOC105035275    259   8e-81   
ref|XP_007038174.1|  MtN19-like protein, putative isoform 1             266   9e-81   
ref|XP_011003519.1|  PREDICTED: uncharacterized protein LOC105110237    263   1e-80   
ref|XP_007209275.1|  hypothetical protein PRUPE_ppa007517mg             260   1e-80   
gb|ACJ85863.1|  unknown                                                 261   2e-80   Medicago truncatula
ref|XP_010099538.1|  hypothetical protein L484_011611                   261   2e-80   
ref|XP_002321764.2|  hypothetical protein POPTR_0015s12000g             263   2e-80   Populus trichocarpa [western balsam poplar]
gb|KEH31348.1|  stress up-regulated Nod 19 protein                      261   2e-80   
ref|XP_003531077.1|  PREDICTED: uncharacterized protein LOC100803...    261   2e-80   
ref|XP_010099536.1|  hypothetical protein L484_011609                   261   3e-80   
ref|XP_006436986.1|  hypothetical protein CICLE_v10031458mg             261   5e-80   
dbj|BAJ53113.1|  JHL07K02.3                                             260   5e-80   
ref|XP_010036842.1|  PREDICTED: uncharacterized protein LOC104425754    260   2e-79   
ref|XP_007147471.1|  hypothetical protein PHAVU_006G127300g             258   2e-79   
gb|KHG23950.1|  G2/mitotic-specific cyclin-B                            259   4e-79   
ref|XP_002511074.1|  conserved hypothetical protein                     259   4e-79   Ricinus communis
ref|XP_011040294.1|  PREDICTED: uncharacterized protein LOC105136594    259   5e-79   
ref|XP_011040293.1|  PREDICTED: uncharacterized protein LOC105136592    256   9e-79   
ref|XP_004300378.1|  PREDICTED: uncharacterized protein LOC101300539    256   1e-78   
ref|XP_006436984.1|  hypothetical protein CICLE_v10031461mg             257   2e-78   
gb|AFK43962.1|  unknown                                                 255   4e-78   
gb|KEH31350.1|  stress up-regulated Nod 19 protein                      255   5e-78   
ref|XP_007158976.1|  hypothetical protein PHAVU_002G197800g             254   8e-78   
ref|XP_010099537.1|  hypothetical protein L484_011610                   254   1e-77   
gb|KHN39141.1|  hypothetical protein glysoja_027946                     261   1e-77   
dbj|BAI63593.1|  MtN19 protein                                          254   1e-77   Lotus japonicus
ref|XP_006374581.1|  hypothetical protein POPTR_0015s11990g             255   2e-77   
ref|XP_007158977.1|  hypothetical protein PHAVU_002G197800g             254   2e-77   
dbj|BAE71234.1|  hypothetical protein                                   253   3e-77   Trifolium pratense [peavine clover]
ref|XP_003524108.1|  PREDICTED: uncharacterized protein LOC100785991    253   3e-77   
ref|XP_007158975.1|  hypothetical protein PHAVU_002G197800g             253   3e-77   
gb|KEH31352.1|  stress up-regulated Nod 19 protein                      249   5e-77   
ref|XP_011040291.1|  PREDICTED: uncharacterized protein LOC105136589    253   9e-77   
ref|XP_010668152.1|  PREDICTED: uncharacterized protein LOC104885143    251   9e-77   
gb|KHN25868.1|  hypothetical protein glysoja_018722                     252   1e-76   
ref|NP_001240902.1|  uncharacterized protein LOC100784767 precursor     251   2e-76   
ref|XP_010663820.1|  PREDICTED: uncharacterized protein LOC100243...    249   6e-76   
ref|XP_008808813.1|  PREDICTED: uncharacterized protein LOC103720...    251   7e-76   
ref|XP_002511073.1|  conserved hypothetical protein                     251   7e-76   Ricinus communis
gb|KEH37065.1|  stress up-regulated Nod 19 protein                      247   7e-76   
ref|XP_002284739.2|  PREDICTED: uncharacterized protein LOC100243...    251   9e-76   Vitis vinifera
gb|KEH31351.1|  stress up-regulated Nod 19 protein                      249   1e-75   
gb|ACJ85534.1|  unknown                                                 249   1e-75   Medicago truncatula
ref|NP_001062371.1|  Os08g0538600                                       249   1e-75   Oryza sativa Japonica Group [Japonica rice]
gb|AFK45617.1|  unknown                                                 249   1e-75   
ref|XP_008808814.1|  PREDICTED: uncharacterized protein LOC103720...    250   1e-75   
gb|ACU22964.1|  unknown                                                 248   2e-75   Glycine max [soybeans]
gb|KEH41599.1|  stress up-regulated Nod 19 protein                      244   2e-75   
ref|XP_006586844.1|  PREDICTED: uncharacterized protein LOC100791925    248   3e-75   
ref|XP_003594548.1|  MtN19 protein                                      246   7e-75   
gb|AFK34663.1|  unknown                                                 246   8e-75   
gb|AES64799.2|  stress up-regulated Nod 19 protein                      246   9e-75   
ref|XP_003574847.1|  PREDICTED: uncharacterized protein LOC100825330    246   1e-74   
gb|EEC83958.1|  hypothetical protein OsI_30065                          246   1e-74   Oryza sativa Indica Group [Indian rice]
ref|XP_008367082.1|  PREDICTED: uncharacterized protein LOC103430711    245   2e-74   
gb|KEH41598.1|  stress up-regulated Nod 19 protein                      243   2e-74   
gb|KEH16840.1|  stress up-regulated Nod 19 protein                      245   3e-74   
emb|CAA75589.1|  MtN19                                                  244   5e-74   Medicago truncatula
ref|XP_009360277.1|  PREDICTED: uncharacterized protein LOC103950768    244   9e-74   
ref|XP_008392751.1|  PREDICTED: uncharacterized protein LOC103454938    242   1e-73   
ref|XP_010546109.1|  PREDICTED: uncharacterized protein LOC104818287    246   1e-73   
ref|XP_009335863.1|  PREDICTED: uncharacterized protein LOC103928535    243   2e-73   
ref|XP_009411808.1|  PREDICTED: uncharacterized protein LOC103993457    244   2e-73   
gb|KEH41600.1|  stress up-regulated Nod 19 protein                      243   3e-73   
ref|XP_008375421.1|  PREDICTED: uncharacterized protein LOC103438661    242   4e-73   
ref|XP_003546270.2|  PREDICTED: uncharacterized protein LOC100815629    250   5e-73   
ref|XP_009373664.1|  PREDICTED: uncharacterized protein LOC103962646    241   6e-73   
ref|XP_006844651.1|  hypothetical protein AMTR_s00016p00236400          239   3e-72   
ref|XP_011040297.1|  PREDICTED: uncharacterized protein LOC105136...    241   4e-72   
emb|CDY53158.1|  BnaCnng24580D                                          242   4e-72   
ref|XP_011040295.1|  PREDICTED: uncharacterized protein LOC105136...    241   4e-72   
ref|XP_006844648.1|  hypothetical protein AMTR_s00016p00235580          239   5e-72   
gb|AES64800.2|  stress up-regulated Nod 19 protein                      248   6e-72   
ref|XP_003594549.1|  MtN19 protein                                      249   7e-72   
ref|XP_006659641.1|  PREDICTED: uncharacterized protein LOC102706312    239   8e-72   
gb|KGN63844.1|  hypothetical protein Csa_1G024275                       239   2e-71   
ref|XP_004160448.1|  PREDICTED: uncharacterized protein LOC101226527    237   5e-71   
ref|XP_008453444.1|  PREDICTED: uncharacterized protein LOC103494150    236   6e-71   
ref|XP_004974041.1|  PREDICTED: uncharacterized protein LOC101778...    236   1e-70   
ref|XP_006374583.1|  hypothetical protein POPTR_0015s12020g             237   1e-70   
gb|EMS67244.1|  hypothetical protein TRIUR3_19124                       236   2e-70   
ref|XP_004137547.1|  PREDICTED: uncharacterized protein LOC101210584    236   3e-70   
gb|EMT06228.1|  hypothetical protein F775_26753                         235   3e-70   
ref|XP_006374582.1|  hypothetical protein POPTR_0015s12010g             236   3e-70   
ref|XP_009130176.1|  PREDICTED: uncharacterized protein LOC103854962    235   8e-70   
ref|XP_004974037.1|  PREDICTED: uncharacterized protein LOC101776...    234   1e-69   
ref|XP_009150119.1|  PREDICTED: uncharacterized protein LOC103873465    233   7e-69   
ref|XP_009760997.1|  PREDICTED: uncharacterized protein LOC104213242    224   2e-68   
ref|XP_006394466.1|  hypothetical protein EUTSA_v10004123mg             231   4e-68   
ref|NP_200990.2|  uncharacterized protein                               231   5e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004137324.1|  PREDICTED: uncharacterized protein LOC101215981    228   7e-68   
gb|AAL91170.1|  putative protein                                        230   8e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280401.1|  hypothetical protein CARUB_v10026327mg             229   1e-67   
dbj|BAB10082.1|  MtN19-like protein                                     230   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394469.1|  hypothetical protein EUTSA_v10004141mg             229   3e-67   
ref|XP_004160434.1|  PREDICTED: uncharacterized protein LOC101223324    227   4e-67   
ref|XP_002866457.1|  hypothetical protein ARALYDRAFT_496351             228   4e-67   
ref|XP_010483865.1|  PREDICTED: uncharacterized protein LOC104762...    227   5e-67   
gb|EMT11028.1|  hypothetical protein F775_20874                         227   6e-67   
gb|KEH31353.1|  stress up-regulated Nod 19 protein                      223   7e-67   
ref|XP_010483864.1|  PREDICTED: uncharacterized protein LOC104762...    227   1e-66   
ref|XP_008453438.1|  PREDICTED: uncharacterized protein LOC103494145    226   1e-66   
ref|XP_010483862.1|  PREDICTED: uncharacterized protein LOC104762299    227   1e-66   
gb|KEH31354.1|  stress up-regulated Nod 19 protein                      223   3e-66   
ref|XP_003574848.1|  PREDICTED: uncharacterized protein LOC100825842    224   4e-66   
ref|XP_004974890.1|  PREDICTED: uncharacterized protein LOC101770076    225   4e-66   
ref|XP_004974040.1|  PREDICTED: uncharacterized protein LOC101777764    224   5e-66   
gb|EMS55330.1|  hypothetical protein TRIUR3_10894                       224   5e-66   
dbj|BAJ87916.1|  predicted protein                                      223   8e-66   
dbj|BAJ86815.1|  predicted protein                                      223   8e-66   
ref|XP_010477840.1|  PREDICTED: uncharacterized protein LOC104756879    226   8e-66   
ref|XP_010457781.1|  PREDICTED: uncharacterized protein LOC104739202    224   9e-66   
ref|XP_010457791.1|  PREDICTED: uncharacterized protein LOC104739210    225   9e-66   
ref|XP_010444012.1|  PREDICTED: uncharacterized protein LOC104726772    224   1e-65   
gb|KGN43818.1|  hypothetical protein Csa_7G069440                       223   2e-65   
ref|XP_010457823.1|  PREDICTED: uncharacterized protein LOC104739234    223   2e-65   
ref|XP_008455078.1|  PREDICTED: uncharacterized protein LOC103495342    222   5e-65   
ref|XP_002983409.1|  hypothetical protein SELMODRAFT_118146             221   5e-65   
ref|XP_010444011.1|  PREDICTED: uncharacterized protein LOC104726771    222   7e-65   
ref|XP_002960630.1|  hypothetical protein SELMODRAFT_75188              217   1e-63   
ref|XP_008453443.1|  PREDICTED: uncharacterized protein LOC103494148    217   2e-63   
ref|XP_006279767.1|  hypothetical protein CARUB_v10027779mg             218   3e-63   
tpg|DAA48290.1|  TPA: mtN19-like protein                                216   5e-63   
tpg|DAA48291.1|  TPA: hypothetical protein ZEAMMB73_362863              216   6e-63   
gb|ACG30313.1|  mtN19-like protein                                      216   8e-63   Zea mays [maize]
ref|NP_001148306.1|  mtN19-like protein precursor                       216   9e-63   Zea mays [maize]
ref|XP_010457757.1|  PREDICTED: uncharacterized protein LOC104739180    216   1e-62   
ref|XP_003594550.1|  MtN19 protein                                      214   2e-62   
ref|XP_004163909.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    214   2e-62   
ref|XP_002983404.1|  hypothetical protein SELMODRAFT_43474              212   1e-61   
ref|XP_002960633.1|  hypothetical protein SELMODRAFT_437681             213   1e-61   
ref|XP_007133892.1|  hypothetical protein PHAVU_010G000800g             212   2e-61   
ref|XP_002983406.1|  hypothetical protein SELMODRAFT_422686             213   2e-61   
ref|XP_002445785.1|  hypothetical protein SORBIDRAFT_07g025770          212   2e-61   Sorghum bicolor [broomcorn]
ref|XP_004512652.1|  PREDICTED: uncharacterized protein LOC101513451    209   2e-61   
gb|KHN18974.1|  hypothetical protein glysoja_039898                     211   2e-61   
ref|XP_002960632.1|  hypothetical protein SELMODRAFT_437681             213   2e-61   
ref|XP_006577651.1|  PREDICTED: uncharacterized protein LOC100806449    211   7e-61   
ref|XP_004512657.1|  PREDICTED: uncharacterized protein LOC101515735    209   2e-60   
ref|XP_006577555.1|  PREDICTED: uncharacterized protein LOC102664678    206   2e-59   
ref|XP_006577556.1|  PREDICTED: uncharacterized protein LOC102664794    206   2e-59   
gb|KHN15503.1|  hypothetical protein glysoja_049065                     206   2e-59   
gb|KHN17845.1|  hypothetical protein glysoja_047764                     205   5e-59   
ref|XP_003522144.2|  PREDICTED: uncharacterized protein LOC100792489    207   2e-58   
ref|XP_002960631.1|  hypothetical protein SELMODRAFT_270236             204   4e-58   
ref|XP_007134297.1|  hypothetical protein PHAVU_010G035400g             201   5e-58   
ref|XP_006579112.1|  PREDICTED: uncharacterized protein LOC100799740    202   1e-57   
ref|XP_004506757.1|  PREDICTED: uncharacterized protein LOC101509765    201   2e-57   
ref|XP_004510129.1|  PREDICTED: uncharacterized protein LOC101508405    201   3e-57   
ref|XP_002983407.1|  hypothetical protein SELMODRAFT_118200             199   6e-57   
ref|XP_007134300.1|  hypothetical protein PHAVU_010G035700g             198   3e-56   
ref|XP_004497966.1|  PREDICTED: uncharacterized protein LOC101492429    198   3e-56   
ref|XP_004513390.1|  PREDICTED: uncharacterized protein LOC101513345    197   6e-56   
ref|XP_006574192.1|  PREDICTED: uncharacterized protein LOC100820275    200   8e-56   
ref|XP_004497967.1|  PREDICTED: uncharacterized protein LOC101492762    201   3e-55   
ref|XP_007132991.1|  hypothetical protein PHAVU_011G142100g             188   8e-53   
ref|XP_007137902.1|  hypothetical protein PHAVU_009G165400g             186   6e-52   
ref|XP_007134075.1|  hypothetical protein PHAVU_010G017500g             187   8e-52   
emb|CAN69533.1|  hypothetical protein VITISV_013567                     179   2e-51   Vitis vinifera
ref|XP_007134136.1|  hypothetical protein PHAVU_010G022300g             185   3e-51   
ref|XP_007134084.1|  hypothetical protein PHAVU_010G018100g             184   5e-51   
ref|XP_007134081.1|  hypothetical protein PHAVU_010G017900g             184   7e-51   
ref|XP_007134138.1|  hypothetical protein PHAVU_010G022500g             184   1e-50   
gb|KHN44114.1|  hypothetical protein glysoja_039252                     182   1e-50   
ref|XP_003627861.1|  MtN19-like protein                                 183   2e-50   
ref|XP_001774740.1|  predicted protein                                  181   3e-50   
ref|XP_003620759.1|  MtN19-like protein                                 181   1e-49   
ref|XP_004170875.1|  PREDICTED: uncharacterized protein LOC101232587    174   1e-49   
ref|XP_003620745.1|  MtN19 protein                                      180   2e-49   
ref|XP_003599552.1|  MtN19-like protein                                 169   2e-45   
gb|KEH42150.1|  stress up-regulated Nod 19 protein                      161   6e-44   
gb|EYU24544.1|  hypothetical protein MIMGU_mgv1a007758mg                161   2e-42   
ref|XP_010444013.1|  PREDICTED: uncharacterized protein LOC104726773    154   1e-41   
ref|XP_004173525.1|  PREDICTED: uncharacterized protein LOC101232803    148   1e-39   
ref|XP_003589696.1|  MtN19-like protein                                 148   6e-38   
ref|XP_004137076.1|  PREDICTED: uncharacterized protein LOC101210001    148   7e-37   
emb|CDY71893.1|  BnaCnng74960D                                          138   3e-36   
ref|XP_001779179.1|  predicted protein                                  138   5e-34   
dbj|BAJ88316.1|  predicted protein                                      135   1e-33   
ref|XP_008453441.1|  PREDICTED: uncharacterized protein LOC103494146    135   2e-33   
ref|XP_007134295.1|  hypothetical protein PHAVU_010G0353001g            129   1e-32   
ref|XP_001784976.1|  predicted protein                                  122   4e-28   
ref|XP_006574191.1|  PREDICTED: uncharacterized protein LOC100818138    119   9e-28   
ref|XP_007134080.1|  hypothetical protein PHAVU_010G0178000g            114   7e-27   
gb|EMS67414.1|  hypothetical protein TRIUR3_30255                       100   2e-20   
ref|XP_010099535.1|  hypothetical protein L484_011608                 95.9    3e-20   
gb|KHN25867.1|  hypothetical protein glysoja_018721                   91.7    1e-18   
gb|KHN25869.1|  hypothetical protein glysoja_018723                   92.4    2e-18   
gb|AGV54779.1|  MtN19-like protein                                    94.4    2e-18   
emb|CCA14282.1|  conserved hypothetical protein                       92.8    1e-17   
emb|CCI40599.1|  unnamed protein product                              89.4    1e-16   
ref|XP_008360160.1|  PREDICTED: uncharacterized protein LOC103423859  86.3    2e-16   
ref|XP_006844649.1|  hypothetical protein AMTR_s00016p00235830        84.3    2e-16   
ref|XP_006574193.1|  PREDICTED: uncharacterized protein LOC102666323  84.0    1e-15   
ref|XP_002904847.1|  conserved hypothetical protein                   79.7    2e-13   
ref|XP_008390013.1|  PREDICTED: uncharacterized protein LOC103452281  73.2    2e-12   
gb|EJK60813.1|  hypothetical protein THAOC_18774                      75.1    9e-12   
ref|XP_008898088.1|  hypothetical protein PPTG_06079                  72.0    9e-11   
gb|ETK72754.1|  hypothetical protein L915_20217                       71.2    1e-10   
gb|ETO61110.1|  hypothetical protein F444_20823                       71.2    1e-10   
gb|ETI32377.1|  hypothetical protein F443_20804                       71.2    1e-10   
ref|XP_008875588.1|  hypothetical protein H310_10881                  68.9    5e-10   
ref|XP_009520872.1|  hypothetical protein PHYSODRAFT_555341           68.6    1e-09   
ref|XP_005765872.1|  hypothetical protein EMIHUDRAFT_212502           64.3    3e-08   
ref|NP_001148097.1|  LOC100281705                                     62.8    3e-08   Zea mays [maize]
ref|XP_009835513.1|  hypothetical protein H257_10612                  60.1    7e-07   
gb|KDO31539.1|  hypothetical protein SPRG_03467                       58.2    3e-06   
ref|XP_009835512.1|  hypothetical protein H257_10611                  58.2    3e-06   
ref|XP_008609227.1|  hypothetical protein SDRG_05292                  57.8    4e-06   
ref|XP_003622550.1|  hypothetical protein MTR_7g045290                57.4    6e-06   
ref|XP_005642698.1|  hypothetical protein COCSUDRAFT_68383            53.5    1e-04   
ref|XP_003598307.1|  hypothetical protein MTR_3g010150                49.7    1e-04   
gb|KDO16248.1|  hypothetical protein SPRG_18218                       51.2    2e-04   
emb|CDY71894.1|  BnaCnng74970D                                        51.6    2e-04   



>ref|XP_009786123.1| PREDICTED: uncharacterized protein LOC104234287 [Nicotiana sylvestris]
Length=466

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 151/232 (65%), Positives = 176/232 (76%), Gaps = 16/232 (7%)
 Frame = -3

Query  657  SSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEG  478
            SSQ   R+ EENGVK    LSP+  LEPGSV NKF+Y IDFPKGHIA+K F+AEVVDE G
Sbjct  23   SSQS--RLTEENGVKSAVFLSPKIVLEPGSVSNKFYYNIDFPKGHIAIKNFDAEVVDEAG  80

Query  477  NSIPLHQTYLHHWIVGKYMIRKD-EVVEAADKM------FLVG-NSGVC-AELPQYFGLG  325
            NS+PLH+TYLHHW+V +Y  RK  EV +    +      F+V  NSG+C   L QYFGLG
Sbjct  81   NSVPLHETYLHHWVVVRYYQRKGVEVAKYHGNLGFHQSDFIVKRNSGICNGGLTQYFGLG  140

Query  324  SETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYN  154
            SETRKT + VPDPYGIEVGNP   PPG EE W+LNVHAIDTRG AE++ GCTECRCDLYN
Sbjct  141  SETRKTITYVPDPYGIEVGNPVEVPPGYEEGWLLNVHAIDTRG-AEDRLGCTECRCDLYN  199

Query  153  VTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            VTKDE  R +  DY GGLRCCYD  +C+VK+GF+G +R LYLKYTV Y+DW+
Sbjct  200  VTKDEYDRNIEPDYVGGLRCCYDETRCKVKEGFQGARRSLYLKYTVKYIDWD  251



>ref|XP_009610723.1| PREDICTED: uncharacterized protein LOC104104364 [Nicotiana tomentosiformis]
Length=466

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 172/226 (76%), Gaps = 14/226 (6%)
 Frame = -3

Query  639  RIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLH  460
            R  EENGVK    LSP+  LEPGSV NKF+Y IDFPKGHIA+K F+AEVVDE GNS+PLH
Sbjct  27   RSTEENGVKSAVFLSPKIVLEPGSVSNKFYYNIDFPKGHIAIKNFDAEVVDEAGNSVPLH  86

Query  459  QTYLHHWIVGKYMIRKD-EVVEAADKM------FLVG-NSGVC-AELPQYFGLGSETRKT  307
            +TYLHHW+V +Y  +K  EV +    +      F+V  NSG+C   L QYFGLGSETRKT
Sbjct  87   ETYLHHWVVVRYYRQKGVEVAKYHGNLGFHQSDFIVKRNSGICDGGLTQYFGLGSETRKT  146

Query  306  NSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDED  136
             + VPDPYGIEVGNP   PPG EE W+LNVHAIDTRG AE++ GCTECRCDLYNVTKDE 
Sbjct  147  ITYVPDPYGIEVGNPAEVPPGYEERWLLNVHAIDTRG-AEDRLGCTECRCDLYNVTKDEY  205

Query  135  GRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             R +  DY GGLRCCYD  +CRVK+GF+G +R LYLKYTV Y+DW+
Sbjct  206  DRNIEPDYVGGLRCCYDETRCRVKEGFQGARRSLYLKYTVKYIDWD  251



>ref|XP_011073282.1| PREDICTED: uncharacterized protein LOC105158282 [Sesamum indicum]
Length=461

 Score =   285 bits (729),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 151/234 (65%), Positives = 170/234 (73%), Gaps = 16/234 (7%)
 Frame = -3

Query  663  VCSSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE  484
            V SSQ  LR   ENGVK +  LSP F LEPGSV NKF+Y IDFP+GHIA+K F  EV+DE
Sbjct  21   VQSSQAQLR--SENGVKTDVFLSPEFVLEPGSVSNKFYYNIDFPRGHIAIKSFNGEVIDE  78

Query  483  EGNSIPLHQTYLHHWIVGKYMIRK--DEVVEAADKMFL------VGNSGVC-AELPQYFG  331
            +GN IPLH+TYLHHW VG+Y  +K  D      D  FL      + NSGVC    PQYFG
Sbjct  79   KGNPIPLHETYLHHWAVGRYYQQKGIDIPKHHGDLRFLHSDHTIIMNSGVCDGVFPQYFG  138

Query  330  LGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDL  160
            LGSETRKT + VPDPYGIEVGNP   P G EE WMLNVHAIDTRG AE+K GC ECRCDL
Sbjct  139  LGSETRKTATDVPDPYGIEVGNPADIPDGYEERWMLNVHAIDTRG-AEDKLGCIECRCDL  197

Query  159  YNVTKDEDG-RPLGDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            YNVT DE G   L +Y GGL+CCYD A+CRVK+GF G KR L+L+YTV YVDW+
Sbjct  198  YNVTADEYGCALLPNYIGGLKCCYDSARCRVKEGFEGVKRSLFLRYTVKYVDWD  251



>ref|XP_011073597.1| PREDICTED: uncharacterized protein LOC105158512 [Sesamum indicum]
Length=417

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/234 (62%), Positives = 172/234 (74%), Gaps = 16/234 (7%)
 Frame = -3

Query  663  VCSSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE  484
            V SSQ  LR   ENG+K +  +SP+  LEPG V NK +Y IDFP+GHIA+K F AEVVDE
Sbjct  21   VQSSQAQLR--SENGLKTDMFVSPKIVLEPGLVSNKVYYNIDFPRGHIAIKSFNAEVVDE  78

Query  483  EGNSIPLHQTYLHHWIVGKYMIRK--------DEVVEAADKMFLVGNSGVC-AELPQYFG  331
            EGN +PLH+TYLHHWIV +Y  RK        D++        ++ N+GVC + L QYFG
Sbjct  79   EGNPVPLHETYLHHWIVVRYYQRKGIDIPKHHDDLGFLHSDHIIIRNNGVCDSGLSQYFG  138

Query  330  LGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDL  160
            LGSETR+T + VPDPYGIEVGNP   P G EE WMLNVHAIDTRG AE+  GCTECRCDL
Sbjct  139  LGSETRRTATYVPDPYGIEVGNPADIPDGYEERWMLNVHAIDTRG-AEDNLGCTECRCDL  197

Query  159  YNVTKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            YN+T D  GRPL  +Y GGLRCC+DGA+CRVK+GF G +R L L+YTVTYVDW+
Sbjct  198  YNLTVDGHGRPLPPNYNGGLRCCHDGARCRVKEGFDGVQRSLVLRYTVTYVDWD  251



>ref|XP_004504713.1| PREDICTED: uncharacterized protein LOC101499286 [Cicer arietinum]
Length=431

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 168/227 (74%), Gaps = 16/227 (7%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            +  E+ +K    LSP+FEL PGSV N+++Y IDFP+GHIA+K F AEV+DE GNSIPLH+
Sbjct  28   VKSEDKIKSSVFLSPKFELGPGSVINRYYYDIDFPRGHIAIKSFNAEVIDEAGNSIPLHE  87

Query  456  TYLHHWIVGKYMIRK---------DEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRK  310
            TYLHHW+V +Y   K           +++ +D   LV NSG+C E  L QYFGLGSETR 
Sbjct  88   TYLHHWVVARYHKSKHVTHREYDSHRMLQNSDNGVLVRNSGICQENTLGQYFGLGSETRG  147

Query  309  TNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDE  139
            T + +PDP+GIE+GNP   P G EE W++NVHAIDTRG AE+K GCTEC+CDLYNVT DE
Sbjct  148  TATDIPDPFGIEIGNPAEIPEGFEEKWLVNVHAIDTRG-AEDKLGCTECKCDLYNVTVDE  206

Query  138  DGRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             GRP+  DY GGL CCYD ++C++K+GF G KR LYLKYT+ +VDWN
Sbjct  207  YGRPIRPDYKGGLLCCYDYSQCKLKEGFEGPKRSLYLKYTIKWVDWN  253



>ref|XP_006346625.1| PREDICTED: uncharacterized protein LOC102590754 [Solanum tuberosum]
Length=463

 Score =   277 bits (708),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 142/223 (64%), Positives = 167/223 (75%), Gaps = 14/223 (6%)
 Frame = -3

Query  630  EENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTY  451
            +E+ VK    LSP F LEPGSV NKF+Y I FPKGHIA+K F+AEVVDE GN++PL++TY
Sbjct  26   QESRVKSAVFLSPAFVLEPGSVSNKFYYNIGFPKGHIAIKNFDAEVVDEAGNAVPLYETY  85

Query  450  LHHWIVGKYMIRKD-EVVEAAD-------KMFLVGNSGVC-AELPQYFGLGSETRKTNSS  298
            LHHW+V +Y  RK  EV +  D        + +  NSG+C   L QYFGLGSETRKT + 
Sbjct  86   LHHWVVVRYYNRKGVEVTKYRDDLGFHQSDLIVKRNSGICDGGLSQYFGLGSETRKTITY  145

Query  297  VPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRP  127
            VPDPYGIEVGNP   PPG EE W+LN+HAIDTRG AE++ GCTECRCDLYNVTKDE  R 
Sbjct  146  VPDPYGIEVGNPVEVPPGYEEKWLLNLHAIDTRG-AEDRLGCTECRCDLYNVTKDEHDRV  204

Query  126  L-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            +  DY GGLRCCYD  +CRVK GF+G KR LYLKYTV Y+DW+
Sbjct  205  IEPDYIGGLRCCYDETRCRVKDGFQGSKRSLYLKYTVKYIDWD  247



>ref|XP_011073281.1| PREDICTED: uncharacterized protein LOC105158280 [Sesamum indicum]
Length=460

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 147/234 (63%), Positives = 168/234 (72%), Gaps = 16/234 (7%)
 Frame = -3

Query  663  VCSSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE  484
            V SSQ  LR   ENGVK +  LSP F LEPGSV NKF+Y IDFP+GHIA+K F  EV+DE
Sbjct  21   VQSSQAQLR--NENGVKTDVFLSPEFVLEPGSVSNKFYYNIDFPRGHIAIKSFNGEVIDE  78

Query  483  EGNSIPLHQTYLHHWIVGKYMIRK--DEVVEAADKMF------LVGNSGVC-AELPQYFG  331
            +GN IPLH+TYLH+W V +Y  +K  D      D  F      L+ NSGVC +  PQYFG
Sbjct  79   KGNPIPLHETYLHNWFVERYYQQKSIDIPKHHGDLRFLHSDHILIMNSGVCDSVFPQYFG  138

Query  330  LGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDL  160
            LGSETRKT + VPDPYGIEVGNP   P G EE WMLNVHAIDTRG AE+K GC ECRCDL
Sbjct  139  LGSETRKTATDVPDPYGIEVGNPADIPDGYEERWMLNVHAIDTRG-AEDKLGCIECRCDL  197

Query  159  YNVTKDEDG-RPLGDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            YNVT DE G   L +Y GG +CCYD  +CRVK+GF G KR L+L+YTV YVDW+
Sbjct  198  YNVTADEYGCALLPNYIGGAKCCYDSTRCRVKEGFEGVKRSLFLRYTVKYVDWD  251



>emb|CDO98292.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/223 (63%), Positives = 165/223 (74%), Gaps = 14/223 (6%)
 Frame = -3

Query  630  EENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTY  451
            +EN VK    LSP+FEL PGSV NK++Y IDFP+GHIAVK F+AEV+DE GNSIPL++TY
Sbjct  30   DENEVKTLVYLSPKFELGPGSVINKYYYDIDFPRGHIAVKSFDAEVIDEAGNSIPLYETY  89

Query  450  LHHWIVGKYMIRK--------DEVVEAADKMFLVGNSGVCAE-LPQYFGLGSETRKTNSS  298
            LHHW+   Y  R+          V          GN+GVCA+ L Q+FGLGSETRKT+++
Sbjct  90   LHHWVAVNYYQRRGVETPKYHSRVGFQKSDYISAGNNGVCAQVLSQFFGLGSETRKTSNN  149

Query  297  VPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRP  127
            VPDPYGIE GNP   P G +E W+LNVHAIDTRG AEN+ GCTECRCDLYNVT DE G  
Sbjct  150  VPDPYGIEFGNPAVIPAGYDEKWLLNVHAIDTRG-AENRLGCTECRCDLYNVTVDEYGHN  208

Query  126  LG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            L   Y GGLRCCYD  +CR+K+GF+G KR LYLKYTVTYVDW+
Sbjct  209  LDPSYVGGLRCCYDETRCRLKEGFQGVKRSLYLKYTVTYVDWH  251



>ref|XP_009802236.1| PREDICTED: uncharacterized protein LOC104247817 [Nicotiana sylvestris]
 ref|XP_009802237.1| PREDICTED: uncharacterized protein LOC104247817 [Nicotiana sylvestris]
 ref|XP_009802238.1| PREDICTED: uncharacterized protein LOC104247817 [Nicotiana sylvestris]
 ref|XP_009802239.1| PREDICTED: uncharacterized protein LOC104247817 [Nicotiana sylvestris]
 ref|XP_009802240.1| PREDICTED: uncharacterized protein LOC104247817 [Nicotiana sylvestris]
Length=473

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 164/232 (71%), Gaps = 14/232 (6%)
 Frame = -3

Query  657  SSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEG  478
            S     R+  E  VK     SP+F LEPGSVCNKF+Y I FPKGHIA+K F AEVVDE  
Sbjct  21   SPSLQTRLRNEIKVKTSIFRSPKFVLEPGSVCNKFYYNIAFPKGHIAIKSFNAEVVDEAL  80

Query  477  NSIPLHQTYLHHWIVGKYMIRKDEVVE--------AADKMFLVGNSGVC-AELPQYFGLG  325
            N +PLH+TYLHHW+V +Y  RK   V               +  NSG+C  +L QYFGLG
Sbjct  81   NPVPLHETYLHHWLVVRYYQRKGAKVTKYHGDLRFQKSDFIIASNSGMCEGDLYQYFGLG  140

Query  324  SETRKTNSSVPDPYGIEVGN---PPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYN  154
            SETR+T + VPDPYGIE+GN    PPG EE W+LNVHAIDTRG +E++ GCTECRCDLYN
Sbjct  141  SETRRTETYVPDPYGIEIGNLGEVPPGYEERWLLNVHAIDTRG-SEDRLGCTECRCDLYN  199

Query  153  VTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            VTKDE  R +G DY GGLRCCYD  +CRV++GF+G KR LYLKYT+ YVDW+
Sbjct  200  VTKDEYNRDIGPDYIGGLRCCYDETRCRVEKGFQGHKRSLYLKYTIKYVDWD  251



>ref|XP_011073598.1| PREDICTED: uncharacterized protein LOC105158513 [Sesamum indicum]
Length=418

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 173/234 (74%), Gaps = 16/234 (7%)
 Frame = -3

Query  663  VCSSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE  484
            V SSQ  LR   ENG+K +  +SP+  L+PG V +K++Y IDFP+GHIA+K F  EV+DE
Sbjct  21   VQSSQTQLR--SENGLKTDVFVSPKIVLKPGLVSDKYYYNIDFPRGHIAIKSFNGEVIDE  78

Query  483  EGNSIPLHQTYLHHWIVGKYMIRK-DEVVEAADKM-------FLVGNSGVC-AELPQYFG  331
            EGN +PLH+TYLHHW+V +Y  +K  ++ +  D +        ++ NSGVC + L QYFG
Sbjct  79   EGNPVPLHETYLHHWVVIRYYQQKGTDIPKHHDNLGFLHSDHIIIRNSGVCDSGLSQYFG  138

Query  330  LGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDL  160
            LGSETRKT + VP+PYGIEVGNP   P G EE WMLNVHAIDTRG AE+K GCTECRCDL
Sbjct  139  LGSETRKTATYVPNPYGIEVGNPADIPDGYEERWMLNVHAIDTRG-AEDKLGCTECRCDL  197

Query  159  YNVTKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            YN+T D  GRPL  +Y GGLRCC+DGA+CRVK+G  G KR L L+Y VTYVDW+
Sbjct  198  YNLTMDGHGRPLPQNYNGGLRCCHDGARCRVKEGIDGVKRSLVLRYKVTYVDWD  251



>gb|KEH31347.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=437

 Score =   273 bits (698),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 167/227 (74%), Gaps = 16/227 (7%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            +  EN +K    LSP+FEL PGSV N+++Y IDFP+GH+A+K F AEVVDE+GN IPLH+
Sbjct  29   LKTENKIKSAVFLSPKFELGPGSVINRYYYDIDFPRGHVALKSFNAEVVDEDGNPIPLHE  88

Query  456  TYLHHWIVGKYMIRK---------DEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRK  310
            TYLHHW VG+Y  RK           +++ +    LV NSG+C E  +PQYFGLGSETR 
Sbjct  89   TYLHHWAVGRYHQRKHVTHTENDSHRMLQNSADHVLVRNSGICQENVIPQYFGLGSETRG  148

Query  309  TNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDE  139
            T + +PDP+GIE+GNP   P G EE W++NVHAIDTRG AE+K GCTEC+C+LYNVT DE
Sbjct  149  TATDIPDPFGIEIGNPEEIPEGFEEKWLVNVHAIDTRG-AEDKLGCTECKCELYNVTVDE  207

Query  138  DGRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             GR +  DY GGL CCYD  +C++K+GF G KR LYL+YTV +VDW+
Sbjct  208  YGRSIRSDYEGGLLCCYDYTQCKLKEGFEGPKRSLYLRYTVKWVDWD  254



>emb|CDO98291.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   275 bits (703),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/228 (59%), Positives = 168/228 (74%), Gaps = 16/228 (7%)
 Frame = -3

Query  642  LRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPL  463
            + +   NG++    LSP+FELEPGSV  K F+ IDFP+GHIA+K F+AEVVDE GN +PL
Sbjct  78   VHLSNANGIRTAVFLSPKFELEPGSVAEKLFHNIDFPRGHIAIKSFDAEVVDETGNPVPL  137

Query  462  HQTYLHHWIVGKYMIRK---------DEVVEAADKMFLVGNSGVCAE-LPQYFGLGSETR  313
            ++TYLHHWI  +Y   K         ++  E +D + ++ NSG+C + LPQYFGLGSETR
Sbjct  138  YETYLHHWIAMRYYRPKAVENSNSSSNQRAEKSDYV-VIKNSGICDDLLPQYFGLGSETR  196

Query  312  KTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKD  142
            KT + VPDPYGIEVGNP   P G EE W LN+HAIDTRG AE+K GCTECRCDLYNVT+D
Sbjct  197  KTAAVVPDPYGIEVGNPAEIPAGYEEGWTLNLHAIDTRG-AEDKLGCTECRCDLYNVTQD  255

Query  141  EDGRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            EDG  L  +Y GG+RCCYD  KCR+ +G+R  +RG ++KYTV YVDW+
Sbjct  256  EDGNALEPEYIGGMRCCYDETKCRLIEGYRSPRRGFFMKYTVKYVDWD  303



>ref|XP_006368006.1| PREDICTED: uncharacterized protein LOC102587597 [Solanum tuberosum]
Length=458

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 167/226 (74%), Gaps = 14/226 (6%)
 Frame = -3

Query  639  RIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLH  460
            R+  EN VK  T LSP F LEPG V NKF+Y IDFPKGHIA+K F+AEVVDE  N +PL+
Sbjct  27   RLRNENKVKTATFLSPNFVLEPGLVANKFYYNIDFPKGHIAIKSFDAEVVDESRNPVPLY  86

Query  459  QTYLHHWIVGKYMIRKD-EVVEAADKM-------FLVGNSGVCA-ELPQYFGLGSETRKT  307
            +TYLHHW+V +Y   K  EV +  D +        LV NSG+C  +L QYFGLGSETRKT
Sbjct  87   ETYLHHWLVVRYYQHKGLEVSKYHDDLGFEQSDYILVRNSGICGRDLFQYFGLGSETRKT  146

Query  306  NSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDED  136
               VPDPYGIEVGNP   PPG EE W+LNVHAI+TRG +E++ GCTECRCDLYNVTKDE 
Sbjct  147  VKYVPDPYGIEVGNPLEVPPGYEERWLLNVHAIETRG-SEDQMGCTECRCDLYNVTKDEY  205

Query  135  GRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             R +  +Y GGLRCC+D  +CR ++GF+G KR LYLKYT+ YVDW+
Sbjct  206  DRDIEPNYIGGLRCCHDETRCRTREGFQGPKRSLYLKYTIKYVDWH  251



>ref|XP_004252289.1| PREDICTED: uncharacterized protein LOC101252852 [Solanum lycopersicum]
 ref|XP_010314239.1| PREDICTED: uncharacterized protein LOC101252852 [Solanum lycopersicum]
Length=462

 Score =   272 bits (695),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 161/222 (73%), Gaps = 14/222 (6%)
 Frame = -3

Query  630  EENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTY  451
            +E+ +K    LSP F LEPGSV NKF+Y I FPKGHIA+K F+AEVVDE GN +PL++TY
Sbjct  26   QESPLKSAVFLSPAFVLEPGSVSNKFYYNIGFPKGHIAIKNFDAEVVDEGGNPVPLYETY  85

Query  450  LHHWIVGKYMIRKDEVVEA--------ADKMFLVGNSGVC-AELPQYFGLGSETRKTNSS  298
            LHHWIV +Y  +K   V               L  NSG+C   L QYFGLGSETRKT + 
Sbjct  86   LHHWIVVRYYQQKGVKVTNYHNNLGFHQSDFILKRNSGICDGGLSQYFGLGSETRKTITY  145

Query  297  VPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRP  127
            VPDPYGIEVGNP   PPG EE W+LNVHAIDTRG AE++ GCTECRCDLYNVTKDE  R 
Sbjct  146  VPDPYGIEVGNPVEVPPGYEEKWLLNVHAIDTRG-AEDRLGCTECRCDLYNVTKDEHDRV  204

Query  126  L-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDW  4
            +  DY GGLRCCYD  KCRVK GF+G +R LYLKYTV Y+DW
Sbjct  205  IEPDYIGGLRCCYDETKCRVKDGFQGPRRNLYLKYTVKYIDW  246



>gb|EYU21767.1| hypothetical protein MIMGU_mgv1a005580mg [Erythranthe guttata]
Length=478

 Score =   272 bits (696),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 149/241 (62%), Positives = 171/241 (71%), Gaps = 28/241 (12%)
 Frame = -3

Query  663  VCSSQRSL---RIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEV  493
            + S Q SL   RI   N  K E  LSP+F +EPGSV NK++Y +DFPKGHIA+K F AEV
Sbjct  19   LVSVQTSLSDPRIGNGNS-KSEVFLSPKFVMEPGSVSNKYYYNVDFPKGHIAIKSFNAEV  77

Query  492  VDEEGNSIPLHQTYLHHWIVGKYMIRKDEVVEAA---DKMFL------VGNSGVC-AELP  343
            VDE+GN IPLH+TYLHHWIV +Y  RKD     A   D  FL      V NSG+C A L 
Sbjct  78   VDEKGNPIPLHETYLHHWIVLRYHQRKDTADSGAHQGDLGFLQSDHIVVKNSGMCDAGLS  137

Query  342  QYFGLGSETRKTNSSVPDPYGIEVGNP----PPGLEEAWMLNVHAIDTRGTAENKRGCTE  175
            QYFGLGSETRKT++ VPDPYGIEVGNP      G EE WMLNVHAIDTRG AE+K GCTE
Sbjct  138  QYFGLGSETRKTSTDVPDPYGIEVGNPADVAADGYEERWMLNVHAIDTRG-AEDKMGCTE  196

Query  174  CRCDLYNVTKDEDGRPLGDYPGGLRCCYDGAKCRVKQGFRG----EKRGLYLKYTVTYVD  7
            CRCDLYN+T D      G+Y GGLRCC+DGAKCRV++GF G     +R LYL+YTV Y+D
Sbjct  197  CRCDLYNMTVDG-----GNYNGGLRCCHDGAKCRVEKGFEGGVETSRRSLYLRYTVEYID  251

Query  6    W  4
            W
Sbjct  252  W  252



>gb|KEH26244.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=421

 Score =   270 bits (691),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 130/222 (59%), Positives = 163/222 (73%), Gaps = 14/222 (6%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            E  +K    LSP+FEL PGSV NKF+Y IDFPKGH+A+K F+AEVVDE GNSIPLH+TYL
Sbjct  30   EEKIKSAMFLSPKFELGPGSVINKFYYDIDFPKGHVAIKSFDAEVVDEAGNSIPLHETYL  89

Query  447  HHWIVGKYMIRKDEVVEA-ADKMF------LVGNSGVCAE--LPQYFGLGSETRKTNSSV  295
            HHW+V +Y +R     E  + +M       LV N+G+C    LPQYFGLGSETR T + +
Sbjct  90   HHWVVARYHLRHVTYTENDSHRMLQNSDYVLVRNNGICQADILPQYFGLGSETRGTPTDI  149

Query  294  PDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL  124
            PDP+GIE+GNP   P G EE W+ N+HAIDTRG  E+K GCTEC+C+LYNVT DE GRPL
Sbjct  150  PDPFGIEIGNPADIPEGFEEKWLFNIHAIDTRG-VEDKLGCTECKCELYNVTVDEYGRPL  208

Query  123  G-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
              DY GG++CC+D  +C++K GF G KR LYLKY + ++DW+
Sbjct  209  SLDYKGGMKCCHDNTQCKLKVGFEGPKRSLYLKYKIKWIDWD  250



>ref|XP_006346626.1| PREDICTED: uncharacterized protein LOC102591330 [Solanum tuberosum]
Length=471

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/230 (63%), Positives = 166/230 (72%), Gaps = 22/230 (10%)
 Frame = -3

Query  630  EENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTY  451
            EE+ VK    LSP F LEPGSV NKF+Y I FPKGHIA+K  +AEVVDE GN +PL++TY
Sbjct  26   EESRVKSAVFLSPAFVLEPGSVSNKFYYNIGFPKGHIAIKNLDAEVVDEGGNPVPLYETY  85

Query  450  LHHWIVGKYMIRKD-EVVEAADKM------FLVG-NSGVC---------AELPQYFGLGS  322
            LHHWIV +Y  RK  EV +  D +      F+V  NSGVC           L QYFGLGS
Sbjct  86   LHHWIVVRYYHRKGVEVTKFHDDLGFHQSDFIVKRNSGVCDRGLPGICDGGLSQYFGLGS  145

Query  321  ETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNV  151
            ETRKT + VPDPYGIEVGNP   PPG EE W+LN+HAIDTRG AE++ GCTECRCDLYNV
Sbjct  146  ETRKTITYVPDPYGIEVGNPVEVPPGYEEKWLLNLHAIDTRG-AEDRLGCTECRCDLYNV  204

Query  150  TKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDW  4
            TKDE  R +  DY GGLRCCYD  +CRVK GF+G +R LYLKYTV Y+DW
Sbjct  205  TKDEHDRVIEPDYIGGLRCCYDETRCRVKDGFQGSRRSLYLKYTVKYIDW  254



>ref|XP_009360279.1| PREDICTED: uncharacterized protein LOC103950769 [Pyrus x bretschneideri]
 ref|XP_009360280.1| PREDICTED: uncharacterized protein LOC103950769 [Pyrus x bretschneideri]
 ref|XP_009360286.1| PREDICTED: uncharacterized protein LOC103950773 [Pyrus x bretschneideri]
 ref|XP_009360287.1| PREDICTED: uncharacterized protein LOC103950773 [Pyrus x bretschneideri]
Length=417

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/231 (61%), Positives = 167/231 (72%), Gaps = 17/231 (7%)
 Frame = -3

Query  651  QRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNS  472
              +LRI +    +    +SP+F L PGSV +K++Y IDFP+GHIA+K F AEV+DEEGN 
Sbjct  24   SHALRIVKTK-TRTSVFVSPKFVLGPGSVADKYYYDIDFPRGHIAIKSFTAEVIDEEGNP  82

Query  471  IPLHQTYLHHWIVGKYMIR---------KDEVVEAADKMFLVGNSGVCAE-LPQYFGLGS  322
            IPLH+TYLHHW+V  Y  R         + E ++ +D +F V NSGVC   L QYFGLGS
Sbjct  83   IPLHETYLHHWVVEGYYGRVGSVEPEGTRAEELQRSDFIF-VRNSGVCQRTLGQYFGLGS  141

Query  321  ETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNV  151
            ETRKT++ VPDP+GIEVGNP   P G EE WMLNVHAIDTRG AEN  GCTECRCDLYNV
Sbjct  142  ETRKTDTHVPDPFGIEVGNPAVTPAGYEERWMLNVHAIDTRG-AENGLGCTECRCDLYNV  200

Query  150  TKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            + D  GRPL   Y GGL CCYDG +CRVKQGF G +R LYL+YTV +VDW+
Sbjct  201  STDSRGRPLRPGYVGGLFCCYDGVQCRVKQGFNGVRRNLYLRYTVKWVDWS  251



>gb|KEH26246.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=432

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 161/223 (72%), Gaps = 15/223 (7%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            E  +K    LSP+FEL PGSV NKF+  IDFPKGH+A+K F+AEVVDE GNSIPLH+TYL
Sbjct  31   EERIKSAVFLSPKFELRPGSVINKFYDDIDFPKGHVAIKSFDAEVVDEAGNSIPLHETYL  90

Query  447  HHWIVGKYMIRKDEVVEAAD--KMF------LVGNSGVCAE--LPQYFGLGSETRKTNSS  298
            HHW+VG+Y           D  KM       LV NSG+C    LPQYFGLGSETR T + 
Sbjct  91   HHWVVGRYHQSNHATHTENDSHKMLQKAYPGLVRNSGICQGNILPQYFGLGSETRGTPTD  150

Query  297  VPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRP  127
            +PDP+G+E+GNP   P G EE W+ N+HAIDTRG  E+K GCTEC+C+LYNVT DE GRP
Sbjct  151  IPDPFGMEMGNPTEIPEGFEEKWLFNIHAIDTRG-VEDKLGCTECKCELYNVTVDEYGRP  209

Query  126  L-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            L  DY GGL CCYD  +C++K+GF+G KR LYLKY + +VDW+
Sbjct  210  LMSDYKGGLSCCYDNTQCKLKEGFKGPKRSLYLKYKIKWVDWD  252



>ref|XP_009596902.1| PREDICTED: uncharacterized protein LOC104092914 [Nicotiana tomentosiformis]
 ref|XP_009596903.1| PREDICTED: uncharacterized protein LOC104092914 [Nicotiana tomentosiformis]
 ref|XP_009596904.1| PREDICTED: uncharacterized protein LOC104092914 [Nicotiana tomentosiformis]
Length=457

 Score =   269 bits (687),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 159/225 (71%), Gaps = 14/225 (6%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            +  EN VK     SP+F LE G VCNKF+Y I FPK HIA+K F AEVVDE  N +PLH+
Sbjct  25   LRNENKVKTSVFRSPKFVLETGLVCNKFYYNIAFPKSHIAIKSFNAEVVDEAWNPVPLHE  84

Query  456  TYLHHWIVGKYMIRKDEVVE--------AADKMFLVGNSGVCA-ELPQYFGLGSETRKTN  304
            TYLHHW+V +Y  RK   V               +  NSG+C  +L QYFGLGSETRKT 
Sbjct  85   TYLHHWLVVRYYQRKGVKVSKYHGDLRFQNSDFIIASNSGMCERDLYQYFGLGSETRKTA  144

Query  303  SSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDG  133
            + VPDPYGIEVGNP   PPG EE W+LNVHAIDTRG+ E++ GCTECRCDLYNVTKDE  
Sbjct  145  TYVPDPYGIEVGNPGEVPPGYEERWLLNVHAIDTRGS-EDRLGCTECRCDLYNVTKDEYN  203

Query  132  RPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            R +G DY GGLRCCYD  +CRV +GF G +R LYLKYT+ YVDW+
Sbjct  204  RDIGPDYIGGLRCCYDETRCRVGKGFEGLERSLYLKYTIKYVDWD  248



>ref|XP_004242193.1| PREDICTED: uncharacterized protein LOC101264834 [Solanum lycopersicum]
Length=465

 Score =   269 bits (687),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 137/226 (61%), Positives = 167/226 (74%), Gaps = 14/226 (6%)
 Frame = -3

Query  639  RIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLH  460
            R+  EN V+  T LSP+F LEPG V NKF+  IDFP GHIA+K F+AEVVDE  N +PL+
Sbjct  27   RLRNENKVRTATFLSPKFVLEPGLVANKFYNNIDFPNGHIAIKSFDAEVVDESRNPVPLY  86

Query  459  QTYLHHWIVGKYMIRKD-EVVEAADKM-------FLVGNSGVC-AELPQYFGLGSETRKT  307
            +TYLHHW+V +Y  +K  EV +  D +        LV NSG+C  +L QYFGLGSETRKT
Sbjct  87   ETYLHHWLVVRYYQQKGMEVSKYHDNLGFEQSDYILVRNSGICDRDLFQYFGLGSETRKT  146

Query  306  NSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDED  136
               VPDPYGIEVGNP   PPG EE W+LNVHAI+TRG+ E++ GCTECRCDLYNVTKDE 
Sbjct  147  VQYVPDPYGIEVGNPLEVPPGYEERWLLNVHAIETRGS-EDRMGCTECRCDLYNVTKDEY  205

Query  135  GRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             R +  +Y GGLRCC+D  +CR ++GF+G KR LYLKYT+ YVDW+
Sbjct  206  DRDIEPNYIGGLRCCHDETRCRTREGFQGAKRSLYLKYTIKYVDWH  251



>gb|AAU14999.2| MtN19-like protein [Pisum sativum]
Length=435

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 163/226 (72%), Gaps = 15/226 (7%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            +  EN +K    LSP+FEL PGSV N+++YGIDFPKGHIA+K F AEVVDE GNSIPLH+
Sbjct  28   LKTENKIKSAVFLSPKFELGPGSVINRYYYGIDFPKGHIALKSFNAEVVDEAGNSIPLHE  87

Query  456  TYLHHWIVGKYMIRKDEVVEAAD--------KMFLVGNSGVCAE--LPQYFGLGSETRKT  307
            TYLHHW+V +Y   K       D           +V NSG+C E  L QYFGLGSETR T
Sbjct  88   TYLHHWVVARYHQSKHVTHTENDTHRMLHNSNHVMVRNSGICQENALGQYFGLGSETRGT  147

Query  306  NSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDED  136
             + VPDP+GIEVGNP   P G EE W++N+HAIDTRG AE+K GCTEC+C+LYNVT D+ 
Sbjct  148  ETRVPDPFGIEVGNPEVVPEGFEEKWVVNIHAIDTRG-AEDKMGCTECKCELYNVTVDKY  206

Query  135  GRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            GR +  DY GGL CC D A+C++K+GF G KR LYL+YTV +VDW+
Sbjct  207  GRTIRPDYVGGLLCCSDYAQCKLKEGFEGPKRSLYLRYTVKWVDWD  252



>ref|XP_007147472.1| hypothetical protein PHAVU_006G127400g [Phaseolus vulgaris]
 gb|ESW19466.1| hypothetical protein PHAVU_006G127400g [Phaseolus vulgaris]
Length=404

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 168/228 (74%), Gaps = 9/228 (4%)
 Frame = -3

Query  660  CSSQRSLRIDE-ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE  484
            C++  S  + + EN +K    LSP+FEL PGSV NKF+Y +DFP+GHIA+K F AEVVDE
Sbjct  20   CTTYSSTAMGKPENNIKTSVFLSPKFELGPGSVANKFYYDVDFPRGHIALKSFNAEVVDE  79

Query  483  EGNSIPLHQTYLHHWIVGKYMIRKDEVVEAADK-MFLVGNSGVCAE--LPQYFGLGSETR  313
             G S+PLH+TYLHHWIV KY   K+         + ++ NSG+C E  L QYFGLGSETR
Sbjct  80   AGKSVPLHETYLHHWIVIKYHQPKNVSHNNNQTGIIVLRNSGLCQENVLGQYFGLGSETR  139

Query  312  KTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKD  142
            +T + +PDP+GIE+GNP   P G EE W +NVHAIDTRG  E++ GC ECRCDLYNVTKD
Sbjct  140  RTATDIPDPFGIEIGNPSEIPDGYEEKWFINVHAIDTRG-VEDRVGCFECRCDLYNVTKD  198

Query  141  EDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            EDG PL   Y GGL CC D ++CR+++GF+G+KR LY++YTV +++W+
Sbjct  199  EDGNPLSPSYKGGLDCCPDNSQCRLEKGFKGQKRSLYMRYTVKWINWD  246



>ref|XP_006346659.1| PREDICTED: uncharacterized protein LOC102603832 [Solanum tuberosum]
Length=468

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 164/226 (73%), Gaps = 19/226 (8%)
 Frame = -3

Query  630  EENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTY  451
            +ENGVKV   LSP F LEPGSV NKF+Y I FPKGHIA+K F+AEVVDE GNS+PL++TY
Sbjct  31   QENGVKVGVFLSPAFVLEPGSVSNKFYYNIGFPKGHIAIKSFDAEVVDEAGNSVPLYETY  90

Query  450  LHHWIVGKYMIRKDEVVEAADKMFLVG----------NSGVCAELPQ--YFGLGSETRKT  307
            LHHW+V +Y  RK   VE A   + +G          NSG+C  +    YFG+G ETRKT
Sbjct  91   LHHWVVSRYFNRKG--VEVAKYHYDLGYDQSDSIIKSNSGICGGVLNTVYFGVGPETRKT  148

Query  306  NSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDED  136
               +PDPY IEVGNP   PP  EE  MLN+HAIDTRG AE++ GCTECRCDLYNVTKDE+
Sbjct  149  IIYIPDPYRIEVGNPVEVPPRYEEKRMLNLHAIDTRG-AEDRLGCTECRCDLYNVTKDEN  207

Query  135  GRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             R +  DY GG RCCY+G +C+VK GF+G KR LYLKYTV Y+DW+
Sbjct  208  NRDIEPDYIGGSRCCYNGTRCKVKDGFQGSKRNLYLKYTVKYIDWD  253



>gb|KHG10977.1| G2/mitotic-specific cyclin-B [Gossypium arboreum]
Length=465

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 163/221 (74%), Gaps = 13/221 (6%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            EN ++    +SP+F L PGSV N+F+Y ++FPKGHIAVK F+AEV+DE GN IPLH+TYL
Sbjct  30   ENKIQTAVFVSPKFVLGPGSVENRFYYNVNFPKGHIAVKSFDAEVIDEAGNPIPLHETYL  89

Query  447  HHWIVGKYMIRKDEVVEAADKM-------FLVG-NSGVCAELPQYFGLGSETRKTNSSVP  292
            HHW+V +Y +RK   +   D         ++ G NSG+C  L Q+FGLGSETRKT++ VP
Sbjct  90   HHWVVIRYYVRKGVEISEFDNPRKFNESDYISGRNSGICQNLGQFFGLGSETRKTSTHVP  149

Query  291  DPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-  124
            +PYGIEVGNP   P G EE WMLNVHAIDTRG AE+K GCTECRCDLYN+T DE GRPL 
Sbjct  150  NPYGIEVGNPAEIPSGFEEQWMLNVHAIDTRG-AEDKLGCTECRCDLYNITVDEYGRPLR  208

Query  123  GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             DY GGL CCYD  +C+VK GF   +R LYL+YTV +VD +
Sbjct  209  PDYKGGLLCCYDHTQCKVKHGFEAVRRTLYLRYTVKWVDMD  249



>ref|XP_008392684.1| PREDICTED: uncharacterized protein LOC103454870 [Malus domestica]
Length=356

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 163/232 (70%), Gaps = 18/232 (8%)
 Frame = -3

Query  651  QRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNS  472
              +LRI +    +    +SP+F LEPGSV +K +Y ++FP+GHIA+K F  EV+DEEGN 
Sbjct  24   SHALRIVKPK-TRTSVFVSPKFVLEPGSVADKXYYDVNFPRGHIAIKSFNGEVIDEEGNP  82

Query  471  IPLHQTYLHHWIVGKYMIRKDEVVEAADKMF---------LVGNSGVCA--ELPQYFGLG  325
            IPLH+TYLHHW+VGKY  R    VE  D  F          V NSGVC      QYFG+G
Sbjct  83   IPLHETYLHHWVVGKYYGRIG-FVEPEDARFDEFQRSDFAFVRNSGVCQGDTNGQYFGIG  141

Query  324  SETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYN  154
            SETR+T++ VPDP+GIEVGNP   P G EE W+LNVHAIDTRG AEN  GCTECRCDLYN
Sbjct  142  SETRRTDTHVPDPFGIEVGNPAVXPAGYEERWLLNVHAIDTRG-AENGLGCTECRCDLYN  200

Query  153  VTKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            V+ D  G+PL   Y GGLRCCYDG  CRVKQGF G KR LYL+YTV +VDW+
Sbjct  201  VSTDSRGQPLRPGYKGGLRCCYDGTXCRVKQGFNGVKRNLYLRYTVKWVDWS  252



>ref|XP_011073280.1| PREDICTED: uncharacterized protein LOC105158279 [Sesamum indicum]
Length=457

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 163/226 (72%), Gaps = 8/226 (4%)
 Frame = -3

Query  663  VCSSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE  484
            V SSQ   R   EN VK    LSP+F  EPG V +KF+Y I+FP+GHIA+K F  EV+DE
Sbjct  21   VQSSQAQQR--SENVVKTNVFLSPKFVSEPGLVSDKFYYNINFPRGHIALKSFNGEVIDE  78

Query  483  EGNSIPLHQTYLHHWIVGKYMIRKD-EVVEAADKMFLVGNSGVCAELPQYFGLGSETRKT  307
            +GN +PLH+TYLHHW V +Y  RK  +  +  +    + NSG+C  L QYFGLGSETR+T
Sbjct  79   KGNPVPLHETYLHHWAVLRYYQRKGIDTPKHHEDHIAIKNSGLCDSLSQYFGLGSETRRT  138

Query  306  NSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDED  136
             + VPDPYGIEVGNP   P G EE W+LNVHAIDTRG AE+K  CTECRCDLYN+T D  
Sbjct  139  ATYVPDPYGIEVGNPADIPDGYEERWLLNVHAIDTRG-AEDKVSCTECRCDLYNITVDAH  197

Query  135  GRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            GR L  +Y GG +CCYD  +CRVK+GF+G KR L+L+YTV YVDW+
Sbjct  198  GRALPVNYTGGWKCCYDNRRCRVKEGFKGVKRSLFLRYTVKYVDWD  243



>gb|KEH31355.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=433

 Score =   265 bits (678),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 162/226 (72%), Gaps = 15/226 (7%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            +  E+ +K    LSP+FEL PGSV N+++Y IDFP+GHIA+K F AEVVDE GN IPLH+
Sbjct  28   VKTEDKIKSAVFLSPKFELGPGSVVNRYYYDIDFPRGHIAIKDFHAEVVDESGNPIPLHE  87

Query  456  TYLHHWIVGKYMIRKDEVVEAADKMF--------LVGNSGVCAE--LPQYFGLGSETRKT  307
            TYLHHW+VG+Y  RK       D           LV NSG+C    L QYFGLGSETR T
Sbjct  88   TYLHHWVVGRYHQRKHVTHTENDSHMMLQNSDHVLVRNSGICQGNYLGQYFGLGSETRGT  147

Query  306  NSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDED  136
             + +PDP+GIEVGNP   P G +E WM+NVHAIDTRG AE+K GCTEC+C+LYNVT DE 
Sbjct  148  LTDIPDPFGIEVGNPAEVPEGFDEKWMVNVHAIDTRG-AEDKLGCTECKCELYNVTVDEY  206

Query  135  GRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            GR +  DY GG+ CCYD  +C++K+GF G KR LYL+YTV +VDW+
Sbjct  207  GRSVRPDYKGGMLCCYDHTRCKLKEGFEGPKRNLYLRYTVKWVDWD  252



>ref|XP_008375426.1| PREDICTED: uncharacterized protein LOC103438663 [Malus domestica]
Length=410

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/230 (60%), Positives = 161/230 (70%), Gaps = 15/230 (7%)
 Frame = -3

Query  651  QRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNS  472
              +LRI +    +    +SP+F L PGSV +K++Y IDFPKGHIA+K F AEV+DEEGN 
Sbjct  24   SHALRIVKTK-TRTSVFVSPKFVLGPGSVADKYYYDIDFPKGHIAIKSFTAEVIDEEGNP  82

Query  471  IPLHQTYLHHWIVGKYMIRKDEVVEAADKM--------FLVGNSGVCAE-LPQYFGLGSE  319
             PLH+TYLHHW+V  Y  R   V     ++         LV NSGVC   L QYFGLGSE
Sbjct  83   NPLHETYLHHWVVEGYYGRVGSVEPEGTRVEELQRSDFILVRNSGVCQRTLGQYFGLGSE  142

Query  318  TRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVT  148
            TRKT++ VPDP+GIEVGNP   P G EE WMLNVHAIDTRG AEN  GC ECRCDLYNV+
Sbjct  143  TRKTDTHVPDPFGIEVGNPAVIPAGYEERWMLNVHAIDTRG-AENGLGCIECRCDLYNVS  201

Query  147  KDEDGRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             D  G+PL   Y GGL CCYDG +CRVKQGF G KR LYL+YTV +VDW+
Sbjct  202  TDSRGQPLRPGYVGGLFCCYDGVQCRVKQGFNGVKRNLYLRYTVKWVDWS  251



>ref|XP_009373663.1| PREDICTED: uncharacterized protein LOC103962645 [Pyrus x bretschneideri]
Length=418

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 164/232 (71%), Gaps = 18/232 (8%)
 Frame = -3

Query  651  QRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNS  472
              +LRI +    +    +SP+F LEPGSV +K++Y ++FP+GHIA+K F  EV+DEEGN 
Sbjct  24   SHALRIVKPK-TRTSVFVSPKFVLEPGSVADKYYYDVNFPRGHIAIKSFNGEVIDEEGNP  82

Query  471  IPLHQTYLHHWIVGKYMIRKDEVVEAADKMF---------LVGNSGVCAELP--QYFGLG  325
            IPLH+TYLHHW+VG+Y  R    VE  +  F          V NSGVC      QYFG+G
Sbjct  83   IPLHETYLHHWVVGRYYGRTG-FVEPEEARFDDFQRSDFAFVRNSGVCQGYTNGQYFGIG  141

Query  324  SETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYN  154
            SETR+T++ VPDP+GIEVGNP   P G EE W+LNVHAIDTRG  EN  GCTECRCDLYN
Sbjct  142  SETRRTDTHVPDPFGIEVGNPAVIPAGYEERWLLNVHAIDTRG-VENGLGCTECRCDLYN  200

Query  153  VTKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            V+ D  G+PL   Y GGLRCCYDG +CRVKQGF G KR LYL+YTV +VDW+
Sbjct  201  VSTDSRGQPLRPGYKGGLRCCYDGTQCRVKQGFNGVKRNLYLRYTVKWVDWS  252



>gb|KEH31349.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=435

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 162/226 (72%), Gaps = 15/226 (7%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            +  E+ +K    LSP+FEL PGSV NK +Y IDFP+GHIA+K F AEVVD+ GN IPLH+
Sbjct  28   VKAEDKIKSAVFLSPKFELGPGSVINKHYYDIDFPRGHIALKSFNAEVVDDAGNPIPLHE  87

Query  456  TYLHHWIVGKYMIRK--------DEVVEAADKMFLVGNSGVCA--ELPQYFGLGSETRKT  307
            TYLHHW+V ++  RK          ++       LV NSG+C    + QYFGLGSETR T
Sbjct  88   TYLHHWLVQRHYQRKYVTHTEDVSHMMLQNSDHVLVRNSGICQGNAISQYFGLGSETRGT  147

Query  306  NSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDED  136
             + +PDP+GIE+GNP   P G E+ W+LNVHAIDTRG AE+K GCTEC+CDLYNVT DE 
Sbjct  148  TTDIPDPFGIEIGNPEEIPQGFEDKWLLNVHAIDTRG-AEDKLGCTECKCDLYNVTVDEY  206

Query  135  GRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            GR +G DY GGL CCYD  +C++K+GF G KR LYL+YTV +VDW+
Sbjct  207  GRSIGPDYKGGLLCCYDHTQCKLKEGFEGPKRSLYLRYTVKWVDWD  252



>ref|XP_008246210.1| PREDICTED: uncharacterized protein LOC103344390, partial [Prunus 
mume]
Length=266

 Score =   259 bits (662),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 161/231 (70%), Gaps = 21/231 (9%)
 Frame = -3

Query  648  RSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSI  469
            R  +    +GV V    SP+F L PGSV +K++Y I FPKGHI +K F AEV+DEEGN I
Sbjct  28   RVTKTKTRSGVYV----SPKFVLAPGSVADKYYYDIPFPKGHIGLKSFNAEVIDEEGNPI  83

Query  468  PLHQTYLHHWIVGKYMIRKDEV---------VEAADKMFLVGNSGVCAE--LPQYFGLGS  322
            PLH+TYLHHW+V +Y  R   V         ++ +D  F V N+G+C    L QYFGLGS
Sbjct  84   PLHETYLHHWVVARYYARTGFVEPEETGFQELKKSDFTF-VRNTGMCQNNVLGQYFGLGS  142

Query  321  ETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNV  151
            ETR T++ VPDPYGIE GNP   P G EE WMLNVHAIDTRG AEN  GCTECRCDLYNV
Sbjct  143  ETRNTSTHVPDPYGIEAGNPAEVPAGYEERWMLNVHAIDTRG-AENGLGCTECRCDLYNV  201

Query  150  TKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            + D  G+PL   Y GGL CCYDG +CRVKQGF G KR LYL+YTV +VDW+
Sbjct  202  STDSRGQPLKPGYKGGLYCCYDGVQCRVKQGFNGAKRSLYLRYTVKWVDWS  252



>ref|XP_010255828.1| PREDICTED: uncharacterized protein LOC104596392 isoform X3 [Nelumbo 
nucifera]
Length=465

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/222 (62%), Positives = 157/222 (71%), Gaps = 15/222 (7%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            EN VK    LSP F L PG+V NK++Y IDFP+GHIA+K F AEVVDE G  +PLH+TYL
Sbjct  31   ENKVKSSVFLSPEFVLGPGTVANKYYYNIDFPRGHIALKEFNAEVVDEAGIPVPLHETYL  90

Query  447  HHWIVGKYMIRKDEVVEA--------ADKMFLVGNSGVCA--ELPQYFGLGSETRKTNSS  298
            HHWIV +Y + KD               K F+V NSGVC    L QYFGLGSETRKT + 
Sbjct  91   HHWIVVRYYVPKDAKTSKILSDDELHQSKGFIVRNSGVCQGNSLGQYFGLGSETRKTATY  150

Query  297  VPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRP  127
            VPDPYGIEVGNP   P G EE W+LNVHAIDTR   E++ GCTECRCDLYNVT+DE GRP
Sbjct  151  VPDPYGIEVGNPAQVPDGYEERWLLNVHAIDTR-NVEDRLGCTECRCDLYNVTEDELGRP  209

Query  126  L-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDW  4
            L  DY GGL CCYD  KCRV++GF    R LYL+YTV ++DW
Sbjct  210  LRPDYTGGLYCCYDQTKCRVREGFDDIHRSLYLRYTVKWIDW  251



>ref|XP_011016694.1| PREDICTED: uncharacterized protein LOC105120200 [Populus euphratica]
Length=467

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 159/220 (72%), Gaps = 13/220 (6%)
 Frame = -3

Query  624  NGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLH  445
            N +K  T LSP F L PGSV N+F+Y IDFP+GHI +K   AEV+DE G  IPLH+TYLH
Sbjct  34   NKIKSVTFLSPEFVLGPGSVENRFYYNIDFPRGHIGLKSLRAEVIDEAGKPIPLHETYLH  93

Query  444  HWIVGKYMIRKDEVVEAADKMF------LVGNSGVC--AELPQYFGLGSETRKTNSSVPD  289
            HW+V KY  R+D V    D+ F      L  NSG+C    L QYFGLGSETRKT++ +PD
Sbjct  94   HWVVAKYYQRQDVVENNGDQKFQQADYILGTNSGICQGTILRQYFGLGSETRKTDTHIPD  153

Query  288  PYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-  121
            PY IE+GNP   P G EE WMLNVHAIDTRG A +  GCTECRCDLYNVT DE G+PL  
Sbjct  154  PYAIEIGNPAEIPEGYEEKWMLNVHAIDTRG-AVDTLGCTECRCDLYNVTVDEYGQPLSP  212

Query  120  DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            DY GGL+CCYD  +C+V+QG+ G +R LYL+Y+V +VDW+
Sbjct  213  DYIGGLKCCYDQTRCKVQQGYGGARRSLYLRYSVEWVDWD  252



>ref|XP_007038175.1| MtN19-like protein, putative isoform 2 [Theobroma cacao]
 gb|EOY22676.1| MtN19-like protein, putative isoform 2 [Theobroma cacao]
Length=544

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 163/222 (73%), Gaps = 15/222 (7%)
 Frame = -3

Query  630  EENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTY  451
            +EN +K    LSP+FEL PGSV N+++Y +DFPKGHIA+K F  EV+DE GN +PLH+TY
Sbjct  106  KENKIKTAVFLSPKFELGPGSVENRYYYDMDFPKGHIALKSFNGEVIDEAGNPVPLHETY  165

Query  450  LHHWIVGKYMIRK-------DEVVEAADKMFLVG-NSGVC--AELPQYFGLGSETRKTNS  301
            LHHW+V +Y  RK       +E  +     ++ G NSG+C    L QYFGLGSETR+T +
Sbjct  166  LHHWVVARYYARKGVDVSKFNESKKLHRSDYISGRNSGICQGGVLGQYFGLGSETRRTAT  225

Query  300  SVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGR  130
             VPDPYGIEVGNP   P G EE W+LN+HAIDTRG  E++ GCTECRCDLYNVT+DE GR
Sbjct  226  HVPDPYGIEVGNPSEIPSGFEEIWLLNIHAIDTRG-VEDRLGCTECRCDLYNVTEDEYGR  284

Query  129  PL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVD  7
            PL  DY GGL CCYD  +CR+KQGF G +R LYL+YTV +VD
Sbjct  285  PLRPDYKGGLSCCYDRTQCRLKQGFEGVRRTLYLRYTVKWVD  326



>ref|XP_006844650.1| hypothetical protein AMTR_s00016p00236100 [Amborella trichopoda]
 gb|ERN06325.1| hypothetical protein AMTR_s00016p00236100 [Amborella trichopoda]
Length=465

 Score =   265 bits (676),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 139/227 (61%), Positives = 165/227 (73%), Gaps = 14/227 (6%)
 Frame = -3

Query  645  SLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIP  466
            SL+  E N +K    LSP+F L  G V NKF+  +DFPKGHIA+K F+AEV+DE GNSIP
Sbjct  23   SLKTQEPN-LKTSVFLSPKFILGHGHVQNKFYLNVDFPKGHIALKEFDAEVIDEAGNSIP  81

Query  465  LHQTYLHHWIVGKYM-----IRKDEVVEAADKMFL-VGNSGVCAE-LPQYFGLGSETRKT  307
            LH+TYLHHW+V +Y      + KD   E   K F+ V N GVC E L QYFGLGSETR T
Sbjct  82   LHETYLHHWVVMRYYGLLKNVSKDPESETELKSFIWVRNGGVCQETLGQYFGLGSETRHT  141

Query  306  NSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDED  136
             +S+PDPYGIEVGNP   P G EE W+LN+HAIDTRG  E++ GCTECRCDLYNVTKD  
Sbjct  142  RTSIPDPYGIEVGNPTLIPEGYEERWLLNIHAIDTRG-VEDRAGCTECRCDLYNVTKDGR  200

Query  135  GRPLGD-YPGGLRCCYDGAKCRVKQGFRG-EKRGLYLKYTVTYVDWN  1
            G+P+ D Y GGLRCCY G KC++K GF G   RGLYLKYTV +V+W+
Sbjct  201  GKPIRDNYKGGLRCCYHGTKCKLKDGFNGLGARGLYLKYTVKWVEWD  247



>ref|XP_006485063.1| PREDICTED: uncharacterized protein LOC102618549 [Citrus sinensis]
Length=462

 Score =   264 bits (675),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 160/220 (73%), Gaps = 15/220 (7%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            VK +  LSP+F L PGSV NKF+YGIDFP+GHIA+K F+AEV+DE GN +PLH+TYLHHW
Sbjct  29   VKSKVFLSPKFVLGPGSVENKFYYGIDFPRGHIALKSFDAEVIDEAGNPVPLHETYLHHW  88

Query  438  IVGKYMIRKD-EVVEAADKMFL-------VGNSGVCAE--LPQYFGLGSETRKTNSSVPD  289
            +V KY  RKD EV+E      L         N G+C    L Q+FGLGSETR T + +PD
Sbjct  89   LVEKYYGRKDAEVLEYNGNRLLHESDYISARNDGICQRNCLGQFFGLGSETRGTATHIPD  148

Query  288  PYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-G  121
            PYGIE+GNP   P G EE W LNVHAIDTRG  E++ GCTEC+CDLYNVT DE G+PL  
Sbjct  149  PYGIEIGNPATIPAGYEERWFLNVHAIDTRG-VEDRLGCTECKCDLYNVTVDEYGQPLRP  207

Query  120  DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            +Y GG  CCYDG +CRVK GF G +R LYL+YTV +VDW+
Sbjct  208  NYRGGFACCYDGTQCRVKNGFEGARRSLYLRYTVKWVDWD  247



>ref|XP_004300379.1| PREDICTED: uncharacterized protein LOC101300825 [Fragaria vesca 
subsp. vesca]
Length=420

 Score =   263 bits (672),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 164/225 (73%), Gaps = 19/225 (8%)
 Frame = -3

Query  624  NGVKVET--LLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTY  451
            N VK  T   LSP+  LEPGSV +K+FY I+FPKGHIA+K F AEV+DEEGN IPLH+TY
Sbjct  30   NKVKTRTNVYLSPKLVLEPGSVADKYFYNINFPKGHIAIKYFNAEVIDEEGNPIPLHETY  89

Query  450  LHHWIVGKYMIRKDEV---------VEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTN  304
            LHHW++ +Y  R   +         +E +D   LV NSG+C    L QY+GLGSETRKT+
Sbjct  90   LHHWVLARYYARTSYLEPEQIGFDHIENSD-FQLVRNSGLCQNNVLGQYYGLGSETRKTD  148

Query  303  SSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDG  133
            + VPDP+GIE+GNP   P G EE WMLNVHAIDTRG A ++ GCTECRCDLYNVTKD  G
Sbjct  149  THVPDPFGIEIGNPAEIPAGYEERWMLNVHAIDTRG-AVDRLGCTECRCDLYNVTKDGRG  207

Query  132  RPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            +PL   Y GGL CCYDG +C VKQG+ G KR LYL+YTV +VDW+
Sbjct  208  QPLRPGYTGGLHCCYDGTQCSVKQGYNGVKRSLYLRYTVKWVDWS  252



>ref|XP_010255827.1| PREDICTED: uncharacterized protein LOC104596392 isoform X2 [Nelumbo 
nucifera]
Length=543

 Score =   266 bits (681),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/222 (62%), Positives = 157/222 (71%), Gaps = 15/222 (7%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            EN VK    LSP F L PG+V NK++Y IDFP+GHIA+K F AEVVDE G  +PLH+TYL
Sbjct  109  ENKVKSSVFLSPEFVLGPGTVANKYYYNIDFPRGHIALKEFNAEVVDEAGIPVPLHETYL  168

Query  447  HHWIVGKYMIRKDEVVEA--------ADKMFLVGNSGVCA--ELPQYFGLGSETRKTNSS  298
            HHWIV +Y + KD               K F+V NSGVC    L QYFGLGSETRKT + 
Sbjct  169  HHWIVVRYYVPKDAKTSKILSDDELHQSKGFIVRNSGVCQGNSLGQYFGLGSETRKTATY  228

Query  297  VPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRP  127
            VPDPYGIEVGNP   P G EE W+LNVHAIDTR   E++ GCTECRCDLYNVT+DE GRP
Sbjct  229  VPDPYGIEVGNPAQVPDGYEERWLLNVHAIDTR-NVEDRLGCTECRCDLYNVTEDELGRP  287

Query  126  L-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDW  4
            L  DY GGL CCYD  KCRV++GF    R LYL+YTV ++DW
Sbjct  288  LRPDYTGGLYCCYDQTKCRVREGFDDIHRSLYLRYTVKWIDW  329



>ref|XP_010255826.1| PREDICTED: uncharacterized protein LOC104596392 isoform X1 [Nelumbo 
nucifera]
Length=574

 Score =   267 bits (682),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 137/222 (62%), Positives = 157/222 (71%), Gaps = 15/222 (7%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            EN VK    LSP F L PG+V NK++Y IDFP+GHIA+K F AEVVDE G  +PLH+TYL
Sbjct  140  ENKVKSSVFLSPEFVLGPGTVANKYYYNIDFPRGHIALKEFNAEVVDEAGIPVPLHETYL  199

Query  447  HHWIVGKYMIRKDEVVEA--------ADKMFLVGNSGVCA--ELPQYFGLGSETRKTNSS  298
            HHWIV +Y + KD               K F+V NSGVC    L QYFGLGSETRKT + 
Sbjct  200  HHWIVVRYYVPKDAKTSKILSDDELHQSKGFIVRNSGVCQGNSLGQYFGLGSETRKTATY  259

Query  297  VPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRP  127
            VPDPYGIEVGNP   P G EE W+LNVHAIDTR   E++ GCTECRCDLYNVT+DE GRP
Sbjct  260  VPDPYGIEVGNPAQVPDGYEERWLLNVHAIDTR-NVEDRLGCTECRCDLYNVTEDELGRP  318

Query  126  L-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDW  4
            L  DY GGL CCYD  KCRV++GF    R LYL+YTV ++DW
Sbjct  319  LRPDYTGGLYCCYDQTKCRVREGFDDIHRSLYLRYTVKWIDW  360



>ref|XP_006376935.1| hypothetical protein POPTR_0012s11210g [Populus trichocarpa]
 gb|ERP54732.1| hypothetical protein POPTR_0012s11210g [Populus trichocarpa]
Length=467

 Score =   264 bits (674),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 157/220 (71%), Gaps = 13/220 (6%)
 Frame = -3

Query  624  NGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLH  445
            N +K  T LSP F L PGSV N+F+Y IDFP+GHI +K   AEV+DE G  IPLH+TYLH
Sbjct  34   NKIKSATFLSPEFVLGPGSVENRFYYNIDFPRGHIGLKSLGAEVIDEAGKPIPLHETYLH  93

Query  444  HWIVGKYMIRKDEVVEAADKMFLVG------NSGVC--AELPQYFGLGSETRKTNSSVPD  289
            HW+V KY  R+D V    D+ F         NSG+C    L QYFGLGSETRKT++ +PD
Sbjct  94   HWVVAKYYQRQDVVENNGDQKFQQADYIFGTNSGICQGTVLRQYFGLGSETRKTDTHIPD  153

Query  288  PYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-  121
            PY IE+GNP   P G EE WMLNVHAIDTRG A +  GCTECRCDLYNVT DE G+PL  
Sbjct  154  PYAIEIGNPAEIPEGYEEKWMLNVHAIDTRG-AVDTWGCTECRCDLYNVTVDEYGQPLSP  212

Query  120  DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            DY GGL CCYD  +C+V+QG+ G +R LYL+YTV +VDW+
Sbjct  213  DYIGGLNCCYDQTRCKVQQGYGGARRSLYLRYTVEWVDWD  252



>ref|XP_010909090.1| PREDICTED: uncharacterized protein LOC105035275, partial [Elaeis 
guineensis]
Length=337

 Score =   259 bits (663),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 169/231 (73%), Gaps = 15/231 (6%)
 Frame = -3

Query  654  SQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGN  475
            + ++L+ID+ + +K     SP F L+PGSV NKF++ + FPKGHIA+K F AEVVDE G 
Sbjct  22   ASQALKIDDHS-LKTAIFHSPPFILQPGSVANKFYFDVPFPKGHIALKSFHAEVVDENGI  80

Query  474  SIPLHQTYLHHWIVGKYMIRKDEV----VEAAD----KMFLVGNSGVC-AELPQYFGLGS  322
            S+PLH+TYLHHW+V +Y   ++      V A+D    K     N+G+C   L QYFGLGS
Sbjct  81   SVPLHETYLHHWVVERYYRAREHKIPGDVGASDLNLKKFIWARNAGICQGTLGQYFGLGS  140

Query  321  ETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNV  151
            ETR+T++ VPDPYGIEVGNP   P G EE W+LNVHAIDTRG  E++ GCTECRC+LYNV
Sbjct  141  ETRRTSTWVPDPYGIEVGNPKDIPEGYEEMWLLNVHAIDTRGV-EDRLGCTECRCNLYNV  199

Query  150  TKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            T+DE GRPL  DY GGL CCYD  +CRV++GF G  R LYLKYTVT+VDW+
Sbjct  200  TEDEHGRPLRKDYTGGLYCCYDETQCRVREGFGGAIRKLYLKYTVTWVDWH  250



>ref|XP_007038174.1| MtN19-like protein, putative isoform 1 [Theobroma cacao]
 gb|EOY22675.1| MtN19-like protein, putative isoform 1 [Theobroma cacao]
Length=570

 Score =   266 bits (681),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 163/222 (73%), Gaps = 15/222 (7%)
 Frame = -3

Query  630  EENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTY  451
            +EN +K    LSP+FEL PGSV N+++Y +DFPKGHIA+K F  EV+DE GN +PLH+TY
Sbjct  132  KENKIKTAVFLSPKFELGPGSVENRYYYDMDFPKGHIALKSFNGEVIDEAGNPVPLHETY  191

Query  450  LHHWIVGKYMIRK-------DEVVEAADKMFLVG-NSGVC--AELPQYFGLGSETRKTNS  301
            LHHW+V +Y  RK       +E  +     ++ G NSG+C    L QYFGLGSETR+T +
Sbjct  192  LHHWVVARYYARKGVDVSKFNESKKLHRSDYISGRNSGICQGGVLGQYFGLGSETRRTAT  251

Query  300  SVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGR  130
             VPDPYGIEVGNP   P G EE W+LN+HAIDTRG  E++ GCTECRCDLYNVT+DE GR
Sbjct  252  HVPDPYGIEVGNPSEIPSGFEEIWLLNIHAIDTRG-VEDRLGCTECRCDLYNVTEDEYGR  310

Query  129  PL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVD  7
            PL  DY GGL CCYD  +CR+KQGF G +R LYL+YTV +VD
Sbjct  311  PLRPDYKGGLSCCYDRTQCRLKQGFEGVRRTLYLRYTVKWVD  352



>ref|XP_011003519.1| PREDICTED: uncharacterized protein LOC105110237 [Populus euphratica]
Length=467

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 157/220 (71%), Gaps = 13/220 (6%)
 Frame = -3

Query  624  NGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLH  445
            N +K  T LSP F L PGSV N+F+Y IDFP+GHI +K   AEV+DE G  IPLH+TYLH
Sbjct  34   NKIKSVTFLSPEFVLGPGSVENRFYYNIDFPRGHIGLKSLRAEVIDEAGKPIPLHETYLH  93

Query  444  HWIVGKYMIRKDEVVEAADKMFLVG------NSGVC--AELPQYFGLGSETRKTNSSVPD  289
            HW+V KY  R+D V    D+ F         NSG+C    L QYFGLGSETRKT++ +PD
Sbjct  94   HWVVAKYYQRQDVVENNGDQKFQQADYIFGTNSGICQGTILRQYFGLGSETRKTDTHIPD  153

Query  288  PYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-  121
            PY IE+GNP   P G EE WMLNVHAIDTRG A +  GCTECRCDLYNVT DE G+PL  
Sbjct  154  PYAIEIGNPAEIPEGYEEKWMLNVHAIDTRG-AVDTLGCTECRCDLYNVTVDEYGQPLSP  212

Query  120  DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            DY GGL+CCYD  +C+V+QG+ G +R LYL+Y V +VDW+
Sbjct  213  DYIGGLKCCYDQTRCKVQQGYGGARRSLYLRYNVEWVDWD  252



>ref|XP_007209275.1| hypothetical protein PRUPE_ppa007517mg [Prunus persica]
 gb|EMJ10474.1| hypothetical protein PRUPE_ppa007517mg [Prunus persica]
Length=365

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 156/215 (73%), Gaps = 17/215 (8%)
 Frame = -3

Query  600  LSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHWIVGKYM  421
            +SP+F L PGSV +K++Y I FPKGHI +K F AEV+DEEGN IPL +TYLHHW+V +Y 
Sbjct  80   VSPKFVLAPGSVADKYYYDIPFPKGHIGLKSFNAEVIDEEGNPIPLQETYLHHWVVARYY  139

Query  420  IRKDEV---------VEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGIE  274
             R   V         ++ +D  F V N+G+C    L QYFGLGSETR T++ VPDPYGIE
Sbjct  140  ARTGFVEPEETGFQELKKSDFTF-VRNTGMCQNNVLGQYFGLGSETRNTSTHVPDPYGIE  198

Query  273  VGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-GDYPGG  106
            VGNP   P G EE WMLNVHAIDTRG AEN  GCTECRCDLYNV+ D  G+PL   Y GG
Sbjct  199  VGNPAEVPAGYEERWMLNVHAIDTRG-AENGLGCTECRCDLYNVSTDSRGQPLRPGYKGG  257

Query  105  LRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            L CCYDG +CRVKQGF G KR LYL+YTV +VDW+
Sbjct  258  LYCCYDGVQCRVKQGFNGAKRSLYLRYTVKWVDWS  292



>gb|ACJ85863.1| unknown [Medicago truncatula]
 gb|AFK38198.1| unknown [Medicago truncatula]
Length=430

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 163/227 (72%), Gaps = 17/227 (7%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            +  EN +K    LSP+FEL PGSV NK++Y IDFP+GH+A+K F AEVVDE+GN IPLH+
Sbjct  29   VKTENKIKSAVFLSPKFELGPGSVINKYYYDIDFPRGHVAIKSFHAEVVDEDGNPIPLHE  88

Query  456  TYLHHWIVGKYMIRK---------DEVVEAADKMFLVGNSGVCAEL--PQYFGLGSETRK  310
            TYLHHW+V +Y   K          ++ E +D + +V NSG+C E    QYFGLGSETR 
Sbjct  89   TYLHHWVVERYHQSKHVTHTRNDGQKMPENSDNI-MVRNSGICQESINKQYFGLGSETRG  147

Query  309  TNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDE  139
            T + +PDP+GIE+GNP   P G EE WMLNVHAIDTRG  E+K GCTEC+C+LYNVT DE
Sbjct  148  TATDIPDPFGIEIGNPAEIPEGYEEIWMLNVHAIDTRG-VEDKLGCTECKCELYNVTVDE  206

Query  138  DGRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             GR +  DY GG  CCYD  +C++K+GF   KR LYL+YTV +VDW+
Sbjct  207  YGRSIRSDYKGGFLCCYDSKQCKLKEGFERPKRSLYLRYTVKWVDWD  253



>ref|XP_010099538.1| hypothetical protein L484_011611 [Morus notabilis]
 gb|EXB79418.1| hypothetical protein L484_011611 [Morus notabilis]
Length=420

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 164/231 (71%), Gaps = 15/231 (6%)
 Frame = -3

Query  651  QRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNS  472
             +SLRI      K    LSP+F+L PGSV +K +Y IDFP+GHIA K F+AEVVDE G S
Sbjct  24   SQSLRIKNRIKTKSAVFLSPKFDLGPGSVQDKNYYDIDFPRGHIAFKRFDAEVVDEAGRS  83

Query  471  IPLHQTYLHHWIVGKYMIRK---DEVVEAADK-----MFLVGNSGVCA--ELPQYFGLGS  322
            +PLH+ YLHHW + +Y IRK   D   +A  +       LV NSG+C    L QY+G+GS
Sbjct  84   VPLHEVYLHHWALVRYRIRKGVPDAEHDATQRRNQSDFVLVRNSGICQGNALGQYYGIGS  143

Query  321  ETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNV  151
            ETRK ++ VPDPYG+EVGNP   P G EE W LNVHAIDTRG A ++ GCTECRCDLYNV
Sbjct  144  ETRKLSTFVPDPYGMEVGNPAEIPDGFEERWFLNVHAIDTRG-AVDRLGCTECRCDLYNV  202

Query  150  TKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            TKDE G PL  DY GGLRCCYD  +C+V++GF+G +R LYL+YTV + DW+
Sbjct  203  TKDEHGHPLSPDYIGGLRCCYDQTQCKVREGFQGARRSLYLRYTVEWADWS  253



>ref|XP_002321764.2| hypothetical protein POPTR_0015s12000g [Populus trichocarpa]
 gb|EEF05891.2| hypothetical protein POPTR_0015s12000g [Populus trichocarpa]
Length=466

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 160/220 (73%), Gaps = 13/220 (6%)
 Frame = -3

Query  624  NGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLH  445
            N +K  T LSP+F L PGSV N+F+  +DFPKGHI +K F AEV+D+ GN +PLH+TYLH
Sbjct  32   NKIKSATFLSPKFVLGPGSVENRFYRNVDFPKGHIGIKSFNAEVIDDTGNPVPLHETYLH  91

Query  444  HWIVGKYMIRKDEVVEAADKMF------LVGNSGVCAE--LPQYFGLGSETRKTNSSVPD  289
            HW+V +Y  R D V    ++ F         NSG+C +  L QYFGLGSETRKT + +PD
Sbjct  92   HWLVSRYYQRLDAVETNHEQKFKESDRISARNSGICQKGILNQYFGLGSETRKTATRIPD  151

Query  288  PYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-G  121
            PY IE+GNP   P G EE W+LNVHAIDTRG AE++ GCTECRCDLYN+T  E GRPL  
Sbjct  152  PYAIEIGNPAEIPVGYEERWLLNVHAIDTRG-AEDRLGCTECRCDLYNITVSEWGRPLRP  210

Query  120  DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            DY GGL CCYD  +C+VKQGF+G +R LYL+YTV +V+W+
Sbjct  211  DYKGGLLCCYDHTQCKVKQGFQGTRRSLYLRYTVEWVEWD  250



>gb|KEH31348.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=430

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 163/227 (72%), Gaps = 17/227 (7%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            +  EN +K    LSP+FEL PGSV NK++Y IDFP+GH+A+K F AEVVDE+GN IPLH+
Sbjct  29   VKTENKIKSAVFLSPKFELGPGSVINKYYYDIDFPRGHVAIKSFHAEVVDEDGNPIPLHE  88

Query  456  TYLHHWIVGKYMIRK---------DEVVEAADKMFLVGNSGVCAEL--PQYFGLGSETRK  310
            TYLHHW+V +Y   K          ++ E +D + +V NSG+C E    QYFGLGSETR 
Sbjct  89   TYLHHWVVERYHQSKHVTHTRNDGQKMPENSDNI-MVRNSGICQESINKQYFGLGSETRG  147

Query  309  TNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDE  139
            T + +PDP+GIE+GNP   P G EE WMLNVHAIDTRG  E+K GCTEC+C+LYNVT DE
Sbjct  148  TATDIPDPFGIEIGNPAEIPEGYEEIWMLNVHAIDTRG-VEDKLGCTECKCELYNVTVDE  206

Query  138  DGRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             GR +  DY GG  CCYD  +C++K+GF   KR LYL+YTV +VDW+
Sbjct  207  YGRSIRSDYKGGFLCCYDSKQCKLKEGFERPKRSLYLRYTVKWVDWD  253



>ref|XP_003531077.1| PREDICTED: uncharacterized protein LOC100803184 isoform X1 [Glycine 
max]
 ref|XP_006585010.1| PREDICTED: uncharacterized protein LOC100803184 isoform X2 [Glycine 
max]
 ref|XP_006585011.1| PREDICTED: uncharacterized protein LOC100803184 isoform X3 [Glycine 
max]
 ref|XP_006585012.1| PREDICTED: uncharacterized protein LOC100803184 isoform X4 [Glycine 
max]
Length=429

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/225 (59%), Positives = 161/225 (72%), Gaps = 18/225 (8%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            E+ VK    LSP+FEL PGSV NKF Y IDFP+GHIA+K F AEVVDE GNS+ LH+TYL
Sbjct  26   ESNVKTAVFLSPKFELGPGSVANKFDYDIDFPRGHIALKSFNAEVVDEAGNSVALHETYL  85

Query  447  HHWIVGKYMIRK----------DEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTN  304
            HHW+V +Y   K            ++  +D +F V NSG+C    L QYFGLGSETR T 
Sbjct  86   HHWVVARYYQPKYVKTHTSYDGHRILHNSDFVF-VRNSGLCQRNTLGQYFGLGSETRGTA  144

Query  303  SSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDG  133
            + VPDP+GI VG+P   P G EE WM N+HAIDTRG  + KRGCTEC+C+LYNVTKD  G
Sbjct  145  TDVPDPFGIAVGDPAEIPEGYEEKWMFNIHAIDTRGVVD-KRGCTECKCELYNVTKDAYG  203

Query  132  RPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            +PL  DY GGL+CCYD  +CR+++GF G KR LYL+YTV +VDW+
Sbjct  204  KPLMPDYKGGLKCCYDQTQCRLREGFEGPKRSLYLRYTVKWVDWD  248



>ref|XP_010099536.1| hypothetical protein L484_011609 [Morus notabilis]
 gb|EXB79416.1| hypothetical protein L484_011609 [Morus notabilis]
Length=420

 Score =   261 bits (666),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 163/231 (71%), Gaps = 15/231 (6%)
 Frame = -3

Query  651  QRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNS  472
              SLRI           LSP+FEL PGSV NK+++ IDFP GHIA+K  +AEVVDE G+ 
Sbjct  24   SHSLRIKNRIKTNSAVFLSPKFELGPGSVENKYYHDIDFPIGHIALKRLDAEVVDEAGSP  83

Query  471  IPLHQTYLHHWIVGKYMIRKDEV---VEAADKM-----FLVGNSGVCAE--LPQYFGLGS  322
            IPLH+TYLHHW+V +Y IRKD +    +A  K+       V N+GVC    L QY+GLGS
Sbjct  84   IPLHETYLHHWVVERYRIRKDVLDVEHDATQKLNQSNFMFVRNNGVCQGNYLGQYYGLGS  143

Query  321  ETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNV  151
            ETRKT + +PDPYGIE GNP   P G EE WMLNVHAIDTRG A ++ GCTEC+CDLYNV
Sbjct  144  ETRKTATFIPDPYGIETGNPAEIPDGFEERWMLNVHAIDTRG-AVDRLGCTECKCDLYNV  202

Query  150  TKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            TKDE G PL  DY GGL CCYD  +C+VK+GF+  +R LYL+YTV + DW+
Sbjct  203  TKDEFGHPLSPDYTGGLYCCYDQTQCKVKEGFQSARRSLYLRYTVEWADWS  253



>ref|XP_006436986.1| hypothetical protein CICLE_v10031458mg [Citrus clementina]
 ref|XP_006436987.1| hypothetical protein CICLE_v10031458mg [Citrus clementina]
 gb|ESR50226.1| hypothetical protein CICLE_v10031458mg [Citrus clementina]
 gb|ESR50227.1| hypothetical protein CICLE_v10031458mg [Citrus clementina]
Length=462

 Score =   261 bits (668),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 159/220 (72%), Gaps = 15/220 (7%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            VK +  LSP+F L PGSV NKF+YGIDFP+GHIA+K F+AEV+DE GN IPLH+TYLHHW
Sbjct  29   VKSKVFLSPKFVLGPGSVENKFYYGIDFPRGHIALKSFDAEVIDEAGNPIPLHETYLHHW  88

Query  438  IVGKYMIRKD-EVVEAADKMFL-------VGNSGVCAE--LPQYFGLGSETRKTNSSVPD  289
            +V KY  RKD EV+E      L         N G+C    L Q+FGLGSETR T + +PD
Sbjct  89   LVEKYYGRKDAEVLEYNGNRLLHESDYISARNDGICQRNCLGQFFGLGSETRGTATHIPD  148

Query  288  PYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-G  121
            PYGIE+GNP   P G EE W LNVHAIDTRG  E++ GCTEC+CDLYNVT DE G+ L  
Sbjct  149  PYGIEIGNPATIPAGYEERWFLNVHAIDTRG-VEDRLGCTECKCDLYNVTVDEYGQLLRP  207

Query  120  DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            +Y GG  CCYDG +CRVK GF G +R LYL+YTV +VDW+
Sbjct  208  NYRGGFACCYDGTQCRVKNGFEGARRSLYLRYTVKWVDWD  247



>dbj|BAJ53113.1| JHL07K02.3 [Jatropha curcas]
 gb|KDP22519.1| hypothetical protein JCGZ_26350 [Jatropha curcas]
Length=409

 Score =   260 bits (664),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 157/218 (72%), Gaps = 7/218 (3%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            ++E + VK  T  SP F L PGSV N++++ I+FP+GHIA+K F+AEVVD  GN +PLH+
Sbjct  28   LEEGSKVKSATFRSPMFVLGPGSVENRYYFNINFPRGHIAIKSFDAEVVDAAGNPVPLHE  87

Query  456  TYLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPY  283
            TYLHHW+V KY  R D      DK     NSG+C    L QYFGLGSETR+T++ VPDPY
Sbjct  88   TYLHHWVVAKYYKRLDVENTDKDKYISGNNSGICQGRVLRQYFGLGSETRRTDTYVPDPY  147

Query  282  GIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-GDY  115
            GIE+GNP   P G EE W+LNVHAIDTRG  E++ GCTECRCDLYNVT DE  RPL  DY
Sbjct  148  GIEIGNPAEIPVGYEERWLLNVHAIDTRG-VEDRLGCTECRCDLYNVTVDEYERPLRSDY  206

Query  114  PGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             GGL CCYD  +CRV  GF G +R LYL+Y V +VDW+
Sbjct  207  NGGLLCCYDRTQCRVTAGFEGARRKLYLRYKVKWVDWD  244



>ref|XP_010036842.1| PREDICTED: uncharacterized protein LOC104425754 [Eucalyptus grandis]
 gb|KCW48501.1| hypothetical protein EUGRSUZ_K02186 [Eucalyptus grandis]
Length=460

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 158/212 (75%), Gaps = 9/212 (4%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K  T LSP+F L PGSV +K+++ IDFP+GH+A+K F+AEVVDE+G  +PLHQTYLHHW
Sbjct  42   LKSATFLSPKFVLGPGSVEDKYYFDIDFPRGHVALKSFDAEVVDEDGIPVPLHQTYLHHW  101

Query  438  IVGKYMIRKDEVVEAADKMFLVGNSGVCA--ELPQYFGLGSETRKTNSSVPDPYGIEVGN  265
            +V +Y        ++ D      NSG+C    L QYFGLGSETRKT + VPDPYGIEVGN
Sbjct  102  VVARYHAPLHP--QSEDDYEFARNSGICQRHSLGQYFGLGSETRKTATFVPDPYGIEVGN  159

Query  264  P---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-GDYPGGLRC  97
            P   P GLEE WMLNVHAIDTRG  E++ GCTECRCDLYNVT+D  GRPL   Y GGL C
Sbjct  160  PADIPAGLEEKWMLNVHAIDTRGV-EDRLGCTECRCDLYNVTQDAYGRPLRPGYTGGLYC  218

Query  96   CYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            CYD  +CR++ GF+G +R LYL+YTV ++DW+
Sbjct  219  CYDQTRCRLRPGFQGPRRSLYLRYTVAWLDWD  250



>ref|XP_007147471.1| hypothetical protein PHAVU_006G127300g [Phaseolus vulgaris]
 gb|ESW19465.1| hypothetical protein PHAVU_006G127300g [Phaseolus vulgaris]
Length=404

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 159/217 (73%), Gaps = 10/217 (5%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            EN +K    LSP+FEL PGSV NKF+Y +DFP+GHIA+K F AEVVDE G S+ L +TYL
Sbjct  32   ENNIKTSVFLSPKFELGPGSVANKFYYDVDFPRGHIALKSFNAEVVDEAGKSVSLQETYL  91

Query  447  HHWIVGKYMIRKDEVVEAADKMFLV--GNSGVCAE--LPQYFGLGSETRKTNSSVPDPYG  280
            HHWIV KY   K+ V    ++  +V   NSG+C E  L QYFGLGSETR T S +PDPYG
Sbjct  92   HHWIVIKYHQPKN-VSHNNNQTGIVYLRNSGLCQENVLGQYFGLGSETRGTASDIPDPYG  150

Query  279  IEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-DYP  112
            IE+GNP   P G EE W +NVHAIDTRG  E++ GC EC CDLYNVTKDEDG PL   Y 
Sbjct  151  IEIGNPSEIPDGYEENWFINVHAIDTRG-VEDRVGCFECSCDLYNVTKDEDGNPLSPSYK  209

Query  111  GGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            GGL CC D ++CR+++GF+G KR LY++YTV +++W+
Sbjct  210  GGLACCPDNSQCRLEKGFKGPKRSLYMRYTVKWINWD  246



>gb|KHG23950.1| G2/mitotic-specific cyclin-B [Gossypium arboreum]
Length=467

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 159/223 (71%), Gaps = 15/223 (7%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            EN +     LSP F L PGSV N+F++ +DFPKGHIA+K F+AEV+DE G  +PLH+TYL
Sbjct  30   ENKIHTAVFLSPEFVLGPGSVENRFYFNVDFPKGHIALKSFDAEVIDEAGYPVPLHETYL  89

Query  447  HHWIVGKYMIRKDEVVEAADKMFLV--------GNSGVCAE--LPQYFGLGSETRKTNSS  298
            HHW+V +Y +RK   +   D +  +        GNSG+C    L Q+FGLGSETRKT++ 
Sbjct  90   HHWVVVRYYVRKGVEISKLDDLKKLNRSDYISGGNSGICQNGILSQFFGLGSETRKTSTH  149

Query  297  VPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRP  127
            +PDPYGIEVGNP   P G +E WMLNVHAIDTRG AE+K GCTECRCDLYNVT DE GRP
Sbjct  150  IPDPYGIEVGNPAEVPSGFQEQWMLNVHAIDTRG-AEDKLGCTECRCDLYNVTVDEYGRP  208

Query  126  LGD-YPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            L   Y GGL CCYD  +C+VK GF   +R LYL+YTV ++D +
Sbjct  209  LRPYYKGGLLCCYDRTQCKVKHGFEAVRRTLYLRYTVKWIDMD  251



>ref|XP_002511074.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51676.1| conserved hypothetical protein [Ricinus communis]
Length=467

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 161/220 (73%), Gaps = 12/220 (5%)
 Frame = -3

Query  627  ENG--VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQT  454
            ENG  +K  T LSP F L PGSV N+++Y IDFP+GHI +K F AE++DE GN IPL++T
Sbjct  29   ENGSKIKTATFLSPNFVLGPGSVENRWYYNIDFPRGHIFIKSFNAEIIDEAGNPIPLYET  88

Query  453  YLHHWIVGKYMIRKDEVVEAADK---MFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPD  289
            Y+HHW+V +Y  R +  V    +       GNSG+C    L QYFGLGSETRKT++ VPD
Sbjct  89   YIHHWVVSRYYQRTNASVAENSRRPDRIPAGNSGICQAHVLGQYFGLGSETRKTDTHVPD  148

Query  288  PYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-G  121
            PYGIE+GNP   P G EE W+LN+HAIDTRG  +++ GCTEC+CDLYNVT DE G PL  
Sbjct  149  PYGIEIGNPAEIPQGYEERWVLNIHAIDTRG-VQDRLGCTECKCDLYNVTVDEYGDPLRP  207

Query  120  DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            +Y GGL CCYD  +C+VKQGF+G +R LYL+YTV +VDW+
Sbjct  208  EYKGGLLCCYDRTQCKVKQGFQGARRSLYLRYTVKWVDWD  247



>ref|XP_011040294.1| PREDICTED: uncharacterized protein LOC105136594 [Populus euphratica]
Length=466

 Score =   259 bits (662),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 160/218 (73%), Gaps = 13/218 (6%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K  T LSP+F L PGSV N+F+  +DFPKGHI +K F+AEV+D+ GN +PLH+TYLHHW
Sbjct  34   IKSTTFLSPKFVLGPGSVENRFYRNVDFPKGHIGIKSFKAEVIDDTGNPVPLHETYLHHW  93

Query  438  IVGKYMIRKDEVVEAADKMF------LVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPY  283
            +V +Y  + D V    ++ F         NSG+C +  L QYFGLGSETRKT + +PDPY
Sbjct  94   LVSRYYQQLDVVETNHEQKFKESDRISARNSGICQKGILNQYFGLGSETRKTATHIPDPY  153

Query  282  GIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-GDY  115
             IE+GNP   P G EE W+LNVHAIDTRG AE++ GCTECRCDLYN+T  E GRPL  DY
Sbjct  154  AIEIGNPAEIPVGYEERWLLNVHAIDTRG-AEDRLGCTECRCDLYNITVSEWGRPLRPDY  212

Query  114  PGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             GGL CCYD  +C+VKQGF+G +R LYL+YTV +V+W+
Sbjct  213  KGGLLCCYDHTQCKVKQGFQGTRRSLYLRYTVEWVEWD  250



>ref|XP_011040293.1| PREDICTED: uncharacterized protein LOC105136592 [Populus euphratica]
Length=377

 Score =   256 bits (653),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 158/218 (72%), Gaps = 13/218 (6%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K  T LSP+F L PGSV N+F+  +DFPKGHI +K F+AEV+D+ GN +PLH+TYLHHW
Sbjct  34   IKSTTFLSPKFVLGPGSVENRFYRNVDFPKGHIGIKSFKAEVIDDTGNPVPLHETYLHHW  93

Query  438  IVGKYMIRKDEVVEAADKMF------LVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPY  283
            +V +Y  + D V    ++ F         NSG+C +  L QYFGLGSETRKT + +PDPY
Sbjct  94   LVSRYYQQLDVVETNHEQKFKESDRISARNSGICQKGILNQYFGLGSETRKTATHIPDPY  153

Query  282  GIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-GDY  115
             IE+GNP   P G EE W+LNVHAIDTRG AE++ GCTECRCDLYN+   E GRPL   Y
Sbjct  154  AIEIGNPAEIPVGYEERWLLNVHAIDTRG-AEDRLGCTECRCDLYNIKASEWGRPLRPGY  212

Query  114  PGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             GGL CCYD  +C+VKQGF+G +R LYL+YTV +V+W+
Sbjct  213  KGGLLCCYDHTQCKVKQGFQGTRRSLYLRYTVEWVEWD  250



>ref|XP_004300378.1| PREDICTED: uncharacterized protein LOC101300539 [Fragaria vesca 
subsp. vesca]
Length=420

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 160/224 (71%), Gaps = 17/224 (8%)
 Frame = -3

Query  624  NGVKVET--LLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTY  451
            N VK  T   LSP+F LEPGSV +K+FY I FP+GHIA+K F AEVVDEEGN +PLH+TY
Sbjct  30   NKVKTTTSVYLSPKFVLEPGSVADKYFYNIQFPRGHIAMKYFNAEVVDEEGNPVPLHETY  89

Query  450  LHHWIVGKYMIRKDEV-------VEAADKMF-LVGNSGVCAE--LPQYFGLGSETRKTNS  301
            LHHW++ +Y      V        +  D  F +V NSG+C    L QY+GLGSETRKT++
Sbjct  90   LHHWVIERYYAETSYVEPVLSGFEDIKDPEFKIVRNSGLCQNDALGQYYGLGSETRKTDT  149

Query  300  SVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGR  130
             VPDP+GIE+GNP   P G EE WMLNVHAIDTRG A +K GCTECRCDLYNVTKD  G+
Sbjct  150  HVPDPFGIEIGNPADIPAGYEERWMLNVHAIDTRG-AVDKLGCTECRCDLYNVTKDGKGQ  208

Query  129  PL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            PL   Y GGL CCYDG  C VKQG  G KR LYL+YTV +VDW+
Sbjct  209  PLRPGYTGGLYCCYDGTHCSVKQGNNGVKRSLYLRYTVKWVDWS  252



>ref|XP_006436984.1| hypothetical protein CICLE_v10031461mg [Citrus clementina]
 ref|XP_006436985.1| hypothetical protein CICLE_v10031461mg [Citrus clementina]
 gb|ESR50224.1| hypothetical protein CICLE_v10031461mg [Citrus clementina]
 gb|ESR50225.1| hypothetical protein CICLE_v10031461mg [Citrus clementina]
Length=462

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 158/220 (72%), Gaps = 15/220 (7%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            VK +  LSP+F L PGSV NKF+YGIDFP+GHIA+K F AEV+DE G  +PLH+TYLHHW
Sbjct  29   VKSKVFLSPKFVLGPGSVDNKFYYGIDFPRGHIALKSFNAEVIDEAGYPVPLHETYLHHW  88

Query  438  IVGKYMIRKD-EVVEAADKMFL-------VGNSGVCAE--LPQYFGLGSETRKTNSSVPD  289
            +V +Y  RKD EV+E      L         N G+C    L Q+FGLGSETR T + +PD
Sbjct  89   VVERYYGRKDAEVLEYNGNRLLRESDYISARNDGICQRNCLGQFFGLGSETRGTATHIPD  148

Query  288  PYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-G  121
            PYGIE+GNP   P G EE W+LNVHAIDTRG  E++ GCTEC+CDLYNVT DE G+ L  
Sbjct  149  PYGIEIGNPATIPAGYEERWVLNVHAIDTRG-VEDRLGCTECKCDLYNVTVDEYGQLLRP  207

Query  120  DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            +Y GG  CCYDG +CRVK GF G +R LYL+YTV +VDW+
Sbjct  208  NYRGGFACCYDGTQCRVKNGFEGARRSLYLRYTVKWVDWD  247



>gb|AFK43962.1| unknown [Medicago truncatula]
Length=425

 Score =   255 bits (652),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 159/218 (73%), Gaps = 9/218 (4%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            +  E  +K    LSP+FEL PGSV N ++Y I FP+GH+A+K F AEVVDE GN +PLH+
Sbjct  28   MKTEAKIKSAVFLSPKFELGPGSVVNGYYYDIGFPRGHVALKSFNAEVVDESGNPVPLHE  87

Query  456  TYLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCA--ELPQYFGLGSETRKTNSSVPDPY  283
            TYLHHW+V +Y   K    + +D + L+ NSG+C    L QYFGLGSETR T + +PDP+
Sbjct  88   TYLHHWLVVRYHQSK-HATQNSDNV-LIRNSGICQGNTLGQYFGLGSETRGTATDIPDPF  145

Query  282  GIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-GDY  115
            GIE+GNP   P G  E W+LNVHAIDTRGT ++K GCTEC+C+LYNVT DE GR +  DY
Sbjct  146  GIEIGNPEEIPEGFHEKWLLNVHAIDTRGT-KDKLGCTECKCELYNVTVDEYGRSIRPDY  204

Query  114  PGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             GGL CCYD  +C++K+GF G KR LYL+YTV +VDW+
Sbjct  205  KGGLLCCYDSKQCKLKEGFEGPKRSLYLRYTVKWVDWD  242



>gb|KEH31350.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=425

 Score =   255 bits (652),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 159/218 (73%), Gaps = 9/218 (4%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            +  E  +K    LSP+FEL PGSV N ++Y I FP+GH+A+K F AEVVDE GN +PLH+
Sbjct  28   MKTEAKIKSAVFLSPKFELGPGSVVNGYYYDIGFPRGHVALKSFNAEVVDESGNPVPLHE  87

Query  456  TYLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCA--ELPQYFGLGSETRKTNSSVPDPY  283
            TYLHHW+V +Y   K    + +D + L+ NSG+C    L QYFGLGSETR T + +PDP+
Sbjct  88   TYLHHWLVVRYHQSK-HATQNSDNV-LIRNSGICQGNTLGQYFGLGSETRGTATDIPDPF  145

Query  282  GIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-GDY  115
            GIE+GNP   P G  E W+LNVHAIDTRGT ++K GCTEC+C+LYNVT DE GR +  DY
Sbjct  146  GIEIGNPEEIPEGFHEKWLLNVHAIDTRGT-KDKLGCTECKCELYNVTVDEYGRSIRPDY  204

Query  114  PGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             GGL CCYD  +C++K+GF G KR LYL+YTV +VDW+
Sbjct  205  KGGLLCCYDSKQCKLKEGFEGPKRSLYLRYTVKWVDWD  242



>ref|XP_007158976.1| hypothetical protein PHAVU_002G197800g [Phaseolus vulgaris]
 gb|ESW30970.1| hypothetical protein PHAVU_002G197800g [Phaseolus vulgaris]
Length=392

 Score =   254 bits (648),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 156/224 (70%), Gaps = 16/224 (7%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            E+ VK    LSP+FEL PGSV NK+ Y IDFP+GHIA+K F AEV+DE GN +PLH+TYL
Sbjct  39   ESKVKTAIFLSPKFELGPGSVANKYDYDIDFPRGHIALKSFNAEVIDELGNPVPLHETYL  98

Query  447  HHWIVGKYMIRKDEVVEA---------ADKMFLVGNSGVCAE--LPQYFGLGSETRKTNS  301
            HHW+V +Y   K                    +V N G+C    L QYFGLGSETR T +
Sbjct  99   HHWVVARYYEAKHVATHTRYDGHRELHQSGHVMVRNGGICQRDVLGQYFGLGSETRGTAT  158

Query  300  SVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGR  130
             VPDP+GI VG+P   P G EE W++N+HAIDTRG  + K GCTECRCDLYNVT+DE GR
Sbjct  159  DVPDPFGIVVGDPAEIPEGYEEKWLVNIHAIDTRGVVD-KLGCTECRCDLYNVTEDEYGR  217

Query  129  PL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            P+  DY GGL CCYD ++C++++GF G KR LYL+YTV +VDW+
Sbjct  218  PIRSDYKGGLFCCYDESQCKLREGFEGPKRSLYLRYTVKWVDWD  261



>ref|XP_010099537.1| hypothetical protein L484_011610 [Morus notabilis]
 gb|EXB79417.1| hypothetical protein L484_011610 [Morus notabilis]
Length=420

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 161/231 (70%), Gaps = 15/231 (6%)
 Frame = -3

Query  651  QRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNS  472
             +SLRI      K    LSP+F+L PGSV  K +Y IDFP+GHIA K F+AEVVDE G S
Sbjct  24   SQSLRIKNRIKTKSAVFLSPKFDLGPGSVQEKNYYDIDFPRGHIAFKRFDAEVVDEAGRS  83

Query  471  IPLHQTYLHHWIVGKYMIRKD--EVVEAADK------MFLVGNSGVC--AELPQYFGLGS  322
            +PLH+ YLHHW + +Y IRKD  +V   A +         V N G+C    L QY+G+GS
Sbjct  84   VPLHEIYLHHWALVRYRIRKDVPDVEHDATQKRNQSNFVYVRNRGICQGTVLGQYYGIGS  143

Query  321  ETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNV  151
            ETRK ++ VPDPYG+EVGNP   P G EE W LNVHAIDTRG A ++ GCTECRCDLYNV
Sbjct  144  ETRKLSTFVPDPYGMEVGNPAEIPDGFEERWFLNVHAIDTRG-AVDRLGCTECRCDLYNV  202

Query  150  TKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            TKDE G PL  DY GGL CCYD  +C+V++GF+G +R LY++YTV + DW+
Sbjct  203  TKDEHGHPLSPDYIGGLHCCYDQTRCKVREGFQGARRSLYIRYTVEWADWS  253



>gb|KHN39141.1| hypothetical protein glysoja_027946 [Glycine soja]
Length=701

 Score =   261 bits (668),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/225 (59%), Positives = 161/225 (72%), Gaps = 18/225 (8%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            E+ VK    LSP+FEL PGSV NKF Y IDFP+GHIA+K F AEVVDE GNS+ LH+TYL
Sbjct  298  ESNVKTAVFLSPKFELGPGSVANKFDYDIDFPRGHIALKSFNAEVVDEAGNSVALHETYL  357

Query  447  HHWIVGKYMIRK----------DEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTN  304
            HHW+V +Y   K            ++  +D +F V NSG+C    L QYFGLGSETR T 
Sbjct  358  HHWVVARYYQPKYVKTHTSYDGHRILHNSDYVF-VRNSGLCQRNTLGQYFGLGSETRGTA  416

Query  303  SSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDG  133
            + VPDP+GI VG+P   P G EE WM N+HAIDTRG  + KRGCTEC+C+LYNVTKD  G
Sbjct  417  TDVPDPFGIAVGDPAEIPEGYEEKWMFNIHAIDTRGVVD-KRGCTECKCELYNVTKDAYG  475

Query  132  RPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            +PL  DY GGL+CCYD  +CR+++GF G KR LYL+YTV +VDW+
Sbjct  476  KPLMPDYKGGLKCCYDQTQCRLREGFEGPKRSLYLRYTVKWVDWD  520


 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 111/159 (70%), Gaps = 13/159 (8%)
 Frame = -3

Query  444  HWIVGKYMIRKD----EVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPY  283
            HW++G+Y + KD      +  +D + LV NSG C    L QY+GLGSETR+T + +PDP+
Sbjct  26   HWVIGRYYLFKDVKHTRTLNHSD-IILVRNSGTCQRDILAQYYGLGSETRRTATDIPDPF  84

Query  282  GIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL--GD  118
             I VGNP   P G EE W++N+HAIDTRG  + K GCTEC+C+LYNVT DE G  L   D
Sbjct  85   EIIVGNPAKIPEGYEEKWLVNIHAIDTRGVVD-KMGCTECKCELYNVTNDEYGELLLRPD  143

Query  117  YPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            Y GGL CCYD  +CR+++GF G+KR LYL+ TV +V+W+
Sbjct  144  YKGGLLCCYDQTQCRLREGFVGQKRNLYLRCTVKWVNWD  182



>dbj|BAI63593.1| MtN19 protein [Lotus japonicus]
Length=405

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 160/215 (74%), Gaps = 9/215 (4%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            +N  K    LSP FEL PGSV NK FY ++FP+GHIA+K F AEVVDE GNS+ L +TYL
Sbjct  33   KNNEKSAVFLSPMFELGPGSVANKLFYDVEFPRGHIALKSFNAEVVDEAGNSVSLQETYL  92

Query  447  HHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGIE  274
            HHWIV +Y   K+ V + +D + +V NSG+C E  L  YFG+GSETR T S +PDP+GIE
Sbjct  93   HHWIVIRYHHLKN-VTDPSD-IDVVSNSGLCQEGTLNYYFGVGSETRGTASHIPDPFGIE  150

Query  273  VGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-DYPGG  106
            VGNP   P G EE W++N HAIDTRG AE + GC ECRCDLYN+T D DG+PLG DY GG
Sbjct  151  VGNPKEIPKGYEEKWLINSHAIDTRGVAE-RLGCAECRCDLYNITTDGDGKPLGPDYGGG  209

Query  105  LRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            L+CC D A+C++++GF G KR LYLKYTV +V+W+
Sbjct  210  LQCCPDKAQCKLRKGFLGPKRKLYLKYTVKWVEWD  244



>ref|XP_006374581.1| hypothetical protein POPTR_0015s11990g [Populus trichocarpa]
 gb|ERP52378.1| hypothetical protein POPTR_0015s11990g [Populus trichocarpa]
Length=466

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 160/221 (72%), Gaps = 15/221 (7%)
 Frame = -3

Query  624  NGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLH  445
            N +K  T LSP F L PGSV ++++  IDFP+GH+ +K F+AEVVD+ GN IPLH+TYLH
Sbjct  32   NQIKSATFLSPEFVLGPGSVEDRYYSNIDFPRGHVGIKSFKAEVVDDIGNPIPLHETYLH  91

Query  444  HWIVGKYMIRKDEVVEAADK-------MFLVGNSGVCAE--LPQYFGLGSETRKTNSSVP  292
            HW+V KY  R+  + E  DK           GNSG+C    L QYFGLGSETRKT++ VP
Sbjct  92   HWVVAKYYQRQG-MAENNDKHKFQPSDYLFAGNSGICQGNVLGQYFGLGSETRKTDTYVP  150

Query  291  DPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-  124
            +PY IE+GNP   P G EE W+LNVHAIDTRG A ++ GCTECRCDLYN+T D+ G+PL 
Sbjct  151  NPYAIEIGNPDEVPEGYEEKWLLNVHAIDTRG-AVDRLGCTECRCDLYNITVDQHGQPLR  209

Query  123  GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
              Y GGLRCCYD  +C+V+QG+ G +R LYL+YTV +VDW+
Sbjct  210  PGYIGGLRCCYDQTQCKVQQGYGGARRSLYLRYTVEWVDWD  250



>ref|XP_007158977.1| hypothetical protein PHAVU_002G197800g [Phaseolus vulgaris]
 gb|ESW30971.1| hypothetical protein PHAVU_002G197800g [Phaseolus vulgaris]
Length=439

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 156/224 (70%), Gaps = 16/224 (7%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            E+ VK    LSP+FEL PGSV NK+ Y IDFP+GHIA+K F AEV+DE GN +PLH+TYL
Sbjct  39   ESKVKTAIFLSPKFELGPGSVANKYDYDIDFPRGHIALKSFNAEVIDELGNPVPLHETYL  98

Query  447  HHWIVGKYMIRKDEVVEA---------ADKMFLVGNSGVCAE--LPQYFGLGSETRKTNS  301
            HHW+V +Y   K                    +V N G+C    L QYFGLGSETR T +
Sbjct  99   HHWVVARYYEAKHVATHTRYDGHRELHQSGHVMVRNGGICQRDVLGQYFGLGSETRGTAT  158

Query  300  SVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGR  130
             VPDP+GI VG+P   P G EE W++N+HAIDTRG   +K GCTECRCDLYNVT+DE GR
Sbjct  159  DVPDPFGIVVGDPAEIPEGYEEKWLVNIHAIDTRGVV-DKLGCTECRCDLYNVTEDEYGR  217

Query  129  PL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            P+  DY GGL CCYD ++C++++GF G KR LYL+YTV +VDW+
Sbjct  218  PIRSDYKGGLFCCYDESQCKLREGFEGPKRSLYLRYTVKWVDWD  261



>dbj|BAE71234.1| hypothetical protein [Trifolium pratense]
Length=404

 Score =   253 bits (645),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 158/218 (72%), Gaps = 13/218 (6%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            +  E  +K    LS +FEL PGSV N+F+Y IDFP+GHIA+K F AEVVDE G  IPLH+
Sbjct  30   LKTEARIKSAVFLSTKFELGPGSVSNRFYYDIDFPRGHIALKSFNAEVVDEAGIPIPLHE  89

Query  456  TYLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCA--ELPQYFGLGSETRKTNSSVPDPY  283
            TYLHHW+V +Y   K      +D++  V NSG+C    L QYFGLGSETR T + +PDP+
Sbjct  90   TYLHHWLVVRYHQSK-----YSDRVH-VRNSGICQGDSLGQYFGLGSETRGTATDIPDPF  143

Query  282  GIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-GDY  115
            GIE+GNP   P G EE WM+N+HAIDTRG AE+K GCTEC+CDLYNVT D  GR +  DY
Sbjct  144  GIEIGNPAEIPEGFEEKWMVNIHAIDTRG-AEDKSGCTECKCDLYNVTVDSYGRSIRPDY  202

Query  114  PGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             GGL CCYD  +C++K+GF G KR LYL+YTV ++DW+
Sbjct  203  KGGLLCCYDYTQCKLKEGFEGPKRSLYLRYTVKWIDWD  240



>ref|XP_003524108.1| PREDICTED: uncharacterized protein LOC100785991 [Glycine max]
Length=429

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 160/225 (71%), Gaps = 18/225 (8%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            E+ VK    LSP+FEL PGSV NK+ Y IDFP+GHIA+K F AEVVDE GN +PLH+TYL
Sbjct  26   ESNVKTAVFLSPKFELGPGSVANKYDYDIDFPRGHIALKSFNAEVVDEAGNPVPLHETYL  85

Query  447  HHWIVGKYMIRK----------DEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTN  304
            HHW+VG+Y   K            ++  +D +F V NSG+C    L QY+GLGSETR T 
Sbjct  86   HHWVVGRYYQPKYVTTHTNYDGHRILHNSDHIF-VRNSGICQRDILGQYYGLGSETRGTA  144

Query  303  SSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDG  133
            + VPDP+GI VG+    P G EE W++N+HAIDTRG  + K GCTECRCDLYNVTKDE G
Sbjct  145  TDVPDPFGIVVGDHAEIPEGYEEKWLVNIHAIDTRGVVD-KMGCTECRCDLYNVTKDEYG  203

Query  132  RPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
              L  DY GGL+CCYD  +CR+++GF G KR LYL+YTV +V+W+
Sbjct  204  EFLRPDYKGGLKCCYDQTQCRLREGFEGPKRSLYLRYTVKWVEWD  248



>ref|XP_007158975.1| hypothetical protein PHAVU_002G197800g [Phaseolus vulgaris]
 gb|ESW30969.1| hypothetical protein PHAVU_002G197800g [Phaseolus vulgaris]
Length=425

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 156/224 (70%), Gaps = 16/224 (7%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            E+ VK    LSP+FEL PGSV NK+ Y IDFP+GHIA+K F AEV+DE GN +PLH+TYL
Sbjct  25   ESKVKTAIFLSPKFELGPGSVANKYDYDIDFPRGHIALKSFNAEVIDELGNPVPLHETYL  84

Query  447  HHWIVGKYMIRKDEVVEA---------ADKMFLVGNSGVCAE--LPQYFGLGSETRKTNS  301
            HHW+V +Y   K                    +V N G+C    L QYFGLGSETR T +
Sbjct  85   HHWVVARYYEAKHVATHTRYDGHRELHQSGHVMVRNGGICQRDVLGQYFGLGSETRGTAT  144

Query  300  SVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGR  130
             VPDP+GI VG+P   P G EE W++N+HAIDTRG   +K GCTECRCDLYNVT+DE GR
Sbjct  145  DVPDPFGIVVGDPAEIPEGYEEKWLVNIHAIDTRGVV-DKLGCTECRCDLYNVTEDEYGR  203

Query  129  PL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            P+  DY GGL CCYD ++C++++GF G KR LYL+YTV +VDW+
Sbjct  204  PIRSDYKGGLFCCYDESQCKLREGFEGPKRSLYLRYTVKWVDWD  247



>gb|KEH31352.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=327

 Score =   249 bits (637),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 157/226 (69%), Gaps = 15/226 (7%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            ++ EN +K    LSP+FEL PGSV NK +Y IDFP+GHIA+K F AEVVDE GN IPLH+
Sbjct  28   LNAENKIKSAVFLSPKFELGPGSVINKEYYDIDFPRGHIALKSFNAEVVDEVGNPIPLHE  87

Query  456  TYLHHWIVGKYMIRKDEVVEAAD--------KMFLVGNSGVCA--ELPQYFGLGSETRKT  307
            TYLHHW VG+Y   K       D         +  V NSG+C    L QYFG+GSETR T
Sbjct  88   TYLHHWGVGRYHQSKHVTHTRNDGKRMLQSSNIVKVRNSGICQGNTLGQYFGIGSETRGT  147

Query  306  NSSVPDPYGIEVGNPP---PGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDED  136
             + +PDP+GIE+GNP     G E+ W+LNVHAIDTRG  E+K GCTEC+C+LYNVT DE 
Sbjct  148  ATDIPDPFGIEIGNPAEVSEGSEDKWVLNVHAIDTRG-VEDKLGCTECKCELYNVTVDEY  206

Query  135  GRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            GR +  DY GG  CCYD  +C++K+GF G KR LYL+YTV +VDW+
Sbjct  207  GRSIRPDYKGGWLCCYDCTQCKLKEGFEGPKRSLYLRYTVKWVDWD  252



>ref|XP_011040291.1| PREDICTED: uncharacterized protein LOC105136589 [Populus euphratica]
Length=466

 Score =   253 bits (646),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 160/221 (72%), Gaps = 15/221 (7%)
 Frame = -3

Query  624  NGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLH  445
            N +K  T LSP F L PGSV ++++  IDFP+GH+ +K F+AEV+D+ GN IPLH+TYLH
Sbjct  32   NQIKSATFLSPEFVLRPGSVEDRYYSNIDFPRGHVGIKSFKAEVIDDIGNPIPLHETYLH  91

Query  444  HWIVGKYMIRKDEV-------VEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVP  292
            HW+V KY  R+           + +D +F  GNSG+C    L QYFGLGSETRKT++ VP
Sbjct  92   HWVVAKYYQRQGMAENNDMRKFQLSDYLF-AGNSGICQGNVLGQYFGLGSETRKTDTHVP  150

Query  291  DPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-  124
            +PY IE+GNP   P G EE W+LNVHAIDTRG A ++ GCTECRCDLYN+T D+ G+PL 
Sbjct  151  NPYAIEIGNPDEIPEGYEEKWLLNVHAIDTRG-AVDRLGCTECRCDLYNITVDKHGQPLR  209

Query  123  GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
              Y GGLRCCYD  +C V+QG+ G +R LYL+YTV +VDW+
Sbjct  210  PGYIGGLRCCYDQTQCEVQQGYGGARRSLYLRYTVEWVDWD  250



>ref|XP_010668152.1| PREDICTED: uncharacterized protein LOC104885143 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010668153.1| PREDICTED: uncharacterized protein LOC104885143 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010668154.1| PREDICTED: uncharacterized protein LOC104885143 [Beta vulgaris 
subsp. vulgaris]
Length=413

 Score =   251 bits (642),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 127/233 (55%), Positives = 158/233 (68%), Gaps = 16/233 (7%)
 Frame = -3

Query  660  CSSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEE  481
            C   ++  I +E  +K    LSP F ++PG+V N+F++ IDFP+GHI +K F AEVVDE+
Sbjct  20   CEIIKAQIIQDETMIKSAVYLSPEFVMKPGTVINRFYHNIDFPRGHIGIKSFNAEVVDED  79

Query  480  GNSIPLHQTYLHHWIVGKYMI----------RKDEVVEAADKMFLVGNSGVCAELPQYFG  331
            G  + L  TYLHHW+VG+Y +          R    ++ +D M+ V N+GVC  L QYFG
Sbjct  80   GVPVSLQDTYLHHWLVGRYYVRIGSEDKGLSRNPNSLDKSDFMW-VRNTGVCENLGQYFG  138

Query  330  LGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDL  160
            LGSETRKT + VPDPY IE GN    PPG EE W+LNVHAIDTRG A ++ GCTEC+C L
Sbjct  139  LGSETRKTATHVPDPYAIEAGNAAEIPPGYEERWILNVHAIDTRG-AVDRLGCTECKCSL  197

Query  159  YNVTKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDW  4
            YNVT DE GRPL  DY GGL CCYD  +CRVK+GF    R LYL+YTV + DW
Sbjct  198  YNVTIDEYGRPLRPDYEGGLLCCYDQTQCRVKEGFTNSPRKLYLRYTVKWFDW  250



>gb|KHN25868.1| hypothetical protein glysoja_018722 [Glycine soja]
Length=434

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 155/222 (70%), Gaps = 18/222 (8%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            VK    LSP+FEL PGSV NK+ Y  DFP+GHIA+K F AEVVDE GN +PLH+TYLHHW
Sbjct  34   VKTAIFLSPKFELGPGSVANKYDYDADFPRGHIALKSFNAEVVDEAGNPVPLHETYLHHW  93

Query  438  IVGKYMIRK----------DEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSV  295
            +V +Y   K            ++  +D +F V NSG+C    L QY+GLGSETR T + V
Sbjct  94   VVVRYYQPKYVTTHTNYDGHRILHNSDHIF-VRNSGICQRDILGQYYGLGSETRGTATDV  152

Query  294  PDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL  124
            PDP+GI VG+P   P G EE WM+N+HAIDTRG  + + GCTECRCDLYNVTK E G PL
Sbjct  153  PDPFGIVVGDPAEIPEGYEEKWMVNIHAIDTRGVVD-RMGCTECRCDLYNVTKKEHGEPL  211

Query  123  -GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
              DY GG  CCYD  +CR+++GF G KR LYL+YTV +V+WN
Sbjct  212  SSDYKGGYYCCYDQTQCRLREGFEGPKRSLYLRYTVKWVEWN  253



>ref|NP_001240902.1| uncharacterized protein LOC100784767 precursor [Glycine max]
 gb|ACU17750.1| unknown [Glycine max]
Length=434

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 155/222 (70%), Gaps = 18/222 (8%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            VK    LSP+FEL PGSV NK+ Y  DFP+GHIA+K F AEVVDE GN +PLH+TYLHHW
Sbjct  34   VKTAIFLSPKFELGPGSVANKYDYDADFPRGHIALKSFNAEVVDEAGNPVPLHETYLHHW  93

Query  438  IVGKYMIRK----------DEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSV  295
            +V +Y   K            ++  +D +F V NSG+C    L QY+GLGSETR T + V
Sbjct  94   VVVRYYQPKYVTTHTNYDGHRILHNSDHIF-VRNSGLCQRDTLGQYYGLGSETRGTATDV  152

Query  294  PDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL  124
            PDP+GI VG+P   P G EE WM+N+HAIDTRG  + + GCTECRCDLYNVTK E G PL
Sbjct  153  PDPFGIVVGDPAEIPEGYEEKWMVNIHAIDTRGVVD-RMGCTECRCDLYNVTKKEHGEPL  211

Query  123  -GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
              DY GG  CCYD  +CR+++GF G KR LYL+YTV +V+WN
Sbjct  212  SSDYKGGYYCCYDQTQCRLREGFEGPKRSLYLRYTVKWVEWN  253



>ref|XP_010663820.1| PREDICTED: uncharacterized protein LOC100243857 isoform X2 [Vitis 
vinifera]
Length=422

 Score =   249 bits (637),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 154/219 (70%), Gaps = 15/219 (7%)
 Frame = -3

Query  615  KVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHWI  436
            K    LSP F L PGSV + ++  IDFP+GHIA+K F AEVVDE G  +PL + YLHHW+
Sbjct  33   KSAVFLSPEFVLGPGSVVDSYYQDIDFPRGHIALKSFNAEVVDETGLPVPLQEIYLHHWV  92

Query  435  VGKYMIRK-------DEVVEAADKMFL-VGNSGVCAE--LPQYFGLGSETRKTNSSVPDP  286
            + +Y  RK         + E  +  F+ V NSG+C +  L QYFGLGSETRKT + VPDP
Sbjct  93   IERYYQRKGVEAPGSSSIKETHNPDFITVRNSGICQDNVLAQYFGLGSETRKTATHVPDP  152

Query  285  YGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-GD  118
            YGIE+GNP   P G EE W+LNVHAIDTRG  E++ GC ECRCDLYNVT+D  G PL  D
Sbjct  153  YGIEIGNPVEIPDGYEEKWLLNVHAIDTRG-VEDRLGCAECRCDLYNVTEDGHGYPLSSD  211

Query  117  YPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            Y GGLRCCYD  +CRVK+GF G +R LY+KYTV +VDW+
Sbjct  212  YKGGLRCCYDKTQCRVKEGFEGIRRSLYMKYTVKWVDWD  250



>ref|XP_008808813.1| PREDICTED: uncharacterized protein LOC103720742 isoform X1 [Phoenix 
dactylifera]
Length=487

 Score =   251 bits (642),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 180/269 (67%), Gaps = 19/269 (7%)
 Frame = -3

Query  768  IIISQFLDKIYCSSQIRMWCGRllwlgtillltmTVCSSQRSLRIDEENGVKVETLLSPR  589
            +++ Q L K    S+ RM+  +L  L  I LL      + ++L+I + + +K     SP 
Sbjct  3    LVVFQSLKK----SKDRMFHSQLWLLSLITLLPAVALHASQTLKIGDRS-LKTAIFHSPP  57

Query  588  FELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHWIVGKYMIRKD  409
              L PGSV NK ++ I FPKGHIA+K F+AEVVDE G S+PLH+TYLHHW+V ++   K+
Sbjct  58   IILRPGSVANKIYFNIPFPKGHIALKSFDAEVVDENGISVPLHETYLHHWVVERFYSDKE  117

Query  408  EVVEAA--------DKMFLVGNSGVCAE-LPQYFGLGSETRKTNSSVPDPYGIEVGN---  265
              +            K  L  N+G+C   L QYFGLGSETR+T++ VPDPYGIEVGN   
Sbjct  118  HKIPGELSSVDVNLKKFILARNAGICKRTLGQYFGLGSETRRTSTWVPDPYGIEVGNLKD  177

Query  264  PPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-GDYPGGLRCCYD  88
             P G +E W+LNVHAIDTRG  E++ GCTECRC+LYNVTKDE GRPL  DY GGL CCYD
Sbjct  178  IPKGYKEMWLLNVHAIDTRG-VEDRVGCTECRCNLYNVTKDEHGRPLRKDYTGGLYCCYD  236

Query  87   GAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
              +CRV++GF G  R LYLKYTVT+VDW+
Sbjct  237  ETQCRVREGFGGIIRKLYLKYTVTWVDWH  265



>ref|XP_002511073.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51675.1| conserved hypothetical protein [Ricinus communis]
Length=463

 Score =   251 bits (640),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 159/221 (72%), Gaps = 10/221 (5%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            ++  + +K  T LSP+F L PGSV N++++ IDFP+GHIAVK F AEV+DE GNS+PLH+
Sbjct  28   LEHGSNMKSATFLSPKFVLAPGSVENRWYFNIDFPRGHIAVKSFNAEVIDEAGNSVPLHE  87

Query  456  TYLHHWIVGKYMIRKDEVVEAAD---KMFLVGNSGVC--AELPQYFGLGSETRKTNSSVP  292
            TYLHHW+V KY  R D      +    + L  NSG+C    L Q+FGLGSETR T + V 
Sbjct  88   TYLHHWLVEKYYHRLDVANSENNGNSDVMLAKNSGICQGGILRQHFGLGSETRGTATHVS  147

Query  291  DPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-  124
            DPYGIE+GNP   P G EE W+LNVHAIDTRG  E++ GCTEC+CD+YN+T DE GRP+ 
Sbjct  148  DPYGIEIGNPDEIPAGYEERWLLNVHAIDTRG-VEDRLGCTECKCDIYNITVDEFGRPIR  206

Query  123  GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             DY GGL CCYD  +C+V+ G+   +R LYL+YTV +VDW+
Sbjct  207  PDYKGGLFCCYDHTQCKVRPGYEDVRRSLYLRYTVKWVDWD  247



>gb|KEH37065.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=335

 Score =   247 bits (630),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 157/218 (72%), Gaps = 8/218 (4%)
 Frame = -3

Query  633  DEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQT  454
            + +N VK    +SP+ EL PGS+ NKF+Y ++FP+GHIA+K F AE+VDE GNS+PL +T
Sbjct  32   NTKNNVKSAVFMSPKIELSPGSISNKFYYDVEFPRGHIALKSFNAELVDESGNSVPLQET  91

Query  453  YLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYG  280
            YLHHWIV KY   K+        + +V N+G+C +  L QY+GLG+ETR T++ +PDPYG
Sbjct  92   YLHHWIVLKYQQPKNVTNNNQTDIIMVRNNGLCQDDILGQYYGLGAETRGTDTYIPDPYG  151

Query  279  IEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDE-DGRPLG-DY  115
            +E+GNP   P G +E WM+NVHAIDTRG  E+  GC EC+CDLYNVT +   G+PL  +Y
Sbjct  152  VEIGNPSQIPKGYDEKWMINVHAIDTRG-VEDIMGCIECKCDLYNVTINALTGKPLSPNY  210

Query  114  PGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             GGL CC D  +CR+++GF G K  LYLKYT+ +VDW+
Sbjct  211  KGGLGCCPDNGQCRLRKGFLGTKHVLYLKYTIMWVDWD  248



>ref|XP_002284739.2| PREDICTED: uncharacterized protein LOC100243857 isoform X1 [Vitis 
vinifera]
Length=465

 Score =   251 bits (640),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 154/219 (70%), Gaps = 15/219 (7%)
 Frame = -3

Query  615  KVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHWI  436
            K    LSP F L PGSV + ++  IDFP+GHIA+K F AEVVDE G  +PL + YLHHW+
Sbjct  33   KSAVFLSPEFVLGPGSVVDSYYQDIDFPRGHIALKSFNAEVVDETGLPVPLQEIYLHHWV  92

Query  435  VGKYMIRK-------DEVVEAADKMFL-VGNSGVCAE--LPQYFGLGSETRKTNSSVPDP  286
            + +Y  RK         + E  +  F+ V NSG+C +  L QYFGLGSETRKT + VPDP
Sbjct  93   IERYYQRKGVEAPGSSSIKETHNPDFITVRNSGICQDNVLAQYFGLGSETRKTATHVPDP  152

Query  285  YGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-GD  118
            YGIE+GNP   P G EE W+LNVHAIDTRG  E++ GC ECRCDLYNVT+D  G PL  D
Sbjct  153  YGIEIGNPVEIPDGYEEKWLLNVHAIDTRG-VEDRLGCAECRCDLYNVTEDGHGYPLSSD  211

Query  117  YPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            Y GGLRCCYD  +CRVK+GF G +R LY+KYTV +VDW+
Sbjct  212  YKGGLRCCYDKTQCRVKEGFEGIRRSLYMKYTVKWVDWD  250



>gb|KEH31351.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=420

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 157/226 (69%), Gaps = 15/226 (7%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            ++ EN +K    LSP+FEL PGSV NK +Y IDFP+GHIA+K F AEVVDE GN IPLH+
Sbjct  28   LNAENKIKSAVFLSPKFELGPGSVINKEYYDIDFPRGHIALKSFNAEVVDEVGNPIPLHE  87

Query  456  TYLHHWIVGKYMIRKDEVVEAAD--------KMFLVGNSGVCA--ELPQYFGLGSETRKT  307
            TYLHHW VG+Y   K       D         +  V NSG+C    L QYFG+GSETR T
Sbjct  88   TYLHHWGVGRYHQSKHVTHTRNDGKRMLQSSNIVKVRNSGICQGNTLGQYFGIGSETRGT  147

Query  306  NSSVPDPYGIEVGNPP---PGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDED  136
             + +PDP+GIE+GNP     G E+ W+LNVHAIDTRG  E+K GCTEC+C+LYNVT DE 
Sbjct  148  ATDIPDPFGIEIGNPAEVSEGSEDKWVLNVHAIDTRG-VEDKLGCTECKCELYNVTVDEY  206

Query  135  GRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            GR +  DY GG  CCYD  +C++K+GF G KR LYL+YTV +VDW+
Sbjct  207  GRSIRPDYKGGWLCCYDCTQCKLKEGFEGPKRSLYLRYTVKWVDWD  252



>gb|ACJ85534.1| unknown [Medicago truncatula]
Length=420

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 157/226 (69%), Gaps = 15/226 (7%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            ++ EN +K    LSP+FEL PGSV NK +Y IDFP+GHIA+K F AEVVDE GN IPLH+
Sbjct  28   LNAENKIKSAVFLSPKFELGPGSVINKEYYDIDFPRGHIALKSFNAEVVDEVGNPIPLHE  87

Query  456  TYLHHWIVGKYMIRKDEVVEAAD--------KMFLVGNSGVCA--ELPQYFGLGSETRKT  307
            TYLHHW VG+Y   K       D         +  V NSG+C    L QYFG+GSETR T
Sbjct  88   TYLHHWGVGRYHQSKHVTHTRNDGKRMLQSSNIVKVRNSGICQGNTLGQYFGIGSETRGT  147

Query  306  NSSVPDPYGIEVGNPP---PGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDED  136
             + +PDP+GIE+GNP     G E+ W+LNVHAIDTRG  E+K GCTEC+C+LYNVT DE 
Sbjct  148  ATDIPDPFGIEIGNPAEVSEGSEDKWVLNVHAIDTRG-VEDKLGCTECKCELYNVTVDEY  206

Query  135  GRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            GR +  DY GG  CCYD  +C++K+GF G KR LYL+YTV +VDW+
Sbjct  207  GRSIRPDYKGGWLCCYDCTQCKLKEGFEGPKRSLYLRYTVKWVDWD  252



>ref|NP_001062371.1| Os08g0538600 [Oryza sativa Japonica Group]
 dbj|BAD01246.1| putative MtN19 [Oryza sativa Japonica Group]
 dbj|BAD33139.1| putative MtN19 [Oryza sativa Japonica Group]
 dbj|BAF24285.1| Os08g0538600 [Oryza sativa Japonica Group]
 dbj|BAG90628.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55136.1| hypothetical protein OsJ_02924 [Oryza sativa Japonica Group]
Length=424

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 156/214 (73%), Gaps = 9/214 (4%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K +T LSP F L PGSV NKF+Y + FP+GH+A+K F AEVVDE G  +PLH TYLHHW
Sbjct  32   LKSKTFLSPAFFLHPGSVSNKFYYDVPFPRGHLALKSFNAEVVDENGVPVPLHDTYLHHW  91

Query  438  IVGKYMIRKDEVVEAADKM---FLVGNSGVCAE-LPQYFGLGSETRKTNSSVPDPYGIEV  271
            +V  Y   K+     A K+    +  NSGVC + L QY+GLGSETR T + VPDPYGIE+
Sbjct  92   VVEPYYALKNSDSADAQKLPKGIIARNSGVCKKTLGQYYGLGSETRHTATWVPDPYGIEI  151

Query  270  GN---PPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-GDYPGGL  103
            GN   PP G EE W++NVHAIDTRG A +K GCTEC+CDLYN+T DE GR L  DY GGL
Sbjct  152  GNPEKPPEGYEEKWLINVHAIDTRG-AIDKLGCTECKCDLYNMTIDEYGRKLPKDYIGGL  210

Query  102  RCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             CCYD  +C+VK+GF GE R L+L+YTVT++DW+
Sbjct  211  YCCYDETQCKVKEGFNGELRKLFLRYTVTWLDWS  244



>gb|AFK45617.1| unknown [Medicago truncatula]
Length=420

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 157/226 (69%), Gaps = 15/226 (7%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            ++ EN +K    LSP+FEL PGSV NK +Y IDFP+GHIA+K F AEVVDE GN IPLH+
Sbjct  28   LNAENKIKSAVFLSPKFELGPGSVINKEYYDIDFPRGHIALKSFNAEVVDEVGNPIPLHE  87

Query  456  TYLHHWIVGKYMIRKDEVVEAAD--------KMFLVGNSGVCA--ELPQYFGLGSETRKT  307
            TYLHHW VG+Y   K       D         +  V NSG+C    L QYFG+GSETR T
Sbjct  88   TYLHHWGVGRYHQSKHVTHTRNDGKRMLQSSNIVKVRNSGICQGNTLGQYFGIGSETRGT  147

Query  306  NSSVPDPYGIEVGNPP---PGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDED  136
             + +PDP+GIE+GNP     G E+ W+LNVHAIDTRG  E+K GCTEC+C+LYNVT DE 
Sbjct  148  ATDIPDPFGIEIGNPAEVSEGSEDKWVLNVHAIDTRG-VEDKLGCTECKCELYNVTVDEY  206

Query  135  GRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            GR +  DY GG  CCYD  +C++K+GF G KR LYL+YTV +VDW+
Sbjct  207  GRSIRPDYKGGWLCCYDCTQCKLKEGFEGPKRSLYLRYTVKWVDWD  252



>ref|XP_008808814.1| PREDICTED: uncharacterized protein LOC103720742 isoform X2 [Phoenix 
dactylifera]
Length=472

 Score =   250 bits (639),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 163/231 (71%), Gaps = 15/231 (6%)
 Frame = -3

Query  654  SQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGN  475
            + ++L+I + + +K     SP   L PGSV NK ++ I FPKGHIA+K F+AEVVDE G 
Sbjct  22   ASQTLKIGDRS-LKTAIFHSPPIILRPGSVANKIYFNIPFPKGHIALKSFDAEVVDENGI  80

Query  474  SIPLHQTYLHHWIVGKYMIRKDEVVEAA--------DKMFLVGNSGVCAE-LPQYFGLGS  322
            S+PLH+TYLHHW+V ++   K+  +            K  L  N+G+C   L QYFGLGS
Sbjct  81   SVPLHETYLHHWVVERFYSDKEHKIPGELSSVDVNLKKFILARNAGICKRTLGQYFGLGS  140

Query  321  ETRKTNSSVPDPYGIEVGN---PPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNV  151
            ETR+T++ VPDPYGIEVGN    P G +E W+LNVHAIDTRG  E++ GCTECRC+LYNV
Sbjct  141  ETRRTSTWVPDPYGIEVGNLKDIPKGYKEMWLLNVHAIDTRG-VEDRVGCTECRCNLYNV  199

Query  150  TKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            TKDE GRPL  DY GGL CCYD  +CRV++GF G  R LYLKYTVT+VDW+
Sbjct  200  TKDEHGRPLRKDYTGGLYCCYDETQCRVREGFGGIIRKLYLKYTVTWVDWH  250



>gb|ACU22964.1| unknown [Glycine max]
 gb|KHN14320.1| hypothetical protein glysoja_012358 [Glycine soja]
Length=406

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 155/227 (68%), Gaps = 8/227 (4%)
 Frame = -3

Query  660  CSSQRSLRIDE-ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE  484
            C++  S  + + EN +K     SP+ EL PG V NKF++ +DFP+GHIA+K F AE+VDE
Sbjct  23   CTTYSSASLGKPENNIKTSVFKSPKIELGPGLVSNKFYFDVDFPRGHIALKSFNAELVDE  82

Query  483  EGNSIPLHQTYLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRK  310
               S+PL +TYLHHW++ KY   K+        +  V NSG C +  L QYFGLGSETR 
Sbjct  83   SEKSVPLQETYLHHWLIIKYHQPKNVTHNNQTDIVFVRNSGFCQDGTLIQYFGLGSETRG  142

Query  309  TNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDE  139
            T + +PDP+GIEVGNP   P G +E W++NVHAIDTRG  E++ GC ECRCDLYN+TKD 
Sbjct  143  TATDIPDPFGIEVGNPSEIPYGYDEKWLINVHAIDTRG-VEDRLGCIECRCDLYNITKDA  201

Query  138  DGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            DG PL  DY GGL CC D   CR+ +GF+G KR LYLKYTV +  W+
Sbjct  202  DGNPLSPDYKGGLDCCPDNTTCRLNKGFKGPKRTLYLKYTVKWFSWD  248



>gb|KEH41599.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=292

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 153/213 (72%), Gaps = 7/213 (3%)
 Frame = -3

Query  621  GVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHH  442
             +     +SP+ EL PG V NK +Y ++FP+GHI++K F AE+VD+ GNSIPL+QTYLHH
Sbjct  36   NIITNIFMSPKIELNPGFVSNKVYYDVEFPRGHISLKSFNAELVDDAGNSIPLYQTYLHH  95

Query  441  WIVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGIEVG  268
            WIV +Y   K+    +   +    N+G C E  L QY+GLGSETR TN+ +PDPYGIEVG
Sbjct  96   WIVIRYHQPKNVTPNSQSGIIFQRNNGFCQEDILGQYYGLGSETRSTNTYIPDPYGIEVG  155

Query  267  NP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-DYPGGLR  100
            NP   P G  E W++NVHAIDTRG  +++ GC EC CDLYNVTKDE+G  L  +Y GGL+
Sbjct  156  NPAEIPKGYVEKWLINVHAIDTRG-VDDRVGCIECSCDLYNVTKDENGNALSPNYKGGLQ  214

Query  99   CCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            CC D +KC++++GF G K+ +YLKYTV +++W+
Sbjct  215  CCPDNSKCKMRKGFLGPKKSIYLKYTVMWINWD  247



>ref|XP_006586844.1| PREDICTED: uncharacterized protein LOC100791925 [Glycine max]
 gb|KHN23013.1| hypothetical protein glysoja_030683 [Glycine soja]
Length=408

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 150/216 (69%), Gaps = 7/216 (3%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            EN +K    LSP+ EL PG V NK ++ +DFP+GHIA+K F AE+VDE G S+PL + YL
Sbjct  32   ENKIKTSVFLSPKIELGPGLVSNKNYFDVDFPRGHIAIKSFNAELVDEAGKSVPLQEVYL  91

Query  447  HHWIVGKYMIRKD-EVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGI  277
            HHW++ +Y   K+       D + +V NSG C +  L QYFGLGSETR T + +PDP+GI
Sbjct  92   HHWVIVRYHQPKNVSQNNQTDNIVIVRNSGFCQDGFLVQYFGLGSETRGTATDIPDPFGI  151

Query  276  EVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLGD-YPG  109
            EVGNP   P G EE W++NVHAIDTRG  E++ GC ECRCDLYNVTKD DG PL   Y G
Sbjct  152  EVGNPSEIPYGFEEKWLINVHAIDTRGGVEDRLGCIECRCDLYNVTKDADGNPLSPYYKG  211

Query  108  GLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            GL CC D + CR+ +GF+G KR L LKYTV +  W+
Sbjct  212  GLDCCPDNSTCRLNKGFKGPKRTLNLKYTVKWFSWD  247



>ref|XP_003594548.1| MtN19 protein [Medicago truncatula]
Length=404

 Score =   246 bits (629),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 157/218 (72%), Gaps = 8/218 (4%)
 Frame = -3

Query  633  DEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQT  454
            + +N VK    +SP+ EL PGS+ NKF+Y ++FP+GHIA+K F AE+VDE GNS+PL +T
Sbjct  24   NTKNNVKSAVFMSPKIELSPGSISNKFYYDVEFPRGHIALKSFNAELVDESGNSVPLQET  83

Query  453  YLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYG  280
            YLHHWIV KY   K+        + +V N+G+C +  L QY+GLG+ETR T++ +PDPYG
Sbjct  84   YLHHWIVLKYQQPKNVTNNNQTDIIMVRNNGLCQDDILGQYYGLGAETRGTDTYIPDPYG  143

Query  279  IEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDE-DGRPLG-DY  115
            +E+GNP   P G +E WM+NVHAIDTRG  E+  GC EC+CDLYNVT +   G+PL  +Y
Sbjct  144  VEIGNPSQIPKGYDEKWMINVHAIDTRG-VEDIMGCIECKCDLYNVTINALTGKPLSPNY  202

Query  114  PGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             GGL CC D  +CR+++GF G K  LYLKYT+ +VDW+
Sbjct  203  KGGLGCCPDNGQCRLRKGFLGTKHVLYLKYTIMWVDWD  240



>gb|AFK34663.1| unknown [Medicago truncatula]
Length=412

 Score =   246 bits (629),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 157/218 (72%), Gaps = 8/218 (4%)
 Frame = -3

Query  633  DEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQT  454
            + +N VK    +SP+ EL PGS+ NKF+Y ++FP+GHIA+K F AE+VDE GNS+PL +T
Sbjct  32   NTKNNVKSAVFMSPKIELSPGSISNKFYYDVEFPRGHIALKSFNAELVDESGNSVPLQET  91

Query  453  YLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYG  280
            YLHHWIV KY   K+        + +V N+G+C +  L QY+GLG+ETR T++ +PDPYG
Sbjct  92   YLHHWIVLKYQQPKNVTNNNQTDIIMVRNNGLCQDDILGQYYGLGAETRGTDTYIPDPYG  151

Query  279  IEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDE-DGRPLG-DY  115
            +E+GNP   P G +E WM+NVHAIDTRG  E+  GC EC+CDLYNVT +   G+PL  +Y
Sbjct  152  VEIGNPSQIPKGYDEKWMINVHAIDTRG-VEDIMGCIECKCDLYNVTINALTGKPLSPNY  210

Query  114  PGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             GGL CC D  +CR+++GF G K  LYLKYT+ +VDW+
Sbjct  211  KGGLGCCPDNGQCRLRKGFLGTKHVLYLKYTIMWVDWD  248



>gb|AES64799.2| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=412

 Score =   246 bits (629),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 157/218 (72%), Gaps = 8/218 (4%)
 Frame = -3

Query  633  DEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQT  454
            + +N VK    +SP+ EL PGS+ NKF+Y ++FP+GHIA+K F AE+VDE GNS+PL +T
Sbjct  32   NTKNNVKSAVFMSPKIELSPGSISNKFYYDVEFPRGHIALKSFNAELVDESGNSVPLQET  91

Query  453  YLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYG  280
            YLHHWIV KY   K+        + +V N+G+C +  L QY+GLG+ETR T++ +PDPYG
Sbjct  92   YLHHWIVLKYQQPKNVTNNNQTDIIMVRNNGLCQDDILGQYYGLGAETRGTDTYIPDPYG  151

Query  279  IEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDE-DGRPLG-DY  115
            +E+GNP   P G +E WM+NVHAIDTRG  E+  GC EC+CDLYNVT +   G+PL  +Y
Sbjct  152  VEIGNPSQIPKGYDEKWMINVHAIDTRG-VEDIMGCIECKCDLYNVTINALTGKPLSPNY  210

Query  114  PGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             GGL CC D  +CR+++GF G K  LYLKYT+ +VDW+
Sbjct  211  KGGLGCCPDNGQCRLRKGFLGTKHVLYLKYTIMWVDWD  248



>ref|XP_003574847.1| PREDICTED: uncharacterized protein LOC100825330 [Brachypodium 
distachyon]
Length=421

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 151/213 (71%), Gaps = 8/213 (4%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K +T  SP F L PGSV NK+++ IDFP+GHIA+K F+AEVVDE+G  IPLH+TYLHHW
Sbjct  29   LKSKTFRSPAFSLGPGSVSNKYYHDIDFPRGHIALKSFDAEVVDEDGVPIPLHETYLHHW  88

Query  438  IVGKYMIRKD--EVVEAADKMFLVGNSGVC-AELPQYFGLGSETRKTNSSVPDPYGIEVG  268
            +   Y   K+  E  E      +  N GVC   L QYFGLGSETR T + VPDPYGIE G
Sbjct  89   VAEPYYALKNIGEADEKKAPAMMARNDGVCKTTLGQYFGLGSETRHTATWVPDPYGIESG  148

Query  267  NP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-DYPGGLR  100
            NP   P G EE WMLN+HAIDTRG A+ K  CTEC+CD YNVT DE GR +  +Y GGL 
Sbjct  149  NPKKVPEGYEEKWMLNIHAIDTRGVAD-KPSCTECKCDFYNVTVDEYGRTISKNYTGGLY  207

Query  99   CCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            CCYD  +C++K+GF GE R L+L+YTVT++DW 
Sbjct  208  CCYDQTQCQLKEGFNGEVRKLFLQYTVTWLDWT  240



>gb|EEC83958.1| hypothetical protein OsI_30065 [Oryza sativa Indica Group]
Length=424

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 154/214 (72%), Gaps = 9/214 (4%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K +T LSP F L PGSV NKF+Y + FP+GH+A+K F AEVVDE G  +PLH+TYLHHW
Sbjct  32   LKSKTFLSPAFFLHPGSVSNKFYYDVPFPRGHLALKSFNAEVVDENGVPVPLHETYLHHW  91

Query  438  IVGKYMIRKDEVVEAADKM---FLVGNSGVCAE-LPQYFGLGSETRKTNSSVPDPYGIEV  271
            +V  Y   K+     A K     +  NSGVC + L QY+GLGSETR T + VPDPYGIE+
Sbjct  92   VVEPYYALKNSDSADAQKRPKGIIARNSGVCKKTLGQYYGLGSETRHTATWVPDPYGIEI  151

Query  270  GN---PPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-GDYPGGL  103
            GN   PP G EE W+ NVHAIDTRG   +K GCTEC+CDLYN+T DE GR L  DY GGL
Sbjct  152  GNPEKPPEGYEEKWLTNVHAIDTRGVI-DKLGCTECKCDLYNMTIDEYGRKLPKDYIGGL  210

Query  102  RCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             CCYD  +C+VK+GF GE R L+L+YTVT++DW+
Sbjct  211  YCCYDETQCKVKEGFNGELRKLFLRYTVTWLDWS  244



>ref|XP_008367082.1| PREDICTED: uncharacterized protein LOC103430711 [Malus domestica]
Length=406

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 155/221 (70%), Gaps = 17/221 (8%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
             K    LSP+F LEPG   +K+FY + FPKGHIA+K F AEV+DEEGNS PLH+ YLHHW
Sbjct  35   TKTGVYLSPKFVLEPGLSSSKYFYNVHFPKGHIALKSFNAEVIDEEGNSSPLHEVYLHHW  94

Query  438  IVGKYMIRKDEV---------VEAADKMFLVGNSGVC--AELPQYFGLGSETRKTNSSVP  292
            IV +Y  R   V         +  +D ++L  NSG+C    L QYFGLGSETRKT + VP
Sbjct  95   IVERYYARIGYVEPEQQLPLQLSESDVIWLR-NSGMCQNGALGQYFGLGSETRKTATDVP  153

Query  291  DPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-  124
              YGIEVG+    P G EE WMLNVHAIDTRG  E+  GCTECRCD+YNV++D+ G+PL 
Sbjct  154  GHYGIEVGDGKGVPDGFEERWMLNVHAIDTRG-VEDDLGCTECRCDMYNVSRDQSGQPLP  212

Query  123  GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
              Y GGL CC DGAKCR+KQGF GEK+  YL+YTV +VDW+
Sbjct  213  AGYTGGLTCCPDGAKCRLKQGFDGEKKNHYLRYTVKWVDWS  253



>gb|KEH41598.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=341

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 153/212 (72%), Gaps = 7/212 (3%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +     +SP+ EL PG V NK +Y ++FP+GHI++K F AE+VD+ GNSIPL+QTYLHHW
Sbjct  37   IITNIFMSPKIELNPGFVSNKVYYDVEFPRGHISLKSFNAELVDDAGNSIPLYQTYLHHW  96

Query  438  IVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGIEVGN  265
            IV +Y   K+    +   +    N+G C E  L QY+GLGSETR TN+ +PDPYGIEVGN
Sbjct  97   IVIRYHQPKNVTPNSQSGIIFQRNNGFCQEDILGQYYGLGSETRSTNTYIPDPYGIEVGN  156

Query  264  P---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-DYPGGLRC  97
            P   P G  E W++NVHAIDTRG  +++ GC EC CDLYNVTKDE+G  L  +Y GGL+C
Sbjct  157  PAEIPKGYVEKWLINVHAIDTRG-VDDRVGCIECSCDLYNVTKDENGNALSPNYKGGLQC  215

Query  96   CYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            C D +KC++++GF G K+ +YLKYTV +++W+
Sbjct  216  CPDNSKCKMRKGFLGPKKSIYLKYTVMWINWD  247



>gb|KEH16840.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=412

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 152/212 (72%), Gaps = 7/212 (3%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K    +SP+ EL PG V NK +Y ++FP+GHI++K F AE+VDE GNS+PLHQTYLHHW
Sbjct  37   IKTNVFMSPKIELRPGFVSNKVYYDVEFPRGHISLKSFNAELVDEAGNSVPLHQTYLHHW  96

Query  438  IVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGIEVGN  265
             V +Y   K+        + +V N G C +  L QY+GLGSETR TN+ +PDPYGIEVGN
Sbjct  97   AVVRYQQPKNVTQNRQSGIIIVRNDGFCQQTILGQYYGLGSETRGTNTYIPDPYGIEVGN  156

Query  264  P---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-DYPGGLRC  97
            P   P G  E W++N+H IDTRG  E++ GC +CRCDLYNVTKDE+G  L  +Y GGL+C
Sbjct  157  PAEIPKGYVEKWLMNIHVIDTRG-VEDRMGCIDCRCDLYNVTKDENGDALSPNYKGGLQC  215

Query  96   CYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            C D  KC++++GF G K+ +YLKYT+ +++W+
Sbjct  216  CPDNTKCKLRKGFLGPKKRIYLKYTIMWINWD  247



>emb|CAA75589.1| MtN19 [Medicago truncatula]
Length=411

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 150/211 (71%), Gaps = 7/211 (3%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            ++ +   SP+ EL PGSV NK +Y +DFP GHI+VK F AEVVDE G+SIPLHQTYLHHW
Sbjct  37   IQTQVFFSPKIELSPGSVSNKIYYDVDFPSGHISVKNFFAEVVDESGHSIPLHQTYLHHW  96

Query  438  IVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGIEVGN  265
            +V +Y   K+    +        N G C E    QY+GLGSETR TN+ +P PYGIEVGN
Sbjct  97   VVVRYHQPKNVTNNSQQGFIFKRNHGFCQENVFGQYYGLGSETRGTNTYIPQPYGIEVGN  156

Query  264  P---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-DYPGGLRC  97
                P G  E W++NVHAIDTRG  E++ GC EC+CDLYNVTKDE+G+ L  +Y GGL+C
Sbjct  157  HEEIPKGYVEKWLINVHAIDTRG-VEDRMGCIECKCDLYNVTKDENGKILSPNYKGGLQC  215

Query  96   CYDGAKCRVKQGFRGEKRGLYLKYTVTYVDW  4
            C D +KC++ +GF G K+ +YLKYT+T+V+W
Sbjct  216  CPDNSKCKLSKGFLGPKQSVYLKYTITWVNW  246



>ref|XP_009360277.1| PREDICTED: uncharacterized protein LOC103950768 [Pyrus x bretschneideri]
 ref|XP_009360278.1| PREDICTED: uncharacterized protein LOC103950768 [Pyrus x bretschneideri]
 ref|XP_009360288.1| PREDICTED: uncharacterized protein LOC103950774 [Pyrus x bretschneideri]
 ref|XP_009360289.1| PREDICTED: uncharacterized protein LOC103950774 [Pyrus x bretschneideri]
Length=406

 Score =   244 bits (622),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 148/220 (67%), Gaps = 15/220 (7%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
             K +  LSP+F LEPG   NK+FY I FPKGHI +K F AEVVD EG S PL++TYLHHW
Sbjct  35   TKTDVYLSPKFVLEPGLSSNKYFYNIQFPKGHIGIKSFNAEVVDAEGRSTPLNETYLHHW  94

Query  438  IVGKYMIRKDEVVEAADKMF--------LVGNSGVC--AELPQYFGLGSETRKTNSSVPD  289
            +V +Y  RK  V       F         V NSGVC    L QY+GLGSETRKT + VP 
Sbjct  95   VVLRYYARKSYVEPKQQSPFQLSESDVIWVENSGVCQSGSLGQYYGLGSETRKTATHVPG  154

Query  288  PYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-G  121
             Y IEVG+    P G EE WM+NVHAIDTRG  +N  GCTECRCDLYNV++D  G+PL  
Sbjct  155  RYAIEVGDGKGLPDGFEERWMVNVHAIDTRGVEDN-LGCTECRCDLYNVSRDPSGQPLPA  213

Query  120  DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             Y GGL CC DGAKCR+KQGF GEK   YL+YTV +VDW+
Sbjct  214  GYTGGLLCCTDGAKCRLKQGFDGEKINHYLRYTVKWVDWS  253



>ref|XP_008392751.1| PREDICTED: uncharacterized protein LOC103454938 [Malus domestica]
Length=372

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 154/221 (70%), Gaps = 17/221 (8%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
             K    LSP+F  EPG   +K+FY + FPKGHIA+K F AEV+DEEGNS PLH+ YLHHW
Sbjct  35   TKTGVYLSPKFVXEPGLSSSKYFYNVHFPKGHIALKSFNAEVIDEEGNSSPLHEVYLHHW  94

Query  438  IVGKYMIRKDEV---------VEAADKMFLVGNSGVC--AELPQYFGLGSETRKTNSSVP  292
            IV +Y  R   V         +  +D ++L  NSG+C    L QYFGLGSETRKT + VP
Sbjct  95   IVERYYARIGYVEPEQQLPLQLSESDVIWLR-NSGMCQNGALGQYFGLGSETRKTATDVP  153

Query  291  DPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-  124
              YGIEVG+    P G EE WMLNVHAIDTRG  E+  GCTECRCD+YNV++D+ G+PL 
Sbjct  154  GHYGIEVGDGKGVPDGFEERWMLNVHAIDTRG-VEDDLGCTECRCDMYNVSRDQSGQPLP  212

Query  123  GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
              Y GGL CC DGAKCR+KQGF GEK+  YL+YTV +VDW+
Sbjct  213  AGYTGGLTCCPDGAKCRLKQGFDGEKKNHYLRYTVKWVDWS  253



>ref|XP_010546109.1| PREDICTED: uncharacterized protein LOC104818287 [Tarenaya hassleriana]
Length=492

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/234 (54%), Positives = 154/234 (66%), Gaps = 29/234 (12%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K    LSP+  L PGSV N++++ IDFP+GHI +K F+AEVVDE GN +PLH+TYLHHW
Sbjct  47   IKSAVFLSPKLVLSPGSVVNEYYHNIDFPRGHIGLKRFDAEVVDEAGNPVPLHETYLHHW  106

Query  438  IVGKYMIRKDEVVEAAD----------------------KMFLVGNSGVCAE-LPQYFGL  328
            I+  Y  RK   +   D                         LV N G+C   L  YFGL
Sbjct  107  IIQPYYARKGVELSEQDLRKNLGFSGQDSHRNLESGSEPDFILVKNGGLCRNTLRHYFGL  166

Query  327  GSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLY  157
            GSETRKT++ VPDPYGIE+GNP   P G E  W+LN HAIDTRG  E++ GCTECRCDLY
Sbjct  167  GSETRKTSTHVPDPYGIEIGNPEEIPDGYEFRWLLNTHAIDTRG-VEDRLGCTECRCDLY  225

Query  156  NVTKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGF-RGEKRGLYLKYTVTYVDWN  1
            N+T DE GRP+  DY GGL CCYD  +CRV++GF  G  R LYLKYTVT+VDW+
Sbjct  226  NITVDEYGRPITSDYKGGLLCCYDKTQCRVRKGFDNGRTRTLYLKYTVTWVDWD  279



>ref|XP_009335863.1| PREDICTED: uncharacterized protein LOC103928535 [Pyrus x bretschneideri]
 ref|XP_009335864.1| PREDICTED: uncharacterized protein LOC103928535 [Pyrus x bretschneideri]
Length=406

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 152/221 (69%), Gaps = 17/221 (8%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
             K    LSP+F LEPG    K+FY + FPKGHIA+K F AE++DEEGNS PLH+ YLHHW
Sbjct  35   TKTGVYLSPKFVLEPGLSSGKYFYNVHFPKGHIALKSFNAEIIDEEGNSSPLHEVYLHHW  94

Query  438  IVGKYMIRKDEV---------VEAADKMFLVGNSGVC--AELPQYFGLGSETRKTNSSVP  292
            +V +Y  RK  V         +   D ++L  NSG+C    L QYFGLGSETRKT + VP
Sbjct  95   VVERYYARKGYVEPEQQLPLQLSELDVIWLR-NSGMCQNGALGQYFGLGSETRKTATHVP  153

Query  291  DPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-  124
              YGIEVG+    P G EE WMLNVHAIDTRG  E   GCTECRCD+YNV++D  G+PL 
Sbjct  154  GHYGIEVGDGKGVPEGFEERWMLNVHAIDTRG-VEYDLGCTECRCDMYNVSRDPSGQPLP  212

Query  123  GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
              Y GGL CC DGAKCR+KQGF GEK+  YL+YTV +VDW+
Sbjct  213  AGYTGGLTCCPDGAKCRLKQGFDGEKKNHYLRYTVKWVDWS  253



>ref|XP_009411808.1| PREDICTED: uncharacterized protein LOC103993457 [Musa acuminata 
subsp. malaccensis]
Length=463

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/233 (52%), Positives = 160/233 (69%), Gaps = 14/233 (6%)
 Frame = -3

Query  663  VCSSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE  484
            +  S  ++   ++  +K    LSP F L PGSV NKF++ I FPKGHIA+K F+AEV+DE
Sbjct  18   IADSVSTMNQQKDRSIKSAVFLSPPFFLHPGSVANKFYFNIPFPKGHIALKSFDAEVIDE  77

Query  483  EGNSIPLHQTYLHHWIVGKYMIRKDEVVEAADKM--------FLVGNSGVC-AELPQYFG  331
             G  +PLH+TYLHHWI+ +Y  RK+ + +   ++          + N+G+C   L QY+G
Sbjct  78   NGIPVPLHETYLHHWIIERYYGRKESLADGNSELKAFNHSNFIWMRNAGICKGTLGQYYG  137

Query  330  LGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDL  160
            LGSETR+T++ VPDPYGIEVGNP   P G +E W+LNVHAIDTRG  E++ GCTEC+C L
Sbjct  138  LGSETRRTSTWVPDPYGIEVGNPEKIPDGYKEKWLLNVHAIDTRG-VEDRFGCTECKCSL  196

Query  159  YNVTKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDW  4
            YNVT DE GR L  DY GGL CCYD  +C+V+ G +   R LYLKYTV +++W
Sbjct  197  YNVTMDEFGRALPKDYDGGLHCCYDQTQCQVRAGIQNVSRILYLKYTVKWLNW  249



>gb|KEH41600.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=412

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 153/212 (72%), Gaps = 7/212 (3%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +     +SP+ EL PG V NK +Y ++FP+GHI++K F AE+VD+ GNSIPL+QTYLHHW
Sbjct  37   IITNIFMSPKIELNPGFVSNKVYYDVEFPRGHISLKSFNAELVDDAGNSIPLYQTYLHHW  96

Query  438  IVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGIEVGN  265
            IV +Y   K+    +   +    N+G C E  L QY+GLGSETR TN+ +PDPYGIEVGN
Sbjct  97   IVIRYHQPKNVTPNSQSGIIFQRNNGFCQEDILGQYYGLGSETRSTNTYIPDPYGIEVGN  156

Query  264  P---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-DYPGGLRC  97
            P   P G  E W++NVHAIDTRG  +++ GC EC CDLYNVTKDE+G  L  +Y GGL+C
Sbjct  157  PAEIPKGYVEKWLINVHAIDTRG-VDDRVGCIECSCDLYNVTKDENGNALSPNYKGGLQC  215

Query  96   CYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            C D +KC++++GF G K+ +YLKYTV +++W+
Sbjct  216  CPDNSKCKMRKGFLGPKKSIYLKYTVMWINWD  247



>ref|XP_008375421.1| PREDICTED: uncharacterized protein LOC103438661 [Malus domestica]
 ref|XP_008375422.1| PREDICTED: uncharacterized protein LOC103438661 [Malus domestica]
Length=406

 Score =   242 bits (617),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 149/220 (68%), Gaps = 15/220 (7%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
             K +  LSP+F LEPG   NK+FY I FPKGHI +K F AEVVD EG S PL++TYLHHW
Sbjct  35   TKTDVYLSPKFVLEPGVSSNKYFYNIQFPKGHIGLKSFNAEVVDAEGRSTPLNETYLHHW  94

Query  438  IVGKYMIRKDEVVE--------AADKMFLVGNSGVC--AELPQYFGLGSETRKTNSSVPD  289
            +V +Y  RK  V          +   +  V NSG C    L QY+GLGSETRKT + VP 
Sbjct  95   VVLRYYARKSYVEPKQQSPYQLSESDVIWVENSGACQPGSLGQYYGLGSETRKTATHVPG  154

Query  288  PYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-G  121
             Y IEVG+    P G EE WMLNVHAIDTRG  +N  GCTECRCDLYNV++D  G+PL  
Sbjct  155  RYAIEVGDGKGLPDGFEERWMLNVHAIDTRGVEDN-LGCTECRCDLYNVSRDPSGQPLPA  213

Query  120  DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             Y GGL CC DGAKCR+K+GF GEK+  YL+YTV +VDW+
Sbjct  214  GYTGGLLCCTDGAKCRLKRGFDGEKKNHYLRYTVKWVDWS  253



>ref|XP_003546270.2| PREDICTED: uncharacterized protein LOC100815629 [Glycine max]
Length=742

 Score =   250 bits (638),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 156/228 (68%), Gaps = 9/228 (4%)
 Frame = -3

Query  660  CSSQRSLRIDE-ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE  484
            C++  S  + + EN +K    LSP+ EL PG V NKF++ +DFP+GHIA+K F AE+VDE
Sbjct  355  CTTYSSASLGKPENNIKTSVFLSPKIELGPGLVSNKFYFDVDFPRGHIALKSFNAELVDE  414

Query  483  EGNSIPLHQTYLHHWIVGKYMIRKDEV-VEAADKMFLVGNSGVCAELP--QYFGLGSETR  313
             G S+PL +TYLHHW + KY   K+       D +  V NSG C + P  QYFGLGSETR
Sbjct  415  SGKSLPLQETYLHHWFIIKYQQPKNVTHNNPTDNIVYVRNSGFCQDGPLIQYFGLGSETR  474

Query  312  KTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKD  142
             T + +PDP+GIEVGNP   P G +E W++NVH IDTRG  E++ GC ECRCDLYN+TKD
Sbjct  475  GTATDIPDPFGIEVGNPSDIPYGYDEKWLINVHPIDTRG-VEDRLGCIECRCDLYNITKD  533

Query  141  EDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             DG PL  DY GGL CC D   CR+ +GF+G KR LYLKYTV +  W+
Sbjct  534  ADGNPLSPDYKGGLDCCPDNTTCRLNKGFKGPKRTLYLKYTVKWFSWD  581


 Score =   248 bits (632),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 155/227 (68%), Gaps = 8/227 (4%)
 Frame = -3

Query  660  CSSQRSLRIDE-ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE  484
            C++  S  + + EN +K     SP+ EL PG V NKF++ +DFP+GHIA+K F AE+VDE
Sbjct  23   CTTYSSASLGKPENNIKTSVFKSPKIELGPGLVSNKFYFDVDFPRGHIALKSFNAELVDE  82

Query  483  EGNSIPLHQTYLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRK  310
               S+PL +TYLHHW++ KY   K+        +  V NSG C +  L QYFGLGSETR 
Sbjct  83   SEKSVPLQETYLHHWLIIKYHQPKNVTHNNQTDIVFVRNSGFCQDGTLIQYFGLGSETRG  142

Query  309  TNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDE  139
            T + +PDP+GIEVGNP   P G +E W++NVHAIDTRG  E++ GC ECRCDLYN+TKD 
Sbjct  143  TATDIPDPFGIEVGNPSEIPYGYDEKWLINVHAIDTRG-VEDRLGCIECRCDLYNITKDA  201

Query  138  DGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            DG PL  DY GGL CC D   CR+ +GF+G KR LYLKYTV +  W+
Sbjct  202  DGNPLSPDYKGGLDCCPDNTTCRLNKGFKGPKRTLYLKYTVKWFSWD  248



>ref|XP_009373664.1| PREDICTED: uncharacterized protein LOC103962646 [Pyrus x bretschneideri]
 ref|XP_009373665.1| PREDICTED: uncharacterized protein LOC103962646 [Pyrus x bretschneideri]
Length=406

 Score =   241 bits (616),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 152/221 (69%), Gaps = 17/221 (8%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
             K    LSP+F LEPG    K+FY + FPKGHIA+K F AE++DEEGNS PLH+ Y+HHW
Sbjct  35   TKTGVYLSPKFVLEPGLSSGKYFYNVHFPKGHIALKSFNAEIIDEEGNSSPLHEVYVHHW  94

Query  438  IVGKYMIRKDEV---------VEAADKMFLVGNSGVC--AELPQYFGLGSETRKTNSSVP  292
            +V +Y  RK  V            +D ++L  NSG+C    L QYFGLGSETRKT + VP
Sbjct  95   LVERYYARKGYVEPDQQLPQQFSESDVIWLR-NSGMCQNGALGQYFGLGSETRKTATHVP  153

Query  291  DPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-  124
              YGIEVG+    P G EE WMLNVHAIDTRG  E   GCTECRCD+YNV++D  G+PL 
Sbjct  154  GHYGIEVGDGKGVPEGFEERWMLNVHAIDTRG-VEYDLGCTECRCDMYNVSRDPSGQPLP  212

Query  123  GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
              Y GGL CC DGAKCR+KQGF GEK+  YL+YTV +VDW+
Sbjct  213  AGYAGGLTCCPDGAKCRLKQGFGGEKKNHYLRYTVKWVDWS  253



>ref|XP_006844651.1| hypothetical protein AMTR_s00016p00236400 [Amborella trichopoda]
 gb|ERN06326.1| hypothetical protein AMTR_s00016p00236400 [Amborella trichopoda]
Length=392

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 157/217 (72%), Gaps = 10/217 (5%)
 Frame = -3

Query  630  EENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTY  451
            +E  V+    LSP+F L PG   N  +  IDFPKGHIAVK F AE+VDE+GNS+PL++TY
Sbjct  28   QEAKVQSSVFLSPKFILTPGLANNTVYLDIDFPKGHIAVKDFIAELVDEDGNSVPLYETY  87

Query  450  LHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGI  277
            LHHWIV +Y +R+D+  +    + +  N GVC +  L  YFGLG+E+RKT + +PDPYGI
Sbjct  88   LHHWIVFRYFVREDD--KNGSSIVVARNDGVCQDGALDFYFGLGAESRKTRTWLPDPYGI  145

Query  276  EVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLGD-YPG  109
            +VG+P   P G +E W LNVHAIDTRG  E++ GCTECRCDL+NVTKD +GRP+ D Y G
Sbjct  146  QVGDPDKIPSGRDEKWALNVHAIDTRGV-EDRFGCTECRCDLFNVTKDSNGRPIRDNYLG  204

Query  108  GLRCCYDGAKCRVKQGFRG-EKRGLYLKYTVTYVDWN  1
            GL CCYDG +C+  +G +    RGL+LKYTV +V+W+
Sbjct  205  GLSCCYDGTRCKRNEGLKWLGARGLHLKYTVKWVEWD  241



>ref|XP_011040297.1| PREDICTED: uncharacterized protein LOC105136595 isoform X2 [Populus 
euphratica]
Length=462

 Score =   241 bits (615),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 160/227 (70%), Gaps = 15/227 (7%)
 Frame = -3

Query  663  VCSSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE  484
            V  +Q SL  +  N +K  T LSP F L PGSV +K +  IDFP+GHIA+K F AEVVD+
Sbjct  26   VSCTQASL--ENGNKIKSRTFLSPEFMLGPGSVESKTYDDIDFPRGHIALKSFNAEVVDQ  83

Query  483  EGNSIPLHQTYLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRK  310
             GN + L++TY+HHW+VGKY   +      + + F   NSG+C    L QYFGLGSETRK
Sbjct  84   AGNPVALYETYIHHWLVGKYYEHR-----PSGRNF-SRNSGLCQGQILGQYFGLGSETRK  137

Query  309  TNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDE  139
            T S +PDP+GIE+GNP   P G +E W L +HAI+TRG  E++ GC EC CDLYNVT DE
Sbjct  138  TASHIPDPFGIEIGNPAEIPEGYQEKWYLGIHAIETRG-VEDRLGCIECWCDLYNVTNDE  196

Query  138  DGRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            DG P+  DY GGL CCYD  +C+V+QGF+G+KR LYL+YTV ++DW+
Sbjct  197  DGDPIRPDYKGGLFCCYDQTQCKVRQGFQGDKRSLYLRYTVKWIDWD  243



>emb|CDY53158.1| BnaCnng24580D [Brassica napus]
Length=494

 Score =   242 bits (617),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/222 (55%), Positives = 152/222 (68%), Gaps = 11/222 (5%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            +  E  +K  + LSP+  + PGSV N F + IDFP+GHI +KGF+AEVVD++GN +PLH+
Sbjct  65   LKTEKKIKSASFLSPKLVMNPGSVANPFLFDIDFPRGHIGIKGFDAEVVDQDGNPVPLHE  124

Query  456  TYLHHWIVGKYMIRKDEVVEAADK--MFLVGNSGVCAE-LPQYFGLGSETRKTNSSVPDP  286
            TYLHHW+V  Y +RKD       K    LV N G+C   +  +FGLGSETRKT++ VPDP
Sbjct  125  TYLHHWVVQPYYVRKDNARHLGSKPDYILVRNGGLCRNTVRHFFGLGSETRKTSTHVPDP  184

Query  285  YGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-D  118
            Y IE+ NP   P G E  W+LN+HAIDTRG  + K GCTECRC+LYNVT DE GR +  D
Sbjct  185  YAIEIDNPEETPNGYEFKWLLNIHAIDTRGVVD-KSGCTECRCNLYNVTIDEYGRAIKPD  243

Query  117  YPGGLRCCYDGAKCRVKQGFRG---EKRGLYLKYTVTYVDWN  1
            Y GGL CCYD  +C V+ GF     + R LYLKYTV +VDW+
Sbjct  244  YKGGLYCCYDKTQCLVRNGFDSVEEKTRTLYLKYTVRWVDWD  285



>ref|XP_011040295.1| PREDICTED: uncharacterized protein LOC105136595 isoform X1 [Populus 
euphratica]
 ref|XP_011040296.1| PREDICTED: uncharacterized protein LOC105136595 isoform X1 [Populus 
euphratica]
Length=467

 Score =   241 bits (615),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 160/227 (70%), Gaps = 15/227 (7%)
 Frame = -3

Query  663  VCSSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE  484
            V  +Q SL  +  N +K  T LSP F L PGSV +K +  IDFP+GHIA+K F AEVVD+
Sbjct  31   VSCTQASL--ENGNKIKSRTFLSPEFMLGPGSVESKTYDDIDFPRGHIALKSFNAEVVDQ  88

Query  483  EGNSIPLHQTYLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRK  310
             GN + L++TY+HHW+VGKY   +      + + F   NSG+C    L QYFGLGSETRK
Sbjct  89   AGNPVALYETYIHHWLVGKYYEHR-----PSGRNF-SRNSGLCQGQILGQYFGLGSETRK  142

Query  309  TNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDE  139
            T S +PDP+GIE+GNP   P G +E W L +HAI+TRG  E++ GC EC CDLYNVT DE
Sbjct  143  TASHIPDPFGIEIGNPAEIPEGYQEKWYLGIHAIETRG-VEDRLGCIECWCDLYNVTNDE  201

Query  138  DGRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            DG P+  DY GGL CCYD  +C+V+QGF+G+KR LYL+YTV ++DW+
Sbjct  202  DGDPIRPDYKGGLFCCYDQTQCKVRQGFQGDKRSLYLRYTVKWIDWD  248



>ref|XP_006844648.1| hypothetical protein AMTR_s00016p00235580 [Amborella trichopoda]
 gb|ERN06323.1| hypothetical protein AMTR_s00016p00235580 [Amborella trichopoda]
Length=416

 Score =   239 bits (610),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 157/217 (72%), Gaps = 12/217 (6%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K    LSP+F ++PG+V N F+Y IDFP GHIA+KGF+AE+VDE GN +PL++TY+HH 
Sbjct  34   LKTSVFLSPKFIMKPGTVQNNFYYNIDFPTGHIAIKGFDAEIVDEAGNPVPLYETYIHHL  93

Query  438  IVGKYMIRKDEVVEAAD---KMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGIE  274
             + +Y        ++ D     F+V N+GVC +  L QYFGLG E+RKT +++PDPYG+E
Sbjct  94   AIVRYYAPPSSDQKSKDGPNSKFVVRNAGVCQDDILNQYFGLGPESRKTRTTLPDPYGVE  153

Query  273  VGNPPPGL----EEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLGD-YPG  109
            VG PP G     EE WMLN+HAID RG  +  + C ECRCDLYNVT+DE+GR + D Y G
Sbjct  154  VGVPPEGTPDGYEEGWMLNIHAIDMRGVKDRSK-CGECRCDLYNVTEDENGRSIEDNYYG  212

Query  108  GLRCCYDGAKCRVKQGFRG-EKRGLYLKYTVTYVDWN  1
            GLRCCYDG +CR+K+G +G   +G+YLKYTV +++W+
Sbjct  213  GLRCCYDGTQCRLKEGLQGLGAKGVYLKYTVKWMEWD  249



>gb|AES64800.2| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=826

 Score =   248 bits (633),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 153/211 (73%), Gaps = 7/211 (3%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            ++ +   SP+ EL PGSV NKF+Y  DFP+GHI++K F AEVV+E GNS+PLHQTYLHHW
Sbjct  40   IQTQVFFSPKIELSPGSVSNKFYYDADFPRGHISLKSFFAEVVNESGNSVPLHQTYLHHW  99

Query  438  IVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGIEVGN  265
             V +Y   K+    + + + L  N G C E  + Q +GLGSETR TN+ +PDPYGIEVGN
Sbjct  100  TVTRYHQPKNVTNNSKEGIILKRNHGFCEENVIEQNYGLGSETRGTNTYIPDPYGIEVGN  159

Query  264  P---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-DYPGGLRC  97
            P   P G  E W++NVHAIDTRG  E++ GC EC+CDLYNVTKDE+G+ L  +Y GGL+C
Sbjct  160  PEEIPKGYVEKWLINVHAIDTRG-VEDRMGCIECKCDLYNVTKDENGKILSPNYKGGLQC  218

Query  96   CYDGAKCRVKQGFRGEKRGLYLKYTVTYVDW  4
            C D +KC++ +GF G K+ LYLKYT+ ++ W
Sbjct  219  CPDNSKCKLSKGFLGPKQNLYLKYTIMWIKW  249


 Score =   244 bits (624),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 150/211 (71%), Gaps = 7/211 (3%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            ++ +   SP+ EL PGSV NK +Y +DFP GHI+VK F AEVVDE G+SIPLHQTYLHHW
Sbjct  452  IQTQVFFSPKIELSPGSVSNKIYYDVDFPSGHISVKNFFAEVVDESGHSIPLHQTYLHHW  511

Query  438  IVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGIEVGN  265
            +V +Y   K+    +        N G C E    QY+GLGSETR TN+ +P PYGIEVGN
Sbjct  512  VVVRYHQPKNVTNNSQQGFIFKRNHGFCQENVFGQYYGLGSETRGTNTYIPQPYGIEVGN  571

Query  264  P---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-DYPGGLRC  97
                P G  E W++NVHAIDTRG  E++ GC EC+CDLYNVTKDE+G+ L  +Y GGL+C
Sbjct  572  HEEIPKGYVEKWLINVHAIDTRG-VEDRMGCIECKCDLYNVTKDENGKILSPNYKGGLQC  630

Query  96   CYDGAKCRVKQGFRGEKRGLYLKYTVTYVDW  4
            C D +KC++ +GF G K+ +YLKYT+T+V+W
Sbjct  631  CPDNSKCKLSKGFLGPKQSVYLKYTITWVNW  661



>ref|XP_003594549.1| MtN19 protein [Medicago truncatula]
Length=882

 Score =   249 bits (635),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 153/211 (73%), Gaps = 7/211 (3%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            ++ +   SP+ EL PGSV NKF+Y  DFP+GHI++K F AEVV+E GNS+PLHQTYLHHW
Sbjct  96   IQTQVFFSPKIELSPGSVSNKFYYDADFPRGHISLKSFFAEVVNESGNSVPLHQTYLHHW  155

Query  438  IVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGIEVGN  265
             V +Y   K+    + + + L  N G C E  + Q +GLGSETR TN+ +PDPYGIEVGN
Sbjct  156  TVTRYHQPKNVTNNSKEGIILKRNHGFCEENVIEQNYGLGSETRGTNTYIPDPYGIEVGN  215

Query  264  P---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-DYPGGLRC  97
            P   P G  E W++NVHAIDTRG  E++ GC EC+CDLYNVTKDE+G+ L  +Y GGL+C
Sbjct  216  PEEIPKGYVEKWLINVHAIDTRG-VEDRMGCIECKCDLYNVTKDENGKILSPNYKGGLQC  274

Query  96   CYDGAKCRVKQGFRGEKRGLYLKYTVTYVDW  4
            C D +KC++ +GF G K+ LYLKYT+ ++ W
Sbjct  275  CPDNSKCKLSKGFLGPKQNLYLKYTIMWIKW  305


 Score =   245 bits (625),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 150/211 (71%), Gaps = 7/211 (3%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            ++ +   SP+ EL PGSV NK +Y +DFP GHI+VK F AEVVDE G+SIPLHQTYLHHW
Sbjct  508  IQTQVFFSPKIELSPGSVSNKIYYDVDFPSGHISVKNFFAEVVDESGHSIPLHQTYLHHW  567

Query  438  IVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGIEVGN  265
            +V +Y   K+    +        N G C E    QY+GLGSETR TN+ +P PYGIEVGN
Sbjct  568  VVVRYHQPKNVTNNSQQGFIFKRNHGFCQENVFGQYYGLGSETRGTNTYIPQPYGIEVGN  627

Query  264  P---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-DYPGGLRC  97
                P G  E W++NVHAIDTRG  E++ GC EC+CDLYNVTKDE+G+ L  +Y GGL+C
Sbjct  628  HEEIPKGYVEKWLINVHAIDTRG-VEDRMGCIECKCDLYNVTKDENGKILSPNYKGGLQC  686

Query  96   CYDGAKCRVKQGFRGEKRGLYLKYTVTYVDW  4
            C D +KC++ +GF G K+ +YLKYT+T+V+W
Sbjct  687  CPDNSKCKLSKGFLGPKQSVYLKYTITWVNW  717



>ref|XP_006659641.1| PREDICTED: uncharacterized protein LOC102706312 [Oryza brachyantha]
Length=424

 Score =   239 bits (610),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 151/214 (71%), Gaps = 9/214 (4%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K +T LSP F L PGSV NKF+Y + FP+GH+A K F+AEVVDE G  +PLH+TYLHHW
Sbjct  32   LKSKTFLSPPFFLRPGSVSNKFYYDVPFPRGHLAFKSFDAEVVDENGAPVPLHETYLHHW  91

Query  438  IVGKYMIRKD---EVVEAADKMFLVGNSGVCAE-LPQYFGLGSETRKTNSSVPDPYGIEV  271
            +V  Y   K       +   K  +  NSGVC   L QY+GLGSETR T + VPDPYGIE+
Sbjct  92   VVEPYYALKKGGGADAQGLPKRIIARNSGVCKNTLGQYYGLGSETRHTATWVPDPYGIEI  151

Query  270  GN---PPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLGD-YPGGL  103
            GN    P G EE WM+NVHAIDTRG A +K GCTEC+CDLYN T DE GR L + Y GGL
Sbjct  152  GNTETAPEGYEERWMINVHAIDTRG-AVDKLGCTECKCDLYNTTIDEYGRRLPEGYVGGL  210

Query  102  RCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             CCYD  +C+V++GF GE R L+L+YTV ++DW+
Sbjct  211  YCCYDETQCKVREGFNGELRKLFLRYTVRWLDWS  244



>gb|KGN63844.1| hypothetical protein Csa_1G024275 [Cucumis sativus]
Length=461

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/224 (54%), Positives = 145/224 (65%), Gaps = 19/224 (8%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K +T LSP F + PG V  KFFY I+FPK HIA+K F  EVVDE GN IPL QTYLHHW
Sbjct  61   IKTQTFLSPSFTMTPGLVIEKFFYNINFPKSHIAIKSFHVEVVDESGNQIPLSQTYLHHW  120

Query  438  IVGKYMIRKDEVVEAADKMF---------LVGNSGVCAE--LPQYFGLGSETRKTNSSVP  292
            ++ +Y   K+      +  +         +  NSGVC    LP Y+ +GSE+RK ++ +P
Sbjct  121  VLVRYYQHKNATNPTINTSYNELQEPNFIIASNSGVCERNILPAYYAMGSESRKLSTFLP  180

Query  291  DPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG  121
             PYGIEVGNP   P   EE W LNVHAIDTRG AENK GC EC C LYN+TKD  GRPL 
Sbjct  181  HPYGIEVGNPKEIPTDYEERWSLNVHAIDTRG-AENKLGCIECHCHLYNITKDRSGRPLT  239

Query  120  -DYPGGLRCCYDGAKCRVKQGFRGE---KRGLYLKYTVTYVDWN  1
             DY GGLRCCYD  KCRV     GE   +R L+++Y V +VDWN
Sbjct  240  EDYKGGLRCCYDKTKCRVNALSDGEDFPERNLFVRYRVKWVDWN  283



>ref|XP_004160448.1| PREDICTED: uncharacterized protein LOC101226527 [Cucumis sativus]
Length=431

 Score =   237 bits (605),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 121/224 (54%), Positives = 145/224 (65%), Gaps = 19/224 (8%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K +T LSP F + PG V  KFFY I+FPK HIA+K F  EVVDE GN IPL QTYLHHW
Sbjct  31   IKTQTFLSPSFTMTPGLVIEKFFYNINFPKSHIAIKSFHVEVVDESGNQIPLPQTYLHHW  90

Query  438  IVGKYMIRKDEVVEAADKMF---------LVGNSGVCAE--LPQYFGLGSETRKTNSSVP  292
            ++ +Y   K+      +  +         +  NSGVC    LP Y+ +GSE+RK ++ +P
Sbjct  91   VLVRYYQHKNATNPTINTSYNELQEPNFIIASNSGVCERNILPAYYAMGSESRKLSTFLP  150

Query  291  DPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG  121
             PYGIEVGNP   P   EE W LNVHAIDTRG AENK GC EC C LYN+TKD  GRPL 
Sbjct  151  HPYGIEVGNPKEIPTDYEERWSLNVHAIDTRG-AENKLGCIECHCHLYNITKDRSGRPLT  209

Query  120  -DYPGGLRCCYDGAKCRVKQGFRGE---KRGLYLKYTVTYVDWN  1
             DY GGLRCCYD  KCRV     GE   +R L+++Y V +VDWN
Sbjct  210  EDYKGGLRCCYDKTKCRVNVLSDGEDFQERNLFVRYRVKWVDWN  253



>ref|XP_008453444.1| PREDICTED: uncharacterized protein LOC103494150 [Cucumis melo]
Length=414

 Score =   236 bits (603),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 160/229 (70%), Gaps = 18/229 (8%)
 Frame = -3

Query  648  RSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSI  469
             +++I+ +  +K ++ LSP F L PGSV  KF+Y ++FPKGHIA+K F+AEVVDE+GN +
Sbjct  21   EAIQINHQT-LKTQSFLSPLFTLTPGSVIEKFYYNLNFPKGHIAIKSFDAEVVDEQGNPV  79

Query  468  PLHQTYLHHWIVGKYMIRKDEV--------VEAADKMFLVGNSGVCAE--LPQYFGLGSE  319
             L  TYLHHW + +Y  R  +          + A+ + + GN+GVC    L  ++G+G+E
Sbjct  80   SLFDTYLHHWTIVRYYQRHHKTKTTNHTMNADYANSIIIAGNNGVCQRHTLSYFYGMGTE  139

Query  318  TRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVT  148
             RKT++ +PDPYGIEVGN    P G EE W+LNVHAIDTRG  E++ GC EC+C LY+V+
Sbjct  140  ARKTSNFLPDPYGIEVGNEKEVPLGYEEKWVLNVHAIDTRG-VEDRIGCLECKCSLYDVS  198

Query  147  KDEDGRPLGDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            KDE      DY GG +CCYD A+C+V++G+ GE+R LY+KYTV +VDW+
Sbjct  199  KDELDD---DYKGGFKCCYDKAQCKVREGYNGEERNLYMKYTVQWVDWD  244



>ref|XP_004974041.1| PREDICTED: uncharacterized protein LOC101778177 isoform X1 [Setaria 
italica]
 ref|XP_004974042.1| PREDICTED: uncharacterized protein LOC101778177 isoform X2 [Setaria 
italica]
 ref|XP_004974043.1| PREDICTED: uncharacterized protein LOC101778177 isoform X3 [Setaria 
italica]
Length=433

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 153/215 (71%), Gaps = 10/215 (5%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K +T LSP   L PGSV NK+++ + FP+GHIA+K F AEVVD+ G  +PLH+TYLHHW
Sbjct  32   LKSQTFLSPPIFLRPGSVSNKWYHDVAFPRGHIALKSFNAEVVDDHGVPVPLHETYLHHW  91

Query  438  IVGKYMIRKDEVVEAA---DKMFLVGNSGVCAE-LPQYFGLGSETRKTNSSVPDPYGIEV  271
            +V  Y   KD+    A    KM    NSGVC++ LPQY+GLGSETR T + VPDPYGIE+
Sbjct  92   VVEPYYALKDDAAGEARNRSKMIQHRNSGVCSKTLPQYYGLGSETRHTATWVPDPYGIEI  151

Query  270  GNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-DYPGGL  103
            G+P   P G EE   +NVHAIDTRG A +K GCTECRCDLYN+T DE GRP+  DY GGL
Sbjct  152  GDPAAAPEGYEERLRVNVHAIDTRG-AVDKLGCTECRCDLYNLTVDESGRPVADDYVGGL  210

Query  102  RCCYDGAKCRVKQGFRG-EKRGLYLKYTVTYVDWN  1
             CCYD  +C V++GF   E R ++L+YTV + DW+
Sbjct  211  LCCYDETRCMVEEGFVDVEARKVFLRYTVVWQDWS  245



>ref|XP_006374583.1| hypothetical protein POPTR_0015s12020g [Populus trichocarpa]
 gb|ERP52380.1| hypothetical protein POPTR_0015s12020g [Populus trichocarpa]
Length=465

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 154/218 (71%), Gaps = 13/218 (6%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            ++  N +K  T LSP F L PGSV +K +  IDFP+GHIA+K F AEVVD+ GN +PL++
Sbjct  38   LENGNKIKSRTFLSPEFMLGPGSVESKTYDDIDFPRGHIALKSFNAEVVDQAGNPVPLYE  97

Query  456  TYLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPY  283
            TY+HHW+VGKY     E + +        NSG+C    L QYFGLGSETRKT + +PDP+
Sbjct  98   TYIHHWLVGKYY----EHLPSGRNFSR--NSGLCQGQILGQYFGLGSETRKTVTHIPDPF  151

Query  282  GIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-GDY  115
            GIE+GNP   P G +E W L VHAI+TRG  E++ GC EC CDLYNVT DEDG P+  DY
Sbjct  152  GIEIGNPAEIPEGYQEKWYLGVHAIETRG-VEDRLGCIECWCDLYNVTNDEDGNPIRPDY  210

Query  114  PGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             GGL CCY   +C+V+QGF+G KR LYL+YTV ++DW+
Sbjct  211  KGGLFCCYGQTQCKVRQGFQGGKRSLYLRYTVKWIDWD  248



>gb|EMS67244.1| hypothetical protein TRIUR3_19124 [Triticum urartu]
Length=434

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 147/214 (69%), Gaps = 9/214 (4%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K +T  SP   L PGSV NK+ + +DFP+GH+AVK F+AEVVDE G  +PLH+TYLHHW
Sbjct  32   LKSKTFRSPPILLGPGSVSNKYHHDVDFPRGHLAVKSFDAEVVDENGVPVPLHETYLHHW  91

Query  438  IVGKYMIRKDEV---VEAADKMFLVGNSGVC-AELPQYFGLGSETRKTNSSVPDPYGIEV  271
            +   Y   K+      +   K  L  N GVC   L QYFGLGSETR T + VPDPYGIE+
Sbjct  92   VAEPYYALKNSQSPDTQNLPKGMLKRNDGVCKTTLGQYFGLGSETRHTATWVPDPYGIEI  151

Query  270  GN---PPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-DYPGGL  103
            GN    P G EE W+LN+HAIDTRG  + K  CTEC+CD YNVT DE GR +  +Y GGL
Sbjct  152  GNEDKAPEGYEEKWLLNIHAIDTRGVVD-KSSCTECKCDFYNVTIDEYGRTISKNYTGGL  210

Query  102  RCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             CCYD  +CRVK+GF GE R L+L+YTVT++DW 
Sbjct  211  FCCYDQTQCRVKEGFNGEVRKLFLQYTVTWLDWT  244



>ref|XP_004137547.1| PREDICTED: uncharacterized protein LOC101210584 [Cucumis sativus]
Length=447

 Score =   236 bits (601),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/224 (54%), Positives = 145/224 (65%), Gaps = 19/224 (8%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K +T LSP F + PG V  KFFY I+FPK HIA+K F  EVVDE GN IPL QTYLHHW
Sbjct  35   IKTQTFLSPSFTMTPGLVIEKFFYNINFPKSHIAIKSFHVEVVDESGNQIPLPQTYLHHW  94

Query  438  IVGKYMIRKDEVVEAADKMF---------LVGNSGVCAE--LPQYFGLGSETRKTNSSVP  292
            ++ +Y   K+      +  +         +  NSGVC    LP Y+ +GSE+RK ++ +P
Sbjct  95   VLVRYYQHKNATNPTINTSYNELQEPNFIIASNSGVCERNILPAYYAMGSESRKLSTFLP  154

Query  291  DPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG  121
             PYGIEVGNP   P   EE W LNVHAIDTRG AENK GC EC C LYN+TKD  GRPL 
Sbjct  155  HPYGIEVGNPKEIPTDYEERWSLNVHAIDTRG-AENKLGCIECHCHLYNITKDRSGRPLT  213

Query  120  -DYPGGLRCCYDGAKCRVKQGFRGE---KRGLYLKYTVTYVDWN  1
             DY GGLRCCYD  KCRV     GE   +R L+++Y V +VDWN
Sbjct  214  EDYKGGLRCCYDKTKCRVNVLSDGEDFQERNLFVRYRVKWVDWN  257



>gb|EMT06228.1| hypothetical protein F775_26753 [Aegilops tauschii]
Length=422

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 147/214 (69%), Gaps = 9/214 (4%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K +T  SP   L PGSV NK+ + +DFP+GH+AVK F+AEVVDE G  +PLH+TYLHHW
Sbjct  30   LKSKTFRSPPILLGPGSVSNKYHHDVDFPRGHLAVKSFDAEVVDENGVPVPLHETYLHHW  89

Query  438  IVGKYMIRKDEV---VEAADKMFLVGNSGVC-AELPQYFGLGSETRKTNSSVPDPYGIEV  271
            +   Y   K+      +   K  L  N GVC   L QYFGLGSETR T + VPDPYGIE+
Sbjct  90   VAEPYYALKNSQSPDTQNLPKGMLKRNDGVCKTTLGQYFGLGSETRHTATWVPDPYGIEI  149

Query  270  GN---PPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-DYPGGL  103
            GN    P G EE W+LN+HAIDTRG  + K  CTEC+CD YNVT DE GR +  +Y GGL
Sbjct  150  GNEDKAPEGYEEKWLLNIHAIDTRGVVD-KPSCTECKCDFYNVTIDEYGRTISKNYTGGL  208

Query  102  RCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             CCYD  +CRVK+GF GE R L+L+YTVT++DW 
Sbjct  209  FCCYDQTQCRVKEGFNGEVRKLFLQYTVTWLDWT  242



>ref|XP_006374582.1| hypothetical protein POPTR_0015s12010g [Populus trichocarpa]
 gb|ERP52379.1| hypothetical protein POPTR_0015s12010g [Populus trichocarpa]
Length=446

 Score =   236 bits (601),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 155/218 (71%), Gaps = 15/218 (7%)
 Frame = -3

Query  630  EENG--VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            +ENG  +K  T LSP F L PGSV +K +  IDFP+GHIA+K F AEVVD++GN +PL++
Sbjct  21   QENGNKIKSRTYLSPEFMLGPGSVESKTYDDIDFPRGHIALKSFNAEVVDQDGNPVPLYE  80

Query  456  TYLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPY  283
            TY+HHW+VGKY   +        +     NSG+C    L QYFGLGSETRKT + +PDP+
Sbjct  81   TYIHHWLVGKYYENR------PSQRNFSRNSGLCQGQILGQYFGLGSETRKTATHIPDPF  134

Query  282  GIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-GDY  115
            GIE+GNP   P G +E W L +HAI+TRG AE++ GC EC CDLYNVT DE G P+  DY
Sbjct  135  GIEIGNPAEIPEGYQEKWYLGIHAIETRG-AEDRLGCIECWCDLYNVTNDEYGNPIRPDY  193

Query  114  PGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             GGL CCY   +C+V+QGF+G KR LYL+YTV +++W+
Sbjct  194  KGGLFCCYGQTQCKVRQGFQGGKRSLYLRYTVKWIEWD  231



>ref|XP_009130176.1| PREDICTED: uncharacterized protein LOC103854962 [Brassica rapa]
Length=455

 Score =   235 bits (599),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 152/222 (68%), Gaps = 17/222 (8%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K  + LSP+  + PGSV + + + IDFP+GHI +KGF+AEVVD++GN +PLH+TYLHHW
Sbjct  28   IKSASFLSPKQVMTPGSVADPYLFDIDFPRGHIGLKGFDAEVVDQDGNPVPLHETYLHHW  87

Query  438  IVGKYMIRKDEVVEAADK---------MFLVGNSGVC-AELPQYFGLGSETRKTNSSVPD  289
            +V  Y +RK   +   D            LV N G+C   + QYFGLGSETRKT++ VPD
Sbjct  88   VVHPYYVRKGLNLSHLDTPRNLGSSPDYILVSNGGLCRNRVRQYFGLGSETRKTSTYVPD  147

Query  288  PYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-G  121
            PY IE+GNP   P G E  W+LN+HAIDTRG  + K+GCTECRCDLYNVT DE GR L  
Sbjct  148  PYAIEIGNPEKVPDGYEFKWLLNIHAIDTRGVVD-KQGCTECRCDLYNVTVDEYGRALEP  206

Query  120  DYPGGLRCCYDGAKCRVKQGFRG--EKRGLYLKYTVTYVDWN  1
             Y GG  CCYD  +CR++ GF    + R +YLKYTV +VDW+
Sbjct  207  GYKGGQDCCYDKTQCRLRNGFESGNKTRTVYLKYTVRWVDWD  248



>ref|XP_004974037.1| PREDICTED: uncharacterized protein LOC101776668 isoform X1 [Setaria 
italica]
 ref|XP_004974038.1| PREDICTED: uncharacterized protein LOC101776668 isoform X2 [Setaria 
italica]
Length=433

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 153/215 (71%), Gaps = 10/215 (5%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K +T LSP   L PGSV NK+++ I FP+GH+A+K F AEVVD+ G  +PLH+TYLHHW
Sbjct  32   LKSQTFLSPPIFLRPGSVSNKWYHDIAFPRGHLALKSFNAEVVDDHGVPVPLHETYLHHW  91

Query  438  IVGKYMIRKDEVVEAA---DKMFLVGNSGVCAE-LPQYFGLGSETRKTNSSVPDPYGIEV  271
            +V  Y   KD     A    KM    NSGVC++ L QY+GLGSETR T + VPDPYGIE+
Sbjct  92   LVEPYYAPKDGAAGEARNRSKMIRHRNSGVCSQTLGQYYGLGSETRHTATWVPDPYGIEI  151

Query  270  GNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-DYPGGL  103
            G+P   P G EE W++NVHAIDTRG A +K GCTECRCDLYN+T DE GR +  DY GGL
Sbjct  152  GDPAAAPEGYEERWLVNVHAIDTRG-AVDKLGCTECRCDLYNLTVDEFGRRIADDYAGGL  210

Query  102  RCCYDGAKCRVKQGFRG-EKRGLYLKYTVTYVDWN  1
             CCYD  +C+V++GF   E R ++L+YTV + DW+
Sbjct  211  LCCYDETRCKVEEGFVDVEARKVFLRYTVVWQDWS  245



>ref|XP_009150119.1| PREDICTED: uncharacterized protein LOC103873465 [Brassica rapa]
 emb|CDY00232.1| BnaA06g21330D [Brassica napus]
Length=469

 Score =   233 bits (593),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 151/235 (64%), Gaps = 24/235 (10%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            +  E  +K  + LSP+  + PGSV N F + IDFP+GHI +KGF+AEVVD++GN +PLHQ
Sbjct  30   VKTEKKIKSASFLSPKLVMNPGSVANPFLFDIDFPRGHIGIKGFDAEVVDQDGNPVPLHQ  89

Query  456  TYLHHWIVGKYMIRKDEVVEAAD---------------KMFLVGNSGVCAE-LPQYFGLG  325
            TYLHHW+V  Y +RK   +   D                  LV N G+C   +  +FGLG
Sbjct  90   TYLHHWLVQPYYVRKGFNLSQRDMPRNHGFSRHLGSKPDYILVRNGGLCRNTVRHFFGLG  149

Query  324  SETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYN  154
            SETRKT++ VPDPY IE+ NP   P G E  W+LN+HAIDTR   + K GCTECRCDLYN
Sbjct  150  SETRKTSTRVPDPYAIEIDNPEETPDGYEFKWLLNIHAIDTRDVVD-KSGCTECRCDLYN  208

Query  153  VTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRG---EKRGLYLKYTVTYVDWN  1
            VT DE GR +  DY GGL CCYD  +C ++ GF     + R LYLKYTV +VDW+
Sbjct  209  VTIDEYGRAIKPDYKGGLYCCYDKTQCLLRNGFDSVDEKTRTLYLKYTVRWVDWD  263



>ref|XP_009760997.1| PREDICTED: uncharacterized protein LOC104213242 [Nicotiana sylvestris]
Length=225

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 141/188 (75%), Gaps = 14/188 (7%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K    LSP+  LEPGSV NKF++ IDFPKGHIA+K F+AEVVDE GNS+PLH+TYLHHW
Sbjct  1    MKSAVFLSPKIVLEPGSVSNKFYHNIDFPKGHIAIKNFDAEVVDEVGNSVPLHETYLHHW  60

Query  438  IVGKYMIRKD-EVVEAADKM------FLVG-NSGVC-AELPQYFGLGSETRKTNSSVPDP  286
            +V +Y  RK  EV +    +      F+V  NSG+C   L QYFGLGSETRKT + VPDP
Sbjct  61   VVVRYYQRKGVEVAKYHGNLGFHQSDFIVKRNSGICNGGLTQYFGLGSETRKTITYVPDP  120

Query  285  YGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDE-DGRPLGD  118
            YGIEVGNP   PPG E+ W+LNVHAIDTRG AE++ GCTECRCDLYNVTKDE D   + D
Sbjct  121  YGIEVGNPVEVPPGYEQGWLLNVHAIDTRG-AEDRLGCTECRCDLYNVTKDEYDRNIVPD  179

Query  117  YPGGLRCC  94
            Y GGLRCC
Sbjct  180  YVGGLRCC  187



>ref|XP_006394466.1| hypothetical protein EUTSA_v10004123mg [Eutrema salsugineum]
 ref|XP_006394467.1| hypothetical protein EUTSA_v10004123mg [Eutrema salsugineum]
 dbj|BAJ33779.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31752.1| hypothetical protein EUTSA_v10004123mg [Eutrema salsugineum]
 gb|ESQ31753.1| hypothetical protein EUTSA_v10004123mg [Eutrema salsugineum]
Length=476

 Score =   231 bits (588),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/239 (51%), Positives = 152/239 (64%), Gaps = 28/239 (12%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            +  E  +K E  LSP+  + PG+  N F + IDFP+GH  +KGF+AE+VDEEGN +PLH+
Sbjct  29   LGTEKKIKSEVFLSPKLVMNPGNAANPFLFDIDFPRGHYGLKGFDAEMVDEEGNPVPLHE  88

Query  456  TYLHHWIVGKYMIRKDEVVEAAD--------------------KMFLVGNSGVC-AELPQ  340
             YLHHW++  Y +RK   +   D                       LV N G+C   +  
Sbjct  89   LYLHHWVIQPYYVRKGFELSQRDMPRNHGFARQDPGRNLGSKSDFILVNNGGLCRNNVRH  148

Query  339  YFGLGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECR  169
            YFGLGSETRKT++ +PDPY IE+ NP   P G E  W+LN+HAIDTRG  + K GCTECR
Sbjct  149  YFGLGSETRKTSTYLPDPYAIEIDNPEERPDGYEFKWLLNLHAIDTRGVVD-KSGCTECR  207

Query  168  CDLYNVTKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGF-RGEK-RGLYLKYTVTYVDWN  1
            CDLYNVT DE GR +  DY GGL CCYD  +CRV+ GF  GEK R +YLKYTV +VDW+
Sbjct  208  CDLYNVTIDEYGRAIRPDYNGGLYCCYDKTQCRVRNGFDNGEKTRSVYLKYTVKWVDWD  266



>ref|NP_200990.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL38804.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51266.1| unknown protein [Arabidopsis thaliana]
 gb|AED97522.1| uncharacterized protein AT5G61820 [Arabidopsis thaliana]
Length=475

 Score =   231 bits (588),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 122/237 (51%), Positives = 152/237 (64%), Gaps = 29/237 (12%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            E  +K     SP+  + PGSV N + + IDFP+GHI +K F+AEVVDE G  +PLH+TYL
Sbjct  31   EEKIKSAVFYSPKLVMNPGSVANPYLFDIDFPRGHIGLKAFDAEVVDEAGKPVPLHETYL  90

Query  447  HHWIVGKYMIRK--------------------DEVVEAADKMFLVGNSGVCAELP--QYF  334
            HHWIV  Y +RK                    +  +++   + LV N G+C  L    +F
Sbjct  91   HHWIVEPYYVRKGSKLPQREMFRNHGFSREDPESNLDSKSDIILVKNGGLCRSLTLRHFF  150

Query  333  GLGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCD  163
            GLGSETR+T++ VPDPY IE+GNP   P G E  W+LN+HAIDTRG  E+K+GC EC CD
Sbjct  151  GLGSETRETSTYVPDPYAIEIGNPEETPDGYEFKWLLNIHAIDTRGV-EDKKGCIECLCD  209

Query  162  LYNVTKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGF-RGEK-RGLYLKYTVTYVDWN  1
            LYNVT DE GR +   Y GGL CCYD  +CRVK GF  GEK R LYLKYTV +VDW+
Sbjct  210  LYNVTIDEYGRAIRPGYKGGLYCCYDKTQCRVKSGFDNGEKTRTLYLKYTVRWVDWD  266



>ref|XP_004137324.1| PREDICTED: uncharacterized protein LOC101215981 [Cucumis sativus]
Length=416

 Score =   228 bits (582),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 111/225 (49%), Positives = 155/225 (69%), Gaps = 14/225 (6%)
 Frame = -3

Query  648  RSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSI  469
             +++I+ +  +K ++ LSP F L PGSV  KF+Y ++FPKGHIA+K F+AEVVDE+GN +
Sbjct  27   EAIQINHQT-LKTQSFLSPLFTLTPGSVIEKFYYNLNFPKGHIAIKSFDAEVVDEQGNPV  85

Query  468  PLHQTYLHHWIVGKY----MIRKDEVVEAADKMFLVGNSGVCA--ELPQYFGLGSETRKT  307
             L  TYLHHW + +Y               + + + GN+GVC    L  ++G+G+E RKT
Sbjct  86   SLFDTYLHHWTLVRYYQHNKTTTTNHTTNTNSIIIAGNNGVCQPNTLSYFYGMGTEARKT  145

Query  306  NSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDED  136
            ++ +PDPYGIEVGN    P G EE W+LNVHAIDTRG  + + GC EC+C LY+V+KDE 
Sbjct  146  SNFLPDPYGIEVGNEKEVPLGFEEKWVLNVHAIDTRGVVD-RVGCLECKCSLYDVSKDEL  204

Query  135  GRPLGDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
                 DY GG +CCYD A+C+V++G+ GE+R LY+KYTV +VDW+
Sbjct  205  DD---DYIGGFKCCYDKAQCKVREGYNGEERNLYMKYTVQWVDWD  246



>gb|AAL91170.1| putative protein [Arabidopsis thaliana]
Length=475

 Score =   230 bits (586),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 122/237 (51%), Positives = 152/237 (64%), Gaps = 29/237 (12%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            E  +K     SP+  + PGSV N + + IDFP+GHI +K F+AEVVDE G  +PLH+TYL
Sbjct  31   EEKIKSAVFYSPKLVMNPGSVANPYLFDIDFPRGHIGLKAFDAEVVDEAGKPVPLHETYL  90

Query  447  HHWIVGKYMIRK--------------------DEVVEAADKMFLVGNSGVCAELP--QYF  334
            HHWIV  Y +RK                    +  +++   + LV N G+C  L    +F
Sbjct  91   HHWIVEPYYVRKGSKLPQREMFRNHGFSREDPESNLDSKSDIILVKNGGLCRSLTLRHFF  150

Query  333  GLGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCD  163
            GLGSETR+T++ VPDPY IE+GNP   P G E  W+LN+HAIDTRG  E+K+GC EC CD
Sbjct  151  GLGSETRETSTYVPDPYAIEIGNPEETPDGYEFKWLLNIHAIDTRGV-EDKKGCIECFCD  209

Query  162  LYNVTKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGF-RGEK-RGLYLKYTVTYVDWN  1
            LYNVT DE GR +   Y GGL CCYD  +CRVK GF  GEK R LYLKYTV +VDW+
Sbjct  210  LYNVTIDEYGRAIRPGYKGGLYCCYDKTQCRVKSGFDNGEKTRTLYLKYTVRWVDWD  266



>ref|XP_006280401.1| hypothetical protein CARUB_v10026327mg [Capsella rubella]
 gb|EOA13299.1| hypothetical protein CARUB_v10026327mg [Capsella rubella]
Length=477

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 152/240 (63%), Gaps = 29/240 (12%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            +  E  +K     SP+  + PGSV N + + IDFP+GHI +K F+A+VVDE G  +PLH+
Sbjct  29   LGTEKKIKSAIFFSPKLVMNPGSVSNSYLFDIDFPRGHIGLKSFDAQVVDEAGKPVPLHE  88

Query  456  TYLHHWIVGKYMIRKDEVVE--------------------AADKMFLVGNSGVC--AELP  343
            TYLHHWIV  Y +RK   +                     ++  + LV N G+C  A L 
Sbjct  89   TYLHHWIVEPYYVRKGSKLPQQEMFRNHGFQRQDPRSSLGSSSDIILVKNGGLCRGAVLR  148

Query  342  QYFGLGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTEC  172
             YFG GSETRKT++ +PDPY +E+ NP   P G E  W+LN+HAIDTRG AE+K GC EC
Sbjct  149  HYFGSGSETRKTSTYIPDPYAVEIDNPEERPEGYEFKWLLNIHAIDTRG-AEDKTGCIEC  207

Query  171  RCDLYNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGF-RGEK-RGLYLKYTVTYVDWN  1
             CDLYNVT DE GR +G  Y GGL CCYD  +CRVK GF  GEK R L+LKYTV +VDW+
Sbjct  208  LCDLYNVTIDEYGRAIGPGYKGGLYCCYDKTQCRVKSGFDNGEKTRTLFLKYTVRWVDWD  267



>dbj|BAB10082.1| MtN19-like protein [Arabidopsis thaliana]
Length=517

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/237 (51%), Positives = 152/237 (64%), Gaps = 29/237 (12%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            E  +K     SP+  + PGSV N + + IDFP+GHI +K F+AEVVDE G  +PLH+TYL
Sbjct  37   EEKIKSAVFYSPKLVMNPGSVANPYLFDIDFPRGHIGLKAFDAEVVDEAGKPVPLHETYL  96

Query  447  HHWIVGKYMIRK--------------------DEVVEAADKMFLVGNSGVCAELP--QYF  334
            HHWIV  Y +RK                    +  +++   + LV N G+C  L    +F
Sbjct  97   HHWIVEPYYVRKGSKLPQREMFRNHGFSREDPESNLDSKSDIILVKNGGLCRSLTLRHFF  156

Query  333  GLGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCD  163
            GLGSETR+T++ VPDPY IE+GNP   P G E  W+LN+HAIDTRG  E+K+GC EC CD
Sbjct  157  GLGSETRETSTYVPDPYAIEIGNPEETPDGYEFKWLLNIHAIDTRG-VEDKKGCIECLCD  215

Query  162  LYNVTKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGF-RGEK-RGLYLKYTVTYVDWN  1
            LYNVT DE GR +   Y GGL CCYD  +CRVK GF  GEK R LYLKYTV +VDW+
Sbjct  216  LYNVTIDEYGRAIRPGYKGGLYCCYDKTQCRVKSGFDNGEKTRTLYLKYTVRWVDWD  272



>ref|XP_006394469.1| hypothetical protein EUTSA_v10004141mg [Eutrema salsugineum]
 gb|ESQ31755.1| hypothetical protein EUTSA_v10004141mg [Eutrema salsugineum]
Length=472

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 149/239 (62%), Gaps = 28/239 (12%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            +  E  +K    LSP+  + PGSV N F + IDFP+GHI +KGF+AEVVDE GN +PLH+
Sbjct  26   LGTEKKIKSAVFLSPKLVMNPGSVANPFLFDIDFPRGHIGLKGFDAEVVDESGNPVPLHE  85

Query  456  TYLHHWIVGKYMIRKDEVVEAAD--------------------KMFLVGNSGVC-AELPQ  340
            TYLHHW+V  Y +RK   +   D                       LV N G+C   +  
Sbjct  86   TYLHHWVVQPYYVRKGFELSQRDMPRNHGFARQDPERNLGSRSDYILVKNGGLCRNSVRH  145

Query  339  YFGLGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECR  169
            YFGLGSETRKT++ +PDPY IE  NP   P G E  W+LN+HAIDTR   + K GCTECR
Sbjct  146  YFGLGSETRKTSTYLPDPYAIEFDNPEERPDGYEFKWLLNIHAIDTRSVVD-KSGCTECR  204

Query  168  CDLYNVTKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGF-RGEK-RGLYLKYTVTYVDWN  1
            CDLYNVT DE GR L   Y GGL CCYD  +C V+ GF  GEK R LYLKYTV +VDW+
Sbjct  205  CDLYNVTIDEYGRALRPGYNGGLYCCYDKTQCLVRSGFDNGEKTRTLYLKYTVRWVDWD  263



>ref|XP_004160434.1| PREDICTED: uncharacterized protein LOC101223324 [Cucumis sativus]
Length=416

 Score =   227 bits (578),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 155/227 (68%), Gaps = 14/227 (6%)
 Frame = -3

Query  654  SQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGN  475
            +  +++I+ +  +K ++ LSP F L PGSV  KF+Y ++FPKGHIA+K F+AEVVDE+GN
Sbjct  25   NSEAIQINHQT-LKTQSFLSPLFTLTPGSVIEKFYYNLNFPKGHIAIKSFDAEVVDEQGN  83

Query  474  SIPLHQTYLHHWIVGKY----MIRKDEVVEAADKMFLVGNSGVCA--ELPQYFGLGSETR  313
             + L  TYLHHW + +Y               + + + GN+GVC    L  ++G+G+E R
Sbjct  84   PVSLFDTYLHHWTLVRYYQHNKTTTTNHTTNTNSIIIAGNNGVCQPNTLSYFYGMGTEAR  143

Query  312  KTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKD  142
            KT++ +PDPYGIEVGN    P G EE W+LNVHAIDTRG  + + GC EC+C LY+V+KD
Sbjct  144  KTSNFLPDPYGIEVGNEKEVPLGFEEKWVLNVHAIDTRGVVD-RVGCLECKCSLYDVSKD  202

Query  141  EDGRPLGDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            E      DY GG +CCYD A+C+V++G+ GE+  LY+KYTV +VDW+
Sbjct  203  ELDD---DYIGGFKCCYDKAQCKVREGYNGEESNLYMKYTVQWVDWD  246



>ref|XP_002866457.1| hypothetical protein ARALYDRAFT_496351 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42716.1| hypothetical protein ARALYDRAFT_496351 [Arabidopsis lyrata subsp. 
lyrata]
Length=475

 Score =   228 bits (582),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 121/237 (51%), Positives = 151/237 (64%), Gaps = 29/237 (12%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            E  +K     SP+  + PGSV N +   IDFP+GHI +K F+AEVVD+ GN +PLH+TYL
Sbjct  30   EKKIKSAVFYSPKLVMNPGSVANPYLLDIDFPRGHIGLKAFDAEVVDDAGNPVPLHETYL  89

Query  447  HHWIVGKYMIRK--------------------DEVVEAADKMFLVGNSGVCAE--LPQYF  334
            HHWI+  Y +RK                    +  +++   + LV N G+C    L  YF
Sbjct  90   HHWIIEPYYVRKGSKLPQREMFRNHGFSRQDPESNLDSKSDIILVKNGGLCRSVVLRHYF  149

Query  333  GLGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCD  163
            GLGSETRKT++ +PDPY IE+GNP   P G E  W+LN+HAIDTRG  E+K+GC EC C 
Sbjct  150  GLGSETRKTSTYLPDPYAIEIGNPEETPDGYEFKWLLNIHAIDTRG-VEDKKGCIECLCH  208

Query  162  LYNVTKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGF-RGEK-RGLYLKYTVTYVDWN  1
            LYNVT DE GR +   Y GGL CCYD  +CRVK GF  GEK R LYLKYTV +VDW+
Sbjct  209  LYNVTIDEYGRAIRPGYKGGLYCCYDKTQCRVKSGFDNGEKTRTLYLKYTVRWVDWD  265



>ref|XP_010483865.1| PREDICTED: uncharacterized protein LOC104762302 isoform X2 [Camelina 
sativa]
Length=436

 Score =   227 bits (578),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 151/237 (64%), Gaps = 29/237 (12%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            +N +K    LSP+  + PGSV + + + +DFP+GHI +K F+AEVVDE GN +PLH+TYL
Sbjct  29   KNKIKSAVFLSPKLVMSPGSVSDSYLFDMDFPRGHIGLKSFDAEVVDEAGNPVPLHETYL  88

Query  447  HHWIVGKYMIRK--------------------DEVVEAADKMFLVGNSGVC--AELPQYF  334
            HHW+V  Y +RK                       +++A  + LV N G+C  A L  YF
Sbjct  89   HHWVVEPYYVRKGAKLPQQEMFRNHGFQRQDPKSNLDSASDIILVKNGGLCRSAVLRHYF  148

Query  333  GLGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCD  163
            G GSETR T++ VPDPY IE+ NP   P G E  W+LN+HAIDTRG  E+K+GC EC CD
Sbjct  149  GSGSETRNTSTYVPDPYAIEIDNPEERPDGYEFKWLLNIHAIDTRGV-EDKKGCIECLCD  207

Query  162  LYNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGF-RGEK-RGLYLKYTVTYVDWN  1
            LYNVT D  GR +   Y GGL CCYD  +C VK GF  GEK R LYLKYT+ +VDW+
Sbjct  208  LYNVTTDAYGRAMKPGYKGGLYCCYDKTQCLVKSGFDNGEKTRNLYLKYTLRWVDWD  264



>gb|EMT11028.1| hypothetical protein F775_20874 [Aegilops tauschii]
Length=441

 Score =   227 bits (578),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 147/217 (68%), Gaps = 15/217 (7%)
 Frame = -3

Query  633  DEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQT  454
            +  N +K +T LSP F L PG V NK++Y +DFP+GH+A+K F  +VVDE G  +PLH+T
Sbjct  51   EAANVLKTQTFLSPPFFLRPGGVANKWYYDVDFPRGHVAIKSFNGDVVDEAGAPVPLHET  110

Query  453  YLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAE-LPQYFGLGSETRKTNSSVPDPYGI  277
            YLHHW+V  Y                + NSG C + L QYFGLGSETR+T + VPDPYGI
Sbjct  111  YLHHWLVSPYY--------GGPSTIPITNSGPCKDLLGQYFGLGSETRRTATWVPDPYGI  162

Query  276  EVG-NPPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLGD-YPGGL  103
            E+G   P G EE W++NVHAIDTRG A+ K  CTECRCD YNVT DE G  +G+ Y GG+
Sbjct  163  EIGAGAPAGYEERWLINVHAIDTRGAAD-KLACTECRCDAYNVTVDETGNRIGNGYVGGI  221

Query  102  RCCYDGAKCRVKQGF--RGE-KRGLYLKYTVTYVDWN  1
             CCYD  +CRV+  F   GE  R L+L+YTV+++DW+
Sbjct  222  HCCYDSLRCRVEDAFANNGEPPRKLFLRYTVSWLDWS  258



>gb|KEH31353.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=313

 Score =   223 bits (568),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 143/216 (66%), Gaps = 29/216 (13%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE-EGNSIPLHQTY  451
            EN +K    LSP+FEL PGSV N+F+Y IDFP  HIA+K F AEVVDE E  S  + Q Y
Sbjct  31   ENKIKSAVFLSPKFELGPGSVINRFYYYIDFPSDHIALKSFNAEVVDEDEDGSHMMLQNY  90

Query  450  LHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCA--ELPQYFGLGSETRKTNSSVPDPYGI  277
             H                      LV NSG+C    +PQYFGLGSETR T + +PDP+GI
Sbjct  91   DH---------------------VLVRNSGICQGNTIPQYFGLGSETRGTTTDIPDPFGI  129

Query  276  EVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-GDYPG  109
            E G+P   P G EE W+LNVHAIDTRGT E+K GCTEC+CDLYNVT DE G+ +  DY G
Sbjct  130  ETGSPEEIPEGFEEKWLLNVHAIDTRGT-EDKLGCTECKCDLYNVTVDEYGKSIRPDYKG  188

Query  108  GLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            GL CCYD  +C++K+GF G KR LYL+ TV +VDW+
Sbjct  189  GLLCCYDSTRCKLKEGFEGPKRSLYLRCTVKWVDWD  224



>ref|XP_010483864.1| PREDICTED: uncharacterized protein LOC104762302 isoform X1 [Camelina 
sativa]
Length=471

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 151/237 (64%), Gaps = 29/237 (12%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            +N +K    LSP+  + PGSV + + + +DFP+GHI +K F+AEVVDE GN +PLH+TYL
Sbjct  29   KNKIKSAVFLSPKLVMSPGSVSDSYLFDMDFPRGHIGLKSFDAEVVDEAGNPVPLHETYL  88

Query  447  HHWIVGKYMIRK--------------------DEVVEAADKMFLVGNSGVC--AELPQYF  334
            HHW+V  Y +RK                       +++A  + LV N G+C  A L  YF
Sbjct  89   HHWVVEPYYVRKGAKLPQQEMFRNHGFQRQDPKSNLDSASDIILVKNGGLCRSAVLRHYF  148

Query  333  GLGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCD  163
            G GSETR T++ VPDPY IE+ NP   P G E  W+LN+HAIDTRG  E+K+GC EC CD
Sbjct  149  GSGSETRNTSTYVPDPYAIEIDNPEERPDGYEFKWLLNIHAIDTRGV-EDKKGCIECLCD  207

Query  162  LYNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGF-RGEK-RGLYLKYTVTYVDWN  1
            LYNVT D  GR +   Y GGL CCYD  +C VK GF  GEK R LYLKYT+ +VDW+
Sbjct  208  LYNVTTDAYGRAMKPGYKGGLYCCYDKTQCLVKSGFDNGEKTRNLYLKYTLRWVDWD  264



>ref|XP_008453438.1| PREDICTED: uncharacterized protein LOC103494145 [Cucumis melo]
 ref|XP_008453439.1| PREDICTED: uncharacterized protein LOC103494145 [Cucumis melo]
 ref|XP_008453440.1| PREDICTED: uncharacterized protein LOC103494145 [Cucumis melo]
Length=431

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 144/223 (65%), Gaps = 18/223 (8%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K +T  SP F + PG V  K+FY I+FPK HIA+K F+ EVVDE GN IPL QTYLHHW
Sbjct  33   IKTQTFSSPSFTMTPGLVIEKYFYDINFPKSHIAIKSFDVEVVDESGNQIPLPQTYLHHW  92

Query  438  IVGKYMIRKDEVVEAADKMF---------LVGNSGVCAE--LPQYFGLGSETRKTNSSVP  292
             + +Y   K+      + ++         +  N+GVC    L  Y+ +GSE+RK ++ +P
Sbjct  93   ALVRYYQHKNATNPTINTVYSELQEPNFIIASNNGVCGRNVLTAYYAMGSESRKLSTFLP  152

Query  291  DPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG  121
             PYGIEVGNP   P   EE W LNVHAIDTRG AENK GC EC C LYN+TKD  GRPL 
Sbjct  153  HPYGIEVGNPKEIPADYEERWSLNVHAIDTRG-AENKLGCIECHCHLYNITKDRFGRPLT  211

Query  120  -DYPGGLRCCYDGAKCR--VKQGFRGEKRGLYLKYTVTYVDWN  1
             DY GGLRCCYD  KCR  V  G   ++R L+++Y V +VDWN
Sbjct  212  EDYKGGLRCCYDKTKCRVNVSDGEDFKERNLFVRYRVRWVDWN  254



>ref|XP_010483862.1| PREDICTED: uncharacterized protein LOC104762299 [Camelina sativa]
Length=475

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 147/238 (62%), Gaps = 30/238 (13%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            EN +K    LSP+  + PGSV N + Y IDFP+GHI +K F+AEVVDE GN +PLH+TYL
Sbjct  29   ENKIKSAVFLSPKLVMNPGSVSNAYLYDIDFPRGHIGLKSFDAEVVDEAGNPVPLHETYL  88

Query  447  HHWIVGKYMIRKDEVVEAADKMF----------------------LVGNSGVC-AELPQY  337
            HHW+V  Y  RK        +MF                       V N G+C   L  Y
Sbjct  89   HHWVVKPYYARKGSSTLPQQEMFRNQGVSSQDPGSNLDSRSSDFIFVNNGGLCRRRLRHY  148

Query  336  FGLGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRC  166
            +GLGSETRKT++ +PDPY +E+ NP   P G +  W+LN+HAIDTRG  E+++GC EC C
Sbjct  149  YGLGSETRKTSTYLPDPYAVEIDNPQERPDGYDLKWLLNLHAIDTRGV-EDRKGCIECVC  207

Query  165  DLYNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEK--RGLYLKYTVTYVDWN  1
            DLYNVT DE GR +   Y GGL CCYD  +C VK GF   K  R LYLKYT+ +VDW+
Sbjct  208  DLYNVTVDEYGRAINPGYKGGLYCCYDKTQCLVKSGFDNGKKTRNLYLKYTLRWVDWD  265



>gb|KEH31354.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=352

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 143/216 (66%), Gaps = 29/216 (13%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE-EGNSIPLHQTY  451
            EN +K    LSP+FEL PGSV N+F+Y IDFP  HIA+K F AEVVDE E  S  + Q Y
Sbjct  31   ENKIKSAVFLSPKFELGPGSVINRFYYYIDFPSDHIALKSFNAEVVDEDEDGSHMMLQNY  90

Query  450  LHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCA--ELPQYFGLGSETRKTNSSVPDPYGI  277
             H                      LV NSG+C    +PQYFGLGSETR T + +PDP+GI
Sbjct  91   DH---------------------VLVRNSGICQGNTIPQYFGLGSETRGTTTDIPDPFGI  129

Query  276  EVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-GDYPG  109
            E G+P   P G EE W+LNVHAIDTRGT E+K GCTEC+CDLYNVT DE G+ +  DY G
Sbjct  130  ETGSPEEIPEGFEEKWLLNVHAIDTRGT-EDKLGCTECKCDLYNVTVDEYGKSIRPDYKG  188

Query  108  GLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            GL CCYD  +C++K+GF G KR LYL+ TV +VDW+
Sbjct  189  GLLCCYDSTRCKLKEGFEGPKRSLYLRCTVKWVDWD  224



>ref|XP_003574848.1| PREDICTED: uncharacterized protein LOC100825842 [Brachypodium 
distachyon]
Length=404

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 143/220 (65%), Gaps = 16/220 (7%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K +T  SP   L PGSV NK++Y IDFP+GHIA+K F AEVVDE+G  +PLH+TYLHHW
Sbjct  29   LKSKTFRSPAILLSPGSVSNKYYYDIDFPRGHIALKSFRAEVVDEDGVPVPLHETYLHHW  88

Query  438  IVGKYMIRKDEVVEAADKMFL-----VGNSGVCAELPQYFGLGSETRKTNSSVPDPYGIE  274
            I   Y   K+     AD   L     V N GVC  L QYFGLGSETR T + VPDPYGIE
Sbjct  89   IAEPYYALKNN-GSGADAQKLPTRKKVLNDGVCNVLGQYFGLGSETRHTATWVPDPYGIE  147

Query  273  VGNPPP----GLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-GDYPG  109
             GNP      G EE W LNVHAIDT G  +  R CTEC C  YNVT DEDG  +  +Y G
Sbjct  148  AGNPEKVPKGGYEEKWFLNVHAIDTSGVIDKLR-CTECECGSYNVTVDEDGITIPKNYTG  206

Query  108  GLRCCYDGAKCRVKQGF----RGEKRGLYLKYTVTYVDWN  1
            GL CCYD  +C++  GF    RG KR L+L+YTVT++DW 
Sbjct  207  GLFCCYDQTQCQLIDGFGSNLRGAKRKLFLQYTVTWLDWT  246



>ref|XP_004974890.1| PREDICTED: uncharacterized protein LOC101770076 [Setaria italica]
Length=442

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 121/232 (52%), Positives = 151/232 (65%), Gaps = 19/232 (8%)
 Frame = -3

Query  654  SQRSLRIDEENG--------VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEA  499
            + ++L +D+  G        +K  T LSP F L PGSV NK++  I FP+GH+A+K F  
Sbjct  27   TTQTLDLDDARGHGHGYDQQLKSRTFLSPAFTLRPGSVSNKWYADIAFPRGHVALKSFNG  86

Query  498  EVVDEEGNSIPLHQTYLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVC--AELPQYFGLG  325
            EVVD  G  +PLH+TYLHHW+V  Y           + +    NSGVC    L QYFGLG
Sbjct  87   EVVDVRGAPVPLHETYLHHWLVEPYYA-ASGGGGGQENIIPRANSGVCKGGALGQYFGLG  145

Query  324  SETRKTNSSVPDPYGIEVGN---PPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYN  154
            SETR+T + VPDPYGIE+G+   PP G EE W L VHAIDTRG A ++ GCTECRC LYN
Sbjct  146  SETRRTATWVPDPYGIEIGDPAAPPEGYEERWSLTVHAIDTRG-AVDRLGCTECRCVLYN  204

Query  153  VTKDEDGRPLGDYPGGLRCCYDGAKCRVKQGFR-GEKRGLYLKYTVTYVDWN  1
            VT DED      Y GGLRCCYD A+C V++GF  GE R L+L+YTV ++DW+
Sbjct  205  VTVDEDDD---GYAGGLRCCYDQARCAVEEGFADGETRELFLRYTVMWLDWS  253



>ref|XP_004974040.1| PREDICTED: uncharacterized protein LOC101777764 [Setaria italica]
Length=432

 Score =   224 bits (572),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 144/212 (68%), Gaps = 8/212 (4%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K  T LSP   L PGSV NK++  + FP+GH+A+K F  EVVD  G  +PLH+TYLHHW
Sbjct  32   LKSRTYLSPPISLRPGSVSNKWYSDVAFPRGHLALKSFNGEVVDARGAPVPLHETYLHHW  91

Query  438  IVGKYMIRKDEVVEAADKMFLVGNSGVCAE-LPQYFGLGSETRKTNSSVPDPYGIEVGN-  265
            +V  Y           ++     N+GVC   L QYFGLG+ETR+T + VPDPYG+E+GN 
Sbjct  92   LVAPYYAATTS-GGGEERRRQRPNAGVCGGLLGQYFGLGAETRRTATWVPDPYGVEIGNP  150

Query  264  --PPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-DYPGGLRCC  94
              PP G EE W LNVHAIDTRG A ++ GCTECRCDLYNVT DEDGR +G  Y GG  CC
Sbjct  151  EAPPEGYEERWSLNVHAIDTRGAA-DRAGCTECRCDLYNVTVDEDGRRIGAGYAGGTHCC  209

Query  93   YDGAKCRVKQGF-RGEKRGLYLKYTVTYVDWN  1
            YD  +C V+ GF  GE R L+L+YTV ++DW+
Sbjct  210  YDQTRCAVEGGFGGGEPRELFLRYTVMWLDWS  241



>gb|EMS55330.1| hypothetical protein TRIUR3_10894 [Triticum urartu]
Length=419

 Score =   224 bits (571),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 145/212 (68%), Gaps = 16/212 (8%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K +T LSP F L PG + NK++Y +DFP+GH+A+K F  +VVDE G  +PLH+TYLHHW
Sbjct  35   LKTQTFLSPPFFLRPGGIANKWYYDVDFPRGHVAIKSFNGDVVDEAGAPVPLHETYLHHW  94

Query  438  IVGKYMIRKDEVVEAADKMFLVGNSGVCAE-LPQYFGLGSETRKTNSSVPDPYGIEVG-N  265
            +V  Y                + NSG C + L QYFGLGSETR+T + VPDPYGIE+G  
Sbjct  95   LVSPYY---------GPSAIPITNSGPCKDLLGQYFGLGSETRRTATWVPDPYGIEIGAG  145

Query  264  PPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLGD-YPGGLRCCYD  88
             P G EE W++NVHAIDTRG A+ K  CTECRCD YNVT DE G  +G+ Y GG+ CCYD
Sbjct  146  APAGYEERWLINVHAIDTRGAAD-KLACTECRCDAYNVTVDETGNRIGNGYVGGIHCCYD  204

Query  87   GAKCRVKQGF--RGE-KRGLYLKYTVTYVDWN  1
              +CRV+  F   GE  R L+L+YTV+++DW+
Sbjct  205  SLRCRVEDAFANNGEPPRKLFLRYTVSWLDWS  236



>dbj|BAJ87916.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=422

 Score =   223 bits (569),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 145/212 (68%), Gaps = 14/212 (7%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K +T LSP F L PG V NK++Y +DFP+GH+A+K F  EVVD+ G S+PLH+TYLHHW
Sbjct  36   LKTQTFLSPPFFLRPGGVVNKWYYDVDFPRGHVALKSFNGEVVDDAGASVPLHETYLHHW  95

Query  438  IVGKYMIRKDEVVEAADKMFLVGNSGVCAE-LPQYFGLGSETRKTNSSVPDPYGIEVGNP  262
            +V  Y +     +        + NSG C + L Q+FGLGSETR+T + VPDPY IE+G P
Sbjct  96   LVAPYYVYGPNTIP-------ITNSGPCKDSLGQHFGLGSETRQTATWVPDPYAIEIGKP  148

Query  261  -PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLGD-YPGGLRCCYD  88
             P G +E W +NVHAIDTRG A +K  C ECRCD YNVT DE G  +G+ Y GGL CCYD
Sbjct  149  APAGYDERWFINVHAIDTRG-APDKLACAECRCDFYNVTVDEAGSRIGNGYVGGLHCCYD  207

Query  87   GAKCRVKQGF--RGE-KRGLYLKYTVTYVDWN  1
              +CRV   F   GE  R L+L+YTV+++DW+
Sbjct  208  STRCRVDGAFANNGEPPRKLFLRYTVSWLDWS  239



>dbj|BAJ86815.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=422

 Score =   223 bits (569),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 145/212 (68%), Gaps = 14/212 (7%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K +T LSP F L PG V NK++Y +DFP+GH+A+K F  EVVD+ G S+PLH+TYLHHW
Sbjct  36   LKTQTFLSPPFFLRPGGVVNKWYYDVDFPRGHVALKSFNGEVVDDAGASVPLHETYLHHW  95

Query  438  IVGKYMIRKDEVVEAADKMFLVGNSGVCAE-LPQYFGLGSETRKTNSSVPDPYGIEVGNP  262
            +V  Y +     +        + NSG C + L Q+FGLGSETR+T + VPDPY IE+G P
Sbjct  96   LVAPYYVYGPNTIP-------ITNSGPCKDSLGQHFGLGSETRQTATWVPDPYAIEIGKP  148

Query  261  -PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLGD-YPGGLRCCYD  88
             P G +E W +NVHAIDTRG A +K  C ECRCD YNVT DE G  +G+ Y GGL CCYD
Sbjct  149  APAGYDERWFINVHAIDTRG-APDKLACAECRCDFYNVTVDEAGSRIGNGYVGGLHCCYD  207

Query  87   GAKCRVKQGF--RGE-KRGLYLKYTVTYVDWN  1
              +CRV   F   GE  R L+L+YTV+++DW+
Sbjct  208  STRCRVDGAFANNGEPPRKLFLRYTVSWLDWS  239



>ref|XP_010477840.1| PREDICTED: uncharacterized protein LOC104756879 [Camelina sativa]
Length=543

 Score =   226 bits (577),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 150/242 (62%), Gaps = 31/242 (13%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            +  +N +K     SP+  + PGSV +   + IDFP+GHI +KGF+AEVVDE G  +PLH+
Sbjct  64   LGTKNKIKSAVFFSPKLVMSPGSVSDPRLFDIDFPRGHIGIKGFDAEVVDEVGKPVPLHE  123

Query  456  TYLHHWIVGKYMIRKDEVVEAADKMF----------------------LVGNSGVC--AE  349
            TYLHHW+V  Y  RK        +MF                      +V N G+C    
Sbjct  124  TYLHHWLVQPYYARKGSSKLPQQEMFRNHGFSRQDPETNLDSRSSDIIIVKNGGLCRGVT  183

Query  348  LPQYFGLGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCT  178
            L  YFGLGSETRKT++ VPDPY +E+ NP   P G E  W+LN+HAIDTRG  E+++GC 
Sbjct  184  LRHYFGLGSETRKTSTYVPDPYAVEIDNPEEIPDGYEFKWLLNIHAIDTRG-VEDRKGCI  242

Query  177  ECRCDLYNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGF-RGEK-RGLYLKYTVTYVD  7
            EC CDLYNVT DE GR +   Y GGL CCYD  +CRVK GF  GEK R LYLKYTV +VD
Sbjct  243  ECLCDLYNVTVDEYGRTIKPGYKGGLHCCYDKTQCRVKSGFGNGEKQRNLYLKYTVKWVD  302

Query  6    WN  1
            W+
Sbjct  303  WD  304



>ref|XP_010457781.1| PREDICTED: uncharacterized protein LOC104739202 [Camelina sativa]
Length=472

 Score =   224 bits (572),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 149/238 (63%), Gaps = 30/238 (13%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            E  +K    LSP+  + PGSV + + + +DFP+GHI +K F+AEVVDE GN +PLH+TYL
Sbjct  29   EKKIKSAVFLSPKLVMSPGSVSDSYLFDMDFPRGHIGLKSFDAEVVDEAGNPVPLHETYL  88

Query  447  HHWIVGKYMIR---------------------KDEVVEAADKMFLVGNSGVC--AELPQY  337
            HHW+V  Y +R                     K  +   +  + LV N G+C  + L  Y
Sbjct  89   HHWVVEPYYVRKGAKLPQQEMFRNHGFQRQDPKSNLDSTSSDIILVKNGGLCRSSVLRHY  148

Query  336  FGLGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRC  166
            FG GSETR T++ VPDPY IE+ NP   P G E  W+LNVHAIDTRG  E+K+GC EC C
Sbjct  149  FGSGSETRNTSTYVPDPYAIEIDNPEERPDGYEFKWLLNVHAIDTRG-VEDKKGCIECLC  207

Query  165  DLYNVTKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGF-RGEK-RGLYLKYTVTYVDWN  1
            DLYNVT D  GR +   Y GGL CCYD  +CRVK GF  GEK R LYLKYT+ +VDW+
Sbjct  208  DLYNVTTDSYGRAIRPGYKGGLYCCYDKTQCRVKSGFDNGEKTRDLYLKYTLRWVDWD  265



>ref|XP_010457791.1| PREDICTED: uncharacterized protein LOC104739210 [Camelina sativa]
Length=475

 Score =   225 bits (573),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 121/250 (48%), Positives = 154/250 (62%), Gaps = 32/250 (13%)
 Frame = -3

Query  663  VCSSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE  484
            V S+Q  LR   EN +K    LSP+  + PGSV + + + IDFP+GHI +K F+AEVVDE
Sbjct  19   VSSNQGFLRT--ENKIKSGVFLSPKLVMNPGSVSDAYLFDIDFPRGHIGLKSFDAEVVDE  76

Query  483  EGNSIPLHQTYLHHWIVGKYMIRKDEVVEAADKMF----------------------LVG  370
             GNS+PLH+TY+HHW+V  Y +RK        +MF                       V 
Sbjct  77   AGNSVPLHETYVHHWVVKPYYVRKGSSTLPQQEMFRNQGVSSQDPGSNLDSRSSDIIFVN  136

Query  369  NSGVC-AELPQYFGLGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGT  202
            N G+C + L  Y+GLGSETRKT++ VPDPY +E+ NP   P G E  W+LN+HAIDTRG 
Sbjct  137  NGGLCRSRLRHYYGLGSETRKTSTYVPDPYAVEIDNPQERPDGYEFKWLLNLHAIDTRG-  195

Query  201  AENKRGCTECRCDLYNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEK--RGLYL  31
             E+++GC EC C LYNVT  E GR +   Y GGL CCYD  +C VK GF   K  R LYL
Sbjct  196  VEDRKGCIECVCYLYNVTVGEYGRAINPGYKGGLYCCYDKTQCLVKSGFDNGKKTRNLYL  255

Query  30   KYTVTYVDWN  1
            KYT+ +VDW+
Sbjct  256  KYTLRWVDWD  265



>ref|XP_010444012.1| PREDICTED: uncharacterized protein LOC104726772 [Camelina sativa]
Length=474

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 149/240 (62%), Gaps = 29/240 (12%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            +  EN +K    LSP+    PGSV N +F+ +DFP+GHI +KGF+AE+VDE G  +PLH+
Sbjct  29   LGTENKIKSAVFLSPKLVTSPGSVSNSYFFDMDFPRGHIGLKGFDAELVDEAGKPVPLHE  88

Query  456  TYLHHWIVGKYMIRK---------------------DEVVEAADKMFLVGNSGVC-AELP  343
            TYLHHW V  Y  RK                     +  +++   + +  N G+C + L 
Sbjct  89   TYLHHWNVYPYYARKGSSKLPRQEMFKNHGFSRKDPETSLDSTSDIIIAKNGGLCMSTLI  148

Query  342  QYFGLGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTEC  172
             YFG  SETR T+S +PDPY IE+ NP   P G E  W LNVHAIDTRG  E+KRGC EC
Sbjct  149  YYFGSASETRHTSSYIPDPYAIEIDNPEERPDGYEFKWHLNVHAIDTRG-VEDKRGCLEC  207

Query  171  RCDLYNVTKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGF-RGEK-RGLYLKYTVTYVDWN  1
             CDLYNVT DE GR L   Y GGL CCYD  +CRVK GF  GEK R LYLKYT+ +VDW+
Sbjct  208  LCDLYNVTVDEYGRALRPGYKGGLACCYDKTQCRVKSGFDNGEKTRNLYLKYTLRWVDWD  267



>gb|KGN43818.1| hypothetical protein Csa_7G069440 [Cucumis sativus]
Length=445

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 153/231 (66%), Gaps = 21/231 (9%)
 Frame = -3

Query  633  DEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQT  454
            ++   +K +T ++P F L+PG V  +FFY  +FP+GHIA+K F+ EVVDEE N IPL +T
Sbjct  33   NDHQVIKTKTYMTPFFTLKPGHVVERFFYNTNFPEGHIAIKSFDVEVVDEEDNPIPLFET  92

Query  453  YLHHWIVGKYMIRKDEVVEAADKMF---------LVGNSGVCAE--LPQYFGLGSETRKT  307
            YLHHW + +Y   KD      +  F         + GNSGVC +  LP +FG G+E+RKT
Sbjct  93   YLHHWGITRYYQHKDSKDPNINTSFTQLQEPNFIIAGNSGVCQKHALPHFFGTGAESRKT  152

Query  306  NSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDED  136
            +S +P PYGIEVGN    P G EE W+LN+HAIDTRG  E++ GC EC+  LYNVTKD  
Sbjct  153  SSFLPHPYGIEVGNEKEVPLGYEEKWVLNIHAIDTRG-VEDRIGCIECKRHLYNVTKDGL  211

Query  135  GRPL-GDYPGGLRCCYDGAKCRVKQGFRG-----EKRGLYLKYTVTYVDWN  1
            G  L  DY GGLRCCYD  +C+VK+G+       ++R LY++YTV +VDW+
Sbjct  212  GMALEDDYIGGLRCCYDQTQCKVKKGYENKLGDDQQRNLYVRYTVKWVDWD  262



>ref|XP_010457823.1| PREDICTED: uncharacterized protein LOC104739234 [Camelina sativa]
Length=465

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/241 (50%), Positives = 150/241 (62%), Gaps = 30/241 (12%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            +  +N +K    LSP+  +  GSV + + + IDFP+GHI +K F+AEVVDE G  +PLH+
Sbjct  27   LGTKNKIKSAVFLSPKLVMSLGSVSDPYLFDIDFPRGHIGLKSFDAEVVDEAGKPVPLHE  86

Query  456  TYLHHWIVGKYMIRKDEVV---------------------EAADKMFLVGNSGVC--AEL  346
            TYLHHW V  Y +RK   +                       +  + LV N G+C  + L
Sbjct  87   TYLHHWAVQPYYVRKGSKLPQREMFANHGFSQQDPQTNLDSRSSDIILVKNGGLCRSSVL  146

Query  345  PQYFGLGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTE  175
              YFGLGSETRKT++ VPDPY +E+ NP   P G E  W+LN+HAIDTR   E+K GCTE
Sbjct  147  RHYFGLGSETRKTSTYVPDPYAVEIDNPEERPDGYEFKWLLNIHAIDTR-CVEDKTGCTE  205

Query  174  CRCDLYNVTKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGF-RGEK-RGLYLKYTVTYVDW  4
            C CDLYNVT +E GR L   Y GGL CCYD  +CRVK GF  GEK R LYLKYTV +VDW
Sbjct  206  CHCDLYNVTVNEYGRALRPGYKGGLHCCYDKTQCRVKSGFGNGEKQRNLYLKYTVKWVDW  265

Query  3    N  1
            +
Sbjct  266  D  266



>ref|XP_008455078.1| PREDICTED: uncharacterized protein LOC103495342 [Cucumis melo]
Length=448

 Score =   222 bits (566),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 156/231 (68%), Gaps = 21/231 (9%)
 Frame = -3

Query  633  DEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQT  454
            D +  +K +T  +P F L+PG V  +FFY  +FPKGHIA+K F+ EVVDEE N IPL +T
Sbjct  35   DHQVIIKTKTYRTPLFTLKPGYVVERFFYNTNFPKGHIAMKSFDVEVVDEEANPIPLFET  94

Query  453  YLHHWIVGKYMIRKD--------EVVEAADKMFLV-GNSGVCAE--LPQYFGLGSETRKT  307
            YLHHW + +Y   KD           +  +  F+V GN+GVC +  LPQ+FG G+++RKT
Sbjct  95   YLHHWGITRYYQHKDTKDPNINTSFTQLHEPNFIVAGNNGVCQKHALPQFFGTGADSRKT  154

Query  306  NSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDED  136
            +S +P+PYGIEVGN    P G EE W+LN+HAIDTRG  E++ GC EC+  LYNVTKD  
Sbjct  155  SSFLPNPYGIEVGNEKEVPLGYEEKWVLNIHAIDTRG-VEDRIGCIECKRHLYNVTKDGL  213

Query  135  GRPL-GDYPGGLRCCYDGAKCRVKQGFRGE-----KRGLYLKYTVTYVDWN  1
            G  L  DY GGLRCCYD  +C++K+G+  E     +R LY++YTV +VDW+
Sbjct  214  GMALEDDYIGGLRCCYDQTQCKMKKGYGNELGDDQQRNLYVRYTVKWVDWD  264



>ref|XP_002983409.1| hypothetical protein SELMODRAFT_118146 [Selaginella moellendorffii]
 gb|EFJ15751.1| hypothetical protein SELMODRAFT_118146 [Selaginella moellendorffii]
Length=405

 Score =   221 bits (562),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 144/209 (69%), Gaps = 10/209 (5%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            ++ +T  SP F LEPG V +++ Y ++FPKGHI VK F+ EVVDE GNS+PL + YLHHW
Sbjct  29   IQRKTYKSPAFSLEPGDVQDRY-YELEFPKGHIGVKNFQGEVVDELGNSVPLSEVYLHHW  87

Query  438  IVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGIEVGN  265
             V  + ++  E      K    GN+G+C E  L Q++GLGSETR+T+  +P  Y I VGN
Sbjct  88   AVYGHYMKSSE-----RKELTAGNAGICQEDILSQFWGLGSETRQTSYYIPGSYAIGVGN  142

Query  264  PPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLGD-YPGGLRCCYD  88
            PP G EE W+LNVHAIDTRGT  + +GC ECRC LYNVT    G+PL + Y GG  CCYD
Sbjct  143  PPEGYEELWVLNVHAIDTRGTY-DPQGCLECRCSLYNVTTKISGQPLKEGYKGGFSCCYD  201

Query  87   GAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            G KC V+ GF+  KR LY++YT+ +V+W+
Sbjct  202  GTKCAVRPGFQASKRTLYMQYTIEWVEWD  230



>ref|XP_010444011.1| PREDICTED: uncharacterized protein LOC104726771 [Camelina sativa]
Length=475

 Score =   222 bits (566),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 115/238 (48%), Positives = 148/238 (62%), Gaps = 30/238 (13%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            EN +K    LSP+  + PGSV + +F+ IDFP+GHI +K F+AEVVDE GN +PLH+TY+
Sbjct  29   ENKIKSAVFLSPKLAMNPGSVSDAYFFDIDFPRGHIGLKSFDAEVVDEAGNPVPLHETYV  88

Query  447  HHWIVGKYMIRKDEVVEAADKMF----------------------LVGNSGVC-AELPQY  337
            HHW+V  Y +RK        +MF                       V N G+C + L  Y
Sbjct  89   HHWVVKPYYVRKGSSTLPQQEMFKKQGVSSQDPGSNLDSRSSDIIFVNNGGLCRSRLRHY  148

Query  336  FGLGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRC  166
            +GLGSETRKT++ +PDPY +E+ NP   P G E  W+LN+HAIDTRG  E+++GC EC C
Sbjct  149  YGLGSETRKTSTYLPDPYAVEIDNPQERPDGYEFKWLLNLHAIDTRG-VEDRKGCIECVC  207

Query  165  DLYNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEK--RGLYLKYTVTYVDWN  1
             LYNVT  E GR +   Y GGL CCYD  +C VK GF   K  R LYLKYT+ +VDW+
Sbjct  208  YLYNVTVGEYGRAINPGYKGGLYCCYDKTQCLVKSGFDNGKKTRNLYLKYTLRWVDWD  265



>ref|XP_002960630.1| hypothetical protein SELMODRAFT_75188 [Selaginella moellendorffii]
 gb|EFJ38169.1| hypothetical protein SELMODRAFT_75188 [Selaginella moellendorffii]
Length=405

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 142/209 (68%), Gaps = 10/209 (5%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            ++  T  SP F LEPG V +++ Y ++FPKGHI +K F+ EVVDE GNS+PL + YLHHW
Sbjct  29   IQRRTYKSPAFSLEPGDVQDRY-YELEFPKGHIGIKNFQGEVVDELGNSVPLSEVYLHHW  87

Query  438  IVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGIEVGN  265
             V  + ++  E      K    GN+G+C E  L Q++GLGSETR+T+  +P  Y I VGN
Sbjct  88   AVYGHYMKSSE-----RKELTAGNAGICQEDILSQFWGLGSETRQTSYYIPGSYAIGVGN  142

Query  264  PPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLGD-YPGGLRCCYD  88
            PP G EE W+LNVHAIDTRGT  + +GC ECRC LYNVT    G+PL + Y GG  CCYD
Sbjct  143  PPEGYEELWVLNVHAIDTRGTY-DPQGCLECRCSLYNVTTKISGQPLKEGYKGGFSCCYD  201

Query  87   GAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            G KC V+  F+  KR LY++YT+ +V+W+
Sbjct  202  GTKCAVRPEFQASKRTLYMQYTIEWVEWD  230



>ref|XP_008453443.1| PREDICTED: uncharacterized protein LOC103494148 [Cucumis melo]
Length=430

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 141/223 (63%), Gaps = 18/223 (8%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K +T  +P F + PG V   ++Y I+FPK HIA+K F+ EVVDE GN IPL QTYLHHW
Sbjct  33   IKTQTFSTPSFTITPGLVIENYYYNINFPKSHIAIKSFDVEVVDESGNQIPLPQTYLHHW  92

Query  438  IVGKYMIRKDEVVEAAD---------KMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVP  292
             + +Y   K+      +            +  N+GVC    L  ++ LGSE+RK ++ +P
Sbjct  93   ELVRYYQHKNATNPTINTPYHELQEPNFIMASNNGVCGRNVLTAFYALGSESRKLSTFLP  152

Query  291  DPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG  121
             PYGIEVGNP   P   EE W LNVHAIDTRG AENK GC EC C LYN+TKD  GRPL 
Sbjct  153  YPYGIEVGNPKEIPADYEERWSLNVHAIDTRG-AENKLGCIECHCHLYNITKDRFGRPLT  211

Query  120  -DYPGGLRCCYDGAKCR--VKQGFRGEKRGLYLKYTVTYVDWN  1
             DY GGL+CCYD  KCR  V  G   ++R L+++Y V +VDWN
Sbjct  212  EDYKGGLQCCYDKTKCRVNVSDGEDFQERNLFVRYRVKWVDWN  254



>ref|XP_006279767.1| hypothetical protein CARUB_v10027779mg [Capsella rubella]
 gb|EOA12665.1| hypothetical protein CARUB_v10027779mg [Capsella rubella]
Length=477

 Score =   218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 121/236 (51%), Positives = 146/236 (62%), Gaps = 28/236 (12%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            E  +K E   SP+  + PGSV N F   IDFP+GHI +K F+AEVVDE G+ +PLH+TYL
Sbjct  33   EKKIKSEVFFSPKLVMNPGSVSNSFLSDIDFPRGHIGLKSFDAEVVDEAGDPVPLHETYL  92

Query  447  HHWIVGKY------------MIRKD--------EVVEAADKMFLVGNSGVCA-ELPQYFG  331
            HHW++  Y            M R D           ++      V N G+C   L  +FG
Sbjct  93   HHWLLRPYYARIGSKFLQQEMFRNDGFQRQDPESNPDSGSDTIPVRNGGLCTNSLLYFFG  152

Query  330  LGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDL  160
             GSETR T++ +PDPY IEV NP   P G E  W+LNVHAIDTRG  E++ GC EC CDL
Sbjct  153  SGSETRNTSTYLPDPYAIEVDNPEERPDGYEFKWLLNVHAIDTRG-VEDRTGCIECLCDL  211

Query  159  YNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGF-RGEK-RGLYLKYTVTYVDWN  1
            YNVT DE GR +G  Y GGL CCYD  +CRVK GF  GEK R LYLKYTV +VDW+
Sbjct  212  YNVTIDEYGRAIGPGYKGGLYCCYDKTQCRVKSGFDNGEKTRNLYLKYTVRWVDWD  267



>tpg|DAA48290.1| TPA: mtN19-like protein [Zea mays]
Length=418

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 148/225 (66%), Gaps = 10/225 (4%)
 Frame = -3

Query  645  SLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIP  466
            S  +  + GV+ +T LSP   L PG V +KF+Y I FP+GH+A+K F  EVVDE G  +P
Sbjct  24   SEALTPKQGVRSKTFLSPPILLRPGDVADKFYYDIPFPRGHLALKSFNGEVVDERGAPVP  83

Query  465  LHQTYLHHWIVGKY--MIRKDEVVEAADKMFLVGNSGVCA--ELPQYFGLGSETRKTNSS  298
            LH+TYLHHW+V  Y  ++   E   +  +     N+GVC+   L QY+GLGSETR+T + 
Sbjct  84   LHETYLHHWVVQPYYALVVSAEGGSSRPRTIPARNAGVCSGHTLGQYYGLGSETRRTATW  143

Query  297  VPDPYGIEVGNPPP----GLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGR  130
            VPDPYGIE+G+P      G E+ W+LNVHAIDTRG A+    CTECRCD+YNVT D  G 
Sbjct  144  VPDPYGIEIGDPAAAPAEGYEQRWLLNVHAIDTRGAADRTMACTECRCDVYNVTADWRGH  203

Query  129  PL-GDYPGGLRCCYDGAKC-RVKQGFRGEKRGLYLKYTVTYVDWN  1
             +   Y GGLRCCYDG +C    +G  G+ R ++L+YTV + DW+
Sbjct  204  AIEPGYAGGLRCCYDGTRCGAAAEGAEGKARTVFLRYTVMWRDWS  248



>tpg|DAA48291.1| TPA: hypothetical protein ZEAMMB73_362863 [Zea mays]
Length=412

 Score =   216 bits (549),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 148/225 (66%), Gaps = 10/225 (4%)
 Frame = -3

Query  645  SLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIP  466
            S  +  + GV+ +T LSP   L PG V +KF+Y I FP+GH+A+K F  EVVDE G  +P
Sbjct  24   SEALTPKQGVRSKTFLSPPILLRPGDVADKFYYDIPFPRGHLALKSFNGEVVDERGAPVP  83

Query  465  LHQTYLHHWIVGKY--MIRKDEVVEAADKMFLVGNSGVCA--ELPQYFGLGSETRKTNSS  298
            LH+TYLHHW+V  Y  ++   E   +  +     N+GVC+   L QY+GLGSETR+T + 
Sbjct  84   LHETYLHHWVVQPYYALVVSAEGGSSRPRTIPARNAGVCSGHTLGQYYGLGSETRRTATW  143

Query  297  VPDPYGIEVGNPPP----GLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGR  130
            VPDPYGIE+G+P      G E+ W+LNVHAIDTRG A+    CTECRCD+YNVT D  G 
Sbjct  144  VPDPYGIEIGDPAAAPAEGYEQRWLLNVHAIDTRGAADRTMACTECRCDVYNVTADWRGH  203

Query  129  PL-GDYPGGLRCCYDGAKC-RVKQGFRGEKRGLYLKYTVTYVDWN  1
             +   Y GGLRCCYDG +C    +G  G+ R ++L+YTV + DW+
Sbjct  204  AIEPGYAGGLRCCYDGTRCGAAAEGAEGKARTVFLRYTVMWRDWS  248



>gb|ACG30313.1| mtN19-like protein [Zea mays]
Length=419

 Score =   216 bits (549),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 148/226 (65%), Gaps = 11/226 (5%)
 Frame = -3

Query  645  SLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIP  466
            S  +  + GV+ +T LSP   L PG V +KF+Y I FP+GH+A+K F  EVVDE G  +P
Sbjct  24   SEALTPKQGVRSKTFLSPPILLRPGDVADKFYYDIPFPRGHLALKSFNGEVVDERGAPVP  83

Query  465  LHQTYLHHWIVGKY--MIRKDEVVEAADKMFLVGNSGVCA--ELPQYFGLGSETRKTNSS  298
            LH+TYLHHW+V  Y  ++   E   +  +     N+GVC+   L QY+GLGSETR+T + 
Sbjct  84   LHETYLHHWVVQPYYALVVSAEGGSSRPRTIPARNAGVCSGHTLGQYYGLGSETRRTATW  143

Query  297  VPDPYGIEVGNPPP-----GLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDG  133
            VPDPYGIE+G+P       G E+ W+LNVHAIDTRG A+    CTECRCD+YNVT D  G
Sbjct  144  VPDPYGIEIGDPAAAPASEGYEQRWLLNVHAIDTRGAADRTMACTECRCDVYNVTADWRG  203

Query  132  RPL-GDYPGGLRCCYDGAKC-RVKQGFRGEKRGLYLKYTVTYVDWN  1
              +   Y GGLRCCYDG +C    +G  G+ R ++L+YTV + DW+
Sbjct  204  HAIEPGYAGGLRCCYDGTRCGAAAEGAEGKARTVFLRYTVMWRDWS  249



>ref|NP_001148306.1| mtN19-like protein precursor [Zea mays]
 gb|ACG30513.1| mtN19-like protein [Zea mays]
Length=426

 Score =   216 bits (549),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 110/226 (49%), Positives = 143/226 (63%), Gaps = 14/226 (6%)
 Frame = -3

Query  636  IDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            +  + GVK +T LSP   L PG V +KF+Y I FP+GH+A+K F  EVVDE G  +PLH+
Sbjct  31   LTPKQGVKSKTFLSPPILLRPGDVADKFYYDIPFPRGHLALKSFNGEVVDERGAPVPLHE  90

Query  456  TYLHHWIVGKY--MIRKDEVVEAADKMFLVGNSGVCA--ELPQYFGLGSETRKTNSSVPD  289
            TYLHHW+V  Y  ++   E   +  +     N+GVC+   L QY+GLGSETR+T + VPD
Sbjct  91   TYLHHWVVQPYYALVVSAEGGSSRPRTIPARNAGVCSGHTLGQYYGLGSETRRTATWVPD  150

Query  288  PYGIEVGNPPP-----GLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL  124
            PYGIE+G+P       G E+ W+LNVHAIDTRG A+    CTECRCD+YNVT D  G  +
Sbjct  151  PYGIEIGDPAAAPASEGYEQRWLLNVHAIDTRGAADRTMACTECRCDVYNVTADWRGHAI  210

Query  123  -GDYPGGLRCCYDGAKC----RVKQGFRGEKRGLYLKYTVTYVDWN  1
               Y GGLRCCYDG +C              R ++L+YTV + DW+
Sbjct  211  EPGYAGGLRCCYDGTRCGAAAAGAGAEAEAARTVFLRYTVMWRDWS  256



>ref|XP_010457757.1| PREDICTED: uncharacterized protein LOC104739180 [Camelina sativa]
 ref|XP_010457764.1| PREDICTED: uncharacterized protein LOC104739180 [Camelina sativa]
 ref|XP_010457771.1| PREDICTED: uncharacterized protein LOC104739180 [Camelina sativa]
Length=466

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/229 (51%), Positives = 143/229 (62%), Gaps = 24/229 (10%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K     SP+  + PGSV + +   +DFP+GHI +K F AEVVDE GN +PLH+TYLHHW
Sbjct  32   IKSAVFYSPKLVMSPGSVSDFYLLDMDFPRGHIGLKSFHAEVVDEAGNPVPLHETYLHHW  91

Query  438  IVGKYMIRKDEVVE---------------AADKMFLVGNSGVCAE--LPQYFGLGSETRK  310
             V  + +RK   +                +A  + LV N G+C    L  YFG GSETR 
Sbjct  92   AVQPHYVRKGAKLPQQEMLRRQDPKSNLYSASDIILVKNGGLCRSPVLRHYFGSGSETRN  151

Query  309  TNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDE  139
            T++ VPDPY IE+ NP   P G E  W+LN+HAIDTRG  E+K GC EC CDLYNVT +E
Sbjct  152  TSTYVPDPYAIEIDNPEERPDGYEFKWLLNIHAIDTRGV-EDKTGCIECLCDLYNVTVNE  210

Query  138  DGRPLG-DYPGGLRCCYDGAKCRVKQGF-RGE-KRGLYLKYTVTYVDWN  1
             GR +   Y GGL CCYD  +C VK GF  GE KR LYLKYTV +VDW+
Sbjct  211  YGRTIKPGYKGGLHCCYDKTQCPVKSGFGNGEKKRNLYLKYTVKWVDWD  259



>ref|XP_003594550.1| MtN19 protein [Medicago truncatula]
 gb|AES64801.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=391

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 138/211 (65%), Gaps = 27/211 (13%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            ++ +   SP+ EL PGSV NK F  +DFP+GHI++K F AEVV+E GNS+PLHQTYLHHW
Sbjct  37   IQTKVFFSPKIELNPGSVSNKVFMDVDFPRGHISLKSFFAEVVNESGNSVPLHQTYLHHW  96

Query  438  IVGKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGIEVGN  265
            IV +Y   K+    + + +    N+G C E    QY+GLGSETR TN+ +PDPYGIEVGN
Sbjct  97   IVVRYHQPKNVANNSEEGIIFKRNNGFCQENVFGQYYGLGSETRGTNTYIPDPYGIEVGN  156

Query  264  P---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-DYPGGLRC  97
            P   P G+                     GCTEC+CDLY VTKDE+G  L  +Y GGL+C
Sbjct  157  PEEIPKGM---------------------GCTECKCDLYGVTKDENGEALSPNYKGGLQC  195

Query  96   CYDGAKCRVKQGFRGEKRGLYLKYTVTYVDW  4
            C D +KC++ +GF G K+ LYLKYTV +V+W
Sbjct  196  CPDNSKCKLSKGFLGPKQSLYLKYTVKWVNW  226



>ref|XP_004163909.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101231400 
[Cucumis sativus]
Length=402

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 145/220 (66%), Gaps = 21/220 (10%)
 Frame = -3

Query  600  LSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHWIVGKYM  421
            ++P F L+PG V  +FFY  +FP+GHIA+K F+ EVVDEE N IPL +TYLHHW + +Y 
Sbjct  1    MTPFFTLKPGHVVERFFYNTNFPEGHIAIKSFDVEVVDEEDNPIPLFETYLHHWGILRYY  60

Query  420  IRKDEVVEAADKMF---------LVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGIE  274
              KD      +  F         + GNSGVC +  LPQ+FG G+++RKT+S +P PYGIE
Sbjct  61   QHKDTKDPHTNTSFTQLQEPNFIIAGNSGVCQKHALPQFFGTGADSRKTSSFLPHPYGIE  120

Query  273  VGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-GDYPGG  106
            VGN    P G EE W+LN+HAIDTRG  E++ GC EC+  LYNVTKD  G  L  DY  G
Sbjct  121  VGNEKEVPLGYEEKWVLNIHAIDTRG-VEDRIGCIECKRHLYNVTKDGLGMALEDDYIXG  179

Query  105  LRCCYDGAKCRVKQGFRGE-----KRGLYLKYTVTYVDWN  1
            LRCCYD  +C+VK+G+  E     +R LY +YT  +VDW+
Sbjct  180  LRCCYDQTQCKVKKGYDNELGDDQQRNLYARYTAKWVDWD  219



>ref|XP_002983404.1| hypothetical protein SELMODRAFT_43474, partial [Selaginella moellendorffii]
 gb|EFJ15746.1| hypothetical protein SELMODRAFT_43474, partial [Selaginella moellendorffii]
Length=395

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 140/222 (63%), Gaps = 18/222 (8%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            ++ +T  SP F L PG V ++  Y ++FPKGHI VK F+ EVVDE GN +PL   YLHHW
Sbjct  26   IQKKTYKSPAFALGPGEVQDRH-YELEFPKGHIGVKNFQGEVVDELGNPVPLSDVYLHHW  84

Query  438  IVGKYMIRKDEVVE-------------AADKMFLVGNSGVCAE--LPQYFGLGSETRKTN  304
            +V    ++  E  E              +    + GN G+C    L Q++GLGSETR T+
Sbjct  85   VVFSLYVKSSERKELVRGGFHHGQDRLGSPSAIIAGNDGICQHNVLSQFWGLGSETRHTS  144

Query  303  SSVPDPYGIEVGNPPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL  124
              VP  Y I VGNPP G EE W+LNVHAIDTRGT  + +GC ECRC LYNVT D  G+PL
Sbjct  145  YFVPGSYAIGVGNPPEGYEELWVLNVHAIDTRGTY-DPQGCLECRCSLYNVTTDASGQPL  203

Query  123  GD-YPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
               Y GGL CCY+G KC VK GF+  K+ LY++YT+ +V+W+
Sbjct  204  KQGYKGGLHCCYEGTKCAVKPGFQAPKKTLYMQYTIEWVEWD  245



>ref|XP_002960633.1| hypothetical protein SELMODRAFT_437681 [Selaginella moellendorffii]
 gb|EFJ38172.1| hypothetical protein SELMODRAFT_437681 [Selaginella moellendorffii]
Length=430

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 143/219 (65%), Gaps = 15/219 (7%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            ++ +T  SP F + PG V N+  Y I+FPKGHI VK F+ E+VDE GN +PL + YLHHW
Sbjct  32   IQKKTYKSPAFSMGPGEVQNRN-YTIEFPKGHIGVKNFQGEIVDELGNPVPLSEVYLHHW  90

Query  438  IVGKYMIRKDEVVE----------AADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSV  295
            +V  + ++  E  E           +    + GN G+C +   PQ++GLG+ETR T+  V
Sbjct  91   VVFGFHLKSSERKELVRGGFHDRLGSSAAIIPGNDGICQQNVHPQFWGLGAETRHTSYFV  150

Query  294  PDPYGIEVGNPPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLGD-  118
            P  Y I VGNPP G +E W+LNVHAIDTRGT +  +GC ECRC LYNVT D  G+PL   
Sbjct  151  PGSYAIGVGNPPEGYKELWLLNVHAIDTRGTYD-PQGCLECRCSLYNVTIDASGQPLKQG  209

Query  117  YPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            Y GGL CCY+G KC +K GF+  K+ LY++YT+ +V+W+
Sbjct  210  YKGGLHCCYEGTKCAMKLGFQAPKKTLYMQYTIEWVEWD  248



>ref|XP_007133892.1| hypothetical protein PHAVU_010G000800g [Phaseolus vulgaris]
 gb|ESW05886.1| hypothetical protein PHAVU_010G000800g [Phaseolus vulgaris]
Length=407

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 142/223 (64%), Gaps = 18/223 (8%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
             K  T +S  FE+  GS+  K F+ I+FPKGH+ VK F++E+VDEEGN IP  +TYLHHW
Sbjct  33   TKRATFVSESFEMGSGSIAAKTFFNIEFPKGHVGVKSFDSELVDEEGNPIPSFETYLHHW  92

Query  438  IVGKYM----IRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGI  277
               KY+    +  D  +   D      N G+C    LP Y+G G E+R T S++P+P+ I
Sbjct  93   FAIKYIQNITMSDDPKLRHPDDFSFKRNEGMCNGNILPHYWGFGVESRGTTSNIPEPFAI  152

Query  276  EVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDL-------YNVTKDEDGRP  127
            E GNP   P G EE W+LN+ AIDTRG AE+K+GCTECRCDL       YNVT D   +P
Sbjct  153  EQGNPTNVPEGYEEKWLLNIMAIDTRG-AEDKKGCTECRCDLMNLPKDFYNVTVDVHNQP  211

Query  126  L-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            L  DY GGL CC D  +C+   GF+G KR + L+YT+++VDWN
Sbjct  212  LTTDYKGGLFCCQDNLQCKQIDGFQGPKRKISLRYTISWVDWN  254



>ref|XP_002983406.1| hypothetical protein SELMODRAFT_422686 [Selaginella moellendorffii]
 gb|EFJ15748.1| hypothetical protein SELMODRAFT_422686 [Selaginella moellendorffii]
Length=452

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 143/219 (65%), Gaps = 15/219 (7%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            ++ +T  SP F + PG V N+  Y I+FPKGHI VK F+ E+VDE GN +PL + YLHHW
Sbjct  32   IQKKTYKSPAFSMGPGEVQNRN-YTIEFPKGHIGVKNFQGEIVDELGNPVPLSEVYLHHW  90

Query  438  IVGKYMIRKDEVVE----------AADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSV  295
            +V  + ++  E  E           +    + GN G+C +   PQ++GLG+ETR T+  V
Sbjct  91   VVFGFYLKSSERKELVRGGFHDRLGSSAAIIPGNDGICQQNVHPQFWGLGAETRHTSYFV  150

Query  294  PDPYGIEVGNPPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLGD-  118
            P  Y I VGNPP G +E W+LNVHAIDTRGT +  +GC ECRC LYNVT D  G+PL   
Sbjct  151  PGSYAIGVGNPPEGYKELWLLNVHAIDTRGTYD-PQGCLECRCSLYNVTIDASGQPLKQG  209

Query  117  YPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            Y GGL CCY+G KC +K GF+  K+ LY++YT+ +V+W+
Sbjct  210  YKGGLHCCYEGTKCAMKLGFQAPKKTLYMQYTIEWVEWD  248



>ref|XP_002445785.1| hypothetical protein SORBIDRAFT_07g025770 [Sorghum bicolor]
 gb|EES15280.1| hypothetical protein SORBIDRAFT_07g025770 [Sorghum bicolor]
Length=436

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 140/222 (63%), Gaps = 17/222 (8%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            VK +T LSP   L PG V +K +Y I FP+GH+A K F  EVVDE G  +PLH+TYLHHW
Sbjct  42   VKSKTFLSPPIFLRPGDVADKIYYDIAFPRGHLAFKSFNGEVVDEHGVPVPLHETYLHHW  101

Query  438  IVGKY---MIRKDEVVEAADKMFLVGNSGVCAE-LPQYFGLGSETRKTNSSVPDPYGIEV  271
            +V  Y           E   +M    NSGVC   L QY+GLGSETR+T + VPDPYGIE+
Sbjct  102  VVEPYYAAKDASTAAAEGRPRMIPARNSGVCNHTLGQYYGLGSETRRTATWVPDPYGIEI  161

Query  270  GNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLGD-YPGGL  103
            G+P   P G EE WMLNVHAIDTR    +K  CTECRCDLYNVT D+ GR + D Y GGL
Sbjct  162  GDPDAAPEGYEERWMLNVHAIDTRRVV-DKLACTECRCDLYNVTVDQYGRGIEDGYAGGL  220

Query  102  RCCYDGAKCRVKQGF--------RGEKRGLYLKYTVTYVDWN  1
            RCCYD  +C +++              R ++L+YTV + DW+
Sbjct  221  RCCYDETRCALEERAGLLVNADEEAPPRKVFLRYTVMWQDWS  262



>ref|XP_004512652.1| PREDICTED: uncharacterized protein LOC101513451 [Cicer arietinum]
Length=333

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 151/233 (65%), Gaps = 19/233 (8%)
 Frame = -3

Query  645  SLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIP  466
            S + + EN +K  T +S +FE+ PG+V +K    I+FPKGHI VK F+ +++DEEGNSIP
Sbjct  24   SQQKEYENHIKSATFVSEKFEIGPGNVVSKALMEIEFPKGHIGVKSFDVDLIDEEGNSIP  83

Query  465  LHQTYLHHWIVGKYMIRK-----DEVVEAADKMFLVGNSGVC--AELPQYFGLGSETRKT  307
            L++TYLHHW V  ++ +      +      +      N G C    LPQY+GLGSE+R T
Sbjct  84   LYETYLHHWFVINFINKNVSHDHNAHTNPYEDAIFKRNDGTCNGGILPQYWGLGSESRGT  143

Query  306  NSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCD-------LY  157
            +S +PDP+ +EVGNP   P G EE W+ ++  I TRGT EN++ C+ECRCD        +
Sbjct  144  SSKIPDPFAVEVGNPKAIPQGWEEKWLFSIMVIGTRGT-ENRKTCSECRCDQFNLPENYF  202

Query  156  NVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            NVT D +G+PL  DY GG+ CC+D  +C++++GF   +R L L+Y VT+VDW+
Sbjct  203  NVTVDINGKPLSPDYKGGIFCCHDNFQCKLRKGFEAPRRNLALRYKVTWVDWD  255



>gb|KHN18974.1| hypothetical protein glysoja_039898 [Glycine soja]
Length=414

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/240 (46%), Positives = 153/240 (64%), Gaps = 20/240 (8%)
 Frame = -3

Query  663  VCSSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE  484
            +  +  S+ +D EN +K  T +S  FE+ PG + +K FY I+FPKGHI VK F+AE+VDE
Sbjct  25   LSGTTYSIFLDSENHIKSATFVSKSFEMGPGKIVSKSFYDIEFPKGHIGVKSFDAELVDE  84

Query  483  EGNSIPLHQTYLHHWIVGKY-----MIRKDEVVEAADK-MFLVGNSGVCAE--LPQYFGL  328
            +G S+PL++TYLHHW   KY     M R  E      K +    N G C    LP Y+GL
Sbjct  85   DGKSVPLYETYLHHWFAIKYNENITMSRYIEQSHDISKGINYTRNDGACRGFLLPHYWGL  144

Query  327  GSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDL-  160
            G E+R T+S++PDP+ +E GNP   P G +E W+ ++  IDTRG A +++GCTECRCDL 
Sbjct  145  GGESRGTSSNLPDPFAVEFGNPTNIPHGFKEKWLFDIMVIDTRG-AYSRKGCTECRCDLL  203

Query  159  ------YNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
                  YNVTKD + +PL  +Y GGL CC D  +C++++GF G  R L L+Y + +VDW+
Sbjct  204  NLPKDFYNVTKDINEQPLSLNYKGGLFCCKDNLQCKLRKGFHGPTRKLSLRYKIKWVDWD  263



>ref|XP_002960632.1| hypothetical protein SELMODRAFT_437681 [Selaginella moellendorffii]
 gb|EFJ38171.1| hypothetical protein SELMODRAFT_437681 [Selaginella moellendorffii]
Length=452

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 143/219 (65%), Gaps = 15/219 (7%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            ++ +T  SP F + PG V N+  Y I+FPKGHI VK F+ E+VDE GN +PL + YLHHW
Sbjct  32   IQKKTYKSPAFSMGPGEVQNRN-YTIEFPKGHIGVKNFQGEIVDELGNPVPLSEVYLHHW  90

Query  438  IVGKYMIRKDEVVE----------AADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSV  295
            +V  + ++  E  E           +    + GN G+C +   PQ++GLG+ETR T+  V
Sbjct  91   VVFGFHLKSSERKELVRGGFHDRLGSSAAIIPGNDGICQQNVHPQFWGLGAETRHTSYFV  150

Query  294  PDPYGIEVGNPPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLGD-  118
            P  Y I VGNPP G +E W+LNVHAIDTRGT +  +GC ECRC LYNVT D  G+PL   
Sbjct  151  PGSYAIGVGNPPEGYKELWLLNVHAIDTRGTYD-PQGCLECRCSLYNVTIDASGQPLKQG  209

Query  117  YPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            Y GGL CCY+G KC +K GF+  K+ LY++YT+ +V+W+
Sbjct  210  YKGGLHCCYEGTKCAMKLGFQAPKKTLYMQYTIEWVEWD  248



>ref|XP_006577651.1| PREDICTED: uncharacterized protein LOC100806449 [Glycine max]
Length=460

 Score =   211 bits (538),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 110/240 (46%), Positives = 153/240 (64%), Gaps = 20/240 (8%)
 Frame = -3

Query  663  VCSSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE  484
            +  +  S+ +D EN +K  T +S  FE+ PG + +K FY I+FPKGHI VK F+AE+VDE
Sbjct  71   LSGTTYSIFLDSENHIKSATFVSKSFEVGPGKIVSKSFYDIEFPKGHIGVKSFDAELVDE  130

Query  483  EGNSIPLHQTYLHHWIVGKY-----MIRKDEVVEAADK-MFLVGNSGVCAE--LPQYFGL  328
            +GNS+PL++TYLHHW   KY     M R  E      K +    N G C    LP Y+GL
Sbjct  131  DGNSVPLYETYLHHWFAIKYNENITMSRYIEKSHDISKGINYTRNDGACRGFLLPHYWGL  190

Query  327  GSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRC---  166
            G E+R T+S++PDP+ +E GNP   P G +E W+ ++ AIDTRG A +++GC ECRC   
Sbjct  191  GGESRGTSSNLPDPFAVEFGNPTNIPHGFKEKWLFDIMAIDTRG-AYSRKGCIECRCNLL  249

Query  165  ----DLYNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
                D YNVTKD + +PL  +Y GGL CC D  +C++++GF G  R L L+Y + +VDW+
Sbjct  250  NLPKDFYNVTKDINEQPLSLNYKGGLFCCKDNLQCKLRKGFHGPTRKLSLRYKIKWVDWD  309



>ref|XP_004512657.1| PREDICTED: uncharacterized protein LOC101515735 [Cicer arietinum]
Length=415

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 155/240 (65%), Gaps = 21/240 (9%)
 Frame = -3

Query  663  VCSSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE  484
            + S+  S + + EN +K  T +S +FE+ PG+V +K    I+FPKGHI VK F+ +++DE
Sbjct  25   LSSTIYSQQKEYENHIKSATFVSEKFEIGPGNVVSKALMEIEFPKGHIGVKSFDVDLIDE  84

Query  483  EGNSIPLHQTYLHHWIVGKYM---IRKDEVVEA---ADKMFLVGNSGVC--AELPQYFGL  328
            EGNSI L++TYLHHW    ++   +  D         D +F   N G C    LPQY+GL
Sbjct  85   EGNSIQLYETYLHHWFAINFINKNVSHDPNAHTNPYVDAIFK-RNYGSCNGGILPQYWGL  143

Query  327  GSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCD--  163
            GSE+R T S++PDP+ +EVGNP   P G EE W+ N+  IDTRGT EN++ C+ECRCD  
Sbjct  144  GSESRGTTSNIPDPFAVEVGNPKDIPKGWEEKWLFNIMVIDTRGT-ENRKSCSECRCDQF  202

Query  162  -----LYNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
                  +NV+ D +G+PL  DY GG+ CC+D  +C++++GF   +R L L+Y VT+VDW+
Sbjct  203  NLPDNFFNVSVDINGKPLSPDYKGGIFCCHDNFQCKLRKGFEAPRRNLALRYKVTWVDWD  262



>ref|XP_006577555.1| PREDICTED: uncharacterized protein LOC102664678 [Glycine max]
Length=411

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/240 (45%), Positives = 152/240 (63%), Gaps = 20/240 (8%)
 Frame = -3

Query  663  VCSSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE  484
            +  +  S+ ++ EN +K  T +S  FE+ PG + +K  Y I+FPKGHI VK F+AE+VDE
Sbjct  18   LSGTTYSIFLESENHIKSATFVSKSFEVGPGKIASKALYDIEFPKGHIGVKSFDAELVDE  77

Query  483  EGNSIPLHQTYLHHWIVGKY-----MIRKDEVVEAADK-MFLVGNSGVCAE--LPQYFGL  328
            +G S+PL++TYLHHW   KY     M R  E      K +    N G C    LP Y+GL
Sbjct  78   DGKSVPLYETYLHHWFAIKYNENITMSRYIEQSHDISKGINYTRNDGACRGFLLPHYWGL  137

Query  327  GSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDL-  160
            G E+R T+S++PDP+ +E GNP   P G +E W+ ++  IDTRG A +++GCTECRCDL 
Sbjct  138  GGESRGTSSNLPDPFAVEFGNPTNIPHGFKEKWLFDIMVIDTRG-AYSRKGCTECRCDLL  196

Query  159  ------YNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
                  YNVT+D + +PL  +Y GGL CC D  +C++++GF G  R L L+Y + +VDW+
Sbjct  197  NLPKDFYNVTRDINDQPLSLNYKGGLFCCKDNLQCKLRKGFHGPTRKLSLRYKIRWVDWD  256



>ref|XP_006577556.1| PREDICTED: uncharacterized protein LOC102664794 [Glycine max]
 ref|XP_006577557.1| PREDICTED: uncharacterized protein LOC102664925 [Glycine max]
Length=411

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/240 (45%), Positives = 152/240 (63%), Gaps = 20/240 (8%)
 Frame = -3

Query  663  VCSSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE  484
            +  +  S+ ++ EN +K  T +S  FE+ PG + +K  Y I+FPKGHI VK F+AE+VDE
Sbjct  18   LSGTTYSIFLESENHIKSATFVSKSFEVGPGKIASKALYDIEFPKGHIGVKSFDAELVDE  77

Query  483  EGNSIPLHQTYLHHWIVGKY-----MIRKDEVVEAADK-MFLVGNSGVCAE--LPQYFGL  328
            +G S+PL++TYLHHW   KY     M R  E      K +    N G C    LP Y+GL
Sbjct  78   DGKSVPLYETYLHHWFAIKYNENITMSRYIEQSHDISKGINYTRNDGACRGFLLPHYWGL  137

Query  327  GSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDL-  160
            G E+R T+S++PDP+ +E GNP   P G +E W+ ++  IDTRG A +++GCTECRCDL 
Sbjct  138  GGESRGTSSNLPDPFAVEFGNPTNIPHGFKEKWLFDIMVIDTRG-AYSRKGCTECRCDLL  196

Query  159  ------YNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
                  YNVT+D + +PL  +Y GGL CC D  +C++++GF G  R L L+Y + +VDW+
Sbjct  197  NLPKDFYNVTRDINDQPLSLNYKGGLFCCKDNLQCKLRKGFHGPTRKLSLRYKIRWVDWD  256



>gb|KHN15503.1| hypothetical protein glysoja_049065 [Glycine soja]
Length=404

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/240 (45%), Positives = 152/240 (63%), Gaps = 20/240 (8%)
 Frame = -3

Query  663  VCSSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE  484
            +  +  S+ ++ EN +K  T +S  FE+ PG + +K  Y I+FPKGHI VK F+AE+VDE
Sbjct  11   LSGTTYSIFLESENHIKSATFVSKSFEVGPGKIASKALYDIEFPKGHIGVKSFDAELVDE  70

Query  483  EGNSIPLHQTYLHHWIVGKY-----MIRKDEVVEAADK-MFLVGNSGVCAE--LPQYFGL  328
            +G S+PL++TYLHHW   KY     M R  E      K +    N G C    LP Y+GL
Sbjct  71   DGKSVPLYETYLHHWFAIKYNENITMSRYIEQSHDISKGINYTRNDGACRGFLLPHYWGL  130

Query  327  GSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDL-  160
            G E+R T+S++PDP+ +E GNP   P G +E W+ ++  IDTRG A +++GCTECRCDL 
Sbjct  131  GGESRGTSSNLPDPFAVEFGNPTNIPHGFKEKWLFDIMVIDTRG-AYSRKGCTECRCDLL  189

Query  159  ------YNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
                  YNVT+D + +PL  +Y GGL CC D  +C++++GF G  R L L+Y + +VDW+
Sbjct  190  NLPKDFYNVTRDINDQPLSLNYKGGLFCCKDNLQCKLRKGFHGPTRKLSLRYKIRWVDWD  249



>gb|KHN17845.1| hypothetical protein glysoja_047764 [Glycine soja]
Length=405

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 107/240 (45%), Positives = 152/240 (63%), Gaps = 20/240 (8%)
 Frame = -3

Query  663  VCSSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE  484
            +  +  S+ ++ EN +K  T +S  FE+ PG + +K  Y I+FPKGHI VK F+AE+VDE
Sbjct  11   LSGTTYSIFLESENHIKSATFVSRSFEVGPGKIASKALYDIEFPKGHIGVKSFDAELVDE  70

Query  483  EGNSIPLHQTYLHHWIVGKY-----MIRKDEVVEAADK-MFLVGNSGVCA--ELPQYFGL  328
            +G S+PL++TYLHHW   KY     M R  E      K +    N G C    LP Y+GL
Sbjct  71   DGKSVPLYETYLHHWFAIKYNENITMSRYIEQSHDISKGINYTRNDGACRGFMLPHYWGL  130

Query  327  GSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDL-  160
            G E+R T+S++PDP+ +E GNP   P G +E W+ ++  IDTRG A +++GCTECRCDL 
Sbjct  131  GGESRGTSSNLPDPFAVEFGNPTNIPHGFKEKWLFDIMVIDTRG-AYSRKGCTECRCDLL  189

Query  159  ------YNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
                  YNVT+D + +PL  +Y GGL CC D  +C++++GF G  R L L+Y + +VDW+
Sbjct  190  NLPKDFYNVTRDINEQPLSLNYKGGLFCCKDNLQCKLRKGFHGPTRKLSLRYKIRWVDWD  249



>ref|XP_003522144.2| PREDICTED: uncharacterized protein LOC100792489 [Glycine max]
Length=523

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/234 (46%), Positives = 150/234 (64%), Gaps = 20/234 (9%)
 Frame = -3

Query  645  SLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIP  466
            S+ ++ EN +K  T +S  FE+ PG + +K  Y I+FPKGHI VK F+AE+VDE+G S+P
Sbjct  136  SIFLESENHIKSATFVSKSFEVGPGKIASKALYDIEFPKGHIGVKSFDAELVDEDGKSVP  195

Query  465  LHQTYLHHWIVGKY-----MIRKDEVVEAADK-MFLVGNSGVCAE--LPQYFGLGSETRK  310
            L++TYLHHW   KY     M R  E      K +    N G C    LP Y+GLG E+R 
Sbjct  196  LYETYLHHWFAIKYNENITMSRYIEQSHDISKGINYTRNDGACRGFLLPHYWGLGGESRG  255

Query  309  TNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDL-------  160
            T+S++PDP+ +E GNP   P G +E W+ ++  IDTRG A +++GCTECRCDL       
Sbjct  256  TSSNLPDPFAVEFGNPKNIPHGFKEKWLFDIMVIDTRG-AYSRKGCTECRCDLLNLPKDF  314

Query  159  YNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            YNVT+D + +PL  +Y GGL CC D  +C++++GF G  R L L+Y + +VDW+
Sbjct  315  YNVTRDINEQPLSLNYKGGLFCCKDNLQCKLRKGFHGPTRKLSLRYKIRWVDWD  368



>ref|XP_002960631.1| hypothetical protein SELMODRAFT_270236 [Selaginella moellendorffii]
 gb|EFJ38170.1| hypothetical protein SELMODRAFT_270236 [Selaginella moellendorffii]
Length=448

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/219 (48%), Positives = 142/219 (65%), Gaps = 15/219 (7%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            ++ +T  SP F LEPG V +++ Y I+FPKGHI VK F+ E+VDE GN +PL + YLHHW
Sbjct  29   IQRKTYKSPAFSLEPGEVQDRY-YKIEFPKGHIGVKNFQGEIVDELGNPMPLTELYLHHW  87

Query  438  IVGKYMIRKDEVVE----------AADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSV  295
            +V    ++  E  E           +    + GN G+C      Q++GLG+ETR T+  V
Sbjct  88   VVFGLYLKSSERKELVRGGFHDRLGSPSAIITGNDGICQHNVHSQFWGLGAETRHTSYFV  147

Query  294  PDPYGIEVGNPPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLGD-  118
            P  Y I +GNPP G EE ++LN+HAID RGT + +  C ECRC LYNVT +  G+PL + 
Sbjct  148  PGSYAIGIGNPPEGYEELFVLNLHAIDGRGTYDPQL-CHECRCSLYNVTTEISGQPLKEG  206

Query  117  YPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            Y GGLRCCY+G KC VK GF+  KR LY++YTV +V+W+
Sbjct  207  YKGGLRCCYEGTKCAVKPGFQAPKRVLYMQYTVEWVEWD  245



>ref|XP_007134297.1| hypothetical protein PHAVU_010G035400g, partial [Phaseolus vulgaris]
 gb|ESW06291.1| hypothetical protein PHAVU_010G035400g, partial [Phaseolus vulgaris]
Length=357

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 103/229 (45%), Positives = 146/229 (64%), Gaps = 20/229 (9%)
 Frame = -3

Query  630  EENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTY  451
            +EN +K  T LS +FE+ PG V  K  + IDFPKGHI VK F+ EVVDE+GNS+PL++TY
Sbjct  45   DENHIKSATFLSEQFEVGPGKVAVKTLFDIDFPKGHIGVKSFDVEVVDEDGNSVPLYETY  104

Query  450  LHHWIVGKYM--IRKDEVVEAA----DKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSV  295
            LHHW   KY+  I   + ++ +    + +    N G C    LP Y+GLG E+R T+S++
Sbjct  105  LHHWFAVKYIENITMSQYIKKSHDLRNGIEYERNDGACQGFLLPHYWGLGGESRGTSSNL  164

Query  294  PDPYGIEVGNPPP---GLEEAWMLNVHAIDTRGTAENKRGCTECRC-------DLYNVTK  145
            PDP+ +E+GNP     G +E W+ ++  IDTRG A +++GC+ECRC       D YNVT 
Sbjct  165  PDPFAVELGNPTKIKHGFKEKWLFSIMVIDTRG-AYDRKGCSECRCKLLNLPKDFYNVTM  223

Query  144  DEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            D +G  L  +Y GGL CC D  +C+++ GF G  R L L+Y + +VDW+
Sbjct  224  DINGNLLSRNYKGGLFCCQDNLQCKLRNGFHGPTRKLSLRYKIRWVDWD  272



>ref|XP_006579112.1| PREDICTED: uncharacterized protein LOC100799740 [Glycine max]
Length=405

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/236 (44%), Positives = 143/236 (61%), Gaps = 18/236 (8%)
 Frame = -3

Query  657  SSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEG  478
            S+  SL    EN +K    ++  FE+ PGS+  K F  I FPKGH+ +K F+AE+VD+EG
Sbjct  20   STSYSLYQKPENHIKTAIFVTGSFEMGPGSIATKTFENIKFPKGHVGIKSFDAELVDQEG  79

Query  477  NSIPLHQTYLHHWIVGKY----MIRKDEVVEAADKMFLVGNSGVC--AELPQYFGLGSET  316
            NSIP ++TYLHHW   KY     +  +  +   +  F   N G C    LP Y+G G E+
Sbjct  80   NSIPSYETYLHHWFAIKYHQNITMSPNPKLRRPEDAFFQRNEGTCNGGILPHYWGFGVES  139

Query  315  RKTNSSVPDPYGIEVGNPPP---GLEEAWMLNVHAIDTRGTAENKRGCTECRC-------  166
            R T S +PDP+ IE GNP     G EE W+LN+  IDTRG A++K+ CT+CRC       
Sbjct  140  RGTTSKIPDPFAIEQGNPTKIKNGYEEKWLLNIMVIDTRG-AQDKKACTQCRCDNMNLPK  198

Query  165  DLYNVTKD-EDGRPLGDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            D YNVT+D  + R   +Y GGL CC D  +C+  +GF+G +R + L+Y +++VDWN
Sbjct  199  DFYNVTRDIHNQRLTTNYKGGLFCCQDNLQCKQIEGFQGSRRMVSLRYKISWVDWN  254



>ref|XP_004506757.1| PREDICTED: uncharacterized protein LOC101509765 [Cicer arietinum]
Length=423

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/227 (45%), Positives = 142/227 (63%), Gaps = 20/227 (9%)
 Frame = -3

Query  624  NGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLH  445
            N +K  T +S +FE+ PG+V  K F  I+FPKGHI VK F++E+VDEEGNS+PLH+ YLH
Sbjct  36   NNLKTATFISQKFEVGPGTVAAKTFLDIEFPKGHIGVKSFDSEIVDEEGNSVPLHEAYLH  95

Query  444  HWIVGKYMIRKDEVV-----EAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDP  286
            HW   KY  +          +  +    + N G C    LP Y+GLG E+R T S +P+P
Sbjct  96   HWFAIKYQSKVWNTTSPVPHDPMEDAIYIRNQGTCNSYILPAYWGLGGESRGTISKLPNP  155

Query  285  YGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRC--------DLYNVTKDE  139
            Y +E+G+P   P G EE W+LN+  IDTRG A +K+ C+ECRC        + YN T   
Sbjct  156  YALELGDPKNIPIGFEEKWLLNLMVIDTRG-AIDKKSCSECRCNHFINLPKNFYNDTLGV  214

Query  138  DGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            DG+PL  +Y GGL CC D  +C++K+GF   +R L ++Y +T+VDW+
Sbjct  215  DGKPLSPNYKGGLFCCKDELQCKLKKGFEAPRRKLAIRYKITWVDWD  261



>ref|XP_004510129.1| PREDICTED: uncharacterized protein LOC101508405 [Cicer arietinum]
Length=423

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/227 (44%), Positives = 143/227 (63%), Gaps = 20/227 (9%)
 Frame = -3

Query  624  NGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLH  445
            N +K  T +S +FE+ PG+V  K F  I+FPKGHI VK F++E+VDEEGNS+PLH+ YLH
Sbjct  36   NNLKTATFISQKFEVGPGTVAAKTFLDIEFPKGHIGVKSFDSEIVDEEGNSVPLHEAYLH  95

Query  444  HWIVGKYMIRKDEVV-----EAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDP  286
            HW   KY  +          +  +    + N G C    LP Y+GLG E+R T S +P+P
Sbjct  96   HWFAIKYQSKVWNTTSPIPHDPMEGAIYIRNQGTCNSYILPAYWGLGGESRGTISKLPNP  155

Query  285  YGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRC--------DLYNVTKDE  139
            Y +E+G+P   P G +E W+LN+  IDTRG A++K+ C+ECRC        + YN T   
Sbjct  156  YAVELGDPKNIPIGFQEKWLLNLMVIDTRG-AKDKKSCSECRCNHFINLPKNFYNDTFGV  214

Query  138  DGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            DG+PL  +Y GGL CC D  +C++K+GF   +R L ++Y +T+VDW+
Sbjct  215  DGKPLSPNYKGGLFCCKDELQCKLKKGFEAPRRKLAIRYKITWVDWD  261



>ref|XP_002983407.1| hypothetical protein SELMODRAFT_118200 [Selaginella moellendorffii]
 gb|EFJ15749.1| hypothetical protein SELMODRAFT_118200 [Selaginella moellendorffii]
Length=400

 Score =   199 bits (507),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 140/211 (66%), Gaps = 12/211 (6%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            ++ +T  SP F LEPG V +++ Y I+FPKGHI VK F+ E+VDE GN +PL + YLHHW
Sbjct  29   IQRKTYKSPAFSLEPGEVQDRY-YKIEFPKGHIGVKNFQGEIVDELGNPVPLTELYLHHW  87

Query  438  IV--GKYMIRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGIEV  271
            ++  G +  R       +    + GN G+C      Q++GLG+ETR T+  VP  Y I +
Sbjct  88   VLVRGGFHDRL-----GSPSAIITGNDGICQHNVHSQFWGLGAETRHTSYFVPGSYAIGI  142

Query  270  GNPPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLGD-YPGGLRCC  94
            GNPP G EE ++LN+HAID RGT + +  C ECRC LYNVT +  G+PL + Y GGLRCC
Sbjct  143  GNPPEGYEELFVLNLHAIDGRGTYDPQL-CHECRCSLYNVTTEISGQPLKEGYKGGLRCC  201

Query  93   YDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            Y+G KC VK GF+  KR  Y++YTV +V+W+
Sbjct  202  YEGTKCAVKPGFQAPKRVFYMQYTVEWVEWD  232



>ref|XP_007134300.1| hypothetical protein PHAVU_010G035700g [Phaseolus vulgaris]
 gb|ESW06294.1| hypothetical protein PHAVU_010G035700g [Phaseolus vulgaris]
Length=413

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/240 (43%), Positives = 150/240 (63%), Gaps = 24/240 (10%)
 Frame = -3

Query  657  SSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEG  478
            ++Q  +   +EN +K  T LS  FE+ PG V  K  + IDFPKGHI VK F+ EVVDE+G
Sbjct  21   TTQSVVLESDENHIKSATFLSESFEVGPGKVAVKTLFDIDFPKGHIGVKSFDVEVVDEDG  80

Query  477  NSIPLHQTYLHHWIVGKYM--------IRKDEVVEAADKMFLVGNSGVCAE--LPQYFGL  328
            NS+PL++TYLHHW   KY+        I++    + ++ +    N G C    LP ++GL
Sbjct  81   NSVPLYETYLHHWFAVKYIENITMSHYIKQSH--DVSNGIEYERNDGACQGFLLPHHWGL  138

Query  327  GSETRKTNSSVPDPYGIEVGNPPP---GLEEAWMLNVHAIDTRGTAENKRGCTECRC---  166
            G E+R T+S++P+P+ +E+GNP     G +E W+ N+  IDTRG A +++GC+ECRC   
Sbjct  139  GGESRGTSSNLPNPFAVELGNPTKIKHGFKEKWLFNIMVIDTRG-AHDRKGCSECRCKLL  197

Query  165  ----DLYNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
                D YNVT + +G+ L  +Y GGL CC D  +C+++ GF G  R L L+Y + +VDW+
Sbjct  198  NLPKDFYNVTTNINGQLLSRNYKGGLFCCQDNLQCKLRNGFHGPMRKLSLRYKIRWVDWD  257



>ref|XP_004497966.1| PREDICTED: uncharacterized protein LOC101492429 [Cicer arietinum]
Length=423

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/227 (44%), Positives = 141/227 (62%), Gaps = 20/227 (9%)
 Frame = -3

Query  624  NGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLH  445
            N +K  T +S +F++ PG V  K F  I+FPKGHI VK F++E+VDEEGNS+PLH+ YLH
Sbjct  36   NNLKTATFISQKFDVGPGKVAVKTFLDIEFPKGHIGVKSFDSEIVDEEGNSVPLHEAYLH  95

Query  444  HWIVGKYMIRKDEVV-----EAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDP  286
            HW   KY  +          +  +    + N G C    LP Y+GLG E+R T S +P+P
Sbjct  96   HWFAIKYQSKVWNTTSPVPHDPMEDAIYIRNQGTCNSYILPAYWGLGGESRGTISKLPNP  155

Query  285  YGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRC--------DLYNVTKDE  139
            Y +E+G+P   P G EE W+LN+  IDTRG A +K+ C+ECRC        + YN T   
Sbjct  156  YALELGDPKNIPIGFEEKWLLNLMVIDTRG-AIDKKSCSECRCNHFINLPKNFYNDTFGV  214

Query  138  DGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            DG+PL  +Y GGL CC D  +C++K+GF   +R L ++Y +T+VDW+
Sbjct  215  DGKPLSPNYKGGLFCCKDELQCKLKKGFEAPRRKLAIRYKITWVDWD  261



>ref|XP_004513390.1| PREDICTED: uncharacterized protein LOC101513345 [Cicer arietinum]
Length=409

 Score =   197 bits (501),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 143/231 (62%), Gaps = 28/231 (12%)
 Frame = -3

Query  624  NGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLH  445
            N +K  T +S +FE+ PG V  K F  I+FPKGHI VK F++E+VDEEGNS+PLH+ YLH
Sbjct  22   NNLKTATFISQKFEVGPGKVAVKTFLDIEFPKGHIGVKSFDSEIVDEEGNSVPLHEAYLH  81

Query  444  HWIVGKYM---------IRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSS  298
            HW   KY          I  D + +A      + N G C    LP Y+GLG E+R T S 
Sbjct  82   HWFAIKYQSKVWNNTSPIPHDPMEDA----IYIRNQGTCNSYILPAYWGLGGESRGTISK  137

Query  297  VPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRC--------DLYNV  151
            +P+PY +E+G+P   P G +E W+LN+  IDTRG A +K+ C+ECRC        + YN 
Sbjct  138  LPNPYAVELGDPKNVPIGFQEKWLLNLMVIDTRG-AIDKKSCSECRCNNFINLPKNFYND  196

Query  150  TKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            T   DG+PL  +Y GGL CC D  +C++K+GF   +R L ++Y +T+VDW+
Sbjct  197  TFGIDGKPLSPNYKGGLFCCKDELQCKLKKGFEAPRRKLAIRYKITWVDWD  247



>ref|XP_006574192.1| PREDICTED: uncharacterized protein LOC100820275 [Glycine max]
Length=562

 Score =   200 bits (509),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 103/236 (44%), Positives = 143/236 (61%), Gaps = 18/236 (8%)
 Frame = -3

Query  657  SSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEG  478
            S+  SL    EN +K    ++  FE+ PGS+  K F  I FPKGH+ +K F+AE+VD+EG
Sbjct  176  SASYSLYQKPENHIKTAIFVTGSFEMGPGSIATKTFENIKFPKGHVGIKSFDAELVDQEG  235

Query  477  NSIPLHQTYLHHWIVGKY----MIRKDEVVEAADKMFLVGNSGVC--AELPQYFGLGSET  316
            NSIP ++TYLHHW   KY     +  +  +   +  F   N G C    LP Y+G G E+
Sbjct  236  NSIPSYETYLHHWFAIKYHQNITMSPNPKLRRPEDAFFQRNEGTCNGGILPHYWGFGVES  295

Query  315  RKTNSSVPDPYGIEVGNPPP---GLEEAWMLNVHAIDTRGTAENKRGCTECRC-------  166
            R T S +PDP+ IE GNP     G EE W+LN+  IDTRG A++K+ CT+CRC       
Sbjct  296  RGTTSKIPDPFAIEQGNPTKIKNGYEEKWLLNIMVIDTRG-AQDKKACTQCRCDQMNLPK  354

Query  165  DLYNVTKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            D YNVT+D   + L  +Y GGL CC D  +C+  +GF+G +R + L+Y +++VDWN
Sbjct  355  DFYNVTRDIHNQKLTTNYKGGLFCCQDNLQCKQIEGFQGSRRMVSLRYKISWVDWN  410



>ref|XP_004497967.1| PREDICTED: uncharacterized protein LOC101492762 [Cicer arietinum]
Length=718

 Score =   201 bits (511),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/228 (44%), Positives = 141/228 (62%), Gaps = 20/228 (9%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
             N +K  T +S +F++ PG V  K F  I+FPKGHI VK F++E+VDEEGNS+PLH+ YL
Sbjct  332  SNNLKTATFISQKFDVGPGKVAVKTFLDIEFPKGHIGVKSFDSEIVDEEGNSVPLHEAYL  391

Query  447  HHWIVGKYMIRKDEVV-----EAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPD  289
            HHW   KY  +          +  +    + N G C    LP Y+GLG E+R T S +P+
Sbjct  392  HHWFAIKYQSKVWNTTSPIPHDPMEGAIYIRNQGTCNSYILPAYWGLGGESRGTISKLPN  451

Query  288  PYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRC--------DLYNVTKD  142
            PY +E+G+P   P G +E W+LN+  IDTRGT + K+ C+ECRC        + YN T  
Sbjct  452  PYAVELGDPKNVPIGFQEKWLLNIMIIDTRGTID-KKSCSECRCNHFINLPKNFYNDTFG  510

Query  141  EDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             DG+PL  +Y GGL CC D  +C++K+GF   +R L ++Y +T+VDW+
Sbjct  511  VDGKPLSPNYKGGLFCCKDELQCKLKKGFEAPRRKLAIRYKITWVDWD  558



>ref|XP_007132991.1| hypothetical protein PHAVU_011G142100g [Phaseolus vulgaris]
 gb|ESW04985.1| hypothetical protein PHAVU_011G142100g [Phaseolus vulgaris]
Length=389

 Score =   188 bits (478),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 100/229 (44%), Positives = 142/229 (62%), Gaps = 24/229 (10%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            E+ +K  T LS +FE+ PG +  K    IDFPKGHI VK F+ EVVDE+G S+PL++TYL
Sbjct  31   ESYIKSATFLSEKFEVGPGKIVVKTLLDIDFPKGHIGVKSFDVEVVDEDGKSVPLYETYL  90

Query  447  HHWIVGKYM--------IRKDEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSS  298
            HHW   KY+        I+K    +  + +    N G+C    LP Y+GLG E+R T+S+
Sbjct  91   HHWFAVKYIENITMSHYIKKSH--DLRNGIEFERNDGMCQGFLLPHYWGLGGESRGTSSN  148

Query  297  VPDPYGIEVGNPPP---GLEEAWMLNVHAIDTRGTAENKRGCTECRCDL-------YNVT  148
            +PDP+ +E+GNP     G +E W+ ++  IDTRGT  +++GCTECRC L       YNVT
Sbjct  149  LPDPFAVELGNPTKLKDGFKEKWLFSIMVIDTRGT-HDRKGCTECRCKLLNLPNNFYNVT  207

Query  147  KDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDW  4
               +G+ L  +Y GGL CC D  +C+++  F+G  R L L+Y + +VDW
Sbjct  208  MGINGQLLPRNYKGGLFCCQDKLQCKLRNDFQGPTRNLSLRYKIRWVDW  256



>ref|XP_007137902.1| hypothetical protein PHAVU_009G165400g [Phaseolus vulgaris]
 gb|ESW09896.1| hypothetical protein PHAVU_009G165400g [Phaseolus vulgaris]
Length=399

 Score =   186 bits (473),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 142/231 (61%), Gaps = 22/231 (10%)
 Frame = -3

Query  630  EENG--VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQ  457
            E NG  +K  T LS +FE+ PG +  K    IDFPKGHI VK F+ EVVDE G S+PL++
Sbjct  14   ESNGSYIKSATFLSEKFEVGPGKIVVKTLLDIDFPKGHIGVKSFDVEVVDENGKSVPLYE  73

Query  456  TYLHHWIVGKY---MIRKDEVVEAAD---KMFLVGNSGVCAE--LPQYFGLGSETRKTNS  301
            TYLHHW   KY   +   + + E+ D    +    N G+C    LP Y+GLG E+R T+S
Sbjct  74   TYLHHWFAVKYIENITMSNYIKESHDLRNGIEFERNDGMCQGFLLPHYWGLGGESRGTSS  133

Query  300  SVPDPYGIEVGNPPP---GLEEAWMLNVHAIDTRGTAENKRGCTECRCDL-------YNV  151
            ++PDP+ +E+GNP     G +E W+ ++  IDTRG A +++GC+ECRC L       YNV
Sbjct  134  NLPDPFAVELGNPTKLKDGFKEKWLFSIMVIDTRG-AHDRKGCSECRCKLLNLPTNFYNV  192

Query  150  TKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            T   +G+ L  +Y GGL CC D  +C+++  F G  R L L+Y + +VDW+
Sbjct  193  TMGINGQLLPRNYKGGLFCCQDNLQCKLRNDFHGPIRNLSLRYKIRWVDWD  243



>ref|XP_007134075.1| hypothetical protein PHAVU_010G017500g [Phaseolus vulgaris]
 gb|ESW06069.1| hypothetical protein PHAVU_010G017500g [Phaseolus vulgaris]
Length=425

 Score =   187 bits (474),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 100/239 (42%), Positives = 148/239 (62%), Gaps = 21/239 (9%)
 Frame = -3

Query  657  SSQRSLRIDE-ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEE  481
            S+  S+ ++  E+ +K  T LS +FE+ PG V  K    I+FPKGHI VK F+ EVVDE+
Sbjct  32   STTHSIVVESNESYIKSATFLSEKFEVGPGKVVVKTLLDIEFPKGHIGVKSFDVEVVDED  91

Query  480  GNSIPLHQTYLHHWIVGKYM--IRKDEVVEAA----DKMFLVGNSGVCAE--LPQYFGLG  325
            G S+PL++TYLHHW   KY+  I     ++ +    + +    N G+C    LP Y+GLG
Sbjct  92   GKSVPLYETYLHHWFAVKYIENITMSNYIKQSHDLRNGLEFERNDGMCQGFLLPHYWGLG  151

Query  324  SETRKTNSSVPDPYGIEVGNPPP---GLEEAWMLNVHAIDTRGTAENKRGCTECRCDL--  160
             E+R T+S++PDP+ +E+GNP     G +E W+ ++  IDTRG A +++GC+ECRC L  
Sbjct  152  GESRGTSSNLPDPFAVELGNPTKLKDGFKEKWLFSIMVIDTRG-AHDRKGCSECRCKLLN  210

Query  159  -----YNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
                 YNVT   +G+ L  +Y GGL CC D  +C+++  F G  R L L+Y + +VDW+
Sbjct  211  LPNNFYNVTVGINGQLLPRNYKGGLFCCQDNLQCKLRNDFHGPTRNLSLRYKIRWVDWD  269



>emb|CAN69533.1| hypothetical protein VITISV_013567 [Vitis vinifera]
Length=202

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 120/188 (64%), Gaps = 28/188 (15%)
 Frame = -3

Query  615  KVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHWI  436
            K    LSP F L PGSV N+++  ++ P+GHIA+K F AEVVDE    +PL +TYLHHW+
Sbjct  31   KSVVFLSPEFVLGPGSVVNRYYQNVNLPRGHIALKNFNAEVVDEARLPVPLQETYLHHWV  90

Query  435  VGKYMIRK-------DEVVEAADKMFL-VGNSGVCAELPQYFGLGSETRKTNSSVPDPYG  280
            + +Y  RK         + EA +  F+ V NSG+C                 + VPDPYG
Sbjct  91   IERYYQRKGVEAPEHSSIKEARNPEFITVRNSGICQ---------------ITHVPDPYG  135

Query  279  IEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL-GDYP  112
            IE+G+P   P G EE W+LN+HAIDTRG  E++ GCTECRCDLYNVTKDE G PL  DY 
Sbjct  136  IEIGDPDEIPDGYEEKWLLNIHAIDTRGM-EDRLGCTECRCDLYNVTKDEYGDPLSSDYK  194

Query  111  GGLRCCYD  88
            GGLRCCYD
Sbjct  195  GGLRCCYD  202



>ref|XP_007134136.1| hypothetical protein PHAVU_010G022300g [Phaseolus vulgaris]
 gb|ESW06130.1| hypothetical protein PHAVU_010G022300g [Phaseolus vulgaris]
Length=413

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 139/228 (61%), Gaps = 20/228 (9%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            E+ +K  T LS  FE+ PG +  K    IDFPKGHI VK F+ EVVDE+G S+PL++ YL
Sbjct  31   ESYIKSATFLSEEFEVGPGKIAVKTLLDIDFPKGHIGVKSFDVEVVDEDGKSVPLYEAYL  90

Query  447  HHWIVGKYM--IRKDEVVEAADKMF----LVGNSGVCAE--LPQYFGLGSETRKTNSSVP  292
            HHW   KY+  I     ++ +  +        N G+C    LP Y+GLG E+R T+S++P
Sbjct  91   HHWFAVKYIENITLSHYIKQSHDLRSGIEFERNDGMCQGFLLPHYWGLGGESRGTSSNLP  150

Query  291  DPYGIEVGNPPP---GLEEAWMLNVHAIDTRGTAENKRGCTECRCDL-------YNVTKD  142
            DP+ +E+GNP     G +E W+ ++  IDTRG A +++GC+ECRC L       YNVT  
Sbjct  151  DPFAVELGNPTKLKDGFKEKWLFSIMVIDTRG-AHDRKGCSECRCKLLNLPKNFYNVTMG  209

Query  141  EDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             +G+ L  +Y GGL CC D  +C+++  F G  R L L+Y + +VDW+
Sbjct  210  INGQLLSRNYKGGLFCCQDNLQCKLRNDFHGPPRKLSLRYKIRWVDWD  257



>ref|XP_007134084.1| hypothetical protein PHAVU_010G018100g [Phaseolus vulgaris]
 gb|ESW06078.1| hypothetical protein PHAVU_010G018100g [Phaseolus vulgaris]
Length=399

 Score =   184 bits (467),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 100/239 (42%), Positives = 146/239 (61%), Gaps = 21/239 (9%)
 Frame = -3

Query  657  SSQRSLRIDE-ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEE  481
            S+  S+ ++  E+ +K  T LS +FE+ PG V  K    IDFPKGHI VK F+ EVVDE+
Sbjct  6    STTHSIVVESNESYIKSATFLSEKFEVGPGKVVVKTLLDIDFPKGHIGVKSFDVEVVDED  65

Query  480  GNSIPLHQTYLHHWIVGKYM--IRKDEVVEAA----DKMFLVGNSGVCAE--LPQYFGLG  325
            G S+PL++TYLHHW   KY+  I     ++      + +    N G+C    LP Y+GLG
Sbjct  66   GKSVPLYETYLHHWFAVKYIENITMSHYIKQTHDLRNGIEFERNEGMCQGFLLPHYWGLG  125

Query  324  SETRKTNSSVPDPYGIEVGNPPP---GLEEAWMLNVHAIDTRGTAENKRGCTECRCDL--  160
             E+R T+S++PDP+ +E+GNP     G +E W+ ++  IDTRGT  +++GC+ECRC L  
Sbjct  126  GESRGTSSNLPDPFAVELGNPTKLKDGFKEKWLFSIMVIDTRGT-HDRKGCSECRCKLLN  184

Query  159  -----YNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
                 YNVT   +G+ L  +Y  GL CC D  +C+++  F G  R L L+Y + +VDW+
Sbjct  185  LPNNFYNVTVGINGQLLPRNYKEGLFCCQDNLQCKLRNDFHGPTRNLSLRYKIRWVDWD  243



>ref|XP_007134081.1| hypothetical protein PHAVU_010G017900g [Phaseolus vulgaris]
 gb|ESW06075.1| hypothetical protein PHAVU_010G017900g [Phaseolus vulgaris]
Length=413

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 100/239 (42%), Positives = 146/239 (61%), Gaps = 21/239 (9%)
 Frame = -3

Query  657  SSQRSLRIDE-ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEE  481
            S+  S+ ++  E+ +K  T LS +FE+ PG V  K    IDFPKGHI VK F+ EVVDE 
Sbjct  20   STTHSIVVESNESYIKSATFLSEKFEVGPGKVAVKTLLDIDFPKGHIGVKSFDVEVVDEV  79

Query  480  GNSIPLHQTYLHHWIVGKYM--IRKDEVVEAA----DKMFLVGNSGVCAE--LPQYFGLG  325
            G S+PL++TYLHHW   KY+  I     ++ +    + +    N G+C    LP Y+G G
Sbjct  80   GKSVPLYETYLHHWFAVKYIENITMSHYIKQSHDLRNGIEFERNEGLCQGFLLPHYWGSG  139

Query  324  SETRKTNSSVPDPYGIEVGNPPP---GLEEAWMLNVHAIDTRGTAENKRGCTECRCDL--  160
             E+R T+S++PDP+ +E+GNP     G +E W+ ++  IDTRGT  +++GC+ECRC L  
Sbjct  140  GESRGTSSNLPDPFAVELGNPTKLKDGFKEKWLFSIMVIDTRGT-HDRKGCSECRCKLLN  198

Query  159  -----YNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
                 YNVT   +G+ L  +Y GGL CC D  +C+++  F G  R L L+Y + +VDW+
Sbjct  199  LPNNFYNVTVGINGQLLPRNYKGGLFCCQDNLQCKLRNDFHGPTRNLSLRYKIRWVDWD  257



>ref|XP_007134138.1| hypothetical protein PHAVU_010G022500g [Phaseolus vulgaris]
 gb|ESW06132.1| hypothetical protein PHAVU_010G022500g [Phaseolus vulgaris]
Length=413

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/239 (41%), Positives = 146/239 (61%), Gaps = 21/239 (9%)
 Frame = -3

Query  657  SSQRSLRIDE-ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEE  481
            S+  S+ ++  E+ +K  T LS  FE+ PG +  K    IDFPKGHI VK F+ EVVDE+
Sbjct  20   STTHSIVVESNESYIKSATFLSEEFEVGPGKIAVKTLLDIDFPKGHIGVKSFDVEVVDED  79

Query  480  GNSIPLHQTYLHHWIVGKYM--IRKDEVVEAA----DKMFLVGNSGVCAE--LPQYFGLG  325
            G S+PL++ YLHHW   KY+  I     ++ +    + +    N G+C    LP Y+GLG
Sbjct  80   GKSVPLYEAYLHHWFAVKYIENITMSHYIKQSHDLRNGIEFERNDGMCQGFLLPHYWGLG  139

Query  324  SETRKTNSSVPDPYGIEVGNPPP---GLEEAWMLNVHAIDTRGTAENKRGCTECRCDL--  160
             E+R T+S++P+P+ +E+GNP     G +E W+ ++  IDTRG A +++GC+ECRC L  
Sbjct  140  GESRGTSSNLPNPFAVELGNPTKLKDGFKEKWLFSIMVIDTRG-AHDRKGCSECRCKLLN  198

Query  159  -----YNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
                 YNVT   +G+ L  +Y GGL CC D  +C+++  F G  R L L+Y + +VDW+
Sbjct  199  LPKNFYNVTMGINGQLLPRNYKGGLFCCQDNLQCKLRNDFHGPTRKLSLRYKIRWVDWD  257



>gb|KHN44114.1| hypothetical protein glysoja_039252, partial [Glycine soja]
Length=347

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 127/207 (61%), Gaps = 19/207 (9%)
 Frame = -3

Query  567  VCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHWIVGKY-----MIRKDEV  403
            +  K F  I FPKGH+ +K F+AE+VD+EGNSIP ++TYLHHW   KY     M    ++
Sbjct  1    IATKTFENIKFPKGHVGIKSFDAELVDQEGNSIPSYETYLHHWFAIKYHQNITMSPNPKL  60

Query  402  VEAADKMFLVGNSGVC--AELPQYFGLGSETRKTNSSVPDPYGIEVGNPPP---GLEEAW  238
            +   +  F   N G C     P Y+G G E+R T S +PDP+ IE GNP     G EE W
Sbjct  61   LRRPEDAFFQRNEGTCNGGIFPHYWGFGVESRGTTSKIPDPFAIEQGNPTKIKNGYEEKW  120

Query  237  MLNVHAIDTRGTAENKRGCTECRC-------DLYNVTKD-EDGRPLGDYPGGLRCCYDGA  82
            +LN+  IDTRG A++K+ CT+CRC       D YNVT+D  + R   +Y GGL CC D  
Sbjct  121  LLNIMVIDTRG-AQDKKACTQCRCDHMNLPKDFYNVTRDIHNQRLTTNYKGGLFCCQDNL  179

Query  81   KCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            +C+  +GF+G +R + L+Y +++VDWN
Sbjct  180  QCKQIEGFQGSRRMVSLRYKISWVDWN  206



>ref|XP_003627861.1| MtN19-like protein [Medicago truncatula]
 gb|AET02337.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=409

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/228 (39%), Positives = 138/228 (61%), Gaps = 21/228 (9%)
 Frame = -3

Query  624  NGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLH  445
            N ++  T LS  FE+ P  V +K  Y I+FPKGH+ +K F+ ++VDE GN +PLH+TY+H
Sbjct  30   NVIQSTTYLSKEFEVGPREVADKQMYNIEFPKGHVGIKSFDVDLVDEHGNFVPLHETYIH  89

Query  444  HWIVGKYMIRK--------DEVVEAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSV  295
            HW + KY+I+K        ++  + +  +    N G C    LP  +  GSETR T++ +
Sbjct  90   HWFILKYIIKKNMSMSQDPNDHTKPSGDLIYKRNDGTCNNGILPHQWSSGSETRGTSTKL  149

Query  294  PDPYGIEVGNPP---PGLEEAWMLNVHAIDTRGTAENKRGCTECRCD-------LYNVTK  145
            P P+ +E+GNP     G EE W+L V  IDTRG  ENK+ CT+CRCD        Y+VT 
Sbjct  150  PYPFAVEIGNPADITEGWEEQWLLGVLVIDTRG-VENKKICTQCRCDQFNLPENFYDVTV  208

Query  144  DEDGRPLGDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
               G+   +Y  G+ CC D  +C++++GF+  +R L ++Y +T+V+W+
Sbjct  209  GFHGKVTPEYKAGVLCCQDKFQCKMRKGFQAPRRNLAIRYNITWVNWD  256



>ref|XP_001774740.1| predicted protein [Physcomitrella patens]
 gb|EDQ60411.1| predicted protein [Physcomitrella patens]
Length=379

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 129/209 (62%), Gaps = 5/209 (2%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            VK  T LSP    +PG   NK+F   ++PKGHI ++   A++VD+ G +IPL + YLHHW
Sbjct  15   VKTVTYLSPPLTAKPGEANNKYFTA-EYPKGHIGIRSVNADLVDQNGIAIPLFENYLHHW  73

Query  438  IVGKYMIRKDEVVEAADKMFLVGNSG--VCAELPQYFGLGSETRKTNSSVPDPYGIEVGN  265
            I+ ++ +  D  + AA +       G     ++  + G G ETR T+S +P PY  E G 
Sbjct  74   ILLEHGMHMDATMIAALEAPHHNKVGRFPNGKVRNFLGKGGETRHTDSRLPLPYVKESGV  133

Query  264  PPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLGD-YPGGLRCCYD  88
               G E  W+LNVH +DTRG A +  GC+ECRC LYN T DEDG PL D Y GGLRCC D
Sbjct  134  ELEGYENRWILNVHGLDTRG-AVDHIGCSECRCHLYNTTTDEDGEPLPDGYIGGLRCCTD  192

Query  87   GAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            G +C VK+GF GE+   +L+YT  Y+DWN
Sbjct  193  GRQCAVKEGFNGEEITFHLRYTWEYIDWN  221



>ref|XP_003620759.1| MtN19-like protein [Medicago truncatula]
 gb|AES76977.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=425

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 136/226 (60%), Gaps = 21/226 (9%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +   T LS +F++ PG V +   Y I+FPKGH+ +K F+ ++VDE GNS+PLH+TY+HHW
Sbjct  58   IHSTTYLSKKFDVGPGEVADIHMYNIEFPKGHVGIKSFDVDLVDEHGNSVPLHETYIHHW  117

Query  438  IVGKYMIRKDEVV--------EAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPD  289
             + KY I+K+  V        + +  +    N G C    LP  +  GSETR T++ +P 
Sbjct  118  FILKYNIKKNMSVSQNPNDHSKPSGDLIYKRNDGTCNNGILPHQWSSGSETRGTSTKLPY  177

Query  288  PYGIEVGNPP---PGLEEAWMLNVHAIDTRGTAENKRGCTECRCD-------LYNVTKDE  139
            P+ +E+GN      G EE W+L V  IDTRG AENK+ C +CRCD        Y+VT   
Sbjct  178  PFAVEIGNRADITEGWEEQWLLGVLVIDTRG-AENKKICIQCRCDQFNLPENFYDVTVGF  236

Query  138  DGRPLGDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             G+   +Y  G+ CC D  +C++++GF+  +R L +KY +T+V+W+
Sbjct  237  HGKVTPEYKAGVLCCQDKFQCKMRKGFQAPRRNLAIKYNITWVNWD  282



>ref|XP_004170875.1| PREDICTED: uncharacterized protein LOC101232587, partial [Cucumis 
sativus]
Length=178

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 116/175 (66%), Gaps = 15/175 (9%)
 Frame = -3

Query  600  LSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHWIVGKYM  421
            ++P F L+PG V  +FFY  +FP+GHIA+K F+ EVVDEE N IPL +TYLHHW + +Y 
Sbjct  1    MTPFFTLKPGHVVERFFYNTNFPEGHIAIKSFDVEVVDEEDNPIPLFETYLHHWGILRYY  60

Query  420  IRKDEVVEAADKMF---------LVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGIE  274
              KD      +  F         + GNSGVC +  LPQ+FG G+++RKT+S +P PYGIE
Sbjct  61   QHKDTKDPHTNTSFTQLQEPNFIIAGNSGVCQKHALPQFFGTGADSRKTSSFLPHPYGIE  120

Query  273  VGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLGD  118
            VGN    P G EE W+LN+HAIDTRG  E++ GC EC+  LYNVTKD  G  L D
Sbjct  121  VGNEKEVPLGYEEKWVLNIHAIDTRG-VEDRIGCIECKRHLYNVTKDGLGMALED  174



>ref|XP_003620745.1| MtN19 protein [Medicago truncatula]
 gb|AES76963.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=409

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 137/226 (61%), Gaps = 21/226 (9%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            ++  T LS +FE+ PG V NK  + I+FPKGH+ +  F+ ++V+E GN +PLH+TY+HHW
Sbjct  32   IQSMTYLSKKFEVGPGEVANKQMFNIEFPKGHVGITSFDVDLVNEHGNFVPLHETYIHHW  91

Query  438  IVGKYMIRKDEVV--------EAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPD  289
             + KY+I+K+  V        + +  +    N G C    LP  +  GSETR T++ +P 
Sbjct  92   FILKYIIKKNMSVSQDPNDHTKPSGDLIYKRNDGTCNNGILPHQWSSGSETRGTSTKLPY  151

Query  288  PYGIEVGNPP---PGLEEAWMLNVHAIDTRGTAENKRGCTECRCD-------LYNVTKDE  139
            PY +E+GN      G EE W+L V  IDTRG AENK+ C +CRCD        Y+VT   
Sbjct  152  PYAVEIGNHADITEGWEEQWLLGVLVIDTRG-AENKKICVQCRCDQFNLPENFYDVTIGF  210

Query  138  DGRPLGDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             G+   +Y  G+ CC D  +C++++GF+  +R L ++Y +T+V+W+
Sbjct  211  HGKFTPEYKAGVLCCQDKFQCKMRKGFQAPRRNLAIRYNITWVNWD  256



>ref|XP_003599552.1| MtN19-like protein [Medicago truncatula]
 gb|AES69803.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=409

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/226 (38%), Positives = 133/226 (59%), Gaps = 21/226 (9%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            ++  T LS  FE+  G V +K  Y I+FP GH+ +K    ++VDE GNS+PLH+TY+HHW
Sbjct  32   IQSTTYLSKEFEVGHGEVADKKMYNIEFPMGHVGIKSIYVDLVDEHGNSVPLHETYIHHW  91

Query  438  IVGKYMIRKDEVV--------EAADKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSVPD  289
             + KY+I+K+  V        + +  +    N G C +  LP  +  GSETR T++ +P 
Sbjct  92   YILKYIIKKNMSVSQDPNDHTKPSGDLIYKRNDGTCNKGILPHQWSSGSETRGTSTKLPY  151

Query  288  PYGIEVGNPP---PGLEEAWMLNVHAIDTRGTAENKRGCTECRCD-------LYNVTKDE  139
             + +E+GN      G EE W+L +  IDTRG AENK+ C +CRCD        Y+VT   
Sbjct  152  SFAVEIGNHADITEGWEEQWLLGLLVIDTRG-AENKKICIQCRCDQFNLPANFYDVTVGF  210

Query  138  DGRPLGDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             G+   +Y  G+ CC D  +C++ +GF+  +R L ++Y +T+V+W+
Sbjct  211  HGKVTHEYKAGVLCCQDKFQCKMIKGFQAPRRNLAIRYNITWVNWD  256



>gb|KEH42150.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=236

 Score =   161 bits (407),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 123/202 (61%), Gaps = 22/202 (11%)
 Frame = -3

Query  543  IDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHWIVGKY--MIRKDEVVEAADKMFLVG  370
            I+FP GHI VK F+ ++VDE+GNSIPL++TY+HHW   KY  +  K+   +  D     G
Sbjct  3    IEFPSGHIGVKSFDIDLVDEQGNSIPLYETYIHHWFALKYDEIDDKNMSHDPNDNTKPFG  62

Query  369  ------NSGVCAE--LPQYFGLGSETRKTNSSVPDPYGIEVGNPP---PGLEEAWMLNVH  223
                  N G C +  LP Y+GLG E+R T S +PDP+ +EVGNP       +E W+  V 
Sbjct  63   GPIIKRNQGTCNDLILPLYWGLGGESRGTISKLPDPFAVEVGNPANITKDWKEKWLFYVM  122

Query  222  AIDTRGTAENKRGCTECRCD-------LYNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVK  67
             IDTRGT +N++ C+ECRCD        YN T D   +PL  DY GG+ CC++  +C+++
Sbjct  123  FIDTRGT-KNRKSCSECRCDQFNLPKNFYNKTHDIHDKPLSHDYKGGIFCCHNKFQCKLR  181

Query  66   QGFRGEKRGLYLKYTVTYVDWN  1
            +G    +R L ++Y + +VDWN
Sbjct  182  KGLPAPRRKLAIRYKIMWVDWN  203



>gb|EYU24544.1| hypothetical protein MIMGU_mgv1a007758mg [Erythranthe guttata]
Length=396

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 108/160 (68%), Gaps = 13/160 (8%)
 Frame = -3

Query  459  QTYLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAE-LPQYFGLGSETRKTNSSVPDPY  283
             TYLHHW++ +Y  + +          LV NSG+C   L QYFGLG+ETRKT + +PDPY
Sbjct  26   NTYLHHWVLQRYYHQIN-----GSDFILVKNSGLCGTGLTQYFGLGAETRKTETHIPDPY  80

Query  282  GIEVGN--PPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLG-DYP  112
            GIE G   P  G EE W LNVHAIDTRG A ++  CTEC CDLYNVT DE G  +  +Y 
Sbjct  81   GIEAGGNIPAAGYEEGWFLNVHAIDTRG-AHDRLACTECGCDLYNVTVDEYGVTVPREYK  139

Query  111  GGLRCCYDGAKCRVKQG--FRG-EKRGLYLKYTVTYVDWN  1
            GG+RCC+DG +C V++G  F G  +R LYL+YTV YV+WN
Sbjct  140  GGVRCCHDGTRCPVREGIFFSGVAERSLYLRYTVKYVEWN  179



>ref|XP_010444013.1| PREDICTED: uncharacterized protein LOC104726773 [Camelina sativa]
Length=218

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 102/171 (60%), Gaps = 26/171 (15%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            EN +K E   SP+  + PGSV + + + IDFP+GHI +K F+AEVVDE GN +PL +TYL
Sbjct  29   ENKIKSEVFFSPKLAMSPGSVSDSYLFDIDFPRGHIGLKSFDAEVVDEAGNPVPLLETYL  88

Query  447  HHWIVGKYMIRKDEVVEA---------------------ADKMFLVGNSGVC--AELPQY  337
            HHW+V  Y +RK   +                       +  + LV N G+C  A L  Y
Sbjct  89   HHWVVQPYYVRKGSKLPQREMFRNHGFSRQDPETNLDSRSSDIILVKNGGLCRGAVLRHY  148

Query  336  FGLGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAEN  193
            +GLGSETRKT++  PDPY +E+ NP   P G E  W+LN+HAIDTRG  E+
Sbjct  149  YGLGSETRKTSTYFPDPYAVEIDNPQERPDGYEFKWLLNLHAIDTRGVEEH  199



>ref|XP_004173525.1| PREDICTED: uncharacterized protein LOC101232803 [Cucumis sativus]
Length=180

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 92/152 (61%), Gaps = 14/152 (9%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K +T  SP F + PG V  KFFY I+FPK HIA+K F  EVVDE GN IPL QTYLHHW
Sbjct  22   IKTQTFSSPSFTITPGLVIEKFFYNINFPKSHIAIKSFHVEVVDESGNQIPLSQTYLHHW  81

Query  438  IVGKYMIRKDEVVEAADKMF---------LVGNSGVCAE--LPQYFGLGSETRKTNSSVP  292
             + +Y   K+      +  +         +  N+GVC +  L  Y+  GSE+RK ++ +P
Sbjct  82   ELMRYYQHKNATNPTINTSYNELQEPNFIIASNNGVCGQNVLKAYYAFGSESRKLSTFLP  141

Query  291  DPYGIEVGNP---PPGLEEAWMLNVHAIDTRG  205
             PYG EVGNP   P   EE W LNVHAIDTRG
Sbjct  142  HPYGTEVGNPKEIPTDYEERWSLNVHAIDTRG  173



>ref|XP_003589696.1| MtN19-like protein [Medicago truncatula]
 gb|AES59947.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=359

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/234 (35%), Positives = 129/234 (55%), Gaps = 23/234 (10%)
 Frame = -3

Query  663  VCSSQRSLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDE  484
            + SS    ++     ++  T LS  FE+ PG V  K  + I+FPKGH+ +K F+ ++VDE
Sbjct  17   MLSSTTYSQLRSPKVIQSTTYLSKEFEVGPGEVAAKQMFDIEFPKGHVGIKSFDVDLVDE  76

Query  483  EGNSIPLHQTYLHHWIVGKYMIRKDEVV--EAADKMFLVG------NSGVCAE--LPQYF  334
             GN IPL++TY+HHW + KY+I+K+  V  +  D     G      N G C    LP  +
Sbjct  77   HGNFIPLYETYIHHWYILKYIIKKNTSVSHDPNDHTKPYGEPIFKRNDGTCNNGILPHQW  136

Query  333  GLGSETRKTNSSVPDPYGIEVGNPP---PGLEEAWMLNVHAIDTRGTAENKRGCTECRCD  163
            G G ETR T + +P P+ + +GNP     G EE W+L +  IDTRG A+NK+ C +CRCD
Sbjct  137  GSGGETRGTITKLPYPFAVGIGNPANITEGWEEKWLLGLLLIDTRG-AKNKKICIQCRCD  195

Query  162  LYNVTKDEDGRPLGDYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             +N+ +       G         + G      +GF+  ++ L ++Y +T+V+W+
Sbjct  196  QFNLPEIFYNVTFG---------FHGKVTPEYKGFQAPRKNLAIRYNITWVNWD  240



>ref|XP_004137076.1| PREDICTED: uncharacterized protein LOC101210001 [Cucumis sativus]
Length=541

 Score =   148 bits (373),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 99/138 (72%), Gaps = 12/138 (9%)
 Frame = -3

Query  381  FLVGNSGVCAE--LPQYFGLGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAI  217
             + GN+GVC +  LPQ+FG G+E+RKT+S +P PYGIEVGN    P G EE W+LN+HAI
Sbjct  143  IVAGNNGVCQKHALPQFFGTGAESRKTSSFLPHPYGIEVGNEKEVPLGYEEKWVLNIHAI  202

Query  216  DTRGTAENKRGCTECRCDLYNVTKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGFRGE---  49
            DTRG  E++ GC EC+  LYNVTKD  G  L  DY GGLRCCYD  +C+VK+G+  E   
Sbjct  203  DTRG-VEDRIGCIECKRHLYNVTKDGLGMALEDDYIGGLRCCYDQTQCKVKKGYENELGD  261

Query  48   --KRGLYLKYTVTYVDWN  1
              +R LY++YTV +VDW+
Sbjct  262  DQQRNLYVRYTVKWVDWD  279



>emb|CDY71893.1| BnaCnng74960D [Brassica napus]
Length=149

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 91/148 (61%), Gaps = 19/148 (13%)
 Frame = -3

Query  582  LEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHWIVGKYMIRKDEV  403
            + PGSV N + + IDFP+GHI +KGF+AEVVD+ G  IPLH+TYLHHW+V  Y + K   
Sbjct  1    MNPGSVANPYLFDIDFPRGHIGIKGFDAEVVDQGGKPIPLHETYLHHWLVQPYYVCKGFN  60

Query  402  VEAAD---------------KMFLVGNSGVC-AELPQYFGLGSETRKTNSSVPDPYGIEV  271
            +   D                  LV N G+C      +FGLGSETRKT++ VPDPY IE+
Sbjct  61   LSQRDMPTNHGFSRHLGSSPDYILVKNGGLCRNNARHFFGLGSETRKTSTRVPDPYAIEI  120

Query  270  GNP---PPGLEEAWMLNVHAIDTRGTAE  196
             NP   P G E  W+L++HAIDTRG  +
Sbjct  121  DNPEETPDGYEFKWLLDIHAIDTRGVVD  148



>ref|XP_001779179.1| predicted protein [Physcomitrella patens]
 gb|EDQ56025.1| predicted protein [Physcomitrella patens]
Length=398

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 86/245 (35%), Positives = 127/245 (52%), Gaps = 33/245 (13%)
 Frame = -3

Query  642  LRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNS-IP  466
            +R +  NG +    ++     +PG+V N FF+ +D P+G  A + F AE+V E+  + +P
Sbjct  1    MRCESINGTRKREFVTRAMSFKPGTVHNLFFF-VDAPEGRFATRDFLAEMVLEDATTPVP  59

Query  465  LHQTYLHHWIVGKYMIRKDEVVEAADKMF------LVGNSGVCAE---------------  349
            L+ TYLHHW++ +Y + K++       +        +G   V A                
Sbjct  60   LYDTYLHHWLMYEYAVPKNDSDAHKHDLMEELQSDPLGQLKVSARHKDRKRLTEYPGAPD  119

Query  348  ---LPQYFGLGSETRKTNSSVPDPYGIEVGNP-PPGLEEAWMLNVHAIDTRGTAENKRGC  181
               L Q FG+G+ETR TN+ +P PYG E G+      E  W+LNVHAIDTRG A ++  C
Sbjct  120  TWFLIQQFGVGAETRHTNTKMPAPYGFEGGDRFGEDYESVWVLNVHAIDTRG-AISRMSC  178

Query  180  TECRCDLYNVTKDEDGRPLGDYPGGLRCCYDGAKCRVKQGFRGEK-----RGLYLKYTVT  16
            TECRCD+++  K         Y GGL CC+D   C VK  F+GE      R L  +YT +
Sbjct  179  TECRCDVFDFNKTGAVILPEGYHGGLACCHDETHCLVKNEFQGETGMKLARNLRFRYTWS  238

Query  15   YVDWN  1
            +  W+
Sbjct  239  WTPWD  243



>dbj|BAJ88316.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 86/119 (72%), Gaps = 6/119 (5%)
 Frame = -3

Query  342  QYFGLGSETRKTNSSVPDPYGIEVGNP-PPGLEEAWMLNVHAIDTRGTAENKRGCTECRC  166
            Q+FGLGSETR+T + VPDPY IE+G P P G +E W +NVHAIDTRG A +K  C ECRC
Sbjct  2    QHFGLGSETRQTATWVPDPYAIEIGKPAPAGYDERWFINVHAIDTRG-APDKLACAECRC  60

Query  165  DLYNVTKDEDGRPLGD-YPGGLRCCYDGAKCRVKQGF--RGE-KRGLYLKYTVTYVDWN  1
            D YNVT DE G  +G+ Y GGL CCYD  +CRV   F   GE  R L+L+YTV+++DW+
Sbjct  61   DFYNVTVDEAGSRIGNGYVGGLHCCYDSTRCRVDGAFANNGEPPRKLFLRYTVSWLDWS  119



>ref|XP_008453441.1| PREDICTED: uncharacterized protein LOC103494146 [Cucumis melo]
 ref|XP_008453442.1| PREDICTED: uncharacterized protein LOC103494146 [Cucumis melo]
Length=292

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 84/117 (72%), Gaps = 9/117 (8%)
 Frame = -3

Query  330  LGSETRKTNSSVPDPYGIEVGNP---PPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDL  160
            +GSE+RK ++ +P PYGIEVGNP   P   EE W LNVHAIDTRG AENK GC EC C L
Sbjct  1    MGSESRKLSTFLPHPYGIEVGNPKEIPADYEERWSLNVHAIDTRG-AENKLGCIECHCHL  59

Query  159  YNVTKDEDGRPL-GDYPGGLRCCYDGAKCRVKQGFRGE---KRGLYLKYTVTYVDWN  1
            YN+TKD  GRPL  DY GGL+CCYD  KCRV  G  GE   +R L+++Y V +VDWN
Sbjct  60   YNITKDRFGRPLTDDYKGGLQCCYDKTKCRVNVG-DGEYFQERNLFVRYRVKWVDWN  115



>ref|XP_007134295.1| hypothetical protein PHAVU_010G0353001g, partial [Phaseolus vulgaris]
 gb|ESW06289.1| hypothetical protein PHAVU_010G0353001g, partial [Phaseolus vulgaris]
Length=176

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 94/146 (64%), Gaps = 11/146 (8%)
 Frame = -3

Query  630  EENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTY  451
            +EN +K  T LS +FE+ PG V  K  + IDFPKGHI VK F+ EVVDE+GNS+PL++TY
Sbjct  30   DENHIKSATFLSEQFEVGPGKVAVKTLFDIDFPKGHIGVKSFDVEVVDEDGNSVPLYETY  89

Query  450  LHHWIVGKYM--IRKDEVVEAA----DKMFLVGNSGVCAE--LPQYFGLGSETRKTNSSV  295
            LHHW   KY+  I   + ++ +    + +    N G C    LP Y+GLG E+R T+S++
Sbjct  90   LHHWFAVKYIENITMSQYIKKSHDLRNGIEYERNDGACQGFLLPHYWGLGGESRGTSSNL  149

Query  294  PDPYGIEVGNPPP---GLEEAWMLNV  226
            PDP+ +E+GNP     G +E W+ ++
Sbjct  150  PDPFAVELGNPTKIKHGFKEKWLFSI  175



>ref|XP_001784976.1| predicted protein [Physcomitrella patens]
 gb|EDQ50197.1| predicted protein [Physcomitrella patens]
Length=414

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 82/222 (37%), Positives = 113/222 (51%), Gaps = 37/222 (17%)
 Frame = -3

Query  606  TLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHWIVGK  427
            T LSP  +  PG V  K+F  +D P  + A   F AE+V E G  +     YLHHW + +
Sbjct  38   TFLSPGMKFRPGDVKIKYF-NVDAPAEYFATVDFNAELVWENGEPVLQSDMYLHHWSMLE  96

Query  426  YMIRKDEVVEAADKMFLVGN-------------------SGVCAELPQYFGLGSETRKTN  304
            Y I        A    LVGN                    GV  EL Q + +G E+R  N
Sbjct  97   YAI-------PAGAAKLVGNELLEEVKRSPPHVYHRKPWDGVGRELKQAWAMGGESRHLN  149

Query  303  SSVPDPYGIEVGNPPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPL  124
             ++P PYG+E G    G+   W+LNVH +D RG A +K GC EC+C+ +  T  +   P 
Sbjct  150  FAMPAPYGLECGG--DGISTQWVLNVHGVDIRG-AVHKTGCYECQCNSF--TGYDANLPD  204

Query  123  GDYPGGLRCCYDGAKCRVKQGFRGE----KRGLYLKYTVTYV  10
            G Y GG++CC DGA+C ++  F G+    +R ++LKYT TY 
Sbjct  205  G-YLGGMKCCPDGARCLLRDDFNGDDALMERTVHLKYTWTYT  245



>ref|XP_006574191.1| PREDICTED: uncharacterized protein LOC100818138, partial [Glycine 
max]
Length=282

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 82/127 (65%), Gaps = 12/127 (9%)
 Frame = -3

Query  348  LPQYFGLGSETRKTNSSVPDPYGIEVGNPPP---GLEEAWMLNVHAIDTRGTAENKRGCT  178
             P Y+G G E+R T S +PDP+ IE GNP     G EE W+LN+  IDTRG A++K+ CT
Sbjct  5    FPHYWGFGVESRGTTSKIPDPFAIEQGNPTKIKNGYEEKWLLNIMVIDTRG-AQDKKACT  63

Query  177  ECRCD-------LYNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYT  22
            +CRCD        YNVT+D   + L  +Y GGL CC D  +C+  +GF+G +R + L+Y 
Sbjct  64   QCRCDHMNLPKDFYNVTRDIHNQKLTTNYKGGLFCCQDNLQCKQIEGFQGPRRMVSLRYK  123

Query  21   VTYVDWN  1
            +++VDWN
Sbjct  124  ISWVDWN  130



>ref|XP_007134080.1| hypothetical protein PHAVU_010G0178000g, partial [Phaseolus vulgaris]
 gb|ESW06074.1| hypothetical protein PHAVU_010G0178000g, partial [Phaseolus vulgaris]
Length=166

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 92/168 (55%), Gaps = 27/168 (16%)
 Frame = -3

Query  657  SSQRSLRIDE-ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEE  481
            S+  S+ ++  E+ +K  T LS +FE+ PG V  K    IDFPKGHI VK F+ EVVDE 
Sbjct  20   STTHSIVVESNESYIKSATFLSEKFEVGPGKVAVKTLLDIDFPKGHIGVKSFDVEVVDEV  79

Query  480  GNSIPLHQTYLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAELPQYFGL--GSETRKT  307
            G S+PL++TYLHHW   KY                + N  +   + Q   L  G E  + 
Sbjct  80   GKSVPLYETYLHHWFAVKY----------------IENITMSHYIKQSHDLRNGIEFERN  123

Query  306  NSSVPDPYGIEVGNPPP---GLEEAWMLNVHAIDTRGTAENKRGCTEC  172
                 DP+ +E+GNP     G +E W+ ++  IDTRGT  +++GC+EC
Sbjct  124  E----DPFAVELGNPTKLKDGFKEKWLFSIMVIDTRGT-HDRKGCSEC  166



>gb|EMS67414.1| hypothetical protein TRIUR3_30255 [Triticum urartu]
Length=424

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/211 (33%), Positives = 99/211 (47%), Gaps = 46/211 (22%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            +K +T  SP   L PGSV NK+ +    P+  +  +                        
Sbjct  82   LKSKTFRSPPILLGPGSVSNKYHHESTSPEATLQSRA-----------------------  118

Query  438  IVGKYMIRKDEVVEAADKMFLVGNSGVCAELPQYFGLGSETRKT--NSSVPDPYGIEVGN  265
            ++ +  +R   +   +  M L   +G+  +      L +  R +   + VPDPYGIE GN
Sbjct  119  LMQRSSMR---MASQSRSMRLTCITGLHVQESTNPVLRARFRDSPHRTWVPDPYGIETGN  175

Query  264  ---PPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDEDGRPLGDYPGGLRCC  94
                P G EE W+LN+HAIDTRG  + K  CTEC+CD YNVT DE GR +          
Sbjct  176  QEKAPEGYEEKWLLNIHAIDTRGVVD-KPSCTECKCDFYNVTIDEYGRTVSK--------  226

Query  93   YDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
                     +GF GE R ++L+YTVT++DW 
Sbjct  227  ------NYTEGFNGEVRKVFLQYTVTWLDWT  251



>ref|XP_010099535.1| hypothetical protein L484_011608 [Morus notabilis]
 gb|EXB79415.1| hypothetical protein L484_011608 [Morus notabilis]
Length=177

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 57/77 (74%), Gaps = 2/77 (3%)
 Frame = -3

Query  633  DEENGVKVETLLS--PRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLH  460
            D++   +   L S  P FEL PGSV NK +Y IDF +GHIA+K F+AEVVDE G S+PLH
Sbjct  38   DQKQKSRQNLLFSCPPSFELGPGSVQNKVYYNIDFSRGHIAIKRFDAEVVDEAGCSMPLH  97

Query  459  QTYLHHWIVGKYMIRKD  409
            +TYLHHWI+ +Y IRKD
Sbjct  98   ETYLHHWILIRYRIRKD  114



>gb|KHN25867.1| hypothetical protein glysoja_018721 [Glycine soja]
Length=196

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  618  VKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHW  439
            VK    LSP+FEL PGS   + +Y I+FP+GH+A+K F  EVVDE GN +PLH+TYLHHW
Sbjct  3    VKSTVFLSPKFELGPGSATTRHYYDIEFPRGHVALKSFSGEVVDEAGNPVPLHETYLHHW  62

Query  438  IV  433
            IV
Sbjct  63   IV  64



>gb|KHN25869.1| hypothetical protein glysoja_018723 [Glycine soja]
Length=245

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = -3

Query  186  GCTECRCDLYNVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYV  10
            GCTECRCDLYNVTKDE G  L  DY GGL+CCYD  +CR+++GF G KR LYL+YTV +V
Sbjct  2    GCTECRCDLYNVTKDEYGEFLRPDYKGGLKCCYDQTQCRLREGFEGPKRSLYLRYTVKWV  61

Query  9    DWN  1
            +W+
Sbjct  62   EWD  64



>gb|AGV54779.1| MtN19-like protein [Phaseolus vulgaris]
Length=466

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYL  448
            E+ VK    LSP+FEL PGSV NK+ Y IDFP+GHIA+K F AEV+DE GN +PLH+TYL
Sbjct  39   ESKVKTAIFLSPKFELGPGSVANKYDYDIDFPRGHIALKSFNAEVIDELGNPVPLHETYL  98

Query  447  HHWIVGKY  424
            HH +  +Y
Sbjct  99   HHGVGARY  106


 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 60/94 (64%), Gaps = 3/94 (3%)
 Frame = -3

Query  276  EVGNPPPGLEEAWMLNVHAIDTRGTAENKRGCTECRCDLYNVTKDED-GRPLG-DYPGGL  103
            + G  P G EE W +++HA+D RG     + CTE  CDLYN  +    GRP G DY GG 
Sbjct  170  DAGESPEGYEEPWTIDIHAVDRRGMKFGVQ-CTEPGCDLYNGDRRMKYGRPSGPDYKGGC  228

Query  102  RCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             CC D ++C++++GF G K  LYL+YTV +VDW+
Sbjct  229  FCCSDESQCKLREGFEGPKGSLYLRYTVKWVDWD  262



>emb|CCA14282.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=480

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/235 (31%), Positives = 107/235 (46%), Gaps = 53/235 (23%)
 Frame = -3

Query  606  TLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNS-------IPLHQTYL  448
            + LSP F+L+ G V N+F   +  PKG IA+  F+AEVV+   N+       +PL   YL
Sbjct  33   SALSPPFKLKMGEVTNRF-ERVPIPKGPIAIHQFQAEVVEVIENNGKQRIIPVPLSDAYL  91

Query  447  HHWIVG---KYMIRKDEVVEAADKMFLVGNSGVCAELPQYFGLGSETRKTNSSVPDPYGI  277
            HH+++G   +++  K E           G S   +     FG G+E+R T  +   PY  
Sbjct  92   HHYVIGSPYEFLSNKSE-----------GKSSEVSAEGYRFGAGTESRGTPQNYRFPYA-  139

Query  276  EVGNPPPGLEEAWMLNVHAIDTRGTAENK-RGCTECRCDLYNVTKD--------------  142
             V  P    E+ W++N+H I+TR  + ++   C EC C   +  +D              
Sbjct  140  SVTLPD---EDEWIVNIHVINTRNMSTSRAHRCLECPCTSEDSIRDGKINGVVFTNHTCN  196

Query  141  -------EDGRPLGDYPGGLRCCYDGAKCRVKQGFR-----GEKRGLYLKYTVTY  13
                        +G Y GGLRCC DG  C  K+         EK  +YL+YT+ Y
Sbjct  197  AQLMEERNAACSIGTYSGGLRCCEDGEFCLEKEELSEMDTAHEKSVIYLRYTILY  251



>emb|CCI40599.1| unnamed protein product [Albugo candida]
Length=480

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 107/241 (44%), Gaps = 49/241 (20%)
 Frame = -3

Query  630  EENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVD-------EEGNS  472
            E   +K  + LSP  EL+ G V N+F   +  PKG IA+  F+AEVV+       +E   
Sbjct  25   EVPAMKRFSALSPSIELKMGEVANRF-EKVPIPKGPIAIYQFKAEVVELMQNNGKQETRP  83

Query  471  IPLHQTYLHHWIVGK-YMIRKDEVVEAADKMFLVGNSGVCAELPQYFGLGSETRKTNSSV  295
            +P+ + YLHH+++G  Y  R ++      K   V   G        FG G+E+R+T  + 
Sbjct  84   VPVSEAYLHHYVIGSAYAFRTNKNESKGAK---VSGKGF------RFGAGTESRETPQNY  134

Query  294  PDPYGIEVGNPPPGLEEAWMLNVHAIDTRG-TAENKRGCTECRCDLYNVTKD--------  142
            P PY   V  P    E+ W++NVH I+TR  +A     C EC C   +  ++        
Sbjct  135  PFPYA-SVTLPD---EDEWIVNVHVINTRNMSAFRAHQCLECPCTSEDTIRNGHINGMIF  190

Query  141  -------------EDGRPLGDYPGGLRCCYDGAKCRVKQGFRGE-----KRGLYLKYTVT  16
                              +  Y GGLRCC DG  C  ++          K   YL+YT+ 
Sbjct  191  PNHTCNAQLMEERNAACSINTYSGGLRCCEDGEFCLERKQLAEMDTAHVKSVFYLRYTIL  250

Query  15   Y  13
            Y
Sbjct  251  Y  251



>ref|XP_008360160.1| PREDICTED: uncharacterized protein LOC103423859 [Malus domestica]
Length=229

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  615  KVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSIPLHQTYLHHWI  436
            +    +S +F L PGSV +K++Y IDFP+GHI++K F  EV+D+EGN IPLH++YLHHW+
Sbjct  35   RTSVFVSXKFVLGPGSVADKYYYNIDFPRGHISIKSFNXEVIDKEGNLIPLHESYLHHWV  94



>ref|XP_006844649.1| hypothetical protein AMTR_s00016p00235830 [Amborella trichopoda]
 gb|ERN06324.1| hypothetical protein AMTR_s00016p00235830 [Amborella trichopoda]
Length=151

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = -3

Query  174  CRCDLYNVTKDEDGRPLGD-YPGGLRCCYDGAKCRVKQGFRG-EKRGLYLKYTVTYVDWN  1
            CRCDLYNVT+DE+GRP+ D Y GGLRCCYDG +CR+K+G +G   +G+Y+KYTV +++W+
Sbjct  54   CRCDLYNVTEDENGRPIEDNYYGGLRCCYDGTQCRLKEGLQGLGAKGVYVKYTVKWMEWD  113



>ref|XP_006574193.1| PREDICTED: uncharacterized protein LOC102666323 [Glycine max]
Length=249

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 59/91 (65%), Gaps = 9/91 (10%)
 Frame = -3

Query  249  EEAWMLNVHAIDTRGTAENKRGCTECRCD-------LYNVTKDEDGRPLG-DYPGGLRCC  94
            EE W+LN   IDT G A++K+ CT+CRCD        YNVT+D   + L  +Y GGL CC
Sbjct  8    EEKWLLNTMVIDTHG-AQDKKACTQCRCDHMNLPKDFYNVTRDIHNQKLTTNYKGGLFCC  66

Query  93   YDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
             D  +C+  +GF+G +R + L+Y +++VDW+
Sbjct  67   QDNLQCKQVEGFQGSRRMVSLRYKISWVDWD  97



>ref|XP_002904847.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY53229.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=441

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 75/242 (31%), Positives = 99/242 (41%), Gaps = 39/242 (16%)
 Frame = -3

Query  645  SLRIDEENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEE--GNS  472
            SL + E+   K  T L+P   L  G V N F + +  PKG IAV  FEAEVV+++  GN 
Sbjct  13   SLAVAEKPVTKRYTALTPPLPLLQGEVTNAF-HRLAIPKGPIAVYRFEAEVVEKDVSGNI  71

Query  471  IPL--HQTYLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAELPQYFGLGSETRKTNSS  298
            +P+  +  YLHH + G    + D +      M     S   A     FG G+E R T   
Sbjct  72   VPVPTYDAYLHHHVFGSTHKQYDAMKSRWAPMKPKNFSRSVA-----FGAGTECRGTPQE  126

Query  297  VPDPYGIEVGNPPPGLEEAWMLNVHAIDTRGTA-ENKRGCTECRCDLYNVTKDEDGRPLG  121
               PY           E+ W+ NVH I+TR  A E    C EC C   +V  D     + 
Sbjct  127  FYFPYAFMTVEE----EDEWVANVHIINTREMAPERAHRCLECPCTAEDVVTDNSVNGIH  182

Query  120  ---------------------DYPGGLRCCYDGAKCRVKQGFR--GEKRGLY-LKYTVTY  13
                                  Y GGLRCC D   C         G  +  Y L+Y++ Y
Sbjct  183  FRNGSCNAQLQFEENTVCSAETYHGGLRCCEDAEFCLEHNELEVSGPSQATYHLRYSLEY  242

Query  12   VD  7
             D
Sbjct  243  AD  244



>ref|XP_008390013.1| PREDICTED: uncharacterized protein LOC103452281, partial [Malus 
domestica]
Length=157

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -3

Query  156  NVTKDEDGRPLG-DYPGGLRCCYDGAKCRVKQGFRGEKRGLYLKYTVTYVDWN  1
            NV+ D  G+PL   Y GG RCCYDG  CRVKQGF G KR LYL+YTV +VDW+
Sbjct  1    NVSTDSRGQPLRPGYKGGXRCCYDGTHCRVKQGFNGVKRNLYLRYTVKWVDWS  53



>gb|EJK60813.1| hypothetical protein THAOC_18774 [Thalassiosira oceanica]
Length=480

 Score = 75.1 bits (183),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 69/239 (29%), Positives = 101/239 (42%), Gaps = 52/239 (22%)
 Frame = -3

Query  606  TLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVV--DEEGN--SIPLHQTYLHHW  439
            T L+   +L PG V NK+   ++ PKG I++  FEA+VV  DE+GN  ++PL   YLHH 
Sbjct  31   TALTAPMKLYPGEVANKYLR-LEIPKGPISIVSFEADVVESDEDGNVVAVPLADAYLHHH  89

Query  438  IV-GKYMIRKDEVVEAADKMFLVGNSGVCAELPQYFGLGSETRKTNSSVPDPYGIEVGNP  262
            +V   +   + E    +       N GV       FG G+E+R T  + P PY       
Sbjct  90   VVFSDHKFYEREKNWWSPMKPKGANRGVS------FGAGTESRGTRQAFPSPYRFTTVKG  143

Query  261  PPGLEEAWMLNVHAIDTRGT-AENKRGCTEC-----------------------------  172
                E++ + NVH I+TR   A +   C EC                             
Sbjct  144  ----EDSLIANVHIINTRSMEARDAHKCLECPCSSEDRMLGGNDDNVTALFSAVVPRKGL  199

Query  171  --RCDLYNVTKDEDGRPLGDYPGGLRCCYDGAKC----RVKQGFRGEKRGLYLKYTVTY  13
               C+ + + +D        Y GGL CC DG  C    +     + EK   +L+YT+ Y
Sbjct  200  ENHCNSFLLAEDNTSCSPSAYFGGLYCCEDGEYCMDAFKDDVPDKPEKSTYHLRYTIEY  258



>ref|XP_008898088.1| hypothetical protein PPTG_06079 [Phytophthora parasitica INRA-310]
 gb|ETN17018.1| hypothetical protein PPTG_06079 [Phytophthora parasitica INRA-310]
Length=473

 Score = 72.0 bits (175),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 96/237 (41%), Gaps = 39/237 (16%)
 Frame = -3

Query  630  EENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVV--DEEGNSIPL--  463
            E+   K  T L+P   L  G V N F + +  PKG IAV  FEA+VV  D  GN +P+  
Sbjct  18   EKPETKRYTALTPPLSLLQGEVTNTF-HRLAIPKGPIAVYRFEADVVEKDASGNVVPVPT  76

Query  462  HQTYLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAELPQYFGLGSETRKTNSSVPDPY  283
            +  YLHH + G    + D +      M     S   A     FG G+E R T      PY
Sbjct  77   YDAYLHHHVFGSTHKQYDAMKSRWAPMKPKNFSRSVA-----FGAGTECRGTPQEFYFPY  131

Query  282  GIEVGNPPPGLEEAWMLNVHAIDTRGTAENK-RGCTECRCDLYNVTKDEDGRPLG-----  121
                       E+ W+ NVH I+TR  A ++   C EC C   +V  D     +      
Sbjct  132  AFMTVEG----EDEWVANVHIINTRKMAPDRAHRCLECPCTAEDVFTDNAVNGIHFRNGS  187

Query  120  ----------------DYPGGLRCCYDGAKCRVK---QGFRGEKRGLYLKYTVTYVD  7
                             Y GGLRCC D   C      + +   +   +L+Y++ Y +
Sbjct  188  CNAQLQFEENTVCSAETYHGGLRCCEDAEFCLEHNELEVYDASEATYHLRYSLDYAE  244



>gb|ETK72754.1| hypothetical protein L915_20217 [Phytophthora parasitica]
 gb|ETL26208.1| hypothetical protein L916_20084 [Phytophthora parasitica]
Length=473

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 94/237 (40%), Gaps = 39/237 (16%)
 Frame = -3

Query  630  EENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVV--DEEGNSIPL--  463
            E+   K  T L+P   L  G V N F + +  PKG IAV  FEA+VV  D  GN +P+  
Sbjct  18   EKPETKRYTALTPPLSLLQGEVTNTF-HRLAIPKGPIAVYRFEADVVEKDASGNVVPVPT  76

Query  462  HQTYLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAELPQYFGLGSETRKTNSSVPDPY  283
            +  YLHH + G    + D +      M     S   A     FG G+E R T      PY
Sbjct  77   YDAYLHHHVFGSTHKQYDAMKSRWAPMKPKNFSRSVA-----FGAGTECRGTPQEFYFPY  131

Query  282  GIEVGNPPPGLEEAWMLNVHAIDTRGTAENK-RGCTECRCDLYNVTKDEDGRPLG-----  121
                       E+ W+ NVH I+TR  A ++   C EC C   +V  D     +      
Sbjct  132  AFMTVEG----EDEWVANVHIINTRKMAPDRAHRCLECPCTAEDVFTDNAVNGIHFRNGS  187

Query  120  ----------------DYPGGLRCCYDGAKCRVKQGFR---GEKRGLYLKYTVTYVD  7
                             Y GGLRCC D   C            +   +L+Y++ Y +
Sbjct  188  CNAQLQFEENTVCSAETYHGGLRCCEDAEFCLEHNELEVSDASEATYHLRYSLDYAE  244



>gb|ETO61110.1| hypothetical protein F444_20823 [Phytophthora parasitica P1976]
 gb|ETP30402.1| hypothetical protein F442_20601 [Phytophthora parasitica P10297]
Length=473

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 94/237 (40%), Gaps = 39/237 (16%)
 Frame = -3

Query  630  EENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVV--DEEGNSIPL--  463
            E+   K  T L+P   L  G V N F + +  PKG IAV  FEA+VV  D  GN +P+  
Sbjct  18   EKPETKRYTALTPPLSLLQGEVTNTF-HRLAIPKGPIAVYRFEADVVEKDASGNVVPVPT  76

Query  462  HQTYLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAELPQYFGLGSETRKTNSSVPDPY  283
            +  YLHH + G    + D +      M     S   A     FG G+E R T      PY
Sbjct  77   YDAYLHHHVFGSTHKQYDAMKSRWAPMKPKNFSRSVA-----FGAGTECRGTPQEFYFPY  131

Query  282  GIEVGNPPPGLEEAWMLNVHAIDTRGTAENK-RGCTECRCDLYNVTKDEDGRPLG-----  121
                       E+ W+ NVH I+TR  A ++   C EC C   +V  D     +      
Sbjct  132  AFMTVEG----EDEWVANVHIINTRKMAPDRAHRCLECPCTAEDVFTDNAVNGIHFRNGS  187

Query  120  ----------------DYPGGLRCCYDGAKCRVKQGFR---GEKRGLYLKYTVTYVD  7
                             Y GGLRCC D   C            +   +L+Y++ Y +
Sbjct  188  CNAQLQFEENTVCSAETYHGGLRCCEDAEFCLEHNELEVSDASEATYHLRYSLDYAE  244



>gb|ETI32377.1| hypothetical protein F443_20804 [Phytophthora parasitica P1569]
 gb|ETL79413.1| hypothetical protein L917_19954 [Phytophthora parasitica]
 gb|ETM32668.1| hypothetical protein L914_19981 [Phytophthora parasitica]
 gb|ETP02241.1| hypothetical protein F441_20666 [Phytophthora parasitica CJ01A1]
Length=473

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 94/237 (40%), Gaps = 39/237 (16%)
 Frame = -3

Query  630  EENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVV--DEEGNSIPL--  463
            E+   K  T L+P   L  G V N F + +  PKG IAV  FEA+VV  D  GN +P+  
Sbjct  18   EKPETKRYTALTPPLSLLQGEVTNTF-HRLAIPKGPIAVYRFEADVVEKDASGNVVPVPT  76

Query  462  HQTYLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAELPQYFGLGSETRKTNSSVPDPY  283
            +  YLHH + G    + D +      M     S   A     FG G+E R T      PY
Sbjct  77   YDAYLHHHVFGSTHKQYDAMKSRWAPMKPKNFSRSVA-----FGAGTECRGTPQEFYFPY  131

Query  282  GIEVGNPPPGLEEAWMLNVHAIDTRGTAENK-RGCTECRCDLYNVTKDEDGRPLG-----  121
                       E+ W+ NVH I+TR  A ++   C EC C   +V  D     +      
Sbjct  132  AFMTVEG----EDEWVANVHIINTRKMAPDRAHRCLECPCTAEDVFTDNAVNGIHFRNGS  187

Query  120  ----------------DYPGGLRCCYDGAKCRVKQGFR---GEKRGLYLKYTVTYVD  7
                             Y GGLRCC D   C            +   +L+Y++ Y +
Sbjct  188  CNAQLQFEENTVCSAETYHGGLRCCEDAEFCLEHNELEVSDASEATYHLRYSLDYAE  244



>ref|XP_008875588.1| hypothetical protein H310_10881 [Aphanomyces invadans]
 ref|XP_008875589.1| hypothetical protein H310_10882 [Aphanomyces invadans]
 gb|ETV95837.1| hypothetical protein H310_10881 [Aphanomyces invadans]
 gb|ETV95838.1| hypothetical protein H310_10882 [Aphanomyces invadans]
Length=307

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 69/239 (29%), Positives = 91/239 (38%), Gaps = 46/239 (19%)
 Frame = -3

Query  627  ENGVKVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVD--EEGNSIPL--H  460
            E   K  T  +    L  G V N F + +  PKG IAV  F AE+V+  + G  +P   +
Sbjct  17   EAARKTHTAFTRPIVLPQGGVSNDF-HILPIPKGPIAVSRFAAEIVEILDNGTVVPTPNY  75

Query  459  QTYLHHWIVG----KYMIRKDEVVEAADKMFLVGNSGVCAELPQYFGLGSETRKTNSSVP  292
              YLHH +VG     Y  ++       +   +    G        FG G+E+R T     
Sbjct  76   DAYLHHHVVGSRHSSYKAKQSTWTPMKNSERMYAGVG--------FGAGTESRGTPQEFQ  127

Query  291  DPYGIEVGNPPPGLEEAWMLNVHAIDTRG-TAENKRGCTECRC---DLYNVTKDEDGRPL  124
             PY           E+ W+ NVH I+TR  T +    C EC C   DL+      +G  L
Sbjct  128  FPYAFVTSEG----EDEWIANVHIINTRQMTPDRAHHCLECPCTSSDLF-ANGTVNGYEL  182

Query  123  G------------------DYPGGLRCCYDGAKCRVKQGF--RGEKRGLYLKYTVTYVD  7
            G                   Y GGLRCC D   C               YL+YT  Y D
Sbjct  183  GLVCNAQLLHEKNAACFADTYSGGLRCCNDKELCLEPADLDATAPNSTYYLQYTFDYDD  241



>ref|XP_009520872.1| hypothetical protein PHYSODRAFT_555341 [Phytophthora sojae]
 gb|EGZ25584.1| hypothetical protein PHYSODRAFT_555341 [Phytophthora sojae]
Length=445

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 66/203 (33%), Positives = 81/203 (40%), Gaps = 36/203 (18%)
 Frame = -3

Query  606  TLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVV--DEEGNSIPL--HQTYLHHW  439
            T L+P   L  G V N F + +  PKG IAV  FEA+VV  D +GN +P+     YLHH 
Sbjct  29   TALTPPLSLSQGEVTNTF-HRLPIPKGPIAVYRFEADVVEQDADGNVVPVPTFDAYLHHH  87

Query  438  IVGKYMIRKDEVVEAADKMFLVGNSGVCAELPQYFGLGSETRKTNSSVPDPYGIEVGNPP  259
            + G    + D +      M     S   A     FG G+E R T      PY        
Sbjct  88   VFGSTHKQYDAMKSRWAPMKPKNFSRSVA-----FGAGTECRGTPQEFYFPYAFMTVEG-  141

Query  258  PGLEEAWMLNVHAIDTRGTA-ENKRGCTECRC--------DLYNVTKDEDGR--------  130
               E+ W+ NVH I+TR  A E    C EC C        D  N     +G         
Sbjct  142  ---EDEWVANVHIINTRKMAPERAHRCLECPCTSEDVFTADAVNGIHFRNGSCNAQLRFE  198

Query  129  -----PLGDYPGGLRCCYDGAKC  76
                     Y GGLRCC D   C
Sbjct  199  ENTVCSAETYHGGLRCCEDAEFC  221



>ref|XP_005765872.1| hypothetical protein EMIHUDRAFT_212502 [Emiliania huxleyi CCMP1516]
 gb|EOD13443.1| hypothetical protein EMIHUDRAFT_212502 [Emiliania huxleyi CCMP1516]
Length=416

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 57/223 (26%), Positives = 86/223 (39%), Gaps = 35/223 (16%)
 Frame = -3

Query  651  QRSLRIDEENG--VKVETLLSPRFELEPGSV--CNKFFYGIDFPKGHIAVKGFEAEVVDE  484
             RS+ + E     V  E   S    L PG +   N     ++ P G  A+ GF  ++VD 
Sbjct  18   SRSVSLHESKAYNVTTEEYFSSGVTLRPGHMIFTNPRKTRLEMPAGRYAITGFWGDIVDA  77

Query  483  EGNSIPLHQTYLHHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAELPQYFGLGSETRKTN  304
            +   +PL + Y HHW+      R +                +C  +P  FG+G+E+R   
Sbjct  78   DHKPVPLSKIYDHHWVAINNRHRNE----------------ICETVPYVFGVGAESRHNP  121

Query  303  SSVPDPYGIEVGNPPPGLEEAWMLNVHAIDTRGTAE-NKRGCTECRCDLYNVTKDEDGRP  127
             ++P  YG  V          W  N+H +   G +E   + C EC    Y   K ++   
Sbjct  122  VNLPAGYGYVVDE-----TVEWGANIHLLRIDGLSEAAAKECNEC---YYAPGKGKECTA  173

Query  126  LGDYPGGLRCC----YDGAKCRVKQGFRGEKRGLYLKYTVTYV  10
              +  G   CC    YDG      Q         YL+Y V+Y 
Sbjct  174  AQN--GTFECCGERDYDGVGSCPAQRADLPAETFYLRYRVSYT  214



>ref|NP_001148097.1| LOC100281705 [Zea mays]
 gb|ACG29711.1| mtN19-like protein [Zea mays]
Length=235

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = -3

Query  183  CTECRCDLYNVTKDEDGRPL-GDYPGGLRCCYDGAKC-RVKQGFRGEKRGLYLKYTVTYV  10
            CTECRCD+YNVT D  G  +   Y GGLRCCYDG +C    +G  G+ R ++L+YTV + 
Sbjct  3    CTECRCDVYNVTADWRGHAIEPGYAGGLRCCYDGTRCGAAAEGAEGKARTVFLRYTVMWR  62

Query  9    DWN  1
            DW+
Sbjct  63   DWS  65



>ref|XP_009835513.1| hypothetical protein H257_10612 [Aphanomyces astaci]
 gb|ETV75009.1| hypothetical protein H257_10612 [Aphanomyces astaci]
Length=472

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 66/236 (28%), Positives = 91/236 (39%), Gaps = 48/236 (20%)
 Frame = -3

Query  615  KVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVDEEGNSI----PLHQTYL  448
            K  T  +    L  G V N F   +  P G IAV  F AE+V+   N      P +  YL
Sbjct  22   KTHTAFTRPIPLPQGGVSNDFHI-LPIPDGPIAVYRFAAEIVEILANGTVVPTPNYDAYL  80

Query  447  HHWIVGK----YMIRKDE--VVEAADKMFLVGNSGVCAELPQYFGLGSETRKTNSSVPDP  286
            HH +VG     Y  ++     ++ A++M+    +GV       FG G+E+R T      P
Sbjct  81   HHHVVGSRHSSYKSKQSTWTPMKNAERMY----AGVG------FGAGTESRGTPQEFQYP  130

Query  285  YGIEVGNPPPGLEEAWMLNVHAIDTRGTAEN-KRGCTECRCDLYNVTKDE--DGRPLG--  121
            Y           E  W+ NVH I+TR    +    C EC C   ++  +   +G  LG  
Sbjct  131  YAFVTSKG----ENEWIANVHIINTRRLEPDLAHRCLECPCTSSDLMGNGTVNGYELGLV  186

Query  120  ----------------DYPGGLRCCYDGAKCRVKQGFRGEK--RGLYLKYTVTYVD  7
                             Y GGLRCC D   C               Y++YT  Y D
Sbjct  187  CNAQLLHEKNSACFADTYSGGLRCCNDKELCLEPTELNATDTVSTYYMQYTFEYDD  242



>gb|KDO31539.1| hypothetical protein SPRG_03467 [Saprolegnia parasitica CBS 223.65]
Length=464

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 88/232 (38%), Gaps = 40/232 (17%)
 Frame = -3

Query  615  KVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVD--EEGNSIPL--HQTYL  448
            K  T  +    LE G + N F + +  PKG IAV  F  ++V+   +G  IP   +  YL
Sbjct  20   KTFTAYTQPITLEQGGISNAF-HVLKIPKGPIAVYRFAGDIVEIAADGTVIPTPTYDAYL  78

Query  447  HHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAELPQYFGLGSETRKTNSSVPDPYGIEVG  268
            HH +VG    R         K   +   G    +   FG G+E R T      PY     
Sbjct  79   HHHVVGS---RHQRYANQEGKWTPMKPKGAYRGVG--FGAGTEARGTPQEFHYPYAFFTT  133

Query  267  NPPPGLEEAWMLNVHAIDTR--GTAENKRGCTECRC----DLYNVTKDEDGRP-------  127
                  E+ W+ NVH ++TR    A+  R C EC C    D  N T +    P       
Sbjct  134  EG----EDEWIANVHILNTRQMSPAQAHR-CLECPCTAEDDFSNGTINGVENPHECSPQL  188

Query  126  ---------LGDYPGGLRCCYDGAKCRVKQGFRG---EKRGLYLKYTVTYVD  7
                        Y GGL CC  G  C  K             Y++YT+ Y D
Sbjct  189  LHDNNTVCNFETYTGGLWCCNTGEFCLEKHELPAPAPPTSTYYMRYTIDYDD  240



>ref|XP_009835512.1| hypothetical protein H257_10611 [Aphanomyces astaci]
 gb|ETV75008.1| hypothetical protein H257_10611 [Aphanomyces astaci]
Length=472

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 66/236 (28%), Positives = 91/236 (39%), Gaps = 48/236 (20%)
 Frame = -3

Query  615  KVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVD--EEGNSIPLHQ--TYL  448
            K  T  +    L  G V N F   +  P G IAV  F AE+V+    G  +P      YL
Sbjct  22   KTHTAFTRPIPLPQGGVSNDFHI-LPIPDGPIAVYRFAAEIVEILANGTVVPTPNCDAYL  80

Query  447  HHWIVGK----YMIRKDE--VVEAADKMFLVGNSGVCAELPQYFGLGSETRKTNSSVPDP  286
            HH +VG     Y  ++     ++ A++M+    +GV       FG G+E+R T      P
Sbjct  81   HHHVVGSRHSSYKSKQSTWTPMKNAERMY----AGVG------FGAGTESRGTPQEFQYP  130

Query  285  YGIEVGNPPPGLEEAWMLNVHAIDTRGTAEN-KRGCTECRCDLYNVTKDE--DGRPLG--  121
            Y           E  W+ NVH I+TR    +    C EC C   ++  +   +G  LG  
Sbjct  131  YAFVTSKG----ENEWIANVHIINTRRLEPDLAHRCLECPCTSSDLMGNGTVNGYELGLV  186

Query  120  ----------------DYPGGLRCCYDGAKCRVKQGFRGEK--RGLYLKYTVTYVD  7
                             Y GGLRCC D   C               Y++YT  Y D
Sbjct  187  CNAQLLHEKNSACFADTYSGGLRCCNDKELCLEPTELNATDTVSTYYMQYTFEYDD  242



>ref|XP_008609227.1| hypothetical protein SDRG_05292 [Saprolegnia diclina VS20]
 gb|EQC37065.1| hypothetical protein SDRG_05292 [Saprolegnia diclina VS20]
Length=463

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 87/230 (38%), Gaps = 40/230 (17%)
 Frame = -3

Query  615  KVETLLSPRFELEPGSVCNKFFYGIDFPKGHIAVKGFEAEVVD--EEGNSIPL--HQTYL  448
            K  T  +    LE G + N F + +  PKG IAV  F  ++V+   +G  IP   +  YL
Sbjct  19   KTFTAYTQPITLEQGGISNAF-HVLKIPKGPIAVYRFAGDIVEIAADGTVIPTPTYDAYL  77

Query  447  HHWIVGKYMIRKDEVVEAADKMFLVGNSGVCAELPQYFGLGSETRKTNSSVPDPYGIEVG  268
            HH +VG    R         K   +   G    +   FG G+E R T      PY     
Sbjct  78   HHHVVGS---RHKRYANQEGKWTPMKPKGAYRGVG--FGAGTEARGTPQEFHYPYAFFTT  132

Query  267  NPPPGLEEAWMLNVHAIDTR--GTAENKRGCTECRC----DLYNVTKDEDGRP-------  127
                  E+ W+ NVH ++TR    A+  R C EC C    D  N T +    P       
Sbjct  133  EG----EDEWIANVHILNTRQMSPAQAHR-CLECPCTAEDDFSNGTINGVENPHECSPQL  187

Query  126  ---------LGDYPGGLRCCYDGAKCRVKQGFRG---EKRGLYLKYTVTY  13
                        Y GGL CC  G  C  K             Y++YT+ Y
Sbjct  188  LYDNNTVCNFATYTGGLWCCNTGEFCLEKNELPAPAPPTSTYYMRYTIDY  237



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1851063916768