BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25531_g1_i5 len=751 path=[1788:0-132 1921:133-157 1946:158-237
11809:238-249 11821:250-256 11828:257-266 5904:267-304 11882:305-319
10234:320-448 10363:449-457 11953:458-466 11962:467-478
11974:479-493 11989:494-508 11374:509-519 12015:520-522 7447:523-551
12031:552-561 8887:562-599 4022:600-646 4069:647-711 4134:712-730
12150:731-735 2524:736-750]

Length=751
                                                                      Score     E

ref|XP_009761805.1|  PREDICTED: scopoletin glucosyltransferase          313   1e-100   
sp|Q9AT54.1|SCGT_TOBAC  RecName: Full=Scopoletin glucosyltransfer...    311   8e-100   Nicotiana tabacum [American tobacco]
ref|XP_009622522.1|  PREDICTED: scopoletin glucosyltransferase          300   2e-95    
gb|AAK28304.1|AF346432_1  phenylpropanoid:glucosyltransferase 2         299   2e-95    Nicotiana tabacum [American tobacco]
ref|XP_006346388.1|  PREDICTED: scopoletin glucosyltransferase-like     297   1e-94    
ref|XP_004230759.1|  PREDICTED: scopoletin glucosyltransferase          293   6e-93    
gb|ACO44747.1|  UDP glycosyltransferase                                 291   2e-92    Withania somnifera [ashwagandha]
dbj|BAG80536.1|  UDP-glucose:glucosyltransferase                        291   4e-92    Lycium barbarum [goji berry]
dbj|BAG80550.1|  UDP-glucose:glucosyltransferase                        291   4e-92    Lycium barbarum [goji berry]
ref|XP_009762300.1|  PREDICTED: LOW QUALITY PROTEIN: scopoletin g...    274   1e-86    
emb|CDP09466.1|  unnamed protein product                                276   4e-86    
emb|CAA59450.1|  twi1                                                   275   4e-86    Solanum lycopersicum
ref|XP_009772759.1|  PREDICTED: scopoletin glucosyltransferase-like     274   2e-85    
ref|XP_009787720.1|  PREDICTED: scopoletin glucosyltransferase-like     274   3e-85    
dbj|BAF49308.1|  putative glycosyltransferase                           273   6e-85    Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_006346390.1|  PREDICTED: scopoletin glucosyltransferase-like     269   1e-83    
ref|XP_006346389.1|  PREDICTED: scopoletin glucosyltransferase-like     269   2e-83    
ref|XP_004230756.2|  PREDICTED: scopoletin glucosyltransferase-like     265   2e-81    
ref|XP_009600997.1|  PREDICTED: scopoletin glucosyltransferase-like     265   2e-81    
dbj|BAF49309.1|  putative glycosyltransferase                           263   3e-81    Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_004230760.1|  PREDICTED: scopoletin glucosyltransferase-like     261   1e-80    
dbj|BAO51837.1|  UDP-glycosyltransferase 73A17                          259   8e-80    
ref|XP_011000135.1|  PREDICTED: scopoletin glucosyltransferase-like     256   2e-78    
dbj|BAD29722.1|  UDP-glucose glucosyltransferase                        254   1e-77    Catharanthus roseus [chatas]
ref|XP_002298733.1|  hypothetical protein POPTR_0001s31130g             252   5e-77    Populus trichocarpa [western balsam poplar]
ref|XP_006369760.1|  hypothetical protein POPTR_0001s31090g             252   7e-77    
ref|XP_007042481.1|  UDP-glycosyltransferase 73B4, putative             250   5e-76    
ref|XP_006379195.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    249   1e-75    
ref|XP_008236558.1|  PREDICTED: scopoletin glucosyltransferase-like     248   2e-75    
ref|XP_007200988.1|  hypothetical protein PRUPE_ppa004924mg             248   2e-75    
gb|AFK79039.1|  glycosyltransferase UGT7                                248   2e-75    
gb|EYU42689.1|  hypothetical protein MIMGU_mgv1a018398mg                248   2e-75    
ref|XP_010066005.1|  PREDICTED: scopoletin glucosyltransferase-like     248   4e-75    
gb|KCW63754.1|  hypothetical protein EUGRSUZ_G01414                     248   5e-75    
gb|KDO35868.1|  hypothetical protein CISIN_1g041444mg                   241   4e-74    
gb|KCW64874.1|  hypothetical protein EUGRSUZ_G02440                     244   1e-73    
ref|XP_010066838.1|  PREDICTED: scopoletin glucosyltransferase-like     244   1e-73    
ref|XP_006422969.1|  hypothetical protein CICLE_v10028305mg             243   2e-73    
ref|XP_004505252.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      243   2e-73    
gb|KCW64673.1|  hypothetical protein EUGRSUZ_G02259                     242   5e-73    
ref|XP_010066692.1|  PREDICTED: scopoletin glucosyltransferase-like     243   5e-73    
gb|KDO36537.1|  hypothetical protein CISIN_1g036871mg                   239   6e-73    
ref|XP_002313131.2|  hypothetical protein POPTR_0009s10190g             241   1e-72    Populus trichocarpa [western balsam poplar]
ref|XP_011000854.1|  PREDICTED: scopoletin glucosyltransferase-like     241   2e-72    
ref|XP_011000865.1|  PREDICTED: scopoletin glucosyltransferase-like     240   3e-72    
ref|XP_006487030.1|  PREDICTED: scopoletin glucosyltransferase-like     240   4e-72    
ref|XP_011013100.1|  PREDICTED: scopoletin glucosyltransferase-like     239   4e-72    
ref|XP_008354700.1|  PREDICTED: scopoletin glucosyltransferase-like     239   5e-72    
ref|XP_007200989.1|  hypothetical protein PRUPE_ppa004972mg             237   3e-71    
ref|XP_008454970.1|  PREDICTED: scopoletin glucosyltransferase-like     237   3e-71    
ref|XP_007200278.1|  hypothetical protein PRUPE_ppa014816mg             237   4e-71    
gb|KDP25001.1|  hypothetical protein JCGZ_23984                         236   4e-71    
ref|XP_006487031.1|  PREDICTED: scopoletin glucosyltransferase-like     238   4e-71    
ref|XP_011000877.1|  PREDICTED: scopoletin glucosyltransferase-like     237   4e-71    
gb|AAS55083.1|  UDP-glucose glucosyltransferase                         236   5e-71    Rhodiola sachalinensis
gb|KHN12234.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7         236   7e-71    
ref|XP_003520067.1|  PREDICTED: scopoletin glucosyltransferase-like     236   7e-71    
ref|XP_008364526.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    236   1e-70    
ref|XP_002298734.2|  hypothetical protein POPTR_0001s31120g             236   1e-70    Populus trichocarpa [western balsam poplar]
ref|XP_009377799.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    235   1e-70    
ref|XP_002518724.1|  UDP-glucosyltransferase, putative                  235   2e-70    Ricinus communis
ref|XP_008236559.1|  PREDICTED: scopoletin glucosyltransferase-like     235   2e-70    
ref|XP_008236488.1|  PREDICTED: scopoletin glucosyltransferase-like     235   2e-70    
ref|XP_003518712.1|  PREDICTED: scopoletin glucosyltransferase-like     235   2e-70    
sp|Q8H0F2.1|ANGT_GENTR  RecName: Full=Anthocyanin 3'-O-beta-gluco...    234   6e-70    Gentiana triflora
ref|XP_002282463.1|  PREDICTED: scopoletin glucosyltransferase          233   1e-69    Vitis vinifera
emb|CAN65903.1|  hypothetical protein VITISV_004870                     233   1e-69    Vitis vinifera
emb|CAB56231.1|  betanidin-5-O-glucosyltransferase                      233   2e-69    Cleretum bellidiforme
ref|XP_007029404.1|  Anthocyanin 3'-O-beta-glucosyltransferase, p...    232   2e-69    
dbj|BAG71127.1|  glucosyltransferase                                    232   3e-69    Phytolacca americana [common pokeberry]
ref|XP_003518715.1|  PREDICTED: scopoletin glucosyltransferase-like     232   3e-69    
ref|XP_009625604.1|  PREDICTED: scopoletin glucosyltransferase-like     232   4e-69    
dbj|BAD44686.1|  UDP-glucose:anthocyanin 3'-O-glucosyltransferase       231   5e-69    Gentiana scabra var. buergeri
gb|KGN43909.1|  hypothetical protein Csa_7G073450                       231   6e-69    
ref|XP_008375157.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    231   8e-69    
ref|XP_008245758.1|  PREDICTED: scopoletin glucosyltransferase-like     231   9e-69    
ref|XP_009779862.1|  PREDICTED: scopoletin glucosyltransferase-like     231   1e-68    
ref|XP_008340172.1|  PREDICTED: scopoletin glucosyltransferase-like     230   1e-68    
dbj|BAD52006.1|  UDP-glucose: chalcononaringenin 2'-O-glucosyltra...    230   2e-68    Dianthus caryophyllus [carnation]
ref|XP_011000136.1|  PREDICTED: scopoletin glucosyltransferase-like     230   2e-68    
dbj|BAD44687.1|  UDP-glucose:anthocyanin 3'-O-glucosyltransferase       230   2e-68    Gentiana scabra var. buergeri
ref|XP_002518707.1|  UDP-glucosyltransferase, putative                  227   2e-68    Ricinus communis
ref|XP_004304714.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    229   3e-68    
ref|XP_006487029.1|  PREDICTED: scopoletin glucosyltransferase-like     229   3e-68    
ref|XP_006369755.1|  hypothetical protein POPTR_0001s31040g             229   3e-68    
ref|XP_003628776.1|  Glucosyltransferase                                229   5e-68    
ref|XP_008454968.1|  PREDICTED: scopoletin glucosyltransferase-like     228   7e-68    
gb|KDO59783.1|  hypothetical protein CISIN_1g046605mg                   228   8e-68    
gb|KDP25000.1|  hypothetical protein JCGZ_23983                         228   8e-68    
ref|XP_007042482.1|  UDP-glucosyl transferase 73B3, putative            228   1e-67    
ref|XP_007157726.1|  hypothetical protein PHAVU_002G093300g             227   2e-67    
ref|XP_008375155.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    227   2e-67    
gb|AAS94329.1|  UDP-glucose:flavonoid-O-glucosyltransferase             227   3e-67    Beta vulgaris [beet]
dbj|BAJ11652.1|  glucosyltransferase                                    226   3e-67    
ref|XP_010691725.1|  PREDICTED: scopoletin glucosyltransferase-like     226   4e-67    
ref|XP_002518725.1|  UDP-glucosyltransferase, putative                  226   5e-67    Ricinus communis
dbj|BAF75890.1|  tetrahydroxychalcone glucosyltransferase               226   5e-67    Dianthus caryophyllus [carnation]
ref|XP_008358617.1|  PREDICTED: scopoletin glucosyltransferase-like     226   8e-67    
ref|XP_004140708.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    225   9e-67    
gb|KDP24999.1|  hypothetical protein JCGZ_23982                         225   1e-66    
ref|XP_003518713.1|  PREDICTED: scopoletin glucosyltransferase-like     225   1e-66    
gb|AFK79034.1|  glycosyltransferase UGT2                                225   1e-66    
ref|XP_011000140.1|  PREDICTED: scopoletin glucosyltransferase-like     225   2e-66    
ref|XP_009354715.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    224   2e-66    
ref|XP_008236556.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    224   3e-66    
ref|XP_002313133.1|  hypothetical protein POPTR_0009s10120g             224   3e-66    Populus trichocarpa [western balsam poplar]
ref|XP_009354713.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    224   3e-66    
ref|XP_010107898.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7    223   4e-66    
ref|XP_009354714.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    224   4e-66    
ref|XP_003518714.1|  PREDICTED: scopoletin glucosyltransferase-like     224   4e-66    
dbj|BAF75893.1|  tetrahydroxychalcone glucosyltransferase               224   4e-66    Dianthus caryophyllus [carnation]
ref|XP_008375156.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    223   1e-65    
ref|XP_011000141.1|  PREDICTED: scopoletin glucosyltransferase-like     223   1e-65    
ref|XP_007153574.1|  hypothetical protein PHAVU_003G047000g             222   1e-65    
ref|XP_008456146.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    223   1e-65    
ref|XP_010027866.1|  PREDICTED: scopoletin glucosyltransferase-like     221   8e-65    
ref|XP_006422965.1|  hypothetical protein CICLE_v10030025mg             212   2e-64    
ref|XP_008342034.1|  PREDICTED: scopoletin glucosyltransferase-like     219   2e-64    
ref|XP_010263455.1|  PREDICTED: scopoletin glucosyltransferase-like     219   3e-64    
ref|XP_009108750.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      220   3e-64    
ref|XP_004305939.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    219   3e-64    
dbj|BAG31950.1|  UGT73A9                                                219   4e-64    Antirrhinum majus [garden snapdragon]
gb|KCW64674.1|  hypothetical protein EUGRSUZ_G02260                     217   5e-64    
ref|XP_004304022.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    218   5e-64    
ref|XP_010030422.1|  PREDICTED: scopoletin glucosyltransferase-like     213   8e-64    
ref|XP_007042491.1|  Anthocyanin 3'-O-beta-glucosyltransferase          216   8e-64    
gb|KCW54504.1|  hypothetical protein EUGRSUZ_I004473                    212   9e-64    
ref|XP_010068736.1|  PREDICTED: scopoletin glucosyltransferase-like     218   1e-63    
ref|XP_002298737.1|  hypothetical protein POPTR_0001s30980g             218   1e-63    Populus trichocarpa [western balsam poplar]
ref|XP_010030443.1|  PREDICTED: scopoletin glucosyltransferase-like     210   1e-63    
gb|AHV78225.1|  glucosyltransferase                                     217   1e-63    
ref|XP_002518723.1|  UDP-glucosyltransferase, putative                  217   2e-63    Ricinus communis
gb|AIS71990.1|  UDP-glycosyl transferase 1                              217   2e-63    
gb|EYU37652.1|  hypothetical protein MIMGU_mgv1a005524mg                216   3e-63    
gb|AFJ52929.1|  UDP-glycosyltransferase 1                               216   3e-63    
ref|XP_006422968.1|  hypothetical protein CICLE_v10029184mg             209   3e-63    
ref|XP_010027900.1|  PREDICTED: scopoletin glucosyltransferase-like     216   4e-63    
ref|XP_010027899.1|  PREDICTED: scopoletin glucosyltransferase-like     216   5e-63    
ref|NP_567953.1|  UDP-glucosyl transferase 73B3                         216   6e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010691729.1|  PREDICTED: scopoletin glucosyltransferase-like     216   6e-63    
ref|XP_010526965.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      216   6e-63    
ref|XP_010066837.1|  PREDICTED: scopoletin glucosyltransferase-like     216   7e-63    
gb|AAM65945.1|  glucosyltransferase-like protein                        211   8e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004304024.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    215   1e-62    
ref|XP_010041236.1|  PREDICTED: scopoletin glucosyltransferase-like     211   1e-62    
ref|XP_010027898.1|  PREDICTED: scopoletin glucosyltransferase-like     215   1e-62    
ref|XP_006286265.1|  hypothetical protein CARUB_v10007840mg             215   1e-62    
ref|NP_849492.1|  UDP-glucosyltransferase 73B2                          211   1e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007199157.1|  hypothetical protein PRUPE_ppa019699mg             214   2e-62    
emb|CDX76261.1|  BnaA08g11390D                                          214   2e-62    
ref|XP_007201019.1|  hypothetical protein PRUPE_ppa005572mg             213   2e-62    
ref|XP_004137109.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       214   3e-62    
gb|KGN43913.1|  hypothetical protein Csa_7G073490                       214   3e-62    
emb|CDY36633.1|  BnaA07g04240D                                          214   3e-62    
ref|XP_007011132.1|  UDP-glucosyl transferase 73B3                      213   4e-62    
ref|XP_010691730.1|  PREDICTED: scopoletin glucosyltransferase-like     213   6e-62    
gb|KCW44514.1|  hypothetical protein EUGRSUZ_L01977                     212   8e-62    
ref|XP_004230753.1|  PREDICTED: scopoletin glucosyltransferase-like     213   8e-62    
ref|XP_010437661.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       212   1e-61    
ref|XP_006346386.1|  PREDICTED: scopoletin glucosyltransferase-like     212   1e-61    
ref|XP_004137108.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    212   1e-61    
ref|XP_010027835.1|  PREDICTED: scopoletin glucosyltransferase-like     212   1e-61    
ref|XP_009116544.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       211   1e-61    
ref|XP_004305941.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    212   2e-61    
ref|XP_010690618.1|  PREDICTED: scopoletin glucosyltransferase-like     212   2e-61    
emb|CDX69029.1|  BnaC01g04240D                                          212   2e-61    
gb|KDO59784.1|  hypothetical protein CISIN_1g042879mg                   203   2e-61    
gb|ADO33118.1|  UDP glucosyltransferase                                 211   2e-61    
ref|NP_567954.1|  UDP-glucosyltransferase 73B2                          211   2e-61    Arabidopsis thaliana [mouse-ear cress]
gb|KFK40015.1|  hypothetical protein AALP_AA3G318900                    211   2e-61    
ref|XP_009602613.1|  PREDICTED: scopoletin glucosyltransferase-like     211   2e-61    
emb|CDX71221.1|  BnaC07g05000D                                          211   2e-61    
ref|XP_004505253.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      211   2e-61    
emb|CDY45706.1|  BnaC02g35080D                                          206   3e-61    
ref|XP_010027902.1|  PREDICTED: scopoletin glucosyltransferase-like     211   3e-61    
ref|XP_007199033.1|  hypothetical protein PRUPE_ppa018059mg             216   3e-61    
gb|AFJ52945.1|  UDP-glycosyltransferase 1                               211   3e-61    
ref|XP_007153573.1|  hypothetical protein PHAVU_003G046900g             211   4e-61    
gb|KGN43910.1|  hypothetical protein Csa_7G073460                       203   4e-61    
ref|XP_010447141.1|  PREDICTED: UDP-glycosyltransferase 73B3 isof...    211   5e-61    
ref|XP_009119412.1|  PREDICTED: UDP-glycosyltransferase 73B5            211   5e-61    
emb|CDY53948.1|  BnaA02g36980D                                          205   5e-61    
gb|AID60126.1|  UDP-glucosyl transferase 73B1                           211   5e-61    
ref|XP_010905295.1|  PREDICTED: scopoletin glucosyltransferase-like     210   5e-61    
ref|XP_010057243.1|  PREDICTED: scopoletin glucosyltransferase-like     210   6e-61    
ref|XP_009116435.1|  PREDICTED: UDP-glycosyltransferase 73B1            211   6e-61    
sp|Q2V6J9.1|UFOG7_FRAAN  RecName: Full=UDP-glucose flavonoid 3-O-...    210   7e-61    Fragaria x ananassa
ref|XP_007042484.1|  UDP-glucosyl transferase 73B3                      210   9e-61    
ref|XP_004304021.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    210   9e-61    
ref|XP_002867135.1|  predicted protein                                  209   1e-60    
ref|XP_010057244.1|  PREDICTED: scopoletin glucosyltransferase-like     209   1e-60    
ref|XP_011088224.1|  PREDICTED: scopoletin glucosyltransferase-like     209   1e-60    
ref|XP_010107901.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7    209   1e-60    
ref|XP_007011136.1|  UDP-glucosyl transferase 73B3                      209   2e-60    
ref|XP_006283647.1|  hypothetical protein CARUB_v10004704mg             209   2e-60    
gb|AHL38663.1|  glycosyltransferase                                     209   2e-60    
ref|XP_008236573.1|  PREDICTED: scopoletin glucosyltransferase-like     209   3e-60    
ref|XP_009129082.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       203   3e-60    
ref|XP_010027865.1|  PREDICTED: scopoletin glucosyltransferase-like     208   4e-60    
ref|XP_010027864.1|  PREDICTED: scopoletin glucosyltransferase-like     208   4e-60    
dbj|BAF75887.1|  tetrahydroxychalcone glucosyltransferase               208   5e-60    Dianthus caryophyllus [carnation]
gb|KCW55169.1|  hypothetical protein EUGRSUZ_I01125                     207   6e-60    
gb|AID60125.1|  UDP-glucosyl transferase 73B2                           207   8e-60    
ref|XP_006297553.1|  hypothetical protein CARUB_v10013576mg             207   9e-60    
ref|XP_002518722.1|  UDP-glucosyltransferase, putative                  206   1e-59    Ricinus communis
gb|KFK30053.1|  hypothetical protein AALP_AA7G210800                    207   1e-59    
emb|CDX69028.1|  BnaC01g04250D                                          207   1e-59    
ref|XP_010027836.1|  PREDICTED: scopoletin glucosyltransferase-like     207   1e-59    
gb|KEH30901.1|  flavonoid glucosyltransferase                           206   2e-59    
dbj|BAI63589.1|  UDP-glucose glucosyltransferase                        207   2e-59    Lotus japonicus
ref|XP_010028418.1|  PREDICTED: scopoletin glucosyltransferase-like     206   2e-59    
ref|XP_004304025.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    206   2e-59    
ref|XP_007042483.1|  UDP-glucosyl transferase 73B3, putative            206   2e-59    
emb|CAA17559.1|  glucosyltransferase-like protein                       206   2e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010681315.1|  PREDICTED: scopoletin glucosyltransferase-like     206   2e-59    
ref|XP_007201142.1|  hypothetical protein PRUPE_ppa016033mg             206   2e-59    
gb|AFJ52930.1|  UDP-glycosyltransferase 1                               206   2e-59    
emb|CDY65498.1|  BnaCnng47330D                                          206   3e-59    
ref|XP_010028421.1|  PREDICTED: scopoletin glucosyltransferase-like     206   3e-59    
ref|XP_010447140.1|  PREDICTED: UDP-glucosyl transferase 73B2 iso...    206   3e-59    
ref|XP_010691724.1|  PREDICTED: scopoletin glucosyltransferase-like     206   3e-59    
ref|XP_004159901.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       206   3e-59    
gb|AFK37676.1|  unknown                                                 206   4e-59    
ref|XP_010488961.1|  PREDICTED: UDP-glycosyltransferase 73B5-like       205   5e-59    
ref|XP_007200246.1|  hypothetical protein PRUPE_ppa015133mg             205   5e-59    
gb|KCW55162.1|  hypothetical protein EUGRSUZ_I01117                     205   8e-59    
ref|XP_010028420.1|  PREDICTED: scopoletin glucosyltransferase-like     205   1e-58    
ref|XP_008236561.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    204   1e-58    
dbj|BAG80549.1|  UDP-glucose:glucosyltransferase                        204   1e-58    Lycium barbarum [goji berry]
ref|XP_007198987.1|  hypothetical protein PRUPE_ppa019354mg             204   1e-58    
ref|XP_004307464.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    204   2e-58    
gb|KFK30052.1|  hypothetical protein AALP_AA7G210700                    204   2e-58    
ref|XP_010027867.1|  PREDICTED: scopoletin glucosyltransferase-like     204   2e-58    
ref|XP_008454969.1|  PREDICTED: scopoletin glucosyltransferase-like     204   4e-58    
ref|XP_010690617.1|  PREDICTED: scopoletin glucosyltransferase-like     202   8e-58    
ref|XP_010467302.1|  PREDICTED: UDP-glycosyltransferase 73B4-like       202   8e-58    
ref|XP_006409549.1|  hypothetical protein EUTSA_v10022663mg             202   9e-58    
ref|XP_007042490.1|  Anthocyanin 3'-O-beta-glucosyltransferase          202   1e-57    
ref|XP_011088227.1|  PREDICTED: scopoletin glucosyltransferase-like     202   1e-57    
ref|XP_009110190.1|  PREDICTED: UDP-glycosyltransferase 73B5-like       201   2e-57    
gb|KGN43915.1|  hypothetical protein Csa_7G073510                       201   2e-57    
ref|XP_010107891.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7    201   2e-57    
ref|XP_011088228.1|  PREDICTED: scopoletin glucosyltransferase-like     200   2e-57    
ref|XP_002883897.1|  UDP-glucosyl transferase 73B5                      201   3e-57    
gb|KFK30051.1|  hypothetical protein AALP_AA7G210600                    201   3e-57    
ref|XP_010432459.1|  PREDICTED: UDP-glycosyltransferase 73B1-like       201   3e-57    
emb|CDX76262.1|  BnaA08g11380D                                          200   4e-57    
ref|XP_002518708.1|  UDP-glucosyltransferase, putative                  200   5e-57    Ricinus communis
ref|XP_006296609.1|  hypothetical protein CARUB_v10013563mg             200   6e-57    
ref|XP_006346384.1|  PREDICTED: scopoletin glucosyltransferase-like     200   6e-57    
ref|XP_006412271.1|  hypothetical protein EUTSA_v10025048mg             200   7e-57    
gb|KFK30045.1|  hypothetical protein AALP_AA7G209900                    199   8e-57    
ref|XP_009792742.1|  PREDICTED: scopoletin glucosyltransferase-like     199   9e-57    
gb|KCW55161.1|  hypothetical protein EUGRSUZ_I01116                     199   1e-56    
emb|CDY65497.1|  BnaCnng47320D                                          199   1e-56    
ref|XP_004159929.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucose ...    199   1e-56    
ref|NP_001189529.1|  UDP-glycosyltransferase 73B4                       199   1e-56    
gb|ADV71369.1|  glycosyltransferase GT14A05                             199   1e-56    
ref|NP_179151.2|  UDP-glycosyltransferase 73B4                          199   2e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004137110.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    204   2e-56    
ref|XP_008236571.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    198   2e-56    
ref|XP_011088741.1|  PREDICTED: scopoletin glucosyltransferase-like     199   2e-56    
ref|XP_010518197.1|  PREDICTED: UDP-glycosyltransferase 73B5            199   2e-56    
ref|XP_003518710.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      198   2e-56    
emb|CDY13143.1|  BnaA09g16740D                                          198   2e-56    
dbj|BAA83484.1|  UDP-glucose: flavonoid 7-O-glucosyltransferase         198   2e-56    Scutellaria baicalensis [Baikal skullcap]
ref|XP_010107893.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7    198   3e-56    
ref|XP_010530759.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      198   3e-56    
gb|ACJ72160.1|  UGT3                                                    197   3e-56    Pueraria montana var. lobata [kudzu]
ref|XP_010488962.1|  PREDICTED: UDP-glycosyltransferase 73B4-like       198   3e-56    
ref|XP_002518721.1|  UDP-glucosyltransferase, putative                  197   5e-56    Ricinus communis
ref|XP_009108751.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      197   5e-56    
ref|XP_002518718.1|  UDP-glucosyltransferase, putative                  197   9e-56    Ricinus communis
ref|XP_002883898.1|  UGT73B4                                            196   1e-55    
emb|CBI19486.3|  unnamed protein product                                195   2e-55    
emb|CDY65110.1|  BnaUnng01010D                                          196   2e-55    
ref|XP_007153575.1|  hypothetical protein PHAVU_003G047100g             195   3e-55    
gb|AFJ52946.1|  UDP-glycosyltransferase 1                               196   3e-55    
gb|KDP24997.1|  hypothetical protein JCGZ_23980                         195   3e-55    
ref|XP_010432461.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       195   4e-55    
ref|NP_179150.3|  UDP-glucosyl transferase 73B5                         195   4e-55    
gb|KCW54538.1|  hypothetical protein EUGRSUZ_I00496                     188   4e-55    
ref|XP_006283463.1|  hypothetical protein CARUB_v10004508mg             196   5e-55    
ref|XP_009136271.1|  PREDICTED: UDP-glycosyltransferase 73B5-like       195   5e-55    
ref|NP_001189528.1|  UDP-glucosyl transferase 73B5                      195   5e-55    
ref|XP_010447136.1|  PREDICTED: UDP-glycosyltransferase 73B1 isof...    195   5e-55    
ref|XP_002518717.1|  UDP-glucosyltransferase, putative                  194   5e-55    
ref|XP_009117049.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       194   5e-55    
ref|XP_002282952.2|  PREDICTED: scopoletin glucosyltransferase-like     195   6e-55    
ref|XP_010437662.1|  PREDICTED: UDP-glycosyltransferase 73B1-like       194   1e-54    
gb|KFK30050.1|  hypothetical protein AALP_AA7G210500                    193   2e-54    
ref|XP_010048320.1|  PREDICTED: scopoletin glucosyltransferase-like     193   3e-54    
ref|XP_010530757.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      192   3e-54    
ref|XP_010517429.1|  PREDICTED: UDP-glycosyltransferase 73B4-like       192   3e-54    
ref|XP_009108748.1|  PREDICTED: UDP-glycosyltransferase 73B1-like       192   3e-54    
emb|CDX76263.1|  BnaA08g11370D                                          192   4e-54    
gb|KHN12230.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7         184   4e-54    
gb|AID60124.1|  UDP-glucosyl transferase 73B3                           192   4e-54    
ref|XP_007157236.1|  hypothetical protein PHAVU_002G054100g             192   4e-54    
emb|CDX75399.1|  BnaA01g03030D                                          192   5e-54    
ref|XP_006412270.1|  hypothetical protein EUTSA_v10024935mg             192   6e-54    
gb|KGN43914.1|  hypothetical protein Csa_7G073500                       191   1e-53    
ref|XP_003538838.1|  PREDICTED: scopoletin glucosyltransferase-like     191   1e-53    
emb|CDX69027.1|  BnaC01g04260D                                          191   2e-53    
gb|KFK30049.1|  hypothetical protein AALP_AA7G210400                    190   3e-53    
ref|XP_010030421.1|  PREDICTED: scopoletin glucosyltransferase-like     190   4e-53    
ref|XP_004305940.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    189   4e-53    
gb|AFJ52947.1|  UDP-glycosyltransferase 1                               190   4e-53    
gb|KEH30902.1|  flavonoid glucosyltransferase                           189   7e-53    
ref|XP_004505250.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    189   1e-52    
ref|XP_004304023.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    188   1e-52    
ref|XP_010547999.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      189   1e-52    
ref|XP_006386501.1|  hypothetical protein POPTR_0002s12520g             188   2e-52    
ref|XP_002298739.2|  hypothetical protein POPTR_0001s30970g             187   2e-52    
gb|AGU14082.1|  UDP-glycosyltransferase                                 187   4e-52    
ref|XP_009623864.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       187   4e-52    
ref|XP_002510179.1|  UDP-glucosyltransferase, putative                  187   4e-52    
ref|XP_008454967.1|  PREDICTED: scopoletin glucosyltransferase-like     187   6e-52    
gb|KDP46894.1|  hypothetical protein JCGZ_24103                         187   8e-52    
emb|CDP19616.1|  unnamed protein product                                186   1e-51    
gb|KEH30899.1|  flavonoid glucosyltransferase                           184   1e-51    
ref|XP_002867133.1|  UDP-glucosyl transferase 73B1                      186   1e-51    
gb|KCW55160.1|  hypothetical protein EUGRSUZ_I01115                     185   1e-51    
dbj|BAG31952.1|  UGT73A13                                               185   2e-51    
ref|XP_003623458.1|  Cytokinin-O-glucosyltransferase                    185   3e-51    
dbj|BAG80535.1|  putative glycosyltransferase                           185   3e-51    
emb|CAE48294.1|  glucosyltransferase 5                                  184   3e-51    
gb|KHN40682.1|  UDP-glycosyltransferase 73B4                            185   3e-51    
gb|EPS74081.1|  hypothetical protein M569_00673                         184   4e-51    
emb|CDX89662.1|  BnaC03g45760D                                          184   5e-51    
ref|XP_002518719.1|  UDP-glucosyltransferase, putative                  184   7e-51    
ref|XP_003533678.1|  PREDICTED: soyasapogenol B glucuronide galac...    184   8e-51    
ref|XP_003551588.1|  PREDICTED: soyasapogenol B glucuronide galac...    184   1e-50    
ref|XP_010530755.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      183   2e-50    
ref|XP_006346519.1|  PREDICTED: scopoletin glucosyltransferase-like     185   2e-50    
gb|ADV71361.1|  glycosyltransferase GT02J01                             182   2e-50    
ref|XP_006442846.1|  hypothetical protein CICLE_v10023414mg             182   2e-50    
ref|XP_010107895.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7    181   6e-50    
ref|XP_009796872.1|  PREDICTED: UDP-glycosyltransferase 73C2-like       181   6e-50    
ref|XP_009410978.1|  PREDICTED: scopoletin glucosyltransferase-like     182   6e-50    
gb|KCW54502.1|  hypothetical protein EUGRSUZ_I00446                     180   1e-49    
ref|XP_006478662.1|  PREDICTED: scopoletin glucosyltransferase-like     181   1e-49    
gb|KHN40683.1|  UDP-glycosyltransferase 73B3                            181   1e-49    
gb|KDO45786.1|  hypothetical protein CISIN_1g044012mg                   181   1e-49    
gb|EYU37649.1|  hypothetical protein MIMGU_mgv1a026287mg                180   1e-49    
ref|XP_010669783.1|  PREDICTED: scopoletin glucosyltransferase-like     180   2e-49    
gb|AFJ52944.1|  UDP-glycosyltransferase 1                               180   2e-49    
gb|EYU37648.1|  hypothetical protein MIMGU_mgv1a005507mg                180   2e-49    
gb|AFJ52949.1|  UDP-glycosyltransferase 1                               179   2e-49    
ref|XP_006342641.1|  PREDICTED: soyasapogenol B glucuronide galac...    180   2e-49    
gb|AFJ52948.1|  UDP-glycosyltransferase 1                               178   7e-49    
ref|XP_003623449.1|  UDP-glucuronosyltransferase 1-1                    179   7e-49    
ref|XP_007156775.1|  hypothetical protein PHAVU_002G016500g             179   7e-49    
gb|ADV71362.1|  glycosyltransferase GT03H14                             178   7e-49    
ref|XP_009606596.1|  PREDICTED: scopoletin glucosyltransferase-like     177   2e-48    
ref|XP_004252755.1|  PREDICTED: scopoletin glucosyltransferase-li...    177   3e-48    
gb|AES79668.2|  UDP-glucosyltransferase family protein                  177   3e-48    
ref|XP_006422970.1|  hypothetical protein CICLE_v10030328mg             176   3e-48    
ref|XP_008777755.1|  PREDICTED: scopoletin glucosyltransferase-like     176   7e-48    
ref|XP_010107899.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7    175   7e-48    
ref|NP_567955.1|  UDP-glucosyl transferase 73B1                         176   8e-48    
gb|AFJ52931.1|  UDP-glycosyltransferase 1                               176   9e-48    
ref|XP_006342640.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    175   1e-47    
ref|XP_004492515.1|  PREDICTED: soyasapogenol B glucuronide galac...    175   1e-47    
gb|ACU16836.1|  unknown                                                 169   2e-47    
ref|XP_010315221.1|  PREDICTED: LOW QUALITY PROTEIN: scopoletin g...    174   2e-47    
ref|XP_003623451.1|  UDP-glucuronosyltransferase 2B4                    174   2e-47    
ref|XP_011017167.1|  PREDICTED: scopoletin glucosyltransferase-like     176   2e-47    
ref|XP_006827589.1|  hypothetical protein AMTR_s00009p00235050          174   3e-47    
ref|XP_004492516.1|  PREDICTED: soyasapogenol B glucuronide galac...    174   3e-47    
ref|XP_011094571.1|  PREDICTED: UDP-glycosyltransferase 73C5            174   3e-47    
ref|XP_010534180.1|  PREDICTED: probable WRKY transcription factor 9    175   4e-47    
ref|XP_003623450.1|  Cytokinin-O-glucosyltransferase                    177   5e-47    
ref|XP_003623440.1|  Anthocyanidin 3-O-glucosyltransferase              174   5e-47    
ref|XP_006427223.1|  hypothetical protein CICLE_v10027236mg             169   8e-47    
ref|XP_004492514.1|  PREDICTED: soyasapogenol B glucuronide galac...    173   9e-47    
ref|XP_004252827.2|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    171   1e-46    
gb|ACU16826.1|  unknown                                                 166   2e-46    
ref|XP_002867134.1|  UGT73B2                                            171   2e-46    
ref|XP_007140181.1|  hypothetical protein PHAVU_008G090800g             171   2e-46    
ref|XP_007156774.1|  hypothetical protein PHAVU_002G016400g             172   2e-46    
ref|XP_011077287.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       172   2e-46    
ref|XP_009616185.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       172   2e-46    
ref|XP_009616186.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       172   2e-46    
ref|XP_007017169.1|  UDP-glucosyl transferase 73B5, putative            172   2e-46    
ref|XP_007140179.1|  hypothetical protein PHAVU_008G090600g             171   3e-46    
ref|XP_010925717.1|  PREDICTED: scopoletin glucosyltransferase-like     171   3e-46    
ref|NP_973469.1|  UDP-glycosyltransferase 73B4                          166   3e-46    
ref|XP_004511896.1|  PREDICTED: soyasapogenol B glucuronide galac...    171   3e-46    
ref|XP_003623422.1|  Anthocyanin 3'-O-beta-glucosyltransferase          171   4e-46    
ref|XP_009758335.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       171   6e-46    
ref|XP_006346605.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       171   6e-46    
dbj|BAG31951.1|  UGT73A7                                                171   7e-46    
ref|XP_003611681.1|  Anthocyanin 3'-O-beta-glucosyltransferase          170   7e-46    
ref|XP_008790370.1|  PREDICTED: scopoletin glucosyltransferase-like     169   2e-45    
gb|KDO36684.1|  hypothetical protein CISIN_1g044094mg                   164   2e-45    
ref|XP_009631489.1|  PREDICTED: UDP-glycosyltransferase 73C1            169   2e-45    
ref|XP_004492517.1|  PREDICTED: soyasapogenol B glucuronide galac...    169   2e-45    
ref|XP_004492513.1|  PREDICTED: soyasapogenol B glucuronide galac...    169   2e-45    
ref|XP_006427231.1|  hypothetical protein CICLE_v10027181mg             169   2e-45    
gb|KDO45237.1|  hypothetical protein CISIN_1g011490mg                   169   2e-45    
sp|D4Q9Z4.1|SGT2_SOYBN  RecName: Full=Soyasapogenol B glucuronide...    169   3e-45    
ref|XP_006465360.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       169   3e-45    
ref|XP_003539343.1|  PREDICTED: soyasapogenol B glucuronide galac...    169   3e-45    
ref|XP_007140178.1|  hypothetical protein PHAVU_008G090500g             169   3e-45    
gb|KCW55163.1|  hypothetical protein EUGRSUZ_I01119                     164   3e-45    
ref|XP_009800394.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       169   3e-45    
ref|XP_010243179.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       169   4e-45    
ref|XP_010107900.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7    168   4e-45    
gb|EYU41583.1|  hypothetical protein MIMGU_mgv1a005332mg                168   4e-45    
ref|XP_009394304.1|  PREDICTED: scopoletin glucosyltransferase-like     168   5e-45    
ref|XP_003623444.1|  Anthocyanidin 3-O-glucosyltransferase              167   7e-45    
gb|KHN29555.1|  UDP-glycosyltransferase 73B5                            167   8e-45    
gb|AES79656.2|  UDP-glucosyltransferase family protein                  167   8e-45    
ref|XP_006848527.1|  hypothetical protein AMTR_s00169p00014200          167   9e-45    
dbj|BAO66180.1|  hypothetical protein                                   167   9e-45    
ref|XP_010260609.1|  PREDICTED: scopoletin glucosyltransferase-like     167   1e-44    
ref|XP_003623438.1|  UDP-glucuronosyltransferase 2A1                    168   1e-44    
ref|XP_009381746.1|  PREDICTED: scopoletin glucosyltransferase          167   1e-44    
ref|XP_010925706.1|  PREDICTED: scopoletin glucosyltransferase-like     167   1e-44    
ref|XP_008777757.1|  PREDICTED: scopoletin glucosyltransferase-like     167   1e-44    
gb|KDO41467.1|  hypothetical protein CISIN_1g046582mg                   164   2e-44    
ref|XP_006367257.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       166   2e-44    
gb|KDO59780.1|  hypothetical protein CISIN_1g039991mg                   158   2e-44    
ref|XP_006357882.1|  PREDICTED: scopoletin glucosyltransferase-like     166   2e-44    
ref|XP_003637924.1|  Anthocyanin 3'-O-beta-glucosyltransferase          166   3e-44    
emb|CDP01301.1|  unnamed protein product                                166   3e-44    
gb|KHN02289.1|  UDP-glycosyltransferase 73C2                            166   3e-44    
gb|ACU18051.1|  unknown                                                 166   3e-44    
ref|XP_011077288.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       166   3e-44    
ref|XP_006423821.1|  hypothetical protein CICLE_v10028465mg             165   3e-44    
gb|AES79645.2|  UDP-glucosyltransferase family protein                  166   3e-44    
dbj|BAG16513.1|  flavonoid glucoyltransferase UGT73E2                   166   4e-44    
ref|XP_004252303.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       166   4e-44    
ref|XP_006492609.1|  PREDICTED: UDP-glycosyltransferase 73C6-like       166   4e-44    
ref|XP_006363691.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       166   4e-44    
gb|ACS87992.1|  UDP-glucosyltransferase family 1 protein                166   4e-44    
ref|XP_008790368.1|  PREDICTED: scopoletin glucosyltransferase-like     166   5e-44    
ref|XP_003552284.1|  PREDICTED: soyasapogenol B glucuronide galac...    165   5e-44    
emb|CDX96594.1|  BnaA08g21370D                                          166   6e-44    
gb|EYU41584.1|  hypothetical protein MIMGU_mgv1a025584mg                165   6e-44    
ref|XP_003623441.1|  UDP-glucuronosyltransferase 2A1                    165   7e-44    
ref|XP_008373858.1|  PREDICTED: anthocyanin 3'-O-beta-glucosyltra...    165   7e-44    
gb|EYU38580.1|  hypothetical protein MIMGU_mgv1a006196mg                164   7e-44    
ref|XP_003613714.1|  Anthocyanin 3'-O-beta-glucosyltransferase          165   8e-44    
gb|ADV71370.1|  glycosyltransferase GT14K13                             165   9e-44    
gb|AAB48444.2|  UDP-galactose:solanidine galactosyltransferase          164   1e-43    
ref|XP_003623427.1|  Anthocyanin 3'-O-beta-glucosyltransferase          166   1e-43    
ref|XP_008457740.1|  PREDICTED: soyasapogenol B glucuronide galac...    161   1e-43    
gb|AFJ52934.1|  UDP-glycosyltransferase 1                               164   1e-43    
ref|XP_010672458.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    164   2e-43    
gb|AAD17393.1|  putative glucosyltransferase                            164   2e-43    
ref|XP_003622870.1|  Cytokinin-O-glucosyltransferase                    164   3e-43    
ref|XP_010927032.1|  PREDICTED: scopoletin glucosyltransferase-like     163   3e-43    
gb|AFA28184.1|  UDP-glucose:solanidine glucosyltransferase              163   3e-43    
ref|XP_003623434.1|  Cytokinin-O-glucosyltransferase                    163   3e-43    
ref|XP_006848530.1|  hypothetical protein AMTR_s00169p00020090          163   4e-43    
ref|XP_004249831.1|  PREDICTED: UDP-glycosyltransferase 73D1            163   5e-43    
ref|XP_011094572.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       163   6e-43    
ref|XP_007201773.1|  hypothetical protein PRUPE_ppa017305mg             162   1e-42    
ref|XP_003623445.1|  Anthocyanidin 3-O-glucosyltransferase              161   2e-42    
gb|AGU14086.1|  UDP-glycosyltransferase                                 161   2e-42    
ref|XP_006848529.1|  hypothetical protein AMTR_s00169p00018080          161   2e-42    
gb|ABB29874.1|  UDP-glucose:solanidine glucosyltransferase              161   2e-42    
ref|XP_007140180.1|  hypothetical protein PHAVU_008G090700g             160   2e-42    
ref|XP_008785751.1|  PREDICTED: scopoletin glucosyltransferase-like     159   2e-42    
ref|XP_008797684.1|  PREDICTED: scopoletin glucosyltransferase-like     160   3e-42    
ref|XP_003609043.1|  Anthocyanin 3'-O-beta-glucosyltransferase          160   5e-42    
ref|XP_010683973.1|  PREDICTED: UDP-glycosyltransferase 73C2-like       160   5e-42    
ref|NP_001233853.1|  glycoalkaloid metabolism 1 precursor               160   6e-42    
gb|AEN82724.1|  AT4G34135-like protein                                  153   6e-42    
ref|XP_004249618.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       160   7e-42    
ref|XP_004249620.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       159   8e-42    
ref|XP_006367258.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       159   8e-42    
ref|XP_006352842.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    159   9e-42    
ref|XP_010935521.1|  PREDICTED: UDP-glycosyltransferase 73C5-like       159   9e-42    
ref|XP_007142833.1|  hypothetical protein PHAVU_007G020800g             159   1e-41    
ref|XP_010925730.1|  PREDICTED: scopoletin glucosyltransferase-like     159   1e-41    
dbj|BAF75894.1|  glucosyltransferase                                    159   1e-41    
gb|AEN82727.1|  AT4G34135-like protein                                  152   1e-41    
gb|AEN82729.1|  AT4G34135-like protein                                  152   2e-41    
ref|XP_010098834.1|  UDP-glycosyltransferase 73C3                       159   2e-41    
ref|XP_008236496.1|  PREDICTED: abscisate beta-glucosyltransferas...    159   2e-41    
gb|AEN82723.1|  AT4G34135-like protein                                  152   2e-41    
ref|XP_006367256.1|  PREDICTED: UDP-glycosyltransferase 73D1-like       159   2e-41    
ref|XP_006492619.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       158   2e-41    
ref|XP_003517967.1|  PREDICTED: soyasapogenol B glucuronide galac...    158   2e-41    
gb|AEN82722.1|  AT4G34135-like protein                                  151   3e-41    
gb|KHN37410.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7         158   3e-41    
ref|XP_003536714.1|  PREDICTED: soyasapogenol B glucuronide galac...    158   3e-41    
emb|CDP15306.1|  unnamed protein product                                158   3e-41    
ref|XP_009407035.1|  PREDICTED: anthocyanin 3'-O-beta-glucosyltra...    157   3e-41    
ref|XP_010098836.1|  UDP-glycosyltransferase 73C3                       157   3e-41    
gb|AEN82726.1|  AT4G34135-like protein                                  151   4e-41    
dbj|BAD89035.1|  putative glycosyltransferase                           152   4e-41    
ref|XP_010515803.1|  PREDICTED: UDP-glycosyltransferase 73D1            157   4e-41    
ref|XP_007142832.1|  hypothetical protein PHAVU_007G020700g             157   5e-41    
ref|XP_008803492.1|  PREDICTED: UDP-glycosyltransferase 73C6-like       157   5e-41    
ref|XP_009771644.1|  PREDICTED: scopoletin glucosyltransferase-like     157   5e-41    
gb|AIS71989.1|  UDP-glycosyl transferase 2                              156   5e-41    



>ref|XP_009761805.1| PREDICTED: scopoletin glucosyltransferase [Nicotiana sylvestris]
 gb|AAB36653.1| immediate-early salicylate-induced glucosyltransferase [Nicotiana 
tabacum]
Length=476

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 189/226 (84%), Gaps = 0/226 (0%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            MG LH+FFFP+MAHGHMIPTLDMAKLFASRGVKATIITTP N+ VFSKA+ +   LG +I
Sbjct  1    MGQLHIFFFPVMAHGHMIPTLDMAKLFASRGVKATIITTPLNEFVFSKAIQRNKHLGIEI  60

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
            +IRL++FPAVE GLPE+C+ +D++PS E LP+FFKA AM+QEPLE+L+ E RPDCL++D+
Sbjct  61   EIRLIKFPAVENGLPEECERLDQIPSDEKLPNFFKAVAMMQEPLEQLIEECRPDCLISDM  120

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            F PW TD AAKF+IPR++FHG+S+ A+C  NS+R +KPF +VSSDSE F +P+LPH++KL
Sbjct  121  FLPWTTDTAAKFNIPRIVFHGTSFFALCVENSVRLNKPFKNVSSDSETFVVPDLPHEIKL  180

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR QVSP ERS  ET  T ++K VRES+  SYG +FNSFYELE DY
Sbjct  181  TRTQVSPFERSGEETAMTRMIKTVRESDSKSYGVVFNSFYELETDY  226



>sp|Q9AT54.1|SCGT_TOBAC RecName: Full=Scopoletin glucosyltransferase; AltName: Full=Phenylpropanoid:glucosyltransferase 
1 [Nicotiana tabacum]
 gb|AAK28303.1|AF346431_1 phenylpropanoid:glucosyltransferase 1, partial [Nicotiana tabacum]
Length=476

 Score =   311 bits (796),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 188/226 (83%), Gaps = 0/226 (0%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            MG LH FFFP+MAHGHMIPTLDMAKLFASRGVKATIITTP N+ VFSKA+ +   LG +I
Sbjct  1    MGQLHFFFFPVMAHGHMIPTLDMAKLFASRGVKATIITTPLNEFVFSKAIQRNKHLGIEI  60

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
            +IRL++FPAVE GLPE+C+ +D++PS E LP+FFKA AM+QEPLE+L+ E RPDCL++D+
Sbjct  61   EIRLIKFPAVENGLPEECERLDQIPSDEKLPNFFKAVAMMQEPLEQLIEECRPDCLISDM  120

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            F PW TD AAKF+IPR++FHG+S+ A+C  NS+R +KPF +VSSDSE F +P+LPH++KL
Sbjct  121  FLPWTTDTAAKFNIPRIVFHGTSFFALCVENSVRLNKPFKNVSSDSETFVVPDLPHEIKL  180

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR QVSP ERS  ET  T ++K VRES+  SYG +FNSFYELE DY
Sbjct  181  TRTQVSPFERSGEETAMTRMIKTVRESDSKSYGVVFNSFYELETDY  226



>ref|XP_009622522.1| PREDICTED: scopoletin glucosyltransferase [Nicotiana tomentosiformis]
 gb|AAB36652.1| immediate-early salicylate-induced glucosyltransferase [Nicotiana 
tabacum]
Length=476

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 185/226 (82%), Gaps = 0/226 (0%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            MG LH FFFP+MAHGHMIPTLDMAKL ASRGVKATIITTP N+ VFSK++ +   LG +I
Sbjct  1    MGQLHFFFFPVMAHGHMIPTLDMAKLVASRGVKATIITTPLNESVFSKSIQRNKHLGIEI  60

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
            +IRL++FPAVE GLPE+C+ +D +PS + LP+FFKA AM+QEPLE+L+ E RP+CLV+D+
Sbjct  61   EIRLIKFPAVENGLPEECERLDLIPSDDKLPNFFKAVAMMQEPLEQLIEECRPNCLVSDM  120

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            F PW TD AAKF++PR++FHG+S+ A+C  NS+R +KPF +VSSDSE F +PNLPH++KL
Sbjct  121  FLPWTTDTAAKFNMPRIVFHGTSFFALCVENSIRLNKPFKNVSSDSETFVVPNLPHEIKL  180

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR Q+SP E+S  ET  T ++K VRES+  SYG IFNSF ELE DY
Sbjct  181  TRTQLSPFEQSGEETTMTRMIKSVRESDSKSYGVIFNSFNELEHDY  226



>gb|AAK28304.1|AF346432_1 phenylpropanoid:glucosyltransferase 2, partial [Nicotiana tabacum]
Length=476

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 185/226 (82%), Gaps = 0/226 (0%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            MG LH FFFP+MAHGHMIPTLDMAKL ASRGVKATIITTP N+ VFSK++ +   LG +I
Sbjct  1    MGQLHFFFFPVMAHGHMIPTLDMAKLVASRGVKATIITTPLNESVFSKSIQRNKHLGIEI  60

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
            +IRL++FPAVE GLPE+C+ +D +PS + LP+FFKA AM+QEPLE+L+ E RP+CLV+D+
Sbjct  61   EIRLIKFPAVENGLPEECERLDLIPSDDKLPNFFKAVAMMQEPLEQLIEECRPNCLVSDM  120

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            F PW TD AAKF++PR++FHG+S+ A+C  NS+R +KPF +VSSDSE F +PNLPH++KL
Sbjct  121  FLPWTTDTAAKFNMPRIVFHGTSFFALCVENSIRLNKPFKNVSSDSETFVVPNLPHEIKL  180

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR Q+SP E+S  ET  T ++K VRES+  SYG IFNSF ELE DY
Sbjct  181  TRTQLSPFEQSGEETTMTRMIKSVRESDSKSYGVIFNSFNELEHDY  226



>ref|XP_006346388.1| PREDICTED: scopoletin glucosyltransferase-like [Solanum tuberosum]
Length=474

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 182/226 (81%), Gaps = 0/226 (0%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            MG LH FFFPMMA GHMIPTLDMAKL ASRGVKATIITTP N+ VFSKA+++   LG +I
Sbjct  1    MGQLHFFFFPMMAQGHMIPTLDMAKLVASRGVKATIITTPLNESVFSKAIERNKHLGIEI  60

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             IRLL+FPA E  LPEDC+ +D +PS + LP+F KA AM+++  E+L+ E RP+CLV+D+
Sbjct  61   DIRLLKFPAKENDLPEDCERLDLIPSDDKLPNFLKAAAMMKDEFEQLIEECRPNCLVSDM  120

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            F PW TD+AAKFDIPR++FHG+SY A+C  +S+R +KPF +V+SD+E F +P+LPH++KL
Sbjct  121  FLPWTTDSAAKFDIPRIVFHGTSYFALCVVDSIRRNKPFKNVTSDTETFVVPDLPHEIKL  180

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR Q+SP E+S+ ET  T ++K VRES+  SYG IFNSFYELE DY
Sbjct  181  TRTQLSPFEQSDEETGMTPMIKAVRESDAKSYGVIFNSFYELESDY  226



>ref|XP_004230759.1| PREDICTED: scopoletin glucosyltransferase [Solanum lycopersicum]
Length=470

 Score =   293 bits (750),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            MG LH FFFPMMA GHMIPTLDMAKL A RGVKATIITTP N+ VFSKA+++   LG +I
Sbjct  1    MGQLHFFFFPMMAQGHMIPTLDMAKLVACRGVKATIITTPLNESVFSKAIERNKHLGIEI  60

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             IRLL+FPA E  LPEDC+ +D VPS + LP+F KA AM+++  E L+ E RPDCLV+D+
Sbjct  61   DIRLLKFPAKENDLPEDCERLDLVPSDDKLPNFLKAAAMMKDEFEELIGECRPDCLVSDM  120

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            F PW TD+AAKF IPR++FHG+SY A+C  +S+R +KPF +VSSD+E F +P+LPH+++L
Sbjct  121  FLPWTTDSAAKFSIPRIVFHGTSYFALCVGDSIRRNKPFKNVSSDTETFVVPDLPHEIRL  180

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR Q+SP E+S+ ET    ++K VRES+  SYG IFNSFYELE DY
Sbjct  181  TRTQLSPFEQSDEETGMAPMIKAVRESDAKSYGVIFNSFYELESDY  226



>gb|ACO44747.1| UDP glycosyltransferase [Withania somnifera]
Length=470

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 182/226 (81%), Gaps = 4/226 (2%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            MG LH+FFFPMMA GHMIPTLDMAKL ASRGVKATIITTP N+ VFSK + +   LG   
Sbjct  1    MGQLHIFFFPMMAQGHMIPTLDMAKLVASRGVKATIITTPLNESVFSKVIQRNKNLG---  57

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             IRL++FPAVE  LPEDC+ +D +PS + LP+FFKA A +QE LE+L+ E RP+CLV+D+
Sbjct  58   -IRLIKFPAVENDLPEDCERLDLIPSDDKLPNFFKAAATMQESLEQLIQECRPNCLVSDM  116

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPW TD AAKF+IPR++FHG+ Y A+ A +SLR +KPF +VSSDSE F +PNLPH++KL
Sbjct  117  FFPWTTDTAAKFNIPRIVFHGTGYFALSAVDSLRLNKPFKNVSSDSETFVVPNLPHEIKL  176

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR ++SP E+S+ E+  ++++K VR+++  SYG IFNSFYELEPDY
Sbjct  177  TRSKLSPFEQSDEESVMSQMVKAVRDADSKSYGVIFNSFYELEPDY  222



>dbj|BAG80536.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=477

 Score =   291 bits (745),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 185/228 (81%), Gaps = 2/228 (1%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            MG LH F FPMMA GHMIPTLDMAKL ASRGVKATIITTP N+ VFSKA+ +  QLG +I
Sbjct  1    MGQLHFFLFPMMAQGHMIPTLDMAKLIASRGVKATIITTPLNESVFSKAIQRNKQLGIEI  60

Query  252  QI--RLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVA  425
            +I  RL++FPA+E  LPEDC+ +D +P+   LP+FFKA AM+QEPLE+L+ E RPDCLV+
Sbjct  61   EIEIRLIKFPALENDLPEDCERLDLIPTEAHLPNFFKAAAMMQEPLEQLIQECRPDCLVS  120

Query  426  DLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQL  605
            D+F PW TD AAKF+IPR++FHG++Y A+C  +S+R +KPF +VSSDSE F +PNLPH++
Sbjct  121  DMFLPWTTDTAAKFNIPRIVFHGTNYFALCVGDSMRRNKPFKNVSSDSETFVVPNLPHEI  180

Query  606  KLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            KLTR QVSP E+S+ E+  + +LK VRES+  SYG IFNSFYELEPDY
Sbjct  181  KLTRTQVSPFEQSDEESVMSRVLKEVRESDLKSYGVIFNSFYELEPDY  228



>dbj|BAG80550.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=475

 Score =   291 bits (745),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 185/228 (81%), Gaps = 2/228 (1%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            MG LH F FPMMA GHMIPTLDMAKL ASRGVKATIITTP N+ VFSKA+ +  QLG +I
Sbjct  1    MGQLHFFLFPMMAQGHMIPTLDMAKLIASRGVKATIITTPLNESVFSKAIQRNKQLGIEI  60

Query  252  QI--RLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVA  425
            +I  RL++FPA+E  LPEDC+ +D +P+   LP+FFKA AM+QEPLE+L+ E RPDCLV+
Sbjct  61   EIEIRLIKFPALENDLPEDCERLDLIPTEAHLPNFFKAAAMMQEPLEQLIQECRPDCLVS  120

Query  426  DLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQL  605
            D+F PW TD AAKF+IPR++FHG++Y A+C  +S+R +KPF +VSSDSE F +PNLPH++
Sbjct  121  DMFLPWTTDTAAKFNIPRIVFHGTNYFALCVGDSMRRNKPFKNVSSDSETFVVPNLPHEI  180

Query  606  KLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            KLTR QVSP E+S+ E+  + +LK VRES+  SYG IFNSFYELEPDY
Sbjct  181  KLTRTQVSPFEQSDEESVMSRVLKEVRESDLKSYGVIFNSFYELEPDY  228



>ref|XP_009762300.1| PREDICTED: LOW QUALITY PROTEIN: scopoletin glucosyltransferase-like 
[Nicotiana sylvestris]
Length=376

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/226 (61%), Positives = 174/226 (77%), Gaps = 0/226 (0%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            M  LH FFFP+MAHGHMIPTLDMAKL ASRGVKATIITTP N+ VFSKA+ +  Q+G +I
Sbjct  1    MSHLHFFFFPLMAHGHMIPTLDMAKLVASRGVKATIITTPLNESVFSKAIQRSKQVGIEI  60

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             IRL++F AVE GLPE C+ +D +PS + + +F  A  M+Q+P E+LL E RPDCLV+D+
Sbjct  61   DIRLIKFQAVENGLPEGCERIDLIPSDDLINNFSTATTMMQKPFEQLLQERRPDCLVSDM  120

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            F PW +D+A  F+IPRL+FHG+SY A+CA +S+R + PF +VSSDSE F +PNLP+Q+KL
Sbjct  121  FLPWTSDSADXFNIPRLVFHGTSYFALCAADSIRHYMPFKNVSSDSETFAVPNLPNQIKL  180

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR Q+SP +R E E   +  +K VRES    YG +FNSFYELEPDY
Sbjct  181  TRTQLSPFDRIEEEESMSPTIKAVRESGLKGYGIVFNSFYELEPDY  226



>emb|CDP09466.1| unnamed protein product [Coffea canephora]
 emb|CDO97203.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 142/223 (64%), Positives = 177/223 (79%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LHVFFFP  AHGHM+PTLDMAK+F+SRG KAT+ITTP + PVF+KA++K  QLGF I IR
Sbjct  5    LHVFFFPFFAHGHMLPTLDMAKVFSSRGAKATVITTPLHAPVFNKAIEKCKQLGFDISIR  64

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +++FPAVE GLPE  +S D++ S + LP+FF A  +LQEP+E+LL E RP CLVAD FFP
Sbjct  65   VVKFPAVEAGLPEGTESADQLISDDMLPNFFLATRLLQEPVEQLLQECRPHCLVADFFFP  124

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD+AAK+ IPRL+FHGSS  A+ A+ S+  +KP+ +VSSD E F IP+LPH + +TR 
Sbjct  125  WATDSAAKYGIPRLLFHGSSSFAMSASESVWRNKPYRNVSSDDEPFVIPDLPHDIYITRG  184

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            QVS  ER E+E  FT+I+K+VRESE  SYG I NSFYELEPDY
Sbjct  185  QVSTYERQEVENEFTKIMKQVRESELRSYGVIVNSFYELEPDY  227



>emb|CAA59450.1| twi1 [Solanum lycopersicum]
Length=466

 Score =   275 bits (704),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 172/222 (77%), Gaps = 0/222 (0%)
 Frame = +3

Query  84   HVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIRL  263
            H FFFP  A GHMIPTLDMA + A RGVKATIITTP N+ VFSKA+++   LG +I IRL
Sbjct  1    HFFFFPDDAQGHMIPTLDMANVVACRGVKATIITTPLNESVFSKAIERNKHLGIEIDIRL  60

Query  264  LEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFPW  443
            L+FPA E  LPEDC+ +D VPS + LP+F KA AM+++  E L+ E RPDCLV+D+F PW
Sbjct  61   LKFPAKENDLPEDCERLDLVPSDDKLPNFLKAAAMMKDEFEELIGECRPDCLVSDMFLPW  120

Query  444  ATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRLQ  623
             TD+AAKF IPR++FHG+SY A+C  +++R +KPF +VSSD+E F +P+LPH+++LTR Q
Sbjct  121  TTDSAAKFSIPRIVFHGTSYFALCVGDTIRRNKPFKNVSSDTETFVVPDLPHEIRLTRTQ  180

Query  624  VSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            +SP E+S+ ET    ++K VRES+  SYG IFNSFYELE DY
Sbjct  181  LSPFEQSDEETGMAPMIKAVRESDAKSYGVIFNSFYELESDY  222



>ref|XP_009772759.1| PREDICTED: scopoletin glucosyltransferase-like [Nicotiana sylvestris]
Length=479

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 172/226 (76%), Gaps = 0/226 (0%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            M  LH FFFPMMAHGHMIPTLDMAKL A RGVKATIITTP N+ VFSKA+ +   LG +I
Sbjct  1    MSQLHFFFFPMMAHGHMIPTLDMAKLVALRGVKATIITTPLNESVFSKAIQRNKNLGIEI  60

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             IRL++F AVE GL E+C+ +D +PS + L +FFKA  M+QEPLE L+ E RP+CLV+D+
Sbjct  61   DIRLIKFQAVEHGLHEECERLDLIPSDDLLLNFFKATVMMQEPLEHLIQECRPNCLVSDI  120

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPW  D AAKF+IPRL  HG+S+ A+CA  S+R HKPF +V+SDSE F +PNLPHQ+KL
Sbjct  121  FFPWTIDTAAKFNIPRLAIHGTSFFALCAGESIRLHKPFMNVASDSESFVVPNLPHQIKL  180

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            T+ Q+SP +R E E     ++K VRES    YG IFNSFYELE DY
Sbjct  181  TKSQLSPFDRIEEEKNIPLMVKTVRESGLKGYGVIFNSFYELEQDY  226



>ref|XP_009787720.1| PREDICTED: scopoletin glucosyltransferase-like [Nicotiana sylvestris]
Length=483

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/226 (62%), Positives = 178/226 (79%), Gaps = 1/226 (0%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            MG LH FFFP MAHGHMIPTLDMAKL ASRGVKATI+TTP N+ VFSK++ +   LG +I
Sbjct  1    MGQLHFFFFPFMAHGHMIPTLDMAKLVASRGVKATIVTTPLNKSVFSKSIQRNKHLGLEI  60

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             IRL+ F AVE GLPE C+ +D VPS +   +F KA AM+QE LE+L+ E RP+CLV+D+
Sbjct  61   DIRLITFQAVENGLPEGCERLDLVPSQDLFFNFLKATAMMQETLEQLIEECRPNCLVSDM  120

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
             FPW TD+AAKF+IPRL+F+G+SY ++C  +S R +KPF +VSSDSE F +PNLPHQ+KL
Sbjct  121  LFPWTTDSAAKFNIPRLVFYGTSYFSLCPGDSNRLNKPFKNVSSDSETFVVPNLPHQIKL  180

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR Q+SP+++S+ E+  + ++K VRES+  SY  IFNSFYELE DY
Sbjct  181  TRTQLSPLDQSDEESVMSMMMKLVRESDLKSYRVIFNSFYELE-DY  225



>dbj|BAF49308.1| putative glycosyltransferase [Eustoma grandiflorum]
Length=482

 Score =   273 bits (697),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 176/226 (78%), Gaps = 0/226 (0%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            MG LH+FFFP +AHGHM+PT+DMAKLF+SRGVKAT+ITTP + P+F+KA++    LGF I
Sbjct  1    MGQLHIFFFPFLAHGHMLPTIDMAKLFSSRGVKATLITTPYHNPMFTKAIESTRNLGFDI  60

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             +RL++FP++EVGLPE  +S D++ S +  P F   C +LQEPLE+LL E RP  LVAD+
Sbjct  61   SVRLIKFPSIEVGLPEGIESSDQISSEDLRPKFLDGCNLLQEPLEQLLQEYRPHALVADM  120

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FF WA D+AAKF IPRL+FHGSSY A+ AT+S++ HKP+ ++SSDS++F +P+LPH++KL
Sbjct  121  FFYWANDSAAKFGIPRLLFHGSSYFAMSATDSIKRHKPYQNLSSDSDIFVVPDLPHEIKL  180

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR Q+S  ER  IET  T+  K + +SE   YG + NSFYELEPDY
Sbjct  181  TRGQISVEEREGIETEMTKFWKLILDSESKCYGVVMNSFYELEPDY  226



>ref|XP_006346390.1| PREDICTED: scopoletin glucosyltransferase-like [Solanum tuberosum]
Length=467

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 176/223 (79%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFPMMAHGH+IPTLDMAKLF SRG KATIITTP N P+F ++++K   LG +I ++
Sbjct  6    LHIFFFPMMAHGHIIPTLDMAKLFVSRGAKATIITTPLNLPIFIQSIEKIKHLGLEIYVK  65

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             + FPAVE GLPE C+ +D++ S + +P FFKA  MLQE LE LL E +P+ LVAD+FFP
Sbjct  66   AIRFPAVEAGLPEGCERMDQLNSYDLVPKFFKATTMLQEQLELLLHECQPNALVADMFFP  125

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WAT++AAKF IPRL+FHG  + A+CA+ +LR +KP  +V SD+E F +PNLPH++KLTR+
Sbjct  126  WATESAAKFHIPRLVFHGMGFFALCASENLRHYKPQKNVCSDTEPFVLPNLPHKVKLTRM  185

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            +++P +R   ET  T+ +++V+ESE TS+G I NSFYELEPDY
Sbjct  186  KLAPYDRE--ETEMTKFIEQVKESESTSFGVIVNSFYELEPDY  226



>ref|XP_006346389.1| PREDICTED: scopoletin glucosyltransferase-like [Solanum tuberosum]
Length=507

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 169/227 (74%), Gaps = 0/227 (0%)
 Frame = +3

Query  69   AMGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQ  248
             M   H FFFP+MA GHMIPTLDMAKL ASRGVKATIITTP N+ VFS ++ +   LG +
Sbjct  27   GMSRFHFFFFPLMAQGHMIPTLDMAKLVASRGVKATIITTPLNESVFSDSIQRNKHLGIE  86

Query  249  IQIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVAD  428
            I IRL+ F AVE  LPE C+ +D VPS E   +FFKA AM+QEP E L+ E RPDC+V+D
Sbjct  87   IDIRLITFQAVENDLPEGCERLDLVPSPELFKNFFKATAMMQEPFENLVKECRPDCIVSD  146

Query  429  LFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLK  608
            + FPW+TD+AAKF+IPR++FHG+ + A+C   S++ +KPF +VSSDSE F +PNLPHQ++
Sbjct  147  MLFPWSTDSAAKFNIPRIVFHGTGFFALCVAESIKRNKPFKNVSSDSETFVVPNLPHQIR  206

Query  609  LTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            LT  Q+SP +  E E    +I   VRE++  SYG IFNSFYELEPDY
Sbjct  207  LTTTQLSPFDLGEEEAIIFQIFHEVREADLKSYGVIFNSFYELEPDY  253



>ref|XP_004230756.2| PREDICTED: scopoletin glucosyltransferase-like [Solanum lycopersicum]
Length=514

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 169/226 (75%), Gaps = 0/226 (0%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            M  LH FFFPMMA GHMIPTLDMAKL A RGVKATIITTP N+ VFS ++++   LG +I
Sbjct  1    MSPLHFFFFPMMAQGHMIPTLDMAKLVALRGVKATIITTPLNESVFSDSIERNKHLGIEI  60

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             IRL+ F AVE  LPE C+ +D VPS     +FFKA AM+QEP E L+ E RPDC+V+D+
Sbjct  61   DIRLITFQAVENDLPEGCERLDLVPSPVLFNNFFKATAMMQEPFENLVKECRPDCIVSDM  120

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
             +PW+TD+AAKF+IPR++FHG+ + A+C   S++ +KPF +VS+DSE F +PNLPHQ++L
Sbjct  121  LYPWSTDSAAKFNIPRIVFHGTGFFALCVAESIKRNKPFKNVSTDSETFVVPNLPHQIRL  180

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR Q+SP +  E E    +I   VRE++  SYG IFNSFYELE DY
Sbjct  181  TRTQLSPFDLEEKEAIIFQIFHEVREADSKSYGVIFNSFYELETDY  226



>ref|XP_009600997.1| PREDICTED: scopoletin glucosyltransferase-like [Nicotiana tomentosiformis]
Length=539

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 172/226 (76%), Gaps = 0/226 (0%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            M   H FFFP+MAHGHMIPTLDMAKL ASRGVKATIITTP N+ VFS ++ +  Q+G +I
Sbjct  1    MSHRHFFFFPLMAHGHMIPTLDMAKLVASRGVKATIITTPLNESVFSNSIQRSKQVGIEI  60

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             IRL++F AVE GLPE C+ +D +PS + L +F  A  M+QEP E+LL E RP+CLV+D+
Sbjct  61   DIRLIKFQAVENGLPEGCERLDLIPSDDLLNNFSTATTMMQEPFEQLLQECRPNCLVSDM  120

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            F PW  D+A KF+IPRL+FHG+SY A+C  +S+R + PF +VSSDSE F +PNLP+Q+KL
Sbjct  121  FLPWTADSADKFNIPRLVFHGTSYFALCVADSIRHYTPFKNVSSDSETFAVPNLPNQIKL  180

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR Q+SP +R E E   + ++K +R+S    +G +FNSFYELEPDY
Sbjct  181  TRTQLSPFDRIEEEESMSPVIKALRDSGLKGHGIVFNSFYELEPDY  226



>dbj|BAF49309.1| putative glycosyltransferase [Eustoma grandiflorum]
Length=481

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 172/226 (76%), Gaps = 0/226 (0%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            MG LH+FFFP +A GHM+PT+DMAKLF+SRGVKAT+ITTP + P+F+KA++    LGF I
Sbjct  1    MGQLHIFFFPFLAQGHMLPTIDMAKLFSSRGVKATLITTPYHNPMFTKAIESTRNLGFDI  60

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             +RL++FP  E GLPE  +S D++ S +  P F K C +LQ PLE+LL E  P  LVAD+
Sbjct  61   SVRLIKFPYAEAGLPEGIESTDQITSDDLRPXFLKGCNLLQXPLEQLLQEFHPHALVADV  120

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FF WA D+AAKF IPRL+FHGSS  A+ AT+S+R HKP+ ++SSDS++F +P+LPH++KL
Sbjct  121  FFYWANDSAAKFGIPRLLFHGSSSFAMSATDSVRRHKPYQNLSSDSDIFVVPDLPHEIKL  180

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            +R Q+S  +R  IE   T++ ++V +SE  SYG + NSFYELEPDY
Sbjct  181  SRGQISVEQREGIENEMTKLWEKVIDSERKSYGVVVNSFYELEPDY  226



>ref|XP_004230760.1| PREDICTED: scopoletin glucosyltransferase-like [Solanum lycopersicum]
Length=466

 Score =   261 bits (668),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 173/223 (78%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP+MAHGH+IPTLDMAKLF S G KATIITTP N P+F ++ +K   LG +I ++
Sbjct  6    LHIFFFPLMAHGHIIPTLDMAKLFVSHGAKATIITTPLNLPIFVQSSEKIKHLGLEIYVK  65

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             + FPAVE GLPE C+ +D++ S + +P FFKA  MLQ+ LE LL E +P+ LVAD+FFP
Sbjct  66   AIRFPAVEAGLPEGCERMDQLTSDDLVPKFFKATTMLQQQLELLLHECQPNALVADMFFP  125

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WAT++AAKFDIPRL+FHG  + A+CA  +LR +KP  +V SD+E F +PNLPH++KLTR+
Sbjct  126  WATESAAKFDIPRLVFHGMGFFALCALENLRHYKPQKNVCSDTEPFVVPNLPHKVKLTRM  185

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            +++P +R E E   T+ +++V+ SE TS+G I NSFYELEPDY
Sbjct  186  KLAPYDREETE--MTKFIEQVKGSEFTSFGVIVNSFYELEPDY  226



>dbj|BAO51837.1| UDP-glycosyltransferase 73A17 [Camellia sinensis]
Length=473

 Score =   259 bits (662),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 136/226 (60%), Positives = 170/226 (75%), Gaps = 3/226 (1%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            M  LH FFFP+MA GHMIPTLDMAKLFAS GVKATIITTP N P F++++ +       I
Sbjct  1    MAKLHFFFFPVMAQGHMIPTLDMAKLFASHGVKATIITTPLNAPYFTRSIQRTHH---SI  57

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             +  L+FPAVE GL E C+SVD++PS + LP+F KA  MLQ+PLERLL + RPDCLVAD+
Sbjct  58   SVLTLKFPAVEAGLVEGCESVDQIPSPDMLPNFLKATTMLQDPLERLLQDSRPDCLVADM  117

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPWAT  AAKF+IPRL+FHG+ +  +CA+ +LR + P   VSSD E F +PNLPH++ L
Sbjct  118  FFPWATHVAAKFNIPRLVFHGTGFFTLCASENLRLYMPQASVSSDDEPFLVPNLPHKIML  177

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR Q+   ER + ET  + +LK+V+E+E TSYG I NSFYELEPDY
Sbjct  178  TRSQLPENERCDTETGLSTMLKQVKETELTSYGVIVNSFYELEPDY  223



>ref|XP_011000135.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=483

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 165/227 (73%), Gaps = 4/227 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP MAHGHMIPT+DMAKLFASRGVKATI+TTP N P+ S+ + +   LGF I I+
Sbjct  8    LHIFFFPFMAHGHMIPTIDMAKLFASRGVKATIVTTPLNAPLVSRTIQRSKGLGFDINIK  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPS----TEALPSFFKACAmlqeplerllmelrpDCLVAD  428
             ++FPAVEVGLPE C++ D + S     E   +FF A AMLQ+PLE+LL E  PDCL+AD
Sbjct  68   TIKFPAVEVGLPEGCENADSITSHETQGEMTKNFFMATAMLQQPLEKLLQECHPDCLIAD  127

Query  429  LFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLK  608
            +F PW TDAAAKF IPRL+FHG S  ++C ++ L  +KP+  VSSDSELF +P LP  +K
Sbjct  128  MFLPWTTDAAAKFGIPRLVFHGISCFSLCTSDCLNRYKPYKKVSSDSELFVVPELPGDIK  187

Query  609  LTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             T  Q+    +  +ET FT ++++VRES   SYG + NSFYELE DY
Sbjct  188  FTSKQLPDYMKQNVETDFTRLIQKVRESSLKSYGIVVNSFYELESDY  234



>dbj|BAD29722.1| UDP-glucose glucosyltransferase [Catharanthus roseus]
Length=487

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 171/227 (75%), Gaps = 1/227 (0%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            +  LH+F FP MA GHM+P LDMA LF SRGVK T+ITT  + P+F+K++++    GF I
Sbjct  2    VNQLHIFNFPFMAQGHMLPALDMANLFTSRGVKVTLITTHQHVPMFTKSIERSRNSGFDI  61

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPST-EALPSFFKACAmlqeplerllmelrpDCLVAD  428
             I+ ++FPA EVGLPE  +S+D+V    E LP F +   +LQ+PLE+LL E RP CL++D
Sbjct  62   SIQSIKFPASEVGLPEGIESLDQVSGDDEMLPKFMRGVNLLQQPLEQLLQESRPHCLLSD  121

Query  429  LFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLK  608
            +FFPW T++AAKF IPRL+FHGS   A+ A  S+R +KPF +VS+D+E F +P+LPHQ+K
Sbjct  122  MFFPWTTESAAKFGIPRLLFHGSCSFALSAAESVRRNKPFENVSTDTEEFVVPDLPHQIK  181

Query  609  LTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            LTR Q+S  ER  IE+ FT++LK+VR+SE TSYG + NSFYELEPDY
Sbjct  182  LTRTQISTYERENIESDFTKMLKKVRDSESTSYGVVVNSFYELEPDY  228



>ref|XP_002298733.1| hypothetical protein POPTR_0001s31130g [Populus trichocarpa]
 gb|EEE83538.1| hypothetical protein POPTR_0001s31130g [Populus trichocarpa]
Length=483

 Score =   252 bits (644),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 163/227 (72%), Gaps = 4/227 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            +H+FFFP MAHGHMIPT+DMAKLFASRGVKATI+TTP N P+ S+ + +   LGF I I+
Sbjct  8    VHIFFFPFMAHGHMIPTIDMAKLFASRGVKATIVTTPLNAPLVSRTIQRSKGLGFDINIK  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPS----TEALPSFFKACAmlqeplerllmelrpDCLVAD  428
             ++FPAVEVGLPE C++ D + S     E     F A AMLQ+PLE+LL E  PDCL+AD
Sbjct  68   TIKFPAVEVGLPEGCENADSITSHETQGEMTKKLFMATAMLQQPLEKLLQECHPDCLIAD  127

Query  429  LFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLK  608
            +F PW TDAAAKF IPRL+FHG S  ++C ++ L  +KP+  VSSDSELF +P LP  +K
Sbjct  128  MFLPWTTDAAAKFGIPRLVFHGISCFSLCTSDCLNRYKPYKKVSSDSELFVVPELPGDIK  187

Query  609  LTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             T  Q+    +  +ET FT ++++VRES   SYG + NSFYELE DY
Sbjct  188  FTSKQLPDYMKQNVETDFTRLIQKVRESSLKSYGIVVNSFYELESDY  234



>ref|XP_006369760.1| hypothetical protein POPTR_0001s31090g [Populus trichocarpa]
 gb|ERP66329.1| hypothetical protein POPTR_0001s31090g [Populus trichocarpa]
Length=483

 Score =   252 bits (643),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 163/227 (72%), Gaps = 4/227 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            +H+FFFP MAHGHMIPT+DMAKLFASRGVKATI+TTP N P+ S+ + +   LGF I I+
Sbjct  8    VHIFFFPFMAHGHMIPTIDMAKLFASRGVKATIVTTPLNAPLVSRTIQRSKGLGFDINIK  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPS----TEALPSFFKACAmlqeplerllmelrpDCLVAD  428
             ++FPAVEVGLPE C++ D + S     E     F A  MLQ+PLE+LL E  PDCL+AD
Sbjct  68   TIKFPAVEVGLPEGCENADSITSHETQGEMTKKVFMATTMLQQPLEKLLQECHPDCLIAD  127

Query  429  LFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLK  608
            +F PW TDAAAKF IPRL+FHG S  ++CA++ L  +KP+  VSSDSELF +P LP  +K
Sbjct  128  MFLPWTTDAAAKFGIPRLVFHGISCFSLCASDCLNRYKPYKKVSSDSELFVVPELPGDIK  187

Query  609  LTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             T  Q+    +  +ET FT ++++VRES   SYG + NSFYELE DY
Sbjct  188  FTSKQLPDYMKQNVETDFTRLIQKVRESSLKSYGIVVNSFYELESDY  234



>ref|XP_007042481.1| UDP-glycosyltransferase 73B4, putative [Theobroma cacao]
 gb|EOX98312.1| UDP-glycosyltransferase 73B4, putative [Theobroma cacao]
Length=485

 Score =   250 bits (638),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 170/228 (75%), Gaps = 5/228 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            +H+FFFP+MAHGHMIPT+DMAK+FA+RGVK TI+TTP N   F+K +++  + G  I I+
Sbjct  8    VHMFFFPLMAHGHMIPTVDMAKVFATRGVKTTIVTTPLNASFFTKTIERSKESGIDIGIK  67

Query  261  LLEFPAVEVGLPEDCQSVDKVP-----STEALPSFFKACAmlqeplerllmelrpDCLVA  425
            +L+FPAVE GLPE C++ D +P     S + L  FFKA  MLQEPLE+LL E +PDCLVA
Sbjct  68   ILKFPAVEAGLPEGCENADLIPTSQDESGDMLGKFFKATFMLQEPLEQLLQECKPDCLVA  127

Query  426  DLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQL  605
            D+FFPWATDAA KF IPRL+FHG+S+ ++CA+ S+R ++P   V SDSE F +PNLP  +
Sbjct  128  DMFFPWATDAANKFGIPRLVFHGTSFFSLCASESMRLYEPHKKVQSDSEPFVVPNLPGDI  187

Query  606  KLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            KLT+ Q+    + + ET FT+++K  +ESE  SYG + NSFYELE  Y
Sbjct  188  KLTKKQLPDYMKQDAETDFTKMVKASKESELRSYGVVVNSFYELEDTY  235



>ref|XP_006379195.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
 gb|ERP56992.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
Length=486

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 162/228 (71%), Gaps = 5/228 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP +AHGHMIPT+DMAKLFASRGVK TIITTP N P+FSK + K   LGF I I+
Sbjct  8    LHIFFFPFLAHGHMIPTVDMAKLFASRGVKTTIITTPLNAPLFSKTIQKTKDLGFDIDIQ  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPST-----EALPSFFKACAmlqeplerllmelrpDCLVA  425
             ++FPA E GLPE C++ D   +T     E    FF A   LQEP E++L E  PDC+VA
Sbjct  68   TIKFPAAEAGLPEGCENTDAFITTNENAGEMTKKFFIATTFLQEPFEKVLQERHPDCVVA  127

Query  426  DLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQL  605
            D+FFPWATDAAAKF IPRL+FHG+S  A+ A  S+R ++P   VSSD E F +PNLP  +
Sbjct  128  DMFFPWATDAAAKFGIPRLVFHGTSNFALSAGESVRLYEPHKKVSSDYEPFVVPNLPGDI  187

Query  606  KLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            KLTR Q+    R  ++  FT+++K  +ESE  S+G IFNSFYELEP Y
Sbjct  188  KLTRKQLPDFIRENVQNDFTKLVKASKESELRSFGVIFNSFYELEPAY  235



>ref|XP_008236558.1| PREDICTED: scopoletin glucosyltransferase-like [Prunus mume]
Length=485

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 169/227 (74%), Gaps = 3/227 (1%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAV--DKYTQLGFQI  251
            D HVF FP MAHGHMIP  DMAKLFA++GVK TIITTP N P FSKA+   K    G +I
Sbjct  7    DFHVFLFPFMAHGHMIPVSDMAKLFAAQGVKTTIITTPLNAPTFSKAIRSSKTNSGGIEI  66

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALP-SFFKACAmlqeplerllmelrpDCLVAD  428
            +I+ ++FP+ E GLPE C+++D +P T  L  SFFKA  +LQEPLERLL+E +P CLVAD
Sbjct  67   EIKTIKFPSQEAGLPEGCENLDSLPPTPVLADSFFKAAGLLQEPLERLLLEDQPTCLVAD  126

Query  429  LFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLK  608
            +FFPWATDAAAKF IPRL+FHG+S+ A+ A++ +R ++PF + SSDSE F IP+LP ++K
Sbjct  127  MFFPWATDAAAKFGIPRLVFHGTSFFALAASDCVRRYEPFKNTSSDSEPFVIPDLPGEIK  186

Query  609  LTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            +TR QV    +  IE   T +LK+ +E+E  SYG + NSFYELEP Y
Sbjct  187  MTRAQVPSFIKDNIENDLTRLLKQSKEAEVRSYGIVVNSFYELEPVY  233



>ref|XP_007200988.1| hypothetical protein PRUPE_ppa004924mg [Prunus persica]
 gb|EMJ02187.1| hypothetical protein PRUPE_ppa004924mg [Prunus persica]
Length=485

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 169/227 (74%), Gaps = 3/227 (1%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAV--DKYTQLGFQI  251
            D HVF FP MAHGHMIP  DMAKLFA++GVK TIITTP N P FSKA    K    G +I
Sbjct  7    DFHVFLFPFMAHGHMIPVSDMAKLFAAQGVKTTIITTPLNAPTFSKATRSSKTNSGGIEI  66

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALP-SFFKACAmlqeplerllmelrpDCLVAD  428
            +I+ ++FP+ E GLPE C+++D +P T  L  SFFKA  +LQEPLERLL+E +P CLVAD
Sbjct  67   EIKTIKFPSQEAGLPEGCENLDSLPPTPVLADSFFKAAGLLQEPLERLLLEDQPTCLVAD  126

Query  429  LFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLK  608
            +FFPWATDAAAKF IPRL+FHG+S+ A+ A++ +R ++PF ++SSDSE F IP+LP ++K
Sbjct  127  MFFPWATDAAAKFGIPRLVFHGTSFFALAASDCVRRYEPFKNISSDSEPFVIPDLPGEIK  186

Query  609  LTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            +TR QV    +  IE   T +LK+ +E+E  SYG + NSFYELEP Y
Sbjct  187  MTRAQVPGFIKDNIENDLTRLLKQSKEAEVRSYGIVVNSFYELEPVY  233



>gb|AFK79039.1| glycosyltransferase UGT7 [Bupleurum chinense]
Length=474

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 164/226 (73%), Gaps = 1/226 (0%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            M +L VFFFP MA GHMIP LDMAKLFASRGV +TIITTP N P F+K V+K    GF +
Sbjct  1    MVELEVFFFPAMAPGHMIPILDMAKLFASRGVHSTIITTPLNAPAFAKGVEKSNDSGFHM  60

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             I+++EFP V  GLPEDC++ D++ S   LP F +A  ML+E +E+LL E RP+CLVAD+
Sbjct  61   SIKIVEFPKVS-GLPEDCENADQITSPAMLPLFIRATMMLEEQVEQLLGEYRPNCLVADM  119

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPWA D+AAKFDIP LIFHG+S+ A CA   +R H+PF ++ ++S+ F IPNLPH++KL
Sbjct  120  FFPWAVDSAAKFDIPTLIFHGTSFFASCANEQVRLHEPFKNLKNESDDFIIPNLPHKVKL  179

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
               Q+ P    E +T F ++L   +ESE  S G I NSFYELEPDY
Sbjct  180  CLGQIPPQHHQEKDTVFAKMLIAAKESEMKSNGVIVNSFYELEPDY  225



>gb|EYU42689.1| hypothetical protein MIMGU_mgv1a018398mg [Erythranthe guttata]
Length=477

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 166/226 (73%), Gaps = 4/226 (2%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            MG LH+FFFPM+AHGHMIP LDMAKLF SRG++ TII+TPA    FS+ + K    G +I
Sbjct  1    MGKLHIFFFPMLAHGHMIPILDMAKLFTSRGLRTTIISTPA----FSQPIKKAQNSGIEI  56

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             I+ +EFP  + GLP+   S+D+V   E +P+F KA ++LQ PLE+LL E RPDCL++D+
Sbjct  57   GIQTIEFPPKDSGLPDHIVSLDQVTDDELIPNFVKALSLLQPPLEKLLQEFRPDCLISDM  116

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            F PW  D+AAKF IPRL+FHG+SY A+ AT  +R HKPF +VSSD E F +PNLPH++KL
Sbjct  117  FLPWTVDSAAKFGIPRLVFHGTSYFALSATEQMRRHKPFENVSSDLEPFIVPNLPHEVKL  176

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             R QV   +  E E+   E++KR++ES+  SYG + N+FYELEPDY
Sbjct  177  VRTQVPEYDLEENESDLIELMKRMKESDGRSYGVVANTFYELEPDY  222



>ref|XP_010066005.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=495

 Score =   248 bits (632),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 162/223 (73%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            L +FFFP MA+GH++PT+DMAKLFASRG+KATIITTP N P+F++ V +  +LG +I ++
Sbjct  16   LRIFFFPFMAYGHILPTIDMAKLFASRGLKATIITTPLNAPIFAQTVQRIQKLGAKIDVK  75

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             + FP+VE GLP  C+S+D V S E    F KA  ML++PLE LL E  PDCLVAD+FFP
Sbjct  76   TVNFPSVEAGLPPGCESLDSVASQEMFLKFIKATEMLKQPLEDLLSEDPPDCLVADMFFP  135

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD A +  +PR++FHG+S+ A+CAT  +R H+P  +V SD + F IPN PH++KLTR 
Sbjct  136  WATDVAQRLGVPRMVFHGTSFFALCATECVRLHEPHKNVPSDLDPFAIPNFPHEIKLTRK  195

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    RS +E  FT   +  +ESE  S+G I NSFYELEPDY
Sbjct  196  QLPEHLRSGVENDFTRFNREAKESEVRSFGVIVNSFYELEPDY  238



>gb|KCW63754.1| hypothetical protein EUGRSUZ_G01414 [Eucalyptus grandis]
Length=498

 Score =   248 bits (632),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 162/223 (73%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            L +FFFP MA+GH++PT+DMAKLFASRG+KATIITTP N P+F++ V +  +LG +I ++
Sbjct  9    LRIFFFPFMAYGHILPTIDMAKLFASRGLKATIITTPLNAPIFAQTVQRIQKLGAKIDVK  68

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             + FP+VE GLP  C+S+D V S E    F KA  ML++PLE LL E  PDCLVAD+FFP
Sbjct  69   TVNFPSVEAGLPPGCESLDSVASQEMFLKFIKATEMLKQPLEDLLSEDPPDCLVADMFFP  128

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD A +  +PR++FHG+S+ A+CAT  +R H+P  +V SD + F IPN PH++KLTR 
Sbjct  129  WATDVAQRLGVPRMVFHGTSFFALCATECVRLHEPHKNVPSDLDPFAIPNFPHEIKLTRK  188

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    RS +E  FT   +  +ESE  S+G I NSFYELEPDY
Sbjct  189  QLPEHLRSGVENDFTRFNREAKESEVRSFGVIVNSFYELEPDY  231



>gb|KDO35868.1| hypothetical protein CISIN_1g041444mg, partial [Citrus sinensis]
Length=367

 Score =   241 bits (616),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 168/227 (74%), Gaps = 4/227 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LHVFFFP MAHGHMIP +DMAKLFA+RGVKA++ITTPAN P  SK+V++  +LG ++ ++
Sbjct  8    LHVFFFPFMAHGHMIPIVDMAKLFATRGVKASVITTPANAPYVSKSVERANELGIELDVK  67

Query  261  LLEFPAVEVGLPEDCQSVDKVP---STEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             ++FP+VE GLP+ C+++D +    + E +  F  A   LQEPLE+LL + +PDCLVAD+
Sbjct  68   TIKFPSVEAGLPDGCENLDAITNEVNKELIVKFLGATTKLQEPLEQLLRDHKPDCLVADI  127

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPWATDAAAKF IPRL+FHG+S+ ++CA+N LR ++P   VSSDSE F +P+ P ++KL
Sbjct  128  FFPWATDAAAKFGIPRLVFHGTSFFSLCASNCLRLYEPHKKVSSDSEPFVMPHFPGEIKL  187

Query  612  TRLQVSPMERSEI-ETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR Q+    + ++ +   + +LK   ESE  SYG   NSFYELEP Y
Sbjct  188  TRNQLPDFVKQDMGDNDLSRLLKATNESESRSYGVAVNSFYELEPAY  234



>gb|KCW64874.1| hypothetical protein EUGRSUZ_G02440 [Eucalyptus grandis]
Length=498

 Score =   244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/223 (54%), Positives = 162/223 (73%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            L +FFFP MA+GH++PT+DMAKLFASRG+KATIITTP N P+F++ + +  +LG +I ++
Sbjct  9    LRIFFFPFMAYGHILPTIDMAKLFASRGLKATIITTPLNAPIFAQTIQRTQKLGAKIDVQ  68

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             + FP+VE GL   C+++D V S E    F KA  ML++PLE LL E  PDCLVAD+FFP
Sbjct  69   TVNFPSVEAGLSPGCENLDLVASQEMFLKFIKATEMLKQPLEELLSEDPPDCLVADMFFP  128

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD A +  +PR++FHG+S+ A+CAT  +R H+P  +V SDS+ F IPN PH++KLTR 
Sbjct  129  WATDVAQRLGVPRMVFHGTSFFALCATECVRLHEPHKNVPSDSDPFAIPNFPHEIKLTRK  188

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    RS +E  FT   +  +ESE  S+G I NSFYELEPDY
Sbjct  189  QLPEHLRSGVENDFTRFNREAKESEVRSFGVIVNSFYELEPDY  231



>ref|XP_010066838.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=505

 Score =   244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/223 (54%), Positives = 162/223 (73%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            L +FFFP MA+GH++PT+DMAKLFASRG+KATIITTP N P+F++ + +  +LG +I ++
Sbjct  16   LRIFFFPFMAYGHILPTIDMAKLFASRGLKATIITTPLNAPIFAQTIQRTQKLGAKIDVQ  75

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             + FP+VE GL   C+++D V S E    F KA  ML++PLE LL E  PDCLVAD+FFP
Sbjct  76   TVNFPSVEAGLSPGCENLDLVASQEMFLKFIKATEMLKQPLEELLSEDPPDCLVADMFFP  135

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD A +  +PR++FHG+S+ A+CAT  +R H+P  +V SDS+ F IPN PH++KLTR 
Sbjct  136  WATDVAQRLGVPRMVFHGTSFFALCATECVRLHEPHKNVPSDSDPFAIPNFPHEIKLTRK  195

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    RS +E  FT   +  +ESE  S+G I NSFYELEPDY
Sbjct  196  QLPEHLRSGVENDFTRFNREAKESEVRSFGVIVNSFYELEPDY  238



>ref|XP_006422969.1| hypothetical protein CICLE_v10028305mg [Citrus clementina]
 gb|ESR36209.1| hypothetical protein CICLE_v10028305mg [Citrus clementina]
Length=490

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 168/227 (74%), Gaps = 4/227 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LHVFFFP MAHGHMIP +DMAKLFA+RGVKA++ITTPAN P  SK+V++  +LG ++ ++
Sbjct  8    LHVFFFPFMAHGHMIPIVDMAKLFATRGVKASVITTPANAPYVSKSVERANELGIELDVK  67

Query  261  LLEFPAVEVGLPEDCQSVDKVP---STEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             ++FP+VE GLP+ C+++D +    + E +  F  A   LQEPLE+LL + +PDCLVAD+
Sbjct  68   TIKFPSVEAGLPDGCENLDAITNEVNKELIVKFLGATTKLQEPLEQLLRDHKPDCLVADI  127

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPWATDAAAKF IPRL+FHG+S+ ++CA+N LR ++P   VSSDSE F +P+ P ++KL
Sbjct  128  FFPWATDAAAKFGIPRLVFHGTSFFSLCASNCLRLYEPHKKVSSDSEPFVMPHFPGEIKL  187

Query  612  TRLQVSPMERSEI-ETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR Q+    + ++ +   + +LK   ESE  SYG   NSFYELEP Y
Sbjct  188  TRNQLPDFVKQDMGDNDLSRLLKATNESESRSYGVAVNSFYELEPAY  234



>ref|XP_004505252.1| PREDICTED: UDP-glucosyl transferase 73B2-like [Cicer arietinum]
 gb|AGU14084.1| UDP-glycosyltransferase [Cicer arietinum]
Length=488

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 173/225 (77%), Gaps = 2/225 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP M HGHMIP++DMAKLFAS+GVKATI+TTP N+P+ +KA++++      I I+
Sbjct  8    LHIFFFPFMGHGHMIPSIDMAKLFASKGVKATIVTTPLNKPLVTKAIEQFKTHSNNIDIQ  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +++FP VE GLPE C++VD +PS   +P+FFKA  +LQEPLE+LL + +P+C+VAD+FFP
Sbjct  68   IIKFPCVEGGLPEGCENVDSIPSPHLIPAFFKATWLLQEPLEQLLQQQKPNCIVADMFFP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W+T +AAKF IPR++FHG+S+ ++CA+  L  ++PF +VSSD+ELF I NLP  +K+T+L
Sbjct  128  WSTASAAKFGIPRIVFHGTSFFSLCASQCLNLYEPFKNVSSDTELFEITNLPGNIKMTKL  187

Query  621  QV-SPMERSEIETPFT-EILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+ S   +++  T  T ++   +RESE  SYG I NSFYELE  Y
Sbjct  188  QLPSIFTQNDTMTQNTAKLFAAIRESEKKSYGVIVNSFYELEHVY  232



>gb|KCW64673.1| hypothetical protein EUGRSUZ_G02259 [Eucalyptus grandis]
Length=498

 Score =   242 bits (618),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/223 (54%), Positives = 162/223 (73%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            L +FFFP MA+GH++PT+DMAKLFASRG+KATIITTP N P+F++ + +  +LG +I ++
Sbjct  9    LRIFFFPFMAYGHILPTIDMAKLFASRGLKATIITTPLNAPIFAQTIQRTQKLGAKIDVK  68

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             ++FP+VE GLP  C+++D V S E L  F KA  ML++PLE LL E  PDCLVAD+FFP
Sbjct  69   TVDFPSVEAGLPPGCENLDSVASQEMLLKFIKATEMLKQPLEDLLSEDPPDCLVADMFFP  128

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD A +  +PR++FHG S+ A+CAT  +  H+P  +V SDS+ F IPN PH++KLTR 
Sbjct  129  WATDVAQRLGVPRMVFHGMSFFALCATACVMLHEPHKNVPSDSDPFAIPNFPHEIKLTRK  188

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+     S +E  FT   +  +ESE  S+G I NSFYELEPDY
Sbjct  189  QLPEHLCSGVENDFTRFNREAKESEVRSFGVIVNSFYELEPDY  231



>ref|XP_010066692.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=505

 Score =   243 bits (619),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/223 (54%), Positives = 162/223 (73%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            L +FFFP MA+GH++PT+DMAKLFASRG+KATIITTP N P+F++ + +  +LG +I ++
Sbjct  16   LRIFFFPFMAYGHILPTIDMAKLFASRGLKATIITTPLNAPIFAQTIQRTQKLGAKIDVK  75

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             ++FP+VE GLP  C+++D V S E L  F KA  ML++PLE LL E  PDCLVAD+FFP
Sbjct  76   TVDFPSVEAGLPPGCENLDSVASQEMLLKFIKATEMLKQPLEDLLSEDPPDCLVADMFFP  135

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD A +  +PR++FHG S+ A+CAT  +  H+P  +V SDS+ F IPN PH++KLTR 
Sbjct  136  WATDVAQRLGVPRMVFHGMSFFALCATACVMLHEPHKNVPSDSDPFAIPNFPHEIKLTRK  195

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+     S +E  FT   +  +ESE  S+G I NSFYELEPDY
Sbjct  196  QLPEHLCSGVENDFTRFNREAKESEVRSFGVIVNSFYELEPDY  238



>gb|KDO36537.1| hypothetical protein CISIN_1g036871mg, partial [Citrus sinensis]
Length=383

 Score =   239 bits (609),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 170/227 (75%), Gaps = 4/227 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LHVFFFP MAHGHMIP +DMAKLFASRGVKA++ITTPAN P  SK+V++  ++G ++ ++
Sbjct  8    LHVFFFPFMAHGHMIPIVDMAKLFASRGVKASVITTPANGPYVSKSVERANEMGIELDVK  67

Query  261  LLEFPAVEVGLPEDCQSVDKVP---STEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             ++FP+VE GLPE C+++D +    + E +  F  A   LQEPLE+LL + +PDCLVAD+
Sbjct  68   TIKFPSVEAGLPEGCENLDAITNEVNKELIVKFVGATTKLQEPLEQLLRDHKPDCLVADI  127

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPWATDAAAKF IPRL+FHG+S+ ++CA+N L  ++P  +VSSDSE F +P+ P ++KL
Sbjct  128  FFPWATDAAAKFGIPRLVFHGTSFFSLCASNCLALYEPHKNVSSDSEPFVMPHFPGEIKL  187

Query  612  TRLQVSPMERSEI-ETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR Q+    + ++ +  F+ +LK + +S+  SYG   NSFYELEP Y
Sbjct  188  TRNQLPDFVKQDMGDNDFSRLLKAIDDSDLRSYGVAVNSFYELEPAY  234



>ref|XP_002313131.2| hypothetical protein POPTR_0009s10190g [Populus trichocarpa]
 gb|EEE87086.2| hypothetical protein POPTR_0009s10190g [Populus trichocarpa]
Length=486

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 161/227 (71%), Gaps = 4/227 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH  FFP MAHGHMIP +DMAKLFASRG+K TI+TTP N P FSK V +   LGF+I IR
Sbjct  8    LHALFFPFMAHGHMIPLVDMAKLFASRGLKTTIVTTPLNVPFFSKTVQRIKNLGFEINIR  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPST----EALPSFFKACAmlqeplerllmelrpDCLVAD  428
             +EF  VE GLPE C++ D + S     + L  FF A  +LQEPLERLL E+ PDCL+AD
Sbjct  68   TIEFSTVETGLPEGCENADLIISQAMGWDMLKKFFVATTILQEPLERLLEEIHPDCLIAD  127

Query  429  LFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLK  608
            +FFPW TDAAAKF IPRL+FHG+S+ ++C   S+R ++P   VSSD E F +PNLP  +K
Sbjct  128  MFFPWTTDAAAKFGIPRLVFHGTSFFSLCVGESMRLYEPHKKVSSDCEPFFMPNLPDDIK  187

Query  609  LTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            LTR ++   ER +  + F ++ K+V+E +  SYG + NSFYELEP Y
Sbjct  188  LTRNELPYPERHDDGSDFNKMYKKVKEGDSKSYGVVVNSFYELEPVY  234



>ref|XP_011000854.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=486

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 162/228 (71%), Gaps = 5/228 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH  FFP MAHGHMIP +DMAKLFASRG+K TI+TTP N P+FSK V +   LGF+I IR
Sbjct  8    LHALFFPFMAHGHMIPLVDMAKLFASRGLKTTIVTTPLNVPLFSKTVQRTKNLGFEINIR  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPST----EALPSFFKACAmlqeplerllmelrpDCLVAD  428
             +EF  VE GLPE C++ D + S     + L  FF A   LQEPLERLL E+ PDCL+AD
Sbjct  68   TIEFSTVETGLPEGCENADLIISQAMGWDMLKKFFAATTFLQEPLERLLEEIHPDCLIAD  127

Query  429  LFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLK  608
            +FFPW TDAAAKF IPRL+FHG+S+ ++C   SLR ++P   VSSD E F +PNLP  +K
Sbjct  128  MFFPWTTDAAAKFGIPRLVFHGTSFFSLCVGQSLRLYEPHKKVSSDCEPFFMPNLPDDIK  187

Query  609  LTRLQVSPMERSEIET-PFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            LTR ++   ER + E+  F ++ K+V+E +  SYG + NSFYELEP Y
Sbjct  188  LTRNELPYPERHDDESDDFNKMYKKVKEGDSKSYGVVVNSFYELEPVY  235



>ref|XP_011000865.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=486

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 161/228 (71%), Gaps = 5/228 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH  FFP MAHGHMIP +DMAKLFASRG+K TI+TTP N P+FSK V +   LGF+I IR
Sbjct  8    LHALFFPFMAHGHMIPLVDMAKLFASRGLKTTIVTTPLNVPLFSKTVQRTKNLGFEINIR  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPST----EALPSFFKACAmlqeplerllmelrpDCLVAD  428
             +EF  VE GLPE C++ D + S     + L  FF A   LQEPLERLL E+ PDCL+AD
Sbjct  68   TIEFSTVETGLPEGCENADLIISQAMGWDMLKKFFAATTFLQEPLERLLEEIHPDCLIAD  127

Query  429  LFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLK  608
            +FFPW TDAAAKF IPRL+FHG+S+ ++C   SLR ++P   VSSD E F +PNLP  +K
Sbjct  128  MFFPWTTDAAAKFGIPRLVFHGTSFFSLCVGQSLRLYEPHKKVSSDCEPFFMPNLPDDIK  187

Query  609  LTRLQVSPMERSEIET-PFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            LTR ++   ER + E+  F ++ K+V E +  SYG + NSFYELEP Y
Sbjct  188  LTRNELPYPERHDDESDDFNKMYKKVNEGDSKSYGVVVNSFYELEPVY  235



>ref|XP_006487030.1| PREDICTED: scopoletin glucosyltransferase-like [Citrus sinensis]
Length=490

 Score =   240 bits (612),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 170/227 (75%), Gaps = 4/227 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LHVFFFP MAHGHMIP +DMAKLFASRGVKA++ITTPAN P  SK+V++  ++G ++ ++
Sbjct  8    LHVFFFPFMAHGHMIPIVDMAKLFASRGVKASVITTPANGPYVSKSVERANEMGIELDVK  67

Query  261  LLEFPAVEVGLPEDCQSVDKVP---STEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             ++FP+VE GLPE C+++D +    + E +  F  A   LQEPLE+LL + +PDCLVAD+
Sbjct  68   TIKFPSVEAGLPEGCENLDAITNEVNKELIVKFVGATTKLQEPLEQLLRDHKPDCLVADI  127

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPWATDAAAKF IPRL+FHG+S+ ++CA+N L  ++P  +VSSDSE F +P+ P ++KL
Sbjct  128  FFPWATDAAAKFGIPRLVFHGTSFFSLCASNCLALYEPHKNVSSDSEPFVMPHFPGEIKL  187

Query  612  TRLQVSPMERSEI-ETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR Q+    + ++ +  F+ +LK + +S+  SYG   NSFYELEP Y
Sbjct  188  TRNQLPDFVKQDMGDNDFSRLLKAIDDSDLRSYGVAVNSFYELEPAY  234



>ref|XP_011013100.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=485

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 158/227 (70%), Gaps = 4/227 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH FFFP +AHGH+IPT+DMAKLFASRGVK TIITTP N P FSK + K   LGF I I+
Sbjct  8    LHFFFFPFLAHGHLIPTVDMAKLFASRGVKTTIITTPLNAPFFSKTIQKTKDLGFDIDIQ  67

Query  261  LLEFPAVEVGLPEDCQSVD----KVPSTEALPSFFKACAmlqeplerllmelrpDCLVAD  428
             ++FPA E GLPE C++ D       + E    FF A   LQEP E++L E  PDC+VAD
Sbjct  68   TIKFPAAEAGLPEGCENTDAFITNENAGEMTKKFFIATTFLQEPFEKVLQERHPDCVVAD  127

Query  429  LFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLK  608
            +FFPWATDAAAKF IPRL+FHG+S  A+ A   +R ++P  +VSSD E F +PNLP  +K
Sbjct  128  MFFPWATDAAAKFGIPRLVFHGTSNFALSAGECVRLYEPHKNVSSDYEPFVVPNLPGDIK  187

Query  609  LTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            LTR Q+    R  ++  FT+++K  +ESE  S+G + NSFYELEP Y
Sbjct  188  LTRKQLPDFIRENVQNDFTKLVKASKESELRSFGVVVNSFYELEPAY  234



>ref|XP_008354700.1| PREDICTED: scopoletin glucosyltransferase-like [Malus domestica]
Length=481

 Score =   239 bits (610),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 161/226 (71%), Gaps = 2/226 (1%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVD--KYTQLGFQI  251
            D H+ FFP MAHGHMIP  DMAKLFAS+GVK TI+TTP N P FS A    K    G ++
Sbjct  7    DFHICFFPYMAHGHMIPISDMAKLFASQGVKTTIVTTPLNAPTFSXATQSSKTYSGGXEV  66

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
            +I+ ++FP+VE GLPE C+++D +PS E   +F KA + LQEPLE+LL E  P CLVAD+
Sbjct  67   KIKTIKFPSVEAGLPEGCENLDSLPSPELSTNFLKATSFLQEPLEQLLFEENPSCLVADV  126

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
             FPWATDAAAKFDIPRLIFHG+ + A+ A++ +R ++PF +  SDS+LF IP+ P ++ +
Sbjct  127  LFPWATDAAAKFDIPRLIFHGTGFFAMAASHVVRKYEPFKNTLSDSDLFVIPDFPGEITM  186

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR QV       IE   T +LKR +E+E TSYG + NSFYELE  Y
Sbjct  187  TRAQVPDHVXENIENDLTRMLKRAKEAEKTSYGIVVNSFYELESVY  232



>ref|XP_007200989.1| hypothetical protein PRUPE_ppa004972mg [Prunus persica]
 gb|EMJ02188.1| hypothetical protein PRUPE_ppa004972mg [Prunus persica]
Length=483

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 166/226 (73%), Gaps = 2/226 (1%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAV--DKYTQLGFQI  251
            + H+F  P MA+GHMIP  DMAKLFA++GVK TIITTP N P FSKA    K      ++
Sbjct  7    EFHIFLLPFMAYGHMIPVSDMAKLFAAQGVKTTIITTPLNAPTFSKATRSSKTNSGRIEV  66

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
            QI+ ++FP+ E GLPE C+++D +P+ E   +F KA  +LQEPLERLL+E +P CLVAD+
Sbjct  67   QIKTIKFPSQEAGLPEGCENLDSLPTPEFANNFSKALGLLQEPLERLLLEDQPSCLVADM  126

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPWATDAAAKF IPRL+FHG+S+  + A++ +R ++PF ++SSDSE F IPNLP ++K+
Sbjct  127  FFPWATDAAAKFGIPRLLFHGTSFFTLAASDCVRRYQPFKNMSSDSEPFVIPNLPGEIKM  186

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR QV    +  IE  FT+++K+  +SE  SYG + NSFYELEP Y
Sbjct  187  TRAQVPDFLKENIENDFTQLMKQAHDSEVGSYGTVVNSFYELEPVY  232



>ref|XP_008454970.1| PREDICTED: scopoletin glucosyltransferase-like [Cucumis melo]
Length=478

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 158/223 (71%), Gaps = 1/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+F FP MAHGHMIP +DMAKLFASRG+K TI+TTP N   FSK++  Y+     IQ+ 
Sbjct  8    LHIFMFPFMAHGHMIPMVDMAKLFASRGIKITIVTTPLNSISFSKSLHNYSADSL-IQLL  66

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +L+FP+ E GLPE C++ D +PS + LP+FF+A ++LQ P E  L   RPDCL++D+FFP
Sbjct  67   ILKFPSAEAGLPEGCENADSIPSMDFLPNFFRAVSLLQPPFEEALQNNRPDCLISDMFFP  126

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W  D A +  IPRLIFHG+S  ++CA+  +R H+P+ HVSSD+E F IP LP  +KLT++
Sbjct  127  WTNDVADRIGIPRLIFHGTSCFSLCASEFMRLHEPYKHVSSDTEPFPIPYLPGDIKLTKM  186

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            ++    R   E  F++ + +V+ESE   YG + NSFYELE +Y
Sbjct  187  KLPIFVRENTENEFSKFITKVKESESCCYGVVVNSFYELEAEY  229



>ref|XP_007200278.1| hypothetical protein PRUPE_ppa014816mg [Prunus persica]
 gb|EMJ01477.1| hypothetical protein PRUPE_ppa014816mg [Prunus persica]
Length=485

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 164/228 (72%), Gaps = 4/228 (2%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAV----DKYTQLGF  245
            +LHVF FP MAHGHMIP  DMAKLFA++GVK TIIT   N P FSKA+          G 
Sbjct  7    ELHVFLFPFMAHGHMIPVSDMAKLFAAQGVKTTIITNTLNAPTFSKAIRSRKTNSCGCGI  66

Query  246  QIQIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVA  425
            +I+I+ ++FP+ E GLPE C+++D +P+ E   +FFKA  +LQ PLE+LL+E +P CLVA
Sbjct  67   EIEIKTIKFPSQEAGLPEGCENLDSLPTPELAGNFFKAMGLLQAPLEQLLLEDQPTCLVA  126

Query  426  DLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQL  605
            D+FFPWATDAAAKF IPRL+FHG+S+ A+ A++ +  ++PF + SSDSE F IPNLP  +
Sbjct  127  DMFFPWATDAAAKFGIPRLVFHGTSFFALAASDCVWRYEPFKNTSSDSEPFVIPNLPGLI  186

Query  606  KLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            ++TR QV    +  IE   + +LK+ +E+E  SYG + NSFYELEP Y
Sbjct  187  RMTRAQVPDFIKDNIENDLSRLLKQSKEAEVRSYGIVVNSFYELEPVY  234



>gb|KDP25001.1| hypothetical protein JCGZ_23984 [Jatropha curcas]
Length=471

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 161/220 (73%), Gaps = 5/220 (2%)
 Frame = +3

Query  105  MAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIRLLEFPAVE  284
            MAHGHMIPT+DMAKLFA RG KATIITTP+N+P+ SK + +   +GF I I++L+FP+VE
Sbjct  1    MAHGHMIPTVDMAKLFAFRGHKATIITTPSNEPLISKTIQRTKDMGFDINIQILKFPSVE  60

Query  285  VGLPEDCQSVDKVPS-----TEALPSFFKACAmlqeplerllmelrpDCLVADLFFPWAT  449
            VGLPE C ++D V S      E +  F+ A   LQEPLE+LL E  P+CLVAD+FFPW T
Sbjct  61   VGLPEGCDNIDFVLSLVENGMEMIIKFWLATGKLQEPLEKLLQECNPNCLVADMFFPWTT  120

Query  450  DAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRLQVS  629
            DAAAKF IPRL+FHG+S+ ++CA  S+R ++P   VS+DSE F IP LP ++K+TR Q+ 
Sbjct  121  DAAAKFGIPRLVFHGTSFFSLCAGESIRLYQPHKKVSTDSESFVIPGLPGEIKITRKQLP  180

Query  630  PMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
               R E++  FT+I+K  +ESE  S+G + NSFYELE  Y
Sbjct  181  SFVREEVQNDFTKIVKESKESELKSFGVVVNSFYELEQAY  220



>ref|XP_006487031.1| PREDICTED: scopoletin glucosyltransferase-like [Citrus sinensis]
 gb|KDO59781.1| hypothetical protein CISIN_1g010093mg [Citrus sinensis]
Length=518

 Score =   238 bits (606),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 168/227 (74%), Gaps = 4/227 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LHVFFFP MAHGHMIP +DMAKLFA+RGVKA++ITTPAN P  SK+V++  +LG ++ ++
Sbjct  36   LHVFFFPFMAHGHMIPIVDMAKLFATRGVKASVITTPANAPYVSKSVERANELGIEMDVK  95

Query  261  LLEFPAVEVGLPEDCQSVDKVP---STEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             ++FP+VE GLPE C+++D +    +   +  FF A   LQEPLE+LL E +PDCLVAD 
Sbjct  96   TIKFPSVEAGLPEGCENLDAITNEVNKGLIVKFFGATMKLQEPLEQLLQEHKPDCLVADT  155

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPWATDAAAKF IPRL+FHG+S+ ++CA+N L  ++P   VSSDSE F +P+ P ++KL
Sbjct  156  FFPWATDAAAKFGIPRLVFHGTSFFSLCASNCLALYEPHKKVSSDSEPFVMPHFPGEIKL  215

Query  612  TRLQVSPMERSEI-ETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR Q+    + ++ +  F+ +LK + +S+  SYG   NSFYELEP Y
Sbjct  216  TRNQLPDFVKQDMGDNDFSRLLKAIDDSDLRSYGVAVNSFYELEPAY  262



>ref|XP_011000877.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=485

 Score =   237 bits (604),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 157/227 (69%), Gaps = 4/227 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH FFFP +AHGHMIP++DMAKLFASRGVK TIITTP N P FSK + K   LGF I I+
Sbjct  8    LHFFFFPFLAHGHMIPSVDMAKLFASRGVKTTIITTPLNAPFFSKTIQKTKDLGFDIDIQ  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTE----ALPSFFKACAmlqeplerllmelrpDCLVAD  428
             ++FP  E GLPE C++ D   + E        FF A  +LQEP E++L E  PDC+VAD
Sbjct  68   TIKFPTAEAGLPEGCENTDAFITNENAGEMTKKFFIAITLLQEPFEKVLQERHPDCVVAD  127

Query  429  LFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLK  608
            +FFPWATDAAAKF IPRL+FHG+S  A+ A + +R ++P   VSSD E F +PNLP  +K
Sbjct  128  MFFPWATDAAAKFGIPRLVFHGTSNFALSAGDCVRLYEPHKKVSSDYEPFVVPNLPGDIK  187

Query  609  LTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            LTR Q+    R  ++  FT+ +K  +ESE  S+G + NSFYELEP Y
Sbjct  188  LTRKQLPDFIRENVQNHFTKFVKAYKESELRSFGVVVNSFYELEPAY  234



>gb|AAS55083.1| UDP-glucose glucosyltransferase [Rhodiola sachalinensis]
Length=480

 Score =   236 bits (603),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 118/225 (52%), Positives = 164/225 (73%), Gaps = 3/225 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            L +FFFP MAHGHMIP +DMA+LFAS+GV+ TI+TTP NQP+ ++++ K   LGF+I + 
Sbjct  8    LSIFFFPFMAHGHMIPMVDMARLFASQGVRCTIVTTPGNQPLIARSIGKVQLLGFEIGVT  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             + F   E GLP+ C+++D VPS + +  FF+A   L+EP E+LL E +PDC+V D+FFP
Sbjct  68   TIPFRGTEFGLPDGCENLDSVPSPQHVFHFFEAAGSLREPFEQLLEEHKPDCVVGDMFFP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W+TD+AAKF IPRL+FHG+SY A+CA  ++R HKP+  VSSD E F IP LP ++KLT+ 
Sbjct  128  WSTDSAAKFGIPRLVFHGTSYFALCAGEAVRIHKPYLSVSSDDEPFVIPGLPDEIKLTKS  187

Query  621  QVSPME--RSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+ PM     + ++   ++L  V+E+E +SYG I NS YELEP Y
Sbjct  188  QL-PMHLLEGKKDSVLAQLLDEVKETEVSSYGVIVNSIYELEPAY  231



>gb|KHN12234.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Glycine soja]
Length=482

 Score =   236 bits (603),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/226 (54%), Positives = 157/226 (69%), Gaps = 2/226 (1%)
 Frame = +3

Query  75   GDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDK-YTQLGFQI  251
            G LH+FFFP MAHGHMIP +DMAKLFA++GV+ TIITTP N P+ SK +++  T    +I
Sbjct  6    GPLHIFFFPFMAHGHMIPLVDMAKLFAAKGVRTTIITTPLNAPIISKTIEQTKTHQSKEI  65

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             I+ ++FP V VGLPE C+  D V ST+  P F KA  ++QEP E+LL+  RP+C+VAD 
Sbjct  66   NIQTIKFPNVGVGLPEGCEHSDSVLSTDLFPIFLKATTLMQEPFEQLLLHQRPNCVVADW  125

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPW TD+AAKF IPRL+FHG S+ ++CAT  +  +KP+N+  SDSELF IPN P ++K+
Sbjct  126  FFPWTTDSAAKFGIPRLVFHGISFFSLCATKIMSLYKPYNNTCSDSELFVIPNFPGEIKM  185

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TRLQV      +             ESE+ SYG + NSFYELE DY
Sbjct  186  TRLQVGNFHTKD-NVGHNSFWNEAEESEERSYGVVVNSFYELEKDY  230



>ref|XP_003520067.1| PREDICTED: scopoletin glucosyltransferase-like [Glycine max]
Length=483

 Score =   236 bits (603),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/226 (54%), Positives = 157/226 (69%), Gaps = 2/226 (1%)
 Frame = +3

Query  75   GDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKY-TQLGFQI  251
            G LH+FFFP MAHGHMIP +DMAKLFA++GV+ TIITTP N P+ SK +++  T    +I
Sbjct  6    GPLHIFFFPFMAHGHMIPLVDMAKLFAAKGVRTTIITTPLNAPIISKTIEQTKTHQSKEI  65

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             I+ ++FP V VGLPE C+  D V ST+  P F KA  ++QEP E+LL+  RP+C+VAD 
Sbjct  66   NIQTIKFPNVGVGLPEGCEHSDSVLSTDLFPIFLKATTLMQEPFEQLLLHQRPNCVVADW  125

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPW TD+AAKF IPRL+FHG S+ ++CAT  +  +KP+N+  SDSELF IPN P ++K+
Sbjct  126  FFPWTTDSAAKFGIPRLVFHGISFFSLCATKIMSLYKPYNNTCSDSELFVIPNFPGEIKM  185

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TRLQV      +             ESE+ SYG + NSFYELE DY
Sbjct  186  TRLQVGNFHTKD-NVGHNSFWNEAEESEERSYGVVVNSFYELEKDY  230



>ref|XP_008364526.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Malus domestica]
Length=477

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/224 (55%), Positives = 159/224 (71%), Gaps = 0/224 (0%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQI  257
             LH+FFFP MA GH IP ++MAKLFAS GVK+T+ITTP N P+FSKA+    QLGF I+I
Sbjct  8    QLHIFFFPYMAQGHTIPLINMAKLFASHGVKSTLITTPLNAPLFSKAIQGTKQLGFDIEI  67

Query  258  RLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFF  437
             +++FP  EVGLP+ C+S +   +TE    FFKA  +LQ  +E++L E RP CLVAD FF
Sbjct  68   LVIKFPTEEVGLPQGCESGNLATTTEMKEKFFKATFLLQPQIEQVLDEHRPHCLVADAFF  127

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
            PWATD AAKF IPR+IFHG  + A+ AT S+  ++P   +SSDSE+FTIPN P ++KL R
Sbjct  128  PWATDLAAKFGIPRIIFHGVGFFALYATLSVLLYEPHLKLSSDSEVFTIPNFPVEIKLIR  187

Query  618  LQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             Q+    +   ET FT++ K  RE E+ S+G I NSFYELEP +
Sbjct  188  SQIPAFIKQNAETEFTKLFKAARECEEKSFGFIINSFYELEPAF  231



>ref|XP_002298734.2| hypothetical protein POPTR_0001s31120g [Populus trichocarpa]
 gb|EEE83539.2| hypothetical protein POPTR_0001s31120g [Populus trichocarpa]
Length=485

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 158/227 (70%), Gaps = 4/227 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP  AHGHMIP++DMAKLFASRG+K TIITTP N P+FSK + K  +LGF I I 
Sbjct  8    LHIFFFPFFAHGHMIPSVDMAKLFASRGIKTTIITTPLNAPLFSKTIQKTKELGFDINIL  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPS----FFKACAmlqeplerllmelrpDCLVAD  428
             ++FPA E G PE  ++ D    +E   +    FFKA  +LQ P E+ L E  PDC+VAD
Sbjct  68   TIKFPAAEAGFPEGYENTDTFIFSENARAMTTKFFKATTLLQAPFEKALQECHPDCIVAD  127

Query  429  LFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLK  608
            +FFPWATDAAAKF IPRL+FHG+S  A+ A   +R ++P   VSSDSE F +P+LP  +K
Sbjct  128  MFFPWATDAAAKFGIPRLVFHGTSNFALSAAECVRLYEPHKKVSSDSEPFVVPDLPGDIK  187

Query  609  LTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            LT+ Q+    R  +E  F++ILK  +E+E  S+G + NSFYELEP Y
Sbjct  188  LTKKQLPDYVRENVENDFSKILKASKEAELRSFGVVVNSFYELEPAY  234



>ref|XP_009377799.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Pyrus x bretschneideri]
 ref|XP_009377807.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Pyrus x bretschneideri]
Length=477

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/224 (54%), Positives = 159/224 (71%), Gaps = 0/224 (0%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQI  257
             LH+FFFP MA GH IP ++MAKLFAS GVK+T++TTP N P+FSKA+    QLGF I+I
Sbjct  8    QLHIFFFPYMAQGHTIPLINMAKLFASHGVKSTLMTTPLNAPLFSKAIQSTKQLGFDIEI  67

Query  258  RLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFF  437
             +++FP  EVGLP+ C+S +   +TE    FFKA  +LQ  +E++L E RP CLVAD FF
Sbjct  68   LVIKFPTEEVGLPQGCESGNLATTTEMKEKFFKATFLLQPQIEQILDEHRPHCLVADAFF  127

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
            PWATD AAKF IPR++FHG  + A+CAT S+  ++P   +SSDSE+FTIPN P ++KL  
Sbjct  128  PWATDLAAKFGIPRIVFHGVGFFALCATLSVLLYEPHLKLSSDSEVFTIPNFPVEIKLIS  187

Query  618  LQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             Q+    +   ET FT++ K  RE E+ S+G I NSFYELEP +
Sbjct  188  SQIPAFIKQNAETEFTKLFKAARECEEKSFGFIVNSFYELEPAF  231



>ref|XP_002518724.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43649.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=486

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 161/227 (71%), Gaps = 5/227 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP MAHGH+IPT+DMAKLFASRGVK+T+ITTP N    SK + +    GF I IR
Sbjct  9    LHIFFFPFMAHGHIIPTIDMAKLFASRGVKSTVITTPLNAKTISKTIQRTKNSGFDIDIR  68

Query  261  LLEFPAVEVGLPEDCQSVDKVPS----TEALPSFFKACAmlqeplerllmelrpDCLVAD  428
            +LEFPA E GLPE C+++D + S     + +  FF+A A LQ+PLE LL E +PDCLVAD
Sbjct  69   ILEFPA-EAGLPEGCENMDVIISHQDGKDLVMKFFRAIARLQQPLENLLGECKPDCLVAD  127

Query  429  LFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLK  608
            +FFPW TDAAAKF IPRL+FHG ++ ++C    ++ ++P   VSSDSE F IP LP ++K
Sbjct  128  MFFPWTTDAAAKFGIPRLVFHGINFFSLCTGECIKLYEPHKKVSSDSEPFVIPYLPGEIK  187

Query  609  LTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             TR Q+    R + E  F +++K V+ESE  SYG I NSFYELE  Y
Sbjct  188  YTRKQLPDFLRQQEENDFLKMVKAVKESELKSYGVIVNSFYELESVY  234



>ref|XP_008236559.1| PREDICTED: scopoletin glucosyltransferase-like [Prunus mume]
Length=485

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 163/228 (71%), Gaps = 4/228 (2%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAV----DKYTQLGF  245
            +LHVF FP MAHGHMIP  DMAKL A++GV+ TIITTP N P FSKA           G 
Sbjct  7    ELHVFLFPFMAHGHMIPVSDMAKLLAAQGVETTIITTPLNAPTFSKATRSRKTNSGSCGI  66

Query  246  QIQIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVA  425
            +I+I+ ++FP+ E GLPE C++ D +P+ E   +FFKA  +LQ PLE+LL+E +P CLVA
Sbjct  67   EIKIKTIKFPSQEAGLPEGCENPDSLPTPELASNFFKAVGLLQAPLEQLLLEDQPTCLVA  126

Query  426  DLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQL  605
            D+FFPWATDAAAKF IPRL+FHG+S+ A+ A++ +R ++PF + SSDSE F IPNLP ++
Sbjct  127  DMFFPWATDAAAKFGIPRLVFHGTSFFALAASDCVRRYEPFKNTSSDSEPFVIPNLPGEI  186

Query  606  KLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            K+TR Q+    +   E   T +LK+ +E+E  SYG + NSFYELE  Y
Sbjct  187  KMTRAQLPDFIKDNNENDLTRLLKQSKEAEVRSYGIVVNSFYELETVY  234



>ref|XP_008236488.1| PREDICTED: scopoletin glucosyltransferase-like [Prunus mume]
Length=483

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 167/226 (74%), Gaps = 2/226 (1%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAV-DKYTQLG-FQI  251
            + H+F FP MA+GHMIP  DMAKLFA++GVK TIITTP N P FSKA   + T  G  ++
Sbjct  7    EFHIFLFPFMAYGHMIPVSDMAKLFAAQGVKTTIITTPLNAPTFSKATRSRRTNSGRIEV  66

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
            QI+ ++FP+ E GLPE C++++ +P+ E   +F KA  +LQEPLERLL E +P CLVAD+
Sbjct  67   QIKTIKFPSQEAGLPEGCENLESLPTPELANNFSKALGLLQEPLERLLHEDQPSCLVADM  126

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPWATDAAAKF IPRL+FHG+S+  + A++ +R ++PF ++SSDSE F IPNLP ++K+
Sbjct  127  FFPWATDAAAKFGIPRLVFHGTSFFTLAASDCVRRYQPFKNMSSDSEPFVIPNLPGEIKM  186

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            T  QV    +  IE  FT+++K+  +SE  SYG + NSFYELEP Y
Sbjct  187  TSAQVPYFLKENIENDFTQLMKQAHDSEVGSYGIVVNSFYELEPVY  232



>ref|XP_003518712.1| PREDICTED: scopoletin glucosyltransferase-like [Glycine max]
Length=476

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 164/224 (73%), Gaps = 2/224 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDK-YTQLGFQIQI  257
            LH+FFFP +AHGHMIP +DMAKLFA++GV+ATI+TTP N P+ SKA++K  T  G +IQI
Sbjct  8    LHMFFFPFLAHGHMIPLVDMAKLFAAKGVRATILTTPLNAPIISKAIEKTKTHQGKEIQI  67

Query  258  RLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFF  437
            + L+F   E GLPE C+  D +PS    P+F  A A+LQEP E+LL + RP+C+VAD+FF
Sbjct  68   QTLKFLGTEFGLPEGCEHCDSLPSPNLFPAFIMATALLQEPFEQLLHQQRPNCVVADMFF  127

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
            PW TD+A KF IPRL+FHG S+ ++CA+  +  ++P+N+ SSD+ELF IPN P ++K+TR
Sbjct  128  PWTTDSADKFGIPRLVFHGISFFSLCASQIMSLYQPYNNTSSDTELFVIPNFPGEIKMTR  187

Query  618  LQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            LQ +   R + +   +   K++ ESE  SYG + NSFYELE DY
Sbjct  188  LQEANFFRKD-DVDSSRFWKQIYESEVRSYGVVVNSFYELEKDY  230



>sp|Q8H0F2.1|ANGT_GENTR RecName: Full=Anthocyanin 3'-O-beta-glucosyltransferase; Short=3'GT 
[Gentiana triflora]
 dbj|BAC54092.1| anthocyanin 3'-glucosyltransferase [Gentiana triflora]
Length=482

 Score =   234 bits (596),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 165/227 (73%), Gaps = 1/227 (0%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            M  LHVFFFP +A+GH++PT+DMAKLF+SRGVKAT+ITT  N  +F KA+++   LGF I
Sbjct  1    MDQLHVFFFPFLANGHILPTIDMAKLFSSRGVKATLITTHNNSAIFLKAINRSKILGFDI  60

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             +  ++FP+ E GLPE  ++ D+  S + +  FF+AC +LQEPLE LL E RP  LVADL
Sbjct  61   SVLTIKFPSAEFGLPEGYETADQARSIDMMDEFFRACILLQEPLEELLKEHRPQALVADL  120

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FF WA DAAAKF IPRL+FHGSS  A+ A  S+R +KP+ ++SSDS+ F +P++P ++ L
Sbjct  121  FFYWANDAAAKFGIPRLLFHGSSSFAMIAAESVRRNKPYKNLSSDSDPFVVPDIPDKIIL  180

Query  612  TRLQV-SPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            T+ QV +P E  E  T  TE+ K + ESE+  YG I NSFYELEPDY
Sbjct  181  TKSQVPTPDETEENNTHITEMWKNISESENDCYGVIVNSFYELEPDY  227



>ref|XP_002282463.1| PREDICTED: scopoletin glucosyltransferase [Vitis vinifera]
Length=482

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 159/223 (71%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LHV FFP MA GHMIPT+DMAKLF++RGV+ATIITTP N PV SK +++   LG QI +R
Sbjct  8    LHVLFFPFMALGHMIPTIDMAKLFSARGVRATIITTPLNAPVVSKTMERGHYLGAQIGLR  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +++FP+V+ GLP+  +++D+  S E    FF A ++ Q+PLE+LL E RP  LVAD FFP
Sbjct  68   VIQFPSVQAGLPQGLENLDQDASPEIRLKFFLAMSLFQQPLEQLLQEYRPHGLVADAFFP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WA D A+KF IPRL F G+ + A+CA  SL  HKP+  V SD+E F +P+LP ++KLTRL
Sbjct  128  WALDVASKFGIPRLAFQGTGFFAMCALQSLTAHKPYKGVGSDTEPFLLPDLPDEIKLTRL  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+S      +E  FT   K  RESE+ SYG I N+FYELEP Y
Sbjct  188  QISNDLTLGLENDFTRFFKEARESEERSYGTIVNTFYELEPAY  230



>emb|CAN65903.1| hypothetical protein VITISV_004870 [Vitis vinifera]
Length=482

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 159/223 (71%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LHV FFP MA GHMIPT+DMAKLF++RGV+ATIITTP N PV SK +++   LG QI +R
Sbjct  8    LHVLFFPFMALGHMIPTIDMAKLFSARGVRATIITTPLNAPVVSKTMERGHYLGAQIGLR  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +++FP+V+ GLP+  +++D+  S E    FF A ++ Q+PLE+LL E RP  LVAD FFP
Sbjct  68   VIQFPSVQAGLPQGLENLDQDASPEIRLKFFLAMSLFQQPLEQLLQEYRPHGLVADAFFP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WA D A+KF IPRL F G+ + A+CA  SL  HKP+  V SD+E F +P+LP ++KLTRL
Sbjct  128  WALDVASKFGIPRLAFQGTGFFAMCALQSLTAHKPYKGVGSDTEPFLLPDLPDEIKLTRL  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+S      +E  FT   K  RESE+ SYG I N+FYELEP Y
Sbjct  188  QISNDLTLGLENDFTRFFKEARESEERSYGTIVNTFYELEPAY  230



>emb|CAB56231.1| betanidin-5-O-glucosyltransferase [Cleretum bellidiforme]
Length=489

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 162/225 (72%), Gaps = 1/225 (0%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQ-LGFQIQ  254
            DLHV FFP +AHGHMIP+LD+AKLFA+RGVK TIITTP N  +F+KA++K  +    Q++
Sbjct  9    DLHVVFFPFLAHGHMIPSLDIAKLFAARGVKTTIITTPLNASMFTKAIEKTRKNTETQME  68

Query  255  IRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLF  434
            I +  FP+ E GLP  C+++++  +  A   FF A  +L+E LE  L++ RP+CLVAD+F
Sbjct  69   IEVFSFPSEEAGLPLGCENLEQAMAIGANNEFFNAANLLKEQLENFLVKTRPNCLVADMF  128

Query  435  FPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLT  614
            F WA D+ AKF+IP L+FHG S+ A CA   +  +KP+  VSSD+E+F++P LPH++K+T
Sbjct  129  FTWAADSTAKFNIPTLVFHGFSFFAQCAKEVMWRYKPYKAVSSDTEVFSLPFLPHEVKMT  188

Query  615  RLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            RLQV    R   ET FT+  +R+RE E  SYG I NSFYELEPDY
Sbjct  189  RLQVPESMRKGEETHFTKRTERIRELERKSYGVIVNSFYELEPDY  233



>ref|XP_007029404.1| Anthocyanin 3'-O-beta-glucosyltransferase, putative [Theobroma 
cacao]
 gb|EOY09906.1| Anthocyanin 3'-O-beta-glucosyltransferase, putative [Theobroma 
cacao]
Length=484

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/223 (54%), Positives = 157/223 (70%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH  FFP +AHGH+IPT+DMA+LFA  GVK TI+TTP N  +F+  + +  QLGF I   
Sbjct  8    LHFIFFPQLAHGHLIPTVDMARLFAMHGVKVTIVTTPLNALLFASKIQREKQLGFDISTL  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +++FPA EVGLPE C++V  + S E +P F KA  + Q+PLER+L ELRPDCLVAD  FP
Sbjct  68   VIKFPASEVGLPEGCENVSSITSQEMIPKFLKAINLFQQPLERILEELRPDCLVADWMFP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD A KF IPRL+FHG+S  A+C  ++L  H+PF  +SS+SE F +P LP Q+K+TRL
Sbjct  128  WATDIAGKFGIPRLVFHGTSCFALCVVDTLIRHEPFKKISSESEPFDVPGLPDQIKMTRL  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    +   ET   +++    +SE TSYG I NSF+ELEP Y
Sbjct  188  QLPDYIKDTAETERQKLIDEAIKSELTSYGVIVNSFHELEPAY  230



>dbj|BAG71127.1| glucosyltransferase [Phytolacca americana]
 dbj|BAH05017.1| glucosyltransferase [Phytolacca americana]
Length=485

 Score =   232 bits (592),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/229 (52%), Positives = 165/229 (72%), Gaps = 9/229 (4%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGF-QIQ  254
             LHV FFP+MAHGHMIPTLD+A+LFA+R V+ATIITTP N   F+KA++   + G   I 
Sbjct  7    QLHVVFFPIMAHGHMIPTLDIARLFAARNVRATIITTPLNAHTFTKAIEMGKKNGSPTIH  66

Query  255  IRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLF  434
            + L +FPA +VGLPE C+++++   +  +  FFK   +L+E LE  L + RP+CLVAD+F
Sbjct  67   LELFKFPAQDVGLPEGCENLEQALGSSLIEKFFKGVGLLREQLEAYLEKTRPNCLVADMF  126

Query  435  FPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLT  614
            FPWATD+AAKF+IPRL+FHG+S+ ++CA   +R ++P  +VSSD ELF++P  PH +K+ 
Sbjct  127  FPWATDSAAKFNIPRLVFHGTSFFSLCALEVVRLYEPHKNVSSDEELFSLPLFPHDIKMM  186

Query  615  RLQ----VSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            RLQ    V   E++E +T     LK ++ESE  SYG I NSFYELEP+Y
Sbjct  187  RLQLPEDVWKHEKAEGKTR----LKLIKESELKSYGVIVNSFYELEPNY  231



>ref|XP_003518715.1| PREDICTED: scopoletin glucosyltransferase-like [Glycine max]
 gb|KHN12228.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Glycine soja]
Length=480

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 158/223 (71%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP   HGHMIPT+DMAKLFA +GVKATI+TTP N P FSKA+      G +I I 
Sbjct  9    LHIFFFPFFGHGHMIPTVDMAKLFAEKGVKATIVTTPLNAPFFSKAIGNSKTNGNKIHIE  68

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +EFP  E GLP  C++VD +PS     +F  A  +LQEPLE+LL++ RPDC+VAD FFP
Sbjct  69   TIEFPCAEAGLPVGCENVDSIPSPNLFQAFIMATGLLQEPLEQLLLKQRPDCIVADFFFP  128

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W TD+AAKF IPRL+FHG+ + + CAT  +  ++P+N VSSDSE F IPNLP ++K+TR+
Sbjct  129  WTTDSAAKFGIPRLVFHGTGFFSSCATTCMGLYEPYNDVSSDSESFVIPNLPGEIKMTRM  188

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+ P  + + +T   ++L   RESE   YG + NSFYELE  Y
Sbjct  189  QLPPFFKGKEKTGLAKLLVEARESESRCYGVVVNSFYELEKVY  231



>ref|XP_009625604.1| PREDICTED: scopoletin glucosyltransferase-like [Nicotiana tomentosiformis]
Length=485

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/223 (53%), Positives = 150/223 (67%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH++F PMMA GHMIP +DMA+ F  RGVKAT++TTP N P FSK + +  +LG  I IR
Sbjct  8    LHIYFLPMMAPGHMIPLVDMARQFTRRGVKATLVTTPLNAPKFSKTIQRDRELGNDISIR  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +EFP  E GLP+ C+++    STE    F KA  + Q+P+E+ L E  PDCL+A   FP
Sbjct  68   TIEFPCKEAGLPDGCENLASTTSTEMTLKFIKALYLFQQPVEQFLEEDHPDCLIAGTLFP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W  D AAK  IPRL+F G+  L +CA +SL  HKP   V SD+E F IP LPH +K++R 
Sbjct  128  WTVDVAAKLGIPRLVFSGTGLLPLCAYHSLMEHKPHLKVESDTEEFIIPGLPHTIKMSRQ  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+S   + E E P TEI+K V  +E TSYGAI NSFYELEP+Y
Sbjct  188  QLSDHIKDETENPMTEIIKDVMRAEMTSYGAIVNSFYELEPNY  230



>dbj|BAD44686.1| UDP-glucose:anthocyanin 3'-O-glucosyltransferase [Gentiana scabra 
var. buergeri]
Length=482

 Score =   231 bits (590),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 164/227 (72%), Gaps = 1/227 (0%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            M  LHVFFFP +A+GH++PT+DMAKLF+SRGVKAT+ITT  N  +F KA+ +   LGF I
Sbjct  1    MDQLHVFFFPFLANGHILPTIDMAKLFSSRGVKATLITTHNNSAIFLKAISRSKILGFDI  60

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             +  ++FP+ E GLPE  ++ D+  S + +  FF+AC +LQEPLE LL E RP  LVADL
Sbjct  61   SVLTIKFPSAEFGLPEGYETADQARSIDMMDEFFRACILLQEPLEELLKEHRPQALVADL  120

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FF WA DAAAKF IPRL+FHGSS  A+ +  S+R +KP+ ++SSDS+ F +P++P ++ L
Sbjct  121  FFYWANDAAAKFGIPRLLFHGSSSFAMISAESVRRNKPYKNLSSDSDPFVVPDIPDKIIL  180

Query  612  TRLQV-SPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            T+ QV +P E  E  T  TE+ K + ESE+  YG I NSFYELEPDY
Sbjct  181  TKSQVPTPDETEENNTHITEMWKNISESENDCYGVIVNSFYELEPDY  227



>gb|KGN43909.1| hypothetical protein Csa_7G073450 [Cucumis sativus]
Length=480

 Score =   231 bits (589),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 156/223 (70%), Gaps = 1/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+F FP MAHGHMIP +DMAKLFASRG+K TI+TTP N    SK++   +     IQ+ 
Sbjct  8    LHIFMFPFMAHGHMIPIVDMAKLFASRGIKITIVTTPLNSISISKSLHNCSPNSL-IQLL  66

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +L+FPA E GLP+ C++ D +PS + LP FF+A ++LQ P E  L   RPDCL++D+FFP
Sbjct  67   ILKFPAAEAGLPDGCENADSIPSMDLLPKFFEAVSLLQPPFEEALHNNRPDCLISDMFFP  126

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W  D A +  IPRLIFHG+S  ++C++  +R HKP+ HVSSD+E FTIP LP  +KLT++
Sbjct  127  WTNDVADRVGIPRLIFHGTSCFSLCSSEFMRLHKPYQHVSSDTEPFTIPYLPGDIKLTKM  186

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            ++    R   E  F++ + +V+ESE   YG + NSFYELE +Y
Sbjct  187  KLPIFVRENSENEFSKFITKVKESESFCYGVVVNSFYELEAEY  229



>ref|XP_008375157.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Malus domestica]
Length=477

 Score =   231 bits (588),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 117/224 (52%), Positives = 161/224 (72%), Gaps = 2/224 (1%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQI  257
             LH+FFFP M  GH +P +++A+LFASRGVK+T+I TP N+P+FSKA+    +LGF + I
Sbjct  8    QLHIFFFPYMVQGHFVPLINIARLFASRGVKSTLIATPLNEPLFSKAIQSSKKLGFDVDI  67

Query  258  RLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFF  437
             +++FPA EVGLP+ C++   V +TE    F KA  +LQ  +E++L + RP CLVAD FF
Sbjct  68   LVIKFPAEEVGLPQGCENASLVTTTEMNEKFIKATFLLQPQIEQILDKHRPHCLVADTFF  127

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
            PWAT+ AAKFDIPR+IFHG  + A+CA+ S+  ++P   +SSDSE+FTIPN P ++KLTR
Sbjct  128  PWATEVAAKFDIPRIIFHGMGFFALCASRSVALYEPHAKLSSDSEVFTIPNFPVEIKLTR  187

Query  618  LQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             Q+  + +   E   T++LK  RES + SYG I NSFYELEP +
Sbjct  188  SQMPTVPKQSPE--ITKLLKEARESGEKSYGFIVNSFYELEPAF  229



>ref|XP_008245758.1| PREDICTED: scopoletin glucosyltransferase-like [Prunus mume]
Length=486

 Score =   231 bits (589),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 120/226 (53%), Positives = 161/226 (71%), Gaps = 4/226 (2%)
 Frame = +3

Query  84   HVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAV----DKYTQLGFQI  251
            HVF FP MAHGHMIP  DMAKL A++GV+ TIITTP N P FSKA           G +I
Sbjct  9    HVFLFPFMAHGHMIPVSDMAKLLAAQGVETTIITTPLNAPTFSKATRSRKTNSGSCGIEI  68

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
            +I+ ++FP+ E GLPE C++ D +P+ E   +FFKA  +LQ PLE+LL+E +P CLVAD+
Sbjct  69   KIKTIKFPSQEAGLPEGCENPDSLPTPELASNFFKAVGLLQAPLEQLLLEDQPTCLVADM  128

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPWATDAAAKF IPRL+FHG+S+ ++ A++ +R ++PF + SSDSE F IPN P ++K+
Sbjct  129  FFPWATDAAAKFGIPRLVFHGTSFFSLAASDCVRRYEPFKNTSSDSEPFVIPNFPGEIKM  188

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR QV    +  IE   T ++++ +E+E  SYG + NSFYELE  Y
Sbjct  189  TRAQVPDFVKYNIENDLTPLIEQAKEAEVRSYGIVVNSFYELESVY  234



>ref|XP_009779862.1| PREDICTED: scopoletin glucosyltransferase-like [Nicotiana sylvestris]
Length=485

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 151/223 (68%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH +FFP+MA GHMIP +DMA+ FA RGVKAT++TTP N P FSK + +  +LG  I IR
Sbjct  8    LHAYFFPVMAPGHMIPLVDMARQFARRGVKATLVTTPLNAPKFSKTIQRERELGSDISIR  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +EFP  E GLP+ C+++    STE    F KA  + Q+P+E+ L E  PDCL+A   FP
Sbjct  68   TIEFPCKEAGLPDGCENLASTTSTEMTQKFIKALYLFQQPIEQFLEEDHPDCLIASTLFP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W  D AAK  IPRL+F G+  L +CA +SL  +KP   V SD+E F IP LPH +K++R 
Sbjct  128  WTVDVAAKLGIPRLVFSGTGLLPICAYHSLMEYKPHLKVESDTEEFIIPGLPHTIKMSRQ  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+S   + E E P TEI+K V  +E TSYGAI NSFYE+EP+Y
Sbjct  188  QLSDHIKDETENPMTEIIKDVMRAEMTSYGAIVNSFYEVEPNY  230



>ref|XP_008340172.1| PREDICTED: scopoletin glucosyltransferase-like [Malus domestica]
Length=481

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/226 (54%), Positives = 158/226 (70%), Gaps = 2/226 (1%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVD--KYTQLGFQI  251
            D H+ FFP MAHGHMIP  DMAKLFAS+GVK TI+TTP N P  SKA    K    G ++
Sbjct  7    DFHICFFPFMAHGHMIPISDMAKLFASQGVKTTIVTTPLNAPTLSKATQSSKTCSGGVEV  66

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
            +I+ ++FP+VE GLPE C+ VD +PS E   +F+KA ++LQEPLE LL+   P CLVAD 
Sbjct  67   RIKTIKFPSVEAGLPEGCEHVDSLPSPEFRSNFYKATSLLQEPLEHLLLHENPSCLVADF  126

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
             F WATDAAAKFDIPRLIFHG+S+ A+ A++ +  ++PF + S DS+ F IP+ P ++ +
Sbjct  127  LFHWATDAAAKFDIPRLIFHGTSFFAMAASDIVTKYEPFKNTSLDSDPFMIPDFPGEITM  186

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR QV    +  IE     ++KR +E+E TSYG + NSFYELE  Y
Sbjct  187  TRAQVPDHVKENIENDLIRMVKRAKEAEKTSYGIVVNSFYELESAY  232



>dbj|BAD52006.1| UDP-glucose: chalcononaringenin 2'-O-glucosyltransferase [Dianthus 
caryophyllus]
Length=475

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 156/223 (70%), Gaps = 7/223 (3%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LHV FFP MAHGHMIPT D+AKLFA R VK TIITTP N   F+K           + + 
Sbjct  8    LHVAFFPFMAHGHMIPTFDLAKLFAGRDVKTTIITTPMNAHAFAKT-------NVPMNLE  60

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +  FPA E GLPE+C+++++  S   LP+F KA AML + LER L   +P+CLVAD+FFP
Sbjct  61   IFTFPAQEAGLPENCENLEQAMSIGLLPAFIKASAMLCDQLERFLERSQPNCLVADMFFP  120

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WAT++A KF++PR++FHG+ +L++CA    R ++PF +VSSD E+  +P LPH++KLTR 
Sbjct  121  WATESARKFNVPRIVFHGTGFLSLCAKEVERLYRPFKNVSSDDEVVVLPRLPHEVKLTRT  180

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            QVS  E S+ +  F +   R++ESE  SYG I NSFYELEP++
Sbjct  181  QVSEEEWSDDDNEFNKRSARIKESEVESYGVIVNSFYELEPEF  223



>ref|XP_011000136.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=485

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 156/227 (69%), Gaps = 4/227 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP  AHGHMIP +DMAKLFASRG+K TIITTP N P+FSK + K  +LGF I I 
Sbjct  8    LHIFFFPFFAHGHMIPFVDMAKLFASRGIKTTIITTPLNAPLFSKTIHKNKELGFDINIL  67

Query  261  LLEFPAVEVGLPEDCQSVDKV----PSTEALPSFFKACAmlqeplerllmelrpDCLVAD  428
             ++FPA E G PE  ++ D       + E    F KA  +LQ P E++L E  PDC+VAD
Sbjct  68   TIKFPAAEAGFPEGYENTDAFIFSENAREMTIKFIKATTLLQAPFEKVLQECHPDCIVAD  127

Query  429  LFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLK  608
            +FFPWATDAAAKF IPRL+FHG+S  A+ A+  +R ++P   VSSDSE F +P+LP  +K
Sbjct  128  MFFPWATDAAAKFGIPRLVFHGTSNFALSASECVRLYEPHKKVSSDSEPFVVPDLPGDIK  187

Query  609  LTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            LT+ Q+    R + E  F++ LK  +E+E  S+G + NSFYELEP Y
Sbjct  188  LTKKQLPDFAREDAENDFSKFLKASKEAELRSFGVVVNSFYELEPAY  234



>dbj|BAD44687.1| UDP-glucose:anthocyanin 3'-O-glucosyltransferase [Gentiana scabra 
var. buergeri]
Length=482

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 164/227 (72%), Gaps = 1/227 (0%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            M  LHVFFFP +A+GH++PT+DMAKLF+SRGVKAT+ITT  N  +F KA+ +   LGF I
Sbjct  1    MDQLHVFFFPFLANGHILPTIDMAKLFSSRGVKATLITTHNNSAIFLKAISRSKILGFDI  60

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             +  ++FP+ E GLPE  ++ D+  S + +  FF+AC +LQEPLE LL E RP  LVADL
Sbjct  61   SVLTIKFPSAEFGLPEGYETADQARSIDLMDEFFRACILLQEPLEELLKEHRPQALVADL  120

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FF WA DAAAKF IPRL+FHGSS  A+ +  S+R +KP+ ++SSDS+ F +P++P ++ L
Sbjct  121  FFYWANDAAAKFGIPRLLFHGSSSFAMISAESVRRNKPYKNLSSDSDPFVVPDIPDKIIL  180

Query  612  TRLQV-SPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            T+ QV +P +  E  T  TE+ K + ESE+  YG I NSFYELEPDY
Sbjct  181  TKSQVPTPDDTEENNTHITEMWKNISESENDCYGVIVNSFYELEPDY  227



>ref|XP_002518707.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43632.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=387

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/223 (53%), Positives = 158/223 (71%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+ FFP MAHGHMIPT+DMA+LFA  GVKATIITTP N  + SK +++  Q GF+I I+
Sbjct  8    LHIAFFPYMAHGHMIPTMDMARLFARHGVKATIITTPFNASLISKTIERDRQKGFEIGIQ  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            L+ F + E GLPE C++   + + E    FFKA ++LQ+PLE +L E  P+CLVAD+ FP
Sbjct  68   LINFASAETGLPEGCENASSIRTQEMAAKFFKAISLLQQPLEHVLKECHPNCLVADMMFP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WAT+ A+KF IPRL+FHG S  ++C  NSLR ++P   ++SD E F +P LP Q+K+TRL
Sbjct  128  WATEVASKFGIPRLVFHGISTFSLCVYNSLRHYEPHKGLASDFEPFMVPGLPDQIKITRL  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            QV    + + +   TE+  R+ +SE TSYG + NSFYELEP Y
Sbjct  188  QVPDYIKEKNKQ--TELTHRMSQSELTSYGVLLNSFYELEPAY  228



>ref|XP_004304714.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Fragaria vesca subsp. vesca]
Length=477

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 159/223 (71%), Gaps = 3/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            +H+F FP MAHGHMIP  DMAKLFAS GVK TI+TTP N   F++         F IQI+
Sbjct  9    VHIFLFPFMAHGHMIPVSDMAKLFASHGVKITIVTTPLNAIRFAQTTQSSK---FNIQIK  65

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +EFP+ E GLP+ C++VD +PS   +  FFKA  +LQ   E LL E++P C+VAD+FFP
Sbjct  66   AIEFPSEEAGLPKGCENVDTLPSPNLVNPFFKATRLLQPQFEELLKEVKPTCIVADMFFP  125

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WAT+AAAKF IPRL+FHG+S+ A+CA++ ++ ++P+N +SSD+E F IP LP +++LTR 
Sbjct  126  WATEAAAKFGIPRLVFHGTSFFAMCASDCVKVYEPYNKISSDTEPFVIPYLPGEIELTRA  185

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    ++ +    T++LK  RE+E  S+G I NSFYELEP Y
Sbjct  186  QLPDFIKNNVLNDVTQLLKEAREAELKSFGIIMNSFYELEPVY  228



>ref|XP_006487029.1| PREDICTED: scopoletin glucosyltransferase-like [Citrus sinensis]
Length=487

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/227 (52%), Positives = 166/227 (73%), Gaps = 4/227 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP +AHGHMIPT+DMAKLF +RGVKA++ITTPAN P  S+++ K ++LG ++ ++
Sbjct  8    LHIFFFPFLAHGHMIPTVDMAKLFTTRGVKASVITTPANAPHLSRSIQKASELGIELDVK  67

Query  261  LLEFPAVEVGLPEDCQSVDKVP---STEALPSFFKACAmlqeplerllmelrpDCLVADL  431
            +++FP+ E GLPE  +++D +    + E +  F+ A   LQ+PLE+LL E +PDCLVAD+
Sbjct  68   IIKFPSAEAGLPEGWENLDAITNEVNRELIVKFYMATTKLQKPLEQLLQEHKPDCLVADM  127

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPWATDAAAKF IPRL+FHG+S+ ++CA   L  ++P   VSSDSE F +PNLP ++KL
Sbjct  128  FFPWATDAAAKFGIPRLVFHGTSFFSLCAIKCLALYEPHKKVSSDSEPFVMPNLPGEIKL  187

Query  612  TRLQV-SPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR Q+  P ++   +  F+  +K   +S+  SYG + NSFYELE  Y
Sbjct  188  TRNQLPDPAKQDMGDNDFSRFMKASDDSDLRSYGVVVNSFYELEHAY  234



>ref|XP_006369755.1| hypothetical protein POPTR_0001s31040g [Populus trichocarpa]
 gb|ERP66324.1| hypothetical protein POPTR_0001s31040g [Populus trichocarpa]
Length=485

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 155/227 (68%), Gaps = 4/227 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FF P  AHGHMIP++DMAKLFASRG+K TIITTP N P FSK + K  +LGF I I 
Sbjct  8    LHIFFLPFFAHGHMIPSVDMAKLFASRGIKTTIITTPLNAPFFSKTIQKTKELGFDINIL  67

Query  261  LLEFPAVEVGLPEDCQSVDKV----PSTEALPSFFKACAmlqeplerllmelrpDCLVAD  428
             ++FPA E GLPE  ++ D       + E    F KA   LQ P E++L E  PDC+VAD
Sbjct  68   TIKFPAAEAGLPEGYENTDAFIFSENAREMTIKFIKATTFLQAPFEKVLQECHPDCIVAD  127

Query  429  LFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLK  608
            +FFPWATDAAAKF IPRL+FHG+S  A+ A+  +R ++P   VSSDSE F +P+LP  +K
Sbjct  128  VFFPWATDAAAKFGIPRLVFHGTSNFALSASECVRLYEPHKKVSSDSEPFVVPDLPGDIK  187

Query  609  LTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            LT+ Q+    R  +E  F++ LK  +E+E  S+G + NSFYELEP Y
Sbjct  188  LTKKQLPDDVRENVENDFSKFLKASKEAELRSFGVVVNSFYELEPAY  234



>ref|XP_003628776.1| Glucosyltransferase [Medicago truncatula]
 gb|AET03252.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=489

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/225 (50%), Positives = 164/225 (73%), Gaps = 2/225 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+  FP M HGH IPT+DMAKLFAS+GV+ TI+TTP N+P  SKA+++       I I+
Sbjct  8    LHILVFPFMGHGHTIPTIDMAKLFASKGVRVTIVTTPLNKPPISKALEQSKIHFNNIDIQ  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             ++FP VE GLPE C++VD +PS   +P+FF A  +LQ+P E LL++ +P C+VAD+FFP
Sbjct  68   TIKFPCVEAGLPEGCENVDSIPSVSFVPAFFAAIRLLQQPFEELLLQQKPHCVVADMFFP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD+AAKF IPR++FHG+S+ ++CA+  ++ ++P+ +VSSD++LF I +LP  +K+TRL
Sbjct  128  WATDSAAKFGIPRIVFHGTSFFSLCASQCMKKYQPYKNVSSDTDLFEITDLPGNIKMTRL  187

Query  621  QV--SPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+  +  E   I   F ++ + +++SE  SYG I NSFYELE  Y
Sbjct  188  QLPNTLTENDPISQSFAKLFEEIKDSEVRSYGVIVNSFYELENVY  232



>ref|XP_008454968.1| PREDICTED: scopoletin glucosyltransferase-like [Cucumis melo]
Length=480

 Score =   228 bits (582),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 156/223 (70%), Gaps = 1/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+F FP MAHGHMIP ++MAKLFASRG+K TI+TTP N    S+++   +     I + 
Sbjct  8    LHIFMFPFMAHGHMIPIVNMAKLFASRGIKITIVTTPLNSISISRSLHNDSN-SLDIHLL  66

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +L+FP+ EVGLP DC++VD +P+ + LP F++A  +LQ  LE  L + RP CLVAD+FFP
Sbjct  67   ILKFPSAEVGLPPDCENVDSLPTMDLLPIFYQAINLLQPSLEEALHQNRPHCLVADMFFP  126

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W  D A +  IPRLIFHG+   ++CA+  +R H+P+ HVSSD+E F IP LP  +KLT++
Sbjct  127  WTNDVADRIGIPRLIFHGTGSFSLCASEFVRLHQPYKHVSSDTEHFLIPYLPGDIKLTKM  186

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+  + R  +E  +++ + +V+ESE   YG + NSFYELE +Y
Sbjct  187  QLPIILRENVENEYSKFITKVKESESYCYGVVVNSFYELEAEY  229



>gb|KDO59783.1| hypothetical protein CISIN_1g046605mg [Citrus sinensis]
Length=487

 Score =   228 bits (582),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 116/227 (51%), Positives = 165/227 (73%), Gaps = 4/227 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP +AHGHMIPT+DMAKLF +RGVKA++ITTP N P  S+++ K ++LG ++ ++
Sbjct  8    LHIFFFPFLAHGHMIPTVDMAKLFTTRGVKASVITTPGNAPHLSRSIQKASELGIELDVK  67

Query  261  LLEFPAVEVGLPEDCQSVDKVP---STEALPSFFKACAmlqeplerllmelrpDCLVADL  431
            +++FP+ E GLPE  +++D +    + E +  F+ A   LQ+PLE+LL E +PDCLVAD+
Sbjct  68   IIKFPSAEAGLPEGWENLDAITNEVNRELIVKFYMATTKLQKPLEQLLQEHKPDCLVADM  127

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPWATDAAAKF IPRL+FHG+S+ ++CA   L  ++P   VSSDSE F +PNLP ++KL
Sbjct  128  FFPWATDAAAKFGIPRLVFHGTSFFSLCAIKCLALYEPHKKVSSDSEPFVMPNLPGEIKL  187

Query  612  TRLQV-SPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR Q+  P ++   +  F+  +K   +S+  SYG + NSFYELE  Y
Sbjct  188  TRNQLPDPAKQDMGDNDFSRFMKASDDSDLRSYGVVVNSFYELEHAY  234



>gb|KDP25000.1| hypothetical protein JCGZ_23983 [Jatropha curcas]
Length=471

 Score =   228 bits (581),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 159/220 (72%), Gaps = 5/220 (2%)
 Frame = +3

Query  105  MAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIRLLEFPAVE  284
            MAHGH IPT+DMAKLFA RG K TIITTP+N+P+ SK + +   LGF I I++L+FP+VE
Sbjct  1    MAHGHTIPTVDMAKLFAFRGHKTTIITTPSNEPLISKTIQRTKDLGFVINIQILKFPSVE  60

Query  285  VGLPEDCQSVDKVPS-----TEALPSFFKACAmlqeplerllmelrpDCLVADLFFPWAT  449
            VGLPE C+++D V S     TE +  F  A   LQEPLE+LL E  P+CLVAD+FFPWAT
Sbjct  61   VGLPEGCENIDFVLSLVENGTEMMNKFCLAIGKLQEPLEKLLQECNPNCLVADMFFPWAT  120

Query  450  DAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRLQVS  629
            DAAAKF IPRL+F G+S+ ++CA  S+R ++P   VS+DS  F IP+LP ++K+TR Q  
Sbjct  121  DAAAKFGIPRLVFQGTSFFSLCAGESIRLYQPHKKVSTDSASFVIPDLPGEIKITRKQFP  180

Query  630  PMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             + R E++  FT+I+K   ESE  S+G + NSFYELE  Y
Sbjct  181  IIFREEVQNDFTKIVKESNESELKSFGVVVNSFYELEQAY  220



>ref|XP_007042482.1| UDP-glucosyl transferase 73B3, putative [Theobroma cacao]
 gb|EOX98313.1| UDP-glucosyl transferase 73B3, putative [Theobroma cacao]
Length=485

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 160/228 (70%), Gaps = 5/228 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            +H+FFFP+MA GH+IPT+DMAKLFA+RGVK TIITTPAN   FSK + +  + G  + ++
Sbjct  8    VHIFFFPIMAQGHVIPTVDMAKLFATRGVKTTIITTPANASFFSKTIQRSKESGLDVDVK  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPS-----FFKACAmlqeplerllmelrpDCLVA  425
            +L++   E GLPE C++ D +P++   P      FFKA  MLQEPLERLL E +PDCLVA
Sbjct  68   ILKYSTEEAGLPEGCENADLLPTSRDEPKDIVSKFFKAKVMLQEPLERLLQECKPDCLVA  127

Query  426  DLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQL  605
             +FFPWATDAA KF IPRL+F+G S  + CA   +  ++P  HV S+ E F +PNLP  +
Sbjct  128  HMFFPWATDAADKFGIPRLVFYGVSVFSTCAMECMTLYEPHKHVESEFEQFVVPNLPGDI  187

Query  606  KLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            KL++ Q+    +  +ET FT++LK  +ESE  SYG IFNSFYELE  Y
Sbjct  188  KLSKKQLPDYVKESVETDFTKMLKASKESELRSYGVIFNSFYELEDMY  235



>ref|XP_007157726.1| hypothetical protein PHAVU_002G093300g [Phaseolus vulgaris]
 gb|ESW29720.1| hypothetical protein PHAVU_002G093300g [Phaseolus vulgaris]
Length=472

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 158/223 (71%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LHVFF P +A+GH IPT+DMAKLFA +GVKATIITTP N P  +KA+ K       I ++
Sbjct  8    LHVFFIPFLAYGHFIPTVDMAKLFAEKGVKATIITTPLNAPFITKAIGKTKTSSTMIHVK  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +E P  E GLP  C++ + + +    P+FF+AC +LQ P E+LL+E RP+C+VAD+ FP
Sbjct  68   TIELPCAEAGLPNGCENTNSLTTGTLFPAFFRACGLLQYPFEQLLLEQRPNCVVADVMFP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD+AAK  +P L++ G+S+ ++CA   +  ++P+ +VS+DSE F IPNLP ++K+TR+
Sbjct  128  WATDSAAKLGVPSLVYDGTSFFSICANQCMGLYEPYKNVSTDSEPFLIPNLPGEIKMTRM  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            QVSP   S+  +  T++L  V+ES+  SYG + NSFYELE  Y
Sbjct  188  QVSPHAMSDESSGVTKLLDEVKESDLKSYGMVVNSFYELEKVY  230



>ref|XP_008375155.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Malus domestica]
Length=474

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 158/224 (71%), Gaps = 2/224 (1%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQI  257
             LH+FFFP MA GH IP ++MAKLFASRG K+T+ITTP N P+FSK +    +LGF ++I
Sbjct  8    QLHIFFFPYMAQGHFIPLINMAKLFASRGEKSTLITTPLNAPLFSKEIQSSKKLGFDVEI  67

Query  258  RLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFF  437
             +++FP  EVGLP+ C++ +   + E    F KA  +LQ  +E++L E RP CLVAD+FF
Sbjct  68   FVIKFPTEEVGLPQGCENANLATTREMKEKFIKATFLLQPQIEQILDEHRPHCLVADVFF  127

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
            PWATD AAKF +PR+IFHG  + A+CA+ S+  ++P   +SSDSE+FTIPN P ++KLTR
Sbjct  128  PWATDVAAKFGVPRIIFHGIGFFAMCASLSVALYEPHAKLSSDSEVFTIPNFPVEIKLTR  187

Query  618  LQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             QV    +   E  FT++ K  RE E+ SYG I NSFYELEP +
Sbjct  188  SQVPTFPKHSSE--FTKLFKEAREIEEKSYGFIVNSFYELEPAF  229



>gb|AAS94329.1| UDP-glucose:flavonoid-O-glucosyltransferase [Beta vulgaris]
Length=476

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 158/225 (70%), Gaps = 2/225 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGF-QIQI  257
            LH+  FP MAHGHMIPTLD+A+LFA+RGVK T+ITTP N P F  A++K  + G   I +
Sbjct  8    LHIVLFPFMAHGHMIPTLDIARLFAARGVKTTLITTPRNAPTFLTAIEKGNKSGAPTINV  67

Query  258  RLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFF  437
             +  F A   GLPE C+++++         FFKA AML++ LE  L + RP+CLVAD+FF
Sbjct  68   EVFNFQAQSFGLPEGCENLEQALGPGIRDRFFKAAAMLRDQLEHFLEKTRPNCLVADMFF  127

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
            PWATD+AAKF+IPRL+FHG    A+CA   +R H+P+N+ SSD E F +P+LPH+++LTR
Sbjct  128  PWATDSAAKFNIPRLVFHGHCLFALCALEIIRLHEPYNNASSDEEPFLLPHLPHEIELTR  187

Query  618  LQVS-PMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            LQ S  + ++  ++ + E  K ++ESE   YG + NSFYELEPDY
Sbjct  188  LQFSEELWKNGGDSDYKERSKAIKESELKCYGVLVNSFYELEPDY  232



>dbj|BAJ11652.1| glucosyltransferase [Sinningia cardinalis]
Length=478

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 160/227 (70%), Gaps = 5/227 (2%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            MG LH+ F P MAHGHMIP LDMAKLF S GVK TII+TPA    F++ V +  + G  I
Sbjct  1    MGQLHIVFLPFMAHGHMIPMLDMAKLFNSCGVKTTIISTPA----FAEPVRRAQESGIDI  56

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPS-FFKACAmlqeplerllmelrpDCLVAD  428
             +  ++FP     LP++  S+D+  +TE L S F KA  +LQEP+E+LL E  P+CLV+D
Sbjct  57   GLSTIKFPPEGSDLPDNFVSLDQTMATEDLISNFVKALDLLQEPVEKLLEEFNPNCLVSD  116

Query  429  LFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLK  608
            +F PW TD+AAK  IPRL+FHG S  A+CA   ++ HKP+ +VSSDSE F +PNLPHQLK
Sbjct  117  MFLPWTTDSAAKLGIPRLVFHGVSTFALCAMEQMKRHKPYKNVSSDSEPFILPNLPHQLK  176

Query  609  LTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             TR QVS  E  E E  F+++LK++RE+E+ SYG + NSFY+LE DY
Sbjct  177  FTRTQVSQHELEETENDFSKLLKQMREAEERSYGVVINSFYDLESDY  223



>ref|XP_010691725.1| PREDICTED: scopoletin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=476

 Score =   226 bits (577),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 158/225 (70%), Gaps = 2/225 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGF-QIQI  257
            LH+  FP MAHGHMIPTLD+A+LFA+RGVK T+ITTP N P F  A++K  + G   I +
Sbjct  8    LHIVLFPFMAHGHMIPTLDIARLFAARGVKTTLITTPRNAPTFLTAIEKGNKSGAPTINV  67

Query  258  RLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFF  437
             +  F A   GLPE C+++++         FFKA AML++ LE  L + RP+CLVAD+FF
Sbjct  68   EVFNFQAQSFGLPEGCENLEQALGPGIRDRFFKAAAMLRDQLEHFLEKTRPNCLVADMFF  127

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
            PWATD+AAKF+IPRL+FHG    A+CA   +R H+P+N+ SSD E F +P+LPH+++LTR
Sbjct  128  PWATDSAAKFNIPRLVFHGHCLFALCALEIIRLHEPYNNASSDEEPFLLPHLPHEIELTR  187

Query  618  LQVS-PMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            LQ S  + ++  ++ + E  K ++ESE   YG + NSFYELEPDY
Sbjct  188  LQFSEELWKNGGDSDYKERSKAIKESELKCYGVLVNSFYELEPDY  232



>ref|XP_002518725.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43650.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=483

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 163/226 (72%), Gaps = 5/226 (2%)
 Frame = +3

Query  84   HVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIRL  263
            H+FFFP MAHGHMIPT+DMAKLFASRG+K TI+TTP N+   SK + +   LG +I I++
Sbjct  9    HIFFFPFMAHGHMIPTVDMAKLFASRGLKTTIVTTPLNESFISKPIQRTKNLGLEINIKI  68

Query  264  LEFPAVEVGLPEDCQSVDKVPS----TEALPSFFKACAmlqeplerllmelrpDCLVADL  431
            L+FP VE GLPE C+++D + S     E +  F KA A+LQEPLE+LL   RPDCLVAD+
Sbjct  69   LKFPTVEAGLPEGCENLDFITSQNMDMEIVNKFLKAIALLQEPLEKLLSACRPDCLVADM  128

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPWAT+A++KF IPRL+FHG+S+ ++CAT S+  H+P   V+SDSE F +PNLP  +KL
Sbjct  129  FFPWATEASSKFRIPRLVFHGTSFFSLCATISVVLHEPHKKVASDSEPFIVPNLPGDIKL  188

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            +  Q+    R E  +   + ++   +SE TS+G + NSFYELEP Y
Sbjct  189  SGQQLPGFMR-EDGSYVAKFMEASIKSELTSFGVLANSFYELEPTY  233



>dbj|BAF75890.1| tetrahydroxychalcone glucosyltransferase [Dianthus caryophyllus]
Length=483

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 156/224 (70%), Gaps = 4/224 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+  FP +AHGHMIPTLD+A+LFA+R V+ +IITTP N P+F+KA++    L   I + 
Sbjct  8    LHIVMFPFLAHGHMIPTLDIARLFAARNVEVSIITTPVNAPIFTKAIETGNPL---INVE  64

Query  261  LLEFPAVEVGLPEDCQSVDKVPST-EALPSFFKACAmlqeplerllmelrpDCLVADLFF  437
            L +FPA E GLPE C++ + V    E +P FFKA  + Q+ LE  L  +RPDCLVAD+F+
Sbjct  65   LFKFPAKEAGLPEGCENAEIVIRQPELIPQFFKATHLFQQQLEEYLDRVRPDCLVADMFY  124

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
            PWATD+A KF++PRL+FHG S  A+CA  S+  ++P+ +VSSD E F +P LPH++KL R
Sbjct  125  PWATDSATKFNLPRLVFHGISCFALCAQESVSRYEPYRNVSSDDEPFALPGLPHEIKLIR  184

Query  618  LQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             Q+SP  R + E       + + +SE  S+G I NSFYELEP+Y
Sbjct  185  SQISPDSRGDKENSSKTTTELINDSEVESFGVIMNSFYELEPEY  228



>ref|XP_008358617.1| PREDICTED: scopoletin glucosyltransferase-like [Malus domestica]
Length=482

 Score =   226 bits (575),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 162/226 (72%), Gaps = 2/226 (1%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVD--KYTQLGFQI  251
            + HVF FP MAHGH++P LD AKLFA++GV+ TI+TTP N   FSKA    +      ++
Sbjct  7    EFHVFLFPYMAHGHIVPILDXAKLFAAQGVRTTIVTTPLNASTFSKATQSSEINSGNVKV  66

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
            +I+ ++FP+VE GLP+ C+ ++ +PS E   +F KA ++LQEPLE+LL++ +P  L+AD+
Sbjct  67   EIKTIKFPSVEAGLPDGCEYLNSLPSPELSTNFLKATSLLQEPLEQLLLDEKPSFLLADI  126

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
             FPWATDAAAKFDIPRL+FHG+S+ A  A+ ++  ++PF + SSD E F IPN P ++ +
Sbjct  127  CFPWATDAAAKFDIPRLVFHGTSFFASAASYNMSKYEPFKNSSSDLEPFVIPNFPGEITM  186

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR QV   ++  IE   T +LKR +ESE TSYG + NSFYELEP Y
Sbjct  187  TRAQVPAFDKENIENDLTRLLKRAKESEQTSYGIVVNSFYELEPVY  232



>ref|XP_004140708.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Cucumis sativus]
 ref|XP_004167459.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Cucumis sativus]
 gb|KGN57511.1| hypothetical protein Csa_3G200710 [Cucumis sativus]
Length=477

 Score =   225 bits (574),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 154/223 (69%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            L +FFFP MA GH IP +DMAKLFASRG    IITTP N P+ +K+++K+ + G +I++ 
Sbjct  8    LRIFFFPFMAQGHTIPAIDMAKLFASRGADVAIITTPLNAPLIAKSINKFDRPGRKIELL  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +++FP+V VGLP+ C+S+D   S E   SFF+A  +L+  ++++L   RP CLVAD FFP
Sbjct  68   IIDFPSVAVGLPDGCESLDLARSPEMFQSFFRATTLLEPQIDQILDHHRPHCLVADTFFP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W TD AAK+ IPR++FHG+ + A+CA  SL  ++P+  VSSD E F IP LP ++KLTR 
Sbjct  128  WTTDLAAKYGIPRVVFHGTCFFALCAAASLIANRPYKKVSSDLEPFVIPGLPDEIKLTRS  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            QV    + E+ET F ++    +E E   YG + NSFYELEP Y
Sbjct  188  QVPGFLKEEVETDFIKLYWASKEVESRCYGFLINSFYELEPAY  230



>gb|KDP24999.1| hypothetical protein JCGZ_23982 [Jatropha curcas]
Length=469

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/218 (54%), Positives = 157/218 (72%), Gaps = 3/218 (1%)
 Frame = +3

Query  105  MAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIRLLEFPAVE  284
            M+HGHMIP +DMAKLFA RG K T++TTP+N P+ SK + +   LGF   IR+LEFP+VE
Sbjct  1    MSHGHMIPAVDMAKLFAFRGHKTTVVTTPSNAPLISKTIQRTKDLGFDTNIRILEFPSVE  60

Query  285  VGLPEDCQSVDKVPSTE---ALPSFFKACAmlqeplerllmelrpDCLVADLFFPWATDA  455
             GLPE C+++D + S +    +  F  A A LQEPLE+LL E RP+CLVAD+FFPWATDA
Sbjct  61   AGLPEGCENMDSINSYDNDNMMDKFLLATAKLQEPLEKLLQECRPNCLVADMFFPWATDA  120

Query  456  AAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRLQVSPM  635
            A+KF IPRL+FHG+S+ ++CA  S+R ++P     SDSE F IP+LP ++K+TR Q+   
Sbjct  121  ASKFAIPRLVFHGTSFFSLCAGESIRLYQPHRKFLSDSEPFVIPSLPGEIKITRKQLPSS  180

Query  636  ERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             R E+E  FT+++K   ESE  S+G + NSFYELE  Y
Sbjct  181  FREEVENAFTKMIKESMESELKSFGVVVNSFYELEQAY  218



>ref|XP_003518713.1| PREDICTED: scopoletin glucosyltransferase-like [Glycine max]
 gb|KHN12233.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Glycine soja]
Length=481

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 160/224 (71%), Gaps = 1/224 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP +AHGHMIPT+DMAKLFA +GVKATIITTP N+P    A+ K    G +I I+
Sbjct  9    LHIFFFPFLAHGHMIPTVDMAKLFAEKGVKATIITTPLNEPFIYNAIGKSKTNGNKIHIQ  68

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +EFP+ E GL + C++ + VPS E L  FF A   LQEPLE+LL +  PDC+VAD+FFP
Sbjct  69   TIEFPSAEAGLLDGCENTESVPSPELLNPFFMATHFLQEPLEQLLQKQLPDCIVADMFFP  128

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFN-HVSSDSELFTIPNLPHQLKLTR  617
            WATD+AAKF IPRL+FHG+S+ ++C T  +  ++P + + SSDS+ F IPN P ++++ +
Sbjct  129  WATDSAAKFGIPRLVFHGTSFFSLCVTTCMPFYEPHDKYASSDSDSFLIPNFPGEIRIEK  188

Query  618  LQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             ++ P  +S+ +    ++L+  +ESE  SYG + NSFYELE  Y
Sbjct  189  TKIPPYSKSKEKAGLAKLLEEAKESELRSYGVVVNSFYELEKVY  232



>gb|AFK79034.1| glycosyltransferase UGT2 [Bupleurum chinense]
Length=474

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 159/225 (71%), Gaps = 3/225 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQ-LGFQIQI  257
            + VFFFP MAHGHMIP LDMAKLFAS GV +TII+TP N P F+K V+K    LGF++ I
Sbjct  2    VEVFFFPFMAHGHMIPILDMAKLFASHGVHSTIISTPLNAPSFAKGVEKSNDDLGFRMTI  61

Query  258  RLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFF  437
            +++EFP V  GLPEDC++ D+V S   +  F +A  ML+E +E+LL E RPDCLVAD+FF
Sbjct  62   KIVEFPKVS-GLPEDCENADQVTSPAMVSLFSRATMMLKEQIEQLLGEYRPDCLVADMFF  120

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
            PWA D+AAKFD+P L+F G+S+ A CA+  +  H+PF ++  +S+ F IPNLPH +KL  
Sbjct  121  PWAIDSAAKFDVPTLVFLGTSFFASCASEQVSLHEPFKNLKDESDEFIIPNLPHTVKLCL  180

Query  618  LQVSPMER-SEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             Q+ P ++  E  T   +IL   RE E  S G I NSFYELEPDY
Sbjct  181  GQIPPYQQEQEKNTDIAKILIAAREFEMRSNGVIVNSFYELEPDY  225



>ref|XP_011000140.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=486

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/223 (54%), Positives = 156/223 (70%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LHV F P MA GHMIPT+DMA+LFA RGVKATII+TP N P FSKA+++  QLG  I IR
Sbjct  8    LHVLFLPYMAPGHMIPTIDMARLFARRGVKATIISTPLNAPFFSKAIERDGQLGHDISIR  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +++FPA E GLPE C+++  + S +   +FFKA +MLQ+P+E+LL E  P CLVAD+ F 
Sbjct  68   IIKFPAAEAGLPEGCENLSSIKSWDMHANFFKAMSMLQQPIEQLLEECHPHCLVADMTFT  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WAT+ A K  IPRL F+G+SY A+C  +SL+ ++P   V SD E F +P LP Q+K TR 
Sbjct  128  WATEVADKLRIPRLYFNGTSYFAMCVFDSLKRYEPHRRVDSDFEPFIVPGLPDQIKTTRQ  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            QV    +   E  FT+ + +V ESE  SYG + NSF+ELEP Y
Sbjct  188  QVPDYLKQTTEHEFTKFVNQVSESEVRSYGVLVNSFHELEPAY  230



>ref|XP_009354715.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Pyrus x bretschneideri]
Length=475

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/224 (53%), Positives = 156/224 (70%), Gaps = 2/224 (1%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQI  257
             LH+FFFP M  GH IP +DMAKLFASRGVK+T+ITTP N P+FSKA+    +LGF + I
Sbjct  8    QLHIFFFPYMIQGHFIPLIDMAKLFASRGVKSTLITTPLNAPLFSKAIQSSKKLGFDVDI  67

Query  258  RLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFF  437
             +++FP  EVGLP+ C++ + V + E    F +A  +LQ  +E+LL E RP CLVAD F 
Sbjct  68   LVIKFPTEEVGLPQGCENANLVTTREMNEKFIRATFLLQPQIEQLLDEHRPHCLVADNFL  127

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
            PWATD AAKF IPR+IF G  + A+CA +S+  ++P   +SSDSE+FTIPN P ++KLTR
Sbjct  128  PWATDVAAKFGIPRIIFQGLGFFALCAFHSVALYEPHAKLSSDSEVFTIPNFPVEIKLTR  187

Query  618  LQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             Q+    +   E  FT++ K   ESE+ SYG I NSFYELEP +
Sbjct  188  SQIPNFPKQSAE--FTKLFKEAMESEEKSYGFIVNSFYELEPAF  229



>ref|XP_008236556.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Prunus mume]
Length=481

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/225 (53%), Positives = 161/225 (72%), Gaps = 3/225 (1%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQI  257
             LH+FFFP MA GH IP +D+AKLFASRGVK+T+ITT  N P+ SKA+     LGF+I+I
Sbjct  8    QLHIFFFPYMAQGHSIPLIDIAKLFASRGVKSTLITTTLNAPLLSKAIQSSKNLGFEIEI  67

Query  258  RLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFF  437
             +++FPA+EVGLP+  +      + E    FF+A  +L+  +E++L + RP CLVAD FF
Sbjct  68   LVIQFPAIEVGLPQGFEITSMATTHEMKEKFFQATFLLEPQIEQILDQHRPHCLVADSFF  127

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
            PWATD A KF IPRLIF+G  +L +CA+ S+  ++P   VSSDSE+FTIPNLP ++K+TR
Sbjct  128  PWATDVAGKFGIPRLIFYGPGFLPMCASLSVILYEPHLKVSSDSEVFTIPNLPVEIKITR  187

Query  618  LQVSPMERSEIETPF-TEILKRVRESEDTSYGAIFNSFYELEPDY  749
             QV   E++    PF +++LK  RE E+ SYG IFN+FYELEP +
Sbjct  188  NQVPIFEQN--ANPFLSKLLKESRECEERSYGIIFNTFYELEPAF  230



>ref|XP_002313133.1| hypothetical protein POPTR_0009s10120g [Populus trichocarpa]
 gb|EEE87088.1| hypothetical protein POPTR_0009s10120g [Populus trichocarpa]
Length=491

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 154/223 (69%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+ FFP MAHGHMIPT+DMA+LFA RGVKATI++TP N P+ SK +++  QLG  I I 
Sbjct  8    LHILFFPYMAHGHMIPTVDMARLFARRGVKATIVSTPLNAPLCSKTIERDRQLGLDISIH  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +++FP+ E GLPE C+++  +PS + L +F KA  MLQ+PLE+LL E  P CLVAD+ FP
Sbjct  68   IIKFPSAEAGLPEGCENLSSIPSPDMLSNFLKAIGMLQQPLEQLLEECHPSCLVADMVFP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WAT+AA K  IPRL F G+ +   C  +SL+ ++P   V SD E F +P LP Q+KLTRL
Sbjct  128  WATEAANKLRIPRLFFSGTGFFPACVFDSLKRYEPHKGVDSDFEPFVVPGLPDQIKLTRL  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            ++    +   E   T+++ ++ ES   SYG + NSF ELEP Y
Sbjct  188  RLPAYIKERTENELTKLMDKISESMVRSYGVLTNSFLELEPAY  230



>ref|XP_009354713.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Pyrus x bretschneideri]
Length=475

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 160/226 (71%), Gaps = 6/226 (3%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQI  257
             LH+FFFP M  GH IP ++MAKLFASRGVK+T+ITTP N P+FSK +    +LGF ++I
Sbjct  8    QLHIFFFPYMIQGHFIPLINMAKLFASRGVKSTLITTPLNAPLFSKEIQSSKKLGFDVEI  67

Query  258  RLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFF  437
             +++FP  EVGLP+ C++ +   ++E    F KA  +LQ  +E++L + RP CLVAD+FF
Sbjct  68   LVIKFPTEEVGLPQGCENGNLATTSEMNEKFIKATFLLQPQIEQILDKHRPHCLVADVFF  127

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
            PWATD AAKF IPR+IFHG  + A+CA+ S+  ++P   +SSDSE+FT+PN P ++KLTR
Sbjct  128  PWATDVAAKFGIPRIIFHGIGFFALCASLSVALYEPHAKLSSDSEVFTMPNFPVEIKLTR  187

Query  618  LQVS--PMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             Q+   P + SE    FT++ K   E E+ SYG I NSFYELEP +
Sbjct  188  SQMPTFPKQSSE----FTKLFKEAMEIEEKSYGFIVNSFYELEPAF  229



>ref|XP_010107898.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Morus notabilis]
 gb|EXC17298.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Morus notabilis]
Length=464

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 156/215 (73%), Gaps = 2/215 (1%)
 Frame = +3

Query  105  MAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIRLLEFPAVE  284
            MAHGHMIP +DMAKLFASRG KAT+I TPAN   F++ +++   LG +I+I LL+FP ++
Sbjct  1    MAHGHMIPAVDMAKLFASRGCKATVILTPANALFFTQEIERSRNLGLEIEIVLLKFPVLD  60

Query  285  VGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFPWATDAAAK  464
              LPE C++V  + S + +  FFKA  ML++PLE L+ E RP+CLVAD+ F WAT+ AA+
Sbjct  61   FELPEGCENVHMLTSDDMVEKFFKATTMLEQPLEELIKEHRPNCLVADITFSWATEVAAR  120

Query  465  FDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRLQVSPMERS  644
            F IPRL+FHG S+ A+C +  L  H+P+  VSSDSE F +PNLPH++KLTR Q+ P  + 
Sbjct  121  FGIPRLVFHGVSFFALCTSICLMEHEPYKKVSSDSEPFVVPNLPHEIKLTRDQLPPYIKQ  180

Query  645  EIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            E E     + ++  ESE+TSYG I NS+YELEPDY
Sbjct  181  ESE--LATLARQFTESEETSYGVIVNSYYELEPDY  213



>ref|XP_009354714.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Pyrus x bretschneideri]
Length=477

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 158/226 (70%), Gaps = 6/226 (3%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQI  257
             LH+FFFP M  GH IP +++A+LFASRGVK+T+I TP N P+FSKA+    +LG  + I
Sbjct  8    QLHIFFFPYMVQGHFIPLINIARLFASRGVKSTLIATPLNAPLFSKAIQSSKKLGIDVDI  67

Query  258  RLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFF  437
             +++FP  EVGLP+ C++ + V + E    F KA  +LQ  +E++L + RP CLVAD FF
Sbjct  68   LVIKFPTEEVGLPQGCENANLVTTLEMNEKFIKATFLLQPQIEQILDKHRPHCLVADTFF  127

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
            PWATD AAKF IPR+IFHG  + A+CA+ S+  ++P   +SSDSE FTIPN P ++KLTR
Sbjct  128  PWATDVAAKFGIPRIIFHGMGFFALCASRSVALYEPHAKLSSDSEAFTIPNFPVEIKLTR  187

Query  618  LQV--SPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             Q+   P + +EI    T++LK  RES + SYG I NSFYELEP +
Sbjct  188  SQMPNVPKQSAEI----TKLLKESRESGEKSYGFIVNSFYELEPAF  229



>ref|XP_003518714.1| PREDICTED: scopoletin glucosyltransferase-like [Glycine max]
Length=487

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/227 (51%), Positives = 160/227 (70%), Gaps = 4/227 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKY---TQLGFQI  251
            LHVFF P +AHGH+IPT+DMAKLFA +G+K TIITTP N P  SKA+ K    +     I
Sbjct  8    LHVFFIPFLAHGHIIPTIDMAKLFAGKGLKTTIITTPLNVPFISKAIGKAESESNDNNVI  67

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             I  +EFP  E GLP+ C++ + + S    P+FFKA  +LQ P E+LL++  P+C+VAD+
Sbjct  68   HIETIEFPYAEAGLPKGCENTNSITSMHLYPAFFKALGLLQHPFEQLLLQQHPNCVVADV  127

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
             FPWAT+++AKF +P L++ G+S+ ++CA    R ++P+ +VSSDSE F IPNLP ++ +
Sbjct  128  MFPWATNSSAKFGVPSLVYDGTSFFSICANECTRLYEPYKNVSSDSEPFVIPNLPGEITM  187

Query  612  TRLQVSPMERSEIETP-FTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR+QVSP   S  E+P  T++L+ V+ESE  SYG + NSFYELE  Y
Sbjct  188  TRMQVSPHVMSNKESPAVTKLLEEVKESELKSYGMVVNSFYELEKVY  234



>dbj|BAF75893.1| tetrahydroxychalcone glucosyltransferase [Dianthus caryophyllus]
Length=486

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 161/228 (71%), Gaps = 7/228 (3%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQ--IQ  254
            LH+ FFP +AHGHMIPTLD+A+LFA+R V+ATIITT  N P F+ AVD   ++G    ++
Sbjct  8    LHIVFFPFLAHGHMIPTLDVARLFAARNVEATIITTRVNAPRFTSAVDTGNRIGNNQTVK  67

Query  255  IRLLEFPAVEVGLPEDCQSVD---KVPSTEALPSFFKACAmlqeplerllmelrpDCLVA  425
            + LL FP  E G+PE C++ +   ++P    +P FFK   +L+E LE+ L  ++P+CLVA
Sbjct  68   LELLRFPTHEAGVPEGCENAEIAMRIPGM--MPRFFKGTQLLREQLEQYLSRVKPNCLVA  125

Query  426  DLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQL  605
            D+F+PWAT++A K+DIPRL+FHG+SY ++CA   +R H+P+  V  ++E FTIP +PH +
Sbjct  126  DMFYPWATESANKYDIPRLVFHGTSYFSLCAQEIVRVHEPYKMVLCNNEKFTIPLIPHDI  185

Query  606  KLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            KL R Q+ P   S+ +  F + +  V++SE  SYG I NSFYELEPDY
Sbjct  186  KLLRSQMCPDLISDEDNDFRKRMDLVKKSEVESYGVIVNSFYELEPDY  233



>ref|XP_008375156.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Malus domestica]
Length=475

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/224 (52%), Positives = 156/224 (70%), Gaps = 2/224 (1%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQI  257
             LH+FFFP M  GH IP ++MAKLFASRGVK+T+ITTP N P+FSKA+    +LGF + I
Sbjct  8    QLHIFFFPYMIQGHFIPLINMAKLFASRGVKSTLITTPLNAPLFSKAIQSSKKLGFDVDI  67

Query  258  RLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFF  437
             +++FP  EVGLP+ C++ +   + E    F KA  +LQ  +E++L E RP CLVAD FF
Sbjct  68   LVIKFPTEEVGLPQGCENANLATTREMNEKFIKATFLLQPQIEQILYEHRPHCLVADNFF  127

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
            PWATD AAKF IPR+IF G  + A+CA +S+  ++P   +SSDSE+FTIP+ P ++KLTR
Sbjct  128  PWATDVAAKFGIPRIIFQGLGFFALCAFHSVALYEPHAKLSSDSEVFTIPSFPVEIKLTR  187

Query  618  LQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             Q+    +   E  FT++ K   ESE+ SYG I NSFYELEP +
Sbjct  188  SQIPNFPKQSAE--FTKLFKEAMESEEKSYGFIVNSFYELEPAF  229



>ref|XP_011000141.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=486

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 160/223 (72%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+ FFP MA GH+IPT+DMA+ FA  GVKATIITTP N P+FS+ +++  ++G +I+I 
Sbjct  8    LHIAFFPFMAQGHIIPTVDMARTFARHGVKATIITTPLNAPLFSRTIERDIEMGSKIRIL  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +++FP+ + GLPE C++   + + E +P FFKA ++LQ+PLE LL E RP+CLVAD+ FP
Sbjct  68   IMKFPSADAGLPEGCENASSIETLEMVPKFFKAVSLLQQPLEYLLEECRPNCLVADMMFP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WAT  A KF IPRL+FHG+SY A+C ++ L+  +P+  + +D E FT+P LP ++KLTRL
Sbjct  128  WATKVANKFGIPRLVFHGTSYFALCVSDCLKRFEPYKSIETDLEPFTVPGLPDKIKLTRL  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    +   E  FT+ +  +  ++  SYG I NSF+ELEP Y
Sbjct  188  QLPSYVKENSE--FTKQMDEISRADLESYGVIMNSFHELEPAY  228



>ref|XP_007153574.1| hypothetical protein PHAVU_003G047000g [Phaseolus vulgaris]
 gb|ESW25568.1| hypothetical protein PHAVU_003G047000g [Phaseolus vulgaris]
Length=461

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 157/224 (70%), Gaps = 6/224 (3%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP +AHGH IP +DMA LFA++GV+ TIITTP N P+ SKA++K  +    I I+
Sbjct  8    LHIFFFPFLAHGHTIPCIDMAILFAAKGVRTTIITTPLNAPIISKAIEKTKE----INIQ  63

Query  261  LLEFPAVE-VGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFF  437
             ++FP+ +  GLP+ C+ V  +PS   LP+F KA  +LQEP E+LL +  P+C+VAD+FF
Sbjct  64   TIKFPSTDHTGLPQGCEHVSTLPSLHLLPAFHKATTLLQEPFEQLLRDQHPNCVVADMFF  123

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
            PW TD+AAKF IPRL+FHG S+ ++CA   +R ++P+N+ S DSELF +PN P Q+K+TR
Sbjct  124  PWTTDSAAKFGIPRLVFHGMSFFSLCAYEVMRLYEPYNNTSFDSELFLLPNFPGQIKMTR  183

Query  618  LQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            LQV    R   +       K++ ESE  SYG + NS YE+E DY
Sbjct  184  LQVGSFFRKN-DVEANRFWKQIHESEVRSYGVVVNSVYEVEKDY  226



>ref|XP_008456146.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Cucumis melo]
Length=477

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 153/223 (69%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            L +FFFP MA GH IP +DMAKLFASRG    IITT  N P+ +K+++K+ + G +I++ 
Sbjct  8    LRIFFFPFMAQGHTIPAIDMAKLFASRGADVAIITTRVNAPLIAKSINKFDRPGRKIELL  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +++FP+V VGLP+ C+S+D   S E   SFF+A  ML+  ++++L   RP CLVAD FFP
Sbjct  68   IIDFPSVAVGLPDGCESLDLARSPEMFQSFFRATTMLEPQIDQILDHHRPHCLVADTFFP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W TD AAK+ IPR++FHG+ + A+CA  SL  ++P+  VSSD E F IP LP ++KLTR 
Sbjct  128  WTTDLAAKYGIPRVVFHGTCFFALCAAASLIANRPYQKVSSDLEPFVIPGLPDEIKLTRS  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            QV    + E+ET F ++    +E E   YG + NSFYELEP Y
Sbjct  188  QVPGFLKEEVETDFIKLYWASKEVESRCYGFLINSFYELEPAY  230



>ref|XP_010027866.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW54507.1| hypothetical protein EUGRSUZ_I00449 [Eucalyptus grandis]
Length=485

 Score =   221 bits (562),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 151/223 (68%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP MA GHMIP +DMAKLFA RG K+T+I TP ++P F K++ K    GF I + 
Sbjct  8    LHMFFFPFMAPGHMIPMIDMAKLFAIRGCKSTLIATPHDEPTFLKSIAKAKDSGFDIDVV  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            ++  P  EVGLPEDC +++KV + E    F +A  ML + LE L+ +L PDCLV+D+F P
Sbjct  68   IVTLPLKEVGLPEDCDNMNKVTTAEIRKQFMRAIMMLDQQLELLIEKLAPDCLVSDMFLP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W T+ AAK+ IPRL+FHG+S  ++  T  +R ++P   VS DSE F IPN P ++ ++R+
Sbjct  128  WTTEIAAKWGIPRLVFHGTSAFSISGTECVRIYEPHKKVSHDSESFIIPNFPGEITMSRM  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    R   ET FT+    V+ESE TS+G + NSFYELEP Y
Sbjct  188  QLPDFYRE--ETEFTKFFNEVKESEKTSFGVVMNSFYELEPAY  228



>ref|XP_006422965.1| hypothetical protein CICLE_v10030025mg [Citrus clementina]
 gb|ESR36205.1| hypothetical protein CICLE_v10030025mg [Citrus clementina]
Length=218

 Score =   212 bits (539),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 149/198 (75%), Gaps = 1/198 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP+MAHGHMIP +DMAKLF SRGVK T+ITTPAN  +FSKA+ +  +LG +I I+
Sbjct  8    LHIFFFPLMAHGHMIPLVDMAKLFGSRGVKTTVITTPANATLFSKAIPRANELGIEIDIK  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALP-SFFKACAmlqeplerllmelrpDCLVADLFF  437
             ++FP+VEVGLPE  ++++++ S   +P  F K   MLQEPLE LL E +P+CLVAD+ F
Sbjct  68   TIKFPSVEVGLPEGSENLNEMTSQPDMPVKFLKGVTMLQEPLELLLQEHKPNCLVADMLF  127

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
            PWATDAAAKF IPRL+FHG+S+L++CAT  L  ++P   VSS SE F IPNLP  +KLTR
Sbjct  128  PWATDAAAKFGIPRLVFHGTSFLSLCATACLMLYEPHKKVSSVSEPFVIPNLPGDIKLTR  187

Query  618  LQVSPMERSEIETPFTEI  671
             Q+    + + ET F+ +
Sbjct  188  NQLPDTMKQDDETDFSSV  205



>ref|XP_008342034.1| PREDICTED: scopoletin glucosyltransferase-like [Malus domestica]
Length=481

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 159/226 (70%), Gaps = 3/226 (1%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVD--KYTQLGFQI  251
            + HVF FP M+HGHMIP  DMAKLFA++GVK TI+TTP N   F KA    K      ++
Sbjct  7    EFHVFLFPFMSHGHMIPISDMAKLFAAQGVKTTIVTTPLNASTFYKATQSSKTNSGSVKV  66

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
            +I+ ++FP+ E GLP+ C+ +D + S E   +F KA ++LQEPLE+LL++  P  L+AD+
Sbjct  67   EIKTIKFPS-EAGLPDGCEILDSLASPELSTNFLKATSLLQEPLEQLLLDQNPSFLLADI  125

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
             FPWATDAAAKFDIPRL+FHG+S+ A+ A+ ++  ++PF + SSD E F IPN P ++ +
Sbjct  126  CFPWATDAAAKFDIPRLVFHGTSFFALAASYNMSKYEPFKNSSSDLEPFVIPNFPGEITM  185

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR QV   ++  IE   T +LKR +ESE TSYG + NSFYELEP Y
Sbjct  186  TRAQVPAFDKENIENDVTRMLKRAKESEQTSYGIVVNSFYELEPVY  231



>ref|XP_010263455.1| PREDICTED: scopoletin glucosyltransferase-like [Nelumbo nucifera]
Length=496

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 155/223 (70%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LHVF FP MAHGHMIP +DMA+ FA RGVK TI+TTP N  + SK VD+  +LG +I I 
Sbjct  8    LHVFLFPFMAHGHMIPFMDMARQFALRGVKVTIVTTPLNAILLSKTVDRDRELGIEIDIH  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             + FP  E GLPE C++V+ + + E   +FFKA  MLQ+P ++LL E  PDC+VAD+FFP
Sbjct  68   SIPFPTKEAGLPEGCENVNSITTPELSSNFFKALNMLQQPFQKLLEEHHPDCIVADMFFP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W TD A K  IPRL+FHGS + + C  +S+  + P N+VSS++E F +P LP  +++T+ 
Sbjct  128  WTTDFAGKLGIPRLVFHGSCFFSSCVPDSISRYAPHNNVSSETETFVVPGLPDPIEMTKS  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+   +  +I+  FT  +++++E+E  SYG + NSFYELEP Y
Sbjct  188  QLP--DHMKIQNDFTRAMEQIKEAEVKSYGVVMNSFYELEPAY  228



>ref|XP_009108750.1| PREDICTED: UDP-glucosyl transferase 73B2-like [Brassica rapa]
Length=513

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 120/256 (47%), Positives = 168/256 (66%), Gaps = 16/256 (6%)
 Frame = +3

Query  18   AEISQSIKNFAVSSKDFAMGD---LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITT  188
            ++IS++I +F+  SK     +   LHV FFP+MAHGHMIPTLDMAKLF+SRG K+TI+TT
Sbjct  15   SQISRNI-SFSFQSKSNMTSNSHKLHVMFFPIMAHGHMIPTLDMAKLFSSRGAKSTILTT  73

Query  189  PANQPVFSKAVDKYTQLG--FQIQIRLLEFPAVEVGLPEDCQSVDKVPSTE-------AL  341
            P N  +  K +D +  L    QI+I++L+FP V++GLPE C++ D    T         +
Sbjct  74   PLNAKILQKPIDTFKNLNPSLQIEIQILDFPCVQLGLPEGCENADFFTLTNNSDDRRAMI  133

Query  342  PSFFKACAmlqeplerllmelrpDCLVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCAT  521
              FF A    ++ LE LL   RPDCL+AD+FFPWAT+AA KF +PRL+FHG+ Y ++CA+
Sbjct  134  SKFFLATRFFKDQLENLLETRRPDCLIADMFFPWATEAAEKFHVPRLVFHGTGYFSLCAS  193

Query  522  NSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRLQVSPMERSEIETPFTEILKRVRESEDT  701
              +R H P   V++ SE F IP+LP  + +T+ Q+  ++R E +T   + +  V ESE  
Sbjct  194  YCIRVHNPQKRVATSSEPFVIPDLPGNIVITQGQI--LDRGE-DTEMGKFMTEVLESEAK  250

Query  702  SYGAIFNSFYELEPDY  749
            S G + NSFYELEPDY
Sbjct  251  SSGVVVNSFYELEPDY  266



>ref|XP_004305939.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Fragaria vesca subsp. vesca]
Length=483

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/224 (49%), Positives = 154/224 (69%), Gaps = 0/224 (0%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQI  257
             LH+FF P MA GH +P +D+AKLFASRGVK TI+TT AN P+ S+A+      GF+I++
Sbjct  8    QLHIFFLPFMAPGHTLPLIDIAKLFASRGVKCTIVTTHANAPIISQAIKTSIGFGFEIKL  67

Query  258  RLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFF  437
             L++FP+ EVGL E  +S+    + E      KA  +LQ+ +E++L +  P CLVAD  F
Sbjct  68   VLIKFPSTEVGLHEGIESIKLEKTKEMRKGLVKATTLLQQQVEQVLDQHHPHCLVADFLF  127

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
             WATD AAKF+IPRL+FHG+ + A+CA  S+  ++P   VSSDSE F IP+LP+++K+TR
Sbjct  128  HWATDVAAKFEIPRLVFHGTGFFALCALKSIMLYQPHLKVSSDSESFVIPSLPNEIKMTR  187

Query  618  LQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             ++ P      +T   +++K  RE+E+ SYG I NSFYELEPDY
Sbjct  188  NKLVPFLTLNGKTELIKLIKLSREAEERSYGIIVNSFYELEPDY  231



>dbj|BAG31950.1| UGT73A9 [Antirrhinum majus]
Length=481

 Score =   219 bits (557),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 158/226 (70%), Gaps = 5/226 (2%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            MG LH+  FP+MAHGHMIP LDMAKLF SRG++ TII+T A    F+  ++K    G  I
Sbjct  1    MGKLHIALFPVMAHGHMIPMLDMAKLFTSRGIQTTIISTLA----FADPINKARDSGLDI  56

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             + +L+FP    G+P+   S+D V + + LP F ++  +LQEP+E+L+ EL+ DCLV+D+
Sbjct  57   GLSILKFPPEGSGIPDHMVSLDLV-TEDWLPKFVESLVLLQEPVEKLIEELKLDCLVSDM  115

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            F PW  D AAKF IPRL+FHG+S  A+CA+  ++ HKP+ +V+SD+E F IP+ PH+LK 
Sbjct  116  FLPWTVDCAAKFGIPRLVFHGTSNFALCASEQMKLHKPYKNVTSDTETFVIPDFPHELKF  175

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             R QV+P + +E E  F++++K++ ES   SYG + NSFYELE  Y
Sbjct  176  VRTQVAPFQLAETENGFSKLMKQMTESVGRSYGVVVNSFYELESTY  221



>gb|KCW64674.1| hypothetical protein EUGRSUZ_G02260, partial [Eucalyptus grandis]
Length=424

 Score =   217 bits (552),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 153/223 (69%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            +HV FFP+MAHGHM+PTLDMA+LF +RG +ATIITTP N PVF  ++      G +I +R
Sbjct  9    VHVLFFPLMAHGHMLPTLDMARLFTARGARATIITTPHNAPVFQNSLQ--IDAGSRIDLR  66

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +EFP  EVGLPE  +++D V + +    FF+A +ML  PLE L+ EL PD LVAD+FFP
Sbjct  67   TIEFPTREVGLPEGLENLDMVTTQDIQLKFFRAISMLSRPLEALVEELAPDALVADIFFP  126

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            +A D AA   IPRL FHG+S+ ++CA  S++ H+P   VSSD ELF +P LP ++ +TR 
Sbjct  127  FANDIAAGHGIPRLAFHGTSFFSMCAAESVQRHRPHEKVSSDDELFRLPGLPDEIMMTRS  186

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    +  +ET FT +LKR  ++    +G I NSF+ELEP Y
Sbjct  187  QIRDELKISVETDFTRLLKRSHQAAGRCFGMIVNSFHELEPSY  229



>ref|XP_004304022.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Fragaria vesca subsp. vesca]
Length=477

 Score =   218 bits (556),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 113/225 (50%), Positives = 156/225 (69%), Gaps = 3/225 (1%)
 Frame = +3

Query  75   GDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQ  254
            G +H+F FP MAHGHMIP  D AKLFAS GVK TI+TTP N   F++         F IQ
Sbjct  7    GSVHIFLFPFMAHGHMIPVSDTAKLFASYGVKITIVTTPLNAIRFAQTTQSSK---FNIQ  63

Query  255  IRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLF  434
            I+ +EFP+ E GLP+ C++VD +PS + +  FFKA  +LQ   E LL E +P C+VAD+ 
Sbjct  64   IKAIEFPSEEAGLPKGCENVDTLPSPDLVNPFFKATRLLQPQFEELLKEFKPTCIVADMV  123

Query  435  FPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLT  614
            FPWAT+AAAKF IPRL+F G+S+ A+CA + ++ ++P++ VSS++E F IP LP +++LT
Sbjct  124  FPWATEAAAKFGIPRLVFSGTSFFAMCALDCVKVYEPYSKVSSETEPFVIPYLPGEIELT  183

Query  615  RLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            R Q+    ++ +    T++LK  RE+E  S+G I NSFYELEP Y
Sbjct  184  RAQLPDFIKNNVLNDVTQLLKEAREAELKSFGIIMNSFYELEPVY  228



>ref|XP_010030422.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=304

 Score =   213 bits (542),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 148/221 (67%), Gaps = 2/221 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP+MA GHMIP +DMAKLFA RG K+T+ITTP ++P F K++ K    GF I + 
Sbjct  8    LHIFFFPLMAPGHMIPMIDMAKLFAIRGCKSTLITTPHDEPTFLKSIAKTKDSGFDIDVV  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +  P  EVGLPEDC ++ KV + E    F +A  ML   LE L+ +L P+CL++D+F P
Sbjct  68   TVTLPLKEVGLPEDCDNLSKVTTVEIRKQFMRATMMLDRQLELLIEKLAPNCLISDMFLP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W T+ AAK++IPRL FHG+   +   T  +R ++P   VS DSE F IPN P ++ ++R+
Sbjct  128  WTTEIAAKYEIPRLTFHGTGAFSFAGTVCVRLYEPHKKVSCDSEPFIIPNFPGEITMSRM  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEP  743
            Q+  + R   ET F E   +V+ESE+ S+G I NSFYELEP
Sbjct  188  QLPDLFRE--ETDFIEFYNKVKESEERSFGVIMNSFYELEP  226



>ref|XP_007042491.1| Anthocyanin 3'-O-beta-glucosyltransferase [Theobroma cacao]
 gb|EOX98322.1| Anthocyanin 3'-O-beta-glucosyltransferase [Theobroma cacao]
Length=425

 Score =   216 bits (551),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 155/223 (70%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+ F P +AHGH+IPT+DMA+LFA  GVK TI TTP N  +F+K + + ++ GF+I   
Sbjct  8    LHIVFLPQLAHGHLIPTVDMARLFARHGVKVTIATTPLNAHLFAKTIQRDSESGFEIGTY  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +++FP+ EVGLPE C++V  + S E    FFKA  + Q+PLE+LL ELRPDCLVADL F 
Sbjct  68   IIKFPSAEVGLPEGCENVSSLTSQEMQNKFFKAVNLFQQPLEQLLEELRPDCLVADLMFS  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD A+KF IPRL+FHG+S  ++   +S+  H P+  +++D E F +P LP Q+K+T++
Sbjct  128  WATDVASKFGIPRLVFHGTSCFSISIVDSVIRHAPYKKIATDFEFFDVPGLPDQIKMTKM  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    + E  +   +++    ESE TS+G I NSFYELEP Y
Sbjct  188  QLPDFMKEEEGSERRKMMNEALESERTSFGVIVNSFYELEPAY  230



>gb|KCW54504.1| hypothetical protein EUGRSUZ_I004473, partial [Eucalyptus grandis]
Length=278

 Score =   212 bits (539),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 148/221 (67%), Gaps = 2/221 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP+MA GHMIP +DMAKLFA RG K+T+ITTP ++P F K++ K    GF I + 
Sbjct  40   LHIFFFPLMAPGHMIPMIDMAKLFAIRGCKSTLITTPHDEPTFLKSIAKTKDSGFDIDVV  99

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +  P  EVGLPEDC ++ KV + E    F +A  ML   LE L+ +L P+CL++D+F P
Sbjct  100  TVTLPLKEVGLPEDCDNLSKVTTVEIRKQFMRATMMLDRQLELLIEKLAPNCLISDMFLP  159

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W T+ AAK++IPRL FHG+   +   T  +R ++P   VS DSE F IPN P ++ ++R+
Sbjct  160  WTTEIAAKYEIPRLTFHGTGAFSFAGTVCVRLYEPHKKVSCDSEPFIIPNFPGEITMSRM  219

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEP  743
            Q+  + R   ET F E   +V+ESE+ S+G I NSFYELEP
Sbjct  220  QLPDLFRE--ETDFIEFYNKVKESEERSFGVIMNSFYELEP  258



>ref|XP_010068736.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=499

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 153/223 (69%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            +HV FFP+MAHGHM+PTLDMA+LF +RG +ATIITTP N PVF  ++      G +I +R
Sbjct  9    VHVLFFPLMAHGHMLPTLDMARLFTARGARATIITTPHNAPVFQNSLQ--IDAGSRIDLR  66

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +EFP  EVGLPE  +++D V + +    FF+A +ML  PLE L+ EL PD LVAD+FFP
Sbjct  67   TIEFPTREVGLPEGLENLDMVTTQDIQLKFFRAISMLSRPLEALVEELAPDALVADIFFP  126

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            +A D AA   IPRL FHG+S+ ++CA  S++ H+P   VSSD ELF +P LP ++ +TR 
Sbjct  127  FANDIAAGHGIPRLAFHGTSFFSMCAAESVQRHRPHEKVSSDDELFRLPGLPDEIMMTRS  186

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    +  +ET FT +LKR  ++    +G I NSF+ELEP Y
Sbjct  187  QIRDELKISVETDFTRLLKRSHQAAGRCFGMIVNSFHELEPSY  229



>ref|XP_002298737.1| hypothetical protein POPTR_0001s30980g [Populus trichocarpa]
 gb|EEE83542.1| hypothetical protein POPTR_0001s30980g [Populus trichocarpa]
Length=491

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 154/223 (69%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LHV F P MA GHMIP +DMA+LFA RGVKATII+TP N P FSKA+++  QLG  I IR
Sbjct  8    LHVLFLPYMAPGHMIPIVDMARLFARRGVKATIISTPLNAPFFSKAIERDGQLGHDISIR  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +++FP+ E GLPE C+++  + S +   +F KA +MLQ+P+E+LL E  P CLVAD+ F 
Sbjct  68   IIKFPSAEAGLPEGCENLSSIISWDMHANFLKAMSMLQQPIEQLLEECHPHCLVADMTFT  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WAT+ A K  IPRL F G+SY A+C  +SL+ ++P   V SD E F +P LP Q+K TR 
Sbjct  128  WATEVADKLRIPRLYFSGTSYFAMCVFDSLKRYEPHRRVDSDFEPFIVPGLPDQIKTTRQ  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    +   E  FT+++ +V ESE  SYG + NSF+ELEP Y
Sbjct  188  QLPDYLKQTTEHEFTKLVNQVSESELRSYGVLVNSFHELEPAY  230



>ref|XP_010030443.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=239

 Score =   210 bits (535),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/229 (48%), Positives = 154/229 (67%), Gaps = 5/229 (2%)
 Frame = +3

Query  72   MGD---LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG  242
            MG+   +H+FFFP +A GHMIP +DMAKLFA RG K+T+I TP ++P F K++ K    G
Sbjct  1    MGESHQVHIFFFPFVASGHMIPMIDMAKLFAIRGCKSTLIATPHDKPTFLKSIAKTKDDG  60

Query  243  FQIQIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLV  422
            F I +  +  P  EVGLPEDC +++KV + E    FF+A  ML + LERL+ +L PDCLV
Sbjct  61   FDIDVITVTLPLKEVGLPEDCDNMNKVTTVEVRKQFFRAIKMLDQQLERLIEKLAPDCLV  120

Query  423  ADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQ  602
            +D+  PW T+ AAK+ IPRL+FHG+S  ++ +   +R ++P   VS DSE F IPN P +
Sbjct  121  SDMLLPWTTEIAAKWGIPRLVFHGTSAFSIASMECVRLYEPQKRVSCDSEPFVIPNFPGE  180

Query  603  LKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            + ++R+Q+  + R E E   T++L  + ESE  S+G I NSFYELEP Y
Sbjct  181  ITMSRMQLPDVYREETEV--TKLLNVMMESEKRSFGVIMNSFYELEPAY  227



>gb|AHV78225.1| glucosyltransferase [Amaranthus hypochondriacus]
Length=487

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/230 (49%), Positives = 157/230 (68%), Gaps = 1/230 (0%)
 Frame = +3

Query  63   DFAMGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG  242
            D  +  LHV FFP MA+GHMIPTLD+A+LFA+RGVK TIITTP + P+ ++A++K  + G
Sbjct  3    DDELQKLHVVFFPFMAYGHMIPTLDIARLFAARGVKTTIITTPVSLPIVTQAIEKAIKHG  62

Query  243  F-QIQIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCL  419
               I   +  FP+ E GLP+ C++V++      +P F +A  ML  PLE+ L + RP CL
Sbjct  63   SPAIYTEIFSFPSAENGLPDGCETVNQAIKYYMIPKFMQAVEMLNTPLEQYLEKTRPHCL  122

Query  420  VADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPH  599
            V+D+F PW TD AAKF++PRL+FHG+SY A+CA   +R +KP+ +VS+D E F +P+LPH
Sbjct  123  VSDMFLPWTTDCAAKFNVPRLVFHGTSYFALCAEEIVRVYKPYKNVSNDEETFILPSLPH  182

Query  600  QLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            ++K+T+ Q S     E      +  + ++ESE  SYG I NSFYELE DY
Sbjct  183  EVKMTKSQFSEDFMKEELNESKKEFELIKESEIKSYGVIVNSFYELERDY  232



>ref|XP_002518723.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43648.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=479

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 157/224 (70%), Gaps = 2/224 (1%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQI  257
            +L+ FFFP MA GH IP +DMAKLFASRG K +IITTP N P  SKA+++   LG +I I
Sbjct  10   ELYFFFFPFMAQGHSIPLIDMAKLFASRGQKVSIITTPVNAPDISKAIERSRVLGHEIDI  69

Query  258  RLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFF  437
             +++FP VE GLPE C+ ++ V S E   +FF A  +L +PLE LL + RPDCLVAD FF
Sbjct  70   LIIKFPCVEAGLPEGCEHLELVTSPEMGLNFFMATDILAKPLEHLLKQYRPDCLVADTFF  129

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
            PW+ +AA+K  IPR++F G+ + + CA+  +  ++P+ ++SSD++LF IP  P ++KLTR
Sbjct  130  PWSNEAASKSGIPRIVFSGTCFFSSCASQCVNKYQPYKNISSDTDLFVIPEFPGEIKLTR  189

Query  618  LQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             Q+   E    +T F+E  ++V+E+E   YG I NSFYELEPDY
Sbjct  190  NQLP--EFVIQQTGFSEFYQKVKEAEAKCYGVIVNSFYELEPDY  231



>gb|AIS71990.1| UDP-glycosyl transferase 1, partial [Haloxylon ammodendron]
Length=490

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 161/225 (72%), Gaps = 3/225 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL-GFQIQI  257
            LHV FFP+MAHGHMIPTLD A+LFA+RGVKATIITTP N P+F++A++K  +  G  I I
Sbjct  4    LHVVFFPLMAHGHMIPTLDTARLFAARGVKATIITTPCNMPIFTQAIEKSKESEGPMIDI  63

Query  258  RLLEFPAVEVGLPEDCQSVDK-VPSTEALPSFFKACAmlqeplerllmelrpDCLVADLF  434
             + +F  VE GLP+ C+++ + + S +    FF+A +MLQ+ LE  L  +RP  LVAD+F
Sbjct  64   EVFKFSLVEDGLPKGCENLKQAMSSLDMAQKFFRAASMLQQQLEVYLERVRPHVLVADMF  123

Query  435  FPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLT  614
            F WAT+ AAKF+IPRL+F+G+S+ A C  + +  H+P+ HVSSD E F IP+LPH++ LT
Sbjct  124  FTWATECAAKFNIPRLVFYGTSFFADCVRDMIMVHQPYKHVSSDYEPFVIPSLPHEIMLT  183

Query  615  RLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            R Q+ P   +  E+   +  + ++ESE  SYG I NSFYELEP+Y
Sbjct  184  RSQL-PEGLTMNESELKKRHEMMQESEVQSYGVIVNSFYELEPNY  227



>gb|EYU37652.1| hypothetical protein MIMGU_mgv1a005524mg [Erythranthe guttata]
Length=480

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/227 (51%), Positives = 158/227 (70%), Gaps = 5/227 (2%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            MG LH+ F P+MAHGH IPTLDMAKLF SRG+K TII TPA    F+  + K  + G  I
Sbjct  1    MGQLHIVFLPVMAHGHTIPTLDMAKLFTSRGLKTTIIATPA----FAGPITKAQESGHAI  56

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             + +L+FP     LP++  S+D++ + + +P F +A ++L+EP+E+LL EL P+CLV+D+
Sbjct  57   NLSILKFPPKGSSLPDNVVSLDQMSTPDLIPKFVEALSLLREPVEKLLQELNPNCLVSDM  116

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            F PW  D+AAKF IPRL+FHG++  A C    +  HKP+ +VSSD+E F++PNLPH+L  
Sbjct  117  FLPWTADSAAKFGIPRLVFHGTNCFAQCVAEQMHIHKPYKNVSSDAEPFSVPNLPHELTF  176

Query  612  TRLQVSPMERSEI-ETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR QV   E  E  E  F+++ K++RES+  SYG IFNSF ELE DY
Sbjct  177  TRSQVPEFELFEDEENEFSKLRKQMRESDKKSYGVIFNSFTELESDY  223



>gb|AFJ52929.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=495

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 119/231 (52%), Positives = 158/231 (68%), Gaps = 8/231 (3%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQ-LGFQIQI  257
            LHVFFFP +AHGHMIP +DMAK+FASRGVK TI+TTP N P FSK + K+++  G +I+I
Sbjct  13   LHVFFFPFLAHGHMIPAIDMAKIFASRGVKVTIVTTPLNVPFFSKTISKHSESTGSEIRI  72

Query  258  RLLEFPAVEVGLPEDCQSVDKVPST----EALPSFFKACAmlqeplerllmelrpDCLVA  425
            + L+FP  E GLPE C++ + + S     E    FF A   LQE LE+LL E RPDCLVA
Sbjct  73   QTLKFPTTEFGLPEGCENAEVITSMNLGWETFSKFFLASTKLQESLEKLLEEDRPDCLVA  132

Query  426  DLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIP-NLPHQ  602
            D+FFPWATD++ KF IPRL+FHG+S+ ++   + L  ++P   VSSD+E F +P  LP +
Sbjct  133  DMFFPWATDSSEKFGIPRLLFHGTSFFSLTVMDVLSRYEPHKDVSSDTEPFEVPGGLPDK  192

Query  603  LKLTRLQV--SPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            + LT+ Q+  S +   + +T   E  K+VRES    YG + NSFYELEP Y
Sbjct  193  IMLTKRQLPASAVATGQGDTFMWEFFKKVRESNSQGYGTVVNSFYELEPGY  243



>ref|XP_006422968.1| hypothetical protein CICLE_v10029184mg [Citrus clementina]
 gb|ESR36208.1| hypothetical protein CICLE_v10029184mg [Citrus clementina]
Length=240

 Score =   209 bits (532),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 155/216 (72%), Gaps = 4/216 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP +AHGHMIPT+DMAKLF +RGVKA++ITTP N P  S+++ K ++LG ++ ++
Sbjct  8    LHIFFFPFLAHGHMIPTVDMAKLFTTRGVKASVITTPGNAPHLSRSIQKASELGIELDVK  67

Query  261  LLEFPAVEVGLPEDCQSVDKVP---STEALPSFFKACAmlqeplerllmelrpDCLVADL  431
            +++FP+ E GLPE  +++D +    + E +  F+ A   LQ+PLE+LL E +PDCLVAD+
Sbjct  68   IIKFPSAEAGLPEGWENLDAITNEVNRELIVKFYMATTKLQKPLEQLLQEHKPDCLVADM  127

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
             FPWATDAAAKF IPRL+FHG+S+ ++CA   L  ++P   VSSDSE F +PNLP ++KL
Sbjct  128  LFPWATDAAAKFGIPRLVFHGTSFFSLCAIKCLALYEPHKKVSSDSEPFVMPNLPGEIKL  187

Query  612  TRLQV-SPMERSEIETPFTEILKRVRESEDTSYGAI  716
            TR Q+  P +    +  F+  +K   +S+  SYG +
Sbjct  188  TRNQLPDPAKHDMGDNDFSRFMKAADDSDLRSYGVV  223



>ref|XP_010027900.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW54537.1| hypothetical protein EUGRSUZ_I00494 [Eucalyptus grandis]
Length=485

 Score =   216 bits (550),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 150/223 (67%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP MA GHMIP +DMAKLFA RG K+T+I TP ++P F K++ K    GF I + 
Sbjct  8    LHMFFFPFMAPGHMIPMIDMAKLFAIRGCKSTLIATPHDEPTFLKSIAKAKDSGFDIDVV  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            ++  P  EVGLPED  +++KV + E    F +A  ML + LE L+ +L PDCLV+D+F P
Sbjct  68   IVTLPLKEVGLPEDSDNLNKVTTVEMRKQFMRAIMMLDQQLELLIEKLAPDCLVSDMFLP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W T+ AAK+ IPRL+FHG+S  ++  T  +R ++P   VS DSE F IPN P ++ ++R+
Sbjct  128  WTTEIAAKWGIPRLVFHGTSAFSISGTECVRIYEPHKKVSHDSEPFIIPNFPGEITMSRM  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    R   ET FT+    V+ESE TS+G + NSFYELEP Y
Sbjct  188  QLPDFYRE--ETEFTKFFNEVKESEKTSFGVVMNSFYELEPAY  228



>ref|XP_010027899.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW54536.1| hypothetical protein EUGRSUZ_I00493 [Eucalyptus grandis]
Length=489

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 149/223 (67%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP+MA GH IP +DMAKLFA RG K+T+ITTP ++P F K++ K    GF I + 
Sbjct  12   LHIFFFPLMAPGHTIPMIDMAKLFAIRGCKSTLITTPHDEPTFLKSIAKAKDSGFDIDVV  71

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +  P  EVGLPEDC +++KV S E    F +A  ML   LE L+  L PDCL++D+F P
Sbjct  72   TVILPLKEVGLPEDCDNLNKVTSVEIRKQFMRAIMMLDRQLELLIETLAPDCLISDMFLP  131

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W T+ AAK+ IPRL FHG+S  ++ +T  +R ++P   VS DSE F IPN P ++ ++R+
Sbjct  132  WTTEIAAKYKIPRLAFHGTSAFSIASTECVRLYEPHKKVSCDSEPFIIPNFPGEITMSRM  191

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+  + R   ET FT+    V+ESE  S+G + NSFYELEP Y
Sbjct  192  QLPDLFRE--ETDFTKFYNEVKESEKRSFGVVMNSFYELEPAY  232



>ref|NP_567953.1| UDP-glucosyl transferase 73B3 [Arabidopsis thaliana]
 sp|Q8W491.1|U73B3_ARATH RecName: Full=UDP-glycosyltransferase 73B3; AltName: Full=Flavonol 
3-O-glucosyltransferase UGT73B3 [Arabidopsis thaliana]
 gb|AAL32831.1| putative protein [Arabidopsis thaliana]
 gb|AAM47999.1| putative protein [Arabidopsis thaliana]
 gb|AEE86327.1| UDP-glucosyl transferase 73B3 [Arabidopsis thaliana]
 gb|AHL38664.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=481

 Score =   216 bits (549),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 158/231 (68%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQIQ  254
            LHV FFP MA+GHMIPTLDMAKLF+SRG K+TI+TTP N  +F K ++++  L   F+I 
Sbjct  9    LHVVFFPFMAYGHMIPTLDMAKLFSSRGAKSTILTTPLNSKIFQKPIERFKNLNPSFEID  68

Query  255  IRLLEFPAVEVGLPEDCQSVDKVPSTEA------LPSFFKACAmlqeplerllmelrpDC  416
            I++ +FP V++GLPE C++VD   S            FFK+    ++ LE+LL   RPDC
Sbjct  69   IQIFDFPCVDLGLPEGCENVDFFTSNNNDDRQYLTLKFFKSTRFFKDQLEKLLETTRPDC  128

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            L+AD+FFPWAT+AA KF++PRL+FHG+ Y ++C+   +R H P N V+S  E F IP+LP
Sbjct  129  LIADMFFPWATEAAEKFNVPRLVFHGTGYFSLCSEYCIRVHNPQNIVASRYEPFVIPDLP  188

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T+ Q++  +R E E+   + +  V+ES+  S G I NSFYELEPDY
Sbjct  189  GNIVITQEQIA--DRDE-ESEMGKFMIEVKESDVKSSGVIVNSFYELEPDY  236



>ref|XP_010691729.1| PREDICTED: scopoletin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score =   216 bits (549),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 155/226 (69%), Gaps = 2/226 (1%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASR-GVKATIITTPANQPVFSKAVDKYTQLGFQI-  251
            D HV  FP MAHGHMIP LD+A+LF +R  VKATIITT  N    +K ++        I 
Sbjct  7    DFHVVLFPFMAHGHMIPMLDIARLFTARDNVKATIITTQLNIATITKDIESNKTTRTPIF  66

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             I L +FPA EVGLPE  +++++V   E    FF+A  +L E LE+ L ++RP+CLVAD+
Sbjct  67   NIELFKFPAQEVGLPEGFENLEQVLRPEFFDKFFEATELLNEQLEKYLEKVRPNCLVADM  126

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPWATD+AAKF+IPRL+FHG+S +A+CA   +R ++PFN+VSSD E F +P LPH+++L
Sbjct  127  FFPWATDSAAKFNIPRLVFHGTSIIALCAEEIIRLYEPFNNVSSDEEPFVLPLLPHEIQL  186

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             R Q+S       ET +   +  ++ESE  SYG I NSFYE+EPDY
Sbjct  187  RRSQISEGLTENEETDYKRKIANIKESELKSYGVIINSFYEMEPDY  232



>ref|XP_010526965.1| PREDICTED: UDP-glucosyl transferase 73B2-like [Tarenaya hassleriana]
Length=493

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 155/231 (67%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQIQ  254
            LHVFFFP MAHGHMIPTLDMAKLFASRGVK+TI+TTP N P+F + ++ +        I 
Sbjct  9    LHVFFFPFMAHGHMIPTLDMAKLFASRGVKSTILTTPLNAPIFQRPIEAFKNKNPDSDIG  68

Query  255  IRLLEFPAVEVGLPEDCQSVDKVPST------EALPSFFKACAmlqeplerllmelrpDC  416
            I +L FP  E+GLPE C+SVD + S         +   F +   L++ LE L+   RPDC
Sbjct  69   IEILNFPCPELGLPEGCESVDFIHSNFTGDIFPMVQKLFFSTKFLKDQLEHLIETARPDC  128

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            LVAD+FFPWATDA+ KF +PRL+FHG+ Y A+ A+  +R HKP   V+S SE F IP+LP
Sbjct  129  LVADMFFPWATDASEKFGVPRLVFHGTCYFALSASYCIRLHKPHKKVASSSERFVIPDLP  188

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T  QV  M+ +E ++   + +K V++SE  SYG + N+FYELE DY
Sbjct  189  GNIVITADQV--MDHNE-DSEMGKFMKEVKDSEKLSYGVLMNTFYELESDY  236



>ref|XP_010066837.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW64873.1| hypothetical protein EUGRSUZ_G02439 [Eucalyptus grandis]
Length=487

 Score =   216 bits (549),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 153/223 (69%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            +HV FFP+MAHGHM+PTLDMA+LF +RG +ATIITTP N PVF  ++      G +I +R
Sbjct  9    VHVLFFPLMAHGHMLPTLDMARLFTARGARATIITTPHNAPVFQNSLQ--IDAGSRIDLR  66

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +EFP  EVGLPE  +++D V + +    FF+A +ML  PLE L+ EL PD LVAD+FFP
Sbjct  67   TIEFPTQEVGLPEGLENLDMVTTQDIQLKFFRAISMLSRPLEALVEELAPDALVADIFFP  126

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            +A D AA   IPRL FHG+S+ ++CA  S++ H+P   VSSD ELF +P LP ++ +TR 
Sbjct  127  FANDIAAGHGIPRLAFHGTSFFSMCAAESVQRHRPHEKVSSDDELFRLPGLPDEIMMTRS  186

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    +  +ET FT +LKR  ++    +G I NSF+ELEP Y
Sbjct  187  QLPDELKISVETDFTRLLKRSYQAAGRCFGMIVNSFHELEPSY  229



>gb|AAM65945.1| glucosyltransferase-like protein [Arabidopsis thaliana]
Length=335

 Score =   211 bits (538),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 150/231 (65%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQIQ  254
            LHV FFP MA+GHMIPTLDMAKLF+SRG K+TI+TT  N  +  K +D +  L  G +I 
Sbjct  10   LHVMFFPFMAYGHMIPTLDMAKLFSSRGAKSTILTTSLNSKILQKPIDTFKNLNPGLEID  69

Query  255  IRLLEFPAVEVGLPEDCQSVDKVPST------EALPSFFKACAmlqeplerllmelrpDC  416
            I++ +FP VE+GLPE C++VD   S       E +  FF +    ++ LE+LL   RPDC
Sbjct  70   IQIFDFPCVELGLPEGCENVDFFTSNNNDDKNEMIVKFFFSTRFFKDQLEKLLGTTRPDC  129

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            L+AD+FFPWAT+AA KF++PRL+FHG+ Y ++CA   +  HKP   V+S SE F IP LP
Sbjct  130  LIADMFFPWATEAAGKFNVPRLVFHGTGYFSLCAGYCIGVHKPQKRVASSSEPFVIPELP  189

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T  Q+      + E+   + +  VRESE  S G + NSFYELE DY
Sbjct  190  GNIVITEEQIID---GDGESDMGKFMTEVRESEVKSSGVVLNSFYELEHDY  237



>ref|XP_004304024.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Fragaria vesca subsp. vesca]
Length=483

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 152/224 (68%), Gaps = 1/224 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASR-GVKATIITTPANQPVFSKAVDKYTQLGFQIQI  257
            LH+FF P M  GH +P LD+AKLFASR GVK+TIITTP N P+FS +++     GF+I++
Sbjct  9    LHIFFLPYMVQGHTLPLLDIAKLFASRSGVKSTIITTPVNAPLFSNSIETSKSSGFEIEL  68

Query  258  RLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFF  437
             +++FP+ EVGLP+  +++  V + E    F+KA   L+  +E+LL + RP CLVA   F
Sbjct  69   VIIKFPSTEVGLPDGIENMKLVKTQETKEKFYKAITALEHQVEQLLDQHRPHCLVASTLF  128

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
             WAT+ AAKF IPRLIFHG  +  +CA  S+  ++P   VSSDSE F IPNLPH++K TR
Sbjct  129  HWATNVAAKFGIPRLIFHGPGFFPLCAARSVTLYQPHLKVSSDSESFVIPNLPHEIKTTR  188

Query  618  LQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             ++        ET   ++L+  RE+E+ S+G I NSFYELEPDY
Sbjct  189  NELPTFLTQNGETGLYKLLETCREAEERSFGIIVNSFYELEPDY  232



>ref|XP_010041236.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=352

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 149/223 (67%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP +A GHMIP +DMAK+FA+RG K+T+I TP ++P F K++ K   LGF I + 
Sbjct  8    LHLFFFPFIAPGHMIPMIDMAKVFATRGCKSTLIATPHDKPSFMKSITKSKDLGFDIDVV  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +  P  EVGLP DC ++++V S E    F +  AML + LE L+ +L PDCL++D+F P
Sbjct  68   TVTLPLKEVGLPADCDNLNRVTSMEMRQQFRRGTAMLDQQLELLIEKLTPDCLISDMFLP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W     AK  IPRL+FHG+S  +V  T  +R ++P   VSSDSE F IPN P ++ L+R+
Sbjct  128  WTIKVTAKCGIPRLVFHGTSAFSVAGTECVRLYEPHKKVSSDSEPFVIPNFPGEITLSRM  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    + E E  FT+++  ++ESE  S+G + NSFYELEP Y
Sbjct  188  QLQDFVKEETE--FTKLMDEIKESEKRSFGVVMNSFYELEPAY  228



>ref|XP_010027898.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=488

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 149/223 (67%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP+MA GH IP +DMAKLFA RG K+T+ITTP ++P F K++ K    GF I + 
Sbjct  12   LHIFFFPVMAPGHTIPMIDMAKLFAIRGCKSTLITTPHDEPTFLKSIAKTKDSGFDINVV  71

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +  P  EVGLPEDC S++KV + E    F +A  ML + LE L+ +L PDCL++D F P
Sbjct  72   TVTLPLKEVGLPEDCDSLNKVTTVEMRKQFRRAIMMLDQQLELLIEKLAPDCLISDTFLP  131

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W T+ AAK+ IPRL FHG+S  +V  T  +R ++P   VS DSE F IPN P ++ ++R+
Sbjct  132  WTTEIAAKYKIPRLAFHGTSAFSVAGTECVRLYEPHKKVSCDSEPFIIPNFPGEITMSRM  191

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+  + R   ET FT+    V+ESE  S+G + NSFYELEP Y
Sbjct  192  QLPDLFRE--ETDFTKFYNEVKESEKRSFGVVMNSFYELEPAY  232



>ref|XP_006286265.1| hypothetical protein CARUB_v10007840mg [Capsella rubella]
 gb|EOA19163.1| hypothetical protein CARUB_v10007840mg [Capsella rubella]
Length=485

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/231 (46%), Positives = 151/231 (65%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQIQ  254
            LHV  FP+MAHGHMIPT+DMAKLF++RG K+TI+TTP N  +  K +D +  L  G  I 
Sbjct  10   LHVMLFPIMAHGHMIPTVDMAKLFSTRGAKSTILTTPLNAKILQKQIDAFKNLNPGLDIG  69

Query  255  IRLLEFPAVEVGLPEDCQSVD------KVPSTEALPSFFKACAmlqeplerllmelrpDC  416
            I + +FP VE+GLP+ C++ D       V   +    F  +    ++ LE+LL    PDC
Sbjct  70   IHIFDFPCVELGLPQGCENADFFTSDNYVGRQDLTLKFILSTRFFKDQLEKLLETTTPDC  129

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            L+AD+FFPWAT+AA KF++PRL+FHG+ Y ++C+   +R H+P N V+S SE F IP+LP
Sbjct  130  LIADMFFPWATEAAEKFNVPRLVFHGTGYFSLCSEYCIRAHQPQNRVTSSSETFVIPDLP  189

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T+ Q+S ++    E+     +  V+ESE  S G + NSFYELEPDY
Sbjct  190  GNILMTKEQISDLDE---ESEVGRFMIEVKESEVKSSGVVVNSFYELEPDY  237



>ref|NP_849492.1| UDP-glucosyltransferase 73B2 [Arabidopsis thaliana]
 gb|AEE86329.1| UDP-glucosyltransferase 73B2 [Arabidopsis thaliana]
Length=335

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 149/231 (65%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQIQ  254
            LHV FFP MA+GHMIPTLDMAKLF+SRG K+TI+TT  N  +  K +D +  L  G +I 
Sbjct  10   LHVMFFPFMAYGHMIPTLDMAKLFSSRGAKSTILTTSLNSKILQKPIDTFKNLNPGLEID  69

Query  255  IRLLEFPAVEVGLPEDCQSVDKVPST------EALPSFFKACAmlqeplerllmelrpDC  416
            I++  FP VE+GLPE C++VD   S       E +  FF +    ++ LE+LL   RPDC
Sbjct  70   IQIFNFPCVELGLPEGCENVDFFTSNNNDDKNEMIVKFFFSTRFFKDQLEKLLGTTRPDC  129

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            L+AD+FFPWAT+AA KF++PRL+FHG+ Y ++CA   +  HKP   V+S SE F IP LP
Sbjct  130  LIADMFFPWATEAAGKFNVPRLVFHGTGYFSLCAGYCIGVHKPQKRVASSSEPFVIPELP  189

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T  Q+      + E+   + +  VRESE  S G + NSFYELE DY
Sbjct  190  GNIVITEEQIID---GDGESDMGKFMTEVRESEVKSSGVVLNSFYELEHDY  237



>ref|XP_007199157.1| hypothetical protein PRUPE_ppa019699mg [Prunus persica]
 gb|EMJ00356.1| hypothetical protein PRUPE_ppa019699mg [Prunus persica]
Length=474

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 156/224 (70%), Gaps = 12/224 (5%)
 Frame = +3

Query  84   HVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVD--KYTQLGFQIQI  257
            HVF FP MAHGHMIP  DMAKL A++GVK TIITTP N P+FSKA    K    G +I+I
Sbjct  9    HVFLFPFMAHGHMIPVSDMAKLLAAQGVKTTIITTPLNAPIFSKATRSRKTNSGGIEIEI  68

Query  258  RLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFF  437
            +  +           C+++D +P+ E   SFFKA  +LQEPLERLL+E +P CLVAD+FF
Sbjct  69   KSWK----------GCENLDSLPTPELADSFFKAAGLLQEPLERLLLEYQPTCLVADMFF  118

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
             WATDAAAKF IPRLIFHG+S+ ++ A++ ++ ++PF + SSDSE F IPN P ++K+TR
Sbjct  119  SWATDAAAKFGIPRLIFHGTSFFSLAASDCVKRYEPFKNTSSDSEPFVIPNFPGEIKMTR  178

Query  618  LQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             QV    +  IE   T ++++ +E+E  SYG + NSFYELEP Y
Sbjct  179  AQVPDFVKYNIENDLTPLIEQAKEAEVRSYGIVVNSFYELEPVY  222



>emb|CDX76261.1| BnaA08g11390D [Brassica napus]
Length=482

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/238 (47%), Positives = 158/238 (66%), Gaps = 15/238 (6%)
 Frame = +3

Query  72   MGD---LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG  242
            MG+   LH+F FP MAHGHMIPTLDMAKLF+++G K+TI+TTP N  +  K +D +  L 
Sbjct  1    MGEATKLHIFLFPYMAHGHMIPTLDMAKLFSTKGAKSTILTTPLNAKILQKPIDTFKNLN  60

Query  243  --FQIQIRLLEFPAVEVGLPEDCQSVDKVPSTE-------ALPSFFKACAmlqeplerll  395
               QI+I++L+FP V++GLPE C++ D    T         +  FF A    ++ LE++L
Sbjct  61   PSLQIEIQILDFPCVQLGLPEGCENADFFTLTNNSDDRRAMISKFFLATRFFKDQLEKIL  120

Query  396  melrpDCLVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSEL  575
               RP CL+AD+FFPWAT+AA KF++PRL+FHG+ Y ++CA+  +R H P   V++ SE 
Sbjct  121  ETTRPSCLIADMFFPWATEAAEKFNVPRLVFHGTGYFSLCASYCIRVHNPQKRVATSSEP  180

Query  576  FTIPNLPHQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            F IP+LP  + +T+ Q+  ++R E +T   + +  V ESE  S G + NSFYELEPDY
Sbjct  181  FVIPDLPGNIVITQGQI--LDRGE-DTEMGKFMTEVLESEAKSSGVVVNSFYELEPDY  235



>ref|XP_007201019.1| hypothetical protein PRUPE_ppa005572mg [Prunus persica]
 gb|EMJ02218.1| hypothetical protein PRUPE_ppa005572mg [Prunus persica]
Length=454

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/225 (49%), Positives = 143/225 (64%), Gaps = 21/225 (9%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP MA GH IP +D+AKLFAS GVK+T+ITTP N P+FSKA+     LGF+I++ 
Sbjct  9    LHMFFFPFMAQGHNIPFIDIAKLFASHGVKSTLITTPVNAPLFSKAIQSSKNLGFEIELL  68

Query  261  LLEFPAVEVGLPEDCQSVDKV--PSTEALPSFFKACAmlqeplerllmelrpDCLVADLF  434
            +++FP  EVGLP+ C+S   +  P  E +    +                   CLVAD F
Sbjct  69   VIKFPNEEVGLPQGCESTTFLLEPQIEQILDQHRP-----------------HCLVADSF  111

Query  435  FPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLT  614
            FPWATD AAKF I RLIFHG+ +   CA+ ++  H+P   V SDSELFTIPN   ++K+T
Sbjct  112  FPWATDVAAKFGISRLIFHGTGFFPSCASLTVILHQPHKKVESDSELFTIPNF--EIKMT  169

Query  615  RLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            R Q+        E+  T++ K  RESE+ SYG I NSFYELEPD+
Sbjct  170  RTQILRFFEKNSESIMTKLFKESRESEERSYGIIVNSFYELEPDF  214



>ref|XP_004137109.1| PREDICTED: UDP-glycosyltransferase 73B3-like [Cucumis sativus]
Length=477

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 157/227 (69%), Gaps = 4/227 (2%)
 Frame = +3

Query  72   MGD-LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQ  248
            MG+ LH+F FP +AHGHMIP +DMAKLF+SRG+K TI+TTP N    +K++     L   
Sbjct  1    MGNQLHIFLFPFLAHGHMIPMVDMAKLFSSRGIKVTIVTTPINSISIAKSLHDSNPL---  57

Query  249  IQIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVAD  428
            I + +L+FP+ EVGLP+ C+++D + S   +P F  A ++LQ PLE  + E RP C+VAD
Sbjct  58   INLLILKFPSAEVGLPDGCENLDFLISPSMIPKFISAVSLLQTPLEEAITEHRPHCIVAD  117

Query  429  LFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLK  608
            +FFPWA DA+ K  IPRL FHG+S+ + CA   +R ++P+N+VSS++E F IP+LP  + 
Sbjct  118  MFFPWANDASVKLGIPRLNFHGTSFFSTCALEFMRIYEPYNNVSSETEPFLIPHLPGNIT  177

Query  609  LTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            +T++++  + R  ++   TE +KR  +S+   YG + NSFYELE +Y
Sbjct  178  ITKMKLHELVRENVKNDLTEYMKRAYDSDSKCYGVVMNSFYELEAEY  224



>gb|KGN43913.1| hypothetical protein Csa_7G073490 [Cucumis sativus]
Length=477

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 157/227 (69%), Gaps = 4/227 (2%)
 Frame = +3

Query  72   MGD-LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQ  248
            MG+ LH+F FP +AHGHMIP +DMAKLF+SRG+K TI+TTP N    +K++     L   
Sbjct  1    MGNQLHIFLFPFLAHGHMIPMVDMAKLFSSRGIKVTIVTTPINSISIAKSLHDSNPL---  57

Query  249  IQIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVAD  428
            I + +L+FP+ EVGLP+ C+++D + S   +P F  A ++LQ PLE  + E RP C+VAD
Sbjct  58   INLLILKFPSAEVGLPDGCENLDFLISPSMIPKFISAVSLLQTPLEEAITEHRPHCIVAD  117

Query  429  LFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLK  608
            +FFPWA DA+ K  IPRL FHG+S+ + CA   +R ++P+N+VSS++E F IP+LP  + 
Sbjct  118  MFFPWANDASVKLGIPRLNFHGTSFFSTCALEFMRIYEPYNNVSSETEPFLIPHLPGNIT  177

Query  609  LTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            +T++++  + R  ++   TE +KR  +S+   YG + NSFYELE +Y
Sbjct  178  ITKMKLHELVRENVKNDLTEYMKRAYDSDSKCYGVVMNSFYELEAEY  224



>emb|CDY36633.1| BnaA07g04240D [Brassica napus]
Length=484

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/231 (46%), Positives = 152/231 (66%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQIQ  254
            +HV FFP MAHGHMIP LDMAKLF+SRG K+TIITTP+N  +  K ++ +     G +I 
Sbjct  9    IHVCFFPFMAHGHMIPILDMAKLFSSRGAKSTIITTPSNSKILEKPIEAFRNQNPGLEIG  68

Query  255  IRLLEFPAVEVGLPEDCQSVDKVPSTEALPS------FFKACAmlqeplerllmelrpDC  416
            IR+ +FP+VE+GLPE C++VD + S +   +      F  +   +++  E  +   +P C
Sbjct  69   IRIFDFPSVELGLPEGCENVDFINSNQKPDAGDLSLKFLFSTKHMKQQWESFIETTKPSC  128

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            +VAD+FFPWAT+AA KF +PRL+FHG+S+ ++C + ++RTHKP   V++ S  F IP LP
Sbjct  129  IVADMFFPWATEAAEKFGVPRLVFHGTSFFSLCCSYNMRTHKPHKKVATTSTPFVIPGLP  188

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T  Q +  +    ETP  + +K VRESE  S+G + NSFYELE  Y
Sbjct  189  GDIVITAEQANVADE---ETPMGKFMKEVRESESISFGVLVNSFYELESTY  236



>ref|XP_007011132.1| UDP-glucosyl transferase 73B3 [Theobroma cacao]
 gb|EOY19942.1| UDP-glucosyl transferase 73B3 [Theobroma cacao]
Length=482

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 146/223 (65%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            L +FF P MAHGHMIP +D+A LFA++GVK TIITT  N P  SK  ++   LG++I I 
Sbjct  8    LQIFFLPFMAHGHMIPFIDLAMLFAAKGVKTTIITTTLNVPHISKVTERAKNLGYEINIL  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +  FP+VE GLPE C+S D+  S +    FF A  ML+EPL  LL   RPDCLVAD+FFP
Sbjct  68   VTYFPSVEAGLPEGCESYDQASSPDMQFKFFTATTMLREPLAHLLQAHRPDCLVADMFFP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W TD AA F IPR++FHG+   ++ AT  +R ++P   VSSDSE F IPN P ++KLTR 
Sbjct  128  WVTDVAAAFGIPRIVFHGTCVFSLSATEHIRLYEPHKKVSSDSEPFVIPNFPGEIKLTRS  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    R   ET FT+     +E+E   YG I NSFYELE  Y
Sbjct  188  QMPDFVRQ--ETGFTKFYSESKETELKCYGVIVNSFYELESAY  228



>ref|XP_010691730.1| PREDICTED: scopoletin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=485

 Score =   213 bits (542),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 155/226 (69%), Gaps = 2/226 (1%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASR-GVKATIITTPANQPVFSKAVDKYTQLGFQI-  251
            + HV  FP MAHGHMIP LD+A+LFA R  VKATIITTP N   F+K  +   +    I 
Sbjct  5    EFHVVLFPFMAHGHMIPILDIARLFAVRDNVKATIITTPLNVTNFTKDNESNMESSAPIV  64

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             I +  FPA EVGLPE  ++++KV   E L  FFKA  ML E LE+ L ++RP+CLVAD+
Sbjct  65   NIEVFRFPAQEVGLPEGFENLEKVMKPELLNKFFKAAGMLNEQLEQYLEKIRPNCLVADM  124

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPWAT++AAKF+IPRL+FHG+S  A+CA   +R +KPF +V+SD E F +P+LPH +++
Sbjct  125  FFPWATESAAKFNIPRLVFHGTSNFALCAQEIVRLYKPFKNVTSDEEPFVLPSLPHDIQM  184

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             RLQ+         T F + +  +++SE  SYG + NSFYELEPDY
Sbjct  185  RRLQIPEDLWKYDGTEFEKRMDSLKDSEIKSYGVLVNSFYELEPDY  230



>gb|KCW44514.1| hypothetical protein EUGRSUZ_L01977 [Eucalyptus grandis]
Length=471

 Score =   212 bits (540),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 149/223 (67%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP +A GHMIP +DMAK+FA+RG K+T+I TP ++P F K++ K   LGF I + 
Sbjct  8    LHLFFFPFIAPGHMIPMIDMAKVFATRGCKSTLIATPHDKPSFMKSITKSKDLGFDIDVV  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +  P  EVGLP DC ++++V S E    F +  AML + LE L+ +L PDCL++D+F P
Sbjct  68   TVTLPLKEVGLPADCDNLNRVTSMEMRQQFRRGTAMLDQQLELLIEKLTPDCLISDMFLP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W     AK  IPRL+FHG+S  +V  T  +R ++P   VSSDSE F IPN P ++ L+R+
Sbjct  128  WTIKVTAKCGIPRLVFHGTSAFSVAGTECVRLYEPHKKVSSDSEPFVIPNFPGEITLSRM  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    +   ET FT+++  ++ESE  S+G + NSFYELEP Y
Sbjct  188  QLQDFVKE--ETEFTKLMDEIKESEKRSFGVVMNSFYELEPAY  228



>ref|XP_004230753.1| PREDICTED: scopoletin glucosyltransferase-like [Solanum lycopersicum]
Length=485

 Score =   213 bits (541),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 144/223 (65%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LHV+F PMMA GHMIP +DMA+ FA  GVK TI+TTP N   F+K + K  ++G  I IR
Sbjct  8    LHVYFLPMMAPGHMIPLVDMARQFARHGVKVTIVTTPLNATKFTKTIQKDREVGSDICIR  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
              EFP  E GLPE C+++    ++E    F KA  + ++P+E+ + E  PDCLVA  FF 
Sbjct  68   TTEFPCKEAGLPEGCENLASTTTSEMTMKFIKALYLFEQPVEKFMEEDHPDCLVAGTFFA  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WA D AAK  IPRL F+G+  L +CA N L  HKP   V S++E F IP LP  +K++R 
Sbjct  128  WAVDVAAKLGIPRLAFNGTGLLPMCAYNCLMEHKPHLKVESETEEFVIPGLPDTIKMSRS  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            ++S     E ETP T I+K    +E TSYGAI NSFYELEP+Y
Sbjct  188  KLSQHWVDEKETPMTPIIKDFMRAEATSYGAIVNSFYELEPNY  230



>ref|XP_010437661.1| PREDICTED: UDP-glycosyltransferase 73B3-like [Camelina sativa]
Length=482

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 150/231 (65%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQIQ  254
            LHV FFP MAHGHMIPT+DMAKLF+SRG K+TI+TTP N  +  K +D +  L  G +I 
Sbjct  10   LHVMFFPFMAHGHMIPTVDMAKLFSSRGAKSTILTTPLNAKILQKPIDAFKNLNPGLEID  69

Query  255  IRLLEFPAVEVGLPEDCQSVD------KVPSTEALPSFFKACAmlqeplerllmelrpDC  416
            I++ +FP V++GLPE C++ D       +   +    F  +    ++ LE+LL   RPDC
Sbjct  70   IQIFDFPCVQLGLPEGCENADFFTADNNIDRQDLSLKFLLSTRFFKDQLEKLLQTTRPDC  129

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            L+AD+FFPWAT+AA KF++PRL+FHG+ Y ++C+   +R H P N V+S  E F IP+LP
Sbjct  130  LIADMFFPWATEAAEKFNVPRLVFHGTGYFSLCSDYCIRVHNPQNTVASSCEPFVIPDLP  189

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T+ Q+        E+   + +  VRESE  S G + NSFYELEPDY
Sbjct  190  GNIVITKGQIGDRHG---ESEMGKFMAEVRESEVKSSGVVVNSFYELEPDY  237



>ref|XP_006346386.1| PREDICTED: scopoletin glucosyltransferase-like [Solanum tuberosum]
Length=484

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 145/223 (65%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LHV+F PMMA GHMIP +DMA+ F+  GVK TIITTP N   FSK + K  +LG  I IR
Sbjct  8    LHVYFLPMMAPGHMIPLVDMARQFSRHGVKVTIITTPLNATKFSKTIQKDRELGSDISIR  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +EFP  E GLPE C+++    S+E    F  A  + Q+P+E+ + E  PDCL+A  FF 
Sbjct  68   TIEFPCKEAGLPEGCENLASTTSSEMSLKFVIALYLFQQPVEQFMEEDHPDCLIAGTFFS  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WA D AAK  IPRL F+G+  L +CA +S   HKP   V S++E F IP LP  +K++R 
Sbjct  128  WAVDVAAKLGIPRLAFNGTGLLPMCAYHSFMEHKPHLKVESETEEFVIPGLPDTIKMSRS  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            ++S   + E ETP T I+K    +E TSYGAI NSFYE+EP+Y
Sbjct  188  KISEHWKDEKETPMTPIVKDFMRAEATSYGAIVNSFYEMEPNY  230



>ref|XP_004137108.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Cucumis sativus]
 gb|KGN43912.1| hypothetical protein Csa_7G073480 [Cucumis sativus]
Length=480

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 150/228 (66%), Gaps = 2/228 (1%)
 Frame = +3

Query  72   MG-DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGF-  245
            MG  LH+F  P MA GHMIP +D+AKL +SRG+K TI+TTP N    S ++     L   
Sbjct  1    MGTQLHMFLLPFMARGHMIPMVDLAKLLSSRGIKITIVTTPLNAISISNSIQNSKSLSTS  60

Query  246  QIQIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVA  425
            QIQ+ +L+FP+ EVGLP+ C+++D V + +  P F  A  + Q P E  +ME RP C++A
Sbjct  61   QIQLLVLKFPSAEVGLPDGCENLDSVITPDMFPKFISAFNLFQNPFEEAVMEQRPHCIIA  120

Query  426  DLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQL  605
            D++FPWA D AAKF IPRLIFHG+S+ + CA+  +R H+P+NHVSSD+E F IP  P  +
Sbjct  121  DMYFPWANDVAAKFGIPRLIFHGTSFFSSCASEFMRIHEPYNHVSSDAEPFLIPCFPGDI  180

Query  606  KLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              T+ ++    R  ++   +E +KR  E     YGAI+NSFYELE +Y
Sbjct  181  TFTKTKLPQFVRENLKNEVSEFIKRAHELGSACYGAIWNSFYELEAEY  228



>ref|XP_010027835.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW54462.1| hypothetical protein EUGRSUZ_I00409 [Eucalyptus grandis]
Length=485

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 151/223 (68%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP MA GHMIP +DMAKLFA RG K+T+I TP ++  F K++ K+  LGF I + 
Sbjct  8    LHLFFFPFMAPGHMIPMIDMAKLFAMRGCKSTLIATPYDKSTFMKSIVKFKDLGFDINVV  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +  P  EVGLPED  ++++V S E    F +A  ML + LE L+ +L PDCL++D+F P
Sbjct  68   TVTLPLKEVGLPEDRDNMNRVTSMEMRMQFMRAITMLDQQLELLIEKLAPDCLISDMFLP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W T+ AAK  IPRL+FHG+S  +V  T  +R ++    VSSDSE F IPN P ++ L+R+
Sbjct  128  WTTEVAAKCSIPRLVFHGTSAFSVAGTECVRLYELHKKVSSDSEPFVIPNFPGEITLSRM  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    +  +ET FT+++  ++ESE  S+G + NSFYELEP Y
Sbjct  188  QLQDFVK--VETEFTKLMDEMKESEKRSFGVVMNSFYELEPAY  228



>ref|XP_009116544.1| PREDICTED: UDP-glycosyltransferase 73B3-like [Brassica rapa]
Length=451

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 150/231 (65%), Gaps = 13/231 (6%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVD--KYTQLGFQIQ  254
            LHV FFP MA+GHMIPTLDMAKLF+S+GVK+TIITTP N  +F K +D  K      +I 
Sbjct  9    LHVMFFPYMAYGHMIPTLDMAKLFSSKGVKSTIITTPLNSKIFQKPIDVFKNQNPSLEID  68

Query  255  IRLLEFPAVEVGLPEDCQSVD-----KVPSTEALP-SFFKACAmlqeplerllmelrpDC  416
            I + EFP V++GLPE C++VD       P  E +   F  +    ++ LE+LL   RPDC
Sbjct  69   IHIFEFPCVQLGLPEGCENVDFFTSSNNPGRENIAFKFLSSTRFFKDQLEKLLETTRPDC  128

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            L+AD+FFPW+T  A K  +PRL+FHG+ Y ++CA   ++ HKP N V+S SE F IP+LP
Sbjct  129  LIADMFFPWSTQVAEKCHVPRLVFHGTGYFSLCANYCMKVHKPQNKVASSSEPFVIPDLP  188

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              +++TR Q+        E+   + L  VRESE  S G I NSFYELEP+Y
Sbjct  189  GDIEITREQI-----INSESEMAKFLLDVRESETKSTGVIVNSFYELEPEY  234



>ref|XP_004305941.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Fragaria vesca subsp. vesca]
Length=474

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 146/223 (65%), Gaps = 3/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+ FFP MA GH+IP + + KLF SRG+KATIITTPA+ P   K ++     G QI I 
Sbjct  8    LHIAFFPFMAQGHVIPAIHLTKLFVSRGLKATIITTPADAPFIRKKIENS---GTQINIF  64

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             ++ PAVEVGLPE+C++     S E    FFKA  +L   LE  L + +P+CLVAD+FFP
Sbjct  65   TIKVPAVEVGLPENCENFHSATSPEMQAKFFKATTLLGPQLELFLKQRKPNCLVADMFFP  124

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD A+K  IP LIFHG SY A+CAT  +  +KP N VSSDSE F IPNLP +++L R 
Sbjct  125  WATDVASKLGIPTLIFHGISYFALCATLCVHLYKPHNQVSSDSEPFVIPNLPDKIELNRK  184

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            ++    +  +E  F ++ +   E+  +SYG + NSFYELE  Y
Sbjct  185  KIPDFVKDGVENEFKKMYEESMEALKSSYGVLVNSFYELEHSY  227



>ref|XP_010690618.1| PREDICTED: scopoletin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=486

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 153/224 (68%), Gaps = 2/224 (1%)
 Frame = +3

Query  84   HVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL-GFQIQIR  260
            H+FFFP MA GHMIPTLDMA+LFASRG+K+TI+TTPAN   F++ +  +TQ  G QI + 
Sbjct  10   HIFFFPFMAPGHMIPTLDMARLFASRGIKSTIVTTPANLHYFTETIKVHTQKSGIQIDLL  69

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             + FP+ EVGLPE C++ + V S+E    F KA  +LQ P   L+ +  P+CLVAD FF 
Sbjct  70   TINFPSEEVGLPEGCENFEFVTSSEMFHKFCKAVDLLQHPFANLMEKYNPNCLVADPFFS  129

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIP-NLPHQLKLTR  617
            WA   A+KF +PRL FHGSSY + C  +SL   +P  ++SSDSE F +P +LPH++KLT 
Sbjct  130  WANSVASKFRVPRLAFHGSSYFSRCIVSSLLHFEPHKNLSSDSETFVVPGDLPHEIKLTI  189

Query  618  LQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             +++P +++E  T   +++ ++RE     YG I NSFYELE  Y
Sbjct  190  SELAPYDKNEGPTFLLDLMGKIREEVKGCYGVIMNSFYELESGY  233



>emb|CDX69029.1| BnaC01g04240D [Brassica napus]
Length=495

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/241 (46%), Positives = 160/241 (66%), Gaps = 12/241 (5%)
 Frame = +3

Query  54   SSKDFAMGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYT  233
            +S + A   LH+FFFP MAHGHMIPTLDMAKLFA++G K+TI+TTP N  +F K ++ + 
Sbjct  3    TSDEAAASKLHIFFFPYMAHGHMIPTLDMAKLFATKGAKSTILTTPLNSKLFEKPINSFN  62

Query  234  QLGFQ---IQIRLLEFPAVEVGLPEDCQSVDKVPSTEALPS------FFKACAmlqeple  386
                +   I++++L FP  E+GLPE C++ D + S   L        F  A    +E LE
Sbjct  63   DENPELEDIKLQILNFPCTELGLPEGCENTDFIFSNHDLTKGNLNMKFLLAMEYFKEQLE  122

Query  387  rllmelrpDCLVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSD  566
             LL  ++PDCLV ++FFPWAT  A KF++PRL+FHG+ Y ++CA++ LR HKP+ +V+S 
Sbjct  123  ELLETVKPDCLVGNMFFPWATKVAEKFNVPRLVFHGTGYFSLCASHCLRLHKPYKNVASS  182

Query  567  SELFTIPNLPHQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPD  746
            SE F IP LP  + +T  QV  +E+ E E+   + +K +R+SE  S+G + NSFY+LEP 
Sbjct  183  SEPFVIPELPGDVVITDEQV--IEKEE-ESVMGKFMKDIRDSERDSFGVLVNSFYDLEPA  239

Query  747  Y  749
            Y
Sbjct  240  Y  240



>gb|KDO59784.1| hypothetical protein CISIN_1g042879mg, partial [Citrus sinensis]
Length=189

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 137/195 (70%), Gaps = 14/195 (7%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+ FFP+MAHGHMIP +DMAKLF SRGVK T+ITTPAN  +FSKA+ +  +LG +I I+
Sbjct  8    LHIIFFPLMAHGHMIPLVDMAKLFGSRGVKTTVITTPANATLFSKAIPRANELGIEIDIK  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             ++FP+VEVGLPE  ++++++ S   +P   +              E +P+CLVAD+ FP
Sbjct  68   TIKFPSVEVGLPEGSENLNEMTSQPDMPVNLQ--------------EHKPNCLVADMLFP  113

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATDAAAKF IPRL+FHG+S+L++CAT  L  ++P   VSS SE F IPNLP  +KLTR 
Sbjct  114  WATDAAAKFGIPRLVFHGTSFLSLCATACLMLYEPHKKVSSVSEPFVIPNLPGDIKLTRN  173

Query  621  QVSPMERSEIETPFT  665
            Q+    + + ET F+
Sbjct  174  QLPDTMKQDDETDFS  188



>gb|ADO33118.1| UDP glucosyltransferase [Scutellaria barbata]
Length=477

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 153/228 (67%), Gaps = 7/228 (3%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            MG LH+   PM+AHGHMIP LDMAKLF+SRGV+ TII TPA    F+  V K  + G  I
Sbjct  1    MGQLHIILVPMIAHGHMIPLLDMAKLFSSRGVQTTIIATPA----FADPVRKAREAGHDI  56

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             + +  FP     LP++  S+D+V + + +  FF+A  +LQ+P+E ++ EL+PDCLV+D+
Sbjct  57   GLTITSFPPEGSSLPDNILSLDQV-TNDMIAEFFRALELLQQPVEEIMKELKPDCLVSDM  115

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            F PW TD+AAKF IPRLIFHG+   + C    +   KPF +VSSDSE F IPNLPH+L  
Sbjct  116  FLPWTTDSAAKFGIPRLIFHGTCCFSRCCAIEMGLQKPFKNVSSDSEPFVIPNLPHELSF  175

Query  612  TRLQVSPMERSE--IETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             R QV   E  E   E PFT+++K++RESE  SYG + NSF ELE +Y
Sbjct  176  VRTQVPDFELQEDVNENPFTKMMKQMRESEARSYGDVINSFQELESEY  223



>ref|NP_567954.1| UDP-glucosyltransferase 73B2 [Arabidopsis thaliana]
 sp|Q94C57.1|U73B2_ARATH RecName: Full=UDP-glucosyl transferase 73B2; AltName: Full=Flavonol 
7-O-glucosyltransferase; AltName: Full=UDP glucose:flavonoid 
7-O-glucosyltransferase [Arabidopsis thaliana]
 gb|AAK59668.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AAN13230.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AAR01231.1| UDP glucose:flavonoid 7-O-glucosyltransferase [Arabidopsis thaliana]
 gb|AEE86328.1| UDP-glucosyltransferase 73B2 [Arabidopsis thaliana]
Length=483

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 149/231 (65%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQIQ  254
            LHV FFP MA+GHMIPTLDMAKLF+SRG K+TI+TT  N  +  K +D +  L  G +I 
Sbjct  10   LHVMFFPFMAYGHMIPTLDMAKLFSSRGAKSTILTTSLNSKILQKPIDTFKNLNPGLEID  69

Query  255  IRLLEFPAVEVGLPEDCQSVDKVPST------EALPSFFKACAmlqeplerllmelrpDC  416
            I++  FP VE+GLPE C++VD   S       E +  FF +    ++ LE+LL   RPDC
Sbjct  70   IQIFNFPCVELGLPEGCENVDFFTSNNNDDKNEMIVKFFFSTRFFKDQLEKLLGTTRPDC  129

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            L+AD+FFPWAT+AA KF++PRL+FHG+ Y ++CA   +  HKP   V+S SE F IP LP
Sbjct  130  LIADMFFPWATEAAGKFNVPRLVFHGTGYFSLCAGYCIGVHKPQKRVASSSEPFVIPELP  189

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T  Q+      + E+   + +  VRESE  S G + NSFYELE DY
Sbjct  190  GNIVITEEQIID---GDGESDMGKFMTEVRESEVKSSGVVLNSFYELEHDY  237



>gb|KFK40015.1| hypothetical protein AALP_AA3G318900 [Arabis alpina]
Length=483

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 155/233 (67%), Gaps = 13/233 (6%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQIQ  254
            +H+ FFP MA GHMIP LDMAKLF++RG ++TI+TTP N  +  K ++ +  L    QI 
Sbjct  6    IHILFFPFMAQGHMIPMLDMAKLFSTRGARSTILTTPINSKILEKPIEAFKTLNPDLQIG  65

Query  255  IRLLEFPAVEVGLPEDCQSVDKV-----PSTEALPSFFK---ACAmlqeplerllmelrp  410
            I++L FP VE+GLPE C++VD +     P +++   F K   +   +++ LE  +   +P
Sbjct  66   IKILNFPCVELGLPEGCENVDFINSYQNPDSDSGDLFLKFLFSTKSMKQQLESFIETTKP  125

Query  411  DCLVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPN  590
             C+VAD+FFPW T++A KF++PRL+FHG+++ A+C + ++RTHKP   V++ S  F IP 
Sbjct  126  SCIVADMFFPWTTESAEKFNVPRLVFHGTAFFALCCSYNMRTHKPHKKVATTSTPFVIPG  185

Query  591  LPHQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            LP ++ +T  Q +  +    ETP  +I+K +RESE  S+G + NSFYELEP Y
Sbjct  186  LPGEIVITTEQANVADE---ETPMGKIMKEIRESESNSFGVLVNSFYELEPAY  235



>ref|XP_009602613.1| PREDICTED: scopoletin glucosyltransferase-like [Nicotiana tomentosiformis]
Length=483

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 146/223 (65%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FF PMMA GHMIP +D+A+ FA RG KATIITTP N   FSKA+ +  +LG  I IR
Sbjct  8    LHIFFLPMMAPGHMIPLVDIARQFARRGAKATIITTPLNASKFSKAIQRDRELGSDISIR  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
              EFP  E GLP+ C+++    STE    F  + ++ Q+P E+ L E  PDCLVA   F 
Sbjct  68   TTEFPCKEAGLPDGCENIASTTSTEMYLKFIMSLSLFQQPFEQFLEEDHPDCLVAAPQFS  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WA D AAK  IPRL F+G+ +  +CA +SL  HKP   + SD+E F IP LP  +K++R 
Sbjct  128  WAVDVAAKLGIPRLFFNGTGFFPLCAIHSLMEHKPHLKIESDTEEFIIPGLPDTIKMSRQ  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    + E E+  TEI++ +  +E TSYGAI NSFYELEP+Y
Sbjct  188  QLPDHLKYETESIITEIVRNIMRAEMTSYGAIVNSFYELEPNY  230



>emb|CDX71221.1| BnaC07g05000D [Brassica napus]
Length=484

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/231 (46%), Positives = 153/231 (66%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVD--KYTQLGFQIQ  254
            +HV FFP MAHGHMIP LDMAKLF+SRG K+TIITTP+N  +  K ++  K+   G +I 
Sbjct  9    IHVCFFPFMAHGHMIPILDMAKLFSSRGAKSTIITTPSNSNILEKPIEAFKHQNPGLEIG  68

Query  255  IRLLEFPAVEVGLPEDCQSVDKVPSTEA------LPSFFKACAmlqeplerllmelrpDC  416
            I++ +FP+VE+GLPE C++VD + S +          F  +   +++ LE  +   +P C
Sbjct  69   IKIFDFPSVELGLPEGCENVDFITSYQKPDAGDLFLKFLFSTKHMKQQLESFIETTKPSC  128

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            +VAD+FFPWAT++A KF +PRL+FHG+S+ ++C + ++RTHKP   V++ S  F IP LP
Sbjct  129  IVADMFFPWATESAEKFGVPRLVFHGTSFFSLCCSYNMRTHKPHKKVATTSTPFVIPGLP  188

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T  Q +  +    ETP  + +K VRESE  S+G + NSFYELE  Y
Sbjct  189  GDVVITAEQANVADE---ETPMGKFMKEVRESESISFGVLVNSFYELESTY  236



>ref|XP_004505253.1| PREDICTED: UDP-glucosyl transferase 73B2-like [Cicer arietinum]
Length=475

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 156/224 (70%), Gaps = 1/224 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP   HGH+ PT+DMAKLFAS+GVKATIITTP+N+ + SK + K    G  I I+
Sbjct  9    LHIFFFPYFGHGHIKPTVDMAKLFASKGVKATIITTPSNETLISKFIQKSKISGHNIHIQ  68

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +EF + +  LP   + +D +PS E+  SF KA   LQEPLE+LL+E  PDC+VAD+FFP
Sbjct  69   TIEFTSPKTCLPNGSEIIDSIPSPESFFSFLKATESLQEPLEKLLVEQNPDCVVADMFFP  128

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W TD+A+KF IPR++FHG+S+ ++CAT  ++  +PF +VSSD E F I +LP  +K+T+ 
Sbjct  129  WVTDSASKFGIPRIVFHGTSFFSLCATYCIKRFEPFKNVSSDFEPFVITDLPGNVKMTKS  188

Query  621  QVSPMERSEIETP-FTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             + P E S+  T    +  + + ESE  S+G + NSFYELE DY
Sbjct  189  FLQPFEISKGSTEGLGKFFREIHESEMKSFGVVVNSFYELEKDY  232



>emb|CDY45706.1| BnaC02g35080D [Brassica napus]
Length=294

 Score =   206 bits (524),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 147/231 (64%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQIQ  254
            LHV FFP MAHGHMIPTLDMAKLF+SRG K+TI+TTP N  +  K +D +  L    +I+
Sbjct  8    LHVMFFPFMAHGHMIPTLDMAKLFSSRGAKSTILTTPLNSKILQKHIDTFKNLNPSLEIE  67

Query  255  IRLLEFPAVEVGLPEDCQSVD------KVPSTEALPSFFKACAmlqeplerllmelrpDC  416
            I++L+FP V++GLPE C+  D      K    + +  FF +    +  LE LL  +RPDC
Sbjct  68   IQVLDFPCVQLGLPEGCEDADFLTLSNKDDRQDMITKFFLSTRFFKGQLENLLETMRPDC  127

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            L AD+FFPWAT AA KF++PRL+FHG  Y  +C    ++ HKP   V+S  E F IP+LP
Sbjct  128  LTADMFFPWATQAAEKFNVPRLVFHGFGYFPLCFAYCIKLHKPQQRVTSSCEPFVIPHLP  187

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T+ Q++  +     T   + +  V+ESE  S G + NSFYELEPDY
Sbjct  188  GSIVMTQEQINDCDEG---TEMGKFMVEVKESEVESSGVVVNSFYELEPDY  235



>ref|XP_010027902.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW54539.1| hypothetical protein EUGRSUZ_I00497 [Eucalyptus grandis]
Length=483

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/229 (48%), Positives = 154/229 (67%), Gaps = 5/229 (2%)
 Frame = +3

Query  72   MGD---LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG  242
            MG+   +H+FFFP +A GHMIP +DMAKLFA RG K+T+I TP ++P F K++ K    G
Sbjct  1    MGESHQVHIFFFPFVASGHMIPMIDMAKLFAIRGCKSTLIATPHDKPTFLKSIAKTKDDG  60

Query  243  FQIQIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLV  422
            F I +  +  P  EVGLPEDC +++KV + E    FF+A  ML + LERL+ +L PDCLV
Sbjct  61   FDIDVITVTLPLKEVGLPEDCDNMNKVTTVEVRKQFFRAIKMLDQQLERLIEKLAPDCLV  120

Query  423  ADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQ  602
            +D+  PW T+ AAK+ IPRL+FHG+S  ++ +   +R ++P   VS DSE F IPN P +
Sbjct  121  SDMLLPWTTEIAAKWGIPRLVFHGTSAFSIASMECVRLYEPQKRVSCDSEPFVIPNFPGE  180

Query  603  LKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            + ++R+Q+  + R E E   T++L  + ESE  S+G I NSFYELEP Y
Sbjct  181  ITMSRMQLPDVYREETEV--TKLLNVMMESEKRSFGVIMNSFYELEPAY  227



>ref|XP_007199033.1| hypothetical protein PRUPE_ppa018059mg [Prunus persica]
 gb|EMJ00232.1| hypothetical protein PRUPE_ppa018059mg [Prunus persica]
Length=769

 Score =   216 bits (550),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 149/224 (67%), Gaps = 0/224 (0%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQI  257
             LH+FFFP MA GH IP +D+AKLFASRGVK+T+ITTP N P+ SKA+     LGF I+I
Sbjct  8    QLHIFFFPYMAQGHSIPLIDIAKLFASRGVKSTLITTPLNAPLLSKAIQSSKNLGFDIEI  67

Query  258  RLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFF  437
             ++ FP  EVGLP  C+      + E    FFKA  +L+  +E++L + RP CLVAD  F
Sbjct  68   LVIIFPTEEVGLPPGCEIASMTTTHEMKEKFFKATFLLEPQIEQILDQHRPHCLVADSLF  127

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
            PWAT  AAKF IPRLIFHG  +  +CA   ++ ++P   VSSDSE+FTIPNLP ++K+ R
Sbjct  128  PWATYVAAKFGIPRLIFHGPGFFPLCALLGVKLYEPHWKVSSDSEVFTIPNLPVEIKMKR  187

Query  618  LQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             QV  +         +++LK  RE E+ SYG I N+FYELEP +
Sbjct  188  NQVPMVFEQNANLILSKLLKESRECEERSYGIIVNTFYELEPAF  231


 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 107/170 (63%), Gaps = 1/170 (1%)
 Frame = +3

Query  240  GFQIQIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCL  419
            G+  Q+ +LE  A+  G    C     +        FF+A  +L+  LE++L + RP CL
Sbjct  348  GWAPQVLILEHEAIG-GFVSHCGWNSILEGVSCGEKFFRATTLLRPQLEQILDQQRPHCL  406

Query  420  VADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPH  599
            +AD  FPWATD AAKF IPRLIFHG+ +  +CA+ S+  ++P   VSSDSE+FT+PN P 
Sbjct  407  LADTLFPWATDVAAKFGIPRLIFHGTGFFPLCASLSVILYEPHLKVSSDSEVFTLPNFPV  466

Query  600  QLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            ++KLT  Q+    + ++ET FT++ +  +  E+ SYG I NSFYELEP Y
Sbjct  467  EIKLTGSQIPAFLKKKVETEFTKLFEASKACEERSYGVIVNSFYELEPVY  516



>gb|AFJ52945.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=492

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 148/224 (66%), Gaps = 1/224 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            L V FFP MA GHMIP +DMA+LFA RGVK+TIITTP N P+FS  + +    G QIQ  
Sbjct  6    LQVVFFPFMAQGHMIPLVDMARLFARRGVKSTIITTPLNAPLFSDKIKRDADQGLQIQTH  65

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +++FP +E GLPE C++V+ + S + L  FF +    ++P+E LL   +PDC VADLFF 
Sbjct  66   IIDFPFLEAGLPEGCENVNTIKSADMLLPFFMSMHAFKKPVEELLELWKPDCFVADLFFH  125

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W T++A    IPRL F+G+S  A+C  +     +P+  V SDSE F +P LPH+++ T+L
Sbjct  126  WGTESAHSLGIPRLFFNGTSSFAICLMHCFTRQEPWKGVESDSEPFVMPGLPHRIEFTKL  185

Query  621  QVSPMERSE-IETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+ P  + E I   + E+   + ESE+ S+GA+ NSF+ELEP Y
Sbjct  186  QLPPFWKGEGITEEWLEMRDLINESEEKSFGAVVNSFHELEPGY  229



>ref|XP_007153573.1| hypothetical protein PHAVU_003G046900g [Phaseolus vulgaris]
 gb|ESW25567.1| hypothetical protein PHAVU_003G046900g [Phaseolus vulgaris]
Length=478

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 156/223 (70%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP +++GH+IPT+DMAK+FA +GVKATIITTP+N P  SKA++K  +    IQI+
Sbjct  10   LHIFFFPFLSYGHIIPTVDMAKVFAEKGVKATIITTPSNAPFISKAIEK-AKTNNNIQIQ  68

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             + F   E GLP+  +  D + S +    FF A ++LQEPLE+LL++ RP+C+VAD+FFP
Sbjct  69   TIHFSTAEAGLPDGLEISDSISSQDLFHRFFMATSLLQEPLEQLLLKQRPNCVVADMFFP  128

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD+AAKF IPRL+FHG+S  ++CAT  L  +   NHVSSDSE  TIPNLP ++K+   
Sbjct  129  WATDSAAKFGIPRLVFHGTSLFSLCATTCLGLYSSNNHVSSDSESLTIPNLPGEIKIAGT  188

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             ++     E     T+++K   ESE  S+G + N+FY LE DY
Sbjct  189  SLASYAMVE-HKGMTKLMKEAIESELRSHGVVVNTFYALEKDY  230



>gb|KGN43910.1| hypothetical protein Csa_7G073460 [Cucumis sativus]
Length=219

 Score =   203 bits (516),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 142/205 (69%), Gaps = 1/205 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+F FP MAHGHMIP ++MA LFASRG+K TI+TTP N    SK++   +     I + 
Sbjct  8    LHIFMFPFMAHGHMIPVVNMANLFASRGIKITIVTTPLNSISISKSLHNDSS-SLHIHLL  66

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +L+FP+ EVGLP+DC++VD +P+ + LP F++A ++LQ  LE  L + RP CLVAD+FFP
Sbjct  67   ILKFPSAEVGLPDDCENVDSLPTMDLLPLFYQAISLLQSSLEEALHQNRPHCLVADMFFP  126

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W  D A +  IPRLIFHG+   ++CA+  +R H+P+ HVSS +E F IP LP  +KLT++
Sbjct  127  WTNDVADRIGIPRLIFHGTGSFSLCASEFVRIHQPYKHVSSYTERFVIPYLPGDIKLTKM  186

Query  621  QVSPMERSEIETPFTEILKRVRESE  695
            Q+  + R  IE  + +   +V+ESE
Sbjct  187  QLPIILRENIENEYNKFSTKVKESE  211



>ref|XP_010447141.1| PREDICTED: UDP-glycosyltransferase 73B3 isoform X2 [Camelina 
sativa]
Length=482

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 150/231 (65%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQIQ  254
            LHV FFP MAHGHMIPT+DMAKLF+SRG K+TI+TTP N  +  K +D +  L  G +I 
Sbjct  10   LHVMFFPFMAHGHMIPTVDMAKLFSSRGAKSTILTTPLNAKILQKPIDAFKNLNPGLEID  69

Query  255  IRLLEFPAVEVGLPEDCQSVD------KVPSTEALPSFFKACAmlqeplerllmelrpDC  416
            I++ +FP V++GLPE C++ D       V   +    FF +   L++ LE+LL   RPDC
Sbjct  70   IQIFDFPCVQLGLPEGCENADFFTSDNNVDRQDMTLKFFMSTRFLKDQLEKLLQTTRPDC  129

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            L+AD+FFPWAT AA KF++PRL+FHG+ Y ++C+   +R H P N V+S  E F IP+LP
Sbjct  130  LIADMFFPWATKAAEKFNVPRLVFHGTGYFSLCSDYCIRVHNPQNTVASSCEPFVIPDLP  189

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T+ Q+        E+   + +  VR SE  S G + NSFYELEP+Y
Sbjct  190  GNIVITKDQIGDRHG---ESEMGKFMAEVRASEVKSSGVVVNSFYELEPEY  237



>ref|XP_009119412.1| PREDICTED: UDP-glycosyltransferase 73B5 [Brassica rapa]
Length=484

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 152/231 (66%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQIQ  254
            +HV FFP MAHGHMIP LDMAKLF+SRG K+TIITTP+N  +  K ++ +     G +I 
Sbjct  9    IHVCFFPFMAHGHMIPILDMAKLFSSRGAKSTIITTPSNSKISEKPIEAFRNQNPGLEIG  68

Query  255  IRLLEFPAVEVGLPEDCQSVDKVPSTEA------LPSFFKACAmlqeplerllmelrpDC  416
            I++ +FP+VE+GLPE C++VD + S +          F  +   +++ LE  +   +P C
Sbjct  69   IKIFDFPSVELGLPEGCENVDFITSYQKPDAGDLFLKFLFSTKHMKQQLESFIETTKPSC  128

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            +VAD+FFPWAT+AA KF +PRL+FHG+S+ ++C + ++RTHKP   V++ S  F IP LP
Sbjct  129  IVADMFFPWATEAAEKFGVPRLVFHGTSFFSLCCSYNMRTHKPHKKVATTSTPFVIPGLP  188

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T  Q +  +    ETP  + +K VRESE  S+G + NSFYE+E  Y
Sbjct  189  GDIVITAEQANVADE---ETPMGKFMKEVRESESISFGVLVNSFYEMESTY  236



>emb|CDY53948.1| BnaA02g36980D [Brassica napus]
Length=295

 Score =   205 bits (522),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 107/231 (46%), Positives = 149/231 (65%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQIQ  254
            LHV FFP MAHGHMIPTLDMAKLF+SRG K+TI+TTP N  +  K ++ +  L    +I+
Sbjct  8    LHVMFFPFMAHGHMIPTLDMAKLFSSRGAKSTILTTPLNSKILQKHINTFKNLNPSLEIE  67

Query  255  IRLLEFPAVEVGLPEDCQSVDKVP------STEALPSFFKACAmlqeplerllmelrpDC  416
            I++L+FP V++GLPE C++ D +         + +  FF +    +  LE LL  +RPDC
Sbjct  68   IQVLDFPCVQLGLPEGCENADFLTLNNNDDRQDMITKFFLSTRFFKGQLENLLETMRPDC  127

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            L+AD+FFPWAT AA KF++PRL+FHG  Y  +C    ++ HKP   V+S  E F IP+LP
Sbjct  128  LIADMFFPWATQAAEKFNVPRLVFHGFGYFPLCFAYRIKLHKPQQRVTSSCEPFVIPHLP  187

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T+ Q++  +     T   + +  V+ESE  S G + NSFYELEPDY
Sbjct  188  GSIGMTQEQINDCDEG---TEMGKFMVEVKESEVESSGVVVNSFYELEPDY  235



>gb|AID60126.1| UDP-glucosyl transferase 73B1 [Brassica napus]
 gb|AID60169.1| UDP-glucosyl transferase 73B1 [Brassica napus]
 emb|CDX75401.1| BnaA01g03010D [Brassica napus]
Length=495

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 111/241 (46%), Positives = 160/241 (66%), Gaps = 12/241 (5%)
 Frame = +3

Query  54   SSKDFAMGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYT  233
            +S + A   LH+FFFP MAHGHMIPTLDMAK+FA++G K+TI+TTP N  +F K ++ + 
Sbjct  3    TSDEAAASKLHIFFFPYMAHGHMIPTLDMAKVFATKGAKSTILTTPLNSKLFEKPINSFN  62

Query  234  QLGFQ---IQIRLLEFPAVEVGLPEDCQSVDKVPSTEALPS------FFKACAmlqeple  386
                +   I++++L FP  E+GLPE C++ D + S   L        F  A    +E LE
Sbjct  63   DENPELEDIKLQILNFPCTELGLPEGCENTDFIFSNHDLTKGNLNMKFLLAMEYFKEQLE  122

Query  387  rllmelrpDCLVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSD  566
             LL  ++PDCLV ++FFPWAT  A KF++PRL+FHG+ Y ++CA++ LR HKP+ +V+S 
Sbjct  123  ELLETVKPDCLVGNMFFPWATKVAEKFNVPRLVFHGTGYFSLCASHCLRLHKPYKNVASS  182

Query  567  SELFTIPNLPHQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPD  746
            SE F IP LP  + +T  QV  +E+ E E+   + +K +R+SE  S+G + NSFY+LEP 
Sbjct  183  SEPFVIPELPGDVVITDEQV--IEKEE-ESVMGKFMKDIRDSERDSFGVLVNSFYDLEPA  239

Query  747  Y  749
            Y
Sbjct  240  Y  240



>ref|XP_010905295.1| PREDICTED: scopoletin glucosyltransferase-like [Elaeis guineensis]
Length=481

 Score =   210 bits (535),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 152/223 (68%), Gaps = 1/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+ FFP MAHGHMIP +++A+LFA+RG+K +II+TP N P +SK  ++   LG+Q+ I 
Sbjct  9    LHICFFPFMAHGHMIPMMEIARLFATRGLKISIISTPVNVPQYSKFTERSKILGYQVDIL  68

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +++FP VE GLPE C+ +D   S +   +FF A  ML   LE+LL + RPD LVAD+FFP
Sbjct  69   VIKFPCVEAGLPEGCEHLDMALSGDLNRNFFTAAGMLGPQLEQLLKKHRPDGLVADMFFP  128

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD A    IPR++FHG+ + ++CA   +R ++P   VSSD+E F IPN P ++KLTR 
Sbjct  129  WATDIAHSLGIPRIVFHGTGFFSLCAAECVRLYEPHKKVSSDTEPFVIPNFPGEIKLTRN  188

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    + E    F ++   ++ESE  S+G + NSFYELEP Y
Sbjct  189  QLPHFAKIEGHH-FAQLHIDIKESELKSFGVLVNSFYELEPAY  230



>ref|XP_010057243.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW74287.1| hypothetical protein EUGRSUZ_E02950 [Eucalyptus grandis]
Length=485

 Score =   210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 151/223 (68%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+ F P+ A GHMIP +D+AK FA+RG K T+IT+PA   +FSK +++  QLG +  ++
Sbjct  8    LHISFLPLPAQGHMIPMIDIAKAFATRGAKITVITSPAFAAIFSKQIERANQLGLEFHVQ  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             ++FP+ EVG+PE  ++ D    ++ LP F +A ++L+EP+  +L + RPDCLV D FF 
Sbjct  68   TVKFPSTEVGMPEGWENTDATAYSQNLPKFAEALSLLREPVLHILEKHRPDCLVTDFFFA  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD AA+  IPRL+F G+S +AVCA   +  H+P   VS DSE F +P+LP  +KLTR 
Sbjct  128  WATDVAARLKIPRLVFGGTSIIAVCAEEVIARHQPHKGVSCDSETFLMPHLPGDIKLTRN  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q++   R  +E  FT+      E+E  S+G+IFNSFYELE DY
Sbjct  188  QLAEHIRRPVENDFTKHAGEAFEAEVKSFGSIFNSFYELEKDY  230



>ref|XP_009116435.1| PREDICTED: UDP-glycosyltransferase 73B1 [Brassica rapa]
 ref|XP_009116653.1| PREDICTED: UDP-glycosyltransferase 73B1-like [Brassica rapa]
Length=495

 Score =   211 bits (536),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 111/236 (47%), Positives = 157/236 (67%), Gaps = 12/236 (5%)
 Frame = +3

Query  69   AMGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQ  248
            A   LH+FFFP MAHGHMIPTLDMAKLFA++G K+TI+TTP N  +F K ++ +     +
Sbjct  8    AASKLHIFFFPYMAHGHMIPTLDMAKLFATKGAKSTILTTPLNSKLFEKPINSFNDENPE  67

Query  249  ---IQIRLLEFPAVEVGLPEDCQSVDKVPSTEALPS------FFKACAmlqeplerllme  401
               I++++L FP  E+GLPE C++ D + S   L        F  A    +E LE LL  
Sbjct  68   LEDIKLQILNFPCTELGLPEGCENTDFIFSNHDLTKGNLNMKFLLAMEYFKEQLEELLET  127

Query  402  lrpDCLVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFT  581
            ++PDCLV ++FFPWAT  A KF++PRL+FHG+ Y ++CA++ LR HKP+ +V+S SE F 
Sbjct  128  VKPDCLVGNMFFPWATKVAEKFNVPRLVFHGTGYFSLCASHCLRLHKPYKNVASSSEPFV  187

Query  582  IPNLPHQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            IP LP  + +T  QV  +E+ E E+   + +K +R+SE  S+G + NSFY+LEP Y
Sbjct  188  IPELPGDVVITDEQV--IEKEE-ESVMGKFMKDIRDSERDSFGVLVNSFYDLEPAY  240



>sp|Q2V6J9.1|UFOG7_FRAAN RecName: Full=UDP-glucose flavonoid 3-O-glucosyltransferase 7; 
AltName: Full=Flavonol 3-O-glucosyltransferase 7; Short=FaGT7 
[Fragaria x ananassa]
 gb|ABB92749.1| UDP-glucose glucosyltransferase [Fragaria x ananassa]
Length=487

 Score =   210 bits (535),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 154/223 (69%), Gaps = 8/223 (4%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FF P MA GH IP  D+AKLF+S G + TI+TTP N P+FSKA    TQ G +I++ 
Sbjct  11   LHIFFLPFMARGHSIPLTDIAKLFSSHGARCTIVTTPLNAPLFSKA----TQRG-EIELV  65

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            L++FP+ E GLP+DC+S D + + + L  F KA  +++   E++L E RP CLVAD FF 
Sbjct  66   LIKFPSAEAGLPQDCESADLITTQDMLGKFVKATFLIEPHFEKILDEHRPHCLVADAFFT  125

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD AAKF IPRL FHG+ + A+CA+ S+  ++P +++SSDSE F IPNLP ++K+TR 
Sbjct  126  WATDVAAKFRIPRLYFHGTGFFALCASLSVMMYQPHSNLSSDSESFVIPNLPDEIKMTRS  185

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+        E+ F ++LK   E E+ SYG I NSFYELEP Y
Sbjct  186  QLPVFPD---ESEFMKMLKASIEIEERSYGVIVNSFYELEPAY  225



>ref|XP_007042484.1| UDP-glucosyl transferase 73B3 [Theobroma cacao]
 gb|EOX98315.1| UDP-glucosyl transferase 73B3 [Theobroma cacao]
Length=483

 Score =   210 bits (534),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 144/223 (65%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            L +FF P MAHGHMIP  D+  LFA++GVK TIITT  N P  SK  ++   LG++I I 
Sbjct  8    LQIFFLPFMAHGHMIPFTDLVMLFAAKGVKTTIITTTLNVPHISKVTERAKSLGYEINIL  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +  FP+VE GLPE C+S D+  S +    FF A  ML+EPL  LL   RPDCLVAD+FFP
Sbjct  68   VTYFPSVEAGLPEGCESFDQASSPDMQFKFFTATTMLREPLAHLLQAHRPDCLVADMFFP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W TD AA F IPR++FHG+   ++ AT  +R ++P   VSSDSE F IPN P ++KLTR 
Sbjct  128  WVTDVAAAFGIPRIVFHGTCVFSLSATEHIRLYEPHKKVSSDSEPFVIPNFPGEIKLTRS  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    R   ET F++     RE+E   YG I NSFYELE  Y
Sbjct  188  QMPDFVRQ--ETGFSKFYSESRETELKCYGVIVNSFYELESAY  228



>ref|XP_004304021.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Fragaria vesca subsp. vesca]
Length=487

 Score =   210 bits (534),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 154/223 (69%), Gaps = 8/223 (4%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FF P MA GH IP  D+AKLF+S G + TI+TTP N P+FSKA    TQ G +I++ 
Sbjct  11   LHIFFLPFMARGHSIPLTDIAKLFSSHGARCTIVTTPLNAPLFSKA----TQRG-EIELV  65

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            L++FP+ E GLP+DC+S D + + + L  F KA  +++   E++L E RP CLVAD FF 
Sbjct  66   LIKFPSAEAGLPQDCESADLITTQDMLGKFVKATFLIEPHFEKILDEHRPHCLVADAFFT  125

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD AAKF IPRL FHG+ + A+CA+ S+  ++P +++SSDSE F IPNLP ++K+TR 
Sbjct  126  WATDVAAKFRIPRLYFHGTGFFALCASLSVMMYQPHSNLSSDSESFVIPNLPDEIKMTRS  185

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+        E+ F ++LK   E E+ SYG I NSFYELEP Y
Sbjct  186  QLPVFPD---ESEFMKMLKASIEIEERSYGVIVNSFYELEPAY  225



>ref|XP_002867135.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43394.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=482

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 153/231 (66%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQIQ  254
            LHV FFP MA+GH+IPTLDMAKLF+SRG K+TI+TTP N  +  K +D +  L    +I 
Sbjct  9    LHVMFFPFMAYGHLIPTLDMAKLFSSRGAKSTILTTPLNSKILQKPIDTFKNLNPSLEID  68

Query  255  IRLLEFPAVEVGLPEDCQSVDKVPSTEA------LPSFFKACAmlqeplerllmelrpDC  416
            I++ +FP VE+GLPE C++VD   S            FF +    ++ LE+LL   RPDC
Sbjct  69   IQIFDFPCVELGLPEGCENVDFFTSNNNDDRQYLTLKFFLSTRFFKDQLEKLLETTRPDC  128

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            L+AD+FFPWAT+AA K ++PRL+FHG+ Y ++C+   +R H P N V+S  E F IP+LP
Sbjct  129  LIADMFFPWATEAAEKLNVPRLVFHGTGYFSLCSEYCIRVHNPQNRVASSCEPFVIPDLP  188

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T+ Q++  +R E E+   + +  V+ES+  S G I NSFYELEPDY
Sbjct  189  GNIVITKEQIA--DRDE-ESEMGKFMIEVKESDVKSSGVIVNSFYELEPDY  236



>ref|XP_010057244.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW74288.1| hypothetical protein EUGRSUZ_E02951 [Eucalyptus grandis]
Length=485

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 147/223 (66%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP MA GHMIP +DMAK+FA RG K+T+I TP ++P F +++ K   LGF I + 
Sbjct  8    LHIFFFPFMAPGHMIPMIDMAKMFAMRGCKSTLIATPHDEPTFLRSIAKPKDLGFDINVV  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +  P  +VGLPEDC S+ K+ + E   +F +A  ML   +E L+ +L PDCL++D+F P
Sbjct  68   TVTLPLKDVGLPEDCGSLSKITTMEMRMTFVRAVMMLDRQIELLIEKLAPDCLISDIFLP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W T+ AAKF IPRL+FHG+S  ++     +R ++P   VS DSE F IPN P ++ L ++
Sbjct  128  WTTEIAAKFGIPRLVFHGTSAFSMAGIECVRLYQPHKKVSCDSEPFIIPNFPGEITLCKM  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+  + R E E    +    V++SE TS+G + NSFYELEP Y
Sbjct  188  QMQDLVREENE--LAKFFNAVKDSEKTSFGVVMNSFYELEPAY  228



>ref|XP_011088224.1| PREDICTED: scopoletin glucosyltransferase-like [Sesamum indicum]
Length=484

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 154/223 (69%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LHV+F PMMA GH IP +D+A+ FA  G KATII+TP N   FS+ +++  ++G +I I 
Sbjct  9    LHVYFLPMMAPGHTIPMIDIARQFARNGAKATIISTPLNASHFSQTIERDRKIGLEISIS  68

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            L+EFP  E GLPE C+++  + + E + +F +A  +LQEP+E+LL E  PD +VA LFF 
Sbjct  69   LIEFPCQEAGLPEGCENLSSITTPEMVRNFCRAMDLLQEPVEKLLRENHPDAIVAGLFFW  128

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WA D A KF+IPRL F+G+ +  +C  ++L+ HKP  +V S+ E F +P LP ++KLTR 
Sbjct  129  WANDLAQKFNIPRLQFYGTGFFPMCLYHTLKEHKPHENVESECEEFVMPGLPDEVKLTRR  188

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+S   + E ++PF EIL+++  S+ TS G I NSFYELEP Y
Sbjct  189  QLSEETKDEDKSPFAEILRKIAASQSTSLGIIVNSFYELEPAY  231



>ref|XP_010107901.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Morus notabilis]
 gb|EXC17301.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Morus notabilis]
Length=474

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 157/226 (69%), Gaps = 16/226 (7%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQ-LGFQIQ  254
            +LH+FFFP M+HGHMIPT+DMAKLF+ RGV++TIITTP N  + SK + +  Q L  +IQ
Sbjct  14   ELHIFFFPFMSHGHMIPTIDMAKLFSKRGVRSTIITTPLNAILLSKTIQQTNQFLVSEIQ  73

Query  255  IRLLEFPAVE-VGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
            I+ + FP  +  GLP+ C+++D VPS + + +F++A A L+EPLERLL +  P CLVAD+
Sbjct  74   IKTINFPCTDRSGLPQHCENIDSVPSQDMIAAFYEATAELREPLERLLSKHMPTCLVADM  133

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPWATDAAAKF IPRL              S++ H+P+    SD E F IP+LP ++ L
Sbjct  134  FFPWATDAAAKFGIPRL--------------SIKAHEPYIRALSDFEPFVIPDLPGEISL  179

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            T +++  + R  +E+  T++L+  RESE  SYG + NSFY+LEP+Y
Sbjct  180  TTMELPELVRRNVESYMTKLLEEARESEVRSYGVVVNSFYDLEPEY  225



>ref|XP_007011136.1| UDP-glucosyl transferase 73B3 [Theobroma cacao]
 gb|EOY19946.1| UDP-glucosyl transferase 73B3 [Theobroma cacao]
Length=482

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 144/223 (65%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            L +FF P MA GHMIP +D+A LFA++GVK TIITT  N P  SK  ++   LG++I I 
Sbjct  8    LQIFFLPFMAQGHMIPFIDLAMLFAAKGVKTTIITTTLNVPHISKVTERAKNLGYEINIL  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +  FP+VE GLPE C+S D+  S +    FF A  ML+EPL  LL   RPDCLVAD FFP
Sbjct  68   VTYFPSVEAGLPEGCESYDQASSPDMQFKFFTATTMLREPLAHLLQAHRPDCLVADTFFP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W TD AA F IPR++FHG+   ++ AT  +R ++P   VSSDSE F IPN P ++KLTR 
Sbjct  128  WVTDVAAAFGIPRIVFHGTCVFSLSATEHIRLYEPHKKVSSDSEPFVIPNFPGEIKLTRS  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    R   ET FT+     +E+E   YG I NSFYELE  Y
Sbjct  188  QMPDFVRQ--ETGFTKFYSESKETELKCYGVIVNSFYELESAY  228



>ref|XP_006283647.1| hypothetical protein CARUB_v10004704mg [Capsella rubella]
 gb|EOA16545.1| hypothetical protein CARUB_v10004704mg [Capsella rubella]
Length=482

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 149/230 (65%), Gaps = 10/230 (4%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQIQ  254
            LHV FFP MAHGHMIPTLDMAKLF+SR  K+TI+TTP N  +  K +D +  L  G +I 
Sbjct  11   LHVMFFPFMAHGHMIPTLDMAKLFSSRRAKSTILTTPLNAKILQKPIDAFKNLNPGLEID  70

Query  255  IRLLEFPAVEVGLPEDCQSVDKVPST-----EALPSFFKACAmlqeplerllmelrpDCL  419
            I++ +FP V++GLP+ C++ D   S      E    FF +   L++ LE+LL   RPDCL
Sbjct  71   IQIFDFPCVQLGLPQGCENADFFTSNNDDGNEMELKFFFSTRFLKDQLEKLLETTRPDCL  130

Query  420  VADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPH  599
            +AD+FFPWAT+ A KF++PRL+FHG+ Y ++   + +R HKP N V+S  E F IP LP 
Sbjct  131  IADMFFPWATEVAGKFNVPRLVFHGTGYFSLSTGHCIRVHKPQNRVASSCEQFVIPELPG  190

Query  600  QLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             + +T  Q+      + E+   + +  VRESE  S G + NSFYELEPDY
Sbjct  191  NILITEEQIID---GDGESEMGKFMTEVRESEVKSSGVVVNSFYELEPDY  237



>gb|AHL38663.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=483

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 149/231 (65%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQIQ  254
            LHV FFP MA+G+MIPTLDMAKLF+SRG K+TI+TT  N  +  K +D +  L  G +I 
Sbjct  10   LHVMFFPFMAYGNMIPTLDMAKLFSSRGAKSTILTTSLNSKILQKPIDTFKNLNPGLEID  69

Query  255  IRLLEFPAVEVGLPEDCQSVDKVPST------EALPSFFKACAmlqeplerllmelrpDC  416
            I++  FP VE+GLPE C++VD   S       E +  FF +    ++ LE+LL   RPDC
Sbjct  70   IQIFNFPCVELGLPEGCENVDFFTSNNNDDKNEMIVKFFFSTRFFKDQLEKLLGTTRPDC  129

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            L+AD+FFPWAT+AA KF++PRL+FHG+ Y ++CA   +  HKP   V+S SE F IP LP
Sbjct  130  LIADMFFPWATEAAGKFNVPRLVFHGTGYFSLCAGYCIGVHKPQKRVASSSEPFVIPELP  189

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T  Q+      + E+   + +  VRESE  S G + NSFYELE DY
Sbjct  190  GNIVITEEQIID---GDGESDMGKFMTEVRESEVKSSGVVLNSFYELEHDY  237



>ref|XP_008236573.1| PREDICTED: scopoletin glucosyltransferase-like [Prunus mume]
Length=487

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 148/215 (69%), Gaps = 4/215 (2%)
 Frame = +3

Query  105  MAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIRLLEFPAVE  284
            M+HGHMIPT+DMAKLFAS+G+K TII+TP N  +FSKA+++    GF+I +  L+FPAVE
Sbjct  1    MSHGHMIPTIDMAKLFASKGIKTTIISTPHNLSLFSKAIERSELSGFEIGVIALKFPAVE  60

Query  285  VGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFPWATDAAAK  464
            VGLPE C+S   V + E L  F KA  +L + LE+LL E +P+CLVADLFFPWATD AAK
Sbjct  61   VGLPEGCESAHMVETQEELQKFLKAATLLDQQLEQLLKEHQPNCLVADLFFPWATDVAAK  120

Query  465  FDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRLQVSPMERS  644
            F IPRL+FHG+S++++C T+ L   K    + SDSE   IPNLPH+ +L   Q+    + 
Sbjct  121  FGIPRLVFHGTSFISLCVTHHLM--KMDLSIVSDSEPLVIPNLPHKHELAGNQIPDFMKQ  178

Query  645  EIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            E E       K   ESE  S+G + NSFYELEP Y
Sbjct  179  ESE--LGSFAKAAAESEWKSHGVLVNSFYELEPAY  211



>ref|XP_009129082.1| PREDICTED: UDP-glycosyltransferase 73B3-like [Brassica rapa]
Length=294

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/231 (46%), Positives = 148/231 (64%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQIQ  254
            LHV FFP MAHGHMIPTLDMAKLF+SRG K+TI+TTP N  +  K +D +  L    +I+
Sbjct  8    LHVMFFPFMAHGHMIPTLDMAKLFSSRGAKSTILTTPLNSKILQKHIDTFKNLNPSLEIE  67

Query  255  IRLLEFPAVEVGLPEDCQSVDKVP------STEALPSFFKACAmlqeplerllmelrpDC  416
            I++L+FP V++GLPE C++ D +         + +  FF +    +  LE LL  +RPDC
Sbjct  68   IQVLDFPCVQLGLPEGCENADFLTLNNNDDRQDMITKFFLSTRFFKGQLENLLETMRPDC  127

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            L+AD+FFPWAT AA KF++PRL+FHG  Y  +C    ++ HKP   V+S  E F I +LP
Sbjct  128  LIADMFFPWATQAAEKFNVPRLVFHGFGYFPLCFAYRIKLHKPQQRVTSSCEPFVIAHLP  187

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T+ Q++  +     T   + +  V+ESE  S G + NSFYELEPDY
Sbjct  188  GSIVMTQEQINDCDEG---TEMGKFMVEVKESEVESSGVVVNSFYELEPDY  235



>ref|XP_010027865.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW54506.1| hypothetical protein EUGRSUZ_I00448 [Eucalyptus grandis]
Length=484

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/229 (47%), Positives = 151/229 (66%), Gaps = 5/229 (2%)
 Frame = +3

Query  72   MGD---LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG  242
            MG+   +H+FFFP MA GHMIP ++MAKLFA RG K+T+I TP ++P F K++ K    G
Sbjct  1    MGESHQVHIFFFPFMASGHMIPMIEMAKLFAIRGCKSTLIATPHDKPTFLKSITKTKDAG  60

Query  243  FQIQIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLV  422
            F I +  +  P  EVGLPED  +++K+ + E    F++A  ML + LERL+ +L P+CLV
Sbjct  61   FDIDVVTVTLPLKEVGLPEDSDNMNKITTEEIRKQFYRAIRMLDQQLERLIEKLAPNCLV  120

Query  423  ADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQ  602
            +D+F PW T+ AAK+ IPRL+FHGSS  +      +R ++P   VS DSE F IPN P +
Sbjct  121  SDMFLPWTTEIAAKWGIPRLVFHGSSAFSSAGAGCVRIYEPHKKVSHDSEPFIIPNFPGE  180

Query  603  LKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            + ++R+Q+    R   ET FT+    V+ESE  S+G + NSFYELEP Y
Sbjct  181  ITMSRMQLPDFYRE--ETEFTKFFNEVKESEKRSFGVVMNSFYELEPAY  227



>ref|XP_010027864.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW54501.1| hypothetical protein EUGRSUZ_I00445 [Eucalyptus grandis]
Length=488

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 147/223 (66%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP+MA GH IP +DMAKLFA RG K+T+ITTP ++P F K++ K    GF I + 
Sbjct  12   LHIFFFPVMAPGHTIPMIDMAKLFAIRGCKSTLITTPHDEPTFLKSIAKTKDSGFDINVV  71

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +  P  EVGLPED   ++KV + E    F +A  ML + LE L+ +L PDCL++D F P
Sbjct  72   TVTLPLKEVGLPEDSDFLNKVTTVEMRKQFRRAIMMLDQQLEMLIEKLAPDCLISDTFLP  131

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W T+ AAK+ IPRL FHG+S  ++  T  +R ++P   VS DSE F IPN P ++ ++R+
Sbjct  132  WTTEIAAKYKIPRLAFHGTSAFSIAGTECVRLYEPHKKVSCDSEPFIIPNFPGEITMSRM  191

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+  + R   ET FT+    V+ESE  S+G I NSFYELEP Y
Sbjct  192  QLPDLFRE--ETDFTKFYNEVKESEKRSFGVIMNSFYELEPAY  232



>dbj|BAF75887.1| tetrahydroxychalcone glucosyltransferase [Dianthus caryophyllus]
Length=489

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 151/226 (67%), Gaps = 3/226 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LHV FFP+MA GHMIPTLD+AKLFA+  VK TI+TTP N P F K +  YT +G  I ++
Sbjct  8    LHVVFFPLMAAGHMIPTLDIAKLFAAHHVKTTIVTTPLNAPTFLKPLQSYTNIGPPIDVQ  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqe--plerllmelrpDCLVADLF  434
            ++ FPA E GLPE  ++ +   S E    F KA  +L+E           + DCLVAD+ 
Sbjct  68   VIPFPAKEAGLPEGVENFEHFTSDEMSLKFLKAAELLEEPLIQVLERCNPKADCLVADML  127

Query  435  FPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLT  614
             P+AT+ AAKFDIPRL+FHGS   A+   ++   ++P   VS+D E F IP+LPH++K+T
Sbjct  128  LPFATEVAAKFDIPRLVFHGSCCFALSVMDAFIKYQPHKDVSNDDEEFVIPHLPHEIKIT  187

Query  615  RLQVSP-MERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            R+Q++  +++++ +T + ++L R  ESE  SYG I NSFYELEP+Y
Sbjct  188  RMQLNEGVKQNKQDTMWMDVLGRALESEIKSYGVIVNSFYELEPEY  233



>gb|KCW55169.1| hypothetical protein EUGRSUZ_I01125 [Eucalyptus grandis]
Length=473

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 146/223 (65%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP MA GHMIP +DMAK+FA RG K+T+I TP ++P F +++ K    GF I + 
Sbjct  8    LHIFFFPFMAPGHMIPMIDMAKMFAMRGCKSTLIATPHDEPTFLRSIAKTKDSGFDINVV  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +  P  +VGLPEDC S+ K+ + E   +F +A  ML   +E L+ +L PDCL++D+F P
Sbjct  68   TVTLPLKDVGLPEDCGSLSKITTMEMRMTFIRAVMMLDRQIELLIEKLAPDCLISDIFLP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W T+ AAKF IPRL+FHG+S  ++  T  +R ++P   VS DSE F IPN P ++ L R+
Sbjct  128  WTTETAAKFGIPRLVFHGTSAFSMAGTECVRLYQPHKKVSCDSEPFIIPNFPGEITLCRM  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+      E E   T+ +  +++SE T +G + NSFYELEP Y
Sbjct  188  QMQDFVNEENE--LTKFVNVMKDSEKTCFGVVMNSFYELEPAY  228



>gb|AID60125.1| UDP-glucosyl transferase 73B2 [Brassica napus]
 gb|AID60168.1| UDP-glucosyl transferase 73B2 [Brassica napus]
 emb|CDX75400.1| BnaA01g03020D [Brassica napus]
Length=486

 Score =   207 bits (528),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 149/232 (64%), Gaps = 14/232 (6%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQ---I  251
            LHV FFP MA+GHMIPTLDMAKLF+S+GVK+TIITTP N  +F K +D +         I
Sbjct  9    LHVMFFPYMAYGHMIPTLDMAKLFSSKGVKSTIITTPLNSKIFQKPIDVFKNQNPSLEII  68

Query  252  QIRLLEFPAVEVGLPEDCQSVD-----KVPSTEALP-SFFKACAmlqeplerllmelrpD  413
             I + EFP V++GLPE C++VD       P  E +   F  +    ++ LE+LL   RPD
Sbjct  69   DIHIFEFPCVQLGLPEGCENVDFFTSSNNPGRENIAFRFLSSTRFFKDQLEKLLETTRPD  128

Query  414  CLVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNL  593
            CL+AD+FFPW+T  A K  +PRL+FHG+ Y ++CA   ++ HKP N V+S SE F IP+L
Sbjct  129  CLIADMFFPWSTQVAEKCHVPRLVFHGTGYFSLCANYCMKVHKPQNKVASSSEPFVIPDL  188

Query  594  PHQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            P  +++TR Q+        E+   + L  VRESE  S G I NSFYELEP+Y
Sbjct  189  PGDIEITREQI-----INSESEMAKFLLDVRESETKSTGVIVNSFYELEPEY  235



>ref|XP_006297553.1| hypothetical protein CARUB_v10013576mg [Capsella rubella]
 gb|EOA30451.1| hypothetical protein CARUB_v10013576mg [Capsella rubella]
Length=482

 Score =   207 bits (527),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 151/230 (66%), Gaps = 10/230 (4%)
 Frame = +3

Query  84   HVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVD--KYTQLGFQIQI  257
            H+ FFP MAHGHMIPTLDMAKLFASRG K+T++TTP N  +  K ++  K      +I I
Sbjct  7    HILFFPFMAHGHMIPTLDMAKLFASRGAKSTLLTTPINAKILEKPIEAFKVQNPDLEIGI  66

Query  258  RLLEFPAVEVGLPEDCQSVDKVPSTEALPS---FFK---ACAmlqeplerllmelrpDCL  419
            ++ +FP VE+GLPE C++VD + S +   S   FFK   +   +++ LE  +   +P  L
Sbjct  67   KIFDFPCVELGLPEGCENVDFINSYKESDSGDLFFKFLFSIKYMKQQLESFIETTKPSAL  126

Query  420  VADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPH  599
            VAD+FFPWAT++A KF +PRL+FHG+S+ A+C + ++R HKP   V++ S  F IP LP 
Sbjct  127  VADMFFPWATESAEKFGVPRLVFHGTSFFALCCSYNMRIHKPHKKVATSSTPFVIPGLPG  186

Query  600  QLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             + +T  Q + +   + ETPF    K VRESE +SYG + NSFYELE  Y
Sbjct  187  DIVITTDQANVV--VDEETPFGNFWKEVRESEISSYGVLVNSFYELESTY  234



>ref|XP_002518722.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43647.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=461

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 149/215 (69%), Gaps = 2/215 (1%)
 Frame = +3

Query  105  MAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIRLLEFPAVE  284
            MA GH IP +DMAKLFASRG K +IITTP N P  SK++ +   LG +I I +++FP VE
Sbjct  1    MAQGHSIPLIDMAKLFASRGQKVSIITTPVNAPDISKSIQRSRVLGHKIDIVIIKFPCVE  60

Query  285  VGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFPWATDAAAK  464
             GLPE C+ ++ V S E +  FF+A  +L +PLE LL +  PDCLV+D FFPW+   A+K
Sbjct  61   AGLPEGCEHLELVTSPEMVSVFFQATTILAQPLEHLLKKYCPDCLVSDTFFPWSNKVASK  120

Query  465  FDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRLQVSPMERS  644
            F IPR++F G+ + + CA+  +  ++P  +VSSD+++F IPNLP ++KLTR Q+    + 
Sbjct  121  FGIPRIVFSGTCFFSSCASQCMYLYQPCKNVSSDTDVFVIPNLPREIKLTRNQLPEFVKE  180

Query  645  EIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              ET F++  ++V+E+E  SYG + NSFYELEP Y
Sbjct  181  --ETSFSDYYRKVKEAEAKSYGVLVNSFYELEPTY  213



>gb|KFK30053.1| hypothetical protein AALP_AA7G210800 [Arabis alpina]
Length=480

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 149/231 (65%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQIQ  254
            LHV FFP MAHGHMIPTLD+AKLF+SRG K+TI+TTP N  +  K +D +       +I 
Sbjct  8    LHVVFFPFMAHGHMIPTLDLAKLFSSRGAKSTILTTPLNSKILQKPIDAFKNQNPDLEID  67

Query  255  IRLLEFPAVEVGLPEDCQSVDKVPSTE------ALPSFFKACAmlqeplerllmelrpDC  416
            + + +FP V++GLPE  ++VD   S         +  FFKA    +E LE+LL   RPDC
Sbjct  68   LEIFDFPCVQLGLPEGWENVDFFTSNTNNDGGYMIFKFFKATRFFKEQLEKLLETTRPDC  127

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            L+AD+FFPWAT+AA KF +PR +FHG+ Y ++CA   +R H+P N V+S SE F IP+LP
Sbjct  128  LIADMFFPWATEAAEKFHVPRFVFHGTGYFSLCAGYCIRVHQPQNKVASSSEPFVIPDLP  187

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + LTR Q+  +++   E    +    VR+SE  S G I NSFYELEP Y
Sbjct  188  GDIFLTREQIVIVDK---ENEIGKFRIEVRQSEMESSGVIVNSFYELEPAY  235



>emb|CDX69028.1| BnaC01g04250D [Brassica napus]
Length=483

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/233 (48%), Positives = 150/233 (64%), Gaps = 14/233 (6%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQ---  248
            +LHV FFP MA+GHMIPTLDMAKLF+S+GVK+TIITTP N  +F K +D +         
Sbjct  8    ELHVMFFPYMAYGHMIPTLDMAKLFSSKGVKSTIITTPLNSKIFQKPIDVFKNQNPSLEI  67

Query  249  IQIRLLEFPAVEVGLPEDCQSVD-----KVPSTEALP-SFFKACAmlqeplerllmelrp  410
            I I + +FP V++GLPE C++VD       P  E +   F  +    ++ LE+LL   RP
Sbjct  68   IDIHIFDFPCVQLGLPEGCENVDFFTSSNNPGRENIAFKFLSSTRFFKDQLEKLLETTRP  127

Query  411  DCLVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPN  590
            DCL+AD+FFPWAT  A K  +PRL+FHG+ Y ++CA   ++ HKP N V+S SE F IP+
Sbjct  128  DCLIADMFFPWATQVAEKCHVPRLVFHGTGYFSLCANYCMKVHKPQNKVASSSEPFVIPD  187

Query  591  LPHQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            LP  +++TR Q+      + E+     L  VRESE  S G I NSFYELEP+Y
Sbjct  188  LPGDIEITREQI-----IDNESEMGMFLLDVRESETKSSGVIVNSFYELEPEY  235



>ref|XP_010027836.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW54463.1| hypothetical protein EUGRSUZ_I00410 [Eucalyptus grandis]
Length=485

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 148/223 (66%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP +A GHMIP +DMAK+FA+RG K+T+I TP ++P F K++ K   LGF I + 
Sbjct  8    LHLFFFPFIAPGHMIPMIDMAKVFATRGCKSTLIATPHDKPSFMKSITKSKDLGFDIDVV  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +  P  EVGLP DC ++++V S E    F +  AML + LE L+ +L PDCL++D+F P
Sbjct  68   TVTLPLKEVGLPADCDNLNRVTSMEMRQQFRRGTAMLDQQLELLIEKLTPDCLISDMFLP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W     AK  IPRL+FHG+S  +V  T  +R ++P   VSSDSE F IPN P ++ L+R+
Sbjct  128  WTIKVTAKCGIPRLVFHGTSAFSVAGTECVRLYEPHKKVSSDSEPFVIPNFPGEITLSRM  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    +   ET FT+++  ++ESE  S+G + NSFYELE  Y
Sbjct  188  QLQDFVKE--ETEFTKLMDVMKESEKRSFGVVMNSFYELELAY  228



>gb|KEH30901.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=466

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 152/212 (72%), Gaps = 2/212 (1%)
 Frame = +3

Query  120  MIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIRLLEFPAVEVGLPE  299
            MIPT+DMAK+FAS+GVKATI+TTP N+P FS++++++      I I+ ++FP VE GLPE
Sbjct  1    MIPTIDMAKIFASKGVKATIVTTPLNKPFFSRSIEQFKIHFNNIDIQTIKFPCVEGGLPE  60

Query  300  DCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFPWATDAAAKFDIPR  479
             C++VD +P+   LP+FF A  +LQ+P E LL++ +P C+VAD+FFPWATD+A KF IPR
Sbjct  61   GCENVDAIPTISLLPTFFTATKLLQQPFEELLLQQKPHCIVADMFFPWATDSATKFGIPR  120

Query  480  LIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRLQVSPM--ERSEIE  653
            ++FH + + ++C +  L  ++PF +VSS++E F IPNLP  +K+TRLQ+  +  +   I 
Sbjct  121  IVFHATGFFSLCVSQCLEQYEPFKNVSSETEEFFIPNLPGNIKMTRLQLPNIFTKNDAIT  180

Query  654  TPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
                ++   +RESE  SYG I NSFYEL+  Y
Sbjct  181  QNIAKLYAEMRESEARSYGVIVNSFYELDGVY  212



>dbj|BAI63589.1| UDP-glucose glucosyltransferase [Lotus japonicus]
Length=491

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/236 (50%), Positives = 158/236 (67%), Gaps = 12/236 (5%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASR-GVKATIITTPANQPVFSKAVDKYTQ---LGF  245
            +LH+ FFP + HGHMIP  DMA LFA+R GV+ATI+TTP N P  S+ + +  +      
Sbjct  4    ELHILFFPFLGHGHMIPMSDMATLFATRRGVRATIVTTPLNAPTISRTIQEGGEDEGTHA  63

Query  246  QIQIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVA  425
             IQIR ++FP  E GLPE C++ D VPS+  +P+F KA  MLQ PLE LL++  PDCL+A
Sbjct  64   NIQIRTIKFPCAEAGLPEGCENPDLVPSSAMIPNFLKATTMLQGPLEHLLLQEHPDCLIA  123

Query  426  DLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRT---HKPFNHVSSDSELFTIPNLP  596
              FFPWATD+AAKF+IPR++FHG+   ++CA   +R    HK  N VSSDSE F IP+LP
Sbjct  124  SAFFPWATDSAAKFNIPRIVFHGTGVFSLCAAECIRLYEPHKKENIVSSDSEPFVIPHLP  183

Query  597  --HQLKLTRLQVSPMERS---EIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
               ++ +TR  +    +S   E E+  + I+K ++ESE TS+G + NSFYELE  Y
Sbjct  184  GAKEITMTRNALPDYVKSDDEEAESSRSRIVKAIKESEVTSFGVVVNSFYELEQIY  239



>ref|XP_010028418.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=485

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 146/223 (65%), Gaps = 2/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FFFP +A GHMIP +DMAKLFA RG K+T+I TP ++P F K++ K    GF I + 
Sbjct  8    LHIFFFPFVAPGHMIPMIDMAKLFAMRGCKSTLIATPHDEPTFLKSIAKPRDSGFDIDVV  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             +  P  +VGLPEDC +++K  + +    F +A  ML   LE L+ +L PDCL++D+F P
Sbjct  68   TVSLPLKDVGLPEDCDNLNKAATMDMHRQFMRAVMMLDRQLELLIEKLAPDCLISDMFLP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            W T+ AAK  IPRL+FHG+S  +V  T  +R ++P   V  DSE F IPN P ++ L+R+
Sbjct  128  WTTEIAAKCGIPRLVFHGTSAFSVGGTECVRLYEPHKKVLCDSEPFVIPNFPGEITLSRM  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    R E E  FT+   +V+ESE  S+G + NSFYELEP Y
Sbjct  188  QLQDFVREETE--FTKFYAQVKESEKRSFGVVMNSFYELEPAY  228



>ref|XP_004304025.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Fragaria vesca subsp. vesca]
Length=468

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 146/216 (68%), Gaps = 1/216 (0%)
 Frame = +3

Query  105  MAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIRLLEFPAVE  284
            M  GH +P +D+AKLFASRG K++IITTPAN P+F+KA+      G +I+I L++FP+ E
Sbjct  1    MGQGHTLPLIDIAKLFASRGEKSSIITTPANAPLFTKAIQTSRSSGLEIEILLIKFPSSE  60

Query  285  VGLPEDCQSVDKVPST-EALPSFFKACAmlqeplerllmelrpDCLVADLFFPWATDAAA  461
            VGLPE  +S +    T E    FFKA  +L+  +E+LL +  P CLVA   F W+TD AA
Sbjct  61   VGLPEGIESSNDWGKTAEIAEKFFKALTLLKHQVEQLLHQYHPHCLVASSLFHWSTDLAA  120

Query  462  KFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRLQVSPMER  641
            KF IPRLIF G  + ++CA  S+  ++P   V+SDSE F +PNLPH++K+TR ++    +
Sbjct  121  KFGIPRLIFQGPGFFSLCAAMSVTLYQPHMKVASDSESFIVPNLPHEIKMTRNELPSFLK  180

Query  642  SEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             E ET   ++L+  RE+E  SYG I NSFYELEPDY
Sbjct  181  QEGETELMKLLRECRETEKRSYGIIINSFYELEPDY  216



>ref|XP_007042483.1| UDP-glucosyl transferase 73B3, putative [Theobroma cacao]
 gb|EOX98314.1| UDP-glucosyl transferase 73B3, putative [Theobroma cacao]
Length=489

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 149/228 (65%), Gaps = 5/228 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+FF P +A GHMIP +DMAK+FA RG + TIITTP N  +FS  + +    G  I I+
Sbjct  8    LHMFFIPFLAPGHMIPAVDMAKMFAMRGAQTTIITTPFNASLFSNTIQRCKNSGLDIDIK  67

Query  261  LLEFPAVEVGLPEDCQSVD-----KVPSTEALPSFFKACAmlqeplerllmelrpDCLVA  425
            +L+FP VEVGLPE C+++D     K  + E +  F K  AMLQEPLE+LL EL+PDC+VA
Sbjct  68   VLKFPCVEVGLPEGCENLDLITTPKDANREMVVKFCKGAAMLQEPLEQLLQELKPDCIVA  127

Query  426  DLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQL  605
            D+F  W  DAA KF IPRL+FHG+ + ++C    +R ++P   V SDSE F + NLP  +
Sbjct  128  DVFLHWTFDAANKFGIPRLVFHGTGFFSLCGLECMRLYEPQKKVESDSEPFVVTNLPGDV  187

Query  606  KLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            KLTR Q+S      I   FT++L   + SE  SYG + NSFYELE  Y
Sbjct  188  KLTRKQLSDFIDQRIGGDFTQLLIECKASELKSYGVVVNSFYELEATY  235



>emb|CAA17559.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 emb|CAB80130.1| glucosyltransferase-like protein [Arabidopsis thaliana]
Length=478

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/229 (48%), Positives = 146/229 (64%), Gaps = 9/229 (4%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH   FP MAHGHMIPTLDMAKLFA++G K+TI+TTP N  +F +   K    G +I I+
Sbjct  10   LHFLLFPFMAHGHMIPTLDMAKLFATKGAKSTILTTPLNAKLFFEKPIKNLNPGLEIDIQ  69

Query  261  LLEFPAVEVGLPEDCQSVDKVPS------TEALPSFFKACAmlqeplerllmelrpDCLV  422
            +  FP VE+GLPE C++VD   S       E +  FF +    ++ LE+LL   RPDCL+
Sbjct  70   IFNFPCVELGLPEGCENVDFFTSNNNDDKNEMIVKFFFSTRFFKDQLEKLLGTTRPDCLI  129

Query  423  ADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQ  602
            AD+FFPWAT+AA KF++PRL+FHG+ Y ++CA   +  HKP   V+S SE F IP LP  
Sbjct  130  ADMFFPWATEAAGKFNVPRLVFHGTGYFSLCAGYCIGVHKPQKRVASSSEPFVIPELPGN  189

Query  603  LKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            + +T  Q+      + E+   + +  VRESE  S G + NSFYELE DY
Sbjct  190  IVITEEQIID---GDGESDMGKFMTEVRESEVKSSGVVLNSFYELEHDY  235



>ref|XP_010681315.1| PREDICTED: scopoletin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 150/227 (66%), Gaps = 4/227 (2%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LHV FFP+MA GH+IPTLD+AKLFA+  VK TIITTP N P F+K ++ Y  LG +I I 
Sbjct  8    LHVVFFPLMAAGHLIPTLDIAKLFAAHHVKTTIITTPLNAPCFTKPLESYKNLGHRIDIE  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            ++ FP+ E GLPE  ++ D+  S +    F KA  +LQE  E+ L + +P+C+V D+  P
Sbjct  68   IIPFPSKEAGLPEGLENFDQFTSDQMAVKFLKATELLQESFEKFLEKHKPNCIVTDMLMP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            +  + AAKF+IPR++FHG SY A+C  ++L  ++P   + SD E F +PNLPH++ LTR 
Sbjct  128  FTNNVAAKFNIPRIVFHGCSYFALCMMHTLLKYQPHKSLLSDDEEFLVPNLPHEINLTRS  187

Query  621  QVSPMERS----EIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            ++  M R     E+   + +I     E+E+ S+G I NSFYELEP+Y
Sbjct  188  RLPDMMRGQGDKELNDAWMKIFIHAMEAEENSFGVIMNSFYELEPEY  234



>ref|XP_007201142.1| hypothetical protein PRUPE_ppa016033mg [Prunus persica]
 gb|EMJ02341.1| hypothetical protein PRUPE_ppa016033mg [Prunus persica]
Length=474

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 147/222 (66%), Gaps = 2/222 (1%)
 Frame = +3

Query  84   HVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIRL  263
            H+F FP MA GHMIPT+ MAKLFASRG+K TII+TP N   FSK +++   LGF+I + L
Sbjct  9    HIFLFPYMAPGHMIPTIAMAKLFASRGIKTTIISTPKNVAAFSKTIERSKALGFEIGVLL  68

Query  264  LEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFPW  443
            L+FP+VEVGLPE C+    V + E L  F KA ++L + LE+LL E +P+CLVAD  FPW
Sbjct  69   LKFPSVEVGLPEGCECGHMVETLEELQKFLKATSLLDQQLEKLLEEHQPNCLVADNCFPW  128

Query  444  ATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRLQ  623
             TD AAKF IPRL+FHG +++++C +  L        + SDSE   IP+LP ++KL   Q
Sbjct  129  TTDLAAKFGIPRLVFHGINFISLCISQHLIKMDFSTLLKSDSEPLVIPDLPDEIKLAGTQ  188

Query  624  VSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            +    + E E    + L+   E+E  SYG + NSFYELEP Y
Sbjct  189  IPNFLKQETE--LRKFLESTAETERRSYGVVVNSFYELEPVY  228



>gb|AFJ52930.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=495

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/241 (49%), Positives = 161/241 (67%), Gaps = 10/241 (4%)
 Frame = +3

Query  57   SKDFAMGD--LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKY  230
            S + ++GD  LHVFFFP +AHGHMIP +DMAK+FASRGVK TI+TTP N P FSK + K+
Sbjct  3    SLNSSVGDHQLHVFFFPFLAHGHMIPAIDMAKIFASRGVKVTIVTTPLNVPFFSKTISKH  62

Query  231  TQ-LGFQIQIRLLEFPAVEVGLPEDCQSVDKVPS----TEALPSFFKACAmlqeplerll  395
            ++  G +I+IR L+FP  E  LPE C++ + + S     E    F  A   LQE LE+LL
Sbjct  63   SESTGSEIRIRTLKFPTAEFRLPEGCENTEVITSLNLGWETFSKFLLASTKLQESLEKLL  122

Query  396  melrpDCLVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSEL  575
             E RPDCLVAD+FFPWATD++ KF IPRL+FHG+S+ ++   + +  ++P   VSSD+E 
Sbjct  123  EEARPDCLVADMFFPWATDSSEKFGIPRLLFHGTSFFSLSVMDVVSRYEPHKDVSSDTEP  182

Query  576  FTIP-NLPHQLKLTRLQV--SPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPD  746
            F +P  +P ++ LT+ Q+  S +   + ++   E  +RV ES    YG + NSFYELEP 
Sbjct  183  FEVPGGIPDRIMLTKRQLPASAVTPGQEDSFLWEFFERVSESNSHGYGTVVNSFYELEPG  242

Query  747  Y  749
            Y
Sbjct  243  Y  243



>emb|CDY65498.1| BnaCnng47330D [Brassica napus]
Length=483

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 149/231 (65%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQIQ  254
            LHV FFP MA+GHMIPTLDMAKL +SRG K+TIITTP N  +  K +D +  L     I 
Sbjct  10   LHVMFFPFMAYGHMIPTLDMAKLLSSRGAKSTIITTPLNSRILQKPIDVFKNLNPNLDID  69

Query  255  IRLLEFPAVEVGLPEDCQSVDKVPSTEALPS------FFKACAmlqeplerllmelrpDC  416
            I + +FP VE+GLPE C++VD   S   + S      FF + +  ++ LE LL + RPDC
Sbjct  70   IEIFDFPCVELGLPEGCENVDFFTSNTNVDSNYMAFKFFMSTSFFKDQLEVLLKKTRPDC  129

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            L+AD+FFPWAT+AA K  +PRL+FHG+ Y ++CA   ++ HKP N V+S  E F IP LP
Sbjct  130  LIADMFFPWATEAAEKSHVPRLVFHGTGYFSLCAGYCIKMHKPQNKVASSCEPFVIPELP  189

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T+ Q+   +    E+   + +  VRESE  S G + NSFYELEPD+
Sbjct  190  GDIVITQEQIIDGDN---ESEMGKFMIDVRESELKSSGVVVNSFYELEPDH  237



>ref|XP_010028421.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW55164.1| hypothetical protein EUGRSUZ_I01120 [Eucalyptus grandis]
Length=485

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 148/223 (66%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+ F P+ A GHMIP +D+AK FA+RG K T+IT+PA   +FSK +++  QLG +  ++
Sbjct  8    LHISFLPLPAQGHMIPMIDIAKAFATRGAKITVITSPAFAAIFSKQIERANQLGLEFHVQ  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             ++FP+ EVG+PE  ++ D    ++  P F +A ++L+EP+ R+L + R DCLV D FF 
Sbjct  68   TVKFPSTEVGMPEGWENTDATAYSQNQPKFGEALSLLREPVLRILEKHRTDCLVTDFFFA  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD AA+  IPRL+F G+S +AVCA   +  H+P   VS DSE F +P+LP  +KLTR 
Sbjct  128  WATDVAARLKIPRLVFGGTSIIAVCAEEVIARHQPHKGVSCDSETFLVPHLPGDIKLTRN  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    R  +E  F +      ESE  S+G+IFNSFYELE DY
Sbjct  188  QLPEHLRLLVENDFFKHAGEALESELKSFGSIFNSFYELEKDY  230



>ref|XP_010447140.1| PREDICTED: UDP-glucosyl transferase 73B2 isoform X1 [Camelina 
sativa]
Length=483

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 148/232 (64%), Gaps = 12/232 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQIQ  254
            LHV FFP MA GHMIPT+DMAKLF+SRG K+TI+TTP N     K +D +  L  G +I 
Sbjct  10   LHVIFFPFMADGHMIPTVDMAKLFSSRGAKSTILTTPLNAKFLQKPIDAFKNLNPGLEID  69

Query  255  IRLLEFPAVEVGLPEDCQSVDKVPSTEALP-------SFFKACAmlqeplerllmelrpD  413
            I + +FP V++GLPE C+++D                 FF +    ++ LE+LL   RPD
Sbjct  70   IMIFDFPCVQLGLPEGCENIDFFTGDNNADRQDHMTLKFFSSTRFFKDQLEKLLQTTRPD  129

Query  414  CLVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNL  593
            CL+AD+FFPWAT+AA KF++PRL+FHG  Y ++C+   +R H P N V+S  E F IP+L
Sbjct  130  CLIADMFFPWATEAAEKFNVPRLVFHGVGYFSLCSIYCMRVHNPQNTVASSCEPFVIPDL  189

Query  594  PHQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            P  + +++ Q++  +    E+   + +  VRESE  S G + NSFYELEPDY
Sbjct  190  PGNIVISKDQIADCDG---ESEMGKFMTEVRESEVKSSGVVVNSFYELEPDY  238



>ref|XP_010691724.1| PREDICTED: scopoletin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=517

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/225 (49%), Positives = 154/225 (68%), Gaps = 6/225 (3%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGF-QIQI  257
            LH+ FFP MAHGHMIP LD A LFA+RG+KATIITTP N P+F++A     + G   I+I
Sbjct  44   LHIVFFPFMAHGHMIPMLDTATLFAARGIKATIITTPRNFPIFARA----NETGHPSIEI  99

Query  258  RLLEFPAVEVGLPEDCQSVDK-VPSTEALPSFFKACAmlqeplerllmelrpDCLVADLF  434
             +  FP++E GLPE C+++ + + S E    F K+ AML++ LE+ L + RP  LVAD+F
Sbjct  100  EVFRFPSLENGLPEGCENLGQAMKSIEMAEKFIKSAAMLRQQLEQYLEKSRPHFLVADMF  159

Query  435  FPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLT  614
            FPWAT+ AAKF+IPRL+FHG S+ A C  + +  ++P+ HVSSD + F IP LP+++ LT
Sbjct  160  FPWATECAAKFNIPRLVFHGISFFAHCTKDMIMVYQPYKHVSSDEDPFVIPYLPNEITLT  219

Query  615  RLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            R Q+        ++   +  ++++ESE   YG I NSFYELEPDY
Sbjct  220  RSQIPEDLMKHEQSELKKRHEKIQESELQCYGVIVNSFYELEPDY  264



>ref|XP_004159901.1| PREDICTED: UDP-glycosyltransferase 73B3-like [Cucumis sativus]
Length=483

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 148/226 (65%), Gaps = 3/226 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGF---QI  251
            LH+F FP+MA GHMIP +DMAKL +SRGVK TI+TTP N    S ++   ++      +I
Sbjct  5    LHMFLFPIMAPGHMIPMVDMAKLLSSRGVKITIVTTPLNSISISNSIHNNSKSISPPPKI  64

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             + +L+FP+ EVGLP+ C+++D V     +P F  AC +LQ P E  +ME RP C++AD+
Sbjct  65   HLLILKFPSAEVGLPDGCENLDSVTGNAMIPKFISACNLLQTPFEEAVMEHRPHCILADI  124

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPWA D AAKF IPRL FHG+ + + CA+  +R H+P+ HVSS++E F IP LP ++  
Sbjct  125  FFPWANDVAAKFGIPRLTFHGTGFFSTCASEFIRIHEPYKHVSSETEPFLIPCLPGEITF  184

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            T++++        +   +E +KR  E+    YG I NSFYELE +Y
Sbjct  185  TKMKLPEFMWENYKNDLSEFMKRAFEASSKCYGLIMNSFYELEAEY  230



>gb|AFK37676.1| unknown [Lotus japonicus]
Length=491

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 116/236 (49%), Positives = 158/236 (67%), Gaps = 12/236 (5%)
 Frame = +3

Query  78   DLHVFFFPMMAHGHMIPTLDMAKLFASR-GVKATIITTPANQPVFSKAVDKYTQ---LGF  245
            +LH+ FFP + HGHMIP  DMA LFA+R GV+ATI+TTP N P  S+ + +  +      
Sbjct  4    ELHILFFPFLGHGHMIPMSDMATLFATRRGVRATIVTTPLNAPTISRTIQEGGEDEGTHA  63

Query  246  QIQIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVA  425
             IQIR ++FP  E GLPE C++ D VPS+  +P+F KA  MLQ PLE LL++  PDCL+A
Sbjct  64   NIQIRTIKFPCAEAGLPEGCENPDLVPSSAMIPNFLKATTMLQGPLEHLLLQEHPDCLIA  123

Query  426  DLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRT---HKPFNHVSSDSELFTIPNLP  596
              FFPWATD+AAKF+IPR++FHG+   ++CA   +R    HK  N VSSDSE F IP+LP
Sbjct  124  SAFFPWATDSAAKFNIPRIVFHGTGVFSLCAAECIRLYEPHKKENIVSSDSEPFVIPHLP  183

Query  597  --HQLKLTRLQVSPMERS---EIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
               ++ +TR  +    +S   E E+  + I+K ++ESE TS+G + N+FYELE  Y
Sbjct  184  GAKEITMTRNALPDYVKSDDEEAESSRSRIVKAIKESEVTSFGVVVNNFYELEQIY  239



>ref|XP_010488961.1| PREDICTED: UDP-glycosyltransferase 73B5-like [Camelina sativa]
Length=484

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 150/231 (65%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVD--KYTQLGFQIQ  254
            +H+ FFP MAHGHMIP LDMAKLFA RG K+T++TTP N  +  K V+  K    GF+I+
Sbjct  9    IHILFFPFMAHGHMIPVLDMAKLFACRGAKSTLLTTPINAKILEKPVEAFKVQNPGFEIR  68

Query  255  IRLLEFPAVEVGLPEDCQSVD------KVPSTEALPSFFKACAmlqeplerllmelrpDC  416
            I++  FP VE+GLPE C++ D      K  S +    F  +   +++ LE  + + +P  
Sbjct  69   IKIFNFPCVELGLPEGCENGDFINSYQKSDSGDLFLKFLFSTKYMKDQLESFIEKSKPSA  128

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            LVAD+FFPWAT++A KF +PRL+FHG+S+ ++C + ++R HKP  +V++ S  F IPNLP
Sbjct  129  LVADMFFPWATESAEKFGVPRLVFHGTSFFSLCCSYNMRIHKPHKNVATSSTPFFIPNLP  188

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T  Q +  +    ETP  + +K VRESE  S+G + NSFYELE  Y
Sbjct  189  GDIVITADQANVADE---ETPMGKYMKEVRESETNSFGVLVNSFYELESAY  236



>ref|XP_007200246.1| hypothetical protein PRUPE_ppa015133mg [Prunus persica]
 gb|EMJ01445.1| hypothetical protein PRUPE_ppa015133mg [Prunus persica]
Length=469

 Score =   205 bits (521),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 147/215 (68%), Gaps = 4/215 (2%)
 Frame = +3

Query  105  MAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIRLLEFPAVE  284
            M+HGHMIPT+DMAKLFAS+G+K TII+TP N  +FSKA+++    GF+I +  L+FP VE
Sbjct  1    MSHGHMIPTIDMAKLFASKGIKTTIISTPHNLSLFSKAIERSKLSGFEIGVIALKFPVVE  60

Query  285  VGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFPWATDAAAK  464
            VGLPE C+S   V + E L  F KA  +L + LE+LL + +P+CLVAD+FFPWATD AAK
Sbjct  61   VGLPEGCESAHMVETQEELQKFLKATTLLDQQLEQLLKDHQPNCLVADIFFPWATDVAAK  120

Query  465  FDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRLQVSPMERS  644
            F IPRL+FHG++++++C ++ L   K    + SDSE   IPNLPH+ KL   Q+    + 
Sbjct  121  FGIPRLVFHGTNFISLCVSHHLM--KMDLSIVSDSEPLVIPNLPHEHKLAGNQIPDFMKQ  178

Query  645  EIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            E E       K   ESE  S+G + NSFYELEP Y
Sbjct  179  ESE--LGSFAKAAAESEWKSHGVLVNSFYELEPAY  211



>gb|KCW55162.1| hypothetical protein EUGRSUZ_I01117 [Eucalyptus grandis]
Length=485

 Score =   205 bits (521),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 151/223 (68%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+ F P+ A GHMIP +D+AK FA+RG K T+IT+PA   +FSK +++  QLG +  ++
Sbjct  8    LHISFLPLPAQGHMIPMIDIAKAFATRGAKITVITSPAFAVIFSKQIERANQLGLEFHVQ  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             ++FP+ EVG+PE  ++ D    ++ LP F +A ++L+EP+  +L + RP+CLVAD  FP
Sbjct  68   TVKFPSTEVGMPEGWENTDATAYSQNLPKFAEAVSLLREPVLHILEKHRPNCLVADFSFP  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD AA+  IPRL+F G+S +A+CA   +  H+P   VS DSE F +P+LP  +KLTR 
Sbjct  128  WATDVAARLKIPRLVFGGTSIIAMCAEEVIARHQPHKGVSCDSETFLMPHLPGDIKLTRN  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q++   R  +E   T+   +  E+   S+G+IFNSFYELE DY
Sbjct  188  QLAEYIRRPVENYITKHAGKALEAGVKSFGSIFNSFYELEKDY  230



>ref|XP_010028420.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=516

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/243 (44%), Positives = 158/243 (65%), Gaps = 0/243 (0%)
 Frame = +3

Query  21   EISQSIKNFAVSSKDFAMGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQ  200
            E  QS+ +    S +     LH+ F P+ A GHMIP +D+AK FA+RG K T+IT+PA  
Sbjct  19   ETKQSLDHSFSLSMETESNRLHISFLPLPAQGHMIPMIDIAKAFATRGAKITVITSPAFA  78

Query  201  PVFSKAVDKYTQLGFQIQIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqep  380
             +FSK +++  QLG +  ++ ++FP+ EVG+PE  ++ D    ++ LP F +A ++L+EP
Sbjct  79   VIFSKQIERANQLGLEFHVQTVKFPSTEVGMPEGWENTDATAYSQNLPKFAEAVSLLREP  138

Query  381  lerllmelrpDCLVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVS  560
            +  +L + RP+CLVAD  FPWATD AA+  IPRL+F G+S +A+CA   +  H+P   VS
Sbjct  139  VLHILEKHRPNCLVADFSFPWATDVAARLKIPRLVFGGTSIIAMCAEEVIARHQPHKGVS  198

Query  561  SDSELFTIPNLPHQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELE  740
             DSE F +P+LP  +KLTR Q++   R  +E   T+   +  E+   S+G+IFNSFYELE
Sbjct  199  CDSETFLMPHLPGDIKLTRNQLAEYIRRPVENYITKHAGKALEAGVKSFGSIFNSFYELE  258

Query  741  PDY  749
             DY
Sbjct  259  KDY  261



>ref|XP_008236561.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Prunus mume]
Length=477

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 146/223 (65%), Gaps = 3/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+  FP MA GH+IP +DMAKLF SRGV+ATIIT P + P   K ++  T     + I 
Sbjct  8    LHIALFPFMAQGHIIPFIDMAKLFVSRGVEATIITAPLDAPFIHKKIENSTS---PVHIF  64

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             ++ P +EVGLPE+CQS+    S E    FFKA  +L+  LE+ L + RP+CLVAD+FFP
Sbjct  65   TIDLPTLEVGLPENCQSLHLATSPEMQRKFFKAAGLLEPQLEQFLQQNRPNCLVADMFFP  124

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD A+KF IP LIFHG+S  ++CAT  +  +KP   VSSDSE   IPN P +++LTR 
Sbjct  125  WATDVASKFGIPTLIFHGTSGFSLCATLCMFLYKPHLQVSSDSETLFIPNFPDEIELTRK  184

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            ++    R  +E  F+ +    +++E  SYG + NSFYELEP Y
Sbjct  185  KLPDFIRDGVENDFSRLYDEGKKAEQRSYGVLVNSFYELEPAY  227



>dbj|BAG80549.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=485

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 145/223 (65%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH++F PMMA GHMIP +D+A+ FA  GVK T+ITTP N   FSK + +  +LG  I IR
Sbjct  8    LHIYFLPMMAPGHMIPLVDIARQFARHGVKVTVITTPLNASKFSKTIQRDRELGSDISIR  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
              EFP  E GLPE C+++    ST    +F K  ++ Q+P+E+ L E  PDCL+A   F 
Sbjct  68   TTEFPCKEAGLPEGCENIASTTSTLMYLNFIKGLSLFQKPIEQFLEEDHPDCLIAAPQFS  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WA D AAK  IPRL F+G+ +  +CA +SL  HKP   V S++E F IP LP  +K++R 
Sbjct  128  WAVDVAAKLGIPRLFFNGAGFFPLCALHSLMEHKPHLKVESETEEFIIPGLPDTIKMSRQ  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    + E E+  TE+++ +  +E TSYGAI NSFYELEP+Y
Sbjct  188  QIPDHLKDETESVITEMVRAIMGAEMTSYGAIVNSFYELEPNY  230



>ref|XP_007198987.1| hypothetical protein PRUPE_ppa019354mg [Prunus persica]
 gb|EMJ00186.1| hypothetical protein PRUPE_ppa019354mg [Prunus persica]
Length=477

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 147/223 (66%), Gaps = 3/223 (1%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            L +  FP MA GH+IP +DMAKLF SRG+KATIITTP + P   K ++  T     + I 
Sbjct  8    LRIALFPFMAQGHIIPFIDMAKLFVSRGLKATIITTPLDAPFIHKKIENSTS---PVHIF  64

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             ++ P +EVGLPE+CQS+    S E    FFKA  +L+  LE+ L + RP+CLVAD+FFP
Sbjct  65   TIDLPTLEVGLPENCQSLHLATSPEMQRKFFKAAGLLEPQLEQFLQQNRPNCLVADMFFP  124

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD A+KF IP LIFHG+S  ++CAT  +  +KP   VSSDSE   IPN P +++LTR 
Sbjct  125  WATDVASKFGIPTLIFHGTSGFSLCATLCMFLYKPHLQVSSDSETIFIPNFPDKIELTRK  184

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            ++    R  +E  F+ +    +++E+ SYG + NSFYELEP Y
Sbjct  185  KLPDFIRDGVENEFSRLYDEGKKAEERSYGVLVNSFYELEPAY  227



>ref|XP_004307464.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Fragaria vesca subsp. vesca]
Length=485

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 151/223 (68%), Gaps = 8/223 (4%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+F  P MA GH IP  D+AKLF+S G + TI+TTP N P+FSKA    TQ G +I++ 
Sbjct  11   LHIFILPYMARGHSIPLTDIAKLFSSHGARCTIVTTPLNAPLFSKA----TQRG-EIELV  65

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            L++FP+ E GLP+DC+S D + + + +  F KA  +L+   E++L E RP CLVAD FF 
Sbjct  66   LIKFPSAEAGLPQDCESADLIITQDMVGKFIKATFLLEPQFEKILDEHRPHCLVADAFFT  125

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD AAKF IPRL FHG+ +  +CAT S+  ++P  ++SSDSE F IPNLP ++K+TR 
Sbjct  126  WATDVAAKFRIPRLYFHGTGFFPLCATLSVMMYQPHCNLSSDSESFAIPNLPDEIKMTRS  185

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+        E+ F ++LK   E E+ SYG I NSFYELEP Y
Sbjct  186  QLPVFPD---ESEFMKMLKASIEIEERSYGVIVNSFYELEPAY  225



>gb|KFK30052.1| hypothetical protein AALP_AA7G210700 [Arabis alpina]
Length=481

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/230 (47%), Positives = 148/230 (64%), Gaps = 11/230 (5%)
 Frame = +3

Query  84   HVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQIQI  257
            H   FP MAHGHMIPTLDMAKLFA++G K+TI+TTP N  +  K +D + +L    +I I
Sbjct  10   HFLLFPFMAHGHMIPTLDMAKLFATKGAKSTILTTPLNSKILQKPIDTFNKLNPTLEIDI  69

Query  258  RLLEFPAVEVGLPEDCQSVDKVPSTE------ALPSFFKACAmlqeplerllmelrpDCL  419
            ++ +FP V++GLPE C++VD   S         +  F  A    ++ LE+LL   RPDCL
Sbjct  70   KIFDFPCVQLGLPEGCENVDFFTSNNNDDGGYMIFKFLTATRFFKDQLEKLLEATRPDCL  129

Query  420  VADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPH  599
            +AD+FFPWAT+AA KF +PRL+FHG+ Y ++CA + +R H P N V+S  E F IP+LP 
Sbjct  130  IADMFFPWATEAAEKFYVPRLVFHGTGYFSLCAGHCIRMHNPQNRVASSCEPFVIPDLPG  189

Query  600  QLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             + LT+ Q+   +    E+   + +  VR+SE  S G I NSF+ELEP Y
Sbjct  190  DIILTKEQIVDGDN---ESDMGKFMNEVRKSEVESSGVIVNSFHELEPAY  236



>ref|XP_010027867.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW54508.1| hypothetical protein EUGRSUZ_I00450 [Eucalyptus grandis]
Length=483

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/229 (46%), Positives = 152/229 (66%), Gaps = 5/229 (2%)
 Frame = +3

Query  72   MGD---LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG  242
            MG+   +H+FFFP MA GH IP ++MAKLFA RG K+T+I TP ++P F K++ K    G
Sbjct  1    MGESHQVHIFFFPFMASGHSIPMIEMAKLFAIRGCKSTLIATPHDKPTFLKSITKTKDAG  60

Query  243  FQIQIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLV  422
            F I +  +  P  EVGLPEDC +++K+ + E    F++A  ML + LERL+ +L P+CLV
Sbjct  61   FDIDVVTVTLPLKEVGLPEDCDNMNKITTEEIRKQFYRAIRMLDQQLERLIEKLAPNCLV  120

Query  423  ADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQ  602
            +D+  PW T+ AAK+ IPRL FHG+S  ++ +   +R ++P   VS DSE F IPN P +
Sbjct  121  SDMLLPWTTEIAAKWGIPRLAFHGTSAFSIASIECVRLYEPHKRVSHDSEPFVIPNFPGE  180

Query  603  LKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            + ++++Q+  + R   ET FT++   + ESE  S+G I NSFYELEP Y
Sbjct  181  ITMSKMQLPDVYRE--ETEFTKLFNDMMESEKRSFGVIMNSFYELEPAY  227



>ref|XP_008454969.1| PREDICTED: scopoletin glucosyltransferase-like [Cucumis melo]
Length=512

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/228 (46%), Positives = 147/228 (64%), Gaps = 2/228 (1%)
 Frame = +3

Query  72   MG-DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGF-  245
            MG  LH+F  P MA GHMIP +D+AKL +SRG+K TI+TTP N    S ++     L   
Sbjct  33   MGTQLHMFLLPFMARGHMIPMVDLAKLLSSRGIKITIVTTPLNSISISNSIQNSKSLSTS  92

Query  246  QIQIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVA  425
            QIQ+ +L+FP+ EVGLP+ C+++D V + +  P F  A  + Q P E  +M+ RP C++A
Sbjct  93   QIQLLILKFPSAEVGLPDGCENLDSVITPDMFPKFISAFNLFQNPFEEAVMKQRPHCILA  152

Query  426  DLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQL  605
            D++FPWA D AAKF IPRL FH +S+ + CA+  +R H+P+NHV SD+E F IP LP  +
Sbjct  153  DMYFPWANDVAAKFGIPRLNFHATSFFSSCASEFMRIHEPYNHVLSDTEPFLIPRLPGDI  212

Query  606  KLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              T++++    R  ++   +E +KR  E     YG I NSFYELE +Y
Sbjct  213  TFTKMKLPQFVRENLKNEVSEFIKRAHELGFACYGIIMNSFYELEAEY  260



>ref|XP_010690617.1| PREDICTED: scopoletin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score =   202 bits (514),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 150/227 (66%), Gaps = 2/227 (1%)
 Frame = +3

Query  75   GDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL-GFQI  251
            G  H+FF P MA GH+IPTLDMA+LFA++G+K+T++TTPAN   F++ +D +TQ  G +I
Sbjct  8    GRYHIFFLPFMAPGHIIPTLDMARLFATQGIKSTVVTTPANLHYFTETLDVHTQKPGIEI  67

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             +  + FP  E GLPE C++ D + S E     FKA  +LQ P   L+ + +P+CLVAD 
Sbjct  68   DLLTMIFPYEEAGLPEGCENFDSITSPEMFYKLFKAIDLLQHPFTNLMEKYQPNCLVADP  127

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIP-NLPHQLK  608
            FF WA   A KF +PRL+F+GSSY + C  ++L   +P  +VSSDSE F +P +LPH++K
Sbjct  128  FFYWANSIATKFGVPRLVFNGSSYFSRCIISNLLRFEPHKNVSSDSEAFIVPGDLPHEIK  187

Query  609  LTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            LT+ +++P  + E      E++ +++E     YG I NSFYELE  Y
Sbjct  188  LTKSELAPYHKKEGSDSLLELMDKIKEGVSGCYGVIMNSFYELESAY  234



>ref|XP_010467302.1| PREDICTED: UDP-glycosyltransferase 73B4-like [Camelina sativa]
Length=483

 Score =   202 bits (514),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 148/232 (64%), Gaps = 11/232 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVD--KYTQLGFQIQ  254
            +H+ FFP MAHGHMIP LDMAKLFASRG K+T++TTP N  +  K ++  K     F+I 
Sbjct  6    IHILFFPFMAHGHMIPVLDMAKLFASRGAKSTLLTTPINAKILEKPIEAFKVQNPDFEIG  65

Query  255  IRLLEFPAVEVGLPEDCQSVD------KVPSTEALPSFFKACAmlqeplerllmelrpDC  416
            I++  FP VE+GLPE C++ D      K  S+     F  +   ++  LE  +   RP  
Sbjct  66   IKIFNFPCVELGLPEGCENGDFINSYQKSDSSNLFVKFILSTKYMKHQLESFIETTRPSA  125

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            LVAD+FFPWAT++A KF +PRL+FHG+S  A+C + ++R HKP   VS+ S  F IP LP
Sbjct  126  LVADMFFPWATESAEKFGVPRLVFHGTSVFALCCSYNMRIHKPHKKVSTSSTPFVIPGLP  185

Query  597  -HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              ++ +TR Q + +   + ETPF +  K VRESE +S+G + NSFYELE  Y
Sbjct  186  GEEIVITRDQANVV--FDEETPFGKFWKEVRESEISSFGVLVNSFYELESAY  235



>ref|XP_006409549.1| hypothetical protein EUTSA_v10022663mg [Eutrema salsugineum]
 gb|ESQ51002.1| hypothetical protein EUTSA_v10022663mg [Eutrema salsugineum]
Length=484

 Score =   202 bits (513),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 106/231 (46%), Positives = 148/231 (64%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQIQ  254
            +HV FFP MA GHMIP LDMAKLF+SRG K+TIITTP N  +  K ++ +       +I 
Sbjct  9    IHVCFFPFMAQGHMIPVLDMAKLFSSRGAKSTIITTPINSKILEKPIEAFKNQNPDLEIG  68

Query  255  IRLLEFPAVEVGLPEDCQSVDKVPSTE---ALPSFFK---ACAmlqeplerllmelrpDC  416
            I++ +FP+VE+ LPE C++VD + S +   A   F K   +   +++ LE  +   +P C
Sbjct  69   IKIFDFPSVELKLPEGCENVDFINSYQKPDAGDLFLKLLFSTKYMKQQLESFIETTKPSC  128

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            LVAD+FFPWAT++A KF +PRL+FHG+S+ ++C + S+RTHKP   V + S  F I  LP
Sbjct  129  LVADMFFPWATESAEKFGVPRLVFHGTSFFSLCCSYSMRTHKPHKKVPTSSTPFVITGLP  188

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T  Q +       ETP  + +K VRESE  S+G + NSFYELEP Y
Sbjct  189  GDIVITEEQANIASE---ETPMGKFMKEVRESESNSFGVLVNSFYELEPAY  236



>ref|XP_007042490.1| Anthocyanin 3'-O-beta-glucosyltransferase [Theobroma cacao]
 gb|EOX98321.1| Anthocyanin 3'-O-beta-glucosyltransferase [Theobroma cacao]
Length=484

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 149/223 (67%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH+ F P +AHG +IPT+DMA+L A  GVK TI TTP N  +F+K + +  + GF+I   
Sbjct  8    LHIVFLPQLAHGILIPTVDMARLCARHGVKVTIATTPLNAHLFAKTIQRDRESGFEISTY  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
            +++FP+ EVGLPE C++   + S E    F KA  + Q+PLE+LL ELRPDCLVA + F 
Sbjct  68   IIKFPSAEVGLPEGCENASSLTSQEMQTKFLKAANLFQQPLEQLLAELRPDCLVAGMMFT  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WATD A+KF IPRL+FHG+S  ++   +S+  H P+  +++D E F +P LP Q+K+T++
Sbjct  128  WATDVASKFGIPRLVFHGTSCFSISILDSVIRHAPYKKIATDFEFFDVPGLPDQIKMTKM  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            Q+    + E  +   ++L    ESE TS+G I NSFYELEP Y
Sbjct  188  QLPDFIKEEEGSERRKMLNEALESERTSFGVIVNSFYELEPAY  230



>ref|XP_011088227.1| PREDICTED: scopoletin glucosyltransferase-like [Sesamum indicum]
Length=483

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 154/227 (68%), Gaps = 5/227 (2%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            MG LH+ F PM+AHGHMIP LDMAKLF SRG+K TII TPA    F+ +V +  + G  I
Sbjct  1    MGQLHIVFLPMIAHGHMIPMLDMAKLFTSRGLKTTIIATPA----FAASVKRARESGHDI  56

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             + +++FP     L ++  S D++ +   LP F +A ++LQEP+E+LL EL P+CL++D+
Sbjct  57   GLTIVQFPPKGSSLSDNIMSFDQITTPALLPKFVEALSLLQEPVEKLLQELNPNCLLSDM  116

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPW  D+AAKF IPRL+F G++  + C +  +  HKPF ++S+DSE F +P+LP +L  
Sbjct  117  FFPWTVDSAAKFGIPRLVFGGTNCFSQCISEQMHLHKPFKNISADSEPFVVPDLPDKLTF  176

Query  612  TRLQVSPMERSE-IETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            TR QV+P    E  +  F+++ + +RESE  SYG +FNS YELE  Y
Sbjct  177  TRTQVAPFVLEEGTKNEFSKLREEMRESEKRSYGVVFNSCYELESAY  223



>ref|XP_009110190.1| PREDICTED: UDP-glycosyltransferase 73B5-like [Brassica rapa]
Length=484

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 148/231 (64%), Gaps = 10/231 (4%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVD--KYTQLGFQIQ  254
            +HV FFP MAHGHMIP LDM KLF+SRG K+TI+TTP+N  +  K ++  K      +I 
Sbjct  11   IHVLFFPFMAHGHMIPVLDMVKLFSSRGAKSTILTTPSNSKILEKTIEAFKNHNTDLEIG  70

Query  255  IRLLEFPAVEVGLPEDCQSVDKVPS------TEALPSFFKACAmlqeplerllmelrpDC  416
            I++ +FP V++GLP+ C  VD + S       + L   F +   +++ LE  +   +P C
Sbjct  71   IKIFDFPCVDLGLPQGCDHVDFISSYKKPGAGDLLLKLFLSTKYMKQQLESFIETTKPSC  130

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            LVAD+FFPW+T++A KF +PRL+FHG+S+ ++C   ++ THKP   V++ S  F IP LP
Sbjct  131  LVADMFFPWSTESAEKFGVPRLVFHGTSFFSLCCFYNMNTHKPHEKVATSSTPFVIPGLP  190

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T  Q +    ++ ETP  +I+K + ESE TS+G + NSFYELE  Y
Sbjct  191  GGIVMTAEQANVA--ADDETPMGKIMKEIGESESTSFGVLVNSFYELESAY  239



>gb|KGN43915.1| hypothetical protein Csa_7G073510 [Cucumis sativus]
Length=484

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 148/224 (66%), Gaps = 1/224 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL-GFQIQI  257
            LH+F FP +A GHMIP +DMAKL +SRG+K TI+TTP N    S ++     L    I +
Sbjct  8    LHIFLFPFLAQGHMIPIVDMAKLLSSRGIKITIVTTPLNSISISNSIKSSKSLYASNIHL  67

Query  258  RLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFF  437
             +L+FP+ EVGLP+ C+++D V S   +P F  A  +LQ P E  +ME RP C++AD+FF
Sbjct  68   LILKFPSAEVGLPDGCENLDFVISPAMIPKFISALNLLQTPFEEAVMEHRPHCIIADMFF  127

Query  438  PWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTR  617
            PWA D AAK  IPRL FHGS + + CA+  +R H+P+NHVSS++E F IP LP  +  T+
Sbjct  128  PWANDVAAKVGIPRLNFHGSCFFSFCASEFVRIHQPYNHVSSETEPFLIPCLPRDITFTK  187

Query  618  LQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            +++    R  ++   +E +++  E+E T YG + NSFYELE +Y
Sbjct  188  MKLPEFVRENVKNYLSEFMEKALEAESTCYGVVMNSFYELEAEY  231



>ref|XP_010107891.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Morus notabilis]
 gb|EXC17291.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Morus notabilis]
Length=475

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 148/217 (68%), Gaps = 2/217 (1%)
 Frame = +3

Query  105  MAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQIQIRLLEFPA  278
            MA GHM+PTLDMAKLFA+RGVK+TIITTP N P+F+KA+DK         I +++++FPA
Sbjct  1    MAQGHMLPTLDMAKLFAARGVKSTIITTPLNAPLFTKAIDKTQNSPNSNYIILKVVKFPA  60

Query  279  VEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFPWATDAA  458
             E  LP+  +++D V   E    FF A  +LQ   E +L ELRP   VAD+FF WATD A
Sbjct  61   KEADLPDGLENLDLVSGPEVHRKFFHALTLLQHSAEDILAELRPHAFVADVFFTWATDLA  120

Query  459  AKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRLQVSPME  638
            +K++IPRL+FHG+S++++C   S+   KP+ +VSSDSE F +P LP ++K+TRLQ+    
Sbjct  121  SKYEIPRLVFHGTSFISMCCMESVAKFKPYENVSSDSEPFVLPGLPGEIKMTRLQIPDYL  180

Query  639  RSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            R   E   T+++K   E+   SYG + NSFYELEP Y
Sbjct  181  RLGQENNLTKLMKSAEEAGRRSYGMVVNSFYELEPVY  217



>ref|XP_011088228.1| PREDICTED: scopoletin glucosyltransferase-like [Sesamum indicum]
Length=464

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 146/226 (65%), Gaps = 15/226 (7%)
 Frame = +3

Query  72   MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQI  251
            M  LH+F  P+ A+GHMIP LDM KLF SRG K TIITTP     F K V+   Q GF+I
Sbjct  1    MDQLHIFLLPLTAYGHMIPALDMTKLFLSRGAKTTIITTPE----FVKEVEHIRQQGFEI  56

Query  252  QIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADL  431
             I  ++FP V +          +    +A    F A   LQEP+E LL  LRPDCLVAD+
Sbjct  57   GIECVKFPQVGI----------RDGGDDAFSYQF-AIYALQEPVEELLERLRPDCLVADM  105

Query  432  FFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKL  611
            FFPWA+DAAAKF+IPRL FHG+S  AV    ++R ++PF  VS+D E F +P+LPHQ+  
Sbjct  106  FFPWASDAAAKFNIPRLAFHGTSCFAVSVAENMRLYRPFEKVSTDFEPFVVPDLPHQITF  165

Query  612  TRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             R QVS  +R EI++ F ++L+   ES   SYG IFNSFYELEP+Y
Sbjct  166  YRTQVSANDRGEIKSDFDKVLEEAIESVKRSYGVIFNSFYELEPEY  211



>ref|XP_002883897.1| UDP-glucosyl transferase 73B5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60156.1| UDP-glucosyl transferase 73B5 [Arabidopsis lyrata subsp. lyrata]
Length=484

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 146/231 (63%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQIQ  254
            +H+ FFP MA GHMIP LDMAKLF+SRG K+T++TTP N  +F K+++ +       +I 
Sbjct  9    IHILFFPFMAQGHMIPILDMAKLFSSRGAKSTLLTTPINAKIFEKSIEAFKNQNPDLEIG  68

Query  255  IRLLEFPAVEVGLPEDCQSVD------KVPSTEALPSFFKACAmlqeplerllmelrpDC  416
            I++  FP VE+GLPE C++ D      K  S +    F  +   +++ LE  +   +P  
Sbjct  69   IKIFNFPCVELGLPEGCENADFINSYQKSDSGDLFLKFLFSTKYMKQQLESFIETTKPSA  128

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            LVAD+FFPWAT++A KF +PRL+FHG+S+ ++C + ++R HKP   V++ S  F IP LP
Sbjct  129  LVADMFFPWATESAEKFGVPRLVFHGTSFFSLCCSYNMRIHKPHKKVATSSTPFVIPGLP  188

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             ++ +T  Q +       ETP  + +K VRESE  S+G + NSFYELE  Y
Sbjct  189  GEIVITEDQANVANE---ETPMGKFMKEVRESETNSFGVLVNSFYELESAY  236



>gb|KFK30051.1| hypothetical protein AALP_AA7G210600 [Arabis alpina]
Length=480

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/232 (50%), Positives = 148/232 (64%), Gaps = 13/232 (6%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQIQ  254
            LHV FFP MAHGHMIPTLDMAKLFA++G K+TIITTP N  +    +D + +L    +I 
Sbjct  8    LHVVFFPFMAHGHMIPTLDMAKLFATKGAKSTIITTPLNSKILLSHIDTFKKLNPTLEID  67

Query  255  IRLLEFPAVEVGLPEDCQSVDKVPST---EALPSFFK---ACAmlqeplerllmelrpDC  416
            I +  FP V++GLPE C++VD   S    +    FFK   A   L++ LE++L   RPDC
Sbjct  68   IEIFNFPCVQLGLPEGCENVDFFTSNNNEDGGYMFFKFLMASRFLKDQLEKILEATRPDC  127

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            L+AD+FFPWA +A  K  +PRL+FHGS Y  +C  + +R HKP N V+S  E F IP+LP
Sbjct  128  LIADMFFPWAIEAPEKSHVPRLVFHGSGYFPLCVAHCIRLHKPQNRVASSCEPFVIPDLP  187

Query  597  HQLKLTRLQ-VSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + LT+ Q +   + SE+   F E    VRESE  S G I NSFYELEP Y
Sbjct  188  GDIVLTQEQIIDGDDESEMGKFFIE----VRESEVKSSGVIVNSFYELEPAY  235



>ref|XP_010432459.1| PREDICTED: UDP-glycosyltransferase 73B1-like [Camelina sativa]
Length=486

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 151/233 (65%), Gaps = 13/233 (6%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVF-SKAVDKYTQL--GFQ-  248
            LH   FP MAHGHMIPTLDMAKLFA++G K+TI+TTP N  +F  K +  + Q   G + 
Sbjct  10   LHFLLFPFMAHGHMIPTLDMAKLFATKGAKSTILTTPLNSKLFFEKPIKSFNQENPGLED  69

Query  249  IQIRLLEFPAVEVGLPEDCQSVDKVPSTEALPS------FFKACAmlqeplerllmelrp  410
            I I +L FP  E+GLPE C++ D + S+  L        F  A    +EPLE++L   +P
Sbjct  70   ISIEILNFPCTELGLPEGCENSDFIFSSPDLAKGDLSQKFLLAMKYFEEPLEKVLETTKP  129

Query  411  DCLVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPN  590
            DCLV ++FFPWAT  A KF +PRL+FHG+   ++CA++ +R HKP+ +V+S SELF IP+
Sbjct  130  DCLVGNMFFPWATKVAEKFGVPRLVFHGTGCFSICASHCIRLHKPYENVASSSELFVIPD  189

Query  591  LPHQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            LP  + +T  QV   E   +   F   +K +RESE  S+G + NSFYELEPDY
Sbjct  190  LPGDVVITEEQVIEKEEESVMGKF---MKGIRESERESFGVLVNSFYELEPDY  239



>emb|CDX76262.1| BnaA08g11380D [Brassica napus]
Length=475

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/231 (46%), Positives = 146/231 (63%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQIQ  254
            LHV FFP MA+GHMIPTLDMAKL +SRG K+TIITTP N  +  K ++ +  L     I 
Sbjct  10   LHVMFFPFMAYGHMIPTLDMAKLLSSRGAKSTIITTPLNSKILKKPIEVFKNLNPNLDID  69

Query  255  IRLLEFPAVEVGLPEDCQSVD------KVPSTEALPSFFKACAmlqeplerllmelrpDC  416
            I + +FP +E+GLPE C++VD       V        FF + +  ++ LE LL + RP+C
Sbjct  70   IEIFDFPCLELGLPEGCENVDFFTSNTNVDGNYMALKFFISTSFFKDQLEVLLKKTRPNC  129

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            L+AD+FFPWAT+AA K  +PRL+FHG+ Y ++CA   ++ HKP N V+   E F IP LP
Sbjct  130  LIADMFFPWATEAAEKSHVPRLVFHGTGYFSLCAGYCIKVHKPQNKVALSCEPFVIPELP  189

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T+ Q+   +    E+   + +  VRESE  S G + NSFYELEPDY
Sbjct  190  GDIVITQEQIIDGDN---ESEMGKFMIDVRESELKSSGVVVNSFYELEPDY  237



>ref|XP_002518708.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43633.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=485

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 106/232 (46%), Positives = 151/232 (65%), Gaps = 4/232 (2%)
 Frame = +3

Query  63   DFAMGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL-  239
            D     LH+ FFP MA GHMIPT++MA++FA  GVKAT+ITTP N   FSK +++  +L 
Sbjct  2    DSRRSQLHIVFFPFMADGHMIPTVNMARVFARHGVKATVITTPLNAATFSKTIERDRELL  61

Query  240  GFQIQIRLLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelr-pDC  416
            G  I +R+L+FP    GLPE C++V  +   E  P+F  A ++LQ PL  +L E +  DC
Sbjct  62   GVDISVRMLKFPCAVAGLPEGCENVSSISKPEMNPNFLVAVSLLQRPLAYVLEECQPADC  121

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            LVAD+ FPWAT+ A K +IPRL F+GSS  A C ++ LR ++P+  V SD E F +P LP
Sbjct  122  LVADMMFPWATEVAGKLEIPRLFFNGSSCFAACVSDCLRRYQPYKTVKSDFEPFIVPGLP  181

Query  597  HQLKLTRLQVSPMERSEI-ETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
             Q++ T+LQ+ PM  +E  +  F +++  + ES+   +G + N+F ELEP Y
Sbjct  182  DQIEKTKLQL-PMYLTETNDDAFKKLMDEISESDLNCFGVLVNTFRELEPAY  232



>ref|XP_006296609.1| hypothetical protein CARUB_v10013563mg [Capsella rubella]
 gb|EOA29507.1| hypothetical protein CARUB_v10013563mg [Capsella rubella]
Length=484

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 149/231 (65%), Gaps = 11/231 (5%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQIQ  254
            +H+ FFP MAHGHMIP LDMAKLFASRG K+T++TTP +  +  K ++ +       +I 
Sbjct  9    VHILFFPFMAHGHMIPILDMAKLFASRGAKSTLLTTPISAKILEKPIEAFKAQNPDLEIG  68

Query  255  IRLLEFPAVEVGLPEDCQSVDKVPSTEALPS---FFK---ACAmlqeplerllmelrpDC  416
            I++ EFP VE+GLPE C++ D + S +   S   FFK   +   ++  LE  +   +P  
Sbjct  69   IKIFEFPCVELGLPEGCENGDFINSYQKSDSGDLFFKFIFSTKYMKHQLESFVETTKPSA  128

Query  417  LVADLFFPWATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLP  596
            LVAD+FFPWAT++A KF +PRL+FHG+S+ A+C + ++R HKP   V++ S  F IP LP
Sbjct  129  LVADMFFPWATESAEKFGVPRLVFHGTSFFALCCSYNMRIHKPHKKVATRSTPFEIPCLP  188

Query  597  HQLKLTRLQVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
              + +T  Q +  + +   TP  + +K VRESE  S+G + NSFYELEP Y
Sbjct  189  GNIVITADQANVADEA---TPMGKYMKEVRESETNSFGVLVNSFYELEPAY  236



>ref|XP_006346384.1| PREDICTED: scopoletin glucosyltransferase-like [Solanum tuberosum]
 ref|XP_006346385.1| PREDICTED: scopoletin glucosyltransferase-like [Solanum tuberosum]
Length=484

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 143/223 (64%), Gaps = 0/223 (0%)
 Frame = +3

Query  81   LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQIQIR  260
            LH++F PMMA GHMIP +D+A+ FA  GVKATIITTP N   FSK + +  ++G  I IR
Sbjct  8    LHIYFLPMMAPGHMIPLVDIARQFARHGVKATIITTPLNASKFSKTIQRDREMGSDISIR  67

Query  261  LLEFPAVEVGLPEDCQSVDKVPSTEALPSFFKACAmlqeplerllmelrpDCLVADLFFP  440
             ++FP  E GLPE C+++    ST    +F    ++ Q P+E+ L E  PDCL+A   F 
Sbjct  68   TVKFPCKEAGLPEGCENIASTTSTLMYLNFIMGLSLFQNPIEQFLEEDHPDCLIAAPQFS  127

Query  441  WATDAAAKFDIPRLIFHGSSYLAVCATNSLRTHKPFNHVSSDSELFTIPNLPHQLKLTRL  620
            WA D A K +IP L F+GS +  +CA +SL  HKP  +V S+ E F IP LP  +K++R 
Sbjct  128  WAVDVATKLEIPTLAFNGSGFFPLCALHSLMEHKPHLNVESEMEEFVIPGLPDTIKMSRQ  187

Query  621  QVSPMERSEIETPFTEILKRVRESEDTSYGAIFNSFYELEPDY  749
            ++S     E +TP T I+K +  +E TSYG I NSFYE+EP+Y
Sbjct  188  KLSEHLMDEKDTPVTAIVKAIMRAETTSYGVIVNSFYEMEPNY  230



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1296918549570