BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25531_g1_i2 len=1810 path=[1788:0-132 1921:133-157 1946:158-237
11797:238-249 2038:250-299 2088:300-355 2144:356-406 2195:407-427
11917:428-430 11920:431-438 2227:439-457 11953:458-466 11962:467-478
2267:479-551 12031:552-561 12041:562-579 12059:580-585 2374:586-699
2488:700-729 2518:730-730 12150:731-735 2524:736-750 2539:751-757
12161:758-766 12170:767-774 2563:775-784 2573:785-822 2611:823-878
2667:879-918 2707:919-940 12265:941-948 12273:949-969 12294:970-987
2776:988-1003 12326:1004-1012 2801:1013-1041 2830:1042-1077
12343:1078-1092 2881:1093-1121 2910:1122-1176 12424:1177-1179
2968:1180-1243 3032:1244-1258 12459:1259-1307 12504:1308-1309
3098:1310-1311 3100:1312-1367 12529:1368-1380 3169:1381-1474
3263:1475-1486 3275:1487-1492 3281:1493-1516 3305:1517-1571
12651:1572-1573 3362:1574-1584 3373:1585-1809]

Length=1810
                                                                      Score     E

ref|XP_009761805.1|  PREDICTED: scopoletin glucosyltransferase          672   0.0      
sp|Q9AT54.1|SCGT_TOBAC  RecName: Full=Scopoletin glucosyltransfer...    670   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009622522.1|  PREDICTED: scopoletin glucosyltransferase          663   0.0      
gb|AAK28304.1|AF346432_1  phenylpropanoid:glucosyltransferase 2         661   0.0      Nicotiana tabacum [American tobacco]
gb|ACO44747.1|  UDP glycosyltransferase                                 646   0.0      Withania somnifera [ashwagandha]
ref|XP_006346388.1|  PREDICTED: scopoletin glucosyltransferase-like     641   0.0      
ref|XP_004230759.1|  PREDICTED: scopoletin glucosyltransferase          635   0.0      
dbj|BAG80536.1|  UDP-glucose:glucosyltransferase                        631   0.0      Lycium barbarum [goji berry]
emb|CAA59450.1|  twi1                                                   618   0.0      Solanum lycopersicum
dbj|BAG80550.1|  UDP-glucose:glucosyltransferase                        618   0.0      Lycium barbarum [goji berry]
ref|XP_009772759.1|  PREDICTED: scopoletin glucosyltransferase-like     610   0.0      
ref|XP_009787720.1|  PREDICTED: scopoletin glucosyltransferase-like     608   0.0      
ref|XP_009600997.1|  PREDICTED: scopoletin glucosyltransferase-like     609   0.0      
ref|XP_006346389.1|  PREDICTED: scopoletin glucosyltransferase-like     586   0.0      
emb|CDP09466.1|  unnamed protein product                                584   0.0      
dbj|BAF49308.1|  putative glycosyltransferase                           579   0.0      Eustoma exaltatum subsp. russellianum [bluebells]
dbj|BAO51837.1|  UDP-glycosyltransferase 73A17                          577   0.0      
ref|XP_006379195.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    578   0.0      
ref|XP_004230756.2|  PREDICTED: scopoletin glucosyltransferase-like     578   0.0      
ref|XP_008236558.1|  PREDICTED: scopoletin glucosyltransferase-like     575   0.0      
ref|XP_002298734.2|  hypothetical protein POPTR_0001s31120g             572   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007200988.1|  hypothetical protein PRUPE_ppa004924mg             572   0.0      
ref|XP_007042481.1|  UDP-glycosyltransferase 73B4, putative             571   0.0      
gb|KCW63754.1|  hypothetical protein EUGRSUZ_G01414                     571   0.0      
gb|KCW64874.1|  hypothetical protein EUGRSUZ_G02440                     570   0.0      
ref|XP_010066838.1|  PREDICTED: scopoletin glucosyltransferase-like     570   0.0      
ref|XP_011013100.1|  PREDICTED: scopoletin glucosyltransferase-like     568   0.0      
ref|XP_011000877.1|  PREDICTED: scopoletin glucosyltransferase-like     568   0.0      
dbj|BAF49309.1|  putative glycosyltransferase                           567   0.0      Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_010066005.1|  PREDICTED: scopoletin glucosyltransferase-like     568   0.0      
ref|XP_011000136.1|  PREDICTED: scopoletin glucosyltransferase-like     567   0.0      
ref|XP_006369755.1|  hypothetical protein POPTR_0001s31040g             567   0.0      
dbj|BAD29722.1|  UDP-glucose glucosyltransferase                        566   0.0      Catharanthus roseus [chatas]
ref|XP_008236559.1|  PREDICTED: scopoletin glucosyltransferase-like     565   0.0      
gb|EYU37652.1|  hypothetical protein MIMGU_mgv1a005524mg                564   0.0      
ref|XP_007200278.1|  hypothetical protein PRUPE_ppa014816mg             563   0.0      
gb|KCW64673.1|  hypothetical protein EUGRSUZ_G02259                     558   0.0      
ref|XP_010066692.1|  PREDICTED: scopoletin glucosyltransferase-like     558   0.0      
ref|XP_006422969.1|  hypothetical protein CICLE_v10028305mg             556   0.0      
ref|XP_008236488.1|  PREDICTED: scopoletin glucosyltransferase-like     555   0.0      
ref|XP_006487029.1|  PREDICTED: scopoletin glucosyltransferase-like     555   0.0      
ref|XP_006487031.1|  PREDICTED: scopoletin glucosyltransferase-like     555   0.0      
dbj|BAJ11652.1|  glucosyltransferase                                    553   0.0      
ref|XP_007200989.1|  hypothetical protein PRUPE_ppa004972mg             553   0.0      
ref|XP_008245758.1|  PREDICTED: scopoletin glucosyltransferase-like     553   0.0      
gb|KDO59783.1|  hypothetical protein CISIN_1g046605mg                   553   0.0      
ref|XP_002518724.1|  UDP-glucosyltransferase, putative                  552   0.0      Ricinus communis
ref|XP_004304714.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    551   0.0      
gb|AFK79039.1|  glycosyltransferase UGT7                                550   0.0      
emb|CAN65903.1|  hypothetical protein VITISV_004870                     550   0.0      Vitis vinifera
ref|XP_002518725.1|  UDP-glucosyltransferase, putative                  549   0.0      Ricinus communis
ref|XP_006346390.1|  PREDICTED: scopoletin glucosyltransferase-like     548   0.0      
ref|XP_004230760.1|  PREDICTED: scopoletin glucosyltransferase-like     547   0.0      
ref|XP_002282463.1|  PREDICTED: scopoletin glucosyltransferase          546   0.0      Vitis vinifera
gb|KDP24999.1|  hypothetical protein JCGZ_23982                         545   0.0      
ref|XP_006487030.1|  PREDICTED: scopoletin glucosyltransferase-like     545   0.0      
ref|XP_011000135.1|  PREDICTED: scopoletin glucosyltransferase-like     545   0.0      
ref|XP_002298733.1|  hypothetical protein POPTR_0001s31130g             544   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007042482.1|  UDP-glucosyl transferase 73B3, putative            543   0.0      
ref|XP_008354700.1|  PREDICTED: scopoletin glucosyltransferase-like     542   0.0      
gb|KDP25001.1|  hypothetical protein JCGZ_23984                         541   0.0      
ref|XP_004304022.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    541   0.0      
ref|XP_008358617.1|  PREDICTED: scopoletin glucosyltransferase-like     539   0.0      
ref|XP_006369760.1|  hypothetical protein POPTR_0001s31090g             538   0.0      
ref|XP_007042484.1|  UDP-glucosyl transferase 73B3                      537   0.0      
ref|XP_008340172.1|  PREDICTED: scopoletin glucosyltransferase-like     535   0.0      
ref|XP_007011132.1|  UDP-glucosyl transferase 73B3                      535   0.0      
ref|XP_003518715.1|  PREDICTED: scopoletin glucosyltransferase-like     535   0.0      
gb|KDP25000.1|  hypothetical protein JCGZ_23983                         534   0.0      
gb|EYU42689.1|  hypothetical protein MIMGU_mgv1a018398mg                534   0.0      
ref|XP_004505252.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      535   0.0      
ref|XP_010107898.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7    531   1e-180   
ref|XP_007011136.1|  UDP-glucosyl transferase 73B3                      531   2e-180   
dbj|BAG71127.1|  glucosyltransferase                                    530   5e-180   Phytolacca americana [common pokeberry]
dbj|BAG31950.1|  UGT73A9                                                530   6e-180   Antirrhinum majus [garden snapdragon]
ref|XP_010107891.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7    530   7e-180   
gb|AFK79034.1|  glycosyltransferase UGT2                                530   8e-180   
ref|XP_008342034.1|  PREDICTED: scopoletin glucosyltransferase-like     529   1e-179   
ref|XP_002313131.2|  hypothetical protein POPTR_0009s10190g             529   2e-179   Populus trichocarpa [western balsam poplar]
ref|XP_004137109.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       528   4e-179   
ref|XP_007199157.1|  hypothetical protein PRUPE_ppa019699mg             528   4e-179   
ref|XP_010027866.1|  PREDICTED: scopoletin glucosyltransferase-like     528   5e-179   
ref|XP_002313133.1|  hypothetical protein POPTR_0009s10120g             528   5e-179   Populus trichocarpa [western balsam poplar]
sp|Q8H0F2.1|ANGT_GENTR  RecName: Full=Anthocyanin 3'-O-beta-gluco...    527   1e-178   Gentiana triflora
ref|XP_003518712.1|  PREDICTED: scopoletin glucosyltransferase-like     526   1e-178   
ref|XP_011088227.1|  PREDICTED: scopoletin glucosyltransferase-like     526   2e-178   
gb|KGN43913.1|  hypothetical protein Csa_7G073490                       526   2e-178   
dbj|BAF75890.1|  tetrahydroxychalcone glucosyltransferase               526   3e-178   Dianthus caryophyllus [carnation]
ref|XP_008454970.1|  PREDICTED: scopoletin glucosyltransferase-like     526   3e-178   
ref|XP_002518723.1|  UDP-glucosyltransferase, putative                  525   7e-178   Ricinus communis
ref|XP_003518713.1|  PREDICTED: scopoletin glucosyltransferase-like     524   1e-177   
ref|XP_003520067.1|  PREDICTED: scopoletin glucosyltransferase-like     524   2e-177   
gb|KHN12234.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7         522   7e-177   
dbj|BAD44686.1|  UDP-glucose:anthocyanin 3'-O-glucosyltransferase       522   7e-177   Gentiana scabra var. buergeri
ref|XP_010691730.1|  PREDICTED: scopoletin glucosyltransferase-like     522   1e-176   
ref|XP_010027900.1|  PREDICTED: scopoletin glucosyltransferase-like     521   2e-176   
gb|ADO33118.1|  UDP glucosyltransferase                                 519   9e-176   
ref|XP_011000140.1|  PREDICTED: scopoletin glucosyltransferase-like     520   1e-175   
ref|XP_004140708.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    519   1e-175   
ref|XP_004159901.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       519   2e-175   
gb|AAS94329.1|  UDP-glucose:flavonoid-O-glucosyltransferase             518   3e-175   Beta vulgaris [beet]
dbj|BAA83484.1|  UDP-glucose: flavonoid 7-O-glucosyltransferase         518   3e-175   Scutellaria baicalensis [Baikal skullcap]
ref|XP_010691725.1|  PREDICTED: scopoletin glucosyltransferase-like     518   4e-175   
ref|XP_010905295.1|  PREDICTED: scopoletin glucosyltransferase-like     518   4e-175   
ref|XP_009108750.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      518   6e-175   
dbj|BAD52006.1|  UDP-glucose: chalcononaringenin 2'-O-glucosyltra...    517   7e-175   Dianthus caryophyllus [carnation]
ref|XP_011000854.1|  PREDICTED: scopoletin glucosyltransferase-like     517   1e-174   
ref|XP_010027865.1|  PREDICTED: scopoletin glucosyltransferase-like     516   1e-174   
ref|XP_002518722.1|  UDP-glucosyltransferase, putative                  515   2e-174   Ricinus communis
ref|XP_003628776.1|  Glucosyltransferase                                516   2e-174   
ref|XP_002867135.1|  predicted protein                                  516   2e-174   
dbj|BAD44687.1|  UDP-glucose:anthocyanin 3'-O-glucosyltransferase       516   3e-174   Gentiana scabra var. buergeri
ref|XP_011000865.1|  PREDICTED: scopoletin glucosyltransferase-like     516   3e-174   
ref|XP_009354715.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    515   4e-174   
emb|CDX76261.1|  BnaA08g11390D                                          515   5e-174   
ref|XP_008456146.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    514   1e-173   
ref|XP_007029404.1|  Anthocyanin 3'-O-beta-glucosyltransferase, p...    514   1e-173   
ref|XP_010681315.1|  PREDICTED: scopoletin glucosyltransferase-like     514   2e-173   
ref|NP_567953.1|  UDP-glucosyl transferase 73B3                         513   2e-173   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010027899.1|  PREDICTED: scopoletin glucosyltransferase-like     513   3e-173   
gb|KGN43909.1|  hypothetical protein Csa_7G073450                       513   4e-173   
gb|KDP24997.1|  hypothetical protein JCGZ_23980                         511   1e-172   
gb|AAS55083.1|  UDP-glucose glucosyltransferase                         511   2e-172   Rhodiola sachalinensis
ref|XP_002518718.1|  UDP-glucosyltransferase, putative                  510   4e-172   Ricinus communis
ref|XP_008375155.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    509   1e-171   
ref|XP_010027867.1|  PREDICTED: scopoletin glucosyltransferase-like     509   1e-171   
ref|XP_002298737.1|  hypothetical protein POPTR_0001s30980g             509   2e-171   Populus trichocarpa [western balsam poplar]
ref|XP_008454968.1|  PREDICTED: scopoletin glucosyltransferase-like     508   2e-171   
ref|XP_010066837.1|  PREDICTED: scopoletin glucosyltransferase-like     508   2e-171   
ref|XP_010027864.1|  PREDICTED: scopoletin glucosyltransferase-like     508   3e-171   
ref|XP_010027902.1|  PREDICTED: scopoletin glucosyltransferase-like     508   3e-171   
ref|XP_010028418.1|  PREDICTED: scopoletin glucosyltransferase-like     508   4e-171   
ref|XP_007153573.1|  hypothetical protein PHAVU_003G046900g             507   6e-171   
ref|XP_003518714.1|  PREDICTED: scopoletin glucosyltransferase-like     507   6e-171   
ref|XP_010027898.1|  PREDICTED: scopoletin glucosyltransferase-like     507   7e-171   
ref|XP_010027835.1|  PREDICTED: scopoletin glucosyltransferase-like     507   1e-170   
ref|XP_009377799.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    506   1e-170   
ref|XP_008236556.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    506   1e-170   
ref|XP_008375156.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    505   4e-170   
emb|CAA17559.1|  glucosyltransferase-like protein                       504   8e-170   Arabidopsis thaliana [mouse-ear cress]
dbj|BAG31952.1|  UGT73A13                                               504   8e-170   Perilla frutescens [beefsteak-mint]
gb|KGN43914.1|  hypothetical protein Csa_7G073500                       503   1e-169   
ref|XP_009779862.1|  PREDICTED: scopoletin glucosyltransferase-like     503   2e-169   
ref|XP_010027836.1|  PREDICTED: scopoletin glucosyltransferase-like     503   2e-169   
ref|XP_006286265.1|  hypothetical protein CARUB_v10007840mg             503   2e-169   
dbj|BAF75893.1|  tetrahydroxychalcone glucosyltransferase               503   3e-169   Dianthus caryophyllus [carnation]
ref|XP_008454967.1|  PREDICTED: scopoletin glucosyltransferase-like     503   3e-169   
ref|XP_010447141.1|  PREDICTED: UDP-glycosyltransferase 73B3 isof...    503   4e-169   
ref|XP_009354713.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    502   5e-169   
ref|XP_010057244.1|  PREDICTED: scopoletin glucosyltransferase-like     502   8e-169   
gb|KGN43915.1|  hypothetical protein Csa_7G073510                       502   8e-169   
ref|XP_004159929.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucose ...    501   1e-168   
ref|XP_009354714.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    501   1e-168   
ref|XP_007198987.1|  hypothetical protein PRUPE_ppa019354mg             501   1e-168   
gb|KFK30052.1|  hypothetical protein AALP_AA7G210700                    501   1e-168   
ref|XP_008236561.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    500   3e-168   
dbj|BAF75887.1|  tetrahydroxychalcone glucosyltransferase               501   3e-168   Dianthus caryophyllus [carnation]
ref|XP_008375157.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    499   4e-168   
ref|XP_004137110.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    516   7e-168   
gb|ADV71369.1|  glycosyltransferase GT14A05                             498   1e-167   
ref|XP_002518717.1|  UDP-glucosyltransferase, putative                  498   1e-167   Ricinus communis
ref|XP_004137108.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    498   2e-167   
ref|XP_010691729.1|  PREDICTED: scopoletin glucosyltransferase-like     498   2e-167   
ref|XP_002518721.1|  UDP-glucosyltransferase, putative                  498   2e-167   Ricinus communis
ref|XP_010107893.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7    498   3e-167   
ref|XP_009625604.1|  PREDICTED: scopoletin glucosyltransferase-like     498   4e-167   
ref|XP_007042483.1|  UDP-glucosyl transferase 73B3, putative            498   4e-167   
ref|XP_010437661.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       497   5e-167   
ref|XP_004305941.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    497   5e-167   
ref|XP_010107895.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7    497   6e-167   
gb|AHV78225.1|  glucosyltransferase                                     497   8e-167   
ref|XP_007200246.1|  hypothetical protein PRUPE_ppa015133mg             495   2e-166   
ref|XP_011000141.1|  PREDICTED: scopoletin glucosyltransferase-like     496   2e-166   
gb|ACJ72160.1|  UGT3                                                    494   4e-166   Pueraria montana var. lobata [kudzu]
ref|XP_006412271.1|  hypothetical protein EUTSA_v10025048mg             494   8e-166   
ref|XP_008364526.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    494   8e-166   
ref|XP_008454969.1|  PREDICTED: scopoletin glucosyltransferase-like     494   2e-165   
emb|CAB56231.1|  betanidin-5-O-glucosyltransferase                      493   2e-165   Cleretum bellidiforme
gb|KFK40015.1|  hypothetical protein AALP_AA3G318900                    492   5e-165   
gb|AFJ52930.1|  UDP-glycosyltransferase 1                               493   5e-165   
ref|XP_007042490.1|  Anthocyanin 3'-O-beta-glucosyltransferase          492   7e-165   
ref|XP_006422970.1|  hypothetical protein CICLE_v10030328mg             491   1e-164   
ref|XP_006283647.1|  hypothetical protein CARUB_v10004704mg             491   1e-164   
ref|XP_010447140.1|  PREDICTED: UDP-glucosyl transferase 73B2 iso...    490   4e-164   
ref|XP_008236573.1|  PREDICTED: scopoletin glucosyltransferase-like     490   4e-164   
gb|AID60125.1|  UDP-glucosyl transferase 73B2                           490   4e-164   
ref|XP_002518719.1|  UDP-glucosyltransferase, putative                  489   5e-164   Ricinus communis
gb|AFJ52945.1|  UDP-glycosyltransferase 1                               489   1e-163   
emb|CDY65497.1|  BnaCnng47320D                                          489   1e-163   
ref|XP_004305939.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    488   1e-163   
ref|XP_010526965.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      489   1e-163   
ref|XP_003518710.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      488   2e-163   
emb|CDX69029.1|  BnaC01g04240D                                          488   2e-163   
sp|Q2V6J9.1|UFOG7_FRAAN  RecName: Full=UDP-glucose flavonoid 3-O-...    488   3e-163   Fragaria x ananassa
gb|AFJ52929.1|  UDP-glycosyltransferase 1                               487   5e-163   
gb|KCW55160.1|  hypothetical protein EUGRSUZ_I01115                     486   1e-162   
ref|XP_004304024.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    486   1e-162   
ref|XP_004304021.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    486   1e-162   
emb|CDY65498.1|  BnaCnng47330D                                          486   1e-162   
ref|XP_010530759.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      486   2e-162   
ref|XP_009116435.1|  PREDICTED: UDP-glycosyltransferase 73B1            486   2e-162   
ref|XP_010432461.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       485   3e-162   
ref|XP_010057243.1|  PREDICTED: scopoletin glucosyltransferase-like     485   4e-162   
ref|NP_567954.1|  UDP-glucosyltransferase 73B2                          484   4e-162   Arabidopsis thaliana [mouse-ear cress]
gb|AID60126.1|  UDP-glucosyl transferase 73B1                           485   4e-162   
ref|XP_010028420.1|  PREDICTED: scopoletin glucosyltransferase-like     486   5e-162   
ref|XP_009108748.1|  PREDICTED: UDP-glycosyltransferase 73B1-like       484   6e-162   
ref|XP_009108751.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      484   6e-162   
ref|XP_010030421.1|  PREDICTED: scopoletin glucosyltransferase-like     484   6e-162   
gb|KCW55162.1|  hypothetical protein EUGRSUZ_I01117                     484   8e-162   
ref|XP_007157726.1|  hypothetical protein PHAVU_002G093300g             483   9e-162   
ref|XP_007153575.1|  hypothetical protein PHAVU_003G047100g             483   1e-161   
ref|XP_010432459.1|  PREDICTED: UDP-glycosyltransferase 73B1-like       483   1e-161   
ref|XP_009116544.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       481   2e-161   
gb|AHL38663.1|  glycosyltransferase                                     482   3e-161   
ref|XP_010048320.1|  PREDICTED: scopoletin glucosyltransferase-like     483   3e-161   
ref|XP_004307464.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    482   5e-161   
emb|CDX69028.1|  BnaC01g04250D                                          481   8e-161   
gb|AIS71990.1|  UDP-glycosyl transferase 1                              481   8e-161   
ref|XP_010028421.1|  PREDICTED: scopoletin glucosyltransferase-like     481   1e-160   
gb|KEH30902.1|  flavonoid glucosyltransferase                           480   1e-160   
ref|XP_010107901.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7    480   2e-160   
emb|CDX76263.1|  BnaA08g11370D                                          480   4e-160   
ref|XP_011088228.1|  PREDICTED: scopoletin glucosyltransferase-like     479   5e-160   
ref|XP_006409549.1|  hypothetical protein EUTSA_v10022663mg             479   5e-160   
ref|XP_009117049.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       479   8e-160   
ref|XP_010068736.1|  PREDICTED: scopoletin glucosyltransferase-like     479   1e-159   
ref|XP_007201019.1|  hypothetical protein PRUPE_ppa005572mg             477   1e-159   
ref|XP_010691724.1|  PREDICTED: scopoletin glucosyltransferase-like     479   1e-159   
ref|XP_004505250.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    479   1e-159   
gb|KFK30050.1|  hypothetical protein AALP_AA7G210500                    478   1e-159   
ref|XP_010263455.1|  PREDICTED: scopoletin glucosyltransferase-like     478   1e-159   
ref|XP_002883897.1|  UDP-glucosyl transferase 73B5                      478   3e-159   
ref|XP_010447136.1|  PREDICTED: UDP-glycosyltransferase 73B1 isof...    478   3e-159   
ref|XP_006283463.1|  hypothetical protein CARUB_v10004508mg             480   3e-159   
gb|AFJ52946.1|  UDP-glycosyltransferase 1                               477   4e-159   
gb|AGU14082.1|  UDP-glycosyltransferase                                 476   5e-159   
ref|XP_007153574.1|  hypothetical protein PHAVU_003G047000g             476   6e-159   
ref|XP_011009740.1|  PREDICTED: scopoletin glucosyltransferase-like     473   8e-159   
gb|KFK30045.1|  hypothetical protein AALP_AA7G209900                    475   1e-158   
emb|CDY36633.1|  BnaA07g04240D                                          476   1e-158   
emb|CDX75399.1|  BnaA01g03030D                                          475   2e-158   
gb|AID60124.1|  UDP-glucosyl transferase 73B3                           475   2e-158   
ref|XP_004505253.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      475   2e-158   
gb|KCW54502.1|  hypothetical protein EUGRSUZ_I00446                     474   3e-158   
ref|XP_006297553.1|  hypothetical protein CARUB_v10013576mg             474   4e-158   
emb|CDX71221.1|  BnaC07g05000D                                          474   6e-158   
gb|KFK30053.1|  hypothetical protein AALP_AA7G210800                    474   7e-158   
ref|XP_009119412.1|  PREDICTED: UDP-glycosyltransferase 73B5            474   8e-158   
ref|XP_006412270.1|  hypothetical protein EUTSA_v10024935mg             474   1e-157   
emb|CDY13143.1|  BnaA09g16740D                                          473   1e-157   
ref|XP_011088224.1|  PREDICTED: scopoletin glucosyltransferase-like     473   1e-157   
emb|CDX76262.1|  BnaA08g11380D                                          473   1e-157   
gb|AFJ52947.1|  UDP-glycosyltransferase 1                               473   1e-157   
ref|XP_007201142.1|  hypothetical protein PRUPE_ppa016033mg             472   2e-157   
ref|XP_002518708.1|  UDP-glucosyltransferase, putative                  472   3e-157   Ricinus communis
ref|XP_010437662.1|  PREDICTED: UDP-glycosyltransferase 73B1-like       472   4e-157   
gb|KFK30051.1|  hypothetical protein AALP_AA7G210600                    471   8e-157   
dbj|BAG80549.1|  UDP-glucose:glucosyltransferase                        471   1e-156   Lycium barbarum [goji berry]
ref|XP_007157236.1|  hypothetical protein PHAVU_002G054100g             469   3e-156   
ref|XP_004304025.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    469   4e-156   
ref|XP_010488961.1|  PREDICTED: UDP-glycosyltransferase 73B5-like       469   6e-156   
gb|KCW55161.1|  hypothetical protein EUGRSUZ_I01116                     468   9e-156   
ref|XP_010530757.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      467   3e-155   
gb|KCW44514.1|  hypothetical protein EUGRSUZ_L01977                     466   4e-155   
gb|KEH30901.1|  flavonoid glucosyltransferase                           466   5e-155   
ref|XP_002867133.1|  UDP-glucosyl transferase 73B1                      466   8e-155   
ref|XP_009602613.1|  PREDICTED: scopoletin glucosyltransferase-like     466   1e-154   
gb|KFK30049.1|  hypothetical protein AALP_AA7G210400                    465   2e-154   
ref|XP_006346386.1|  PREDICTED: scopoletin glucosyltransferase-like     465   3e-154   
ref|XP_003538838.1|  PREDICTED: scopoletin glucosyltransferase-like     464   3e-154   
ref|NP_001189528.1|  UDP-glucosyl transferase 73B5                      465   3e-154   
ref|XP_009136271.1|  PREDICTED: UDP-glycosyltransferase 73B5-like       464   4e-154   
ref|XP_011088741.1|  PREDICTED: scopoletin glucosyltransferase-like     464   4e-154   
ref|NP_179150.3|  UDP-glucosyl transferase 73B5                         464   6e-154   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567955.1|  UDP-glucosyl transferase 73B1                         463   1e-153   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189529.1|  UDP-glycosyltransferase 73B4                       463   1e-153   
ref|XP_002298739.2|  hypothetical protein POPTR_0001s30970g             461   4e-153   Populus trichocarpa [western balsam poplar]
ref|XP_004230753.1|  PREDICTED: scopoletin glucosyltransferase-like     462   4e-153   
gb|KCW55169.1|  hypothetical protein EUGRSUZ_I01125                     461   6e-153   
ref|NP_179151.2|  UDP-glycosyltransferase 73B4                          461   9e-153   
ref|XP_010530755.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      460   1e-152   
ref|XP_010518197.1|  PREDICTED: UDP-glycosyltransferase 73B5            460   1e-152   
ref|XP_002883898.1|  UGT73B4                                            459   2e-152   
ref|XP_010467302.1|  PREDICTED: UDP-glycosyltransferase 73B4-like       459   3e-152   
gb|AIS71989.1|  UDP-glycosyl transferase 2                              457   4e-152   
ref|XP_010488962.1|  PREDICTED: UDP-glycosyltransferase 73B4-like       459   4e-152   
ref|XP_008236571.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    458   7e-152   
dbj|BAI63589.1|  UDP-glucose glucosyltransferase                        458   1e-151   
ref|XP_004304023.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    457   1e-151   
ref|XP_009792742.1|  PREDICTED: scopoletin glucosyltransferase-like     457   1e-151   
emb|CDX89662.1|  BnaC03g45760D                                          457   1e-151   
ref|XP_010107899.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7    457   1e-151   
ref|XP_004305940.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    457   1e-151   
gb|EPS74081.1|  hypothetical protein M569_00673                         457   1e-151   
ref|XP_006296609.1|  hypothetical protein CARUB_v10013563mg             457   2e-151   
gb|AFK37676.1|  unknown                                                 457   3e-151   
ref|XP_010107900.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7    454   1e-150   
emb|CDX69027.1|  BnaC01g04260D                                          453   6e-150   
gb|KDO36537.1|  hypothetical protein CISIN_1g036871mg                   449   7e-150   
ref|XP_010547999.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      453   9e-150   
gb|KCW55167.1|  hypothetical protein EUGRSUZ_I01123                     451   1e-149   
ref|XP_009762300.1|  PREDICTED: LOW QUALITY PROTEIN: scopoletin g...    448   3e-149   
gb|ADV71361.1|  glycosyltransferase GT02J01                             450   1e-148   
gb|KEH30899.1|  flavonoid glucosyltransferase                           447   2e-148   
ref|XP_002282952.2|  PREDICTED: scopoletin glucosyltransferase-like     448   1e-147   
ref|XP_010690618.1|  PREDICTED: scopoletin glucosyltransferase-like     447   2e-147   
gb|KCW64674.1|  hypothetical protein EUGRSUZ_G02260                     442   3e-146   
gb|AFJ52931.1|  UDP-glycosyltransferase 1                               442   1e-145   
ref|XP_010517429.1|  PREDICTED: UDP-glycosyltransferase 73B4-like       439   1e-144   
ref|XP_006346384.1|  PREDICTED: scopoletin glucosyltransferase-like     439   3e-144   
ref|XP_002867134.1|  UGT73B2                                            437   6e-144   
emb|CDY65110.1|  BnaUnng01010D                                          439   7e-144   
ref|XP_009410978.1|  PREDICTED: scopoletin glucosyltransferase-like     438   3e-143   
ref|XP_009110190.1|  PREDICTED: UDP-glycosyltransferase 73B5-like       434   2e-142   
gb|AFJ52948.1|  UDP-glycosyltransferase 1                               433   3e-142   
dbj|BAF75894.1|  glucosyltransferase                                    434   3e-142   
gb|KDO35868.1|  hypothetical protein CISIN_1g041444mg                   429   4e-142   
ref|XP_006346519.1|  PREDICTED: scopoletin glucosyltransferase-like     441   4e-142   
gb|AFJ52944.1|  UDP-glycosyltransferase 1                               434   6e-142   
ref|XP_006442846.1|  hypothetical protein CICLE_v10023414mg             433   7e-142   
ref|XP_006478662.1|  PREDICTED: scopoletin glucosyltransferase-like     433   8e-142   
gb|KDO45786.1|  hypothetical protein CISIN_1g044012mg                   432   1e-141   
ref|XP_007042491.1|  Anthocyanin 3'-O-beta-glucosyltransferase          428   5e-141   
ref|XP_002510179.1|  UDP-glucosyltransferase, putative                  431   6e-141   
gb|EYU37648.1|  hypothetical protein MIMGU_mgv1a005507mg                430   7e-141   
gb|AFJ52949.1|  UDP-glycosyltransferase 1                               429   1e-140   
ref|XP_010925717.1|  PREDICTED: scopoletin glucosyltransferase-like     430   1e-140   
gb|KHN12236.1|  UDP-glycosyltransferase 73B3                            428   2e-140   
ref|XP_002518707.1|  UDP-glucosyltransferase, putative                  424   7e-140   
gb|KHN12235.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7         423   1e-139   
gb|AAD17393.1|  putative glucosyltransferase                            426   2e-139   
gb|KCW54535.1|  hypothetical protein EUGRSUZ_I00492                     421   2e-138   
ref|XP_010690617.1|  PREDICTED: scopoletin glucosyltransferase-like     422   7e-138   
ref|XP_010243179.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       422   2e-137   
ref|XP_006386501.1|  hypothetical protein POPTR_0002s12520g             422   2e-137   
ref|XP_007162804.1|  hypothetical protein PHAVU_001G182100g             422   2e-137   
gb|KDP46894.1|  hypothetical protein JCGZ_24103                         421   6e-137   
emb|CAE48294.1|  glucosyltransferase 5                                  418   3e-136   
ref|XP_006827589.1|  hypothetical protein AMTR_s00009p00235050          417   1e-135   
ref|XP_006848527.1|  hypothetical protein AMTR_s00169p00014200          416   3e-135   
ref|XP_007162805.1|  hypothetical protein PHAVU_001G182200g             416   3e-135   
ref|XP_007199033.1|  hypothetical protein PRUPE_ppa018059mg             424   5e-135   
ref|XP_009623864.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       415   6e-135   
ref|XP_007017169.1|  UDP-glucosyl transferase 73B5, putative            415   6e-135   
ref|XP_006848530.1|  hypothetical protein AMTR_s00169p00020090          414   1e-134   
ref|XP_008777755.1|  PREDICTED: scopoletin glucosyltransferase-like     413   4e-134   
ref|XP_006848529.1|  hypothetical protein AMTR_s00169p00018080          413   5e-134   
ref|XP_010098834.1|  UDP-glycosyltransferase 73C3                       412   8e-134   
ref|XP_010098836.1|  UDP-glycosyltransferase 73C3                       411   2e-133   
emb|CDP19616.1|  unnamed protein product                                410   3e-133   
dbj|BAG80535.1|  putative glycosyltransferase                           411   3e-133   
gb|KDP24996.1|  hypothetical protein JCGZ_23979                         407   3e-133   
ref|XP_007014491.1|  UDP-glucosyl transferase 73B3, putative            408   3e-133   
gb|EYU37649.1|  hypothetical protein MIMGU_mgv1a026287mg                409   1e-132   
ref|XP_004306178.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       409   1e-132   
ref|XP_008241360.1|  PREDICTED: UDP-glycosyltransferase 73C6-like       407   5e-132   
ref|XP_008241363.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       407   6e-132   
ref|XP_008800733.1|  PREDICTED: scopoletin glucosyltransferase-like     407   6e-132   
ref|XP_010028419.1|  PREDICTED: scopoletin glucosyltransferase-like     404   7e-132   
ref|XP_007162807.1|  hypothetical protein PHAVU_001G182400g             407   8e-132   
ref|XP_008800734.1|  PREDICTED: scopoletin glucosyltransferase-like     407   9e-132   
ref|XP_003520666.1|  PREDICTED: UDP-glycosyltransferase 73C6-like       408   9e-132   
ref|XP_011077288.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       406   2e-131   
gb|KHN18695.1|  UDP-glycosyltransferase 73C2                            406   3e-131   
ref|XP_009796872.1|  PREDICTED: UDP-glycosyltransferase 73C2-like       405   4e-131   
ref|XP_007201976.1|  hypothetical protein PRUPE_ppa004804mg             405   5e-131   
ref|XP_007201973.1|  hypothetical protein PRUPE_ppa004786mg             405   7e-131   
ref|XP_010669783.1|  PREDICTED: scopoletin glucosyltransferase-like     404   9e-131   
ref|XP_011017167.1|  PREDICTED: scopoletin glucosyltransferase-like     407   9e-131   
ref|XP_007156775.1|  hypothetical protein PHAVU_002G016500g             404   1e-130   
ref|XP_008788905.1|  PREDICTED: scopoletin glucosyltransferase-like     405   2e-130   
ref|XP_003554403.1|  PREDICTED: UDP-glycosyltransferase 73C2-like       404   2e-130   
ref|XP_011094572.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       404   2e-130   
ref|XP_010927325.1|  PREDICTED: scopoletin glucosyltransferase-like     403   3e-130   
ref|XP_004252303.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       402   8e-130   
ref|XP_010925706.1|  PREDICTED: scopoletin glucosyltransferase-like     402   9e-130   
ref|XP_006492619.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       402   1e-129   
ref|XP_006367257.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       402   1e-129   
ref|XP_003521422.1|  PREDICTED: UDP-glycosyltransferase 73C6-like       401   2e-129   
dbj|BAO66180.1|  hypothetical protein                                   400   3e-129   
ref|XP_007156774.1|  hypothetical protein PHAVU_002G016400g             400   3e-129   
ref|XP_008236560.1|  PREDICTED: scopoletin glucosyltransferase-like     394   3e-129   
gb|ADV71362.1|  glycosyltransferase GT03H14                             400   3e-129   
ref|XP_006423816.1|  hypothetical protein CICLE_v10028297mg             400   3e-129   
ref|XP_007204492.1|  hypothetical protein PRUPE_ppa019633mg             399   8e-129   
ref|XP_004494092.1|  PREDICTED: UDP-glycosyltransferase 73C2-like       399   8e-129   
gb|KEH24634.1|  UDP-glucosyltransferase family protein                  399   9e-129   
gb|KDO45022.1|  hypothetical protein CISIN_1g011142mg                   399   1e-128   
ref|XP_009381746.1|  PREDICTED: scopoletin glucosyltransferase          398   2e-128   
ref|XP_009616185.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       398   2e-128   
ref|XP_010924263.1|  PREDICTED: scopoletin glucosyltransferase-like     398   3e-128   
dbj|BAG16513.1|  flavonoid glucoyltransferase UGT73E2                   398   3e-128   
gb|ACU19200.1|  unknown                                                 397   3e-128   
ref|XP_009616186.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       398   3e-128   
ref|XP_004494017.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       397   5e-128   
ref|XP_009341068.1|  PREDICTED: UDP-glycosyltransferase 73C6-like...    397   5e-128   
ref|XP_002519422.1|  UDP-glucosyltransferase, putative                  397   5e-128   
gb|KDP25003.1|  hypothetical protein JCGZ_23986                         396   7e-128   
ref|XP_010935519.1|  PREDICTED: UDP-glycosyltransferase 73C5-like       396   1e-127   
ref|XP_006346605.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       395   3e-127   
ref|XP_010927032.1|  PREDICTED: scopoletin glucosyltransferase-like     395   4e-127   
gb|KHN02292.1|  UDP-glycosyltransferase 73C2                            395   4e-127   
ref|XP_004249618.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       395   5e-127   
ref|XP_006492641.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       397   5e-127   
ref|XP_007027509.1|  Don-glucosyltransferase 1, putative                394   9e-127   
ref|XP_010935521.1|  PREDICTED: UDP-glycosyltransferase 73C5-like       394   1e-126   
ref|XP_008359623.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       394   1e-126   
sp|D4Q9Z4.1|SGT2_SOYBN  RecName: Full=Soyasapogenol B glucuronide...    394   1e-126   
ref|XP_007027513.1|  UDP-glucosyl transferase 73D1                      394   2e-126   
ref|XP_008241357.1|  PREDICTED: UDP-glycosyltransferase 73D1            394   2e-126   
gb|AIS39471.1|  flavonoid UDP-glucosyltransferase 2                     393   2e-126   
ref|XP_008373858.1|  PREDICTED: anthocyanin 3'-O-beta-glucosyltra...    394   2e-126   
ref|XP_009341069.1|  PREDICTED: UDP-glycosyltransferase 73C6-like...    393   3e-126   
ref|XP_003539343.1|  PREDICTED: soyasapogenol B glucuronide galac...    392   5e-126   
ref|XP_006427231.1|  hypothetical protein CICLE_v10027181mg             392   6e-126   
gb|KDO49691.1|  hypothetical protein CISIN_1g042970mg                   392   7e-126   
ref|XP_003623458.1|  Cytokinin-O-glucosyltransferase                    392   1e-125   
ref|XP_007027512.1|  UDP-Glycosyltransferase superfamily protein,...    391   1e-125   
ref|XP_003625714.1|  Cytokinin-O-glucosyltransferase                    391   1e-125   
ref|XP_010260609.1|  PREDICTED: scopoletin glucosyltransferase-like     391   1e-125   
ref|XP_004249620.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       390   2e-125   
ref|XP_006423825.1|  hypothetical protein CICLE_v10030204mg             390   2e-125   
gb|KDO45237.1|  hypothetical protein CISIN_1g011490mg                   390   2e-125   
ref|XP_006465360.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       390   2e-125   
dbj|BAG31951.1|  UGT73A7                                                391   2e-125   
gb|EYU41584.1|  hypothetical protein MIMGU_mgv1a025584mg                390   3e-125   
gb|KHN40683.1|  UDP-glycosyltransferase 73B3                            390   3e-125   
gb|AFK47765.1|  unknown                                                 390   3e-125   
ref|XP_010927315.1|  PREDICTED: scopoletin glucosyltransferase-like     390   3e-125   
ref|XP_008387519.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       390   3e-125   
ref|XP_008777757.1|  PREDICTED: scopoletin glucosyltransferase-like     389   4e-125   
ref|XP_002518735.1|  UDP-glucosyltransferase, putative                  389   5e-125   
ref|XP_011077287.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       390   6e-125   
gb|KDP29204.1|  hypothetical protein JCGZ_16593                         389   7e-125   
gb|EYU41583.1|  hypothetical protein MIMGU_mgv1a005332mg                389   8e-125   
ref|XP_002265216.1|  PREDICTED: UDP-glycosyltransferase 73C2 isof...    389   1e-124   
ref|XP_003518708.1|  PREDICTED: abscisate beta-glucosyltransferas...    388   1e-124   
ref|XP_002265409.1|  PREDICTED: UDP-glycosyltransferase 73C3            389   1e-124   
gb|AAM91525.1|  putative glucosyltransferase                            384   1e-124   
ref|XP_009341087.1|  PREDICTED: UDP-glycosyltransferase 73D1            388   1e-124   
ref|XP_010925730.1|  PREDICTED: scopoletin glucosyltransferase-like     388   1e-124   
ref|XP_006423818.1|  hypothetical protein CICLE_v10028312mg             388   2e-124   
ref|XP_002323494.1|  glucosyltransferase-9 family protein               388   2e-124   
ref|XP_008797684.1|  PREDICTED: scopoletin glucosyltransferase-like     388   2e-124   
ref|XP_002285103.1|  PREDICTED: abscisate beta-glucosyltransferase      387   2e-124   
ref|XP_010028422.1|  PREDICTED: abscisate beta-glucosyltransferas...    387   3e-124   
ref|XP_006423819.1|  hypothetical protein CICLE_v10028274mg             387   4e-124   
ref|XP_008241361.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       387   4e-124   
ref|XP_010050396.1|  PREDICTED: UDP-glycosyltransferase 73C6-like       387   4e-124   
ref|XP_006492608.1|  PREDICTED: UDP-glycosyltransferase 73C5-like       387   4e-124   
ref|XP_006363691.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       387   4e-124   
ref|XP_011094568.1|  PREDICTED: UDP-glycosyltransferase 73D1            387   4e-124   
ref|XP_006367258.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       387   5e-124   
ref|XP_004304331.1|  PREDICTED: UDP-glycosyltransferase 73D1-like       387   5e-124   
gb|AIS39473.1|  flavonoid UDP-glucosyltransferase 4                     387   6e-124   
ref|XP_007153576.1|  hypothetical protein PHAVU_003G047200g             386   7e-124   
ref|XP_003533678.1|  PREDICTED: soyasapogenol B glucuronide galac...    387   7e-124   
ref|XP_003520671.1|  PREDICTED: UDP-glycosyltransferase 73C6-like       387   7e-124   
sp|Q8W3P8.1|AOG_PHAAN  RecName: Full=Abscisate beta-glucosyltrans...    386   7e-124   
ref|XP_009758335.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       387   7e-124   
ref|XP_007162814.1|  hypothetical protein PHAVU_001G183000g             386   7e-124   
ref|XP_009341070.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       387   7e-124   
ref|XP_011094571.1|  PREDICTED: UDP-glycosyltransferase 73C5            386   9e-124   
ref|XP_004492515.1|  PREDICTED: soyasapogenol B glucuronide galac...    386   1e-123   
ref|XP_006492617.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       386   1e-123   
ref|XP_002519419.1|  UDP-glucosyltransferase, putative                  385   1e-123   
ref|XP_007201773.1|  hypothetical protein PRUPE_ppa017305mg             386   2e-123   
gb|AGV53046.1|  UDP-glucose flavonoid glucosyl-transferase              386   2e-123   
ref|XP_007027511.1|  UDP-Glycosyltransferase superfamily protein,...    385   2e-123   
ref|XP_010546526.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       385   3e-123   
ref|XP_007142833.1|  hypothetical protein PHAVU_007G020800g             385   3e-123   
gb|AID51451.1|  UDP-glucose: calycosin 7-O-glucosyltransferase          384   3e-123   
ref|XP_006428485.1|  hypothetical protein CICLE_v10011555mg             385   3e-123   
ref|XP_004305194.1|  PREDICTED: UDP-glycosyltransferase 73C2-like       385   4e-123   
ref|XP_007027505.1|  UDP-glucosyl transferase 73C6                      385   4e-123   
dbj|BAB86927.1|  glucosyltransferase-9                                  385   4e-123   
ref|XP_004249831.1|  PREDICTED: UDP-glycosyltransferase 73D1            385   4e-123   
ref|XP_003520066.1|  PREDICTED: abscisate beta-glucosyltransferas...    384   5e-123   
gb|KHN18700.1|  UDP-glycosyltransferase 73C5                            384   5e-123   
ref|XP_008778462.1|  PREDICTED: scopoletin glucosyltransferase-like     384   6e-123   
ref|XP_006492609.1|  PREDICTED: UDP-glycosyltransferase 73C6-like       385   6e-123   
ref|XP_004492517.1|  PREDICTED: soyasapogenol B glucuronide galac...    384   7e-123   
gb|KDO52537.1|  hypothetical protein CISIN_1g010988mg                   384   7e-123   
ref|XP_007202851.1|  hypothetical protein PRUPE_ppa014729mg             384   8e-123   
ref|XP_006342641.1|  PREDICTED: soyasapogenol B glucuronide galac...    384   8e-123   
ref|XP_007203738.1|  hypothetical protein PRUPE_ppa018454mg             384   9e-123   
ref|XP_008241364.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       384   9e-123   
ref|XP_006492611.1|  PREDICTED: UDP-glycosyltransferase 73C6-like...    384   9e-123   
gb|AAO88911.1|  glucosyltransferase                                     379   1e-122   
gb|ACS87992.1|  UDP-glucosyltransferase family 1 protein                384   1e-122   
ref|XP_009349151.1|  PREDICTED: UDP-glycosyltransferase 73D1-like       384   1e-122   
gb|KDO49689.1|  hypothetical protein CISIN_1g044823mg                   384   1e-122   
gb|KDO45024.1|  hypothetical protein CISIN_1g013951mg                   381   2e-122   
ref|XP_006422972.1|  hypothetical protein CICLE_v10028334mg             382   2e-122   
ref|XP_008775115.1|  PREDICTED: scopoletin glucosyltransferase-like     382   2e-122   
ref|XP_006492612.1|  PREDICTED: UDP-glycosyltransferase 73C6-like...    383   3e-122   
ref|XP_008236496.1|  PREDICTED: abscisate beta-glucosyltransferas...    383   3e-122   
ref|XP_003536714.1|  PREDICTED: soyasapogenol B glucuronide galac...    383   3e-122   
ref|XP_007203728.1|  hypothetical protein PRUPE_ppa018836mg             382   4e-122   



>ref|XP_009761805.1| PREDICTED: scopoletin glucosyltransferase [Nicotiana sylvestris]
 gb|AAB36653.1| immediate-early salicylate-induced glucosyltransferase [Nicotiana 
tabacum]
Length=476

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/455 (71%), Positives = 384/455 (84%), Gaps = 4/455 (1%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             MG LH+FFFP+MAHGHMIPTLDMAKLFASRGVKATIITTP N+ VFSKA+ +   LG ++
Sbjct  1     MGQLHIFFFPVMAHGHMIPTLDMAKLFASRGVKATIITTPLNEFVFSKAIQRNKHLGIEI  60

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
             EIRL++FP VE GLPE C+RLDQ P D+ LP FFKA AM+Q PLE L++E RPDCL++DM
Sbjct  61    EIRLIKFPAVENGLPEECERLDQIPSDEKLPNFFKAVAMMQEPLEQLIEECRPDCLISDM  120

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             F PW T+ AAKF+IPR++FHGTS  ALC  +S+R+ KPF +VSSDSE F +P+LPHE+K+
Sbjct  121   FLPWTTDTAAKFNIPRIVFHGTSFFALCVENSVRLNKPFKNVSSDSETFVVPDLPHEIKL  180

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             T+ QVSPFERS  E  M+  +++VR S+ KSYGV+FNSFYELE DY EHY  VLGRRAW+
Sbjct  181   TRTQVSPFERSGEETAMTRMIKTVRESDSKSYGVVFNSFYELETDYVEHYTKVLGRRAWA  240

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GPLS+ NRD+EDKAERGKKS+ID+HECLKWLDSK P SVVYICFGSVANF  SQLHE+A
Sbjct  241   IGPLSMCNRDIEDKAERGKKSSIDKHECLKWLDSKKPSSVVYICFGSVANFTASQLHELA  300

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             MG+E SG +F+WV+R   E DN  E W+PEGFEERTK KGLIIRGWAPQV+ILDH +VGA
Sbjct  301   MGVEASGQEFIWVVRT--ELDN--EDWLPEGFEERTKEKGLIIRGWAPQVLILDHESVGA  356

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLEGV GGVPMVTWPVFAEQF NEKL+T++L+TG GVGS +WKR  S+GVK
Sbjct  357   FVTHCGWNSTLEGVSGGVPMVTWPVFAEQFFNEKLVTEVLKTGAGVGSIQWKRSASEGVK  416

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             REAIA+AIK+VM+ EE++  R+RAK  K+ A+KAI
Sbjct  417   REAIAKAIKRVMVSEEADGFRNRAKAYKEMARKAI  451



>sp|Q9AT54.1|SCGT_TOBAC RecName: Full=Scopoletin glucosyltransferase; AltName: Full=Phenylpropanoid:glucosyltransferase 
1 [Nicotiana tabacum]
 gb|AAK28303.1|AF346431_1 phenylpropanoid:glucosyltransferase 1, partial [Nicotiana tabacum]
Length=476

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/455 (71%), Positives = 383/455 (84%), Gaps = 4/455 (1%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             MG LH FFFP+MAHGHMIPTLDMAKLFASRGVKATIITTP N+ VFSKA+ +   LG ++
Sbjct  1     MGQLHFFFFPVMAHGHMIPTLDMAKLFASRGVKATIITTPLNEFVFSKAIQRNKHLGIEI  60

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
             EIRL++FP VE GLPE C+RLDQ P D+ LP FFKA AM+Q PLE L++E RPDCL++DM
Sbjct  61    EIRLIKFPAVENGLPEECERLDQIPSDEKLPNFFKAVAMMQEPLEQLIEECRPDCLISDM  120

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             F PW T+ AAKF+IPR++FHGTS  ALC  +S+R+ KPF +VSSDSE F +P+LPHE+K+
Sbjct  121   FLPWTTDTAAKFNIPRIVFHGTSFFALCVENSVRLNKPFKNVSSDSETFVVPDLPHEIKL  180

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             T+ QVSPFERS  E  M+  +++VR S+ KSYGV+FNSFYELE DY EHY  VLGRRAW+
Sbjct  181   TRTQVSPFERSGEETAMTRMIKTVRESDSKSYGVVFNSFYELETDYVEHYTKVLGRRAWA  240

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GPLS+ NRD+EDKAERGKKS+ID+HECLKWLDSK P SVVY+CFGSVANF  SQLHE+A
Sbjct  241   IGPLSMCNRDIEDKAERGKKSSIDKHECLKWLDSKKPSSVVYVCFGSVANFTASQLHELA  300

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             MGIE SG +F+WV+R   E DN  E W+PEGFEERTK KGLIIRGWAPQV+ILDH +VGA
Sbjct  301   MGIEASGQEFIWVVRT--ELDN--EDWLPEGFEERTKEKGLIIRGWAPQVLILDHESVGA  356

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLEGV GGVPMVTWPVFAEQF NEKL+T++L+TG GVGS +WKR  S+GVK
Sbjct  357   FVTHCGWNSTLEGVSGGVPMVTWPVFAEQFFNEKLVTEVLKTGAGVGSIQWKRSASEGVK  416

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             REAIA+AIK+VM+ EE++  R+RAK  K+ A+KAI
Sbjct  417   REAIAKAIKRVMVSEEADGFRNRAKAYKEMARKAI  451



>ref|XP_009622522.1| PREDICTED: scopoletin glucosyltransferase [Nicotiana tomentosiformis]
 gb|AAB36652.1| immediate-early salicylate-induced glucosyltransferase [Nicotiana 
tabacum]
Length=476

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/455 (70%), Positives = 380/455 (84%), Gaps = 4/455 (1%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             MG LH FFFP+MAHGHMIPTLDMAKL ASRGVKATIITTP N+ VFSK++ +   LG ++
Sbjct  1     MGQLHFFFFPVMAHGHMIPTLDMAKLVASRGVKATIITTPLNESVFSKSIQRNKHLGIEI  60

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
             EIRL++FP VE GLPE C+RLD  P DD LP FFKA AM+Q PLE L++E RP+CLV+DM
Sbjct  61    EIRLIKFPAVENGLPEECERLDLIPSDDKLPNFFKAVAMMQEPLEQLIEECRPNCLVSDM  120

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             F PW T+ AAKF++PR++FHGTS  ALC  +S+R+ KPF +VSSDSE F +PNLPHE+K+
Sbjct  121   FLPWTTDTAAKFNMPRIVFHGTSFFALCVENSIRLNKPFKNVSSDSETFVVPNLPHEIKL  180

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             T+ Q+SPFE+S  E TM+  ++SVR S+ KSYGVIFNSF ELE DY EHY  VLGRRAW+
Sbjct  181   TRTQLSPFEQSGEETTMTRMIKSVRESDSKSYGVIFNSFNELEHDYVEHYTKVLGRRAWA  240

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GPLS+ NRD+EDKAERGK+S+ID+HECLKWLDSK P SVVY+CFGSVANF  SQLHE+A
Sbjct  241   IGPLSMCNRDIEDKAERGKQSSIDKHECLKWLDSKKPSSVVYVCFGSVANFTASQLHELA  300

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             MGIE SG +F+WV+R   E DN  E W+PEG EERTK KGLIIRGWAPQV+ILDH +VGA
Sbjct  301   MGIEASGQEFIWVVRT--ELDN--EDWLPEGLEERTKEKGLIIRGWAPQVLILDHESVGA  356

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLEGV GGVPMVTWPVFAEQF NEKL+T++L+TG GVGS +WKR  S+GVK
Sbjct  357   FVTHCGWNSTLEGVSGGVPMVTWPVFAEQFFNEKLVTEVLKTGAGVGSIQWKRSASEGVK  416

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             REAIA+AIK+VM+ EE+E  R+RAK  K+ A+KAI
Sbjct  417   REAIAKAIKRVMVSEEAEGFRNRAKAYKEMARKAI  451



>gb|AAK28304.1|AF346432_1 phenylpropanoid:glucosyltransferase 2, partial [Nicotiana tabacum]
Length=476

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/455 (70%), Positives = 380/455 (84%), Gaps = 4/455 (1%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             MG LH FFFP+MAHGHMIPTLDMAKL ASRGVKATIITTP N+ VFSK++ +   LG ++
Sbjct  1     MGQLHFFFFPVMAHGHMIPTLDMAKLVASRGVKATIITTPLNESVFSKSIQRNKHLGIEI  60

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
             EIRL++FP VE GLPE C+RLD  P DD LP FFKA AM+Q PLE L++E RP+CLV+DM
Sbjct  61    EIRLIKFPAVENGLPEECERLDLIPSDDKLPNFFKAVAMMQEPLEQLIEECRPNCLVSDM  120

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             F PW T+ AAKF++PR++FHGTS  ALC  +S+R+ KPF +VSSDSE F +PNLPHE+K+
Sbjct  121   FLPWTTDTAAKFNMPRIVFHGTSFFALCVENSIRLNKPFKNVSSDSETFVVPNLPHEIKL  180

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             T+ Q+SPFE+S  E TM+  ++SVR S+ KSYGVIFNSF ELE DY EHY  VLGRRAW+
Sbjct  181   TRTQLSPFEQSGEETTMTRMIKSVRESDSKSYGVIFNSFNELEHDYVEHYTKVLGRRAWA  240

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GPLS+ NRD+EDKAERGK+S+ID+HECLKWLDSK P SVVY+CFGSVANF  SQLHE+A
Sbjct  241   IGPLSMCNRDIEDKAERGKQSSIDKHECLKWLDSKKPSSVVYVCFGSVANFTASQLHELA  300

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             MGIE SG +F+WV+R   E DN  E W+PEG EERTK +GLIIRGWAPQV+ILDH +VGA
Sbjct  301   MGIEASGQEFIWVVRT--ELDN--EDWLPEGLEERTKEEGLIIRGWAPQVLILDHESVGA  356

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLEGV GGVPMVTWPVFAEQF NEKL+T++L+TG GVGS +WKR  S+GVK
Sbjct  357   FVTHCGWNSTLEGVSGGVPMVTWPVFAEQFFNEKLVTEVLKTGAGVGSIQWKRSASEGVK  416

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             REAIA+AIK+VM+ EE+E  R+RAK  K+ A+KAI
Sbjct  417   REAIAKAIKRVMVSEEAEGFRNRAKAYKEMARKAI  451



>gb|ACO44747.1| UDP glycosyltransferase [Withania somnifera]
Length=470

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/455 (67%), Positives = 374/455 (82%), Gaps = 10/455 (2%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             MG LH+FFFPMMA GHMIPTLDMAKL ASRGVKATIITTP N+ VFSK + +   LG   
Sbjct  1     MGQLHIFFFPMMAQGHMIPTLDMAKLVASRGVKATIITTPLNESVFSKVIQRNKNLG---  57

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
              IRL++FP VE  LPE C+RLD  P DD LP FFKA A +Q  LE L+QE RP+CLV+DM
Sbjct  58    -IRLIKFPAVENDLPEDCERLDLIPSDDKLPNFFKAAATMQESLEQLIQECRPNCLVSDM  116

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FFPW T+ AAKF+IPR++FHGT + AL A+ SLR+ KPF +VSSDSE F +PNLPHE+K+
Sbjct  117   FFPWTTDTAAKFNIPRIVFHGTGYFALSAVDSLRLNKPFKNVSSDSETFVVPNLPHEIKL  176

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             T+ ++SPFE+S+ E+ MS+ +++VR ++ KSYGVIFNSFYELEPDY EHY  VLGR+ W+
Sbjct  177   TRSKLSPFEQSDEESVMSQMVKAVRDADSKSYGVIFNSFYELEPDYVEHYTKVLGRKNWA  236

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GPLSL NRD+EDKAERGKKS+ID+HECLKW+DSK   S+VY+CFGSVANF  SQL E+A
Sbjct  237   IGPLSLCNRDIEDKAERGKKSSIDKHECLKWIDSKKSSSIVYVCFGSVANFTTSQLQELA  296

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             +G+E SG DF+WV+R     DN  E W+P+GFEERTKGKGLIIRGWAPQV+ILDH +VGA
Sbjct  297   LGLEASGQDFIWVVRT----DN--EDWLPKGFEERTKGKGLIIRGWAPQVLILDHESVGA  350

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLEG+  GVP+VTWPVFAEQF+NEKL+T+I+RTG  VGS +WKR  S+GVK
Sbjct  351   FVTHCGWNSTLEGISAGVPLVTWPVFAEQFLNEKLVTEIMRTGAAVGSVQWKRSASEGVK  410

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             REAIA AIK+VM+ EE+E  R+RAK  K+ A++AI
Sbjct  411   REAIANAIKRVMVSEEAEGFRNRAKAYKELARQAI  445



>ref|XP_006346388.1| PREDICTED: scopoletin glucosyltransferase-like [Solanum tuberosum]
Length=474

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/455 (66%), Positives = 370/455 (81%), Gaps = 6/455 (1%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             MG LH FFFPMMA GHMIPTLDMAKL ASRGVKATIITTP N+ VFSKA+++   LG ++
Sbjct  1     MGQLHFFFFPMMAQGHMIPTLDMAKLVASRGVKATIITTPLNESVFSKAIERNKHLGIEI  60

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
             +IRLL+FP  E  LPE C+RLD  P DD LP F KA AM++   E L++E RP+CLV+DM
Sbjct  61    DIRLLKFPAKENDLPEDCERLDLIPSDDKLPNFLKAAAMMKDEFEQLIEECRPNCLVSDM  120

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             F PW T++AAKFDIPR++FHGTS+ ALC + S+R  KPF +V+SD+E F +P+LPHE+K+
Sbjct  121   FLPWTTDSAAKFDIPRIVFHGTSYFALCVVDSIRRNKPFKNVTSDTETFVVPDLPHEIKL  180

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             T+ Q+SPFE+S+ E  M+  +++VR S+ KSYGVIFNSFYELE DY EHY  V+GR+ W+
Sbjct  181   TRTQLSPFEQSDEETGMTPMIKAVRESDAKSYGVIFNSFYELESDYVEHYTKVVGRKNWA  240

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GPLSL NRD+EDKAERG+KS+IDEHECLKWLDSK   S+VY+CFGS A+F  +Q+ E+A
Sbjct  241   IGPLSLCNRDIEDKAERGRKSSIDEHECLKWLDSKKSSSIVYVCFGSTADFTTAQMQELA  300

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             MG+E SG DF+WVIR       G+E W+PEGFEERTK  GLIIRGWAPQV+ILDH A+GA
Sbjct  301   MGLEASGQDFIWVIR------TGNEDWLPEGFEERTKENGLIIRGWAPQVLILDHEAIGA  354

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLEG+  GVPMVTWPVFAEQF NEKL+T+++RTG GVGS +WKR  S+GVK
Sbjct  355   FVTHCGWNSTLEGISAGVPMVTWPVFAEQFCNEKLVTEVMRTGAGVGSMQWKRTASEGVK  414

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             REAIA+AIK+VM  EE+E  RSRAK  K+ A++AI
Sbjct  415   REAIAKAIKRVMASEEAEGFRSRAKEYKEMAREAI  449



>ref|XP_004230759.1| PREDICTED: scopoletin glucosyltransferase [Solanum lycopersicum]
Length=470

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/455 (66%), Positives = 368/455 (81%), Gaps = 6/455 (1%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             MG LH FFFPMMA GHMIPTLDMAKL A RGVKATIITTP N+ VFSKA+++   LG ++
Sbjct  1     MGQLHFFFFPMMAQGHMIPTLDMAKLVACRGVKATIITTPLNESVFSKAIERNKHLGIEI  60

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
             +IRLL+FP  E  LPE C+RLD  P DD LP F KA AM++   E+L+ E RPDCLV+DM
Sbjct  61    DIRLLKFPAKENDLPEDCERLDLVPSDDKLPNFLKAAAMMKDEFEELIGECRPDCLVSDM  120

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             F PW T++AAKF IPR++FHGTS+ ALC   S+R  KPF +VSSD+E F +P+LPHE+++
Sbjct  121   FLPWTTDSAAKFSIPRIVFHGTSYFALCVGDSIRRNKPFKNVSSDTETFVVPDLPHEIRL  180

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             T+ Q+SPFE+S+ E  M+  +++VR S+ KSYGVIFNSFYELE DY EHY  V+GR+ W+
Sbjct  181   TRTQLSPFEQSDEETGMAPMIKAVRESDAKSYGVIFNSFYELESDYVEHYTKVVGRKNWA  240

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GPLSL NRD+EDKAERG+KS+IDEH CLKWLDSK   S+VY+CFGS A+F  +Q+ E+A
Sbjct  241   IGPLSLCNRDIEDKAERGRKSSIDEHACLKWLDSKKSSSIVYVCFGSTADFTTAQMQELA  300

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             MG+E SG DF+WVIR       G+E W+PEGFEERTK KGLIIRGWAPQV+ILDH A+GA
Sbjct  301   MGLEASGQDFIWVIR------TGNEDWLPEGFEERTKEKGLIIRGWAPQVLILDHEAIGA  354

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLEG+  GVPMVTWPVFAEQF NEKL+T+++R+G GVGSK+WKR  S+GVK
Sbjct  355   FVTHCGWNSTLEGISAGVPMVTWPVFAEQFFNEKLVTEVMRSGAGVGSKQWKRTASEGVK  414

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             REAIA+AIK+VM  EE+E  RSRAK  K+ A++AI
Sbjct  415   REAIAKAIKRVMASEETEGFRSRAKEYKEMAREAI  449



>dbj|BAG80536.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=477

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/457 (67%), Positives = 375/457 (82%), Gaps = 8/457 (2%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             MG LH F FPMMA GHMIPTLDMAKL ASRGVKATIITTP N+ VFSKA+ +  QLG ++
Sbjct  1     MGQLHFFLFPMMAQGHMIPTLDMAKLIASRGVKATIITTPLNESVFSKAIQRNKQLGIEI  60

Query  252   EI--RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVA  425
             EI  RL++FP +E  LPE C+RLD  P +  LP FFKA AM+Q PLE L+QE RPDCLV+
Sbjct  61    EIEIRLIKFPALENDLPEDCERLDLIPTEAHLPNFFKAAAMMQEPLEQLIQECRPDCLVS  120

Query  426   DMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHEL  605
             DMF PW T+ AAKF+IPR++FHGT++ ALC   S+R  KPF +VSSDSE F +PNLPHE+
Sbjct  121   DMFLPWTTDTAAKFNIPRIVFHGTNYFALCVGDSMRRNKPFKNVSSDSETFVVPNLPHEI  180

Query  606   KITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRA  785
             K+T+ QVSPFE+S+ E+ MS  ++ VR S+ KSYGVIFNSFYELEPDY EHY  V+GR++
Sbjct  181   KLTRTQVSPFEQSDEESVMSRVLKEVRESDLKSYGVIFNSFYELEPDYVEHYTKVMGRKS  240

Query  786   WSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHE  965
             W++GPLSL NRDVEDKAERGKKS+ID+HECL+WLDSK P S+VY+CFGSVANF  +Q+ E
Sbjct  241   WAIGPLSLCNRDVEDKAERGKKSSIDKHECLEWLDSKKPSSIVYVCFGSVANFTVTQMRE  300

Query  966   MAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAV  1145
             +A+G+E SG+DF+W +R     DN  E W+PEGFEERTK KGLIIRGWAPQV+ILDH +V
Sbjct  301   LALGLEASGLDFIWAVR----ADN--EDWLPEGFEERTKEKGLIIRGWAPQVLILDHESV  354

Query  1146  GAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDG  1325
             GAFVTHCGWNSTLEG+  GVPMVTWPVFAEQF NEKL+T ++RTG GVGS +WKR  S+G
Sbjct  355   GAFVTHCGWNSTLEGISAGVPMVTWPVFAEQFFNEKLVTQVMRTGAGVGSVQWKRSASEG  414

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             V++EAIA+AIK+VM+ EE+E  R+RA+  K+ A++AI
Sbjct  415   VEKEAIAKAIKRVMVSEEAEGFRNRARAYKEMARQAI  451



>emb|CAA59450.1| twi1 [Solanum lycopersicum]
Length=466

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/451 (65%), Positives = 361/451 (80%), Gaps = 6/451 (1%)
 Frame = +3

Query  84    HVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIRL  263
             H FFFP  A GHMIPTLDMA + A RGVKATIITTP N+ VFSKA+++   LG +++IRL
Sbjct  1     HFFFFPDDAQGHMIPTLDMANVVACRGVKATIITTPLNESVFSKAIERNKHLGIEIDIRL  60

Query  264   LEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFPW  443
             L+FP  E  LPE C+RLD  P DD LP F KA AM++   E+L+ E RPDCLV+DMF PW
Sbjct  61    LKFPAKENDLPEDCERLDLVPSDDKLPNFLKAAAMMKDEFEELIGECRPDCLVSDMFLPW  120

Query  444   ATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKLQ  623
              T++AAKF IPR++FHGTS+ ALC   ++R  KPF +VSSD+E F +P+LPHE+++T+ Q
Sbjct  121   TTDSAAKFSIPRIVFHGTSYFALCVGDTIRRNKPFKNVSSDTETFVVPDLPHEIRLTRTQ  180

Query  624   VSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGPL  803
             +SPFE+S+ E  M+  +++VR S+ KSYGVIFNSFYELE DY EHY  V+GR+ W++GPL
Sbjct  181   LSPFEQSDEETGMAPMIKAVRESDAKSYGVIFNSFYELESDYVEHYTKVVGRKNWAIGPL  240

Query  804   SLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGIE  983
             SL NRD+EDKAERG+KS+IDEH CLKWLDSK   S+VY+CFGS A+F  +Q+ E+AMG+E
Sbjct  241   SLCNRDIEDKAERGRKSSIDEHACLKWLDSKKSSSIVYVCFGSTADFTTAQMQELAMGLE  300

Query  984   DSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVTH  1163
              SG DF+WVIR       G+E W+PEGFEERTK KGLIIRGWAPQ VILDH A+GAFVTH
Sbjct  301   ASGQDFIWVIR------TGNEDWLPEGFEERTKEKGLIIRGWAPQSVILDHEAIGAFVTH  354

Query  1164  CGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREAI  1343
             CGWNSTLEG+  GVPMVTWPVFAEQF NEKL+T+++R+G GVGSK+WKR  S+GVKREAI
Sbjct  355   CGWNSTLEGISAGVPMVTWPVFAEQFFNEKLVTEVMRSGAGVGSKQWKRTASEGVKREAI  414

Query  1344  AEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             A+AIK+VM  EE+E  RSRAK  K+ A++AI
Sbjct  415   AKAIKRVMASEETEGFRSRAKEYKEMAREAI  445



>dbj|BAG80550.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=475

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/457 (66%), Positives = 367/457 (80%), Gaps = 9/457 (2%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             MG LH F FPMMA GHMIPTLDMAKL ASRGVKATIITTP N+ VFSKA+ +  QLG ++
Sbjct  1     MGQLHFFLFPMMAQGHMIPTLDMAKLIASRGVKATIITTPLNESVFSKAIQRNKQLGIEI  60

Query  252   EI--RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVA  425
             EI  RL++FP +E  LPE C+RLD  P +  LP FFKA AM+Q PLE L+QE RPDCLV+
Sbjct  61    EIEIRLIKFPALENDLPEDCERLDLIPTEAHLPNFFKAAAMMQEPLEQLIQECRPDCLVS  120

Query  426   DMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHEL  605
             DMF PW T+ AAKF+IPR++FHGT++ ALC   S+R  KPF +VSSDSE F +PNLPHE+
Sbjct  121   DMFLPWTTDTAAKFNIPRIVFHGTNYFALCVGDSMRRNKPFKNVSSDSETFVVPNLPHEI  180

Query  606   KITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRA  785
             K+T+ QVSPFE+S+ E+ MS  ++ VR S+ KSYGVIFNSFYELEPDY EHY  VLGR++
Sbjct  181   KLTRTQVSPFEQSDEESVMSRVLKEVRESDLKSYGVIFNSFYELEPDYVEHYTKVLGRKS  240

Query  786   WSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHE  965
             W +GPLSL NRD+EDK ERGKKS+ID+HECLKWLDSK   S+VYICFGSVA F  SQ+ E
Sbjct  241   WDIGPLSLCNRDIEDKVERGKKSSIDKHECLKWLDSKKSSSIVYICFGSVAIFTASQMQE  300

Query  966   MAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAV  1145
             +AMG+E SG DF+W +R   EE      W+PEGFEERTK KGLIIRGWAPQ++ILDH AV
Sbjct  301   LAMGLEVSGQDFIWAVRTDNEE------WLPEGFEERTKEKGLIIRGWAPQLLILDHQAV  354

Query  1146  GAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDG  1325
             GAFVTHCGWNSTLEG+  GVPMVTWP+FAEQF NEKL+T++LR G GVGS +W+    +G
Sbjct  355   GAFVTHCGWNSTLEGISAGVPMVTWPLFAEQFFNEKLVTEVLRNGVGVGSVQWQATACEG  414

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VKRE IA+AI++VM+ +E++E R+RAK  K+ AKKA+
Sbjct  415   VKREEIAKAIRRVMV-DEAKEFRNRAKEYKEMAKKAV  450



>ref|XP_009772759.1| PREDICTED: scopoletin glucosyltransferase-like [Nicotiana sylvestris]
Length=479

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/456 (65%), Positives = 366/456 (80%), Gaps = 3/456 (1%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             M  LH FFFPMMAHGHMIPTLDMAKL A RGVKATIITTP N+ VFSKA+ +   LG ++
Sbjct  1     MSQLHFFFFPMMAHGHMIPTLDMAKLVALRGVKATIITTPLNESVFSKAIQRNKNLGIEI  60

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
             +IRL++F  VE GL E C+RLD  P DD L  FFKA  M+Q PLE L+QE RP+CLV+D+
Sbjct  61    DIRLIKFQAVEHGLHEECERLDLIPSDDLLLNFFKATVMMQEPLEHLIQECRPNCLVSDI  120

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FFPW  + AAKF+IPRL  HGTS  ALCA  S+R++KPF +V+SDSE F +PNLPH++K+
Sbjct  121   FFPWTIDTAAKFNIPRLAIHGTSFFALCAGESIRLHKPFMNVASDSESFVVPNLPHQIKL  180

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             TK Q+SPF+R E E  +   +++VR S  K YGVIFNSFYELE DY EHY  VLGR+AW+
Sbjct  181   TKSQLSPFDRIEEEKNIPLMVKTVRESGLKGYGVIFNSFYELEQDYVEHYTKVLGRKAWA  240

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GPLSL NRD+EDKAERGK+S+ID+H+C+KWLDSK   S++YICFGS+ANF   Q+ E+A
Sbjct  241   IGPLSLCNRDIEDKAERGKQSSIDKHDCMKWLDSKKSSSIIYICFGSIANFTTLQMRELA  300

Query  972   MGIEDSGMDFVWVIRNKRE-EDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVG  1148
             MGIE S  +F+WVIR  +E +DN  E  +P+GFEER K KGLIIRGWAPQV+ILDH +VG
Sbjct  301   MGIEASRQEFIWVIRKDKEVQDNEDE--LPKGFEERMKEKGLIIRGWAPQVLILDHESVG  358

Query  1149  AFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGV  1328
             AFVTHCGWNSTLEG+  GVPMVTWPVFAEQF NEKL+T++LRTG GVGS +W++  ++GV
Sbjct  359   AFVTHCGWNSTLEGISAGVPMVTWPVFAEQFCNEKLVTEVLRTGVGVGSVKWQKTYTEGV  418

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             K+E IA+AI++VM+GEE+E  RSRAK  K+ A+KA+
Sbjct  419   KKEEIAKAIRRVMVGEEAEGFRSRAKAYKEMARKAV  454



>ref|XP_009787720.1| PREDICTED: scopoletin glucosyltransferase-like [Nicotiana sylvestris]
Length=483

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/455 (64%), Positives = 364/455 (80%), Gaps = 4/455 (1%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             MG LH FFFP MAHGHMIPTLDMAKL ASRGVKATI+TTP N+ VFSK++ +   LG ++
Sbjct  1     MGQLHFFFFPFMAHGHMIPTLDMAKLVASRGVKATIVTTPLNKSVFSKSIQRNKHLGLEI  60

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
             +IRL+ F  VE GLPE C+RLD  P  D    F KA AM+Q  LE L++E RP+CLV+DM
Sbjct  61    DIRLITFQAVENGLPEGCERLDLVPSQDLFFNFLKATAMMQETLEQLIEECRPNCLVSDM  120

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
              FPW T++AAKF+IPRL+F+GTS+ +LC   S R+ KPF +VSSDSE F +PNLPH++K+
Sbjct  121   LFPWTTDSAAKFNIPRLVFYGTSYFSLCPGDSNRLNKPFKNVSSDSETFVVPNLPHQIKL  180

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             T+ Q+SP ++S+ E+ MS  M+ VR S+ KSY VIFNSFYELE DY EHY  VLGR AW+
Sbjct  181   TRTQLSPLDQSDEESVMSMMMKLVRESDLKSYRVIFNSFYELE-DYVEHYTKVLGRNAWA  239

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             + PLSL N D+EDKAERGK+S+ID HEC+KWLDSK   SV+Y+CFGS+ANF  SQLHE+A
Sbjct  240   ICPLSLCNMDIEDKAERGKQSSIDNHECMKWLDSKKSSSVIYVCFGSIANFTASQLHELA  299

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             MGIE SG +F+WV+R  ++++   + W PEGFEERTK KGLIIRGWAPQV+ILDH AVGA
Sbjct  300   MGIEASGQEFIWVVRTDQQDN---KDWFPEGFEERTKEKGLIIRGWAPQVLILDHEAVGA  356

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLEG+  G+PMVTWP+ AEQF NEKL+T++L+TG G+GS  W+    +GVK
Sbjct  357   FVTHCGWNSTLEGISAGIPMVTWPLSAEQFFNEKLVTEVLKTGVGLGSMLWQTTPCEGVK  416

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             REAIA+AIK+V++GEE+EE R+RAK  K+ A++A+
Sbjct  417   REAIAKAIKRVIVGEEAEEFRNRAKEYKEMARQAV  451



>ref|XP_009600997.1| PREDICTED: scopoletin glucosyltransferase-like [Nicotiana tomentosiformis]
Length=539

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/455 (64%), Positives = 364/455 (80%), Gaps = 4/455 (1%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             M   H FFFP+MAHGHMIPTLDMAKL ASRGVKATIITTP N+ VFS ++ +  Q+G ++
Sbjct  1     MSHRHFFFFPLMAHGHMIPTLDMAKLVASRGVKATIITTPLNESVFSNSIQRSKQVGIEI  60

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
             +IRL++F  VE GLPE C+RLD  P DD L  F  A  M+Q P E LLQE RP+CLV+DM
Sbjct  61    DIRLIKFQAVENGLPEGCERLDLIPSDDLLNNFSTATTMMQEPFEQLLQECRPNCLVSDM  120

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             F PW  ++A KF+IPRL+FHGTS+ ALC   S+R Y PF +VSSDSE F +PNLP+++K+
Sbjct  121   FLPWTADSADKFNIPRLVFHGTSYFALCVADSIRHYTPFKNVSSDSETFAVPNLPNQIKL  180

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             T+ Q+SPF+R E E +MS  ++++R S  K +G++FNSFYELEPDYAEHY  VLGR+ W+
Sbjct  181   TRTQLSPFDRIEEEESMSPVIKALRDSGLKGHGIVFNSFYELEPDYAEHYTKVLGRKTWA  240

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GPLSL NRD +DKAERGKKS+ID+HEC+KWLDSK   SVVYICFGSVA F  +Q+ E+A
Sbjct  241   IGPLSLCNRDSDDKAERGKKSSIDKHECMKWLDSKKSSSVVYICFGSVAIFTATQMRELA  300

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             MGIE SG +F+WV+R   E DN  E W+PEGFEER K KGLIIRGWAPQ++ILDH AVGA
Sbjct  301   MGIEASGQEFIWVVR--IELDN--EDWLPEGFEERIKEKGLIIRGWAPQLLILDHKAVGA  356

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLEG+  GVP+VTWPVF EQF NEKL+T++LRTG GVGS +WKR+ S+GVK
Sbjct  357   FVTHCGWNSTLEGISAGVPVVTWPVFGEQFFNEKLVTEVLRTGVGVGSVQWKRIASEGVK  416

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             REAI++AIK+VM  EE+E  R+RA+  K+ A++A+
Sbjct  417   REAISKAIKQVMESEEAEGFRNRAEEYKEMARQAV  451



>ref|XP_006346389.1| PREDICTED: scopoletin glucosyltransferase-like [Solanum tuberosum]
Length=507

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/456 (61%), Positives = 351/456 (77%), Gaps = 0/456 (0%)
 Frame = +3

Query  69    AMGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQ  248
              M   H FFFP+MA GHMIPTLDMAKL ASRGVKATIITTP N+ VFS ++ +   LG +
Sbjct  27    GMSRFHFFFFPLMAQGHMIPTLDMAKLVASRGVKATIITTPLNESVFSDSIQRNKHLGIE  86

Query  249   MEIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVAD  428
             ++IRL+ F  VE  LPE C+RLD  P  +    FFKA AM+Q P E+L++E RPDC+V+D
Sbjct  87    IDIRLITFQAVENDLPEGCERLDLVPSPELFKNFFKATAMMQEPFENLVKECRPDCIVSD  146

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             M FPW+T++AAKF+IPR++FHGT   ALC   S++  KPF +VSSDSE F +PNLPH+++
Sbjct  147   MLFPWSTDSAAKFNIPRIVFHGTGFFALCVAESIKRNKPFKNVSSDSETFVVPNLPHQIR  206

Query  609   ITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             +T  Q+SPF+  E E  + +    VR ++ KSYGVIFNSFYELEPDY EHY  V   ++W
Sbjct  207   LTTTQLSPFDLGEEEAIIFQIFHEVREADLKSYGVIFNSFYELEPDYFEHYTKVQDNKSW  266

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
             ++GPLSL NRD+EDK ERGKKS+ID+HECLKWLDSK   S+VYICFGS   F  SQ+ E+
Sbjct  267   AIGPLSLCNRDIEDKTERGKKSSIDKHECLKWLDSKKSSSIVYICFGSGVKFTGSQIQEL  326

Query  969   AMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVG  1148
             AMGIEDSG +F+WVIR ++ +    +  +PEGFEERTK KGLIIRGWAPQV+ILDH  VG
Sbjct  327   AMGIEDSGQEFIWVIRERKFKQENEDSCLPEGFEERTKEKGLIIRGWAPQVLILDHEGVG  386

Query  1149  AFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGV  1328
             AFVTHCGWNS LEG+  GVP+VTWP+FAEQF+NEKL+TD+LR G GVGS +W+   S+GV
Sbjct  387   AFVTHCGWNSMLEGISAGVPLVTWPLFAEQFLNEKLVTDVLRIGVGVGSVKWEVAASEGV  446

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             KRE I++AIK+VM+ EE+E   +RAK  K+ AK+AI
Sbjct  447   KREEISKAIKRVMVSEEAEGFINRAKEYKEMAKQAI  482



>emb|CDP09466.1| unnamed protein product [Coffea canephora]
 emb|CDO97203.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/452 (62%), Positives = 356/452 (79%), Gaps = 1/452 (0%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LHVFFFP  AHGHM+PTLDMAK+F+SRG KAT+ITTP + PVF+KA++K  QLGF + IR
Sbjct  5     LHVFFFPFFAHGHMLPTLDMAKVFSSRGAKATVITTPLHAPVFNKAIEKCKQLGFDISIR  64

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
             +++FP VE GLPE  +  DQ   DD LP FF A  +LQ P+E LLQE RP CLVAD FFP
Sbjct  65    VVKFPAVEAGLPEGTESADQLISDDMLPNFFLATRLLQEPVEQLLQECRPHCLVADFFFP  124

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT++AAK+ IPRL+FHG+S  A+ A  S+   KP+ +VSSD E F IP+LPH++ IT+ 
Sbjct  125   WATDSAAKYGIPRLLFHGSSSFAMSASESVWRNKPYRNVSSDDEPFVIPDLPHDIYITRG  184

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             QVS +ER EVEN  ++ M+ VR SE +SYGVI NSFYELEPDYAEHY   LGRRAW VGP
Sbjct  185   QVSTYERQEVENEFTKIMKQVRESELRSYGVIVNSFYELEPDYAEHYTKKLGRRAWHVGP  244

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
               L N++ EDKAERGKKSAID+ +CL+WLD + P+SVVY+CFGS++NF  +QLHE+A G+
Sbjct  245   FVLINKEAEDKAERGKKSAIDQLQCLEWLDKQKPNSVVYVCFGSMSNFNAAQLHEIAKGL  304

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG  F+WV+RN  +E++ S++W PEGFEERTK  GLII+GWAPQ++IL H AVGAFVT
Sbjct  305   EASGQQFIWVVRNCVDEED-SKRWFPEGFEERTKETGLIIKGWAPQLLILGHEAVGAFVT  363

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLEGV  GVPMVTWP+FAEQF NEKL+T++L+ G GVG+++W R  +  +  EA
Sbjct  364   HCGWNSTLEGVSCGVPMVTWPLFAEQFFNEKLLTNVLKIGVGVGAQQWSRRTTQIISAEA  423

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + +A+ ++M GEE+  +R RAK +K+KA+KA+
Sbjct  424   LTKAVDRIMDGEEALNIRGRAKALKEKARKAV  455



>dbj|BAF49308.1| putative glycosyltransferase [Eustoma grandiflorum]
Length=482

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/477 (60%), Positives = 385/477 (81%), Gaps = 2/477 (0%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             MG LH+FFFP +AHGHM+PT+DMAKLF+SRGVKAT+ITTP + P+F+KA++    LGF +
Sbjct  1     MGQLHIFFFPFLAHGHMLPTIDMAKLFSSRGVKATLITTPYHNPMFTKAIESTRNLGFDI  60

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
              +RL++FP +EVGLPE  +  DQ   +D  P+F   C +LQ PLE LLQE RP  LVADM
Sbjct  61    SVRLIKFPSIEVGLPEGIESSDQISSEDLRPKFLDGCNLLQEPLEQLLQEYRPHALVADM  120

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FF WA ++AAKF IPRL+FHG+S+ A+ A  S++ +KP+ ++SSDS++F +P+LPHE+K+
Sbjct  121   FFYWANDSAAKFGIPRLLFHGSSYFAMSATDSIKRHKPYQNLSSDSDIFVVPDLPHEIKL  180

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             T+ Q+S  ER  +E  M++F + +  SE K YGV+ NSFYELEPDY  HYKNV+G+R+W 
Sbjct  181   TRGQISVEEREGIETEMTKFWKLILDSESKCYGVVMNSFYELEPDYVNHYKNVMGKRSWH  240

Query  792   VGPLSLYNRDV-EDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
             VGPL L  ++  ED ++RGK+SAI+  ECLKWL+SKNP+S+VYICFGS++NF  +QLHE+
Sbjct  241   VGPLLLCKKEFGEDVSQRGKESAINTRECLKWLNSKNPNSIVYICFGSMSNFTVAQLHEI  300

Query  969   AMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVG  1148
             A+G+E SG +F+WV+R   +E++ + KW P+GFE+R KGKGLII GWAPQ++IL+H +VG
Sbjct  301   AIGLELSGQEFIWVVRKCADEEDKA-KWFPKGFEDRIKGKGLIIIGWAPQLMILEHESVG  359

Query  1149  AFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGV  1328
             AFVTHCGWNSTLEGVC GVPMVTWP+FAEQF NEKL+TD+LRTG  VGS++W R++ + +
Sbjct  360   AFVTHCGWNSTLEGVCAGVPMVTWPMFAEQFYNEKLVTDVLRTGVAVGSQQWGRVNKETL  419

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAIeeggssylglsslldelRAYH  1499
             KREAI++AI +V++GEE+ EMRS+AK +K+ AK+A+EEGGSSY  LS+L +EL AYH
Sbjct  420   KREAISKAICRVLVGEEAAEMRSKAKELKEMAKRAVEEGGSSYSDLSALFEELGAYH  476



>dbj|BAO51837.1| UDP-glycosyltransferase 73A17 [Camellia sinensis]
Length=473

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/457 (62%), Positives = 352/457 (77%), Gaps = 5/457 (1%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             M  LH FFFP+MA GHMIPTLDMAKLFAS GVKATIITTP N P F++++ +       +
Sbjct  1     MAKLHFFFFPVMAQGHMIPTLDMAKLFASHGVKATIITTPLNAPYFTRSIQRTHH---SI  57

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
              +  L+FP VE GL E C+ +DQ P  D LP F KA  MLQ PLE LLQ+ RPDCLVADM
Sbjct  58    SVLTLKFPAVEAGLVEGCESVDQIPSPDMLPNFLKATTMLQDPLERLLQDSRPDCLVADM  117

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FFPWAT+ AAKF+IPRL+FHGT    LCA  +LR+Y P   VSSD E F +PNLPH++ +
Sbjct  118   FFPWATHVAAKFNIPRLVFHGTGFFTLCASENLRLYMPQASVSSDDEPFLVPNLPHKIML  177

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             T+ Q+   ER + E  +S  ++ V+ +E  SYGVI NSFYELEPDYA++Y+NVLGRRAW 
Sbjct  178   TRSQLPENERCDTETGLSTMLKQVKETELTSYGVIVNSFYELEPDYADYYRNVLGRRAWH  237

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GP+SL NR+VEDKA+RGK+SAIDE ECLKWL+SK P+SV+Y+CFGS+ +F  SQL E+A
Sbjct  238   IGPVSLCNREVEDKAQRGKESAIDEVECLKWLNSKKPNSVIYVCFGSLGDFTASQLFELA  297

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             MG+E SG  F+WV+R  + E++G EK +PE FEER K KGLIIRGWAPQV+ILDH ++G 
Sbjct  298   MGLEASGQQFIWVVRKGKIEEDGDEKRLPEEFEERMKDKGLIIRGWAPQVLILDHESIGG  357

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWK-RLDSDGV  1328
             FVTHCGWNS LEGVC GVPMVTWP FAEQF NEKL+T++LR G GVG+++W+    SD +
Sbjct  358   FVTHCGWNSILEGVCAGVPMVTWPRFAEQFYNEKLVTEVLRIGVGVGARQWQIGAGSDCI  417

Query  1329  KREAIAEAIKKVM-IGEESEEMRSRAKVMKDKAKKAI  1436
             K E IA+A+K+VM  GEE+E MR+RA+  KD AKKA+
Sbjct  418   KGETIAKAVKRVMEAGEEAEGMRTRARAAKDMAKKAV  454



>ref|XP_006379195.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
 gb|ERP56992.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
Length=486

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/457 (61%), Positives = 354/457 (77%), Gaps = 5/457 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FFFP +AHGHMIPT+DMAKLFASRGVK TIITTP N P+FSK + K   LGF ++I+
Sbjct  8     LHIFFFPFLAHGHMIPTVDMAKLFASRGVKTTIITTPLNAPLFSKTIQKTKDLGFDIDIQ  67

Query  261   LLEFPGVEVGLPESCQRLD---QTPDDDG--LPRFFKACAMlqppledllqelrpdCLVA  425
              ++FP  E GLPE C+  D    T ++ G    +FF A   LQ P E +LQE  PDC+VA
Sbjct  68    TIKFPAAEAGLPEGCENTDAFITTNENAGEMTKKFFIATTFLQEPFEKVLQERHPDCVVA  127

Query  426   DMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHEL  605
             DMFFPWAT+AAAKF IPRL+FHGTS+ AL A  S+R+Y+P   VSSD E F +PNLP ++
Sbjct  128   DMFFPWATDAAAKFGIPRLVFHGTSNFALSAGESVRLYEPHKKVSSDYEPFVVPNLPGDI  187

Query  606   KITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRA  785
             K+T+ Q+  F R  V+N  ++ +++ + SE +S+GVIFNSFYELEP YA++Y+ VLGRRA
Sbjct  188   KLTRKQLPDFIRENVQNDFTKLVKASKESELRSFGVIFNSFYELEPAYADYYRKVLGRRA  247

Query  786   WSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHE  965
             W+VGP+SL NRD+EDK+ RGK+++ID+HECLKWLDSK P+SVVYICFGS+A+F  SQL E
Sbjct  248   WNVGPVSLCNRDIEDKSGRGKEASIDQHECLKWLDSKKPNSVVYICFGSMASFPASQLKE  307

Query  966   MAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAV  1145
             +A G+E SG  F+WV+R  +  +   E W+PEGFEER + KGLIIRGWAPQV+ILDH A+
Sbjct  308   IATGLEASGQQFIWVVRRNKNSEEDKEDWLPEGFEERMEDKGLIIRGWAPQVLILDHEAI  367

Query  1146  GAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDG  1325
             GAFVTHCGWNSTLEG+  G PM+TWPV AEQF NEKL+TD+L+TG GVG KEW R+  D 
Sbjct  368   GAFVTHCGWNSTLEGITAGKPMITWPVSAEQFYNEKLVTDVLKTGVGVGVKEWVRVRGDH  427

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VK EA+ +AI ++M+GEE EE RSRA  + + A+KA+
Sbjct  428   VKSEAVEKAITQIMVGEEGEEKRSRAIKLGEMARKAV  464



>ref|XP_004230756.2| PREDICTED: scopoletin glucosyltransferase-like [Solanum lycopersicum]
Length=514

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/459 (61%), Positives = 354/459 (77%), Gaps = 7/459 (2%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             M  LH FFFPMMA GHMIPTLDMAKL A RGVKATIITTP N+ VFS ++++   LG ++
Sbjct  1     MSPLHFFFFPMMAQGHMIPTLDMAKLVALRGVKATIITTPLNESVFSDSIERNKHLGIEI  60

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
             +IRL+ F  VE  LPE C+RLD  P       FFKA AM+Q P E+L++E RPDC+V+DM
Sbjct  61    DIRLITFQAVENDLPEGCERLDLVPSPVLFNNFFKATAMMQEPFENLVKECRPDCIVSDM  120

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
              +PW+T++AAKF+IPR++FHGT   ALC   S++  KPF +VS+DSE F +PNLPH++++
Sbjct  121   LYPWSTDSAAKFNIPRIVFHGTGFFALCVAESIKRNKPFKNVSTDSETFVVPNLPHQIRL  180

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             T+ Q+SPF+  E E  + +    VR ++ KSYGVIFNSFYELE DY E+Y      ++W+
Sbjct  181   TRTQLSPFDLEEKEAIIFQIFHEVREADSKSYGVIFNSFYELETDYFEYYTKFQDNKSWA  240

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GPLSL NRD+EDKAERG KS ID+HECLKWLDSK   S+VYICFGS   F  SQ+ E+A
Sbjct  241   IGPLSLCNRDIEDKAERGTKSCIDKHECLKWLDSKKSGSIVYICFGSGVTFTGSQIEELA  300

Query  972   MGIEDSGMDFVWVIRN----KREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHP  1139
             MGIEDSG +F+WVIR     K+E +N     +PEGFEERTK KGLIIRGWAPQV+ILDH 
Sbjct  301   MGIEDSGQEFIWVIRERIIFKQENENSC---LPEGFEERTKEKGLIIRGWAPQVLILDHQ  357

Query  1140  AVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDS  1319
              VGAFVTHCGWNSTLEG+  GVP+VTWP+FAEQF+NEKL+TD+LR G GVGS +W+   S
Sbjct  358   GVGAFVTHCGWNSTLEGISAGVPLVTWPLFAEQFLNEKLVTDVLRIGVGVGSVKWEASAS  417

Query  1320  DGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             +GVKRE I++AIK+VM+GEE+E  ++RAK  K+KA++AI
Sbjct  418   EGVKREEISKAIKRVMVGEEAEGFKNRAKEYKEKAREAI  456



>ref|XP_008236558.1| PREDICTED: scopoletin glucosyltransferase-like [Prunus mume]
Length=485

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/457 (61%), Positives = 354/457 (77%), Gaps = 4/457 (1%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAV--DKYTQLGFQM  251
             D HVF FP MAHGHMIP  DMAKLFA++GVK TIITTP N P FSKA+   K    G ++
Sbjct  7     DFHVFLFPFMAHGHMIPVSDMAKLFAAQGVKTTIITTPLNAPTFSKAIRSSKTNSGGIEI  66

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLP-RFFKACAMlqppledllqelrpdCLVAD  428
             EI+ ++FP  E GLPE C+ LD  P    L   FFKA  +LQ PLE LL E +P CLVAD
Sbjct  67    EIKTIKFPSQEAGLPEGCENLDSLPPTPVLADSFFKAAGLLQEPLERLLLEDQPTCLVAD  126

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             MFFPWAT+AAAKF IPRL+FHGTS  AL A   +R Y+PF + SSDSE F IP+LP E+K
Sbjct  127   MFFPWATDAAAKFGIPRLVFHGTSFFALAASDCVRRYEPFKNTSSDSEPFVIPDLPGEIK  186

Query  609   ITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             +T+ QV  F +  +EN ++  ++  + +E +SYG++ NSFYELEP YA++Y+ VLG++AW
Sbjct  187   MTRAQVPSFIKDNIENDLTRLLKQSKEAEVRSYGIVVNSFYELEPVYADYYRKVLGKKAW  246

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
              +GPLSL N + E+KA RGK+++IDEHECLKWLDSK P+SVVY+CFGSVA F  SQL E+
Sbjct  247   HIGPLSLCNTENEEKAYRGKEASIDEHECLKWLDSKKPNSVVYVCFGSVAKFNNSQLKEI  306

Query  969   AMGIEDSGMDFVWVIRNKREEDNGS-EKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAV  1145
             A+G+E SG+DFVWV+R  ++ED+ S E W+PEGFEER +GKGLIIRGWAPQV+ILDH AV
Sbjct  307   AIGLEASGVDFVWVVRKGKDEDDVSKEDWLPEGFEERMEGKGLIIRGWAPQVLILDHGAV  366

Query  1146  GAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDG  1325
             G FVTHCGWNSTLEG+  G+PMVTWPV AEQF NEKL+T +L+ G GVG+++W R+  D 
Sbjct  367   GGFVTHCGWNSTLEGIAAGLPMVTWPVSAEQFYNEKLVTQVLKIGVGVGTQKWIRVVGDS  426

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VK EAI +A+ ++M+GEE+E+MRSRAK + ++A++AI
Sbjct  427   VKNEAIEKAVTQIMVGEEAEKMRSRAKGLAEQARRAI  463



>ref|XP_002298734.2| hypothetical protein POPTR_0001s31120g [Populus trichocarpa]
 gb|EEE83539.2| hypothetical protein POPTR_0001s31120g [Populus trichocarpa]
Length=485

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/456 (60%), Positives = 345/456 (76%), Gaps = 4/456 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FFFP  AHGHMIP++DMAKLFASRG+K TIITTP N P+FSK + K  +LGF + I 
Sbjct  8     LHIFFFPFFAHGHMIPSVDMAKLFASRGIKTTIITTPLNAPLFSKTIQKTKELGFDINIL  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDG----LPRFFKACAMlqppledllqelrpdCLVAD  428
              ++FP  E G PE  +  D     +       +FFKA  +LQ P E  LQE  PDC+VAD
Sbjct  68    TIKFPAAEAGFPEGYENTDTFIFSENARAMTTKFFKATTLLQAPFEKALQECHPDCIVAD  127

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             MFFPWAT+AAAKF IPRL+FHGTS+ AL A   +R+Y+P   VSSDSE F +P+LP ++K
Sbjct  128   MFFPWATDAAAKFGIPRLVFHGTSNFALSAAECVRLYEPHKKVSSDSEPFVVPDLPGDIK  187

Query  609   ITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             +TK Q+  + R  VEN  S+ +++ + +E +S+GV+ NSFYELEP YA++YK VLGRRAW
Sbjct  188   LTKKQLPDYVRENVENDFSKILKASKEAELRSFGVVVNSFYELEPAYADYYKKVLGRRAW  247

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
             +VGP+SL NRD EDKA RGK+++ID HECLKWLDSK P+SVVYICFGS  NF+ SQL E+
Sbjct  248   NVGPVSLCNRDTEDKAGRGKETSIDHHECLKWLDSKKPNSVVYICFGSTTNFSDSQLKEI  307

Query  969   AMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVG  1148
             A G+E SG  F+WV+R  ++     E W+PEGF ER +G GLIIRGWAPQV+ILDH A+G
Sbjct  308   AAGLEASGQQFIWVVRRNKKGQEDKEDWLPEGFGERMEGVGLIIRGWAPQVLILDHEAIG  367

Query  1149  AFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGV  1328
             AFVTHCGWNSTLEG+  G PMVTWP+FAEQF NEKL+TD+L+TG GVG KEW R+  D V
Sbjct  368   AFVTHCGWNSTLEGITAGKPMVTWPIFAEQFYNEKLVTDVLKTGVGVGVKEWLRVHGDHV  427

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             K EA+ + I ++M+GEE+EEMRSRAK +   A+KA+
Sbjct  428   KSEAVEKKITQIMVGEEAEEMRSRAKKLGQTARKAV  463



>ref|XP_007200988.1| hypothetical protein PRUPE_ppa004924mg [Prunus persica]
 gb|EMJ02187.1| hypothetical protein PRUPE_ppa004924mg [Prunus persica]
Length=485

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/457 (60%), Positives = 353/457 (77%), Gaps = 4/457 (1%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAV--DKYTQLGFQM  251
             D HVF FP MAHGHMIP  DMAKLFA++GVK TIITTP N P FSKA    K    G ++
Sbjct  7     DFHVFLFPFMAHGHMIPVSDMAKLFAAQGVKTTIITTPLNAPTFSKATRSSKTNSGGIEI  66

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLP-RFFKACAMlqppledllqelrpdCLVAD  428
             EI+ ++FP  E GLPE C+ LD  P    L   FFKA  +LQ PLE LL E +P CLVAD
Sbjct  67    EIKTIKFPSQEAGLPEGCENLDSLPPTPVLADSFFKAAGLLQEPLERLLLEDQPTCLVAD  126

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             MFFPWAT+AAAKF IPRL+FHGTS  AL A   +R Y+PF ++SSDSE F IP+LP E+K
Sbjct  127   MFFPWATDAAAKFGIPRLVFHGTSFFALAASDCVRRYEPFKNISSDSEPFVIPDLPGEIK  186

Query  609   ITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             +T+ QV  F +  +EN ++  ++  + +E +SYG++ NSFYELEP YA++Y+ VLG++AW
Sbjct  187   MTRAQVPGFIKDNIENDLTRLLKQSKEAEVRSYGIVVNSFYELEPVYADYYRKVLGKKAW  246

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
              +GPLSL NR+ E+KA RGK+++IDEHECLKWLDSK P+SVVY+CFGSVA F  SQL E+
Sbjct  247   HIGPLSLCNRENEEKAYRGKEASIDEHECLKWLDSKKPNSVVYVCFGSVAKFNNSQLKEI  306

Query  969   AMGIEDSGMDFVWVIRNKREE-DNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAV  1145
             A+G+E SG+DF+WV+R  +++ D G E W+PEGFEE  +GKGLIIRGWAPQV+ILDH AV
Sbjct  307   AIGLEASGVDFIWVVRKGKDDVDVGKEDWLPEGFEEMMEGKGLIIRGWAPQVLILDHGAV  366

Query  1146  GAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDG  1325
             G FVTHCGWNSTLEG+  G+PMVTWPV AEQF NEKL+T +L+ G GVG+++W R+  D 
Sbjct  367   GGFVTHCGWNSTLEGIAAGLPMVTWPVSAEQFYNEKLVTQVLKIGVGVGTQKWIRVVGDS  426

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VK EAI +A+ ++M+GEE+E+MRSRAK + ++A++AI
Sbjct  427   VKNEAIEKAVTQIMVGEEAEKMRSRAKGLAEQARRAI  463



>ref|XP_007042481.1| UDP-glycosyltransferase 73B4, putative [Theobroma cacao]
 gb|EOX98312.1| UDP-glycosyltransferase 73B4, putative [Theobroma cacao]
Length=485

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/457 (61%), Positives = 355/457 (78%), Gaps = 6/457 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             +H+FFFP+MAHGHMIPT+DMAK+FA+RGVK TI+TTP N   F+K +++  + G  + I+
Sbjct  8     VHMFFFPLMAHGHMIPTVDMAKVFATRGVKTTIVTTPLNASFFTKTIERSKESGIDIGIK  67

Query  261   LLEFPGVEVGLPESCQRLDQTP---DDDG--LPRFFKACAMlqppledllqelrpdCLVA  425
             +L+FP VE GLPE C+  D  P   D+ G  L +FFKA  MLQ PLE LLQE +PDCLVA
Sbjct  68    ILKFPAVEAGLPEGCENADLIPTSQDESGDMLGKFFKATFMLQEPLEQLLQECKPDCLVA  127

Query  426   DMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHEL  605
             DMFFPWAT+AA KF IPRL+FHGTS  +LCA  S+R+Y+P   V SDSE F +PNLP ++
Sbjct  128   DMFFPWATDAANKFGIPRLVFHGTSFFSLCASESMRLYEPHKKVQSDSEPFVVPNLPGDI  187

Query  606   KITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRA  785
             K+TK Q+  + + + E   ++ +++ + SE +SYGV+ NSFYELE  YA+ Y+N+LGR+A
Sbjct  188   KLTKKQLPDYMKQDAETDFTKMVKASKESELRSYGVVVNSFYELEDTYADCYRNILGRKA  247

Query  786   WSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHE  965
             W +GP+SL NR  EDKAERGKKSAIDEHECLKWLDSK P+SVVYICFGS+ANF  +QL E
Sbjct  248   WHIGPVSLCNRATEDKAERGKKSAIDEHECLKWLDSKEPNSVVYICFGSMANFTSAQLKE  307

Query  966   MAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAV  1145
             +AM +E S   F+WV+R K++ +   E W+PEGFE+R +GKGLIIRGWAPQV+ILDH AV
Sbjct  308   IAMALEASEQQFIWVVR-KQKNNEEEEDWLPEGFEKRMEGKGLIIRGWAPQVLILDHEAV  366

Query  1146  GAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDG  1325
             G FVTHCGWNSTLEGV  GV MVTWPVFAEQF NEKL+T +L+ G GVG+++W R   D 
Sbjct  367   GGFVTHCGWNSTLEGVSAGVSMVTWPVFAEQFYNEKLVTQVLKIGVGVGAQQWARTVGDF  426

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VKREAI +A+K++M G+ +EEMR+RAK + + AK AI
Sbjct  427   VKREAIEKAVKEIMKGDRAEEMRNRAKALAEAAKGAI  463



>gb|KCW63754.1| hypothetical protein EUGRSUZ_G01414 [Eucalyptus grandis]
Length=498

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/462 (59%), Positives = 354/462 (77%), Gaps = 10/462 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             L +FFFP MA+GH++PT+DMAKLFASRG+KATIITTP N P+F++ V +  +LG +++++
Sbjct  9     LRIFFFPFMAYGHILPTIDMAKLFASRGLKATIITTPLNAPIFAQTVQRIQKLGAKIDVK  68

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              + FP VE GLP  C+ LD     +   +F KA  ML+ PLEDLL E  PDCLVADMFFP
Sbjct  69    TVNFPSVEAGLPPGCESLDSVASQEMFLKFIKATEMLKQPLEDLLSEDPPDCLVADMFFP  128

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT+ A +  +PR++FHGTS  ALCA   +R+++P  +V SD + F IPN PHE+K+T+ 
Sbjct  129   WATDVAQRLGVPRMVFHGTSFFALCATECVRLHEPHKNVPSDLDPFAIPNFPHEIKLTRK  188

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+    RS VEN  + F R  + SE +S+GVI NSFYELEPDYA++Y+NVLGRRAW +GP
Sbjct  189   QLPEHLRSGVENDFTRFNREAKESEVRSFGVIVNSFYELEPDYADYYRNVLGRRAWHIGP  248

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             +SL NRD+EDKA RGKK+ IDEHECLKWLDSK+P+SV+YICFGSVA F+P+QL E+A+ +
Sbjct  249   VSLCNRDIEDKATRGKKATIDEHECLKWLDSKDPNSVIYICFGSVAKFSPNQLREIALAL  308

Query  981   EDSGMDFVWVIR------NKREEDNGSEKWMPEGFEERTK--GKGLIIRGWAPQVVILDH  1136
             E SG  F+WV+R        ++E  G E+W+P GFEER K   KGLIIR WAPQV+ILDH
Sbjct  309   EASGQQFIWVVRKADKGGGDKDEAGGDEEWLPRGFEERMKSENKGLIIRDWAPQVLILDH  368

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL-  1313
              A+GAFVTHCGWNSTLEG+C GVPMVTWPVFAEQF NEKL+T +LR G GVG+++W  + 
Sbjct  369   KAIGAFVTHCGWNSTLEGICAGVPMVTWPVFAEQFYNEKLVTQVLRVGVGVGAQQWVGIV  428

Query  1314  -DSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              D + V R+ I +A+++VM+G+E+E M  RAK++ DKA++AI
Sbjct  429   ADKEIVSRDRIEKALRQVMVGDEAEAMIDRAKLLADKARRAI  470



>gb|KCW64874.1| hypothetical protein EUGRSUZ_G02440 [Eucalyptus grandis]
Length=498

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/462 (58%), Positives = 355/462 (77%), Gaps = 10/462 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             L +FFFP MA+GH++PT+DMAKLFASRG+KATIITTP N P+F++ + +  +LG +++++
Sbjct  9     LRIFFFPFMAYGHILPTIDMAKLFASRGLKATIITTPLNAPIFAQTIQRTQKLGAKIDVQ  68

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              + FP VE GL   C+ LD     +   +F KA  ML+ PLE+LL E  PDCLVADMFFP
Sbjct  69    TVNFPSVEAGLSPGCENLDLVASQEMFLKFIKATEMLKQPLEELLSEDPPDCLVADMFFP  128

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT+ A +  +PR++FHGTS  ALCA   +R+++P  +V SDS+ F IPN PHE+K+T+ 
Sbjct  129   WATDVAQRLGVPRMVFHGTSFFALCATECVRLHEPHKNVPSDSDPFAIPNFPHEIKLTRK  188

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+    RS VEN  + F R  + SE +S+GVI NSFYELEPDYA++Y+NVLGRRAW +GP
Sbjct  189   QLPEHLRSGVENDFTRFNREAKESEVRSFGVIVNSFYELEPDYADYYRNVLGRRAWHIGP  248

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             +SL NRD+EDKA RGKK+ IDEHECLKWLDSK+P+SV+YICFGSVA F+P+QL E+A+ +
Sbjct  249   VSLCNRDIEDKATRGKKATIDEHECLKWLDSKDPNSVIYICFGSVAKFSPNQLREIALAL  308

Query  981   EDSGMDFVWVIR------NKREEDNGSEKWMPEGFEERTK--GKGLIIRGWAPQVVILDH  1136
             E SG  F+WV+R        ++E  G E+W+P GFEER K   KGLIIR WAPQV+ILDH
Sbjct  309   EASGQQFIWVVRKADKGGGDKDEAGGDEEWLPRGFEERMKSENKGLIIRDWAPQVLILDH  368

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL-  1313
              A+GAFVTHCGWNSTLEG+C GVPM+TWPVFAEQF NEKL+T +LR G GVG+++W  + 
Sbjct  369   KAIGAFVTHCGWNSTLEGICAGVPMMTWPVFAEQFYNEKLVTQVLRVGVGVGAQQWVGIV  428

Query  1314  -DSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              D + V ++ I +A+++VM+G+E+E MR RAK++ DKA++AI
Sbjct  429   ADKEIVSKDRIEKALRQVMVGDEAEAMRDRAKLLADKARRAI  470



>ref|XP_010066838.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=505

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/462 (58%), Positives = 355/462 (77%), Gaps = 10/462 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             L +FFFP MA+GH++PT+DMAKLFASRG+KATIITTP N P+F++ + +  +LG +++++
Sbjct  16    LRIFFFPFMAYGHILPTIDMAKLFASRGLKATIITTPLNAPIFAQTIQRTQKLGAKIDVQ  75

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              + FP VE GL   C+ LD     +   +F KA  ML+ PLE+LL E  PDCLVADMFFP
Sbjct  76    TVNFPSVEAGLSPGCENLDLVASQEMFLKFIKATEMLKQPLEELLSEDPPDCLVADMFFP  135

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT+ A +  +PR++FHGTS  ALCA   +R+++P  +V SDS+ F IPN PHE+K+T+ 
Sbjct  136   WATDVAQRLGVPRMVFHGTSFFALCATECVRLHEPHKNVPSDSDPFAIPNFPHEIKLTRK  195

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+    RS VEN  + F R  + SE +S+GVI NSFYELEPDYA++Y+NVLGRRAW +GP
Sbjct  196   QLPEHLRSGVENDFTRFNREAKESEVRSFGVIVNSFYELEPDYADYYRNVLGRRAWHIGP  255

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             +SL NRD+EDKA RGKK+ IDEHECLKWLDSK+P+SV+YICFGSVA F+P+QL E+A+ +
Sbjct  256   VSLCNRDIEDKATRGKKATIDEHECLKWLDSKDPNSVIYICFGSVAKFSPNQLREIALAL  315

Query  981   EDSGMDFVWVIR------NKREEDNGSEKWMPEGFEERTK--GKGLIIRGWAPQVVILDH  1136
             E SG  F+WV+R        ++E  G E+W+P GFEER K   KGLIIR WAPQV+ILDH
Sbjct  316   EASGQQFIWVVRKADKGGGDKDEAGGDEEWLPRGFEERMKSENKGLIIRDWAPQVLILDH  375

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL-  1313
              A+GAFVTHCGWNSTLEG+C GVPM+TWPVFAEQF NEKL+T +LR G GVG+++W  + 
Sbjct  376   KAIGAFVTHCGWNSTLEGICAGVPMMTWPVFAEQFYNEKLVTQVLRVGVGVGAQQWVGIV  435

Query  1314  -DSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              D + V ++ I +A+++VM+G+E+E MR RAK++ DKA++AI
Sbjct  436   ADKEIVSKDRIEKALRQVMVGDEAEAMRDRAKLLADKARRAI  477



>ref|XP_011013100.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=485

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/456 (60%), Positives = 351/456 (77%), Gaps = 4/456 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH FFFP +AHGH+IPT+DMAKLFASRGVK TIITTP N P FSK + K   LGF ++I+
Sbjct  8     LHFFFFPFLAHGHLIPTVDMAKLFASRGVKTTIITTPLNAPFFSKTIQKTKDLGFDIDIQ  67

Query  261   LLEFPGVEVGLPESCQRLDQ--TPDDDG--LPRFFKACAMlqppledllqelrpdCLVAD  428
              ++FP  E GLPE C+  D   T ++ G    +FF A   LQ P E +LQE  PDC+VAD
Sbjct  68    TIKFPAAEAGLPEGCENTDAFITNENAGEMTKKFFIATTFLQEPFEKVLQERHPDCVVAD  127

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             MFFPWAT+AAAKF IPRL+FHGTS+ AL A   +R+Y+P  +VSSD E F +PNLP ++K
Sbjct  128   MFFPWATDAAAKFGIPRLVFHGTSNFALSAGECVRLYEPHKNVSSDYEPFVVPNLPGDIK  187

Query  609   ITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             +T+ Q+  F R  V+N  ++ +++ + SE +S+GV+ NSFYELEP YA++Y+ VLGRRAW
Sbjct  188   LTRKQLPDFIRENVQNDFTKLVKASKESELRSFGVVVNSFYELEPAYADYYRKVLGRRAW  247

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
             +VGP+SL NRD+EDK+ RGK+++ID+HECLKWLDSK P+S+VYICFG++A+F+ SQL E+
Sbjct  248   NVGPVSLCNRDIEDKSGRGKEASIDQHECLKWLDSKKPNSIVYICFGTMASFSASQLKEI  307

Query  969   AMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVG  1148
             A G+E SG  F+WV+R  +      E W+PEGFEER + KGLIIRGWAPQV+ILDH A+G
Sbjct  308   ATGLEASGQQFIWVVRRNKNSKEDKEDWLPEGFEERMEDKGLIIRGWAPQVLILDHEAIG  367

Query  1149  AFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGV  1328
             AFVTHCGWNSTLEG+  G PM+TWPV AEQF NEKL+TD+L+TG GVG KEW R+  D V
Sbjct  368   AFVTHCGWNSTLEGITAGKPMITWPVSAEQFYNEKLVTDVLKTGVGVGVKEWARVRGDHV  427

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             K EA+ +AI ++M+GEE+EE RSRA  + + A KA+
Sbjct  428   KSEALEKAITQIMVGEEAEEKRSRAIKLGEMAMKAV  463



>ref|XP_011000877.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=485

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/456 (60%), Positives = 352/456 (77%), Gaps = 4/456 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH FFFP +AHGHMIP++DMAKLFASRGVK TIITTP N P FSK + K   LGF ++I+
Sbjct  8     LHFFFFPFLAHGHMIPSVDMAKLFASRGVKTTIITTPLNAPFFSKTIQKTKDLGFDIDIQ  67

Query  261   LLEFPGVEVGLPESCQRLDQ--TPDDDG--LPRFFKACAMlqppledllqelrpdCLVAD  428
              ++FP  E GLPE C+  D   T ++ G    +FF A  +LQ P E +LQE  PDC+VAD
Sbjct  68    TIKFPTAEAGLPEGCENTDAFITNENAGEMTKKFFIAITLLQEPFEKVLQERHPDCVVAD  127

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             MFFPWAT+AAAKF IPRL+FHGTS+ AL A   +R+Y+P   VSSD E F +PNLP ++K
Sbjct  128   MFFPWATDAAAKFGIPRLVFHGTSNFALSAGDCVRLYEPHKKVSSDYEPFVVPNLPGDIK  187

Query  609   ITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             +T+ Q+  F R  V+N  ++F+++ + SE +S+GV+ NSFYELEP YA++Y+ VLGRRAW
Sbjct  188   LTRKQLPDFIRENVQNHFTKFVKAYKESELRSFGVVVNSFYELEPAYADYYRKVLGRRAW  247

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
             +VGP+SL N D+EDK+ RGK+++ID+HECLKWLDSK P+SVVYICFG++A+F+ SQL E+
Sbjct  248   NVGPVSLCNTDIEDKSGRGKEASIDQHECLKWLDSKKPNSVVYICFGTMASFSASQLKEI  307

Query  969   AMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVG  1148
             A G+E SG  F+WV+R  +  +   E W+PEGFEER + KGLIIRGWAPQV+ILDH A+G
Sbjct  308   ATGLEASGQQFIWVVRRNKNSEEDKEDWLPEGFEERMEDKGLIIRGWAPQVLILDHVAIG  367

Query  1149  AFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGV  1328
             AFVTHCGWNSTLEG+  G PM+TWPV AEQF NEKL+TD+L+TG GVG KEW R+  D V
Sbjct  368   AFVTHCGWNSTLEGITAGKPMITWPVCAEQFYNEKLVTDVLKTGVGVGVKEWARVRGDHV  427

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             K EA+ +AI ++M+GEE+EE RSRA  + + A KA+
Sbjct  428   KSEALEKAITQIMVGEEAEEKRSRAIKLGEMAMKAV  463



>dbj|BAF49309.1| putative glycosyltransferase [Eustoma grandiflorum]
Length=481

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/476 (59%), Positives = 371/476 (78%), Gaps = 1/476 (0%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             MG LH+FFFP +A GHM+PT+DMAKLF+SRGVKAT+ITTP + P+F+KA++    LGF +
Sbjct  1     MGQLHIFFFPFLAQGHMLPTIDMAKLFSSRGVKATLITTPYHNPMFTKAIESTRNLGFDI  60

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
              +RL++FP  E GLPE  +  DQ   DD  P F K C +LQ PLE LLQE  P  LVAD+
Sbjct  61    SVRLIKFPYAEAGLPEGIESTDQITSDDLRPXFLKGCNLLQXPLEQLLQEFHPHALVADV  120

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FF WA ++AAKF IPRL+FHG+S  A+ A  S+R +KP+ ++SSDS++F +P+LPHE+K+
Sbjct  121   FFYWANDSAAKFGIPRLLFHGSSSFAMSATDSVRRHKPYQNLSSDSDIFVVPDLPHEIKL  180

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             ++ Q+S  +R  +EN M++    V  SE KSYGV+ NSFYELEPDY  +YKNV+G++AW 
Sbjct  181   SRGQISVEQREGIENEMTKLWEKVIDSERKSYGVVVNSFYELEPDYVNYYKNVMGKKAWH  240

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             VGPL L  ++ ED ++RGK+SAI+ HECLKWLDSKNP+S+VYICFGS++NF  +QL+E+A
Sbjct  241   VGPLLLCKKEDEDVSQRGKESAINTHECLKWLDSKNPNSIVYICFGSMSNFTVAQLNEIA  300

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             +G+E SG +F+WV+R   +E++ S KW  +  + R +GKGLII+GW PQ++IL H AVG 
Sbjct  301   LGLELSGQEFIWVVRKCADEED-SAKWFHKDLKTRIQGKGLIIKGWPPQLMILGHEAVGG  359

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLEGVC GVPMVTWP+FAEQF NEKL+TD+LRTG GVGSK+W R++ + VK
Sbjct  360   FVTHCGWNSTLEGVCAGVPMVTWPMFAEQFYNEKLVTDVLRTGVGVGSKQWGRVNKETVK  419

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAIeeggssylglsslldelRAYH  1499
             REAI +AI  VMIGEE+ EMRS+AK +K  AK A+EEGGSS   L +L +EL+AYH
Sbjct  420   REAIKKAICHVMIGEEAVEMRSKAKELKKMAKMAVEEGGSSSNDLIALFEELKAYH  475



>ref|XP_010066005.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=495

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/457 (58%), Positives = 350/457 (77%), Gaps = 5/457 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             L +FFFP MA+GH++PT+DMAKLFASRG+KATIITTP N P+F++ V +  +LG +++++
Sbjct  16    LRIFFFPFMAYGHILPTIDMAKLFASRGLKATIITTPLNAPIFAQTVQRIQKLGAKIDVK  75

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              + FP VE GLP  C+ LD     +   +F KA  ML+ PLEDLL E  PDCLVADMFFP
Sbjct  76    TVNFPSVEAGLPPGCESLDSVASQEMFLKFIKATEMLKQPLEDLLSEDPPDCLVADMFFP  135

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT+ A +  +PR++FHGTS  ALCA   +R+++P  +V SD + F IPN PHE+K+T+ 
Sbjct  136   WATDVAQRLGVPRMVFHGTSFFALCATECVRLHEPHKNVPSDLDPFAIPNFPHEIKLTRK  195

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+    RS VEN  + F R  + SE +S+GVI NSFYELEPDYA++Y+NVLGRRAW +GP
Sbjct  196   QLPEHLRSGVENDFTRFNREAKESEVRSFGVIVNSFYELEPDYADYYRNVLGRRAWHIGP  255

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             +SL NRD+EDKA RGKK+ IDEHECLKWLDSK+P+SV+Y+CFG+ + F+ +QL E+A G+
Sbjct  256   VSLCNRDIEDKATRGKKATIDEHECLKWLDSKDPNSVIYVCFGTTSKFSDAQLQEIATGL  315

Query  981   EDSGMDFVWVIRNKREEDNGSE-----KWMPEGFEERTKGKGLIIRGWAPQVVILDHPAV  1145
             E SG DFVWV+   R+++ G+E      W+PEGFE+R +G+GLIIRGWAPQV+ILDH +V
Sbjct  316   EASGQDFVWVVSRDRKQEKGNEGEGQDDWLPEGFEKRIQGRGLIIRGWAPQVLILDHRSV  375

Query  1146  GAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDG  1325
             G FVTHCGWNS LEG+  G+PMVTWP+FAEQF NEKL+T++LR G GVG++ W RL  D 
Sbjct  376   GGFVTHCGWNSVLEGISAGLPMVTWPIFAEQFYNEKLVTEVLRIGVGVGARRWARLVGDF  435

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             V++EA+  A+K++M+GE + EMR RA+     AK+A+
Sbjct  436   VRKEAVERAVKEIMVGERAGEMRGRARSFGVMAKRAV  472



>ref|XP_011000136.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=485

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/456 (60%), Positives = 345/456 (76%), Gaps = 4/456 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FFFP  AHGHMIP +DMAKLFASRG+K TIITTP N P+FSK + K  +LGF + I 
Sbjct  8     LHIFFFPFFAHGHMIPFVDMAKLFASRGIKTTIITTPLNAPLFSKTIHKNKELGFDINIL  67

Query  261   LLEFPGVEVGLPESCQRLD----QTPDDDGLPRFFKACAMlqppledllqelrpdCLVAD  428
              ++FP  E G PE  +  D         +   +F KA  +LQ P E +LQE  PDC+VAD
Sbjct  68    TIKFPAAEAGFPEGYENTDAFIFSENAREMTIKFIKATTLLQAPFEKVLQECHPDCIVAD  127

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             MFFPWAT+AAAKF IPRL+FHGTS+ AL A   +R+Y+P   VSSDSE F +P+LP ++K
Sbjct  128   MFFPWATDAAAKFGIPRLVFHGTSNFALSASECVRLYEPHKKVSSDSEPFVVPDLPGDIK  187

Query  609   ITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             +TK Q+  F R + EN  S+F+++ + +E +S+GV+ NSFYELEP YA++Y+ VLGRRAW
Sbjct  188   LTKKQLPDFAREDAENDFSKFLKASKEAELRSFGVVVNSFYELEPAYADYYRLVLGRRAW  247

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
             +VGP+SL NRD EDKA RGK+++ID+HECLKWLDSK P+SVVYICFGS+  F  SQL E+
Sbjct  248   NVGPVSLCNRDTEDKAGRGKETSIDQHECLKWLDSKKPNSVVYICFGSMTVFTDSQLKEI  307

Query  969   AMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVG  1148
             A G+E SG  F+WV+R  +      E W+PEGFEER +G GLIIRGWAPQV+ILDH A+G
Sbjct  308   AAGLEASGQQFIWVVRRNKNGQEDKEDWLPEGFEERMEGMGLIIRGWAPQVLILDHEAIG  367

Query  1149  AFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGV  1328
             AFVTHCGWNSTLEG+  G PMVTWP+FAEQF NEKL+TD+L+TG GVG KEW R+  D V
Sbjct  368   AFVTHCGWNSTLEGITAGKPMVTWPIFAEQFYNEKLVTDVLKTGVGVGVKEWVRVHGDHV  427

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             K EA+   I ++M+GEE+EEMRSRAK + + A+KA+
Sbjct  428   KSEAVERTITQIMVGEEAEEMRSRAKKLGETARKAV  463



>ref|XP_006369755.1| hypothetical protein POPTR_0001s31040g [Populus trichocarpa]
 gb|ERP66324.1| hypothetical protein POPTR_0001s31040g [Populus trichocarpa]
Length=485

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/456 (60%), Positives = 345/456 (76%), Gaps = 4/456 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FF P  AHGHMIP++DMAKLFASRG+K TIITTP N P FSK + K  +LGF + I 
Sbjct  8     LHIFFLPFFAHGHMIPSVDMAKLFASRGIKTTIITTPLNAPFFSKTIQKTKELGFDINIL  67

Query  261   LLEFPGVEVGLPESCQRLD----QTPDDDGLPRFFKACAMlqppledllqelrpdCLVAD  428
              ++FP  E GLPE  +  D         +   +F KA   LQ P E +LQE  PDC+VAD
Sbjct  68    TIKFPAAEAGLPEGYENTDAFIFSENAREMTIKFIKATTFLQAPFEKVLQECHPDCIVAD  127

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             +FFPWAT+AAAKF IPRL+FHGTS+ AL A   +R+Y+P   VSSDSE F +P+LP ++K
Sbjct  128   VFFPWATDAAAKFGIPRLVFHGTSNFALSASECVRLYEPHKKVSSDSEPFVVPDLPGDIK  187

Query  609   ITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             +TK Q+    R  VEN  S+F+++ + +E +S+GV+ NSFYELEP YA++YK VLGRRAW
Sbjct  188   LTKKQLPDDVRENVENDFSKFLKASKEAELRSFGVVVNSFYELEPAYADYYKKVLGRRAW  247

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
             +VGP+SL NRD EDKA RGK+++ID HECLKWLDSK P+SVVYICFGS  NF+ SQL E+
Sbjct  248   NVGPVSLCNRDTEDKAGRGKETSIDHHECLKWLDSKKPNSVVYICFGSTTNFSDSQLKEI  307

Query  969   AMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVG  1148
             A G+E SG  F+WV+R  ++     E W+PEGFEER +G GLIIRGWAPQV+ILDH A+G
Sbjct  308   AAGLEASGQQFIWVVRRNKKGQEDKEDWLPEGFEERMEGVGLIIRGWAPQVLILDHEAIG  367

Query  1149  AFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGV  1328
             AFVTHCGWNSTLEG+  G PMVTWP+FAEQF NEKL+TD+L+TG GVG KEW R+  D V
Sbjct  368   AFVTHCGWNSTLEGITAGKPMVTWPIFAEQFYNEKLVTDVLKTGVGVGVKEWFRVHGDHV  427

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             K EA+ + I ++M+GEE+EEMRSRAK + + A+KA+
Sbjct  428   KSEAVEKTITQIMVGEEAEEMRSRAKKLGETARKAV  463



>dbj|BAD29722.1| UDP-glucose glucosyltransferase [Catharanthus roseus]
Length=487

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/457 (58%), Positives = 356/457 (78%), Gaps = 3/457 (1%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             +  LH+F FP MA GHM+P LDMA LF SRGVK T+ITT  + P+F+K++++    GF +
Sbjct  2     VNQLHIFNFPFMAQGHMLPALDMANLFTSRGVKVTLITTHQHVPMFTKSIERSRNSGFDI  61

Query  252   EIRLLEFPGVEVGLPESCQRLDQ-TPDDDGLPRFFKACAMlqppledllqelrpdCLVAD  428
              I+ ++FP  EVGLPE  + LDQ + DD+ LP+F +   +LQ PLE LLQE RP CL++D
Sbjct  62    SIQSIKFPASEVGLPEGIESLDQVSGDDEMLPKFMRGVNLLQQPLEQLLQESRPHCLLSD  121

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             MFFPW T +AAKF IPRL+FHG+   AL A  S+R  KPF +VS+D+E F +P+LPH++K
Sbjct  122   MFFPWTTESAAKFGIPRLLFHGSCSFALSAAESVRRNKPFENVSTDTEEFVVPDLPHQIK  181

Query  609   ITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             +T+ Q+S +ER  +E+  ++ ++ VR SE  SYGV+ NSFYELEPDYA++Y NVLGR+AW
Sbjct  182   LTRTQISTYERENIESDFTKMLKKVRDSESTSYGVVVNSFYELEPDYADYYINVLGRKAW  241

Query  789   SVGPLSLYNR-DVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHE  965
              +GP  L N+   EDKA+RGKKSAID  ECL WLDSK P+SV+Y+CFGS+AN   +QLHE
Sbjct  242   HIGPFLLCNKLQAEDKAQRGKKSAIDADECLNWLDSKQPNSVIYLCFGSMANLNSAQLHE  301

Query  966   MAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAV  1145
             +A  +E SG +F+WV+R   +E+N S KW PEGFEERTK KGLII+GWAPQ +IL+H +V
Sbjct  302   IATALESSGQNFIWVVRKCVDEENSS-KWFPEGFEERTKEKGLIIKGWAPQTLILEHESV  360

Query  1146  GAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDG  1325
             GAFVTHCGWNSTLEG+C GVP+VTWP FAEQF NEKL+T++L+TG GVG+++W R+ ++ 
Sbjct  361   GAFVTHCGWNSTLEGICAGVPLVTWPFFAEQFFNEKLITEVLKTGYGVGARQWSRVSTEI  420

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             +K EAIA AI +VM+G+E+ EMR+RAK +K+KA+KA+
Sbjct  421   IKGEAIANAINRVMVGDEAVEMRNRAKDLKEKARKAL  457



>ref|XP_008236559.1| PREDICTED: scopoletin glucosyltransferase-like [Prunus mume]
Length=485

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/458 (58%), Positives = 351/458 (77%), Gaps = 5/458 (1%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAV----DKYTQLGF  245
             +LHVF FP MAHGHMIP  DMAKL A++GV+ TIITTP N P FSKA           G 
Sbjct  7     ELHVFLFPFMAHGHMIPVSDMAKLLAAQGVETTIITTPLNAPTFSKATRSRKTNSGSCGI  66

Query  246   QMEIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVA  425
             +++I+ ++FP  E GLPE C+  D  P  +    FFKA  +LQ PLE LL E +P CLVA
Sbjct  67    EIKIKTIKFPSQEAGLPEGCENPDSLPTPELASNFFKAVGLLQAPLEQLLLEDQPTCLVA  126

Query  426   DMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHEL  605
             DMFFPWAT+AAAKF IPRL+FHGTS  AL A   +R Y+PF + SSDSE F IPNLP E+
Sbjct  127   DMFFPWATDAAAKFGIPRLVFHGTSFFALAASDCVRRYEPFKNTSSDSEPFVIPNLPGEI  186

Query  606   KITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRA  785
             K+T+ Q+  F +   EN ++  ++  + +E +SYG++ NSFYELE  YA++Y+ VLG++A
Sbjct  187   KMTRAQLPDFIKDNNENDLTRLLKQSKEAEVRSYGIVVNSFYELETVYADYYRKVLGKKA  246

Query  786   WSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHE  965
             W +GPLSL NRD E+KA RGK+++IDEHECLKWLDSK P+SVVY+CFGSVA F  SQL +
Sbjct  247   WHIGPLSLCNRDNEEKAYRGKEASIDEHECLKWLDSKKPNSVVYVCFGSVAKFNNSQLKD  306

Query  966   MAMGIEDSGMDFVWVIRNKREEDN-GSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPA  1142
             +A+G+E SG++F+WV+R  +++D+ G E W+PEGFEER +GKGLIIRGWAPQV+ILDH A
Sbjct  307   IALGLEASGLEFIWVVRKGKDDDDVGKEDWLPEGFEERMEGKGLIIRGWAPQVLILDHGA  366

Query  1143  VGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD  1322
             VG FVTHCGWNSTLEG+  G+PMVTWPV AEQF NEKL+T +L+ G GVG+++W R+  D
Sbjct  367   VGGFVTHCGWNSTLEGIAAGLPMVTWPVSAEQFYNEKLVTQVLKIGVGVGAQKWVRVLGD  426

Query  1323  GVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              V++EAI +A+ ++M+GEE+EEMR+RA+V+ ++A++ I
Sbjct  427   SVRKEAIEKAVTQIMVGEEAEEMRNRARVLAEQARRTI  464



>gb|EYU37652.1| hypothetical protein MIMGU_mgv1a005524mg [Erythranthe guttata]
Length=480

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/457 (60%), Positives = 351/457 (77%), Gaps = 9/457 (2%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             MG LH+ F P+MAHGH IPTLDMAKLF SRG+K TII TPA    F+  + K  + G  +
Sbjct  1     MGQLHIVFLPVMAHGHTIPTLDMAKLFTSRGLKTTIIATPA----FAGPITKAQESGHAI  56

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
              + +L+FP     LP++   LDQ    D +P+F +A ++L+ P+E LLQEL P+CLV+DM
Sbjct  57    NLSILKFPPKGSSLPDNVVSLDQMSTPDLIPKFVEALSLLREPVEKLLQELNPNCLVSDM  116

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             F PW  ++AAKF IPRL+FHGT+  A C    + ++KP+ +VSSD+E F++PNLPHEL  
Sbjct  117   FLPWTADSAAKFGIPRLVFHGTNCFAQCVAEQMHIHKPYKNVSSDAEPFSVPNLPHELTF  176

Query  612   TKLQVSPFERSE-VENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             T+ QV  FE  E  EN  S+  + +R S++KSYGVIFNSF ELE DYA+HYKNVLGR+AW
Sbjct  177   TRSQVPEFELFEDEENEFSKLRKQMRESDKKSYGVIFNSFTELESDYADHYKNVLGRKAW  236

Query  789   SVGPLSLYNRDVEDKAE-RGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHE  965
              +GPL L N + E+K E RG++SAIDEHECL WLDSK P+SVVY CFGS+A F P+QLHE
Sbjct  237   HIGPLLLRNNENEEKPESRGRESAIDEHECLSWLDSKKPNSVVYACFGSIATFTPAQLHE  296

Query  966   MAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAV  1145
              A+G+E SG DF+WV+RN + +D   E+W+PEGFEER KG+GLIIRGWAPQV IL HPAV
Sbjct  297   TAVGLEGSGQDFIWVVRNGKHDD---EEWLPEGFEERVKGRGLIIRGWAPQVAILGHPAV  353

Query  1146  GAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDG  1325
             GAFVTHCGWNSTLEG+C G+PMVTWPVFAEQF NEKL+ ++LR G  VG+K+W R+ S+G
Sbjct  354   GAFVTHCGWNSTLEGICAGLPMVTWPVFAEQFYNEKLVVEVLRVGVSVGNKKWMRVGSEG  413

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             V REA+AEA+++VM+GEE+EEMR+R +  K+ A++A+
Sbjct  414   VSREAVAEAVRRVMVGEEAEEMRNRVEGYKEMARRAV  450



>ref|XP_007200278.1| hypothetical protein PRUPE_ppa014816mg [Prunus persica]
 gb|EMJ01477.1| hypothetical protein PRUPE_ppa014816mg [Prunus persica]
Length=485

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/457 (59%), Positives = 350/457 (77%), Gaps = 5/457 (1%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAV----DKYTQLGF  245
             +LHVF FP MAHGHMIP  DMAKLFA++GVK TIIT   N P FSKA+          G 
Sbjct  7     ELHVFLFPFMAHGHMIPVSDMAKLFAAQGVKTTIITNTLNAPTFSKAIRSRKTNSCGCGI  66

Query  246   QMEIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVA  425
             ++EI+ ++FP  E GLPE C+ LD  P  +    FFKA  +LQ PLE LL E +P CLVA
Sbjct  67    EIEIKTIKFPSQEAGLPEGCENLDSLPTPELAGNFFKAMGLLQAPLEQLLLEDQPTCLVA  126

Query  426   DMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHEL  605
             DMFFPWAT+AAAKF IPRL+FHGTS  AL A   +  Y+PF + SSDSE F IPNLP  +
Sbjct  127   DMFFPWATDAAAKFGIPRLVFHGTSFFALAASDCVWRYEPFKNTSSDSEPFVIPNLPGLI  186

Query  606   KITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRA  785
             ++T+ QV  F +  +EN +S  ++  + +E +SYG++ NSFYELEP YA++Y+ VLG++A
Sbjct  187   RMTRAQVPDFIKDNIENDLSRLLKQSKEAEVRSYGIVVNSFYELEPVYADYYRKVLGKKA  246

Query  786   WSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHE  965
             W +GPLSL NRD E+KA RGK+++IDEHECLKWLDSK P+SVVY+CFGSV  F  SQL +
Sbjct  247   WHIGPLSLCNRDNEEKAYRGKEASIDEHECLKWLDSKKPNSVVYVCFGSVVKFNNSQLKD  306

Query  966   MAMGIEDSGMDFVWVIRNKREEDN-GSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPA  1142
             +A+G+E SG++F+WV+R  +++D+ G E W+PEGFEER +GKGLIIRGWAPQV+ILDH A
Sbjct  307   IALGLEASGLEFIWVVRKGKDDDDVGKEDWLPEGFEERMEGKGLIIRGWAPQVLILDHGA  366

Query  1143  VGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD  1322
             VG FVTHCGWNSTLEG+  G+PMVTWPV AEQF NEKL+T +L+ G  VG+++W R+  D
Sbjct  367   VGGFVTHCGWNSTLEGIAAGLPMVTWPVAAEQFYNEKLVTQVLKIGVAVGAQKWVRVVGD  426

Query  1323  GVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKA  1433
              VK+EAI +A+ ++M+GEE+EEMR+RA+V+ ++A++A
Sbjct  427   SVKKEAIEKAVTQMMVGEEAEEMRNRARVLAEQARRA  463



>gb|KCW64673.1| hypothetical protein EUGRSUZ_G02259 [Eucalyptus grandis]
Length=498

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/462 (57%), Positives = 351/462 (76%), Gaps = 10/462 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             L +FFFP MA+GH++PT+DMAKLFASRG+KATIITTP N P+F++ + +  +LG +++++
Sbjct  9     LRIFFFPFMAYGHILPTIDMAKLFASRGLKATIITTPLNAPIFAQTIQRTQKLGAKIDVK  68

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              ++FP VE GLP  C+ LD     + L +F KA  ML+ PLEDLL E  PDCLVADMFFP
Sbjct  69    TVDFPSVEAGLPPGCENLDSVASQEMLLKFIKATEMLKQPLEDLLSEDPPDCLVADMFFP  128

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT+ A +  +PR++FHG S  ALCA   + +++P  +V SDS+ F IPN PHE+K+T+ 
Sbjct  129   WATDVAQRLGVPRMVFHGMSFFALCATACVMLHEPHKNVPSDSDPFAIPNFPHEIKLTRK  188

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+     S VEN  + F R  + SE +S+GVI NSFYELEPDYA +Y+NVLGRRAW +GP
Sbjct  189   QLPEHLCSGVENDFTRFNREAKESEVRSFGVIVNSFYELEPDYAAYYRNVLGRRAWHIGP  248

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             +SL NR +EDKA RGKK+ IDEH+CL WLD+K+P+SV+YICFGSVA F+ +QL E+A+ +
Sbjct  249   VSLCNRGIEDKARRGKKATIDEHDCLNWLDTKDPNSVIYICFGSVAKFSSNQLREIALAL  308

Query  981   EDSGMDFVWVIR------NKREEDNGSEKWMPEGFEERTK--GKGLIIRGWAPQVVILDH  1136
             E SG  F+WVIR        ++E  G E+W+P GFEER K   KGLIIR WAPQV+ILDH
Sbjct  309   EASGQQFIWVIRKADKGSGDKDEAGGDEEWLPRGFEERMKSENKGLIIRDWAPQVLILDH  368

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL-  1313
              A+GAFVTHCGWNSTLEG+C GVPMVTWPVFAEQF NEKL+T +LR G GVG+++W  + 
Sbjct  369   KAIGAFVTHCGWNSTLEGICAGVPMVTWPVFAEQFYNEKLVTQVLRVGVGVGAQQWVGIV  428

Query  1314  -DSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              D + V ++ I +A+++VM+G+E+E MR RAK++ DKA++AI
Sbjct  429   ADKEIVSKDRIEKALRQVMVGDEAEAMRDRAKLLADKARRAI  470



>ref|XP_010066692.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=505

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/462 (57%), Positives = 351/462 (76%), Gaps = 10/462 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             L +FFFP MA+GH++PT+DMAKLFASRG+KATIITTP N P+F++ + +  +LG +++++
Sbjct  16    LRIFFFPFMAYGHILPTIDMAKLFASRGLKATIITTPLNAPIFAQTIQRTQKLGAKIDVK  75

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              ++FP VE GLP  C+ LD     + L +F KA  ML+ PLEDLL E  PDCLVADMFFP
Sbjct  76    TVDFPSVEAGLPPGCENLDSVASQEMLLKFIKATEMLKQPLEDLLSEDPPDCLVADMFFP  135

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT+ A +  +PR++FHG S  ALCA   + +++P  +V SDS+ F IPN PHE+K+T+ 
Sbjct  136   WATDVAQRLGVPRMVFHGMSFFALCATACVMLHEPHKNVPSDSDPFAIPNFPHEIKLTRK  195

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+     S VEN  + F R  + SE +S+GVI NSFYELEPDYA +Y+NVLGRRAW +GP
Sbjct  196   QLPEHLCSGVENDFTRFNREAKESEVRSFGVIVNSFYELEPDYAAYYRNVLGRRAWHIGP  255

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             +SL NR +EDKA RGKK+ IDEH+CL WLD+K+P+SV+YICFGSVA F+ +QL E+A+ +
Sbjct  256   VSLCNRGIEDKARRGKKATIDEHDCLNWLDTKDPNSVIYICFGSVAKFSSNQLREIALAL  315

Query  981   EDSGMDFVWVIR------NKREEDNGSEKWMPEGFEERTK--GKGLIIRGWAPQVVILDH  1136
             E SG  F+WVIR        ++E  G E+W+P GFEER K   KGLIIR WAPQV+ILDH
Sbjct  316   EASGQQFIWVIRKADKGSGDKDEAGGDEEWLPRGFEERMKSENKGLIIRDWAPQVLILDH  375

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL-  1313
              A+GAFVTHCGWNSTLEG+C GVPMVTWPVFAEQF NEKL+T +LR G GVG+++W  + 
Sbjct  376   KAIGAFVTHCGWNSTLEGICAGVPMVTWPVFAEQFYNEKLVTQVLRVGVGVGAQQWVGIV  435

Query  1314  -DSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              D + V ++ I +A+++VM+G+E+E MR RAK++ DKA++AI
Sbjct  436   ADKEIVSKDRIEKALRQVMVGDEAEAMRDRAKLLADKARRAI  477



>ref|XP_006422969.1| hypothetical protein CICLE_v10028305mg [Citrus clementina]
 gb|ESR36209.1| hypothetical protein CICLE_v10028305mg [Citrus clementina]
Length=490

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/458 (58%), Positives = 355/458 (78%), Gaps = 6/458 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LHVFFFP MAHGHMIP +DMAKLFA+RGVKA++ITTPAN P  SK+V++  +LG +++++
Sbjct  8     LHVFFFPFMAHGHMIPIVDMAKLFATRGVKASVITTPANAPYVSKSVERANELGIELDVK  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDD---DGLPRFFKACAMlqppledllqelrpdCLVADM  431
              ++FP VE GLP+ C+ LD   ++   + + +F  A   LQ PLE LL++ +PDCLVAD+
Sbjct  68    TIKFPSVEAGLPDGCENLDAITNEVNKELIVKFLGATTKLQEPLEQLLRDHKPDCLVADI  127

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FFPWAT+AAAKF IPRL+FHGTS  +LCA + LR+Y+P   VSSDSE F +P+ P E+K+
Sbjct  128   FFPWATDAAAKFGIPRLVFHGTSFFSLCASNCLRLYEPHKKVSSDSEPFVMPHFPGEIKL  187

Query  612   TKLQVSPFERSEV-ENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             T+ Q+  F + ++ +N +S  +++   SE +SYGV  NSFYELEP YA+HY+  LGRRAW
Sbjct  188   TRNQLPDFVKQDMGDNDLSRLLKATNESESRSYGVAVNSFYELEPAYADHYRKALGRRAW  247

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
              +GP+SL NR+ EDKA RGK+++IDE ECLKWL+SK P+SVVYICFGS+ANF  +QL E+
Sbjct  248   HIGPVSLCNRNFEDKALRGKQASIDELECLKWLNSKQPNSVVYICFGSLANFTSAQLMEI  307

Query  969   AMGIEDSGMDFVWVIRNKREE--DNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPA  1142
             A G+E SG +F+WV+R  + +  + G E W+PEGFE+R +GKGLIIRGWAPQV+ILDH A
Sbjct  308   ATGLEASGRNFIWVVRKNKNDGGEGGKEDWLPEGFEKRMEGKGLIIRGWAPQVLILDHEA  367

Query  1143  VGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD  1322
             VG FVTHCGWNST+E V  GVP+VTWPV AEQF NEK++ ++L+ G GVG ++W R+  D
Sbjct  368   VGGFVTHCGWNSTIEAVAAGVPLVTWPVSAEQFYNEKMVNEVLKIGVGVGIQKWCRIVGD  427

Query  1323  GVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              VKRE I +A+ ++M+G+ +EEMRSRAK +   AK+A+
Sbjct  428   FVKREKIEKAVNEIMVGDRAEEMRSRAKALGKMAKRAV  465



>ref|XP_008236488.1| PREDICTED: scopoletin glucosyltransferase-like [Prunus mume]
Length=483

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/456 (59%), Positives = 346/456 (76%), Gaps = 3/456 (1%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAV-DKYTQLG-FQM  251
             + H+F FP MA+GHMIP  DMAKLFA++GVK TIITTP N P FSKA   + T  G  ++
Sbjct  7     EFHIFLFPFMAYGHMIPVSDMAKLFAAQGVKTTIITTPLNAPTFSKATRSRRTNSGRIEV  66

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
             +I+ ++FP  E GLPE C+ L+  P  +    F KA  +LQ PLE LL E +P CLVADM
Sbjct  67    QIKTIKFPSQEAGLPEGCENLESLPTPELANNFSKALGLLQEPLERLLHEDQPSCLVADM  126

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FFPWAT+AAAKF IPRL+FHGTS   L A   +R Y+PF ++SSDSE F IPNLP E+K+
Sbjct  127   FFPWATDAAAKFGIPRLVFHGTSFFTLAASDCVRRYQPFKNMSSDSEPFVIPNLPGEIKM  186

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             T  QV  F +  +EN  ++ M+    SE  SYG++ NSFYELEP YA++Y+ +LGR+AW 
Sbjct  187   TSAQVPYFLKENIENDFTQLMKQAHDSEVGSYGIVVNSFYELEPVYADYYRKILGRKAWH  246

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GPLSL NRD E+K  RGK+ +IDEHECLKWL+SK P+SVVY+CFGS+A F+ SQL E+A
Sbjct  247   IGPLSLCNRDNEEKLYRGKEVSIDEHECLKWLNSKKPNSVVYVCFGSMARFSNSQLKEIA  306

Query  972   MGIEDSGMDFVWVI-RNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVG  1148
              G+E + ++F+WV+ R K ++D G E W+PEGFEER +GKGLIIRGWAPQV+ILDH AVG
Sbjct  307   AGLEATRLEFIWVVRRGKNDDDVGKEDWLPEGFEERMEGKGLIIRGWAPQVLILDHGAVG  366

Query  1149  AFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGV  1328
              FVTHCGWNSTLEG+  G+PMVTWPV AEQF N+KL+T +L+ G GVG ++W R++ D V
Sbjct  367   GFVTHCGWNSTLEGIAAGLPMVTWPVSAEQFYNDKLVTQVLKIGVGVGDQKWVRVEGDSV  426

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             KREAI +A+ ++M+GEE+EEMRSR+K + ++A+  I
Sbjct  427   KREAIEKAVTQIMVGEEAEEMRSRSKGLAEQARGVI  462



>ref|XP_006487029.1| PREDICTED: scopoletin glucosyltransferase-like [Citrus sinensis]
Length=487

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/458 (58%), Positives = 355/458 (78%), Gaps = 6/458 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FFFP +AHGHMIPT+DMAKLF +RGVKA++ITTPAN P  S+++ K ++LG +++++
Sbjct  8     LHIFFFPFLAHGHMIPTVDMAKLFTTRGVKASVITTPANAPHLSRSIQKASELGIELDVK  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDD---DGLPRFFKACAMlqppledllqelrpdCLVADM  431
             +++FP  E GLPE  + LD   ++   + + +F+ A   LQ PLE LLQE +PDCLVADM
Sbjct  68    IIKFPSAEAGLPEGWENLDAITNEVNRELIVKFYMATTKLQKPLEQLLQEHKPDCLVADM  127

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FFPWAT+AAAKF IPRL+FHGTS  +LCA+  L +Y+P   VSSDSE F +PNLP E+K+
Sbjct  128   FFPWATDAAAKFGIPRLVFHGTSFFSLCAIKCLALYEPHKKVSSDSEPFVMPNLPGEIKL  187

Query  612   TKLQV-SPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             T+ Q+  P ++   +N  S FM++   S+ +SYGV+ NSFYELE  YA+HY+  LGRRAW
Sbjct  188   TRNQLPDPAKQDMGDNDFSRFMKASDDSDLRSYGVVVNSFYELEHAYADHYRKALGRRAW  247

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
              +GP+SL NR+ EDKA RGK++++DE ECLKWL+SK P+SVVYICFGSVANF  +QL E+
Sbjct  248   HIGPVSLCNRNFEDKALRGKQASVDEQECLKWLNSKQPNSVVYICFGSVANFTSAQLMEI  307

Query  969   AMGIEDSGMDFVWVIRNKREEDNGSEK--WMPEGFEERTKGKGLIIRGWAPQVVILDHPA  1142
             AMG+E SG +F+WV+R  +      EK  W+PEGFE+R +GKGLIIRGWAPQV+ILDH A
Sbjct  308   AMGLEASGQNFIWVVRKNKNNGGEEEKEDWLPEGFEKRMEGKGLIIRGWAPQVLILDHEA  367

Query  1143  VGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD  1322
             VG FVTHCGWNS LEGV  GVP+VTWPV+AEQF NEK++ ++L+ G GVG ++W R+  D
Sbjct  368   VGGFVTHCGWNSILEGVTAGVPLVTWPVYAEQFYNEKIVNEVLKIGIGVGIQKWCRIVGD  427

Query  1323  GVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              VKREAI +A+ ++M+G+ +EEMRSRAK   + AK+A+
Sbjct  428   FVKREAIVKAVNEIMMGDRAEEMRSRAKAFGEMAKRAV  465



>ref|XP_006487031.1| PREDICTED: scopoletin glucosyltransferase-like [Citrus sinensis]
 gb|KDO59781.1| hypothetical protein CISIN_1g010093mg [Citrus sinensis]
Length=518

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/458 (59%), Positives = 354/458 (77%), Gaps = 6/458 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LHVFFFP MAHGHMIP +DMAKLFA+RGVKA++ITTPAN P  SK+V++  +LG +M+++
Sbjct  36    LHVFFFPFMAHGHMIPIVDMAKLFATRGVKASVITTPANAPYVSKSVERANELGIEMDVK  95

Query  261   LLEFPGVEVGLPESCQRLDQTPD--DDGL-PRFFKACAMlqppledllqelrpdCLVADM  431
              ++FP VE GLPE C+ LD   +  + GL  +FF A   LQ PLE LLQE +PDCLVAD 
Sbjct  96    TIKFPSVEAGLPEGCENLDAITNEVNKGLIVKFFGATMKLQEPLEQLLQEHKPDCLVADT  155

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FFPWAT+AAAKF IPRL+FHGTS  +LCA + L +Y+P   VSSDSE F +P+ P E+K+
Sbjct  156   FFPWATDAAAKFGIPRLVFHGTSFFSLCASNCLALYEPHKKVSSDSEPFVMPHFPGEIKL  215

Query  612   TKLQVSPFERSEV-ENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             T+ Q+  F + ++ +N  S  ++++  S+ +SYGV  NSFYELEP YA+HY+  LGRRAW
Sbjct  216   TRNQLPDFVKQDMGDNDFSRLLKAIDDSDLRSYGVAVNSFYELEPAYADHYRKALGRRAW  275

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
              +GP+SL NR+ EDKA RGK+++IDE ECLKWL+SK P+SVVY+CFGS+ANF  +QL E+
Sbjct  276   HIGPVSLCNRNFEDKALRGKQASIDELECLKWLNSKQPYSVVYVCFGSLANFTSAQLMEI  335

Query  969   AMGIEDSGMDFVWVIRNKREE--DNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPA  1142
             A G+E SG +F+WV+   + +  + G+E W+PEGFE+R +GKGLIIRGWAPQV+ILDH A
Sbjct  336   ATGLEASGRNFIWVVSKNKNDGGEGGNEDWLPEGFEKRMEGKGLIIRGWAPQVLILDHEA  395

Query  1143  VGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD  1322
             VG FVTHCGWNSTLE V  GVP+VTWPV AEQF NEK++ +IL+ G GVG ++W R+  D
Sbjct  396   VGGFVTHCGWNSTLEAVAAGVPLVTWPVAAEQFYNEKMVNEILKIGVGVGIQKWCRIVGD  455

Query  1323  GVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              VKRE I +A+ ++M+G+ +EEMRSRAK +   AK+A+
Sbjct  456   FVKRETIEKAVNEIMVGDRAEEMRSRAKALGKMAKRAV  493



>dbj|BAJ11652.1| glucosyltransferase [Sinningia cardinalis]
Length=478

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/456 (58%), Positives = 345/456 (76%), Gaps = 6/456 (1%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             MG LH+ F P MAHGHMIP LDMAKLF S GVK TII+TPA    F++ V +  + G  +
Sbjct  1     MGQLHIVFLPFMAHGHMIPMLDMAKLFNSCGVKTTIISTPA----FAEPVRRAQESGIDI  56

Query  252   EIRLLEFPGVEVGLPESCQRLDQT-PDDDGLPRFFKACAMlqppledllqelrpdCLVAD  428
              +  ++FP     LP++   LDQT   +D +  F KA  +LQ P+E LL+E  P+CLV+D
Sbjct  57    GLSTIKFPPEGSDLPDNFVSLDQTMATEDLISNFVKALDLLQEPVEKLLEEFNPNCLVSD  116

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             MF PW T++AAK  IPRL+FHG S  ALCAM  ++ +KP+ +VSSDSE F +PNLPH+LK
Sbjct  117   MFLPWTTDSAAKLGIPRLVFHGVSTFALCAMEQMKRHKPYKNVSSDSEPFILPNLPHQLK  176

Query  609   ITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
              T+ QVS  E  E EN  S+ ++ +R +EE+SYGV+ NSFY+LE DYA+HY+  LGRRAW
Sbjct  177   FTRTQVSQHELEETENDFSKLLKQMREAEERSYGVVINSFYDLESDYADHYRKALGRRAW  236

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
              +GPL   N    DK +RGKKSAIDEHECL WLDSK P+SVVY+CFGS+A F  +QLHE 
Sbjct  237   LIGPLLFRNSGNVDKTQRGKKSAIDEHECLAWLDSKKPNSVVYMCFGSMARFTAAQLHET  296

Query  969   AMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVG  1148
             A+G+E SG DF+WV+R  + ED  +E W+PEGFEERTKG+GLIIRGWAPQ++ILDHP++G
Sbjct  297   AVGLEASGQDFIWVVRKGKNEDE-NEDWLPEGFEERTKGRGLIIRGWAPQLLILDHPSIG  355

Query  1149  AFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGV  1328
             AFVTHCGWNSTLEGVC GVPMVTWP+FAEQF NEKL+T++L+ G  VG+++W R  S+GV
Sbjct  356   AFVTHCGWNSTLEGVCAGVPMVTWPIFAEQFFNEKLVTEVLKIGVSVGNRQWCRRASEGV  415

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
               +A+A A++ VM+GE++ EMR+RAK  ++ A+KA+
Sbjct  416   PSKAVATAVQAVMVGEKALEMRNRAKSYQELARKAV  451



>ref|XP_007200989.1| hypothetical protein PRUPE_ppa004972mg [Prunus persica]
 gb|EMJ02188.1| hypothetical protein PRUPE_ppa004972mg [Prunus persica]
Length=483

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/456 (58%), Positives = 344/456 (75%), Gaps = 3/456 (1%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAV--DKYTQLGFQM  251
             + H+F  P MA+GHMIP  DMAKLFA++GVK TIITTP N P FSKA    K      ++
Sbjct  7     EFHIFLLPFMAYGHMIPVSDMAKLFAAQGVKTTIITTPLNAPTFSKATRSSKTNSGRIEV  66

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
             +I+ ++FP  E GLPE C+ LD  P  +    F KA  +LQ PLE LL E +P CLVADM
Sbjct  67    QIKTIKFPSQEAGLPEGCENLDSLPTPEFANNFSKALGLLQEPLERLLLEDQPSCLVADM  126

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FFPWAT+AAAKF IPRL+FHGTS   L A   +R Y+PF ++SSDSE F IPNLP E+K+
Sbjct  127   FFPWATDAAAKFGIPRLLFHGTSFFTLAASDCVRRYQPFKNMSSDSEPFVIPNLPGEIKM  186

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             T+ QV  F +  +EN  ++ M+    SE  SYG + NSFYELEP YA++Y+ +LGR+AW 
Sbjct  187   TRAQVPDFLKENIENDFTQLMKQAHDSEVGSYGTVVNSFYELEPVYADYYRKLLGRKAWH  246

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GPLSL NRD E+K+ RGK+ +IDEHECLKWL+SK P+SVVY+CFGS+A F+ SQL E+A
Sbjct  247   IGPLSLCNRDNEEKSYRGKEVSIDEHECLKWLNSKKPNSVVYVCFGSMARFSNSQLKEIA  306

Query  972   MGIEDSGMDFVWVI-RNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVG  1148
              G+E + ++F+WV+ R K ++D G E W+PEGFEER +GKGLIIRGWAPQV+ILDH AVG
Sbjct  307   AGLEATRLEFIWVVRRGKNDDDVGKEDWLPEGFEERMEGKGLIIRGWAPQVLILDHGAVG  366

Query  1149  AFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGV  1328
              FVTHCGWNSTLEG+  G+PMVTWP+ AEQF N+KL+T +L+ G GVG ++W R++ D V
Sbjct  367   GFVTHCGWNSTLEGIAAGLPMVTWPLSAEQFYNDKLVTQVLKIGVGVGDQKWVRVEGDSV  426

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             KREAI +A+ ++M+GEE+EEMRSR+K + ++A+  I
Sbjct  427   KREAIEKAVTQIMVGEEAEEMRSRSKGLAEQARGVI  462



>ref|XP_008245758.1| PREDICTED: scopoletin glucosyltransferase-like [Prunus mume]
Length=486

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/458 (59%), Positives = 346/458 (76%), Gaps = 6/458 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAV----DKYTQLGFQ  248
              HVF FP MAHGHMIP  DMAKL A++GV+ TIITTP N P FSKA           G +
Sbjct  8     FHVFLFPFMAHGHMIPVSDMAKLLAAQGVETTIITTPLNAPTFSKATRSRKTNSGSCGIE  67

Query  249   MEIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVAD  428
             ++I+ ++FP  E GLPE C+  D  P  +    FFKA  +LQ PLE LL E +P CLVAD
Sbjct  68    IKIKTIKFPSQEAGLPEGCENPDSLPTPELASNFFKAVGLLQAPLEQLLLEDQPTCLVAD  127

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             MFFPWAT+AAAKF IPRL+FHGTS  +L A   +R Y+PF + SSDSE F IPN P E+K
Sbjct  128   MFFPWATDAAAKFGIPRLVFHGTSFFSLAASDCVRRYEPFKNTSSDSEPFVIPNFPGEIK  187

Query  609   ITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             +T+ QV  F +  +EN ++  +   + +E +SYG++ NSFYELE  YA++++ VLGR+AW
Sbjct  188   MTRAQVPDFVKYNIENDLTPLIEQAKEAEVRSYGIVVNSFYELESVYADYFRKVLGRKAW  247

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
              +GPLSL NRD E+KA RGK+++IDEHECLKWLDSK P+SVVY+CFGSVA F  SQL E+
Sbjct  248   HIGPLSLCNRDNEEKAYRGKEASIDEHECLKWLDSKKPNSVVYVCFGSVAKFNNSQLKEI  307

Query  969   AMGIEDSGMDFVWVIRNKREE-DNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAV  1145
             A+G+E SG++F+WV+R  +++ D G E W+PEGFEE  +GKGLIIRGWAPQV+ILDH AV
Sbjct  308   AIGLEASGVEFIWVVRKGKDDCDVGKEDWLPEGFEEMMEGKGLIIRGWAPQVLILDHAAV  367

Query  1146  GAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEW-KRLDSD  1322
             GAFVTHCGWNSTLEG+  G+PMVTWPV AEQF NEKL+T +L+ G GVG+++W  ++  D
Sbjct  368   GAFVTHCGWNSTLEGIAAGLPMVTWPVSAEQFYNEKLVTQVLKIGVGVGAQKWCIKVVGD  427

Query  1323  GVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              VKREAI +A+ ++M+GEE+EEMRSRAK +  +A++AI
Sbjct  428   IVKREAIEKAVTQIMVGEEAEEMRSRAKGLAKQARRAI  465



>gb|KDO59783.1| hypothetical protein CISIN_1g046605mg [Citrus sinensis]
Length=487

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/458 (58%), Positives = 354/458 (77%), Gaps = 6/458 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FFFP +AHGHMIPT+DMAKLF +RGVKA++ITTP N P  S+++ K ++LG +++++
Sbjct  8     LHIFFFPFLAHGHMIPTVDMAKLFTTRGVKASVITTPGNAPHLSRSIQKASELGIELDVK  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDD---DGLPRFFKACAMlqppledllqelrpdCLVADM  431
             +++FP  E GLPE  + LD   ++   + + +F+ A   LQ PLE LLQE +PDCLVADM
Sbjct  68    IIKFPSAEAGLPEGWENLDAITNEVNRELIVKFYMATTKLQKPLEQLLQEHKPDCLVADM  127

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FFPWAT+AAAKF IPRL+FHGTS  +LCA+  L +Y+P   VSSDSE F +PNLP E+K+
Sbjct  128   FFPWATDAAAKFGIPRLVFHGTSFFSLCAIKCLALYEPHKKVSSDSEPFVMPNLPGEIKL  187

Query  612   TKLQV-SPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             T+ Q+  P ++   +N  S FM++   S+ +SYGV+ NSFYELE  YA+HY+  LGRRAW
Sbjct  188   TRNQLPDPAKQDMGDNDFSRFMKASDDSDLRSYGVVVNSFYELEHAYADHYRKALGRRAW  247

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
              +GP+SL NR+ EDKA RGK++++DE ECLKWL+SK P+SVVYICFGSVANF  +QL E+
Sbjct  248   HIGPVSLCNRNFEDKALRGKQASVDEQECLKWLNSKQPNSVVYICFGSVANFTSAQLMEI  307

Query  969   AMGIEDSGMDFVWVIRNKREEDNGSEK--WMPEGFEERTKGKGLIIRGWAPQVVILDHPA  1142
             AMG+E SG +F+WV+R  +      EK  W+PEGFE+R +GKGLIIRGWAPQV+ILDH A
Sbjct  308   AMGLEASGQNFIWVVRKNKNNGGEEEKEDWLPEGFEKRMEGKGLIIRGWAPQVLILDHEA  367

Query  1143  VGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD  1322
             VG FVTHCGWNS LEGV  GVP+VTWPV+AEQF NEK++ ++L+ G GVG ++W R+  D
Sbjct  368   VGGFVTHCGWNSILEGVTAGVPLVTWPVYAEQFYNEKIVNEVLKIGIGVGIQKWCRIVGD  427

Query  1323  GVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              VKREAI +A+ ++M+G+ +EEMRSRAK   + AK+A+
Sbjct  428   FVKREAIVKAVNEIMMGDRAEEMRSRAKAFGEMAKRAV  465



>ref|XP_002518724.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43649.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=486

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/457 (59%), Positives = 344/457 (75%), Gaps = 6/457 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FFFP MAHGH+IPT+DMAKLFASRGVK+T+ITTP N    SK + +    GF ++IR
Sbjct  9     LHIFFFPFMAHGHIIPTIDMAKLFASRGVKSTVITTPLNAKTISKTIQRTKNSGFDIDIR  68

Query  261   LLEFPGVEVGLPESCQRLD----QTPDDDGLPRFFKACAMlqppledllqelrpdCLVAD  428
             +LEFP  E GLPE C+ +D         D + +FF+A A LQ PLE+LL E +PDCLVAD
Sbjct  69    ILEFPA-EAGLPEGCENMDVIISHQDGKDLVMKFFRAIARLQQPLENLLGECKPDCLVAD  127

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             MFFPW T+AAAKF IPRL+FHG +  +LC    +++Y+P   VSSDSE F IP LP E+K
Sbjct  128   MFFPWTTDAAAKFGIPRLVFHGINFFSLCTGECIKLYEPHKKVSSDSEPFVIPYLPGEIK  187

Query  609   ITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
              T+ Q+  F R + EN   + +++V+ SE KSYGVI NSFYELE  YA+ Y+  LGRRAW
Sbjct  188   YTRKQLPDFLRQQEENDFLKMVKAVKESELKSYGVIVNSFYELESVYADFYRKELGRRAW  247

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
              +GPLSL N  +EDK +RG+++ IDEHEC KWLDSK P+S++YICFGS+ANF  SQL E+
Sbjct  248   HIGPLSLCNSGIEDKTQRGREATIDEHECTKWLDSKKPNSIIYICFGSLANFTASQLMEL  307

Query  969   AMGIEDSGMDFVWVI-RNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAV  1145
             A+G+E SG  F+WV+ RNK+ ++   E+W+P+GFEER +GKG+IIRGWAPQV+ILDH A+
Sbjct  308   AVGLEASGQQFIWVVRRNKKSQEEDDEEWLPKGFEERMEGKGMIIRGWAPQVLILDHEAI  367

Query  1146  GAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDG  1325
             G FVTHCGWNSTLEG+  G PMVTWP+ AEQF NEKL+T+IL+ GTGVG KEW +   D 
Sbjct  368   GGFVTHCGWNSTLEGITAGKPMVTWPISAEQFYNEKLVTEILKIGTGVGVKEWVKFHGDH  427

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             V  EA+ +AI ++M GEE+EEMRSRAK + + A  A+
Sbjct  428   VTSEAVEKAINRIMTGEEAEEMRSRAKKLAEMAGHAV  464



>ref|XP_004304714.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Fragaria vesca subsp. vesca]
Length=477

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/452 (57%), Positives = 348/452 (77%), Gaps = 6/452 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             +H+F FP MAHGHMIP  DMAKLFAS GVK TI+TTP N   F++         F ++I+
Sbjct  9     VHIFLFPFMAHGHMIPVSDMAKLFASHGVKITIVTTPLNAIRFAQTTQSSK---FNIQIK  65

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              +EFP  E GLP+ C+ +D  P  + +  FFKA  +LQP  E+LL+E++P C+VADMFFP
Sbjct  66    AIEFPSEEAGLPKGCENVDTLPSPNLVNPFFKATRLLQPQFEELLKEVKPTCIVADMFFP  125

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT AAAKF IPRL+FHGTS  A+CA   ++VY+P+N +SSD+E F IP LP E+++T+ 
Sbjct  126   WATEAAAKFGIPRLVFHGTSFFAMCASDCVKVYEPYNKISSDTEPFVIPYLPGEIELTRA  185

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+  F ++ V N +++ ++  R +E KS+G+I NSFYELEP YA+ Y+N LGR+AW +GP
Sbjct  186   QLPDFIKNNVLNDVTQLLKEAREAELKSFGIIMNSFYELEPVYADFYRNELGRKAWHIGP  245

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             +SL NR+ E+K +RGK++ IDEHECLKWLDSK P SVVY+CFGSVA+F  +QL E+AM +
Sbjct  246   VSLCNRETEEKVQRGKEATIDEHECLKWLDSKKPDSVVYVCFGSVADFNSTQLKEIAMAL  305

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E +G DF+WV+R  ++E    ++W+PEGFEER +GKGLIIRGWAPQV+ILDHP+VG FVT
Sbjct  306   EAAGQDFIWVVRKGKDE---MDEWLPEGFEERMEGKGLIIRGWAPQVLILDHPSVGGFVT  362

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLEG+  G+PMVTWPV AEQF NEKL+T +L+ G GVG+++W RL  D VK+EA
Sbjct  363   HCGWNSTLEGISAGLPMVTWPVSAEQFYNEKLVTQVLKIGVGVGTQKWVRLFGDSVKKEA  422

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + +A+ ++M+GEE+EE RSRA+ +  +A++A+
Sbjct  423   VVKAVSQIMVGEEAEERRSRARELGKQARRAV  454



>gb|AFK79039.1| glycosyltransferase UGT7 [Bupleurum chinense]
Length=474

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/456 (59%), Positives = 337/456 (74%), Gaps = 5/456 (1%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             M +L VFFFP MA GHMIP LDMAKLFASRGV +TIITTP N P F+K V+K    GF M
Sbjct  1     MVELEVFFFPAMAPGHMIPILDMAKLFASRGVHSTIITTPLNAPAFAKGVEKSNDSGFHM  60

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
              I+++EFP V  GLPE C+  DQ      LP F +A  ML+  +E LL E RP+CLVADM
Sbjct  61    SIKIVEFPKVS-GLPEDCENADQITSPAMLPLFIRATMMLEEQVEQLLGEYRPNCLVADM  119

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FFPWA ++AAKFDIP LIFHGTS  A CA   +R+++PF ++ ++S+ F IPNLPH++K+
Sbjct  120   FFPWAVDSAAKFDIPTLIFHGTSFFASCANEQVRLHEPFKNLKNESDDFIIPNLPHKVKL  179

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
                Q+ P    E +   ++ + + + SE KS GVI NSFYELEPDYA+HY+NVL RRAW 
Sbjct  180   CLGQIPPQHHQEKDTVFAKMLIAAKESEMKSNGVIVNSFYELEPDYADHYRNVLNRRAWH  239

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GPLSL NR  E+KA+RGK S  +  ECLKWLDSK+P SV+YICFGSV+ F   QLHE+A
Sbjct  240   IGPLSLCNRTFEEKAQRGKLSTANGDECLKWLDSKSPDSVLYICFGSVSKFPSHQLHEIA  299

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             MG+E SG  F+WV+   R+ D  SE WMPEGFE+R KGKGLIIRGWAPQV++LDH  +G 
Sbjct  300   MGLEASGQQFIWVV---RKSDEKSEDWMPEGFEKRMKGKGLIIRGWAPQVLLLDHETIGG  356

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDG-V  1328
             FVTHCGWNSTLEG+  GVPMVTWP FAEQF NEKL+TD+LR G  VG K+W  L   G +
Sbjct  357   FVTHCGWNSTLEGISAGVPMVTWPSFAEQFYNEKLITDVLRIGVSVGVKKWVILSGHGNI  416

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             KR+A+  A++ +M+G+E+EE R R K +K+ A+KA+
Sbjct  417   KRDAVESAVRSIMVGDEAEERRKRCKKLKEMARKAV  452



>emb|CAN65903.1| hypothetical protein VITISV_004870 [Vitis vinifera]
Length=482

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/475 (58%), Positives = 362/475 (76%), Gaps = 1/475 (0%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LHV FFP MA GHMIPT+DMAKLF++RGV+ATIITTP N PV SK +++   LG Q+ +R
Sbjct  8     LHVLFFPFMALGHMIPTIDMAKLFSARGVRATIITTPLNAPVVSKTMERGHYLGAQIGLR  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
             +++FP V+ GLP+  + LDQ    +   +FF A ++ Q PLE LLQE RP  LVAD FFP
Sbjct  68    VIQFPSVQAGLPQGLENLDQDASPEIRLKFFLAMSLFQQPLEQLLQEYRPHGLVADAFFP  127

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WA + A+KF IPRL F GT   A+CA+ SL  +KP+  V SD+E F +P+LP E+K+T+L
Sbjct  128   WALDVASKFGIPRLAFQGTGFFAMCALQSLTAHKPYKGVGSDTEPFLLPDLPDEIKLTRL  187

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+S      +EN  + F +  R SEE+SYG I N+FYELEP YAEH++ VLGR+AW +GP
Sbjct  188   QISNDLTLGLENDFTRFFKEARESEERSYGTIVNTFYELEPAYAEHWRKVLGRKAWHIGP  247

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             +SL NRD +DK +RGK ++IDE ECLKWL+SKNP SV+Y+CFGSV+ F  +QL E+AMG+
Sbjct  248   VSLCNRDAQDKTQRGKAASIDEDECLKWLNSKNPDSVIYVCFGSVSKFPAAQLLEIAMGL  307

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG  F+WV+R  ++E +  E+W+P+G+E+R +GKGLIIRGWAPQ +ILDH AVG FVT
Sbjct  308   EASGQQFIWVVRKNKDEGD-EEEWLPQGYEKRMEGKGLIIRGWAPQTLILDHEAVGGFVT  366

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLEGV  GVPMVTWPVFA+QF NEKL+TD+L+ G GVG++ W     D VK++A
Sbjct  367   HCGWNSTLEGVSAGVPMVTWPVFADQFYNEKLLTDVLKIGIGVGAQRWVPFVGDFVKQDA  426

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAIeeggssylglsslldelRAYHAK  1505
             I +A+K VM GE++EE+RSRAK +   A++AIE+GGSSY  + +L++EL+ YHA+
Sbjct  427   IEKAVKAVMAGEKAEELRSRAKSLGGMARRAIEKGGSSYTDMDALIEELKLYHAQ  481



>ref|XP_002518725.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43650.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=483

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/455 (59%), Positives = 348/455 (76%), Gaps = 6/455 (1%)
 Frame = +3

Query  84    HVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIRL  263
             H+FFFP MAHGHMIPT+DMAKLFASRG+K TI+TTP N+   SK + +   LG ++ I++
Sbjct  9     HIFFFPFMAHGHMIPTVDMAKLFASRGLKTTIVTTPLNESFISKPIQRTKNLGLEINIKI  68

Query  264   LEFPGVEVGLPESCQRLD----QTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
             L+FP VE GLPE C+ LD    Q  D + + +F KA A+LQ PLE LL   RPDCLVADM
Sbjct  69    LKFPTVEAGLPEGCENLDFITSQNMDMEIVNKFLKAIALLQEPLEKLLSACRPDCLVADM  128

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FFPWAT A++KF IPRL+FHGTS  +LCA  S+ +++P   V+SDSE F +PNLP ++K+
Sbjct  129   FFPWATEASSKFRIPRLVFHGTSFFSLCATISVVLHEPHKKVASDSEPFIVPNLPGDIKL  188

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             +  Q+  F R E  + +++FM +   SE  S+GV+ NSFYELEP YA+HYKNVLGRRAW 
Sbjct  189   SGQQLPGFMR-EDGSYVAKFMEASIKSELTSFGVLANSFYELEPTYADHYKNVLGRRAWH  247

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GP+SL NRD+EDKA RGK+++IDEHECLKWL+SK P+SVVY+CFG++ANF  SQL E+A
Sbjct  248   IGPVSLCNRDMEDKARRGKEASIDEHECLKWLNSKKPNSVVYLCFGTIANFTASQLKEIA  307

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             M +E SG +F+WV+R  +  +  ++ W+PEGFEER +GKGLIIRGWAPQV+ILDH A+G 
Sbjct  308   MALESSGQEFIWVVRKNKNPEEDNQDWLPEGFEERIEGKGLIIRGWAPQVMILDHEALGG  367

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLEG+  GVPMVTWPV AEQF NEKL+T++L+ G  VG + W  +  D +K
Sbjct  368   FVTHCGWNSTLEGIAAGVPMVTWPVGAEQFYNEKLVTEVLKIGVSVGVQHWT-VYGDSIK  426

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             RE I +AI ++M G E+EEMRS+ K +   A++A+
Sbjct  427   RECIEKAIIRIMEGAEAEEMRSKTKKLGKMAREAV  461



>ref|XP_006346390.1| PREDICTED: scopoletin glucosyltransferase-like [Solanum tuberosum]
Length=467

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/453 (58%), Positives = 344/453 (76%), Gaps = 14/453 (3%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH+FFFPMMAHGH+IPTLDMAKLF SRG KATIITTP N P+F ++++K   LG ++ +
Sbjct  5     QLHIFFFPMMAHGHIIPTLDMAKLFVSRGAKATIITTPLNLPIFIQSIEKIKHLGLEIYV  64

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
             + + FP VE GLPE C+R+DQ    D +P+FFKA  MLQ  LE LL E +P+ LVADMFF
Sbjct  65    KAIRFPAVEAGLPEGCERMDQLNSYDLVPKFFKATTMLQEQLELLLHECQPNALVADMFF  124

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWAT +AAKF IPRL+FHG    ALCA  +LR YKP  +V SD+E F +PNLPH++K+T+
Sbjct  125   PWATESAAKFHIPRLVFHGMGFFALCASENLRHYKPQKNVCSDTEPFVLPNLPHKVKLTR  184

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
             ++++P++R E E  M++F+  V+ SE  S+GVI NSFYELEPDYA++Y+ VLG+RAW +G
Sbjct  185   MKLAPYDREETE--MTKFIEQVKESESTSFGVIVNSFYELEPDYADYYRKVLGKRAWHIG  242

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             P+ L NR  E+K  +       +HECL+WLD+K  +SV+Y+CFGS++NF  SQ+ E+A+G
Sbjct  243   PILLCNRKNEEKFHKSVDH--KQHECLQWLDTKKQNSVIYVCFGSMSNFTDSQIEEIALG  300

Query  978   IEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             +E S  +F+WV+R  +         +PEGFEERTK KGLIIRGWAPQV+ILDH A+GAFV
Sbjct  301   LEASEQEFIWVVRKGK---------IPEGFEERTKEKGLIIRGWAPQVLILDHKAIGAFV  351

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKRE  1337
             THCGWNSTLE V  GVP+VTWP+FAEQF NE+L+T +L+ G  VG++EW  +  D VK E
Sbjct  352   THCGWNSTLESVSAGVPLVTWPMFAEQFFNEQLITKVLKIGVAVGAEEWS-IVVDNVKSE  410

Query  1338  AIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             AI +A+K+VM+GEES+EMR RAK +K  A KA+
Sbjct  411   AITKAVKRVMVGEESKEMRRRAKEVKKMANKAV  443



>ref|XP_004230760.1| PREDICTED: scopoletin glucosyltransferase-like [Solanum lycopersicum]
Length=466

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/452 (58%), Positives = 342/452 (76%), Gaps = 15/452 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FFFP+MAHGH+IPTLDMAKLF S G KATIITTP N P+F ++ +K   LG ++ ++
Sbjct  6     LHIFFFPLMAHGHIIPTLDMAKLFVSHGAKATIITTPLNLPIFVQSSEKIKHLGLEIYVK  65

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              + FP VE GLPE C+R+DQ   DD +P+FFKA  MLQ  LE LL E +P+ LVADMFFP
Sbjct  66    AIRFPAVEAGLPEGCERMDQLTSDDLVPKFFKATTMLQQQLELLLHECQPNALVADMFFP  125

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT +AAKFDIPRL+FHG    ALCA+ +LR YKP  +V SD+E F +PNLPH++K+T++
Sbjct  126   WATESAAKFDIPRLVFHGMGFFALCALENLRHYKPQKNVCSDTEPFVVPNLPHKVKLTRM  185

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             +++P++R E E  M++F+  V+GSE  S+GVI NSFYELEPDYA++Y+ VLG+R+W VGP
Sbjct  186   KLAPYDREETE--MTKFIEQVKGSEFTSFGVIVNSFYELEPDYADYYRKVLGKRSWHVGP  243

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
               L NR  E+K     KS    HECL+WLD+K  +SV+Y+CFGS++NF  SQ+ E+A+G+
Sbjct  244   FLLCNRKNEEKIH---KSDDKHHECLQWLDTKKQNSVIYVCFGSMSNFTDSQIEEIALGL  300

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E S  +F+WVIR  +         +PEGFEERTK KG IIRGWAPQ +ILDH A+GAF+T
Sbjct  301   EASEQEFIWVIRKGK---------IPEGFEERTKEKGFIIRGWAPQTLILDHEAIGAFLT  351

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLEGV  GVPMVTWP+FAEQF+NE+L+T +L+ G  VG++EW  +  D VK EA
Sbjct  352   HCGWNSTLEGVSAGVPMVTWPIFAEQFLNEQLITKVLQIGVAVGAEEWS-IVVDNVKSEA  410

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             I +A+K VM GEES EMR RA+ +K  A KA+
Sbjct  411   ITKAVKCVMAGEESMEMRRRAEEVKKMANKAV  442



>ref|XP_002282463.1| PREDICTED: scopoletin glucosyltransferase [Vitis vinifera]
Length=482

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/475 (57%), Positives = 361/475 (76%), Gaps = 1/475 (0%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LHV FFP MA GHMIPT+DMAKLF++RGV+ATIITTP N PV SK +++   LG Q+ +R
Sbjct  8     LHVLFFPFMALGHMIPTIDMAKLFSARGVRATIITTPLNAPVVSKTMERGHYLGAQIGLR  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
             +++FP V+ GLP+  + LDQ    +   +FF A ++ Q PLE LLQE RP  LVAD FFP
Sbjct  68    VIQFPSVQAGLPQGLENLDQDASPEIRLKFFLAMSLFQQPLEQLLQEYRPHGLVADAFFP  127

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WA + A+KF IPRL F GT   A+CA+ SL  +KP+  V SD+E F +P+LP E+K+T+L
Sbjct  128   WALDVASKFGIPRLAFQGTGFFAMCALQSLTAHKPYKGVGSDTEPFLLPDLPDEIKLTRL  187

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+S      +EN  + F +  R SEE+SYG I N+FYELEP YAEH++ VLGR+AW +GP
Sbjct  188   QISNDLTLGLENDFTRFFKEARESEERSYGTIVNTFYELEPAYAEHWRKVLGRKAWHIGP  247

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             +SL NRD +DK +RGK ++IDE ECLKWL+SK P SV+Y+CFGSV+ F  +QL E+AMG+
Sbjct  248   VSLCNRDAQDKTQRGKAASIDEDECLKWLNSKYPDSVIYVCFGSVSKFPAAQLLEIAMGL  307

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG  F+WV+R  ++E +  E+W+P+G+E+R +GKGLIIRGWAPQ +ILDH AVG FVT
Sbjct  308   EASGQQFIWVVRKNKDEGD-EEEWLPQGYEKRMEGKGLIIRGWAPQTLILDHEAVGGFVT  366

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLEGV  GVPMVTWPVFA+QF NEKL+TD+L+ G GVG++ W     D VK++A
Sbjct  367   HCGWNSTLEGVSAGVPMVTWPVFADQFYNEKLLTDVLKIGIGVGAQRWVPFVGDFVKQDA  426

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAIeeggssylglsslldelRAYHAK  1505
             I +A+K VM GE++EE+RSRAK +   A++AIE+GGSSY  + +L++EL+ YHA+
Sbjct  427   IEKAVKAVMAGEKAEELRSRAKSLGGMARRAIEKGGSSYTDMDALIEELKLYHAQ  481



>gb|KDP24999.1| hypothetical protein JCGZ_23982 [Jatropha curcas]
Length=469

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/448 (60%), Positives = 345/448 (77%), Gaps = 5/448 (1%)
 Frame = +3

Query  105   MAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIRLLEFPGVE  284
             M+HGHMIP +DMAKLFA RG K T++TTP+N P+ SK + +   LGF   IR+LEFP VE
Sbjct  1     MSHGHMIPAVDMAKLFAFRGHKTTVVTTPSNAPLISKTIQRTKDLGFDTNIRILEFPSVE  60

Query  285   VGLPESCQRLDQT---PDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFPWATNA  455
              GLPE C+ +D      +D+ + +F  A A LQ PLE LLQE RP+CLVADMFFPWAT+A
Sbjct  61    AGLPEGCENMDSINSYDNDNMMDKFLLATAKLQEPLEKLLQECRPNCLVADMFFPWATDA  120

Query  456   AAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKLQVSPF  635
             A+KF IPRL+FHGTS  +LCA  S+R+Y+P     SDSE F IP+LP E+KIT+ Q+   
Sbjct  121   ASKFAIPRLVFHGTSFFSLCAGESIRLYQPHRKFLSDSEPFVIPSLPGEIKITRKQLPSS  180

Query  636   ERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGPLSLYN  815
              R EVEN  ++ ++    SE KS+GV+ NSFYELE  YA+HY+NVLGR A  +GP+S+ N
Sbjct  181   FREEVENAFTKMIKESMESELKSFGVVVNSFYELEQAYADHYRNVLGRTARHIGPVSISN  240

Query  816   RDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGIEDSGM  995
             R +EDKA+RGK+++IDEHECLKWL+SK P+SV+YICFGS +NF+ SQL E+A+ +E +G 
Sbjct  241   RGMEDKAQRGKEASIDEHECLKWLNSKKPNSVIYICFGSSSNFSDSQLKEIAIALEAAGQ  300

Query  996   DFVWVI-RNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVTHCGW  1172
              F+WV+ RNK  E N  E+W+ EGFE++ +GKGLIIRGWAPQV+IL+H A+GAFVTHCGW
Sbjct  301   KFIWVVTRNKNSEGN-EEEWLAEGFEKKMEGKGLIIRGWAPQVLILEHEAIGAFVTHCGW  359

Query  1173  NSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREAIAEA  1352
             NSTLEGV  G PMVTWPVFAEQF NEKL+T++L+ G GVG+KE  RL  D +KREAI +A
Sbjct  360   NSTLEGVTSGKPMVTWPVFAEQFFNEKLVTEVLKIGIGVGAKEIVRLRGDYIKREAIEKA  419

Query  1353  IKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             I +VM GEE+EEMRSRA+   + A++AI
Sbjct  420   INRVMAGEEAEEMRSRARQCGEMARQAI  447



>ref|XP_006487030.1| PREDICTED: scopoletin glucosyltransferase-like [Citrus sinensis]
Length=490

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/458 (57%), Positives = 352/458 (77%), Gaps = 6/458 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LHVFFFP MAHGHMIP +DMAKLFASRGVKA++ITTPAN P  SK+V++  ++G +++++
Sbjct  8     LHVFFFPFMAHGHMIPIVDMAKLFASRGVKASVITTPANGPYVSKSVERANEMGIELDVK  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDD---DGLPRFFKACAMlqppledllqelrpdCLVADM  431
              ++FP VE GLPE C+ LD   ++   + + +F  A   LQ PLE LL++ +PDCLVAD+
Sbjct  68    TIKFPSVEAGLPEGCENLDAITNEVNKELIVKFVGATTKLQEPLEQLLRDHKPDCLVADI  127

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FFPWAT+AAAKF IPRL+FHGTS  +LCA + L +Y+P  +VSSDSE F +P+ P E+K+
Sbjct  128   FFPWATDAAAKFGIPRLVFHGTSFFSLCASNCLALYEPHKNVSSDSEPFVMPHFPGEIKL  187

Query  612   TKLQVSPFERSEV-ENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             T+ Q+  F + ++ +N  S  ++++  S+ +SYGV  NSFYELEP YA+HY+  LGRRAW
Sbjct  188   TRNQLPDFVKQDMGDNDFSRLLKAIDDSDLRSYGVAVNSFYELEPAYADHYRKALGRRAW  247

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
              +GP+SL NR+ EDKA  GK+++IDE ECL+WL+SK P+SVVYICFGS+ANF  +QL E+
Sbjct  248   HIGPVSLCNRNFEDKALWGKQASIDEQECLRWLNSKQPNSVVYICFGSIANFTSAQLMEI  307

Query  969   AMGIEDSGMDFVWVIRNKREEDNGSEK--WMPEGFEERTKGKGLIIRGWAPQVVILDHPA  1142
             A G+E S  +F+WV+R  + +    EK  W+PEGFE+R KGKGLIIRGWAPQV+ILDH A
Sbjct  308   ATGLEASRRNFIWVVRRNKNDGGEEEKEAWLPEGFEKRMKGKGLIIRGWAPQVLILDHEA  367

Query  1143  VGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD  1322
             VG FVTHCGWNST+E V  GVP+VTWPV AEQF NEK++ ++L+ G GVG ++W R+  D
Sbjct  368   VGGFVTHCGWNSTIEAVTAGVPLVTWPVSAEQFYNEKMVNEVLKIGVGVGIQKWCRIVGD  427

Query  1323  GVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              VKRE I +A+ ++M+G+ +EEMRSRAK +   AK+A+
Sbjct  428   FVKREKIEKAVNEIMVGDRAEEMRSRAKTLGKMAKRAV  465



>ref|XP_011000135.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=483

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/456 (58%), Positives = 335/456 (73%), Gaps = 6/456 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FFFP MAHGHMIPT+DMAKLFASRGVKATI+TTP N P+ S+ + +   LGF + I+
Sbjct  8     LHIFFFPFMAHGHMIPTIDMAKLFASRGVKATIVTTPLNAPLVSRTIQRSKGLGFDINIK  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDG----LPRFFKACAMlqppledllqelrpdCLVAD  428
              ++FP VEVGLPE C+  D     +        FF A AMLQ PLE LLQE  PDCL+AD
Sbjct  68    TIKFPAVEVGLPEGCENADSITSHETQGEMTKNFFMATAMLQQPLEKLLQECHPDCLIAD  127

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             MF PW T+AAAKF IPRL+FHG S  +LC    L  YKP+  VSSDSELF +P LP ++K
Sbjct  128   MFLPWTTDAAAKFGIPRLVFHGISCFSLCTSDCLNRYKPYKKVSSDSELFVVPELPGDIK  187

Query  609   ITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
              T  Q+  + +  VE   +  ++ VR S  KSYG++ NSFYELE DYA   K  LGR+AW
Sbjct  188   FTSKQLPDYMKQNVETDFTRLIQKVRESSLKSYGIVVNSFYELESDYANFLKE-LGRKAW  246

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
              +GP+SL NR+ EDKA+RGK+++IDEHECLKWLDSK P+SVVYICFG+VANF+ SQL E+
Sbjct  247   HIGPVSLCNREFEDKAQRGKEASIDEHECLKWLDSKKPNSVVYICFGTVANFSDSQLKEI  306

Query  969   AMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVG  1148
             A+ +E SG  F+WV+R K E+    E+W+PEGFE+R + KGLIIRGWAPQVVILDH AVG
Sbjct  307   AIALEASGQQFIWVVR-KDEKAKDKEEWLPEGFEKRMESKGLIIRGWAPQVVILDHEAVG  365

Query  1149  AFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGV  1328
              FVTHCGWNST+EG+  G PMVTWPV AEQF NEKL+TD+L+ G  VG ++W  +  D +
Sbjct  366   GFVTHCGWNSTMEGIAAGKPMVTWPVSAEQFFNEKLVTDVLKIGVAVGVQQWVTVYGDKI  425

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
                A+ +A+ ++M GEE++EMRSR + +   AK+AI
Sbjct  426   TSGAVEKAVTRIMTGEEAKEMRSRVEALGGMAKRAI  461



>ref|XP_002298733.1| hypothetical protein POPTR_0001s31130g [Populus trichocarpa]
 gb|EEE83538.1| hypothetical protein POPTR_0001s31130g [Populus trichocarpa]
Length=483

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/457 (58%), Positives = 339/457 (74%), Gaps = 8/457 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             +H+FFFP MAHGHMIPT+DMAKLFASRGVKATI+TTP N P+ S+ + +   LGF + I+
Sbjct  8     VHIFFFPFMAHGHMIPTIDMAKLFASRGVKATIVTTPLNAPLVSRTIQRSKGLGFDINIK  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDG----LPRFFKACAMlqppledllqelrpdCLVAD  428
              ++FP VEVGLPE C+  D     +       + F A AMLQ PLE LLQE  PDCL+AD
Sbjct  68    TIKFPAVEVGLPEGCENADSITSHETQGEMTKKLFMATAMLQQPLEKLLQECHPDCLIAD  127

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             MF PW T+AAAKF IPRL+FHG S  +LC    L  YKP+  VSSDSELF +P LP ++K
Sbjct  128   MFLPWTTDAAAKFGIPRLVFHGISCFSLCTSDCLNRYKPYKKVSSDSELFVVPELPGDIK  187

Query  609   ITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
              T  Q+  + +  VE   +  ++ VR S  KSYG++ NSFYELE DYA  +K  LGR+AW
Sbjct  188   FTSKQLPDYMKQNVETDFTRLIQKVRESSLKSYGIVVNSFYELESDYANFFKE-LGRKAW  246

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
              +GP+SL NR+ EDKA+RGK+++IDEHECLKWLDSK P+SVVYICFG+VANF+ SQL E+
Sbjct  247   HIGPVSLCNREFEDKAQRGKEASIDEHECLKWLDSKKPNSVVYICFGTVANFSDSQLKEI  306

Query  969   AMGIEDSGMDFVWVIR-NKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAV  1145
             A+ +E SG  F+WV+R +K+ +DN  E+W+PEGFE+R + KGLIIRGWAPQVVILDH A+
Sbjct  307   AIALEASGQQFIWVVRKDKKAKDN--EEWLPEGFEKRMESKGLIIRGWAPQVVILDHEAI  364

Query  1146  GAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDG  1325
             G FVTHCGWNST+EG+  G PMVTWPV AEQF NEKL+TD+L+ G  VG ++W  +  D 
Sbjct  365   GGFVTHCGWNSTIEGIAAGKPMVTWPVSAEQFFNEKLVTDVLKIGVAVGVQQWVTVYGDK  424

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             +   A+ +A+ ++M GEE++EMRSR + +   AK+AI
Sbjct  425   ITSGAVEKAVTRIMTGEEAKEMRSRVEALGGMAKRAI  461



>ref|XP_007042482.1| UDP-glucosyl transferase 73B3, putative [Theobroma cacao]
 gb|EOX98313.1| UDP-glucosyl transferase 73B3, putative [Theobroma cacao]
Length=485

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/458 (57%), Positives = 349/458 (76%), Gaps = 8/458 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             +H+FFFP+MA GH+IPT+DMAKLFA+RGVK TIITTPAN   FSK + +  + G  ++++
Sbjct  8     VHIFFFPIMAQGHVIPTVDMAKLFATRGVKTTIITTPANASFFSKTIQRSKESGLDVDVK  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDD-----DGLPRFFKACAMlqppledllqelrpdCLVA  425
             +L++   E GLPE C+  D  P       D + +FFKA  MLQ PLE LLQE +PDCLVA
Sbjct  68    ILKYSTEEAGLPEGCENADLLPTSRDEPKDIVSKFFKAKVMLQEPLERLLQECKPDCLVA  127

Query  426   DMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHEL  605
              MFFPWAT+AA KF IPRL+F+G S  + CAM  + +Y+P   V S+ E F +PNLP ++
Sbjct  128   HMFFPWATDAADKFGIPRLVFYGVSVFSTCAMECMTLYEPHKHVESEFEQFVVPNLPGDI  187

Query  606   KITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRA  785
             K++K Q+  + +  VE   ++ +++ + SE +SYGVIFNSFYELE  YA++YKNVLGR+A
Sbjct  188   KLSKKQLPDYVKESVETDFTKMLKASKESELRSYGVIFNSFYELEDMYADYYKNVLGRKA  247

Query  786   WSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHE  965
             W +GP+SL NR +EDKAERGKKSA+DEHEC KWLDS+ P+SVVY+CFGS+ANF  +QL E
Sbjct  248   WHIGPVSLCNRAIEDKAERGKKSAVDEHECSKWLDSRKPNSVVYVCFGSMANFNSAQLKE  307

Query  966   MAMGIEDSGMDFVWVIRNKREEDNGSEK-WMPEGFEERTKGKGLIIRGWAPQVVILDHPA  1142
             +AMG+E SG  F+WV+R  +E+ NG E+ W+PEGFE+R +GKGLIIRGWAPQ++ILDH A
Sbjct  308   IAMGLETSGQQFIWVVR--KEKSNGEEEDWLPEGFEKRMEGKGLIIRGWAPQILILDHEA  365

Query  1143  VGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD  1322
             VG FVTHCGWNSTLEG+  GVPM+TWPV AEQF NEK +T+IL+ G  VG ++W     D
Sbjct  366   VGGFVTHCGWNSTLEGISAGVPMITWPVSAEQFYNEKFVTEILKIGVAVGVQQWVSTVGD  425

Query  1323  GVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              VK+EAI +A+KK+M G+ ++E+R++AK + + AK A+
Sbjct  426   FVKKEAIEKAVKKIMNGKTAKELRNKAKALAEMAKGAV  463



>ref|XP_008354700.1| PREDICTED: scopoletin glucosyltransferase-like [Malus domestica]
Length=481

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/455 (57%), Positives = 338/455 (74%), Gaps = 2/455 (0%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVD--KYTQLGFQM  251
             D H+ FFP MAHGHMIP  DMAKLFAS+GVK TI+TTP N P FS A    K    G ++
Sbjct  7     DFHICFFPYMAHGHMIPISDMAKLFASQGVKTTIVTTPLNAPTFSXATQSSKTYSGGXEV  66

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
             +I+ ++FP VE GLPE C+ LD  P  +    F KA + LQ PLE LL E  P CLVAD+
Sbjct  67    KIKTIKFPSVEAGLPEGCENLDSLPSPELSTNFLKATSFLQEPLEQLLFEENPSCLVADV  126

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
              FPWAT+AAAKFDIPRLIFHGT   A+ A H +R Y+PF +  SDS+LF IP+ P E+ +
Sbjct  127   LFPWATDAAAKFDIPRLIFHGTGFFAMAASHVVRKYEPFKNTLSDSDLFVIPDFPGEITM  186

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             T+ QV       +EN ++  ++  + +E+ SYG++ NSFYELE  YA++Y+NVLG +AW 
Sbjct  187   TRAQVPDHVXENIENDLTRMLKRAKEAEKTSYGIVVNSFYELESVYADYYRNVLGMKAWH  246

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GP+SL  R+ E+KA RGK ++ +EH+ LKWLDSK P+SVVY+CFGS+A F  SQL E+A
Sbjct  247   IGPVSLCXRNNEEKALRGKTASXNEHDFLKWLDSKEPNSVVYVCFGSMAKFNASQLMEIA  306

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             MG+E SG DF+WV+R   E D   E W+PEGFE+R +GKGL+IRGWAPQV+ILDH AVG 
Sbjct  307   MGLEASGQDFIWVVRTGXEYDVEKEDWLPEGFEBRMEGKGLVIRGWAPQVLILDHGAVGG  366

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLEG+  G+PMVTWPV AEQF NEKL+T +L+ G GVG+++W  +  D VK
Sbjct  367   FVTHCGWNSTLEGIAAGLPMVTWPVSAEQFYNEKLVTQVLKIGVGVGAQKWVMVVGDSVK  426

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             +EA+ +A+ ++M+GEE++EMRSRA+ + ++AK+AI
Sbjct  427   KEAVEKAVXRIMVGEEADEMRSRARELAEQAKRAI  461



>gb|KDP25001.1| hypothetical protein JCGZ_23984 [Jatropha curcas]
Length=471

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/449 (59%), Positives = 343/449 (76%), Gaps = 5/449 (1%)
 Frame = +3

Query  105   MAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIRLLEFPGVE  284
             MAHGHMIPT+DMAKLFA RG KATIITTP+N+P+ SK + +   +GF + I++L+FP VE
Sbjct  1     MAHGHMIPTVDMAKLFAFRGHKATIITTPSNEPLISKTIQRTKDMGFDINIQILKFPSVE  60

Query  285   VGLPESCQRLDQTPD--DDGLP---RFFKACAMlqppledllqelrpdCLVADMFFPWAT  449
             VGLPE C  +D      ++G+    +F+ A   LQ PLE LLQE  P+CLVADMFFPW T
Sbjct  61    VGLPEGCDNIDFVLSLVENGMEMIIKFWLATGKLQEPLEKLLQECNPNCLVADMFFPWTT  120

Query  450   NAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKLQVS  629
             +AAAKF IPRL+FHGTS  +LCA  S+R+Y+P   VS+DSE F IP LP E+KIT+ Q+ 
Sbjct  121   DAAAKFGIPRLVFHGTSFFSLCAGESIRLYQPHKKVSTDSESFVIPGLPGEIKITRKQLP  180

Query  630   PFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGPLSL  809
              F R EV+N  ++ ++  + SE KS+GV+ NSFYELE  YA+HY+NVLGR+AW +GP+S+
Sbjct  181   SFVREEVQNDFTKIVKESKESELKSFGVVVNSFYELEQAYADHYRNVLGRKAWHIGPVSI  240

Query  810   YNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGIEDS  989
              NR +EDK +RGK+++IDEHECLKWL+SK P+SV+Y+CFGSV NF  SQL E+A+ +E +
Sbjct  241   CNRGMEDKTQRGKEASIDEHECLKWLNSKKPNSVIYLCFGSVTNFTDSQLKEIAIALEAA  300

Query  990   GMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVTHCG  1169
             G  F+WV+R  +  +   E+W+PEGFE++ +GKGLIIRGWAPQV+IL+H AVG FVTHCG
Sbjct  301   GQKFIWVVRRNKNSEENEEEWLPEGFEKKMEGKGLIIRGWAPQVLILEHEAVGGFVTHCG  360

Query  1170  WNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREAIAE  1349
             WNSTLEGV  G  MVTWPV AEQF NEKLMT++LR G GVG+KEW     D VK EAI  
Sbjct  361   WNSTLEGVSAGKAMVTWPVGAEQFYNEKLMTEVLRIGIGVGAKEWVGFHGDYVKSEAIET  420

Query  1350  AIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             AI +VM GEE+EEMRSRA+ + + A++ +
Sbjct  421   AISRVMEGEEAEEMRSRARRLGEMARQVV  449



>ref|XP_004304022.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Fragaria vesca subsp. vesca]
Length=477

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/454 (56%), Positives = 345/454 (76%), Gaps = 6/454 (1%)
 Frame = +3

Query  75    GDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQME  254
             G +H+F FP MAHGHMIP  D AKLFAS GVK TI+TTP N   F++         F ++
Sbjct  7     GSVHIFLFPFMAHGHMIPVSDTAKLFASYGVKITIVTTPLNAIRFAQTTQSSK---FNIQ  63

Query  255   IRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMF  434
             I+ +EFP  E GLP+ C+ +D  P  D +  FFKA  +LQP  E+LL+E +P C+VADM 
Sbjct  64    IKAIEFPSEEAGLPKGCENVDTLPSPDLVNPFFKATRLLQPQFEELLKEFKPTCIVADMV  123

Query  435   FPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKIT  614
             FPWAT AAAKF IPRL+F GTS  A+CA+  ++VY+P++ VSS++E F IP LP E+++T
Sbjct  124   FPWATEAAAKFGIPRLVFSGTSFFAMCALDCVKVYEPYSKVSSETEPFVIPYLPGEIELT  183

Query  615   KLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSV  794
             + Q+  F ++ V N +++ ++  R +E KS+G+I NSFYELEP YA+ Y+N LGR+AW +
Sbjct  184   RAQLPDFIKNNVLNDVTQLLKEAREAELKSFGIIMNSFYELEPVYADFYRNELGRKAWHI  243

Query  795   GPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAM  974
             GP+SL NR+ E+K +RGK++ IDEHECLKWLDSK P SVVY+CFGSVA+F  +QL E+AM
Sbjct  244   GPVSLCNRETEEKVQRGKEATIDEHECLKWLDSKKPDSVVYLCFGSVADFNSTQLKEIAM  303

Query  975   GIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAF  1154
              +E +G DF+WV+R  ++E    ++W+PEGFEER +GKGL+IRGWAPQV+ILDHP+VG F
Sbjct  304   ALEAAGQDFIWVVRKGKDE---VDEWLPEGFEERMEGKGLMIRGWAPQVLILDHPSVGGF  360

Query  1155  VTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKR  1334
             VTHCGWNSTLEG+  G+PMVTWP+ AEQF NEKL+  +L+ G GVG+++W RL  D VK+
Sbjct  361   VTHCGWNSTLEGISAGLPMVTWPLAAEQFYNEKLVAQVLKIGVGVGTQKWVRLFGDSVKK  420

Query  1335  EAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             EAI +A+ ++M+GEE+EE RSRA+ +  +A++A+
Sbjct  421   EAIVKAVSQIMVGEEAEERRSRARELGKQARRAV  454



>ref|XP_008358617.1| PREDICTED: scopoletin glucosyltransferase-like [Malus domestica]
Length=482

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/455 (55%), Positives = 344/455 (76%), Gaps = 2/455 (0%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVD--KYTQLGFQM  251
             + HVF FP MAHGH++P LD AKLFA++GV+ TI+TTP N   FSKA    +      ++
Sbjct  7     EFHVFLFPYMAHGHIVPILDXAKLFAAQGVRTTIVTTPLNASTFSKATQSSEINSGNVKV  66

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
             EI+ ++FP VE GLP+ C+ L+  P  +    F KA ++LQ PLE LL + +P  L+AD+
Sbjct  67    EIKTIKFPSVEAGLPDGCEYLNSLPSPELSTNFLKATSLLQEPLEQLLLDEKPSFLLADI  126

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
              FPWAT+AAAKFDIPRL+FHGTS  A  A +++  Y+PF + SSD E F IPN P E+ +
Sbjct  127   CFPWATDAAAKFDIPRLVFHGTSFFASAASYNMSKYEPFKNSSSDLEPFVIPNFPGEITM  186

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             T+ QV  F++  +EN ++  ++  + SE+ SYG++ NSFYELEP YA++Y+NVLGR+AW 
Sbjct  187   TRAQVPAFDKENIENDLTRLLKRAKESEQTSYGIVVNSFYELEPVYADYYRNVLGRKAWH  246

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GP+SL NR  E+KA RGK S+I+EH+CLKWLDSK P+SVVY+CFGS+A F  SQL E+A
Sbjct  247   IGPVSLCNRSNEEKALRGKASSINEHDCLKWLDSKEPNSVVYVCFGSMAKFNASQLKEIA  306

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             MG++ SG DF+WV+R  +++D   E W+PEGFE R  GKGLIIRGWAPQ++ILDH AVG 
Sbjct  307   MGLQASGQDFIWVVRRGQDDDMEKEDWLPEGFEHRMAGKGLIIRGWAPQLLILDHRAVGG  366

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLEG+  G+PMVTWPV AEQF NEKL+T +L+ G GVG+++W  L  D VK
Sbjct  367   FVTHCGWNSTLEGIAAGLPMVTWPVSAEQFYNEKLVTQVLKIGVGVGAQKWVSLVGDFVK  426

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             ++A+ +A++++M+GEE+++MRSRA  + ++AK+AI
Sbjct  427   KKAVDKAVRRIMVGEEAKQMRSRAWELAEQAKRAI  461



>ref|XP_006369760.1| hypothetical protein POPTR_0001s31090g [Populus trichocarpa]
 gb|ERP66329.1| hypothetical protein POPTR_0001s31090g [Populus trichocarpa]
Length=483

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/457 (57%), Positives = 337/457 (74%), Gaps = 8/457 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             +H+FFFP MAHGHMIPT+DMAKLFASRGVKATI+TTP N P+ S+ + +   LGF + I+
Sbjct  8     VHIFFFPFMAHGHMIPTIDMAKLFASRGVKATIVTTPLNAPLVSRTIQRSKGLGFDINIK  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDG----LPRFFKACAMlqppledllqelrpdCLVAD  428
              ++FP VEVGLPE C+  D     +       + F A  MLQ PLE LLQE  PDCL+AD
Sbjct  68    TIKFPAVEVGLPEGCENADSITSHETQGEMTKKVFMATTMLQQPLEKLLQECHPDCLIAD  127

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             MF PW T+AAAKF IPRL+FHG S  +LCA   L  YKP+  VSSDSELF +P LP ++K
Sbjct  128   MFLPWTTDAAAKFGIPRLVFHGISCFSLCASDCLNRYKPYKKVSSDSELFVVPELPGDIK  187

Query  609   ITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
              T  Q+  + +  VE   +  ++ VR S  KSYG++ NSFYELE DYA  +K  LGR+AW
Sbjct  188   FTSKQLPDYMKQNVETDFTRLIQKVRESSLKSYGIVVNSFYELESDYANFFKE-LGRKAW  246

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
              +GP+SL NR+ EDKA+RGK+++IDEHECLKWLDSK P+SVVYICFG+V  F+ SQL E+
Sbjct  247   HIGPVSLCNREFEDKAQRGKEASIDEHECLKWLDSKKPNSVVYICFGTVDKFSDSQLKEI  306

Query  969   AMGIEDSGMDFVWVIR-NKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAV  1145
             A+ +E SG  F+WV+R +K+ +DN  E+W+PEGFE+R + KGLIIRGWAPQVVILDH A+
Sbjct  307   AIALEASGQQFIWVVRKDKKAKDN--EEWLPEGFEKRMESKGLIIRGWAPQVVILDHEAI  364

Query  1146  GAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDG  1325
             G FVTHCGWNST+EG+  G PMVTWPV AEQF NEKL+TD+L+ G  VG ++W  +  D 
Sbjct  365   GGFVTHCGWNSTIEGIAAGKPMVTWPVSAEQFFNEKLVTDVLKIGVAVGVQQWVTVYGDK  424

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             +   A+ +A+ ++M GEE++EMRSR + +   AK+AI
Sbjct  425   IASGAVEKAVTRIMTGEEAKEMRSRVEALGGMAKRAI  461



>ref|XP_007042484.1| UDP-glucosyl transferase 73B3 [Theobroma cacao]
 gb|EOX98315.1| UDP-glucosyl transferase 73B3 [Theobroma cacao]
Length=483

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/453 (58%), Positives = 328/453 (72%), Gaps = 2/453 (0%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              L +FF P MAHGHMIP  D+  LFA++GVK TIITT  N P  SK  ++   LG+++ I
Sbjct  7     QLQIFFLPFMAHGHMIPFTDLVMLFAAKGVKTTIITTTLNVPHISKVTERAKSLGYEINI  66

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +  FP VE GLPE C+  DQ    D   +FF A  ML+ PL  LLQ  RPDCLVADMFF
Sbjct  67    LVTYFPSVEAGLPEGCESFDQASSPDMQFKFFTATTMLREPLAHLLQAHRPDCLVADMFF  126

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PW T+ AA F IPR++FHGT   +L A   +R+Y+P   VSSDSE F IPN P E+K+T+
Sbjct  127   PWVTDVAAAFGIPRIVFHGTCVFSLSATEHIRLYEPHKKVSSDSEPFVIPNFPGEIKLTR  186

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
              Q+  F R E     S+F    R +E K YGVI NSFYELE  YA+HY  VLGRRAW VG
Sbjct  187   SQMPDFVRQE--TGFSKFYSESRETELKCYGVIVNSFYELESAYADHYTKVLGRRAWHVG  244

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             P+SL NR   DK ERGKK+ ID++ECL WL+SK P+SVVYICFGSV NF  SQL E+A G
Sbjct  245   PISLRNRGTIDKTERGKKACIDDNECLAWLNSKKPNSVVYICFGSVTNFGSSQLLEIATG  304

Query  978   IEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             +E SG  F+WV+R +++ +   E W+PEGFE+R +GKGLIIRGWAPQV+ILDH A+G FV
Sbjct  305   LEASGQQFIWVVRKEKKNEEEKEDWLPEGFEKRMEGKGLIIRGWAPQVLILDHEAIGGFV  364

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKRE  1337
             THCGWNSTLE VC GVPMVTWPV AEQF NEKL+T ILR G GVG+++W RL  D VKRE
Sbjct  365   THCGWNSTLESVCAGVPMVTWPVAAEQFYNEKLLTQILRIGIGVGAQKWARLVGDFVKRE  424

Query  1338  AIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             AI +A++++++G++++EMRSRAK + +  +KA+
Sbjct  425   AIEKAVREIIVGDKADEMRSRAKALAESGRKAV  457



>ref|XP_008340172.1| PREDICTED: scopoletin glucosyltransferase-like [Malus domestica]
Length=481

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/455 (56%), Positives = 338/455 (74%), Gaps = 2/455 (0%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVD--KYTQLGFQM  251
             D H+ FFP MAHGHMIP  DMAKLFAS+GVK TI+TTP N P  SKA    K    G ++
Sbjct  7     DFHICFFPFMAHGHMIPISDMAKLFASQGVKTTIVTTPLNAPTLSKATQSSKTCSGGVEV  66

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
              I+ ++FP VE GLPE C+ +D  P  +    F+KA ++LQ PLE LL    P CLVAD 
Sbjct  67    RIKTIKFPSVEAGLPEGCEHVDSLPSPEFRSNFYKATSLLQEPLEHLLLHENPSCLVADF  126

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
              F WAT+AAAKFDIPRLIFHGTS  A+ A   +  Y+PF + S DS+ F IP+ P E+ +
Sbjct  127   LFHWATDAAAKFDIPRLIFHGTSFFAMAASDIVTKYEPFKNTSLDSDPFMIPDFPGEITM  186

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             T+ QV    +  +EN +   ++  + +E+ SYG++ NSFYELE  YA++Y+NVLG +AW 
Sbjct  187   TRAQVPDHVKENIENDLIRMVKRAKEAEKTSYGIVVNSFYELESAYADYYRNVLGMKAWH  246

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GP+SL NR+ E+KA RGK ++I+EH+ LKWL+SK P+SVVY+CFGSVA F  SQL E+A
Sbjct  247   IGPVSLCNRNNEEKALRGKAASINEHDFLKWLESKEPNSVVYVCFGSVAKFNASQLKEIA  306

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             MG+E SG DF+WV+R  +  D   E+W+PEGFE+R +GKGLIIRGWAPQV+ILDH AVG 
Sbjct  307   MGLEASGQDFMWVVRTGQGYDMEKEEWLPEGFEDRMEGKGLIIRGWAPQVLILDHGAVGG  366

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLEG+  G+PMVTWPV AEQF NEKL+T +L+ G GVG+++W R+  D VK
Sbjct  367   FVTHCGWNSTLEGIASGLPMVTWPVAAEQFYNEKLVTQVLKIGVGVGAQKWVRVVGDSVK  426

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             +EA+ +A++++M+G E++EMRSRA+ + ++AK+AI
Sbjct  427   KEAVEKAVRRIMVGVEAQEMRSRARELAEQAKRAI  461



>ref|XP_007011132.1| UDP-glucosyl transferase 73B3 [Theobroma cacao]
 gb|EOY19942.1| UDP-glucosyl transferase 73B3 [Theobroma cacao]
Length=482

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/453 (58%), Positives = 328/453 (72%), Gaps = 3/453 (1%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              L +FF P MAHGHMIP +D+A LFA++GVK TIITT  N P  SK  ++   LG+++ I
Sbjct  7     QLQIFFLPFMAHGHMIPFIDLAMLFAAKGVKTTIITTTLNVPHISKVTERAKNLGYEINI  66

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +  FP VE GLPE C+  DQ    D   +FF A  ML+ PL  LLQ  RPDCLVADMFF
Sbjct  67    LVTYFPSVEAGLPEGCESYDQASSPDMQFKFFTATTMLREPLAHLLQAHRPDCLVADMFF  126

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PW T+ AA F IPR++FHGT   +L A   +R+Y+P   VSSDSE F IPN P E+K+T+
Sbjct  127   PWVTDVAAAFGIPRIVFHGTCVFSLSATEHIRLYEPHKKVSSDSEPFVIPNFPGEIKLTR  186

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
              Q+  F R E     ++F    + +E K YGVI NSFYELE  YA+HY  VLGRRAW VG
Sbjct  187   SQMPDFVRQE--TGFTKFYSESKETELKCYGVIVNSFYELESAYADHYTKVLGRRAWHVG  244

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             P+SL N+   DK ERGKK+ IDE+ECL WL+SK P+SVVYICFGSV NF+ SQL E+A G
Sbjct  245   PISLRNKGTIDKTERGKKTCIDENECLAWLNSKKPNSVVYICFGSVTNFSSSQLLEIATG  304

Query  978   IEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             +E SG  F+WV+R K  ++   E W+PEGFE+R +GKGLIIRGWAPQV+ILDH A+G FV
Sbjct  305   LEASGQQFIWVVR-KEMKNEEKEDWLPEGFEKRMEGKGLIIRGWAPQVLILDHEAIGGFV  363

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKRE  1337
             THCGWNSTLE VC  VP+VTWPV AEQF NEKL+T ILR G GVG+++W RL  D VKRE
Sbjct  364   THCGWNSTLESVCASVPVVTWPVAAEQFYNEKLLTQILRIGIGVGAQKWARLVGDFVKRE  423

Query  1338  AIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             AI +A+ ++++G+ ++EMRSRAK + + A+KA+
Sbjct  424   AIEKAVTEIIVGDRADEMRSRAKALAESARKAV  456



>ref|XP_003518715.1| PREDICTED: scopoletin glucosyltransferase-like [Glycine max]
 gb|KHN12228.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Glycine soja]
Length=480

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/452 (57%), Positives = 341/452 (75%), Gaps = 2/452 (0%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FFFP   HGHMIPT+DMAKLFA +GVKATI+TTP N P FSKA+      G ++ I 
Sbjct  9     LHIFFFPFFGHGHMIPTVDMAKLFAEKGVKATIVTTPLNAPFFSKAIGNSKTNGNKIHIE  68

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              +EFP  E GLP  C+ +D  P  +    F  A  +LQ PLE LL + RPDC+VAD FFP
Sbjct  69    TIEFPCAEAGLPVGCENVDSIPSPNLFQAFIMATGLLQEPLEQLLLKQRPDCIVADFFFP  128

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             W T++AAKF IPRL+FHGT   + CA   + +Y+P+NDVSSDSE F IPNLP E+K+T++
Sbjct  129   WTTDSAAKFGIPRLVFHGTGFFSSCATTCMGLYEPYNDVSSDSESFVIPNLPGEIKMTRM  188

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+ PF + + +  +++ +   R SE + YGV+ NSFYELE  YA+H++NVLGR+AW +GP
Sbjct  189   QLPPFFKGKEKTGLAKLLVEARESESRCYGVVVNSFYELEKVYADHFRNVLGRKAWHIGP  248

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             L L N+D E+K  RGK+++IDEHECLKWLD+K P SVVY+CFGSVA F+ SQL E+A+G+
Sbjct  249   LFLCNKDTEEKVHRGKEASIDEHECLKWLDNKKPGSVVYVCFGSVAKFSDSQLREIAIGL  308

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG  F+WV++  REE    EKW+P+GFE+R +GKGLIIRGWAPQV+IL+H A+GAFVT
Sbjct  309   EASGQQFIWVVKKSREEKG--EKWLPDGFEKRMEGKGLIIRGWAPQVLILEHEAIGAFVT  366

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLE V  GVPMVTWP+ AEQF NEKL++++L+ G  VG+K+W RL+ D +  +A
Sbjct  367   HCGWNSTLEAVTAGVPMVTWPIAAEQFFNEKLLSEVLKIGVPVGAKKWLRLEGDSITWDA  426

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + +A+K++MI EE+ EMR+R KV+   AK+A+
Sbjct  427   VEKAVKRIMIEEEAIEMRNRTKVLSQLAKQAV  458



>gb|KDP25000.1| hypothetical protein JCGZ_23983 [Jatropha curcas]
Length=471

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/449 (59%), Positives = 342/449 (76%), Gaps = 5/449 (1%)
 Frame = +3

Query  105   MAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIRLLEFPGVE  284
             MAHGH IPT+DMAKLFA RG K TIITTP+N+P+ SK + +   LGF + I++L+FP VE
Sbjct  1     MAHGHTIPTVDMAKLFAFRGHKTTIITTPSNEPLISKTIQRTKDLGFVINIQILKFPSVE  60

Query  285   VGLPESCQRLDQTPD--DDG---LPRFFKACAMlqppledllqelrpdCLVADMFFPWAT  449
             VGLPE C+ +D      ++G   + +F  A   LQ PLE LLQE  P+CLVADMFFPWAT
Sbjct  61    VGLPEGCENIDFVLSLVENGTEMMNKFCLAIGKLQEPLEKLLQECNPNCLVADMFFPWAT  120

Query  450   NAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKLQVS  629
             +AAAKF IPRL+F GTS  +LCA  S+R+Y+P   VS+DS  F IP+LP E+KIT+ Q  
Sbjct  121   DAAAKFGIPRLVFQGTSFFSLCAGESIRLYQPHKKVSTDSASFVIPDLPGEIKITRKQFP  180

Query  630   PFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGPLSL  809
                R EV+N  ++ ++    SE KS+GV+ NSFYELE  YA+HY+NVLGR+AW +GP+S+
Sbjct  181   IIFREEVQNDFTKIVKESNESELKSFGVVVNSFYELEQAYADHYRNVLGRKAWHIGPVSI  240

Query  810   YNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGIEDS  989
              NR +EDKA+RGK+++IDE ECLKWL+SK P+SV+YI FGS+ NF  SQL E+A+ +E +
Sbjct  241   CNRGMEDKAQRGKEASIDEQECLKWLNSKKPNSVIYIRFGSITNFTDSQLKEIAIALETA  300

Query  990   GMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVTHCG  1169
             G  F+WV+R  +  +   E+W+PEGFE++ +GKGLIIRGWAPQV+IL+H AVG FVTHCG
Sbjct  301   GQKFIWVVRRNKNSEGHEEEWLPEGFEKKMEGKGLIIRGWAPQVLILEHDAVGGFVTHCG  360

Query  1170  WNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREAIAE  1349
             WNSTLEGV  G PMVTWPV AEQF NEKL+T++L+ G GVG+KEW  L  D VK EAI +
Sbjct  361   WNSTLEGVSAGKPMVTWPVGAEQFYNEKLVTEVLKIGIGVGAKEWDWLHGDYVKSEAIEK  420

Query  1350  AIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             AI++VM GEE+EEMRSRA+ + + A++A+
Sbjct  421   AIRRVMEGEEAEEMRSRARKLGEMARQAV  449



>gb|EYU42689.1| hypothetical protein MIMGU_mgv1a018398mg [Erythranthe guttata]
Length=477

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/455 (59%), Positives = 351/455 (77%), Gaps = 8/455 (2%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             MG LH+FFFPM+AHGHMIP LDMAKLF SRG++ TII+TPA    FS+ + K    G ++
Sbjct  1     MGKLHIFFFPMLAHGHMIPILDMAKLFTSRGLRTTIISTPA----FSQPIKKAQNSGIEI  56

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
              I+ +EFP  + GLP+    LDQ  DD+ +P F KA ++LQPPLE LLQE RPDCL++DM
Sbjct  57    GIQTIEFPPKDSGLPDHIVSLDQVTDDELIPNFVKALSLLQPPLEKLLQEFRPDCLISDM  116

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             F PW  ++AAKF IPRL+FHGTS+ AL A   +R +KPF +VSSD E F +PNLPHE+K+
Sbjct  117   FLPWTVDSAAKFGIPRLVFHGTSYFALSATEQMRRHKPFENVSSDLEPFIVPNLPHEVKL  176

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
              + QV  ++  E E+ + E M+ ++ S+ +SYGV+ N+FYELEPDYA+HY+NVLGR+AW+
Sbjct  177   VRTQVPEYDLEENESDLIELMKRMKESDGRSYGVVANTFYELEPDYADHYRNVLGRKAWN  236

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GPL L N +      RGKKSAID HEC+ WLDSK+P+SVVY+CFGS+A F PSQL E+A
Sbjct  237   IGPLFLCNGE-SKTVVRGKKSAIDIHECISWLDSKSPNSVVYVCFGSMAVFPPSQLREIA  295

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             +G+E+SG+DFVWV+   REE +  E+WMP GFE+R K +GLIIRGWAPQVVILDH A+G 
Sbjct  296   IGLENSGLDFVWVV---REEGSEIEEWMPLGFEDRVKNRGLIIRGWAPQVVILDHAAIGG  352

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLEG+CGGVP+VTWP+FAEQF NEKL+T++L  G  +G+ +W+R+ S GV 
Sbjct  353   FVTHCGWNSTLEGICGGVPVVTWPLFAEQFFNEKLVTEVLGIGVSIGNTKWERVSSGGVT  412

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
               A+A+A++ VM+GE + EMR RA   K+ A+KA+
Sbjct  413   AAAVAKAVEAVMVGESAAEMRRRAVSYKEMARKAV  447



>ref|XP_004505252.1| PREDICTED: UDP-glucosyl transferase 73B2-like [Cicer arietinum]
 gb|AGU14084.1| UDP-glycosyltransferase [Cicer arietinum]
Length=488

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/455 (57%), Positives = 358/455 (79%), Gaps = 8/455 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FFFP M HGHMIP++DMAKLFAS+GVKATI+TTP N+P+ +KA++++      ++I+
Sbjct  8     LHIFFFPFMGHGHMIPSIDMAKLFASKGVKATIVTTPLNKPLVTKAIEQFKTHSNNIDIQ  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
             +++FP VE GLPE C+ +D  P    +P FFKA  +LQ PLE LLQ+ +P+C+VADMFFP
Sbjct  68    IIKFPCVEGGLPEGCENVDSIPSPHLIPAFFKATWLLQEPLEQLLQQQKPNCIVADMFFP  127

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             W+T +AAKF IPR++FHGTS  +LCA   L +Y+PF +VSSD+ELF I NLP  +K+TKL
Sbjct  128   WSTASAAKFGIPRIVFHGTSFFSLCASQCLNLYEPFKNVSSDTELFEITNLPGNIKMTKL  187

Query  621   QV-SPFERSEV--ENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             Q+ S F +++   +NT ++   ++R SE+KSYGVI NSFYELE  YA++Y++VLG +AW 
Sbjct  188   QLPSIFTQNDTMTQNT-AKLFAAIRESEKKSYGVIVNSFYELEHVYADYYRDVLGIKAWH  246

Query  792   VGPLSLYNR-DVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
             +GPLS++N+ D E  + RGK+ +ID+HECLKWLD+K  HSVVY+CFGS  +F  SQL E+
Sbjct  247   IGPLSIHNKKDKEITSYRGKEDSIDKHECLKWLDTKEKHSVVYLCFGSTTHFLNSQLKEI  306

Query  969   AMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVG  1148
             A+G+E SG +F+WV+ NK++ED   E+W+PEGFE+R +GKGL+IRGWAPQV+IL+H A+G
Sbjct  307   AVGLEASGKNFIWVV-NKKKED--GEEWLPEGFEKRMEGKGLVIRGWAPQVLILNHEAIG  363

Query  1149  AFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGV  1328
             AFVTHCGWNST EGV  GVPM+TWPV AEQF NEKL+T++L+ G  VG K+W  L  D +
Sbjct  364   AFVTHCGWNSTFEGVSAGVPMITWPVAAEQFYNEKLVTEVLKIGVPVGVKKWVGLFGDSI  423

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKA  1433
             + + + +A+K+VM GEE+EEMR++AK+  + AKKA
Sbjct  424   QCDLVEKAVKRVMEGEEAEEMRNKAKLFAEMAKKA  458



>ref|XP_010107898.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Morus notabilis]
 gb|EXC17298.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Morus notabilis]
Length=464

 Score =   531 bits (1368),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 256/443 (58%), Positives = 334/443 (75%), Gaps = 3/443 (1%)
 Frame = +3

Query  105   MAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIRLLEFPGVE  284
             MAHGHMIP +DMAKLFASRG KAT+I TPAN   F++ +++   LG ++EI LL+FP ++
Sbjct  1     MAHGHMIPAVDMAKLFASRGCKATVILTPANALFFTQEIERSRNLGLEIEIVLLKFPVLD  60

Query  285   VGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFPWATNAAAK  464
               LPE C+ +     DD + +FFKA  ML+ PLE+L++E RP+CLVAD+ F WAT  AA+
Sbjct  61    FELPEGCENVHMLTSDDMVEKFFKATTMLEQPLEELIKEHRPNCLVADITFSWATEVAAR  120

Query  465   FDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKLQVSPFERS  644
             F IPRL+FHG S  ALC    L  ++P+  VSSDSE F +PNLPHE+K+T+ Q+ P+ + 
Sbjct  121   FGIPRLVFHGVSFFALCTSICLMEHEPYKKVSSDSEPFVVPNLPHEIKLTRDQLPPYIKQ  180

Query  645   EVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGPLSLYNRDV  824
             E E  ++   R    SEE SYGVI NS+YELEPDYA++Y+ VLGRRAW +GP  L N+D 
Sbjct  181   ESE--LATLARQFTESEETSYGVIVNSYYELEPDYADYYRRVLGRRAWHIGPFYLLNKDK  238

Query  825   EDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGIEDSGMDFV  1004
             EDKA+RG KS+IDE ECL WL+SK P+SVVY+ FGS  NF  +QL E+AM +E  G  F+
Sbjct  239   EDKAQRGPKSSIDERECLNWLNSKKPNSVVYVTFGSNVNFNDTQLMEIAMALEAWGKHFI  298

Query  1005  WVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVTHCGWNSTL  1184
             W +R ++ ++ G E+W+PEGFE+R +GKGL+IRGWAPQV+IL+H AVG FVTHCGWNSTL
Sbjct  299   WTVRKEKLQE-GKEEWLPEGFEKRMEGKGLVIRGWAPQVLILEHEAVGGFVTHCGWNSTL  357

Query  1185  EGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREAIAEAIKKV  1364
             EGVC G+P+VTWPV AEQF NEKL+T+ILR G GVG+K+W R   D VK EAI +A+ ++
Sbjct  358   EGVCAGLPLVTWPVSAEQFYNEKLVTEILRIGVGVGAKKWARFVGDSVKSEAIEKAVNRI  417

Query  1365  MIGEESEEMRSRAKVMKDKAKKA  1433
             M GEE++EMRSRA+ +   A+KA
Sbjct  418   MEGEEAQEMRSRARALAKTARKA  440



>ref|XP_007011136.1| UDP-glucosyl transferase 73B3 [Theobroma cacao]
 gb|EOY19946.1| UDP-glucosyl transferase 73B3 [Theobroma cacao]
Length=482

 Score =   531 bits (1369),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 260/453 (57%), Positives = 327/453 (72%), Gaps = 3/453 (1%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              L +FF P MA GHMIP +D+A LFA++GVK TIITT  N P  SK  ++   LG+++ I
Sbjct  7     QLQIFFLPFMAQGHMIPFIDLAMLFAAKGVKTTIITTTLNVPHISKVTERAKNLGYEINI  66

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +  FP VE GLPE C+  DQ    D   +FF A  ML+ PL  LLQ  RPDCLVAD FF
Sbjct  67    LVTYFPSVEAGLPEGCESYDQASSPDMQFKFFTATTMLREPLAHLLQAHRPDCLVADTFF  126

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PW T+ AA F IPR++FHGT   +L A   +R+Y+P   VSSDSE F IPN P E+K+T+
Sbjct  127   PWVTDVAAAFGIPRIVFHGTCVFSLSATEHIRLYEPHKKVSSDSEPFVIPNFPGEIKLTR  186

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
              Q+  F R E     ++F    + +E K YGVI NSFYELE  YA+HY  VLGRRAW VG
Sbjct  187   SQMPDFVRQE--TGFTKFYSESKETELKCYGVIVNSFYELESAYADHYTKVLGRRAWHVG  244

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             P+SL N+   DK ERGKK+ IDE+ECL WL+SK P+SVVYICFGSV NF+ SQL E+A G
Sbjct  245   PISLRNKGTIDKTERGKKTCIDENECLAWLNSKKPNSVVYICFGSVTNFSSSQLLEIATG  304

Query  978   IEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             +E SG  F+WV+R K  ++   E W+PEGFE+R +GKGLIIRGWAPQV+ILDH A+G FV
Sbjct  305   LEASGQQFIWVVR-KEMKNEEKEDWLPEGFEKRMEGKGLIIRGWAPQVLILDHEAIGGFV  363

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKRE  1337
             THCGWNSTLE VC  VP+VTWPV AEQF NEKL+T ILR G GVG+++W RL  D VKRE
Sbjct  364   THCGWNSTLESVCASVPVVTWPVAAEQFYNEKLLTQILRIGIGVGAQKWARLVGDFVKRE  423

Query  1338  AIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             AI +A++++++G+ ++EMRSRAK + + A+KA+
Sbjct  424   AIEKAVREIIVGDRADEMRSRAKALAESARKAV  456



>dbj|BAG71127.1| glucosyltransferase [Phytolacca americana]
 dbj|BAH05017.1| glucosyltransferase [Phytolacca americana]
Length=485

 Score =   530 bits (1366),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 273/483 (57%), Positives = 370/483 (77%), Gaps = 12/483 (2%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGF-QME  254
              LHV FFP+MAHGHMIPTLD+A+LFA+R V+ATIITTP N   F+KA++   + G   + 
Sbjct  7     QLHVVFFPIMAHGHMIPTLDIARLFAARNVRATIITTPLNAHTFTKAIEMGKKNGSPTIH  66

Query  255   IRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMF  434
             + L +FP  +VGLPE C+ L+Q      + +FFK   +L+  LE  L++ RP+CLVADMF
Sbjct  67    LELFKFPAQDVGLPEGCENLEQALGSSLIEKFFKGVGLLREQLEAYLEKTRPNCLVADMF  126

Query  435   FPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKIT  614
             FPWAT++AAKF+IPRL+FHGTS  +LCA+  +R+Y+P  +VSSD ELF++P  PH++K+ 
Sbjct  127   FPWATDSAAKFNIPRLVFHGTSFFSLCALEVVRLYEPHKNVSSDEELFSLPLFPHDIKMM  186

Query  615   KLQ----VSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRR  782
             +LQ    V   E++E +  +    + ++ SE KSYGVI NSFYELEP+YAE ++  LGRR
Sbjct  187   RLQLPEDVWKHEKAEGKTRL----KLIKESELKSYGVIVNSFYELEPNYAEFFRKELGRR  242

Query  783   AWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLH  962
             AW++GP+SL NR  EDKA+RGK+++IDEHECLKWL+SK  +SV+YICFGS A+    QL+
Sbjct  243   AWNIGPVSLCNRSTEDKAQRGKQTSIDEHECLKWLNSKKKNSVIYICFGSTAHQIAPQLY  302

Query  963   EMAMGIEDSGMDFVWVIR-NKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHP  1139
             E+AM +E SG +F+WV+R N   +D+  + W+P GFE+R +GKGLIIRGWAPQV+IL+H 
Sbjct  303   EIAMALEASGQEFIWVVRNNNNNDDDDDDSWLPRGFEQRVEGKGLIIRGWAPQVLILEHE  362

Query  1140  AVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDS  1319
             A+GAFVTHCGWNSTLEG+  GVPMVTWP+FAEQF NEKL+  IL+ G  VG+ +W R  S
Sbjct  363   AIGAFVTHCGWNSTLEGITAGVPMVTWPIFAEQFYNEKLVNQILKIGVPVGANKWSRETS  422

Query  1320  --DGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAIeeggssylglsslldelRA  1493
               D +K++AI +A++++M+G+E+EE RSRAK +K+ A KA+EEGGSSY  LS+L++ELR 
Sbjct  423   IEDVIKKDAIEKALREIMVGDEAEERRSRAKKLKEMAWKAVEEGGSSYSDLSALIEELRG  482

Query  1494  YHA  1502
             YHA
Sbjct  483   YHA  485



>dbj|BAG31950.1| UGT73A9 [Antirrhinum majus]
Length=481

 Score =   530 bits (1365),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 252/457 (55%), Positives = 342/457 (75%), Gaps = 7/457 (2%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             MG LH+  FP+MAHGHMIP LDMAKLF SRG++ TII+T A    F+  ++K    G  +
Sbjct  1     MGKLHIALFPVMAHGHMIPMLDMAKLFTSRGIQTTIISTLA----FADPINKARDSGLDI  56

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
              + +L+FP    G+P+    LD    +D LP+F ++  +LQ P+E L++EL+ DCLV+DM
Sbjct  57    GLSILKFPPEGSGIPDHMVSLDLV-TEDWLPKFVESLVLLQEPVEKLIEELKLDCLVSDM  115

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             F PW  + AAKF IPRL+FHGTS+ ALCA   ++++KP+ +V+SD+E F IP+ PHELK 
Sbjct  116   FLPWTVDCAAKFGIPRLVFHGTSNFALCASEQMKLHKPYKNVTSDTETFVIPDFPHELKF  175

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
              + QV+PF+ +E EN  S+ M+ +  S  +SYGV+ NSFYELE  Y ++Y+ VLGR++W+
Sbjct  176   VRTQVAPFQLAETENGFSKLMKQMTESVGRSYGVVVNSFYELESTYVDYYREVLGRKSWN  235

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GPL L N   E+K +RGK+SAI EHECL WL+SK  +SVVY+CFGS+A F P+QL E A
Sbjct  236   IGPLLLSNNGNEEKVQRGKESAIGEHECLAWLNSKKQNSVVYVCFGSMATFTPAQLRETA  295

Query  972   MGIEDSGMDFVWVIRNKRE--EDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAV  1145
             +G+E+SG +F+WV++  +   E  G E+W+PE FEER K +GLIIRGWAPQ++ILDHPAV
Sbjct  296   IGLEESGQEFIWVVKKAKNEEEGKGKEEWLPENFEERVKDRGLIIRGWAPQLLILDHPAV  355

Query  1146  GAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDG  1325
             GAFVTHCGWNSTLEG+C GVPMVTWPVFAEQF NEK +T++L TG  VG+K+W R  S+G
Sbjct  356   GAFVTHCGWNSTLEGICAGVPMVTWPVFAEQFFNEKFVTEVLGTGVSVGNKKWLRAASEG  415

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             V REA+  A+++VM+GE + EMR RAK  K+ A++A+
Sbjct  416   VSREAVTNAVQRVMVGENASEMRKRAKYYKEMARRAV  452



>ref|XP_010107891.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Morus notabilis]
 gb|EXC17291.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Morus notabilis]
Length=475

 Score =   530 bits (1364),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 252/450 (56%), Positives = 341/450 (76%), Gaps = 6/450 (1%)
 Frame = +3

Query  105   MAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQMEIRLLEFPG  278
             MA GHM+PTLDMAKLFA+RGVK+TIITTP N P+F+KA+DK         + +++++FP 
Sbjct  1     MAQGHMLPTLDMAKLFAARGVKSTIITTPLNAPLFTKAIDKTQNSPNSNYIILKVVKFPA  60

Query  279   VEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFPWATNAA  458
              E  LP+  + LD     +   +FF A  +LQ   ED+L ELRP   VAD+FF WAT+ A
Sbjct  61    KEADLPDGLENLDLVSGPEVHRKFFHALTLLQHSAEDILAELRPHAFVADVFFTWATDLA  120

Query  459   AKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKLQVSPFE  638
             +K++IPRL+FHGTS +++C M S+  +KP+ +VSSDSE F +P LP E+K+T+LQ+  + 
Sbjct  121   SKYEIPRLVFHGTSFISMCCMESVAKFKPYENVSSDSEPFVLPGLPGEIKMTRLQIPDYL  180

Query  639   RSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGPLSLYNR  818
             R   EN +++ M+S   +  +SYG++ NSFYELEP YA+HY+ VLG +AW +GP+SL N+
Sbjct  181   RLGQENNLTKLMKSAEEAGRRSYGMVVNSFYELEPVYADHYRKVLGNKAWHIGPVSLCNK  240

Query  819   DVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGIEDSGMD  998
             +  +KA RGK+SAIDEHECLKWLDSK P+SV+YICFG+ ++F+ SQL E+A G+E SG +
Sbjct  241   NASEKARRGKESAIDEHECLKWLDSKKPNSVIYICFGTNSSFSASQLQEIATGLEASGQN  300

Query  999   FVWVIRNKREED----NGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVTHC  1166
             F+WV+R  +E+D    N  E+W+PEG+E+R +GKGLIIRGWAPQV+ILDH AVG FVTHC
Sbjct  301   FIWVVRKAKEKDQEKENSEEEWLPEGYEKRVEGKGLIIRGWAPQVLILDHEAVGGFVTHC  360

Query  1167  GWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREAIA  1346
             GWNS LEG+  G+PMVTWP+FAEQF NEKL+T++LRTG GVG+++W R   D VK E I 
Sbjct  361   GWNSVLEGISAGLPMVTWPIFAEQFYNEKLITEVLRTGVGVGAQKWIRFVGDYVKSEQIE  420

Query  1347  EAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              A+K++MIGE S EMRSRAK +K+ A +A+
Sbjct  421   RALKEIMIGERSGEMRSRAKEIKEMALRAV  450



>gb|AFK79034.1| glycosyltransferase UGT2 [Bupleurum chinense]
Length=474

 Score =   530 bits (1364),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 261/455 (57%), Positives = 335/455 (74%), Gaps = 7/455 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQ-LGFQMEI  257
             + VFFFP MAHGHMIP LDMAKLFAS GV +TII+TP N P F+K V+K    LGF+M I
Sbjct  2     VEVFFFPFMAHGHMIPILDMAKLFASHGVHSTIISTPLNAPSFAKGVEKSNDDLGFRMTI  61

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
             +++EFP V  GLPE C+  DQ      +  F +A  ML+  +E LL E RPDCLVADMFF
Sbjct  62    KIVEFPKVS-GLPEDCENADQVTSPAMVSLFSRATMMLKEQIEQLLGEYRPDCLVADMFF  120

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWA ++AAKFD+P L+F GTS  A CA   + +++PF ++  +S+ F IPNLPH +K+  
Sbjct  121   PWAIDSAAKFDVPTLVFLGTSFFASCASEQVSLHEPFKNLKDESDEFIIPNLPHTVKLCL  180

Query  618   LQVSPFERSEVENT-MSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSV  794
              Q+ P+++ + +NT +++ + + R  E +S GVI NSFYELEPDYA+HY+ VL RRAW +
Sbjct  181   GQIPPYQQEQEKNTDIAKILIAAREFEMRSNGVIVNSFYELEPDYADHYRIVLNRRAWHI  240

Query  795   GPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAM  974
             GPLSL N   E+K +RGK S  +  ECLKWLDSK+P SV+YICFG ++ F   QLHE+AM
Sbjct  241   GPLSLCNTTFEEKTQRGKLSTANGDECLKWLDSKSPDSVLYICFGCISKFPSHQLHEIAM  300

Query  975   GIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAF  1154
             G+E SG  F+WV+R   + D  SE WMPEGFEER KGKGLIIRGWAPQV+ILDH A+G F
Sbjct  301   GLEASGQQFIWVVR---KSDEKSEDWMPEGFEERMKGKGLIIRGWAPQVLILDHEAIGGF  357

Query  1155  VTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDG-VK  1331
             VTHCGWNSTLEG+  GVPMVTWP FAEQF NEKL+TD+LR G  VG K+W  L  +G +K
Sbjct  358   VTHCGWNSTLEGISAGVPMVTWPSFAEQFYNEKLITDVLRVGVSVGVKKWVILSGNGNIK  417

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             R+A+  A++ +M+GEE+EE R R K +K+ A+KA+
Sbjct  418   RDAVESAVRSIMVGEEAEERRKRCKKLKEMARKAV  452



>ref|XP_008342034.1| PREDICTED: scopoletin glucosyltransferase-like [Malus domestica]
Length=481

 Score =   529 bits (1363),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 252/455 (55%), Positives = 340/455 (75%), Gaps = 3/455 (1%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVD--KYTQLGFQM  251
             + HVF FP M+HGHMIP  DMAKLFA++GVK TI+TTP N   F KA    K      ++
Sbjct  7     EFHVFLFPFMSHGHMIPISDMAKLFAAQGVKTTIVTTPLNASTFYKATQSSKTNSGSVKV  66

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
             EI+ ++FP  E GLP+ C+ LD     +    F KA ++LQ PLE LL +  P  L+AD+
Sbjct  67    EIKTIKFPS-EAGLPDGCEILDSLASPELSTNFLKATSLLQEPLEQLLLDQNPSFLLADI  125

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
              FPWAT+AAAKFDIPRL+FHGTS  AL A +++  Y+PF + SSD E F IPN P E+ +
Sbjct  126   CFPWATDAAAKFDIPRLVFHGTSFFALAASYNMSKYEPFKNSSSDLEPFVIPNFPGEITM  185

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             T+ QV  F++  +EN ++  ++  + SE+ SYG++ NSFYELEP YA++Y+NVLGR+AW 
Sbjct  186   TRAQVPAFDKENIENDVTRMLKRAKESEQTSYGIVVNSFYELEPVYADYYRNVLGRKAWH  245

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GP+SL NR  E+KA RGK S+I+EH+CLKWL SK P+SVVY+CFGS+A F  SQL ++A
Sbjct  246   IGPVSLCNRSNEEKAFRGKASSINEHDCLKWLGSKEPNSVVYVCFGSMAKFNASQLKKIA  305

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             MG++ SG DF+WV+R  +++D   E W+PEGFE + +GKGLIIRGWAPQ++IL+H AVG 
Sbjct  306   MGLQASGQDFIWVVRRGKDDDMEKEDWLPEGFEHKMEGKGLIIRGWAPQLLILNHRAVGG  365

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLEG+  G+PMVTWPV AEQF NEKL+T +L+ G GVG+++W  L  D VK
Sbjct  366   FVTHCGWNSTLEGIAAGLPMVTWPVSAEQFYNEKLVTQVLKIGVGVGAQKWVSLVGDFVK  425

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             ++A+ +A++++M+G E+EEMRSRA  + D+AK+AI
Sbjct  426   KKAVDKAVRRIMVGGEAEEMRSRAWELADQAKRAI  460



>ref|XP_002313131.2| hypothetical protein POPTR_0009s10190g [Populus trichocarpa]
 gb|EEE87086.2| hypothetical protein POPTR_0009s10190g [Populus trichocarpa]
Length=486

 Score =   529 bits (1362),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 262/460 (57%), Positives = 340/460 (74%), Gaps = 6/460 (1%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             +  LH  FFP MAHGHMIP +DMAKLFASRG+K TI+TTP N P FSK V +   LGF++
Sbjct  5     VNQLHALFFPFMAHGHMIPLVDMAKLFASRGLKTTIVTTPLNVPFFSKTVQRIKNLGFEI  64

Query  252   EIRLLEFPGVEVGLPESCQRLD----QTPDDDGLPRFFKACAMlqppledllqelrpdCL  419
              IR +EF  VE GLPE C+  D    Q    D L +FF A  +LQ PLE LL+E+ PDCL
Sbjct  65    NIRTIEFSTVETGLPEGCENADLIISQAMGWDMLKKFFVATTILQEPLERLLEEIHPDCL  124

Query  420   VADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPH  599
             +ADMFFPW T+AAAKF IPRL+FHGTS  +LC   S+R+Y+P   VSSD E F +PNLP 
Sbjct  125   IADMFFPWTTDAAAKFGIPRLVFHGTSFFSLCVGESMRLYEPHKKVSSDCEPFFMPNLPD  184

Query  600   ELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGR  779
             ++K+T+ ++   ER +  +  ++  + V+  + KSYGV+ NSFYELEP YA+HY+   GR
Sbjct  185   DIKLTRNELPYPERHDDGSDFNKMYKKVKEGDSKSYGVVVNSFYELEPVYADHYRKAFGR  244

Query  780   RAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQL  959
             +AW VGP+SL NR+++DKAERG++++I+E+ECLKWLDSK P+SVVYICFGS+A+F+ SQL
Sbjct  245   KAWHVGPVSLCNRNIDDKAERGREASINENECLKWLDSKKPNSVVYICFGSMASFSASQL  304

Query  960   HEMAMGIEDSGMDFVWVI-RNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
              E+A G+E SG  F+WV+ RNK  E++  E W+PEGFEER   KGLIIRGWAPQV+ILDH
Sbjct  305   KEIATGLEASGQQFIWVVGRNKNSEED-KEDWLPEGFEERMGDKGLIIRGWAPQVLILDH  363

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD  1316
              A+G FVTHCGWNST+EG+  GVPM T P+ AEQF NEKL+T IL+ G  +G +E   L 
Sbjct  364   EAIGGFVTHCGWNSTVEGIAAGVPMATCPLSAEQFYNEKLVTQILKIGIRIGVQEQALLV  423

Query  1317  SDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              D +K +A+ EA+ ++M GEE+EEMR +AK     A+KA+
Sbjct  424   GDSIKSKALEEAVSRLMEGEEAEEMRGKAKAFGKMARKAV  463



>ref|XP_004137109.1| PREDICTED: UDP-glycosyltransferase 73B3-like [Cucumis sativus]
Length=477

 Score =   528 bits (1360),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 253/458 (55%), Positives = 345/458 (75%), Gaps = 6/458 (1%)
 Frame = +3

Query  72    MGD-LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQ  248
             MG+ LH+F FP +AHGHMIP +DMAKLF+SRG+K TI+TTP N    +K++     L   
Sbjct  1     MGNQLHIFLFPFLAHGHMIPMVDMAKLFSSRGIKVTIVTTPINSISIAKSLHDSNPL---  57

Query  249   MEIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVAD  428
             + + +L+FP  EVGLP+ C+ LD       +P+F  A ++LQ PLE+ + E RP C+VAD
Sbjct  58    INLLILKFPSAEVGLPDGCENLDFLISPSMIPKFISAVSLLQTPLEEAITEHRPHCIVAD  117

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             MFFPWA +A+ K  IPRL FHGTS  + CA+  +R+Y+P+N+VSS++E F IP+LP  + 
Sbjct  118   MFFPWANDASVKLGIPRLNFHGTSFFSTCALEFMRIYEPYNNVSSETEPFLIPHLPGNIT  177

Query  609   ITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             ITK+++    R  V+N ++E+M+    S+ K YGV+ NSFYELE +YA+ YKNVLGR+AW
Sbjct  178   ITKMKLHELVRENVKNDLTEYMKRAYDSDSKCYGVVMNSFYELEAEYADCYKNVLGRKAW  237

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
             ++GPLSL  ++ E++A+RG KSAIDEHECLKWLDSK P+SVVY+CFG++  F  +QL E+
Sbjct  238   TIGPLSLCTQESEEEAQRGNKSAIDEHECLKWLDSKKPNSVVYVCFGTLTKFNSNQLKEI  297

Query  969   AMGIEDSGMDFVWVIR--NKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPA  1142
             A G+E  G +F+WV+R   +++ED   + W+PEG+E+R +GKGLIIRGWAPQV+ILDHPA
Sbjct  298   ANGLEACGKNFIWVVRKIKEKDEDEEDKDWLPEGYEQRMEGKGLIIRGWAPQVMILDHPA  357

Query  1143  VGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD  1322
             VG F+THCGWNSTLEGV  GVPMVTWPV AEQF NEKL+T++L+ G GVG ++W R+  D
Sbjct  358   VGGFITHCGWNSTLEGVAAGVPMVTWPVAAEQFYNEKLVTEVLKIGVGVGVQKWVRIVGD  417

Query  1323  GVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              +  EA+ +AI +VM GEE+EE+R RAK   +KA+KA+
Sbjct  418   FINSEAVEKAIGRVMEGEEAEEIRKRAKEFAEKARKAV  455



>ref|XP_007199157.1| hypothetical protein PRUPE_ppa019699mg [Prunus persica]
 gb|EMJ00356.1| hypothetical protein PRUPE_ppa019699mg [Prunus persica]
Length=474

 Score =   528 bits (1359),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 261/454 (57%), Positives = 336/454 (74%), Gaps = 10/454 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
              HVF FP MAHGHMIP  DMAKL A++GVK TIITTP N P+FSKA          +EI 
Sbjct  8     FHVFLFPFMAHGHMIPVSDMAKLLAAQGVKTTIITTPLNAPIFSKATRSRKTNSGGIEIE  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
             +  + G        C+ LD  P  +    FFKA  +LQ PLE LL E +P CLVADMFF 
Sbjct  68    IKSWKG--------CENLDSLPTPELADSFFKAAGLLQEPLERLLLEYQPTCLVADMFFS  119

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT+AAAKF IPRLIFHGTS  +L A   ++ Y+PF + SSDSE F IPN P E+K+T+ 
Sbjct  120   WATDAAAKFGIPRLIFHGTSFFSLAASDCVKRYEPFKNTSSDSEPFVIPNFPGEIKMTRA  179

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             QV  F +  +EN ++  +   + +E +SYG++ NSFYELEP YA++++ VLGR+AW +GP
Sbjct  180   QVPDFVKYNIENDLTPLIEQAKEAEVRSYGIVVNSFYELEPVYADYFRKVLGRKAWHIGP  239

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             LS  NRD E+KA  GK+++IDEHECLKWLDSK P+SVVY+CFGSVA F  SQL E+A+G+
Sbjct  240   LSPCNRDNEEKAYIGKEASIDEHECLKWLDSKKPNSVVYVCFGSVAKFNNSQLKEIAIGL  299

Query  981   EDSGMDFVWVIRNKREE-DNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             E SG++F+WV+R  +++ D G E W+PEGFEE  +GKGLIIRGWAPQV+ILDH AVG FV
Sbjct  300   EASGVEFIWVVRKGKDDCDMGKEDWLPEGFEEMMEGKGLIIRGWAPQVLILDHVAVGGFV  359

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKE-WKRLDSDGVKR  1334
             THCGWNSTLEG+  G+P+VTWPV AEQF NEKL+T +L+ G GVG+++ W ++  D VKR
Sbjct  360   THCGWNSTLEGIAAGLPLVTWPVSAEQFYNEKLVTQVLKIGVGVGAQKWWIKVVGDIVKR  419

Query  1335  EAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             EAI +A+ ++M+GEE+EEMRSRAK +  +A++AI
Sbjct  420   EAIEKAVTRIMVGEEAEEMRSRAKGLAKQARRAI  453



>ref|XP_010027866.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW54507.1| hypothetical protein EUGRSUZ_I00449 [Eucalyptus grandis]
Length=485

 Score =   528 bits (1359),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 245/452 (54%), Positives = 330/452 (73%), Gaps = 2/452 (0%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FFFP MA GHMIP +DMAKLFA RG K+T+I TP ++P F K++ K    GF +++ 
Sbjct  8     LHMFFFPFMAPGHMIPMIDMAKLFAIRGCKSTLIATPHDEPTFLKSIAKAKDSGFDIDVV  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
             ++  P  EVGLPE C  +++    +   +F +A  ML   LE L+++L PDCLV+DMF P
Sbjct  68    IVTLPLKEVGLPEDCDNMNKVTTAEIRKQFMRAIMMLDQQLELLIEKLAPDCLVSDMFLP  127

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             W T  AAK+ IPRL+FHGTS  ++     +R+Y+P   VS DSE F IPN P E+ ++++
Sbjct  128   WTTEIAAKWGIPRLVFHGTSAFSISGTECVRIYEPHKKVSHDSESFIIPNFPGEITMSRM  187

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+  F R E E T  +F   V+ SE+ S+GV+ NSFYELEP YA+HY+  LGRR+W VGP
Sbjct  188   QLPDFYREETEFT--KFFNEVKESEKTSFGVVMNSFYELEPAYADHYRTFLGRRSWFVGP  245

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             LSL N++ EDKA RG +++ID+HECLKWLDSK P+SV+YICFGS+ANF  +QLHE+A+G+
Sbjct  246   LSLCNKESEDKAHRGNQASIDQHECLKWLDSKQPNSVIYICFGSMANFNAAQLHEIAVGL  305

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E S   F+WV++     + G E+W+P+G+E R + KGLIIRGWAPQV+ILDH A+G FVT
Sbjct  306   EASNQQFIWVVKKDPNVEEGKEEWLPDGYESRIRNKGLIIRGWAPQVLILDHEAIGGFVT  365

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLE +  GVPMVTWPV AEQF NEK +T +L+ G  +G K+W RL  D VK E 
Sbjct  366   HCGWNSTLEAITAGVPMVTWPVAAEQFFNEKFVTQVLKIGVNIGVKQWVRLFGDSVKSER  425

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + EA+K+V++GEE+EEMR RAK + + A++A+
Sbjct  426   VKEAVKRVLVGEEAEEMRRRAKALAEMARRAV  457



>ref|XP_002313133.1| hypothetical protein POPTR_0009s10120g [Populus trichocarpa]
 gb|EEE87088.1| hypothetical protein POPTR_0009s10120g [Populus trichocarpa]
Length=491

 Score =   528 bits (1360),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 251/454 (55%), Positives = 333/454 (73%), Gaps = 2/454 (0%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH+ FFP MAHGHMIPT+DMA+LFA RGVKATI++TP N P+ SK +++  QLG  + I
Sbjct  7     QLHILFFPYMAHGHMIPTVDMARLFARRGVKATIVSTPLNAPLCSKTIERDRQLGLDISI  66

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +++FP  E GLPE C+ L   P  D L  F KA  MLQ PLE LL+E  P CLVADM F
Sbjct  67    HIIKFPSAEAGLPEGCENLSSIPSPDMLSNFLKAIGMLQQPLEQLLEECHPSCLVADMVF  126

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWAT AA K  IPRL F GT     C   SL+ Y+P   V SD E F +P LP ++K+T+
Sbjct  127   PWATEAANKLRIPRLFFSGTGFFPACVFDSLKRYEPHKGVDSDFEPFVVPGLPDQIKLTR  186

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
             L++  + +   EN +++ M  +  S  +SYGV+ NSF ELEP Y+EHY+  + R+AW +G
Sbjct  187   LRLPAYIKERTENELTKLMDKISESMVRSYGVLTNSFLELEPAYSEHYRMEIKRKAWHIG  246

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             PLSL NRD++DKAERG  S+IDEHEC++WL  KNP+SV+YICFGS  N + +QL E+AM 
Sbjct  247   PLSLCNRDMKDKAERGNVSSIDEHECMRWLAKKNPNSVLYICFGSFFNLSAAQLLEIAMA  306

Query  978   IEDSGMDFVWVIRNKREEDNG-SEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAF  1154
             +E SG +F+WV+R +++      E+W+PEGFE+R +GKGLI+ GWAPQV+ILDH AVG F
Sbjct  307   LEASGQNFIWVVRERKQTKLAEKEEWLPEGFEKRMEGKGLIVSGWAPQVLILDHKAVGGF  366

Query  1155  VTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD-GVK  1331
             +THCGWNSTLEGV  GVPMVTWP+ AEQF NEKL+TD+L+ G GVG++EW R +    V+
Sbjct  367   MTHCGWNSTLEGVTAGVPMVTWPLGAEQFCNEKLITDVLKIGIGVGAQEWSRYEKKIIVR  426

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKA  1433
             +E I +AI ++M+GEE+EE+R+RA+V+K+ A++A
Sbjct  427   KEDIEKAIIQLMVGEEAEEIRNRARVLKEMARRA  460



>sp|Q8H0F2.1|ANGT_GENTR RecName: Full=Anthocyanin 3'-O-beta-glucosyltransferase; Short=3'GT 
[Gentiana triflora]
 dbj|BAC54092.1| anthocyanin 3'-glucosyltransferase [Gentiana triflora]
Length=482

 Score =   527 bits (1357),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 261/448 (58%), Positives = 343/448 (77%), Gaps = 6/448 (1%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             M  LHVFFFP +A+GH++PT+DMAKLF+SRGVKAT+ITT  N  +F KA+++   LGF +
Sbjct  1     MDQLHVFFFPFLANGHILPTIDMAKLFSSRGVKATLITTHNNSAIFLKAINRSKILGFDI  60

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
              +  ++FP  E GLPE  +  DQ    D +  FF+AC +LQ PLE+LL+E RP  LVAD+
Sbjct  61    SVLTIKFPSAEFGLPEGYETADQARSIDMMDEFFRACILLQEPLEELLKEHRPQALVADL  120

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FF WA +AAAKF IPRL+FHG+S  A+ A  S+R  KP+ ++SSDS+ F +P++P ++ +
Sbjct  121   FFYWANDAAAKFGIPRLLFHGSSSFAMIAAESVRRNKPYKNLSSDSDPFVVPDIPDKIIL  180

Query  612   TKLQVSPFERSEVENT-MSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             TK QV   + +E  NT ++E  +++  SE   YGVI NSFYELEPDY ++ KNVLGRRAW
Sbjct  181   TKSQVPTPDETEENNTHITEMWKNISESENDCYGVIVNSFYELEPDYVDYCKNVLGRRAW  240

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
              +GPLSL N + ED AERGKKS ID HECL WLDSKNP SVVY+CFGS+ANF  +QLHE+
Sbjct  241   HIGPLSLCNNEGEDVAERGKKSDIDAHECLNWLDSKNPDSVVYVCFGSMANFNAAQLHEL  300

Query  969   AMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTK--GKGLIIRGWAPQVVILDHPA  1142
             AMG+E+SG +F+WV+R   +E++ S KW P+GFE+R +   KGLII+GWAPQV+IL+H A
Sbjct  301   AMGLEESGQEFIWVVRTCVDEEDES-KWFPDGFEKRVQENNKGLIIKGWAPQVLILEHEA  359

Query  1143  VGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD  1322
             VGAFV+HCGWNSTLEG+CGGV MVTWP+FAEQF NEKLMTDILRTG  VGS +W R+ + 
Sbjct  360   VGAFVSHCGWNSTLEGICGGVAMVTWPLFAEQFYNEKLMTDILRTGVSVGSLQWSRVTTS  419

Query  1323  G--VKREAIAEAIKKVMIGEESEEMRSR  1400
                VKRE+I++A++++M  EE  ++R+R
Sbjct  420   AVVVKRESISKAVRRLMAEEEGVDIRNR  447



>ref|XP_003518712.1| PREDICTED: scopoletin glucosyltransferase-like [Glycine max]
Length=476

 Score =   526 bits (1356),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 257/454 (57%), Positives = 340/454 (75%), Gaps = 9/454 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKY-TQLGFQMEI  257
             LH+FFFP +AHGHMIP +DMAKLFA++GV+ATI+TTP N P+ SKA++K  T  G +++I
Sbjct  8     LHMFFFPFLAHGHMIPLVDMAKLFAAKGVRATILTTPLNAPIISKAIEKTKTHQGKEIQI  67

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
             + L+F G E GLPE C+  D  P  +  P F  A A+LQ P E LL + RP+C+VADMFF
Sbjct  68    QTLKFLGTEFGLPEGCEHCDSLPSPNLFPAFIMATALLQEPFEQLLHQQRPNCVVADMFF  127

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PW T++A KF IPRL+FHG S  +LCA   + +Y+P+N+ SSD+ELF IPN P E+K+T+
Sbjct  128   PWTTDSADKFGIPRLVFHGISFFSLCASQIMSLYQPYNNTSSDTELFVIPNFPGEIKMTR  187

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
             LQ + F R +  ++ S F + +  SE +SYGV+ NSFYELE DYA+HY+  LG +AW +G
Sbjct  188   LQEANFFRKDDVDS-SRFWKQIYESEVRSYGVVVNSFYELEKDYADHYRKELGIKAWHIG  246

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             PLSL NRD E+K  RG +++IDEHECLKWL++K  +SVVY+CFGS   F+ SQL E+AMG
Sbjct  247   PLSLCNRDKEEKTFRGNEASIDEHECLKWLNTKTTNSVVYVCFGSAVKFSNSQLLEIAMG  306

Query  978   IEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             +E SG  F+WV+R   +E    EKW+PEGFE+R +GKGLIIRGWAPQV+IL+H A+GAFV
Sbjct  307   LEASGQQFIWVVRKSIQEKG--EKWLPEGFEKRMEGKGLIIRGWAPQVLILEHEAIGAFV  364

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKR-LDSDGVKR  1334
             THCGWNSTLE V  GVPM+TWPV  EQF NEKL+T++L+ G  VG K+W R +  D VK 
Sbjct  365   THCGWNSTLEAVSAGVPMITWPVGGEQFYNEKLVTEVLKIGVPVGVKKWTRFIGDDSVKW  424

Query  1335  EAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             +A+ +A+K VM+    EEMR+RA+V K  A++A+
Sbjct  425   DALEKAVKMVMV----EEMRNRAQVFKQMARRAV  454



>ref|XP_011088227.1| PREDICTED: scopoletin glucosyltransferase-like [Sesamum indicum]
Length=483

 Score =   526 bits (1356),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 256/457 (56%), Positives = 343/457 (75%), Gaps = 7/457 (2%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             MG LH+ F PM+AHGHMIP LDMAKLF SRG+K TII TPA    F+ +V +  + G  +
Sbjct  1     MGQLHIVFLPMIAHGHMIPMLDMAKLFTSRGLKTTIIATPA----FAASVKRARESGHDI  56

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
              + +++FP     L ++    DQ      LP+F +A ++LQ P+E LLQEL P+CL++DM
Sbjct  57    GLTIVQFPPKGSSLSDNIMSFDQITTPALLPKFVEALSLLQEPVEKLLQELNPNCLLSDM  116

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FFPW  ++AAKF IPRL+F GT+  + C    + ++KPF ++S+DSE F +P+LP +L  
Sbjct  117   FFPWTVDSAAKFGIPRLVFGGTNCFSQCISEQMHLHKPFKNISADSEPFVVPDLPDKLTF  176

Query  612   TKLQVSPFERSE-VENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             T+ QV+PF   E  +N  S+    +R SE++SYGV+FNS YELE  YA+HYK VLGRRAW
Sbjct  177   TRTQVAPFVLEEGTKNEFSKLREEMRESEKRSYGVVFNSCYELESAYADHYKKVLGRRAW  236

Query  789   SVGPLSLYNR-DVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHE  965
              +GPL L N+   E+KA+RGK+S I E ECL WLDSK P+SVVY+CFGS+A+F P+QL E
Sbjct  237   HIGPLFLCNKAGAEEKAQRGKESDIKEQECLAWLDSKRPNSVVYVCFGSMASFTPAQLRE  296

Query  966   MAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAV  1145
              A+G+E SG DF+WV+R K +    +E WMP+G+E+R KGKGLI+RGWAPQV+ILDHPA+
Sbjct  297   TAIGLEASGQDFIWVVR-KGKNVGENEDWMPQGYEDRIKGKGLIVRGWAPQVMILDHPAI  355

Query  1146  GAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDG  1325
             G FVTHCGWNSTLEG+C GVPMVTWPVFAEQF NEKL+T++LRTG  VG+K+W+   S+G
Sbjct  356   GGFVTHCGWNSTLEGICAGVPMVTWPVFAEQFYNEKLVTEVLRTGVCVGNKKWQMGPSEG  415

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             V REA+ +A++++M+GEE+ E+RSRAK  K+ A+KA+
Sbjct  416   VPREAVTKAVERIMVGEETSEIRSRAKYYKEMARKAV  452



>gb|KGN43913.1| hypothetical protein Csa_7G073490 [Cucumis sativus]
Length=477

 Score =   526 bits (1355),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 252/458 (55%), Positives = 345/458 (75%), Gaps = 6/458 (1%)
 Frame = +3

Query  72    MGD-LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQ  248
             MG+ LH+F FP +AHGHMIP +DMAKLF+SRG+K TI+TTP N    +K++     L   
Sbjct  1     MGNQLHIFLFPFLAHGHMIPMVDMAKLFSSRGIKVTIVTTPINSISIAKSLHDSNPL---  57

Query  249   MEIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVAD  428
             + + +L+FP  EVGLP+ C+ LD       +P+F  A ++LQ PLE+ + E RP C+VAD
Sbjct  58    INLLILKFPSAEVGLPDGCENLDFLISPSMIPKFISAVSLLQTPLEEAITEHRPHCIVAD  117

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             MFFPWA +A+ K  IPRL FHGTS  + CA+  +R+Y+P+N+VSS++E F IP+LP  + 
Sbjct  118   MFFPWANDASVKLGIPRLNFHGTSFFSTCALEFMRIYEPYNNVSSETEPFLIPHLPGNIT  177

Query  609   ITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             ITK+++    R  V+N ++E+M+    S+ K YGV+ NSFYELE +YA+ YKNVLGR+AW
Sbjct  178   ITKMKLHELVRENVKNDLTEYMKRAYDSDSKCYGVVMNSFYELEAEYADCYKNVLGRKAW  237

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
             ++GPLSL  ++ E++A+RG KSAI+EHECLKWLDSK P+SVVY+CFG++  F  +QL E+
Sbjct  238   TIGPLSLCTQESEEEAQRGNKSAIEEHECLKWLDSKKPNSVVYVCFGTLTKFNSNQLKEI  297

Query  969   AMGIEDSGMDFVWVIR--NKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPA  1142
             A G+E  G +F+WV+R   +++ED   + W+PEG+E+R +GKGLIIRGWAPQV+ILDHPA
Sbjct  298   ANGLEACGKNFIWVVRKIKEKDEDEEDKDWLPEGYEQRMEGKGLIIRGWAPQVMILDHPA  357

Query  1143  VGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD  1322
             VG F+THCGWNSTLEGV  GVPMVTWPV AEQF NEKL+T++L+ G GVG ++W R+  D
Sbjct  358   VGGFITHCGWNSTLEGVAAGVPMVTWPVAAEQFYNEKLVTEVLKIGVGVGVQKWVRIVGD  417

Query  1323  GVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              +  EA+ +AI +VM GEE+EE+R RAK   +KA+KA+
Sbjct  418   FINSEAVEKAIGRVMEGEEAEEIRKRAKEFAEKARKAV  455



>dbj|BAF75890.1| tetrahydroxychalcone glucosyltransferase [Dianthus caryophyllus]
Length=483

 Score =   526 bits (1354),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 255/455 (56%), Positives = 334/455 (73%), Gaps = 8/455 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+  FP +AHGHMIPTLD+A+LFA+R V+ +IITTP N P+F+KA++    L   + + 
Sbjct  8     LHIVMFPFLAHGHMIPTLDIARLFAARNVEVSIITTPVNAPIFTKAIETGNPL---INVE  64

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGL-PRFFKACAMlqppledllqelrpdCLVADMFF  437
             L +FP  E GLPE C+  +       L P+FFKA  + Q  LE+ L  +RPDCLVADMF+
Sbjct  65    LFKFPAKEAGLPEGCENAEIVIRQPELIPQFFKATHLFQQQLEEYLDRVRPDCLVADMFY  124

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWAT++A KF++PRL+FHG S  ALCA  S+  Y+P+ +VSSD E F +P LPHE+K+ +
Sbjct  125   PWATDSATKFNLPRLVFHGISCFALCAQESVSRYEPYRNVSSDDEPFALPGLPHEIKLIR  184

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
              Q+SP  R + EN+       +  SE +S+GVI NSFYELEP+YAE Y   +GR+AW +G
Sbjct  185   SQISPDSRGDKENSSKTTTELINDSEVESFGVIMNSFYELEPEYAEFYAKDMGRKAWHIG  244

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             P+SL NR  + KA RGK+++ID+HECL WLDSK P+SVVY+CFGS +     QL E+AM 
Sbjct  245   PVSLCNRSNDQKALRGKRASIDDHECLAWLDSKEPNSVVYVCFGSTSVSIAPQLREIAMA  304

Query  978   IEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             +E SG +F+W +R+     N  E+W+P GFEERTKGKGLIIRGWAPQV+ILDH AVGAFV
Sbjct  305   LEQSGKNFIWAVRDGGNGKN--EEWLPLGFEERTKGKGLIIRGWAPQVLILDHKAVGAFV  362

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDS--DGVK  1331
             THCGWNSTLEG+  GVPMVTWP+FAEQF NEKL+T++LRTG  +G K+W R  S  D + 
Sbjct  363   THCGWNSTLEGISAGVPMVTWPLFAEQFFNEKLVTNVLRTGVSIGVKKWNRTPSVEDLIT  422

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             REAI  AI+++M GE++EEMR RAK +K+ A+ A+
Sbjct  423   REAIEAAIREIMEGEKAEEMRLRAKKLKEAARNAV  457



>ref|XP_008454970.1| PREDICTED: scopoletin glucosyltransferase-like [Cucumis melo]
Length=478

 Score =   526 bits (1354),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 256/452 (57%), Positives = 336/452 (74%), Gaps = 3/452 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+F FP MAHGHMIP +DMAKLFASRG+K TI+TTP N   FSK++  Y+     +++ 
Sbjct  8     LHIFMFPFMAHGHMIPMVDMAKLFASRGIKITIVTTPLNSISFSKSLHNYSADSL-IQLL  66

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
             +L+FP  E GLPE C+  D  P  D LP FF+A ++LQPP E+ LQ  RPDCL++DMFFP
Sbjct  67    ILKFPSAEAGLPEGCENADSIPSMDFLPNFFRAVSLLQPPFEEALQNNRPDCLISDMFFP  126

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             W  + A +  IPRLIFHGTS  +LCA   +R+++P+  VSSD+E F IP LP ++K+TK+
Sbjct  127   WTNDVADRIGIPRLIFHGTSCFSLCASEFMRLHEPYKHVSSDTEPFPIPYLPGDIKLTKM  186

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             ++  F R   EN  S+F+  V+ SE   YGV+ NSFYELE +Y + YK+VLGR+AW +GP
Sbjct  187   KLPIFVRENTENEFSKFITKVKESESCCYGVVVNSFYELEAEYVDCYKDVLGRKAWPIGP  246

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             LSL N+  ++  +RG++SAIDEHECLKWLDS+ P SVVYICFGS+A F  +QL E+A G+
Sbjct  247   LSLTNKKTQEITQRGRESAIDEHECLKWLDSQKPDSVVYICFGSLAKFNSAQLKEIANGL  306

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG +F+WV+R  +EE+   + W+PEG+EER +G GLIIRGWAPQV+ILDHP+VG FVT
Sbjct  307   EASGKNFIWVVRKGKEEEE-EQNWLPEGYEERMEGTGLIIRGWAPQVLILDHPSVGGFVT  365

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLEGV  GVPMVTWPV AEQF NEKL+T++L+TG GVG ++W     D ++ EA
Sbjct  366   HCGWNSTLEGVAAGVPMVTWPVGAEQFYNEKLVTEVLKTGVGVGIQKWAPGVGDFIESEA  425

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + +AI+++M  +E EEMR RA     KAK A+
Sbjct  426   VEKAIRRIM-EKEGEEMRKRATEFAKKAKWAV  456



>ref|XP_002518723.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43648.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=479

 Score =   525 bits (1351),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 251/453 (55%), Positives = 338/453 (75%), Gaps = 5/453 (1%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
             +L+ FFFP MA GH IP +DMAKLFASRG K +IITTP N P  SKA+++   LG +++I
Sbjct  10    ELYFFFFPFMAQGHSIPLIDMAKLFASRGQKVSIITTPVNAPDISKAIERSRVLGHEIDI  69

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +++FP VE GLPE C+ L+     +    FF A  +L  PLE LL++ RPDCLVAD FF
Sbjct  70    LIIKFPCVEAGLPEGCEHLELVTSPEMGLNFFMATDILAKPLEHLLKQYRPDCLVADTFF  129

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PW+  AA+K  IPR++F GT   + CA   +  Y+P+ ++SSD++LF IP  P E+K+T+
Sbjct  130   PWSNEAASKSGIPRIVFSGTCFFSSCASQCVNKYQPYKNISSDTDLFVIPEFPGEIKLTR  189

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
              Q+  F   +     SEF + V+ +E K YGVI NSFYELEPDY +H+K VLG +AW++G
Sbjct  190   NQLPEFVIQQ--TGFSEFYQKVKEAEAKCYGVIVNSFYELEPDYVDHFKKVLGIKAWNIG  247

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             P+SL N +++DKA+RG++++IDE+ECL+WL+SK P+SV+YICFGSVANF  SQL E+AMG
Sbjct  248   PISLCNSNIQDKAKRGREASIDENECLEWLNSKKPNSVIYICFGSVANFVSSQLLEIAMG  307

Query  978   IEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             +EDSG  F+WV++  +   N  E+W+PEGFE+R +GKGLII GWAPQV IL+H A+G FV
Sbjct  308   LEDSGQQFIWVVKKSK---NNQEEWLPEGFEKRMEGKGLIIHGWAPQVTILEHEAIGGFV  364

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKRE  1337
             THCGWNSTLE +  GVPMVTWPV AEQF NEKL+T+ILR G  VG+K+W R+  D VK+E
Sbjct  365   THCGWNSTLEAIAAGVPMVTWPVAAEQFYNEKLITEILRIGVAVGTKKWSRVVGDSVKKE  424

Query  1338  AIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             AI +A+ +VM+ +E+EEMR RAK + + A+KA+
Sbjct  425   AIKKAVTQVMVDKEAEEMRCRAKNIGEMARKAV  457



>ref|XP_003518713.1| PREDICTED: scopoletin glucosyltransferase-like [Glycine max]
 gb|KHN12233.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Glycine soja]
Length=481

 Score =   524 bits (1350),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 249/453 (55%), Positives = 336/453 (74%), Gaps = 3/453 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FFFP +AHGHMIPT+DMAKLFA +GVKATIITTP N+P    A+ K    G ++ I+
Sbjct  9     LHIFFFPFLAHGHMIPTVDMAKLFAEKGVKATIITTPLNEPFIYNAIGKSKTNGNKIHIQ  68

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              +EFP  E GL + C+  +  P  + L  FF A   LQ PLE LLQ+  PDC+VADMFFP
Sbjct  69    TIEFPSAEAGLLDGCENTESVPSPELLNPFFMATHFLQEPLEQLLQKQLPDCIVADMFFP  128

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFND-VSSDSELFTIPNLPHELKITK  617
             WAT++AAKF IPRL+FHGTS  +LC    +  Y+P +   SSDS+ F IPN P E++I K
Sbjct  129   WATDSAAKFGIPRLVFHGTSFFSLCVTTCMPFYEPHDKYASSDSDSFLIPNFPGEIRIEK  188

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
              ++ P+ +S+ +  +++ +   + SE +SYGV+ NSFYELE  YA+H++NVLGR+AW +G
Sbjct  189   TKIPPYSKSKEKAGLAKLLEEAKESELRSYGVVVNSFYELEKVYADHFRNVLGRKAWHIG  248

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             PLSL N+D E+KA RGK+++IDEHECLKWL++K P+SV+YICFGS   F  SQL E+A G
Sbjct  249   PLSLCNKDAEEKARRGKEASIDEHECLKWLNTKKPNSVIYICFGSTVKFPDSQLREIAKG  308

Query  978   IEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             +E SG  F+WV+R   EE    EKW+ +GFE+R +GKGLIIRGWAPQV+IL+H A+G FV
Sbjct  309   LEASGQQFIWVVRKSGEEKG--EKWLHDGFEKRMEGKGLIIRGWAPQVLILEHQAIGTFV  366

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKRE  1337
             THCGWNSTLE V  GVPMVTWP+FA+QF NEKL+ ++L+ G  VG+K W  +  D +  +
Sbjct  367   THCGWNSTLEAVTAGVPMVTWPIFADQFFNEKLVIEVLKIGVPVGAKTWLGMQGDSISCD  426

Query  1338  AIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             A+ +A+K++M GEE+ EMR++AKV+  +A++A+
Sbjct  427   AVEKAVKRIMTGEEAIEMRNKAKVLSHQARRAM  459



>ref|XP_003520067.1| PREDICTED: scopoletin glucosyltransferase-like [Glycine max]
Length=483

 Score =   524 bits (1349),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 257/456 (56%), Positives = 329/456 (72%), Gaps = 5/456 (1%)
 Frame = +3

Query  75    GDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKY-TQLGFQM  251
             G LH+FFFP MAHGHMIP +DMAKLFA++GV+ TIITTP N P+ SK +++  T    ++
Sbjct  6     GPLHIFFFPFMAHGHMIPLVDMAKLFAAKGVRTTIITTPLNAPIISKTIEQTKTHQSKEI  65

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
              I+ ++FP V VGLPE C+  D     D  P F KA  ++Q P E LL   RP+C+VAD 
Sbjct  66    NIQTIKFPNVGVGLPEGCEHSDSVLSTDLFPIFLKATTLMQEPFEQLLLHQRPNCVVADW  125

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FFPW T++AAKF IPRL+FHG S  +LCA   + +YKP+N+  SDSELF IPN P E+K+
Sbjct  126   FFPWTTDSAAKFGIPRLVFHGISFFSLCATKIMSLYKPYNNTCSDSELFVIPNFPGEIKM  185

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             T+LQV  F   +     S F      SEE+SYGV+ NSFYELE DYA+HY+NV GR+AW 
Sbjct  186   TRLQVGNFHTKDNVGHNS-FWNEAEESEERSYGVVVNSFYELEKDYADHYRNVHGRKAWH  244

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GPLSL NR+ E+K  RGK+++IDEHECLKWLD++  +SVVY+CFGS   F+ SQL E+A
Sbjct  245   IGPLSLCNRNKEEKIYRGKEASIDEHECLKWLDTQTTNSVVYVCFGSAVKFSDSQLLEIA  304

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             MG+E SG  F+WV+R   +E    EKW+PEGFE+R +GKGLIIRGWAPQV+IL+H A+GA
Sbjct  305   MGLEASGQQFIWVVRKSIQEK--GEKWLPEGFEKRMEGKGLIIRGWAPQVLILEHEAIGA  362

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD-GV  1328
             FVTHCGWNSTLE V  GVPM+TWPV AEQF NEKL+T++L+ G  VG K+W     D   
Sbjct  363   FVTHCGWNSTLEAVSAGVPMITWPVGAEQFFNEKLVTEVLKIGVPVGVKKWSYSGVDCCA  422

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             K + + +A+K V   EE E MR RAKV+   A++A+
Sbjct  423   KWDVVEKAVKMVFAKEELEGMRKRAKVLAQMARRAV  458



>gb|KHN12234.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Glycine soja]
Length=482

 Score =   522 bits (1345),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 254/455 (56%), Positives = 327/455 (72%), Gaps = 4/455 (1%)
 Frame = +3

Query  75    GDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKY-TQLGFQM  251
             G LH+FFFP MAHGHMIP +DMAKLFA++GV+ TIITTP N P+ SK +++  T    ++
Sbjct  6     GPLHIFFFPFMAHGHMIPLVDMAKLFAAKGVRTTIITTPLNAPIISKTIEQTKTHQSKEI  65

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
              I+ ++FP V VGLPE C+  D     D  P F KA  ++Q P E LL   RP+C+VAD 
Sbjct  66    NIQTIKFPNVGVGLPEGCEHSDSVLSTDLFPIFLKATTLMQEPFEQLLLHQRPNCVVADW  125

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FFPW T++AAKF IPRL+FHG S  +LCA   + +YKP+N+  SDSELF IPN P E+K+
Sbjct  126   FFPWTTDSAAKFGIPRLVFHGISFFSLCATKIMSLYKPYNNTCSDSELFVIPNFPGEIKM  185

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             T+LQV  F   +     S F      SEE+SYGV+ NSFYELE DYA+HY+NV GR+AW 
Sbjct  186   TRLQVGNFHTKDNVGHNS-FWNEAEESEERSYGVVVNSFYELEKDYADHYRNVHGRKAWH  244

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GPLSL NR+ E+K  RGK+++IDEHECLKWLD++  +SVVY+CFGS   F+ SQL E+A
Sbjct  245   IGPLSLCNRNKEEKIYRGKEASIDEHECLKWLDTQTTNSVVYVCFGSAVKFSDSQLLEIA  304

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             MG+E SG  F+WV+R   +E    EKW+PEGFE+R +GKGLIIRGWAPQV+IL+H A+GA
Sbjct  305   MGLEASGQQFIWVVRKSIQEKG--EKWLPEGFEKRMEGKGLIIRGWAPQVLILEHEAIGA  362

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLE V  GVPM+TWPV AEQF NEKL+T++L+ G  VG K+W     D   
Sbjct  363   FVTHCGWNSTLEAVSAGVPMITWPVGAEQFFNEKLVTEVLKIGVPVGVKKWSYSGVDCCA  422

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             +  + E   K++  +E E MR RAKV+   A++A+
Sbjct  423   KWDVVEKAVKMVFAKELEGMRKRAKVLAQMARRAV  457



>dbj|BAD44686.1| UDP-glucose:anthocyanin 3'-O-glucosyltransferase [Gentiana scabra 
var. buergeri]
Length=482

 Score =   522 bits (1345),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 259/448 (58%), Positives = 341/448 (76%), Gaps = 6/448 (1%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             M  LHVFFFP +A+GH++PT+DMAKLF+SRGVKAT+ITT  N  +F KA+ +   LGF +
Sbjct  1     MDQLHVFFFPFLANGHILPTIDMAKLFSSRGVKATLITTHNNSAIFLKAISRSKILGFDI  60

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
              +  ++FP  E GLPE  +  DQ    D +  FF+AC +LQ PLE+LL+E RP  LVAD+
Sbjct  61    SVLTIKFPSAEFGLPEGYETADQARSIDMMDEFFRACILLQEPLEELLKEHRPQALVADL  120

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FF WA +AAAKF IPRL+FHG+S  A+ +  S+R  KP+ ++SSDS+ F +P++P ++ +
Sbjct  121   FFYWANDAAAKFGIPRLLFHGSSSFAMISAESVRRNKPYKNLSSDSDPFVVPDIPDKIIL  180

Query  612   TKLQVSPFERSEVENT-MSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             TK QV   + +E  NT ++E  +++  SE   YGVI NSFYELEPDY ++ KNVLGRRAW
Sbjct  181   TKSQVPTPDETEENNTHITEMWKNISESENDCYGVIVNSFYELEPDYVDYCKNVLGRRAW  240

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
              +GPL L N + ED A+RGKKS ID HECL WLDSKNP+SVVY+CFGS+ANF  +QLHE+
Sbjct  241   HIGPLLLCNNEGEDVAQRGKKSDIDAHECLNWLDSKNPYSVVYVCFGSMANFNAAQLHEL  300

Query  969   AMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTK--GKGLIIRGWAPQVVILDHPA  1142
             AMG+E+SG +F+WV+R   +E + S KW P+GFE+R +   KGLII+GWAPQV+IL+H A
Sbjct  301   AMGLEESGQEFIWVVRTCVDEKDES-KWFPDGFEKRVQENNKGLIIKGWAPQVLILEHEA  359

Query  1143  VGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD  1322
             VGAFV+HCGWNSTLEG+CGGV MVTWP+FAEQF NEKLMTDILRTG  VGS +W R+ + 
Sbjct  360   VGAFVSHCGWNSTLEGICGGVAMVTWPLFAEQFYNEKLMTDILRTGVPVGSLQWSRVTTS  419

Query  1323  G--VKREAIAEAIKKVMIGEESEEMRSR  1400
                VKREAI++A++++M  EE  ++R+R
Sbjct  420   AVVVKREAISKAVRRLMAEEEGVDIRNR  447



>ref|XP_010691730.1| PREDICTED: scopoletin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=485

 Score =   522 bits (1344),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 259/461 (56%), Positives = 340/461 (74%), Gaps = 14/461 (3%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASR-GVKATIITTPANQPVFSKAVDKYTQLGFQM-  251
             + HV  FP MAHGHMIP LD+A+LFA R  VKATIITTP N   F+K  +   +    + 
Sbjct  5     EFHVVLFPFMAHGHMIPILDIARLFAVRDNVKATIITTPLNVTNFTKDNESNMESSAPIV  64

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
              I +  FP  EVGLPE  + L++    + L +FFKA  ML   LE  L+++RP+CLVADM
Sbjct  65    NIEVFRFPAQEVGLPEGFENLEKVMKPELLNKFFKAAGMLNEQLEQYLEKIRPNCLVADM  124

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FFPWAT +AAKF+IPRL+FHGTS+ ALCA   +R+YKPF +V+SD E F +P+LPH++++
Sbjct  125   FFPWATESAAKFNIPRLVFHGTSNFALCAQEIVRLYKPFKNVTSDEEPFVLPSLPHDIQM  184

Query  612   TKLQVS----PFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGR  779
              +LQ+      ++ +E E  M     S++ SE KSYGV+ NSFYELEPDYAE +K  LGR
Sbjct  185   RRLQIPEDLWKYDGTEFEKRMD----SLKDSEIKSYGVLVNSFYELEPDYAEFFKKELGR  240

Query  780   RAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQL  959
             + W++GP+SL NR V+DK++R K+  ID+HECLKWL+SK P SVVYICFGS A+F   QL
Sbjct  241   KTWNIGPVSLSNRSVKDKSQREKEPLIDQHECLKWLNSKKPDSVVYICFGSTASFIAPQL  300

Query  960   HEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHP  1139
             HEMA+ +E SG +F+W+++N  +E+  S++W+P GFE+RT+GKGLIIRGW PQV+IL+H 
Sbjct  301   HEMALALEVSGQEFIWIVKN--DENGRSKEWLPPGFEQRTEGKGLIIRGWVPQVLILEHE  358

Query  1140  AVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDS  1319
             A+GAFVTHCGWNSTLEG+  GVPMVTWP+FAEQF NEKL+  IL TG  VG+K+W R  S
Sbjct  359   AIGAFVTHCGWNSTLEGISAGVPMVTWPIFAEQFYNEKLVNQILNTGVPVGAKKWSRTPS  418

Query  1320  --DGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
               D +K EAI EA+  +M+G E+EE R+RAK +K  A KA+
Sbjct  419   IEDIIKMEAIEEALTDIMVGTEAEERRTRAKKLKILAYKAV  459



>ref|XP_010027900.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW54537.1| hypothetical protein EUGRSUZ_I00494 [Eucalyptus grandis]
Length=485

 Score =   521 bits (1343),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 244/452 (54%), Positives = 328/452 (73%), Gaps = 2/452 (0%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FFFP MA GHMIP +DMAKLFA RG K+T+I TP ++P F K++ K    GF +++ 
Sbjct  8     LHMFFFPFMAPGHMIPMIDMAKLFAIRGCKSTLIATPHDEPTFLKSIAKAKDSGFDIDVV  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
             ++  P  EVGLPE    L++    +   +F +A  ML   LE L+++L PDCLV+DMF P
Sbjct  68    IVTLPLKEVGLPEDSDNLNKVTTVEMRKQFMRAIMMLDQQLELLIEKLAPDCLVSDMFLP  127

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             W T  AAK+ IPRL+FHGTS  ++     +R+Y+P   VS DSE F IPN P E+ ++++
Sbjct  128   WTTEIAAKWGIPRLVFHGTSAFSISGTECVRIYEPHKKVSHDSEPFIIPNFPGEITMSRM  187

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+  F R E E T  +F   V+ SE+ S+GV+ NSFYELEP YA+HY+  LGRR+W VGP
Sbjct  188   QLPDFYREETEFT--KFFNEVKESEKTSFGVVMNSFYELEPAYADHYRTFLGRRSWFVGP  245

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             LSL N++ EDKA RG +++ID+HECLKWLDSK P+SV+YICFGS+ANF  +QLHE+A+G+
Sbjct  246   LSLCNKESEDKAHRGNQASIDQHECLKWLDSKQPNSVIYICFGSMANFNAAQLHEIAVGL  305

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E S   F+WV++     + G E+W+P+G+E R + KGLIIRGWAPQV+ILDH A+G FVT
Sbjct  306   EASNQQFIWVVKKDPNVEEGKEEWLPDGYESRIRNKGLIIRGWAPQVLILDHEAIGGFVT  365

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLE +  GVPMVTWPV AEQF NE  +T +L+ G  +G K+W RL  D VK E 
Sbjct  366   HCGWNSTLEAITAGVPMVTWPVAAEQFFNENFVTQVLKIGVKIGVKQWVRLFGDSVKSER  425

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + EA+K+V++GEE+EEMR RAK + + A++A+
Sbjct  426   VKEAVKRVLVGEEAEEMRRRAKALAEMAREAV  457



>gb|ADO33118.1| UDP glucosyltransferase [Scutellaria barbata]
Length=477

 Score =   519 bits (1337),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 261/458 (57%), Positives = 338/458 (74%), Gaps = 13/458 (3%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             MG LH+   PM+AHGHMIP LDMAKLF+SRGV+ TII TPA    F+  V K  + G  +
Sbjct  1     MGQLHIILVPMIAHGHMIPLLDMAKLFSSRGVQTTIIATPA----FADPVRKAREAGHDI  56

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
              + +  FP     LP++   LDQ   +D +  FF+A  +LQ P+E++++EL+PDCLV+DM
Sbjct  57    GLTITSFPPEGSSLPDNILSLDQV-TNDMIAEFFRALELLQQPVEEIMKELKPDCLVSDM  115

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             F PW T++AAKF IPRLIFHGT   + C    + + KPF +VSSDSE F IPNLPHEL  
Sbjct  116   FLPWTTDSAAKFGIPRLIFHGTCCFSRCCAIEMGLQKPFKNVSSDSEPFVIPNLPHELSF  175

Query  612   TKLQVSPFERSE--VENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRA  785
              + QV  FE  E   EN  ++ M+ +R SE +SYG + NSF ELE +YA+HYKN+LG +A
Sbjct  176   VRTQVPDFELQEDVNENPFTKMMKQMRESEARSYGDVINSFQELESEYADHYKNILGMKA  235

Query  786   WSVGPLSLYNRDVEDKA-ERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLH  962
             W +GPL L N+  E+KA +RGKKS IDE ECL WL+SK P+SVVY+CFGS+A F P+QLH
Sbjct  236   WHIGPLLLCNKRGEEKASQRGKKSVIDEDECLAWLNSKKPNSVVYMCFGSMATFTPAQLH  295

Query  963   EMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPA  1142
             E A+G+E SG DF+WV+RN  E    +E W+P+GFEER KG+GL+IRGWAPQV+IL+HP+
Sbjct  296   ETAVGLESSGQDFIWVVRNAGE----NEDWLPQGFEERIKGRGLMIRGWAPQVMILNHPS  351

Query  1143  VGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD  1322
             VGAFVTHCGWNSTLEG+C G+PMVTWPV AEQF NEKL+T++L+TG  VG+K+W ++  D
Sbjct  352   VGAFVTHCGWNSTLEGICAGLPMVTWPVSAEQFYNEKLVTEVLKTGVSVGNKKWHKV-GD  410

Query  1323  GVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             GV  EA+  A+ +VM+G+ + EMRSRAK  K+ A KAI
Sbjct  411   GVGSEAVKAAVVQVMVGDGAAEMRSRAKHYKEMAGKAI  448



>ref|XP_011000140.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=486

 Score =   520 bits (1338),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 253/453 (56%), Positives = 334/453 (74%), Gaps = 5/453 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LHV F P MA GHMIPT+DMA+LFA RGVKATII+TP N P FSKA+++  QLG  + IR
Sbjct  8     LHVLFLPYMAPGHMIPTIDMARLFARRGVKATIISTPLNAPFFSKAIERDGQLGHDISIR  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
             +++FP  E GLPE C+ L      D    FFKA +MLQ P+E LL+E  P CLVADM F 
Sbjct  68    IIKFPAAEAGLPEGCENLSSIKSWDMHANFFKAMSMLQQPIEQLLEECHPHCLVADMTFT  127

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT  A K  IPRL F+GTS+ A+C   SL+ Y+P   V SD E F +P LP ++K T+ 
Sbjct  128   WATEVADKLRIPRLYFNGTSYFAMCVFDSLKRYEPHRRVDSDFEPFIVPGLPDQIKTTRQ  187

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             QV  + +   E+  ++F+  V  SE +SYGV+ NSF+ELEP Y+EHY  V+GR+AW +GP
Sbjct  188   QVPDYLKQTTEHEFTKFVNQVSESEVRSYGVLVNSFHELEPAYSEHYTKVMGRKAWHLGP  247

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             LSL NR++EDKAERG  ++I +HECL+WLD K P+SV+YICFGS+ +F  +QL E+A+ +
Sbjct  248   LSLCNRNIEDKAERGNTASIGKHECLRWLDLKKPNSVLYICFGSLFDFPAAQLREIALAL  307

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             EDSG +F+WV+R  + ED   E+W+PEGFE R +GKGLIIRGWAPQV+ILDH AVG F+T
Sbjct  308   EDSGQNFIWVVR--KHEDK--EEWLPEGFERRMEGKGLIIRGWAPQVLILDHKAVGGFMT  363

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD-GVKRE  1337
             HCGWNSTLE V  GVP+VTWP++AEQF NEKL+TD+L+ G GVG+ EW R      V+++
Sbjct  364   HCGWNSTLEAVTAGVPLVTWPLYAEQFDNEKLITDVLKIGIGVGALEWSRYAKKILVRKD  423

Query  1338  AIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              I +AI ++M GEE+EE+R+RA+ +++ A+ A+
Sbjct  424   DIEKAIVQLMAGEEAEEIRNRARELQEMARNAM  456



>ref|XP_004140708.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Cucumis sativus]
 ref|XP_004167459.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Cucumis sativus]
 gb|KGN57511.1| hypothetical protein Csa_3G200710 [Cucumis sativus]
Length=477

 Score =   519 bits (1336),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 246/452 (54%), Positives = 326/452 (72%), Gaps = 3/452 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             L +FFFP MA GH IP +DMAKLFASRG    IITTP N P+ +K+++K+ + G ++E+ 
Sbjct  8     LRIFFFPFMAQGHTIPAIDMAKLFASRGADVAIITTPLNAPLIAKSINKFDRPGRKIELL  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
             +++FP V VGLP+ C+ LD     +    FF+A  +L+P ++ +L   RP CLVAD FFP
Sbjct  68    IIDFPSVAVGLPDGCESLDLARSPEMFQSFFRATTLLEPQIDQILDHHRPHCLVADTFFP  127

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             W T+ AAK+ IPR++FHGT   ALCA  SL   +P+  VSSD E F IP LP E+K+T+ 
Sbjct  128   WTTDLAAKYGIPRVVFHGTCFFALCAAASLIANRPYKKVSSDLEPFVIPGLPDEIKLTRS  187

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             QV  F + EVE    +   + +  E + YG + NSFYELEP YA++Y+NVLGRRAW +GP
Sbjct  188   QVPGFLKEEVETDFIKLYWASKEVESRCYGFLINSFYELEPAYADYYRNVLGRRAWHIGP  247

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             LSLY+   ED  +RG  S+I E +CLKWLDSKNP SV+Y+ FGS+A+   SQL E+A G+
Sbjct  248   LSLYSNVEEDNVQRGSSSSISEDQCLKWLDSKNPDSVLYVSFGSLASLTNSQLLEIAKGL  307

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E +G +F+WV++  + +    E+W+PEGFE+R +GKGLIIRGWAPQV+ILDH ++G FVT
Sbjct  308   EGTGQNFIWVVKKAKGD---QEEWLPEGFEKRVEGKGLIIRGWAPQVLILDHRSIGGFVT  364

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNS LEGV  GVPMVTWP  AEQF NEKL+TD+L+ G GVG+  W R   D +K EA
Sbjct  365   HCGWNSALEGVTAGVPMVTWPNSAEQFYNEKLITDVLQIGVGVGALYWGRAGKDEIKSEA  424

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             I +A+ +VM+GEE+EEMRSRAK +  +A+KAI
Sbjct  425   IEKAVNRVMVGEEAEEMRSRAKALGIQARKAI  456



>ref|XP_004159901.1| PREDICTED: UDP-glycosyltransferase 73B3-like [Cucumis sativus]
Length=483

 Score =   519 bits (1336),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 250/458 (55%), Positives = 336/458 (73%), Gaps = 5/458 (1%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAV---DKYTQLGFQ  248
              LH+F FP+MA GHMIP +DMAKL +SRGVK TI+TTP N    S ++    K      +
Sbjct  4     QLHMFLFPIMAPGHMIPMVDMAKLLSSRGVKITIVTTPLNSISISNSIHNNSKSISPPPK  63

Query  249   MEIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVAD  428
             + + +L+FP  EVGLP+ C+ LD    +  +P+F  AC +LQ P E+ + E RP C++AD
Sbjct  64    IHLLILKFPSAEVGLPDGCENLDSVTGNAMIPKFISACNLLQTPFEEAVMEHRPHCILAD  123

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             +FFPWA + AAKF IPRL FHGT   + CA   +R+++P+  VSS++E F IP LP E+ 
Sbjct  124   IFFPWANDVAAKFGIPRLTFHGTGFFSTCASEFIRIHEPYKHVSSETEPFLIPCLPGEIT  183

Query  609   ITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
              TK+++  F     +N +SEFM+    +  K YG+I NSFYELE +YA+ Y+NV GR+ W
Sbjct  184   FTKMKLPEFMWENYKNDLSEFMKRAFEASSKCYGLIMNSFYELEAEYADCYRNVFGRKVW  243

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
              +GPLSL N+D+E+KA+RG KSAIDEHECLKWLDS+ P+SVVY+ FGS+A F   QL E+
Sbjct  244   HIGPLSLCNKDIEEKAQRGNKSAIDEHECLKWLDSQKPNSVVYVSFGSMAKFNADQLKEI  303

Query  969   AMGIEDSGMDFVWVIRN-KREEDNGSEK-WMPEGFEERTKGKGLIIRGWAPQVVILDHPA  1142
             A+G+E S  +F+WV+R  K +E+ G +K W+PEG+E+R +GKG+IIRGWAPQV+ILDHP 
Sbjct  304   AIGLEASRKNFIWVVRKVKGDEEKGEDKDWLPEGYEQRMEGKGMIIRGWAPQVLILDHPG  363

Query  1143  VGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD  1322
             VG FVTHCGWNSTLEGV  GVPMVTWPV AEQF NEKL+T++L+ G GVG ++W R   D
Sbjct  364   VGGFVTHCGWNSTLEGVAAGVPMVTWPVAAEQFYNEKLLTEVLKIGVGVGVQKWVRTVGD  423

Query  1323  GVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              +K EA+ +AI++VM G+E+EEMR++AK + + AKKAI
Sbjct  424   FIKSEAVEKAIRRVMEGKEAEEMRNKAKELAEMAKKAI  461



>gb|AAS94329.1| UDP-glucose:flavonoid-O-glucosyltransferase [Beta vulgaris]
Length=476

 Score =   518 bits (1334),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 256/456 (56%), Positives = 342/456 (75%), Gaps = 13/456 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGF-QMEI  257
             LH+  FP MAHGHMIPTLD+A+LFA+RGVK T+ITTP N P F  A++K  + G   + +
Sbjct  8     LHIVLFPFMAHGHMIPTLDIARLFAARGVKTTLITTPRNAPTFLTAIEKGNKSGAPTINV  67

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +  F     GLPE C+ L+Q        RFFKA AML+  LE  L++ RP+CLVADMFF
Sbjct  68    EVFNFQAQSFGLPEGCENLEQALGPGIRDRFFKAAAMLRDQLEHFLEKTRPNCLVADMFF  127

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWAT++AAKF+IPRL+FHG    ALCA+  +R+++P+N+ SSD E F +P+LPHE+++T+
Sbjct  128   PWATDSAAKFNIPRLVFHGHCLFALCALEIIRLHEPYNNASSDEEPFLLPHLPHEIELTR  187

Query  618   LQVSP-FERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSV  794
             LQ S    ++  ++   E  ++++ SE K YGV+ NSFYELEPDYAE+++  LGRRAW++
Sbjct  188   LQFSEELWKNGGDSDYKERSKAIKESELKCYGVLVNSFYELEPDYAEYFRKDLGRRAWNI  247

Query  795   GPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAM  974
             GP+SLYNR  E+KA+RGK+++IDEHECLKWL+SK P+SV+YICFGS  +  PSQL+E+AM
Sbjct  248   GPVSLYNRSNEEKAQRGKQASIDEHECLKWLNSKKPNSVIYICFGSTMHMIPSQLNEIAM  307

Query  975   GIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAF  1154
             G+E SG DF+WV+RN  E+D G        FE+R +GKGLIIRGWAPQV+IL+H  +GAF
Sbjct  308   GLEASGKDFIWVVRN--EDDLGE-------FEQRMEGKGLIIRGWAPQVLILEHEVIGAF  358

Query  1155  VTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDG--V  1328
             VTHCGWNST+EG+  GVPMVTWPVFAEQF+NEKL+T +LR G  VG+K+W    S+   V
Sbjct  359   VTHCGWNSTIEGIAAGVPMVTWPVFAEQFLNEKLITRVLRIGIPVGAKKWDCKPSEEYVV  418

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             K+  I +A+++VM G E+EE R+RAK  K+ A KA+
Sbjct  419   KKNDIEKALREVMEGNEAEERRTRAKEYKEMAWKAL  454



>dbj|BAA83484.1| UDP-glucose: flavonoid 7-O-glucosyltransferase [Scutellaria baicalensis]
Length=476

 Score =   518 bits (1334),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 252/457 (55%), Positives = 343/457 (75%), Gaps = 12/457 (3%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             MG LH+   PM+AHGHMIP LDMAKLF+SRGVK TII TPA    F++ + K  + G  +
Sbjct  1     MGQLHIVLVPMIAHGHMIPMLDMAKLFSSRGVKTTIIATPA----FAEPIRKARESGHDI  56

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
              +   +FP     LP++ + LDQ   DD LP FF+A  +LQ P+E+++++L+PDCLV+DM
Sbjct  57    GLTTTKFPPKGSSLPDNIRSLDQV-TDDLLPHFFRALELLQEPVEEIMEDLKPDCLVSDM  115

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             F PW T++AAKF IPRL+FHGTS  A C    + + KP+ +VSSDSE F +  LPHE+  
Sbjct  116   FLPWTTDSAAKFGIPRLLFHGTSLFARCFAEQMSIQKPYKNVSSDSEPFVLRGLPHEVSF  175

Query  612   TKLQVSPFERSEV-ENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
              + Q+  +E  E  ++  S+  + +R +++KSYG + NSF ELE +YA++ KNV G++AW
Sbjct  176   VRTQIPDYELQEGGDDAFSKMAKQMRDADKKSYGDVINSFEELESEYADYNKNVFGKKAW  235

Query  789   SVGPLSLYNRDVEDKA-ERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHE  965
              +GPL L+N   E K+ +RGK+SAID+HECL WL+SK P+SVVY+CFGS+A F P+QLHE
Sbjct  236   HIGPLKLFNNRAEQKSSQRGKESAIDDHECLAWLNSKKPNSVVYMCFGSMATFTPAQLHE  295

Query  966   MAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAV  1145
              A+G+E SG DF+WV+RN  E    +E W+P+GFEER KGKGL+IRGWAPQV+ILDHP+ 
Sbjct  296   TAVGLESSGQDFIWVVRNGGE----NEDWLPQGFEERIKGKGLMIRGWAPQVMILDHPST  351

Query  1146  GAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDG  1325
             GAFVTHCGWNSTLEG+C G+PMVTWPVFAEQF NEKL+T++L+TG  VG+K+W+R+  +G
Sbjct  352   GAFVTHCGWNSTLEGICAGLPMVTWPVFAEQFYNEKLVTEVLKTGVSVGNKKWQRV-GEG  410

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             V  EA+ EA+++VM+G+ + EMRSRA   K+ A+KA+
Sbjct  411   VGSEAVKEAVERVMVGDGAAEMRSRALYYKEMARKAV  447



>ref|XP_010691725.1| PREDICTED: scopoletin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=476

 Score =   518 bits (1333),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 256/456 (56%), Positives = 341/456 (75%), Gaps = 13/456 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGF-QMEI  257
             LH+  FP MAHGHMIPTLD+A+LFA+RGVK T+ITTP N P F  A++K  + G   + +
Sbjct  8     LHIVLFPFMAHGHMIPTLDIARLFAARGVKTTLITTPRNAPTFLTAIEKGNKSGAPTINV  67

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +  F     GLPE C+ L+Q        RFFKA AML+  LE  L++ RP+CLVADMFF
Sbjct  68    EVFNFQAQSFGLPEGCENLEQALGPGIRDRFFKAAAMLRDQLEHFLEKTRPNCLVADMFF  127

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWAT++AAKF+IPRL+FHG    ALCA+  +R+++P+N+ SSD E F +P+LPHE+++T+
Sbjct  128   PWATDSAAKFNIPRLVFHGHCLFALCALEIIRLHEPYNNASSDEEPFLLPHLPHEIELTR  187

Query  618   LQVSP-FERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSV  794
             LQ S    ++  ++   E  ++++ SE K YGV+ NSFYELEPDYAE+++  LGRRAW++
Sbjct  188   LQFSEELWKNGGDSDYKERSKAIKESELKCYGVLVNSFYELEPDYAEYFRKDLGRRAWNI  247

Query  795   GPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAM  974
             GP+SLYNR  E+KA+RGK+++IDEHECLKWL+SK P+SV+YICFGS  +  PSQL+E+AM
Sbjct  248   GPVSLYNRSNEEKAQRGKQASIDEHECLKWLNSKKPNSVIYICFGSTMHMIPSQLNEIAM  307

Query  975   GIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAF  1154
             G+E SG DF+WV+RN  E+D G        FE R +GKGLIIRGWAPQV+IL+H  +GAF
Sbjct  308   GLEASGKDFIWVVRN--EDDLGE-------FEHRMEGKGLIIRGWAPQVLILEHEVIGAF  358

Query  1155  VTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEW--KRLDSDGV  1328
             VTHCGWNST+EG+  GVPMVTWPVFAEQF+NEKL+T +LR G  VG+K+W  K  +   V
Sbjct  359   VTHCGWNSTIEGIAAGVPMVTWPVFAEQFLNEKLITRVLRIGIPVGAKKWDCKPCEEYVV  418

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             K+  I +A+++VM G E+EE R+RAK  K+ A KA+
Sbjct  419   KKNDIEKALREVMEGNEAEERRTRAKEYKEMAWKAL  454



>ref|XP_010905295.1| PREDICTED: scopoletin glucosyltransferase-like [Elaeis guineensis]
Length=481

 Score =   518 bits (1333),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 249/453 (55%), Positives = 336/453 (74%), Gaps = 1/453 (0%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH+ FFP MAHGHMIP +++A+LFA+RG+K +II+TP N P +SK  ++   LG+Q++I
Sbjct  8     QLHICFFPFMAHGHMIPMMEIARLFATRGLKISIISTPVNVPQYSKFTERSKILGYQVDI  67

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +++FP VE GLPE C+ LD     D    FF A  ML P LE LL++ RPD LVADMFF
Sbjct  68    LVIKFPCVEAGLPEGCEHLDMALSGDLNRNFFTAAGMLGPQLEQLLKKHRPDGLVADMFF  127

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWAT+ A    IPR++FHGT   +LCA   +R+Y+P   VSSD+E F IPN P E+K+T+
Sbjct  128   PWATDIAHSLGIPRIVFHGTGFFSLCAAECVRLYEPHKKVSSDTEPFVIPNFPGEIKLTR  187

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
              Q+  F + E  +  ++    ++ SE KS+GV+ NSFYELEP YA+H++NV GR+AW VG
Sbjct  188   NQLPHFAKIEGHH-FAQLHIDIKESELKSFGVLVNSFYELEPAYADHFRNVFGRKAWHVG  246

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             P+ L N D EDKA RGK+++I+  ECLKWLDSK P+SVVYI FGS+A F  SQL E+AMG
Sbjct  247   PVFLCNSDFEDKANRGKEASIEVLECLKWLDSKKPNSVVYISFGSLARFTSSQLLEIAMG  306

Query  978   IEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             +EDSG  F+WV++ + +   G E+W+PEGFEER +GKGL I+GW PQV+IL+H AVG F+
Sbjct  307   LEDSGQHFIWVVKQEGDGQEGKEEWLPEGFEERMEGKGLTIKGWVPQVLILEHVAVGGFL  366

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKRE  1337
             THCGWNS LEG+  GVPMVTWPV AEQF NEKL+T+IL  G GVG ++W  +  D VK+E
Sbjct  367   THCGWNSALEGIAAGVPMVTWPVSAEQFYNEKLVTEILGVGVGVGIQQWVVVVGDCVKKE  426

Query  1338  AIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             A+A+A+  +M+G+E+EEMR+RA+ + + A++A+
Sbjct  427   AVAKAVNHIMVGKEAEEMRTRARELGELARRAV  459



>ref|XP_009108750.1| PREDICTED: UDP-glucosyl transferase 73B2-like [Brassica rapa]
Length=513

 Score =   518 bits (1335),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 266/485 (55%), Positives = 344/485 (71%), Gaps = 17/485 (4%)
 Frame = +3

Query  18    AEISQSIKNFAVSSKDFAMGD---LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITT  188
             ++IS++I +F+  SK     +   LHV FFP+MAHGHMIPTLDMAKLF+SRG K+TI+TT
Sbjct  15    SQISRNI-SFSFQSKSNMTSNSHKLHVMFFPIMAHGHMIPTLDMAKLFSSRGAKSTILTT  73

Query  189   PANQPVFSKAVDKYTQLG--FQMEIRLLEFPGVEVGLPESCQRLD-----QTPDDDG--L  341
             P N  +  K +D +  L    Q+EI++L+FP V++GLPE C+  D        DD    +
Sbjct  74    PLNAKILQKPIDTFKNLNPSLQIEIQILDFPCVQLGLPEGCENADFFTLTNNSDDRRAMI  133

Query  342   PRFFKACAMlqppledllqelrpdCLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAM  521
              +FF A    +  LE+LL+  RPDCL+ADMFFPWAT AA KF +PRL+FHGT + +LCA 
Sbjct  134   SKFFLATRFFKDQLENLLETRRPDCLIADMFFPWATEAAEKFHVPRLVFHGTGYFSLCAS  193

Query  522   HSLRVYKPFNDVSSDSELFTIPNLPHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEK  701
             + +RV+ P   V++ SE F IP+LP  + IT+ Q+   +R E +  M +FM  V  SE K
Sbjct  194   YCIRVHNPQKRVATSSEPFVIPDLPGNIVITQGQI--LDRGE-DTEMGKFMTEVLESEAK  250

Query  702   SYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLK  881
             S GV+ NSFYELEPDYA+ YK+ + +RAW +GPLS++NR  E+KAERGKK++IDE ECLK
Sbjct  251   SSGVVVNSFYELEPDYADFYKSSVAKRAWHIGPLSVHNRGFEEKAERGKKASIDEAECLK  310

Query  882   WLDSKNPHSVVYICFGSVANFAPSQLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPE  1061
             WLDSK P SVVYI FGSVAN    QL E+A G+E S   F+WV+R   E     E+W+PE
Sbjct  311   WLDSKKPDSVVYISFGSVANIKNEQLIEIAAGLEASDTSFIWVVRKNGENTGDKEEWLPE  370

Query  1062  GFEERTKGKGLIIRGWAPQVVILDHPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQF  1241
             GFEER KG+G+IIRGWAPQV+ILDH A G FVTHCGWNS LEGV  G+PMVTWPV AEQF
Sbjct  371   GFEERVKGRGMIIRGWAPQVLILDHQATGVFVTHCGWNSLLEGVAAGLPMVTWPVGAEQF  430

Query  1242  INEKLMTDILRTGTGVGSKEWKRLDSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDK  1421
              NE L+T +LRTG  VGS +   +  D + RE + +A+K+V+ GEE+EEMRSRAK + + 
Sbjct  431   YNEILVTQVLRTGVSVGSNK-HAIMGDFISRENVEKAVKEVLAGEEAEEMRSRAKKLAEM  489

Query  1422  AKKAI  1436
             AK A+
Sbjct  490   AKAAV  494



>dbj|BAD52006.1| UDP-glucose: chalcononaringenin 2'-O-glucosyltransferase [Dianthus 
caryophyllus]
Length=475

 Score =   517 bits (1331),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 253/455 (56%), Positives = 334/455 (73%), Gaps = 10/455 (2%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LHV FFP MAHGHMIPT D+AKLFA R VK TIITTP N   F+K           M +
Sbjct  7     QLHVAFFPFMAHGHMIPTFDLAKLFAGRDVKTTIITTPMNAHAFAKT-------NVPMNL  59

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +  FP  E GLPE+C+ L+Q      LP F KA AML   LE  L+  +P+CLVADMFF
Sbjct  60    EIFTFPAQEAGLPENCENLEQAMSIGLLPAFIKASAMLCDQLERFLERSQPNCLVADMFF  119

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWAT +A KF++PR++FHGT  L+LCA    R+Y+PF +VSSD E+  +P LPHE+K+T+
Sbjct  120   PWATESARKFNVPRIVFHGTGFLSLCAKEVERLYRPFKNVSSDDEVVVLPRLPHEVKLTR  179

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
              QVS  E S+ +N  ++    ++ SE +SYGVI NSFYELEP++A+ ++N LGRRAW+VG
Sbjct  180   TQVSEEEWSDDDNEFNKRSARIKESEVESYGVIVNSFYELEPEFADFFRNELGRRAWNVG  239

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             P+SL NR  EDKA RGK++ ++E ECL WLDSK   SVVY+CFGS A++AP+QLHE+A  
Sbjct  240   PVSLCNRKTEDKARRGKQANVNEQECLIWLDSKKCASVVYVCFGSTAHYAPAQLHEIANA  299

Query  978   IEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             +E SG +FVW + N  +  +G E+ +P+GFE+RT+G+GLIIRGWAPQV+IL+H AVGAF+
Sbjct  300   LEASGHNFVWAVGNVDKGSDG-EELLPQGFEQRTEGRGLIIRGWAPQVLILEHEAVGAFM  358

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKR--LDSDGVK  1331
             THCGWNSTLEG+  GVPMVTWPVFAEQF NEKL+T IL+    VG+K+W R  +    + 
Sbjct  359   THCGWNSTLEGISAGVPMVTWPVFAEQFYNEKLVTQILKIRVEVGAKKWSRTAMIEHKIS  418

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              +AI +A+K++M GE++EEMR++A+ +K+ A KA+
Sbjct  419   GDAIEKALKEIMEGEKAEEMRNKARQLKEMAWKAV  453



>ref|XP_011000854.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=486

 Score =   517 bits (1331),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 256/460 (56%), Positives = 334/460 (73%), Gaps = 6/460 (1%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             +  LH  FFP MAHGHMIP +DMAKLFASRG+K TI+TTP N P+FSK V +   LGF++
Sbjct  5     VNQLHALFFPFMAHGHMIPLVDMAKLFASRGLKTTIVTTPLNVPLFSKTVQRTKNLGFEI  64

Query  252   EIRLLEFPGVEVGLPESCQRLD----QTPDDDGLPRFFKACAMlqppledllqelrpdCL  419
              IR +EF  VE GLPE C+  D    Q    D L +FF A   LQ PLE LL+E+ PDCL
Sbjct  65    NIRTIEFSTVETGLPEGCENADLIISQAMGWDMLKKFFAATTFLQEPLERLLEEIHPDCL  124

Query  420   VADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPH  599
             +ADMFFPW T+AAAKF IPRL+FHGTS  +LC   SLR+Y+P   VSSD E F +PNLP 
Sbjct  125   IADMFFPWTTDAAAKFGIPRLVFHGTSFFSLCVGQSLRLYEPHKKVSSDCEPFFMPNLPD  184

Query  600   ELKITKLQVSPFERSEVE-NTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
             ++K+T+ ++   ER + E +  ++  + V+  + KSYGV+ NSFYELEP YA+HY+   G
Sbjct  185   DIKLTRNELPYPERHDDESDDFNKMYKKVKEGDSKSYGVVVNSFYELEPVYADHYRKAFG  244

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             R+AW VGP+SL NR+++DKAERG++++I+E+ECL WL++K P SVVYICFGS+ +F+ SQ
Sbjct  245   RKAWHVGPVSLCNRNIDDKAERGREASINENECLSWLETKKPDSVVYICFGSMVSFSASQ  304

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A G+E SG  F+WV++N    +   E W+P  FE+R +GKGLIIRGWAPQV+ILDH
Sbjct  305   LKEIAKGLEASGQQFIWVVKNTINSEE-EEAWLPVRFEKRMEGKGLIIRGWAPQVLILDH  363

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD  1316
              A+G FVTHCGWNSTLEG+  GVPM T P+ AEQF NEKL+T IL+ G  +G +E   L 
Sbjct  364   EAIGGFVTHCGWNSTLEGITAGVPMATCPLSAEQFYNEKLVTQILKIGIRIGVQEQALLG  423

Query  1317  SDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              D +K +A+ EA+ ++M GEE+EEMR + K     A+KAI
Sbjct  424   GDSIKSKALEEAVSRLMEGEEAEEMRGKVKAFGKMARKAI  463



>ref|XP_010027865.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW54506.1| hypothetical protein EUGRSUZ_I00448 [Eucalyptus grandis]
Length=484

 Score =   516 bits (1330),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 238/452 (53%), Positives = 328/452 (73%), Gaps = 2/452 (0%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             +H+FFFP MA GHMIP ++MAKLFA RG K+T+I TP ++P F K++ K    GF +++ 
Sbjct  7     VHIFFFPFMASGHMIPMIEMAKLFAIRGCKSTLIATPHDKPTFLKSITKTKDAGFDIDVV  66

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              +  P  EVGLPE    +++   ++   +F++A  ML   LE L+++L P+CLV+DMF P
Sbjct  67    TVTLPLKEVGLPEDSDNMNKITTEEIRKQFYRAIRMLDQQLERLIEKLAPNCLVSDMFLP  126

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             W T  AAK+ IPRL+FHG+S  +      +R+Y+P   VS DSE F IPN P E+ ++++
Sbjct  127   WTTEIAAKWGIPRLVFHGSSAFSSAGAGCVRIYEPHKKVSHDSEPFIIPNFPGEITMSRM  186

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+  F R E E T  +F   V+ SE++S+GV+ NSFYELEP YA+HY+  LGRR+W VGP
Sbjct  187   QLPDFYREETEFT--KFFNEVKESEKRSFGVVMNSFYELEPAYADHYRTFLGRRSWFVGP  244

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             LSL N++ EDKA RG +++ID+HECLKWLDS+ P+SV+YICFGS+ANF  SQLHE+ +G+
Sbjct  245   LSLCNKESEDKAHRGNQASIDQHECLKWLDSRQPNSVIYICFGSMANFNASQLHEIVVGL  304

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG  F+WV++     + G E+W+P+G+E R + KGLIIRGWAPQV+ILDH A+G FVT
Sbjct  305   EASGQQFIWVVKKDPNVEEGKEEWLPDGYESRIRNKGLIIRGWAPQVLILDHEAIGGFVT  364

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLE +  GVPMVTWPV AEQF NEK +T +L+ G  +G K+W RL  D VK E 
Sbjct  365   HCGWNSTLEAITAGVPMVTWPVAAEQFFNEKFVTQVLKVGVSIGVKQWVRLFGDSVKSER  424

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + +A+K+V++ EE+EEMR RAK + + A+ A+
Sbjct  425   VEDAVKRVLVSEEAEEMRRRAKALAEMARGAV  456



>ref|XP_002518722.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43647.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=461

 Score =   515 bits (1327),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 247/445 (56%), Positives = 335/445 (75%), Gaps = 6/445 (1%)
 Frame = +3

Query  105   MAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIRLLEFPGVE  284
             MA GH IP +DMAKLFASRG K +IITTP N P  SK++ +   LG +++I +++FP VE
Sbjct  1     MAQGHSIPLIDMAKLFASRGQKVSIITTPVNAPDISKSIQRSRVLGHKIDIVIIKFPCVE  60

Query  285   VGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFPWATNAAAK  464
              GLPE C+ L+     + +  FF+A  +L  PLE LL++  PDCLV+D FFPW+   A+K
Sbjct  61    AGLPEGCEHLELVTSPEMVSVFFQATTILAQPLEHLLKKYCPDCLVSDTFFPWSNKVASK  120

Query  465   FDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKLQVSPFERS  644
             F IPR++F GT   + CA   + +Y+P  +VSSD+++F IPNLP E+K+T+ Q+  F + 
Sbjct  121   FGIPRIVFSGTCFFSSCASQCMYLYQPCKNVSSDTDVFVIPNLPREIKLTRNQLPEFVKE  180

Query  645   EVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGPLSLYNRDV  824
             E   + S++ R V+ +E KSYGV+ NSFYELEP YA+HY+NVLG +AW +GP+SL N + 
Sbjct  181   E--TSFSDYYRKVKEAEAKSYGVLVNSFYELEPTYADHYRNVLGIKAWHIGPISLCNSNN  238

Query  825   EDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGIEDSGMDFV  1004
             +D   RGK+++IDE+ECL+WL+SK P+SVVYICFGS+ANF  SQL E+AMG+EDSG  F+
Sbjct  239   QDMLNRGKEASIDENECLEWLNSKKPNSVVYICFGSLANFVSSQLLEIAMGLEDSGQQFI  298

Query  1005  WVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVTHCGWNSTL  1184
             WV++  +  +   E W+P+GFEER K KGLIIRGWAPQV+IL+H AVG FVTHCGWNSTL
Sbjct  299   WVVKKSKSNE---EDWLPDGFEERMKEKGLIIRGWAPQVMILEHKAVGGFVTHCGWNSTL  355

Query  1185  EGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREAIAEAIKKV  1364
             E V  GVPMVTWPV AEQF NEKL+T++LR G  VG+++W +L+ DGVK+EAI +A+ +V
Sbjct  356   EAVSAGVPMVTWPVSAEQFYNEKLITEVLRIGVAVGAQKWLKLEGDGVKKEAINKAVTQV  415

Query  1365  MI-GEESEEMRSRAKVMKDKAKKAI  1436
             M+ G+E+EEMR RA+ + + AKKA+
Sbjct  416   MVGGKEAEEMRCRAEKLGEMAKKAV  440



>ref|XP_003628776.1| Glucosyltransferase [Medicago truncatula]
 gb|AET03252.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=489

 Score =   516 bits (1330),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 245/456 (54%), Positives = 346/456 (76%), Gaps = 7/456 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+  FP M HGH IPT+DMAKLFAS+GV+ TI+TTP N+P  SKA+++       ++I+
Sbjct  8     LHILVFPFMGHGHTIPTIDMAKLFASKGVRVTIVTTPLNKPPISKALEQSKIHFNNIDIQ  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              ++FP VE GLPE C+ +D  P    +P FF A  +LQ P E+LL + +P C+VADMFFP
Sbjct  68    TIKFPCVEAGLPEGCENVDSIPSVSFVPAFFAAIRLLQQPFEELLLQQKPHCVVADMFFP  127

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT++AAKF IPR++FHGTS  +LCA   ++ Y+P+ +VSSD++LF I +LP  +K+T+L
Sbjct  128   WATDSAAKFGIPRIVFHGTSFFSLCASQCMKKYQPYKNVSSDTDLFEITDLPGNIKMTRL  187

Query  621   QV--SPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSV  794
             Q+  +  E   +  + ++    ++ SE +SYGVI NSFYELE  YA++Y+ VLG + W +
Sbjct  188   QLPNTLTENDPISQSFAKLFEEIKDSEVRSYGVIVNSFYELENVYADYYREVLGIKEWHI  247

Query  795   GPLSLYNRDVEDK--AERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
             GP S++NR+ E++  + RGK+++ID+HECLKWLD+KN +SVVY+CFGS+ +F  SQL E+
Sbjct  248   GPFSIHNRNKEEEIPSYRGKEASIDKHECLKWLDTKNINSVVYMCFGSMTHFLNSQLKEI  307

Query  969   AMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVG  1148
             AMG+E SG +F+WV+R + E+    ++W+PEGFEERT+GKGLIIRGW+PQV+IL+H A+G
Sbjct  308   AMGLEASGHNFIWVVRTQTED---GDEWLPEGFEERTEGKGLIIRGWSPQVMILEHEAIG  364

Query  1149  AFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGV  1328
             AFVTHCGWNS LEGV  GVPM+TWPV AEQF NEKL+T++L+TG  VG K+W     D V
Sbjct  365   AFVTHCGWNSVLEGVVAGVPMITWPVAAEQFYNEKLVTEVLKTGVPVGVKKWVMKVGDNV  424

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + +A+ +A+K+VM GEE+ EMR++AK++ + AKKA+
Sbjct  425   EWDAVEKAVKRVMEGEEAYEMRNKAKMLAEMAKKAV  460



>ref|XP_002867135.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43394.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=482

 Score =   516 bits (1329),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 257/460 (56%), Positives = 336/460 (73%), Gaps = 13/460 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQME  254
             LHV FFP MA+GH+IPTLDMAKLF+SRG K+TI+TTP N  +  K +D +  L    +++
Sbjct  9     LHVMFFPFMAYGHLIPTLDMAKLFSSRGAKSTILTTPLNSKILQKPIDTFKNLNPSLEID  68

Query  255   IRLLEFPGVEVGLPESCQRLD---QTPDDDG---LPRFFKACAMlqppledllqelrpdC  416
             I++ +FP VE+GLPE C+ +D      +DD      +FF +    +  LE LL+  RPDC
Sbjct  69    IQIFDFPCVELGLPEGCENVDFFTSNNNDDRQYLTLKFFLSTRFFKDQLEKLLETTRPDC  128

Query  417   LVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLP  596
             L+ADMFFPWAT AA K ++PRL+FHGT + +LC+ + +RV+ P N V+S  E F IP+LP
Sbjct  129   LIADMFFPWATEAAEKLNVPRLVFHGTGYFSLCSEYCIRVHNPQNRVASSCEPFVIPDLP  188

Query  597   HELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
               + ITK Q++  +R E E+ M +FM  V+ S+ KS GVI NSFYELEPDYA  YK+V+ 
Sbjct  189   GNIVITKEQIA--DRDE-ESEMGKFMIEVKESDVKSSGVIVNSFYELEPDYANFYKSVVV  245

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             +RAW +GPLS+YNR  E+KAERGKK++IDE ECLKWLDSK P SV+YI FGSVA F   Q
Sbjct  246   KRAWHIGPLSVYNRGFEEKAERGKKASIDEVECLKWLDSKKPDSVIYISFGSVACFKNEQ  305

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A G+E SG +F+WV+R  +   N  E+W+PEGFEER KGKG+IIRGWAPQV+ILDH
Sbjct  306   LFEIAAGLETSGANFIWVVR--KNTGNDKEEWLPEGFEERVKGKGMIIRGWAPQVLILDH  363

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD  1316
              A G FVTHCGWNS LEGV  G+PMVTWPV AEQF NEKL+T +LRTG  VG+K+  R  
Sbjct  364   QATGGFVTHCGWNSLLEGVAAGLPMVTWPVGAEQFYNEKLVTQVLRTGVSVGAKKHVRTT  423

Query  1317  SDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              D + RE + +A+++V++GEE++E R RAK + + AK A+
Sbjct  424   GDFISREKVDKAVREVLVGEEADERRERAKKLAEMAKAAV  463



>dbj|BAD44687.1| UDP-glucose:anthocyanin 3'-O-glucosyltransferase [Gentiana scabra 
var. buergeri]
Length=482

 Score =   516 bits (1328),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 257/448 (57%), Positives = 340/448 (76%), Gaps = 6/448 (1%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             M  LHVFFFP +A+GH++PT+DMAKLF+SRGVKAT+ITT  N  +F KA+ +   LGF +
Sbjct  1     MDQLHVFFFPFLANGHILPTIDMAKLFSSRGVKATLITTHNNSAIFLKAISRSKILGFDI  60

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
              +  ++FP  E GLPE  +  DQ    D +  FF+AC +LQ PLE+LL+E RP  LVAD+
Sbjct  61    SVLTIKFPSAEFGLPEGYETADQARSIDLMDEFFRACILLQEPLEELLKEHRPQALVADL  120

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FF WA +AAAKF IPRL+FHG+S  A+ +  S+R  KP+ ++SSDS+ F +P++P ++ +
Sbjct  121   FFYWANDAAAKFGIPRLLFHGSSSFAMISAESVRRNKPYKNLSSDSDPFVVPDIPDKIIL  180

Query  612   TKLQVSPFERSEVENT-MSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             TK QV   + +E  NT ++E  +++  SE   YGVI NSFYELEPDY ++ KNVLGRRAW
Sbjct  181   TKSQVPTPDDTEENNTHITEMWKNISESENDCYGVIVNSFYELEPDYVDYCKNVLGRRAW  240

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
              +GPL L N + ED A+RG+KS ID HE L WLDSKNP+SVVY+CFGS+ANF  +QLHE+
Sbjct  241   HIGPLLLCNNEGEDVAQRGEKSDIDAHEYLNWLDSKNPYSVVYVCFGSMANFNAAQLHEL  300

Query  969   AMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTK--GKGLIIRGWAPQVVILDHPA  1142
             AMG+E+SG +F+WV+R   +E + S KW P+GFE+R +   KGLII+GWAPQV+IL+H A
Sbjct  301   AMGLEESGQEFIWVVRTCVDEKDES-KWFPDGFEKRVQENNKGLIIKGWAPQVLILEHEA  359

Query  1143  VGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD  1322
             VGAFV+HCGWNSTLEG+CGGV MVTWP+FAEQF NEKLMTDILRTG  VGS +W R+ + 
Sbjct  360   VGAFVSHCGWNSTLEGICGGVAMVTWPLFAEQFYNEKLMTDILRTGVPVGSLQWSRVTTS  419

Query  1323  G--VKREAIAEAIKKVMIGEESEEMRSR  1400
                VKREAI++A++++M  EE  ++R+R
Sbjct  420   AVVVKREAISKAVRRLMAEEEGVDIRNR  447



>ref|XP_011000865.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=486

 Score =   516 bits (1328),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 256/460 (56%), Positives = 332/460 (72%), Gaps = 6/460 (1%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             +  LH  FFP MAHGHMIP +DMAKLFASRG+K TI+TTP N P+FSK V +   LGF++
Sbjct  5     VNQLHALFFPFMAHGHMIPLVDMAKLFASRGLKTTIVTTPLNVPLFSKTVQRTKNLGFEI  64

Query  252   EIRLLEFPGVEVGLPESCQRLD----QTPDDDGLPRFFKACAMlqppledllqelrpdCL  419
              IR +EF  VE GLPE C+  D    Q    D L +FF A   LQ PLE LL+E+ PDCL
Sbjct  65    NIRTIEFSTVETGLPEGCENADLIISQAMGWDMLKKFFAATTFLQEPLERLLEEIHPDCL  124

Query  420   VADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPH  599
             +ADMFFPW T+AAAKF IPRL+FHGTS  +LC   SLR+Y+P   VSSD E F +PNLP 
Sbjct  125   IADMFFPWTTDAAAKFGIPRLVFHGTSFFSLCVGQSLRLYEPHKKVSSDCEPFFMPNLPD  184

Query  600   ELKITKLQVSPFERSEVE-NTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
             ++K+T+ ++   ER + E +  ++  + V   + KSYGV+ NSFYELEP YA+HY+   G
Sbjct  185   DIKLTRNELPYPERHDDESDDFNKMYKKVNEGDSKSYGVVVNSFYELEPVYADHYRKAFG  244

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             R+AW VGP+SL NR+++DKAERG++++I+E+ECL WL++K P SVVYICFGS+ N + SQ
Sbjct  245   RKAWHVGPVSLCNRNIDDKAERGREASINENECLSWLETKKPDSVVYICFGSMVNLSASQ  304

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A G+E SG  F+WV++N    +   E W+P  FE+R +GKGLIIRGWAPQV+ILDH
Sbjct  305   LKEIAKGLEASGQQFIWVVKNTINSEE-EEAWLPVRFEKRMEGKGLIIRGWAPQVLILDH  363

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD  1316
              A+G FVTHCGWNSTLEG+  GVPM T P+ AEQF NEKL+T IL+ G  +G +E   L 
Sbjct  364   EAIGGFVTHCGWNSTLEGITAGVPMATCPLSAEQFYNEKLVTQILKIGIRIGVQEQALLG  423

Query  1317  SDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              D +K +A+ EA+ ++M GEE+EEMR + K     A+KAI
Sbjct  424   GDSIKSKALEEAVSRLMEGEEAEEMRGKVKAFGKMARKAI  463



>ref|XP_009354715.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Pyrus x bretschneideri]
Length=475

 Score =   515 bits (1326),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 252/457 (55%), Positives = 329/457 (72%), Gaps = 15/457 (3%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH+FFFP M  GH IP +DMAKLFASRGVK+T+ITTP N P+FSKA+    +LGF ++I
Sbjct  8     QLHIFFFPYMIQGHFIPLIDMAKLFASRGVKSTLITTPLNAPLFSKAIQSSKKLGFDVDI  67

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +++FP  EVGLP+ C+  +     +   +F +A  +LQP +E LL E RP CLVAD F 
Sbjct  68    LVIKFPTEEVGLPQGCENANLVTTREMNEKFIRATFLLQPQIEQLLDEHRPHCLVADNFL  127

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWAT+ AAKF IPR+IF G    ALCA HS+ +Y+P   +SSDSE+FTIPN P E+K+T+
Sbjct  128   PWATDVAAKFGIPRIIFQGLGFFALCAFHSVALYEPHAKLSSDSEVFTIPNFPVEIKLTR  187

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
              Q+  F +   E T  +  +    SEEKSYG I NSFYELEP +A+HY+ V GR+AW +G
Sbjct  188   SQIPNFPKQSAEFT--KLFKEAMESEEKSYGFIVNSFYELEPAFADHYRTVFGRKAWHIG  245

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             P+S  N+  +D+A      ++D HECL WL SK P+SVVYICFGS+ NF  SQL E+A G
Sbjct  246   PVSSVNKAADDEA------SLDRHECLNWLSSKKPNSVVYICFGSITNFIDSQLQEIAAG  299

Query  978   IEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             +E SG +F+WV++    E N  E+W+PEGFEER +GKGLIIRGWAPQV IL+H A+GAFV
Sbjct  300   LEASGQEFIWVVKR---EKNDKEEWLPEGFEERMEGKGLIIRGWAPQVPILEHQAIGAFV  356

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKR----LDSDG  1325
             THCGWNS LEGV  GVPM+TWPV AEQF NEKL+T +L+TG  VG+K+W      +    
Sbjct  357   THCGWNSILEGVSAGVPMITWPVSAEQFYNEKLVTVVLKTGVAVGAKQWGTFLDVMTEAS  416

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VKREAI +A+ +VM+ EE+E MR RA+V+++ A++A+
Sbjct  417   VKREAIEKAVNQVMVSEEAEGMRGRARVLREMARRAV  453



>emb|CDX76261.1| BnaA08g11390D [Brassica napus]
Length=482

 Score =   515 bits (1326),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 255/461 (55%), Positives = 329/461 (71%), Gaps = 13/461 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQME  254
             LH+F FP MAHGHMIPTLDMAKLF+++G K+TI+TTP N  +  K +D +  L    Q+E
Sbjct  7     LHIFLFPYMAHGHMIPTLDMAKLFSTKGAKSTILTTPLNAKILQKPIDTFKNLNPSLQIE  66

Query  255   IRLLEFPGVEVGLPESCQRLD-----QTPDDDG--LPRFFKACAMlqppledllqelrpd  413
             I++L+FP V++GLPE C+  D        DD    + +FF A    +  LE +L+  RP 
Sbjct  67    IQILDFPCVQLGLPEGCENADFFTLTNNSDDRRAMISKFFLATRFFKDQLEKILETTRPS  126

Query  414   CLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNL  593
             CL+ADMFFPWAT AA KF++PRL+FHGT + +LCA + +RV+ P   V++ SE F IP+L
Sbjct  127   CLIADMFFPWATEAAEKFNVPRLVFHGTGYFSLCASYCIRVHNPQKRVATSSEPFVIPDL  186

Query  594   PHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVL  773
             P  + IT+ Q+   +R E +  M +FM  V  SE KS GV+ NSFYELEPDYA+ YK+ +
Sbjct  187   PGNIVITQGQI--LDRGE-DTEMGKFMTEVLESEAKSSGVVVNSFYELEPDYADFYKSSV  243

Query  774   GRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPS  953
              +RAW +GPLS++NR  E+KAERGKK++IDE ECLKWLDSK P SVVYI FGSVAN    
Sbjct  244   AKRAWHIGPLSVHNRGFEEKAERGKKASIDEAECLKWLDSKKPDSVVYISFGSVANIKNE  303

Query  954   QLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILD  1133
             QL E+A G+E S   F+WV+R   E     E+W+PEGFEER KG+G+IIRGWAPQV+ILD
Sbjct  304   QLIEIAAGLEASDTSFIWVVRKNGENTGDKEEWLPEGFEERVKGRGMIIRGWAPQVLILD  363

Query  1134  HPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL  1313
             H A G FVTHCGWNS LEGV  G+PMVTWPV AEQF NE L+T +LRTG  VGS +   +
Sbjct  364   HQATGVFVTHCGWNSLLEGVAAGLPMVTWPVGAEQFYNEILVTQVLRTGVSVGSNK-HAI  422

Query  1314  DSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
               D + RE + +A+K+V+ GEE+EEMRSRAK + + AK A+
Sbjct  423   MGDFISRENVEKAVKEVLAGEEAEEMRSRAKKLAEMAKAAV  463



>ref|XP_008456146.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Cucumis melo]
Length=477

 Score =   514 bits (1324),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 245/452 (54%), Positives = 325/452 (72%), Gaps = 3/452 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             L +FFFP MA GH IP +DMAKLFASRG    IITT  N P+ +K+++K+ + G ++E+ 
Sbjct  8     LRIFFFPFMAQGHTIPAIDMAKLFASRGADVAIITTRVNAPLIAKSINKFDRPGRKIELL  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
             +++FP V VGLP+ C+ LD     +    FF+A  ML+P ++ +L   RP CLVAD FFP
Sbjct  68    IIDFPSVAVGLPDGCESLDLARSPEMFQSFFRATTMLEPQIDQILDHHRPHCLVADTFFP  127

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             W T+ AAK+ IPR++FHGT   ALCA  SL   +P+  VSSD E F IP LP E+K+T+ 
Sbjct  128   WTTDLAAKYGIPRVVFHGTCFFALCAAASLIANRPYQKVSSDLEPFVIPGLPDEIKLTRS  187

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             QV  F + EVE    +   + +  E + YG + NSFYELEP YA++Y++VLGRRAW +GP
Sbjct  188   QVPGFLKEEVETDFIKLYWASKEVESRCYGFLINSFYELEPAYADYYRSVLGRRAWHIGP  247

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             LSLY+   ED  +RG  S+IDE +CLKWLDSKNP SV+Y+ FGS+A+   SQL E+A G+
Sbjct  248   LSLYSDFEEDNVQRGSSSSIDEDQCLKWLDSKNPDSVLYVSFGSLASLTNSQLLEIAKGL  307

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E +G +F+WV++  + +    E+W+PEGFE+R +GKGLIIRGWAPQV+ILDH ++G FVT
Sbjct  308   EATGQNFIWVVKKAKGD---QEEWLPEGFEKRVEGKGLIIRGWAPQVLILDHRSIGGFVT  364

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNS LEGV  GVPMVTWP  AEQF NEKL+TD+L+ G GVG+  W R   D +K EA
Sbjct  365   HCGWNSALEGVTAGVPMVTWPNSAEQFYNEKLLTDVLQIGVGVGALYWGRAGKDEIKSEA  424

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             I +A+ +VM+GEE+E MRSRAK +  +A+KAI
Sbjct  425   IEKAVNRVMVGEEAEGMRSRAKALGIQARKAI  456



>ref|XP_007029404.1| Anthocyanin 3'-O-beta-glucosyltransferase, putative [Theobroma 
cacao]
 gb|EOY09906.1| Anthocyanin 3'-O-beta-glucosyltransferase, putative [Theobroma 
cacao]
Length=484

 Score =   514 bits (1324),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 250/457 (55%), Positives = 331/457 (72%), Gaps = 7/457 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH  FFP +AHGH+IPT+DMA+LFA  GVK TI+TTP N  +F+  + +  QLGF +   
Sbjct  8     LHFIFFPQLAHGHLIPTVDMARLFAMHGVKVTIVTTPLNALLFASKIQREKQLGFDISTL  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
             +++FP  EVGLPE C+ +      + +P+F KA  + Q PLE +L+ELRPDCLVAD  FP
Sbjct  68    VIKFPASEVGLPEGCENVSSITSQEMIPKFLKAINLFQQPLERILEELRPDCLVADWMFP  127

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT+ A KF IPRL+FHGTS  ALC + +L  ++PF  +SS+SE F +P LP ++K+T+L
Sbjct  128   WATDIAGKFGIPRLVFHGTSCFALCVVDTLIRHEPFKKISSESEPFDVPGLPDQIKMTRL  187

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+  + +   E    + +     SE  SYGVI NSF+ELEP Y +HY  V+ R+AW VGP
Sbjct  188   QLPDYIKDTAETERQKLIDEAIKSELTSYGVIVNSFHELEPAYTQHYSKVMRRKAWQVGP  247

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             +SL N + EDKAERG  ++ID HECL+WLDSK P+SV+YICFGS+   + +QL+E+A G+
Sbjct  248   VSLCNMNNEDKAERGNAASIDRHECLRWLDSKKPNSVLYICFGSIFRTSAAQLNEIAKGL  307

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG DF+WV+R   +ED   E+W+PEGFEER +GKGLIIRGWA QV+ILDH AVG F+T
Sbjct  308   EASGQDFIWVVRKVNDEDK--EEWLPEGFEERMEGKGLIIRGWAAQVLILDHEAVGGFMT  365

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD-----G  1325
             HCGWNST+E +  GVPMVTWP+ AEQF NEKL+T++L+ G  VG+KEW R   D      
Sbjct  366   HCGWNSTIESITAGVPMVTWPLCAEQFCNEKLVTEVLKIGVDVGAKEWCRWGDDPSTKFK  425

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             V +E I  A+ +VM+GEE+EEMRSRAK +K+ A+KA+
Sbjct  426   VMKEDIERAVSRVMVGEEAEEMRSRAKELKNMARKAM  462



>ref|XP_010681315.1| PREDICTED: scopoletin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   514 bits (1324),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 247/459 (54%), Positives = 333/459 (73%), Gaps = 8/459 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LHV FFP+MA GH+IPTLD+AKLFA+  VK TIITTP N P F+K ++ Y  LG +++I 
Sbjct  8     LHVVFFPLMAAGHLIPTLDIAKLFAAHHVKTTIITTPLNAPCFTKPLESYKNLGHRIDIE  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
             ++ FP  E GLPE  +  DQ   D    +F KA  +LQ   E  L++ +P+C+V DM  P
Sbjct  68    IIPFPSKEAGLPEGLENFDQFTSDQMAVKFLKATELLQESFEKFLEKHKPNCIVTDMLMP  127

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             +  N AAKF+IPR++FHG S+ ALC MH+L  Y+P   + SD E F +PNLPHE+ +T+ 
Sbjct  128   FTNNVAAKFNIPRIVFHGCSYFALCMMHTLLKYQPHKSLLSDDEEFLVPNLPHEINLTRS  187

Query  621   QVSPFERSEVENTMSE-----FMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRA  785
             ++    R + +  +++     F+ ++  +EE S+GVI NSFYELEP+Y E+Y+NV+GR+A
Sbjct  188   RLPDMMRGQGDKELNDAWMKIFIHAME-AEENSFGVIMNSFYELEPEYVEYYRNVMGRKA  246

Query  786   WSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHE  965
             W +GP+SL NR+ E K +RGK S+I+EHECLKWLDSK P SVVYICFGS+A     QL E
Sbjct  247   WHIGPVSLCNRENEAKFQRGKDSSINEHECLKWLDSKKPKSVVYICFGSLAEVPTLQLRE  306

Query  966   MAMGIEDSGMDFVWVIRNKREEDNGSEK--WMPEGFEERTKGKGLIIRGWAPQVVILDHP  1139
             +AMG+E S  DF+WV+R  +E     +   W+P  FE+R +GKGLIIRGWAPQV+ILDH 
Sbjct  307   IAMGLEASEQDFIWVVRRGKENVEEEKIEEWLPYDFEDRMEGKGLIIRGWAPQVLILDHE  366

Query  1140  AVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDS  1319
             A+GAFVTHCGWNSTLEG+  GVPMVTWPVFAEQF NEKL+T++L+TG  VG+K+W R+  
Sbjct  367   AIGAFVTHCGWNSTLEGISCGVPMVTWPVFAEQFYNEKLVTEVLKTGVAVGAKKWSRILE  426

Query  1320  DGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
               +K E I  AI++VM+GEE+  +RS+AK +K+ A+KA+
Sbjct  427   VNLKSEDIKNAIRRVMVGEEALVLRSKAKKLKELARKAV  465



>ref|NP_567953.1| UDP-glucosyl transferase 73B3 [Arabidopsis thaliana]
 sp|Q8W491.1|U73B3_ARATH RecName: Full=UDP-glycosyltransferase 73B3; AltName: Full=Flavonol 
3-O-glucosyltransferase UGT73B3 [Arabidopsis thaliana]
 gb|AAL32831.1| putative protein [Arabidopsis thaliana]
 gb|AAM47999.1| putative protein [Arabidopsis thaliana]
 gb|AEE86327.1| UDP-glucosyl transferase 73B3 [Arabidopsis thaliana]
 gb|AHL38664.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=481

 Score =   513 bits (1322),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 255/460 (55%), Positives = 339/460 (74%), Gaps = 13/460 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQME  254
             LHV FFP MA+GHMIPTLDMAKLF+SRG K+TI+TTP N  +F K ++++  L   F+++
Sbjct  9     LHVVFFPFMAYGHMIPTLDMAKLFSSRGAKSTILTTPLNSKIFQKPIERFKNLNPSFEID  68

Query  255   IRLLEFPGVEVGLPESCQRLDQTPDDDGLPR------FFKACAMlqppledllqelrpdC  416
             I++ +FP V++GLPE C+ +D    ++   R      FFK+    +  LE LL+  RPDC
Sbjct  69    IQIFDFPCVDLGLPEGCENVDFFTSNNNDDRQYLTLKFFKSTRFFKDQLEKLLETTRPDC  128

Query  417   LVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLP  596
             L+ADMFFPWAT AA KF++PRL+FHGT + +LC+ + +RV+ P N V+S  E F IP+LP
Sbjct  129   LIADMFFPWATEAAEKFNVPRLVFHGTGYFSLCSEYCIRVHNPQNIVASRYEPFVIPDLP  188

Query  597   HELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
               + IT+ Q++  +R E E+ M +FM  V+ S+ KS GVI NSFYELEPDYA+ YK+V+ 
Sbjct  189   GNIVITQEQIA--DRDE-ESEMGKFMIEVKESDVKSSGVIVNSFYELEPDYADFYKSVVL  245

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             +RAW +GPLS+YNR  E+KAERGKK++I+E ECLKWLDSK P SV+YI FGSVA F   Q
Sbjct  246   KRAWHIGPLSVYNRGFEEKAERGKKASINEVECLKWLDSKKPDSVIYISFGSVACFKNEQ  305

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A G+E SG +F+WV+R     +   E+W+PEGFEER KGKG+IIRGWAPQV+ILDH
Sbjct  306   LFEIAAGLETSGANFIWVVRKNIGIEK--EEWLPEGFEERVKGKGMIIRGWAPQVLILDH  363

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD  1316
              A   FVTHCGWNS LEGV  G+PMVTWPV AEQF NEKL+T +LRTG  VG+K+  R  
Sbjct  364   QATCGFVTHCGWNSLLEGVAAGLPMVTWPVAAEQFYNEKLVTQVLRTGVSVGAKKNVRTT  423

Query  1317  SDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              D + RE + +A+++V++GEE++E R RAK + + AK A+
Sbjct  424   GDFISREKVVKAVREVLVGEEADERRERAKKLAEMAKAAV  463



>ref|XP_010027899.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW54536.1| hypothetical protein EUGRSUZ_I00493 [Eucalyptus grandis]
Length=489

 Score =   513 bits (1322),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 239/452 (53%), Positives = 325/452 (72%), Gaps = 2/452 (0%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FFFP+MA GH IP +DMAKLFA RG K+T+ITTP ++P F K++ K    GF +++ 
Sbjct  12    LHIFFFPLMAPGHTIPMIDMAKLFAIRGCKSTLITTPHDEPTFLKSIAKAKDSGFDIDVV  71

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              +  P  EVGLPE C  L++    +   +F +A  ML   LE L++ L PDCL++DMF P
Sbjct  72    TVILPLKEVGLPEDCDNLNKVTSVEIRKQFMRAIMMLDRQLELLIETLAPDCLISDMFLP  131

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             W T  AAK+ IPRL FHGTS  ++ +   +R+Y+P   VS DSE F IPN P E+ ++++
Sbjct  132   WTTEIAAKYKIPRLAFHGTSAFSIASTECVRLYEPHKKVSCDSEPFIIPNFPGEITMSRM  191

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+    R E + T  +F   V+ SE++S+GV+ NSFYELEP YA+HY+  LGRR+W +GP
Sbjct  192   QLPDLFREETDFT--KFYNEVKESEKRSFGVVMNSFYELEPAYADHYRTFLGRRSWFIGP  249

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             LSL N++ EDKA RG +++I +HECLKWLDSK P+SV+YICFGS+ANF  +QL E+A+G+
Sbjct  250   LSLCNKETEDKAHRGNQASIGQHECLKWLDSKQPNSVIYICFGSMANFNAAQLQEIAVGL  309

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG  F+WV++     + G E+W+P+G+E R + KGLIIRGWAPQV+ILDH A+G FVT
Sbjct  310   EASGQQFIWVVKKDPNVEEGKEEWLPDGYESRIRNKGLIIRGWAPQVLILDHEAIGGFVT  369

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLE +  GVPMVTWPV AEQF NEK +T +L+ G  +G K+W RL  D VK E 
Sbjct  370   HCGWNSTLEAITAGVPMVTWPVAAEQFFNEKFVTQVLKVGVSIGVKQWVRLFGDSVKSER  429

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + +A+K+V+  EE+EEMR RAK + + A+ A+
Sbjct  430   VEDAVKRVLGSEEAEEMRRRAKALAEMARGAV  461



>gb|KGN43909.1| hypothetical protein Csa_7G073450 [Cucumis sativus]
Length=480

 Score =   513 bits (1320),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 252/454 (56%), Positives = 336/454 (74%), Gaps = 3/454 (1%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH+F FP MAHGHMIP +DMAKLFASRG+K TI+TTP N    SK++   +     +++
Sbjct  7     QLHIFMFPFMAHGHMIPIVDMAKLFASRGIKITIVTTPLNSISISKSLHNCSPNSL-IQL  65

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +L+FP  E GLP+ C+  D  P  D LP+FF+A ++LQPP E+ L   RPDCL++DMFF
Sbjct  66    LILKFPAAEAGLPDGCENADSIPSMDLLPKFFEAVSLLQPPFEEALHNNRPDCLISDMFF  125

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PW  + A +  IPRLIFHGTS  +LC+   +R++KP+  VSSD+E FTIP LP ++K+TK
Sbjct  126   PWTNDVADRVGIPRLIFHGTSCFSLCSSEFMRLHKPYQHVSSDTEPFTIPYLPGDIKLTK  185

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
             +++  F R   EN  S+F+  V+ SE   YGV+ NSFYELE +Y + YK+VLGR+ W++G
Sbjct  186   MKLPIFVRENSENEFSKFITKVKESESFCYGVVVNSFYELEAEYVDCYKDVLGRKTWTIG  245

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             PLSL N   ++   RG++SAIDEHECLKWLDS+ P+SVVY+CFGS+A F  +QL E+A+G
Sbjct  246   PLSLTNTKTQEITLRGRESAIDEHECLKWLDSQKPNSVVYVCFGSLAKFNSAQLKEIAIG  305

Query  978   IEDSGMDFVWVIR-NKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAF  1154
             +E SG  F+WV+R  K EE+   + W+PEG+EER +G GLIIRGWAPQV+ILDHP+VG F
Sbjct  306   LEASGKKFIWVVRKGKGEEEEEEQNWLPEGYEERMEGTGLIIRGWAPQVLILDHPSVGGF  365

Query  1155  VTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKR  1334
             VTHCGWNSTLEGV  GVPMVTWPV AEQF NEKL+T++L+TG GVG ++W     D ++ 
Sbjct  366   VTHCGWNSTLEGVAAGVPMVTWPVGAEQFYNEKLVTEVLKTGVGVGVQKWAPGVGDFIES  425

Query  1335  EAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             EA+ +AI+++M  +E EEMR+RA  +  KAK A+
Sbjct  426   EAVEKAIRRIM-EKEGEEMRNRAIELGKKAKWAV  458



>gb|KDP24997.1| hypothetical protein JCGZ_23980 [Jatropha curcas]
Length=483

 Score =   511 bits (1317),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 243/460 (53%), Positives = 341/460 (74%), Gaps = 2/460 (0%)
 Frame = +3

Query  63    DFAMGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG  242
             D     LH+F FP++A GHM+P LD+A+LFA+RGVK TIITTP N P F+K++ K   L 
Sbjct  2     DSESNQLHIFLFPLLAPGHMLPMLDIARLFAARGVKTTIITTPVNAPRFTKSIQKIPDLA  61

Query  243   FQMEIRL--LEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdC  416
                 I L  + FP  + GLPE  + LD   + +   RFF A ++LQ PLE+ ++EL P  
Sbjct  62    TTQLINLKAINFPSEKAGLPEGLENLDLVSNQETHSRFFDALSLLQEPLEEAIKELHPQA  121

Query  417   LVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLP  596
             +VAD+FFPW T+ A K+ IPRLIFHGTS +++C M S+ + +P   VSSD+E F +P LP
Sbjct  122   IVADLFFPWTTDLALKYAIPRLIFHGTSFISMCCMASIAINQPHKKVSSDTEEFVLPGLP  181

Query  597   HELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
               +K TK Q+         N ++  +   R  E++SYG++ NSFYELEP YA++Y+NVLG
Sbjct  182   DPIKFTKTQIPDGFPEGPPNVVTNLLSYAREVEKRSYGMLVNSFYELEPAYADYYRNVLG  241

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             ++AW +GP+SL NR++E+KA+RG  S + +HEC+KWLD K P+SV+Y+CFG+V  F+ SQ
Sbjct  242   KKAWHIGPVSLCNRNLEEKAQRGDVSGVSQHECIKWLDLKIPNSVIYVCFGTVTKFSQSQ  301

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A+G+E+SG DF+WV+R ++ E+ G EKW+P+G+E+R +GKGLIIRG+APQV+ILDH
Sbjct  302   LQEIAIGLENSGQDFIWVVRKEKNEEEGEEKWLPDGYEKRIEGKGLIIRGFAPQVLILDH  361

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD  1316
              AVG FVTHCGWNS LEG+  G+PMVTWP+FA+QF NEKL+TDIL+ G GVG+++W RL 
Sbjct  362   EAVGGFVTHCGWNSALEGISAGLPMVTWPIFADQFFNEKLITDILKIGVGVGARKWVRLV  421

Query  1317  SDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              D +K E I +A+K++M+GE++EE+RSRAK + + A+KA+
Sbjct  422   GDYIKSEKIEKAVKEIMVGEKAEEIRSRAKKIGEMARKAV  461



>gb|AAS55083.1| UDP-glucose glucosyltransferase [Rhodiola sachalinensis]
Length=480

 Score =   511 bits (1315),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 252/454 (56%), Positives = 339/454 (75%), Gaps = 5/454 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             L +FFFP MAHGHMIP +DMA+LFAS+GV+ TI+TTP NQP+ ++++ K   LGF++ + 
Sbjct  8     LSIFFFPFMAHGHMIPMVDMARLFASQGVRCTIVTTPGNQPLIARSIGKVQLLGFEIGVT  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              + F G E GLP+ C+ LD  P    +  FF+A   L+ P E LL+E +PDC+V DMFFP
Sbjct  68    TIPFRGTEFGLPDGCENLDSVPSPQHVFHFFEAAGSLREPFEQLLEEHKPDCVVGDMFFP  127

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             W+T++AAKF IPRL+FHGTS+ ALCA  ++R++KP+  VSSD E F IP LP E+K+TK 
Sbjct  128   WSTDSAAKFGIPRLVFHGTSYFALCAGEAVRIHKPYLSVSSDDEPFVIPGLPDEIKLTKS  187

Query  621   QVSPFERSE--VENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSV  794
             Q+ P    E   ++ +++ +  V+ +E  SYGVI NS YELEP YA++++NVL RRAW +
Sbjct  188   QL-PMHLLEGKKDSVLAQLLDEVKETEVSSYGVIVNSIYELEPAYADYFRNVLKRRAWEI  246

Query  795   GPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAM  974
             GPLSL NRDVE+KA RG ++AID+HECLKWLDSK P SVVY+CFGS   F   QL E+A 
Sbjct  247   GPLSLCNRDVEEKAMRGMQAAIDQHECLKWLDSKEPDSVVYVCFGSTCKFPDDQLAEIAS  306

Query  975   GIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAF  1154
             G+E SG  F+WVIR  R  D+  E ++P+GFEER K + L+IRGWAPQV+ILDH +VG F
Sbjct  307   GLEASGQQFIWVIR--RMSDDSKEDYLPKGFEERVKDRALLIRGWAPQVLILDHQSVGGF  364

Query  1155  VTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKR  1334
             V+HCGWNSTLEG+  G+PMVTWPVFAEQF NEKL+T++L+ G  VG+++W++L  D V +
Sbjct  365   VSHCGWNSTLEGISAGLPMVTWPVFAEQFYNEKLLTEVLKIGVAVGARKWRQLVGDFVHK  424

Query  1335  EAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             +AI  A++++M GEE+EE R  A+ M   AK+A+
Sbjct  425   DAIQRAVREIMEGEEAEERRIIARQMGKMAKRAV  458



>ref|XP_002518718.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43643.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=480

 Score =   510 bits (1313),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 250/483 (52%), Positives = 346/483 (72%), Gaps = 8/483 (2%)
 Frame = +3

Query  57    SKDFAMGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQ  236
             + +F    LH+  FP+MA GHM+P LD+A+LFASRGVK TIITTP N   F+K       
Sbjct  2     ASEFDHHQLHILLFPLMAQGHMLPLLDIARLFASRGVKTTIITTPGNAASFTKITQ---D  58

Query  237   LGFQMEIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdC  416
             L  Q+ +++++FP  E GLPE  + LD   D     +FFKA ++LQ PLE ++QEL P  
Sbjct  59    LSIQINLKIIKFPSKEAGLPEGLENLDLVSDKQTHSKFFKALSLLQDPLEKVVQELLPHG  118

Query  417   LVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLP  596
             LV+D+FFPW T  A K  IPRLIF GT    +C   ++   +P  +VSSD+ELF +P  P
Sbjct  119   LVSDIFFPWTTEVATKCGIPRLIFLGTGFFPMCCFANIEEQQPHKNVSSDTELFILPGFP  178

Query  597   HELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
               ++ T+LQ+  F   E +  ++E + S + +E++S+G++ NSFYELEP Y ++YKNVLG
Sbjct  179   DPIRFTRLQLPDFMTGEQQTVLAELLGSAKEAEKRSFGILVNSFYELEPGYVDYYKNVLG  238

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             RRAW +GP+SL NR ++DKA+RGK+++I EHEC+KWLD+K P+SV+Y+CFGSV  F+ SQ
Sbjct  239   RRAWHIGPVSLCNRTLKDKAQRGKETSISEHECMKWLDTKKPNSVIYVCFGSVTKFSDSQ  298

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             LHE+A+G+E SG DF+WV+R      N  EKW+P+ +E+R +GKG+IIRGWAPQV+ILDH
Sbjct  299   LHEIAIGLEASGQDFIWVVRT-----NNEEKWLPDEYEKRMEGKGMIIRGWAPQVLILDH  353

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD  1316
              AVG FVTHCGWNS LEGV  G+PMVTWP+  +QF NEKL+TD+LR G GVG+K+W  L 
Sbjct  354   EAVGGFVTHCGWNSILEGVSAGLPMVTWPICGDQFFNEKLITDVLRIGVGVGAKKWVTLV  413

Query  1317  SDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAIeeggssylglsslldelRAY  1496
              D ++   I EA+++VM+GE++ E+R RA    + A+ AIEEG SS+  L +L+ EL++Y
Sbjct  414   GDYIESTKIKEAVREVMMGEKAREIRRRATKFGEMARSAIEEGASSFNDLGALIQELKSY  473

Query  1497  HAK  1505
             H +
Sbjct  474   HTR  476



>ref|XP_008375155.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Malus domestica]
Length=474

 Score =   509 bits (1310),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 248/456 (54%), Positives = 329/456 (72%), Gaps = 14/456 (3%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH+FFFP MA GH IP ++MAKLFASRG K+T+ITTP N P+FSK +    +LGF +EI
Sbjct  8     QLHIFFFPYMAQGHFIPLINMAKLFASRGEKSTLITTPLNAPLFSKEIQSSKKLGFDVEI  67

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +++FP  EVGLP+ C+  +     +   +F KA  +LQP +E +L E RP CLVAD+FF
Sbjct  68    FVIKFPTEEVGLPQGCENANLATTREMKEKFIKATFLLQPQIEQILDEHRPHCLVADVFF  127

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWAT+ AAKF +PR+IFHG    A+CA  S+ +Y+P   +SSDSE+FTIPN P E+K+T+
Sbjct  128   PWATDVAAKFGVPRIIFHGIGFFAMCASLSVALYEPHAKLSSDSEVFTIPNFPVEIKLTR  187

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
              QV  F +   E T  +  +  R  EEKSYG I NSFYELEP +A+HY+ V GR+AW +G
Sbjct  188   SQVPTFPKHSSEFT--KLFKEAREIEEKSYGFIVNSFYELEPAFADHYRTVFGRKAWHIG  245

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             PLS  N+  +D+A      ++D+HECL WL+SK P+SVVYICFGS  NF  SQL E+A G
Sbjct  246   PLSSVNKAADDEA------SLDQHECLNWLNSKKPNSVVYICFGSTTNFIDSQLLEIAAG  299

Query  978   IEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             +E SG +F+WV++    E N  E+W+PEGFE+R +GKGLIIRGWAPQV IL+H A+GAFV
Sbjct  300   LEASGQEFIWVVKR---EKNDKEEWLPEGFEKRMEGKGLIIRGWAPQVPILEHQAIGAFV  356

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKR---LDSDGV  1328
             THCGWNS LEGV  GVPM+TWPV AEQF NEKL+T++L+TG  VG K+W     +  D V
Sbjct  357   THCGWNSILEGVSAGVPMITWPVSAEQFYNEKLVTEVLKTGVAVGVKQWGTVLDVKEDSV  416

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             K+E + +A+ +VM+ EE+E M  RA+V+++ A +A+
Sbjct  417   KKETVEKAVNQVMVSEEAEGMMGRARVLREMATRAV  452



>ref|XP_010027867.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW54508.1| hypothetical protein EUGRSUZ_I00450 [Eucalyptus grandis]
Length=483

 Score =   509 bits (1311),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 234/452 (52%), Positives = 326/452 (72%), Gaps = 2/452 (0%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             +H+FFFP MA GH IP ++MAKLFA RG K+T+I TP ++P F K++ K    GF +++ 
Sbjct  7     VHIFFFPFMASGHSIPMIEMAKLFAIRGCKSTLIATPHDKPTFLKSITKTKDAGFDIDVV  66

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              +  P  EVGLPE C  +++   ++   +F++A  ML   LE L+++L P+CLV+DM  P
Sbjct  67    TVTLPLKEVGLPEDCDNMNKITTEEIRKQFYRAIRMLDQQLERLIEKLAPNCLVSDMLLP  126

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             W T  AAK+ IPRL FHGTS  ++ ++  +R+Y+P   VS DSE F IPN P E+ ++K+
Sbjct  127   WTTEIAAKWGIPRLAFHGTSAFSIASIECVRLYEPHKRVSHDSEPFVIPNFPGEITMSKM  186

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+    R E E T  +    +  SE++S+GVI NSFYELEP YA+HY+  LGR++W VGP
Sbjct  187   QLPDVYREETEFT--KLFNDMMESEKRSFGVIMNSFYELEPAYADHYRTFLGRQSWFVGP  244

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             LSL N++ EDKA +G +++ID+HECLKWLDS+ P+SV+YICFGS+ANF  +QLHE+A+G+
Sbjct  245   LSLCNKETEDKAHKGNQASIDQHECLKWLDSRQPNSVIYICFGSMANFNAAQLHEIAVGL  304

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG  F+WV++     + G E+W+P+G+E R + KGLIIRGWAPQV+ILDH A+G FVT
Sbjct  305   EASGQQFIWVVKKDPNVEEGKEEWLPDGYESRIRNKGLIIRGWAPQVLILDHEAIGGFVT  364

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLE +  GVPMVTWPV AEQF NEK +T +L+ G  +G K+W RL  D VK E 
Sbjct  365   HCGWNSTLEAITAGVPMVTWPVAAEQFFNEKFVTQVLKVGVSIGVKQWVRLFGDSVKSER  424

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + +A+K+V++ EE+EEMR R K + + A+ A+
Sbjct  425   VEDAVKRVLVSEEAEEMRRRVKALAEMARGAV  456



>ref|XP_002298737.1| hypothetical protein POPTR_0001s30980g [Populus trichocarpa]
 gb|EEE83542.1| hypothetical protein POPTR_0001s30980g [Populus trichocarpa]
Length=491

 Score =   509 bits (1310),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 247/456 (54%), Positives = 330/456 (72%), Gaps = 6/456 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LHV F P MA GHMIP +DMA+LFA RGVKATII+TP N P FSKA+++  QLG  + IR
Sbjct  8     LHVLFLPYMAPGHMIPIVDMARLFARRGVKATIISTPLNAPFFSKAIERDGQLGHDISIR  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
             +++FP  E GLPE C+ L      D    F KA +MLQ P+E LL+E  P CLVADM F 
Sbjct  68    IIKFPSAEAGLPEGCENLSSIISWDMHANFLKAMSMLQQPIEQLLEECHPHCLVADMTFT  127

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT  A K  IPRL F GTS+ A+C   SL+ Y+P   V SD E F +P LP ++K T+ 
Sbjct  128   WATEVADKLRIPRLYFSGTSYFAMCVFDSLKRYEPHRRVDSDFEPFIVPGLPDQIKTTRQ  187

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+  + +   E+  ++ +  V  SE +SYGV+ NSF+ELEP Y+EHY+ V+GR+AW +GP
Sbjct  188   QLPDYLKQTTEHEFTKLVNQVSESELRSYGVLVNSFHELEPAYSEHYRKVMGRKAWHIGP  247

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             LSL NR++EDKAERG  ++I +HECL+WLD K P+SV+YICFG++ +F  +QL E+A+ +
Sbjct  248   LSLCNRNIEDKAERGNTASIGKHECLRWLDLKKPNSVLYICFGTLLDFPAAQLREIALAL  307

Query  981   EDSGMDFVWVIRN---KREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             E SG +F+WV+R    ++ ED   E+W+PEGFE R +GKGLIIRGWAPQV+ILDH AVG 
Sbjct  308   EASGQNFIWVVRKGELRKHEDK--EEWLPEGFERRMEGKGLIIRGWAPQVLILDHKAVGG  365

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD-GV  1328
             F+THCGWNSTLE V  G+P+VTWP+FAEQF NEKL+TD+L+ G GVG+ EW R      V
Sbjct  366   FMTHCGWNSTLEAVTAGLPLVTWPLFAEQFDNEKLITDVLKIGIGVGALEWSRYAKKILV  425

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              ++ I +AI  +M+GEE+EE+R+RA+ +++ A+ A+
Sbjct  426   MKDDIEKAIVHLMVGEEAEEIRNRARELQEMARNAM  461



>ref|XP_008454968.1| PREDICTED: scopoletin glucosyltransferase-like [Cucumis melo]
Length=480

 Score =   508 bits (1309),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 249/454 (55%), Positives = 329/454 (72%), Gaps = 3/454 (1%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH+F FP MAHGHMIP ++MAKLFASRG+K TI+TTP N    S+++   +     + +
Sbjct  7     QLHIFMFPFMAHGHMIPIVNMAKLFASRGIKITIVTTPLNSISISRSLHNDSN-SLDIHL  65

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +L+FP  EVGLP  C+ +D  P  D LP F++A  +LQP LE+ L + RP CLVADMFF
Sbjct  66    LILKFPSAEVGLPPDCENVDSLPTMDLLPIFYQAINLLQPSLEEALHQNRPHCLVADMFF  125

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PW  + A +  IPRLIFHGT   +LCA   +R+++P+  VSSD+E F IP LP ++K+TK
Sbjct  126   PWTNDVADRIGIPRLIFHGTGSFSLCASEFVRLHQPYKHVSSDTEHFLIPYLPGDIKLTK  185

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
             +Q+    R  VEN  S+F+  V+ SE   YGV+ NSFYELE +Y + Y+NVLGR+AW +G
Sbjct  186   MQLPIILRENVENEYSKFITKVKESESYCYGVVVNSFYELEAEYVDCYRNVLGRKAWPIG  245

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             PLSL+N + E  ++RG  S IDEHECLKWLD + P+SVVYICFGS+A F  +QL E+A+G
Sbjct  246   PLSLWNNETEQISQRGTGSTIDEHECLKWLDLQKPNSVVYICFGSLAKFNSAQLKEIAIG  305

Query  978   IEDSGMDFVWVIR-NKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAF  1154
             +E SG  F+WV+R  K EE+   + W+P+G+E+R +G+GLIIRGWAPQV+ILDH AVG F
Sbjct  306   VEASGKKFIWVVRKGKGEEEEDEQNWLPKGYEQRMEGRGLIIRGWAPQVLILDHLAVGGF  365

Query  1155  VTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKR  1334
             VTHCGWNSTLEGV  G+PMVTWPV AEQF NEKL+T++L+ G GVG ++W     D +K 
Sbjct  366   VTHCGWNSTLEGVVAGLPMVTWPVAAEQFYNEKLLTEVLKIGVGVGVQKWAPGVGDFIKS  425

Query  1335  EAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             E + +AIK++M  EE EEMR+RA     KA++AI
Sbjct  426   EVVEKAIKRIM-EEEGEEMRNRAIEFAKKAERAI  458



>ref|XP_010066837.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW64873.1| hypothetical protein EUGRSUZ_G02439 [Eucalyptus grandis]
Length=487

 Score =   508 bits (1309),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 243/458 (53%), Positives = 332/458 (72%), Gaps = 8/458 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             +HV FFP+MAHGHM+PTLDMA+LF +RG +ATIITTP N PVF  ++      G ++++R
Sbjct  9     VHVLFFPLMAHGHMLPTLDMARLFTARGARATIITTPHNAPVFQNSLQ--IDAGSRIDLR  66

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              +EFP  EVGLPE  + LD     D   +FF+A +ML  PLE L++EL PD LVAD+FFP
Sbjct  67    TIEFPTQEVGLPEGLENLDMVTTQDIQLKFFRAISMLSRPLEALVEELAPDALVADIFFP  126

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             +A + AA   IPRL FHGTS  ++CA  S++ ++P   VSSD ELF +P LP E+ +T+ 
Sbjct  127   FANDIAAGHGIPRLAFHGTSFFSMCAAESVQRHRPHEKVSSDDELFRLPGLPDEIMMTRS  186

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+    +  VE   +  ++    +  + +G+I NSF+ELEP Y +HY+N LG+RAW +GP
Sbjct  187   QLPDELKISVETDFTRLLKRSYQAAGRCFGMIVNSFHELEPSYVDHYRNALGKRAWHIGP  246

Query  801   LSLYNRDVEDKAERGKKSA-IDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             +SL NR++++KA+RG K A ID HECLKWLDS+ P SVVY+CFG+ + F+ +QL E+A G
Sbjct  247   VSLCNRNLQEKAQRGGKGASIDGHECLKWLDSRGPSSVVYVCFGTTSKFSDAQLREIATG  306

Query  978   IEDSGMDFVWVIRNKREEDNGSE-----KWMPEGFEERTKGKGLIIRGWAPQVVILDHPA  1142
             +E SG DFVWV+   R+E+ G+E      W+PEGF +R +G+GLIIRGWAPQV+ILDH +
Sbjct  307   LEASGQDFVWVVSRDRKEEKGNEGEGQDDWLPEGFGKRIQGRGLIIRGWAPQVLILDHRS  366

Query  1143  VGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD  1322
             VG FVTHCGWNS LEG+  G+PMVTWP+FAEQF NEKL+T++LR G GVG++ W RL  D
Sbjct  367   VGGFVTHCGWNSVLEGISAGLPMVTWPIFAEQFYNEKLVTEVLRIGVGVGARRWARLVGD  426

Query  1323  GVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              V++EA+  A+K++M+GE + EMR RA+     AK+A+
Sbjct  427   FVRKEAVERAVKEIMVGERAGEMRGRARSFGVMAKRAV  464



>ref|XP_010027864.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW54501.1| hypothetical protein EUGRSUZ_I00445 [Eucalyptus grandis]
Length=488

 Score =   508 bits (1309),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 241/452 (53%), Positives = 322/452 (71%), Gaps = 2/452 (0%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FFFP+MA GH IP +DMAKLFA RG K+T+ITTP ++P F K++ K    GF + + 
Sbjct  12    LHIFFFPVMAPGHTIPMIDMAKLFAIRGCKSTLITTPHDEPTFLKSIAKTKDSGFDINVV  71

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              +  P  EVGLPE    L++    +   +F +A  ML   LE L+++L PDCL++D F P
Sbjct  72    TVTLPLKEVGLPEDSDFLNKVTTVEMRKQFRRAIMMLDQQLEMLIEKLAPDCLISDTFLP  131

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             W T  AAK+ IPRL FHGTS  ++     +R+Y+P   VS DSE F IPN P E+ ++++
Sbjct  132   WTTEIAAKYKIPRLAFHGTSAFSIAGTECVRLYEPHKKVSCDSEPFIIPNFPGEITMSRM  191

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+    R E + T  +F   V+ SE++S+GVI NSFYELEP YA+HY+  LGRR+W VGP
Sbjct  192   QLPDLFREETDFT--KFYNEVKESEKRSFGVIMNSFYELEPAYADHYRTFLGRRSWFVGP  249

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             LSL N + EDKA RG +++ID+HECL+WLDSK P+SV+YICFGS+ANF  +QLHE+A+G+
Sbjct  250   LSLCNEETEDKAHRGNQASIDQHECLEWLDSKQPNSVIYICFGSMANFNAAQLHEIAVGL  309

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG  F+WV++     + G E+W+P+G+E R +  GLIIRGWAPQV+ILDH A+G FVT
Sbjct  310   EASGQQFIWVVKKDPNVEEGKEEWLPDGYESRIQNNGLIIRGWAPQVLILDHEAIGGFVT  369

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLE V  GVPMVTWPV AEQF NEK +T +L+ G  VG K+W RL  D VK E 
Sbjct  370   HCGWNSTLEAVTAGVPMVTWPVAAEQFFNEKFVTQVLKIGVNVGVKQWVRLFGDSVKSER  429

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + EA+K+V++ EE+EEMR + K + + AK A+
Sbjct  430   VEEAVKRVLVREEAEEMRRKVKALAEMAKGAV  461



>ref|XP_010027902.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW54539.1| hypothetical protein EUGRSUZ_I00497 [Eucalyptus grandis]
Length=483

 Score =   508 bits (1308),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 236/452 (52%), Positives = 327/452 (72%), Gaps = 2/452 (0%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             +H+FFFP +A GHMIP +DMAKLFA RG K+T+I TP ++P F K++ K    GF +++ 
Sbjct  7     VHIFFFPFVASGHMIPMIDMAKLFAIRGCKSTLIATPHDKPTFLKSIAKTKDDGFDIDVI  66

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              +  P  EVGLPE C  +++    +   +FF+A  ML   LE L+++L PDCLV+DM  P
Sbjct  67    TVTLPLKEVGLPEDCDNMNKVTTVEVRKQFFRAIKMLDQQLERLIEKLAPDCLVSDMLLP  126

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             W T  AAK+ IPRL+FHGTS  ++ +M  +R+Y+P   VS DSE F IPN P E+ ++++
Sbjct  127   WTTEIAAKWGIPRLVFHGTSAFSIASMECVRLYEPQKRVSCDSEPFVIPNFPGEITMSRM  186

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+    R E E T  + +  +  SE++S+GVI NSFYELEP YA+HY+  LGR++W VGP
Sbjct  187   QLPDVYREETEVT--KLLNVMMESEKRSFGVIMNSFYELEPAYADHYRTFLGRQSWFVGP  244

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             LSL N++ EDKA RG +++ID+HECLKWLDS+ P+SV+YICFGS+ANF   QLHE+A+G+
Sbjct  245   LSLCNKESEDKAHRGNQASIDQHECLKWLDSRQPNSVIYICFGSMANFNVPQLHEIAVGL  304

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG  F+WV++     + G E+W+P+G+E R + KGLIIRGWAPQV+ILDH A+G FVT
Sbjct  305   EASGQQFIWVVKKDPNVEEGKEEWLPDGYESRIQNKGLIIRGWAPQVLILDHEAIGGFVT  364

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLE +  GVPMV WPV AEQF NEK +T +L+ G  +G K+W +   D +K E 
Sbjct  365   HCGWNSTLEAITAGVPMVAWPVEAEQFFNEKFVTQVLKVGVSIGVKQWVKQFGDSMKSER  424

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + +A+K+V++GEE+EEMR RAK + + A+ A+
Sbjct  425   VEDAVKRVLVGEEAEEMRRRAKALAEMARGAV  456



>ref|XP_010028418.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=485

 Score =   508 bits (1307),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 239/452 (53%), Positives = 323/452 (71%), Gaps = 2/452 (0%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FFFP +A GHMIP +DMAKLFA RG K+T+I TP ++P F K++ K    GF +++ 
Sbjct  8     LHIFFFPFVAPGHMIPMIDMAKLFAMRGCKSTLIATPHDEPTFLKSIAKPRDSGFDIDVV  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              +  P  +VGLPE C  L++    D   +F +A  ML   LE L+++L PDCL++DMF P
Sbjct  68    TVSLPLKDVGLPEDCDNLNKAATMDMHRQFMRAVMMLDRQLELLIEKLAPDCLISDMFLP  127

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             W T  AAK  IPRL+FHGTS  ++     +R+Y+P   V  DSE F IPN P E+ ++++
Sbjct  128   WTTEIAAKCGIPRLVFHGTSAFSVGGTECVRLYEPHKKVLCDSEPFVIPNFPGEITLSRM  187

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+  F R E E T  +F   V+ SE++S+GV+ NSFYELEP YA+HY   LGRR+W +GP
Sbjct  188   QLQDFVREETEFT--KFYAQVKESEKRSFGVVMNSFYELEPAYAKHYSTFLGRRSWFIGP  245

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             LSL N ++EDKA RG +++ID+HECLKWLDSK P+SV+YICFGS+ANF  +QLHE+A+G+
Sbjct  246   LSLCNEEIEDKAHRGSQASIDQHECLKWLDSKQPNSVIYICFGSMANFNAAQLHEIAVGL  305

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG  F+WV++     + G E+W+P+G+E R + KGLIIRGWAPQV+ILD+ A+G FVT
Sbjct  306   EASGQQFIWVVKKDPIVEEGKEEWLPDGYESRIRNKGLIIRGWAPQVLILDNEAIGGFVT  365

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNS LE +  GVPMVTWPV AEQF NEKL+T +L+ G  VG K W R   D VK + 
Sbjct  366   HCGWNSILEAITAGVPMVTWPVAAEQFYNEKLVTRVLQIGVNVGVKRWVRYFGDSVKSDR  425

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + EA+K+V++GEE+ EMR R K + + A+ A+
Sbjct  426   VVEAVKRVLVGEEAGEMRRRTKALSEMARGAV  457



>ref|XP_007153573.1| hypothetical protein PHAVU_003G046900g [Phaseolus vulgaris]
 gb|ESW25567.1| hypothetical protein PHAVU_003G046900g [Phaseolus vulgaris]
Length=478

 Score =   507 bits (1306),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 247/452 (55%), Positives = 335/452 (74%), Gaps = 5/452 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FFFP +++GH+IPT+DMAK+FA +GVKATIITTP+N P  SKA++K  +    ++I+
Sbjct  10    LHIFFFPFLSYGHIIPTVDMAKVFAEKGVKATIITTPSNAPFISKAIEK-AKTNNNIQIQ  68

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              + F   E GLP+  +  D     D   RFF A ++LQ PLE LL + RP+C+VADMFFP
Sbjct  69    TIHFSTAEAGLPDGLEISDSISSQDLFHRFFMATSLLQEPLEQLLLKQRPNCVVADMFFP  128

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT++AAKF IPRL+FHGTS  +LCA   L +Y   N VSSDSE  TIPNLP E+KI   
Sbjct  129   WATDSAAKFGIPRLVFHGTSLFSLCATTCLGLYSSNNHVSSDSESLTIPNLPGEIKIAGT  188

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
              ++ +   E    M++ M+    SE +S+GV+ N+FY LE DYAE +  VLGR+AW +GP
Sbjct  189   SLASYAMVE-HKGMTKLMKEAIESELRSHGVVVNTFYALEKDYAEFFSKVLGRKAWHIGP  247

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             LSL NRD+E+KA RGK++ + EHECLKWLD+K P+SVVY+CFGS      S++ E+A G+
Sbjct  248   LSLSNRDMEEKANRGKEACMHEHECLKWLDTKKPNSVVYVCFGSTIVLPDSRVREIATGL  307

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG  F+WV+R  + + NG E W+PEGFE+R +GKGLIIRGWAPQV+IL+H A+GAFVT
Sbjct  308   EASGQAFMWVVR--KSKGNGVE-WLPEGFEKRMEGKGLIIRGWAPQVLILEHKAIGAFVT  364

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLE V  GVPM+TWP+FA+QF NEKL+T++L+ G  VG+K+W  L+ D +  +A
Sbjct  365   HCGWNSTLEAVSAGVPMITWPIFADQFFNEKLVTEVLKIGVPVGAKKWIGLEGDNISWDA  424

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + +A+K++M GEE+ EMR++AKV+   A++A+
Sbjct  425   VEKAVKRIMSGEEAIEMRNKAKVLSQLARQAM  456



>ref|XP_003518714.1| PREDICTED: scopoletin glucosyltransferase-like [Glycine max]
Length=487

 Score =   507 bits (1306),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 246/457 (54%), Positives = 332/457 (73%), Gaps = 7/457 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKY---TQLGFQM  251
             LHVFF P +AHGH+IPT+DMAKLFA +G+K TIITTP N P  SKA+ K    +     +
Sbjct  8     LHVFFIPFLAHGHIIPTIDMAKLFAGKGLKTTIITTPLNVPFISKAIGKAESESNDNNVI  67

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
              I  +EFP  E GLP+ C+  +        P FFKA  +LQ P E LL +  P+C+VAD+
Sbjct  68    HIETIEFPYAEAGLPKGCENTNSITSMHLYPAFFKALGLLQHPFEQLLLQQHPNCVVADV  127

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
              FPWATN++AKF +P L++ GTS  ++CA    R+Y+P+ +VSSDSE F IPNLP E+ +
Sbjct  128   MFPWATNSSAKFGVPSLVYDGTSFFSICANECTRLYEPYKNVSSDSEPFVIPNLPGEITM  187

Query  612   TKLQVSPFERSEVEN-TMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             T++QVSP   S  E+  +++ +  V+ SE KSYG++ NSFYELE  YA+H +N LGR+AW
Sbjct  188   TRMQVSPHVMSNKESPAVTKLLEEVKESELKSYGMVVNSFYELEKVYADHLRNNLGRKAW  247

Query  789   SVGPLSLYNRDVEDKAERGKKSAI-DEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHE  965
              VGP+ L+NR  E+KA RG  ++I DEHECLKWLD+K P+SVVY+CFG+      SQL +
Sbjct  248   HVGPMFLFNRVKEEKAHRGMDASINDEHECLKWLDTKEPNSVVYVCFGTTTKLTDSQLED  307

Query  966   MAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAV  1145
             +A+G+E SG  F+WV+R  + E +G ++W+P+GFEER +GKGLIIRGWAPQV+IL+H A+
Sbjct  308   IAIGLEASGQQFIWVVR--KSEKDGVDQWLPDGFEERIEGKGLIIRGWAPQVLILEHEAI  365

Query  1146  GAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDG  1325
             GAFVTHCGWNS LEGV  GVPMVTWP+  EQF NEKL+ +IL+ G  VG+K+W     D 
Sbjct  366   GAFVTHCGWNSILEGVVAGVPMVTWPIAYEQFFNEKLVAEILKIGVPVGAKKWAAGVGDT  425

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VK EA+ +A+K++MIGEE+EEMR++AK     A++++
Sbjct  426   VKWEAVEKAVKRIMIGEEAEEMRNKAKGFSQLARQSV  462



>ref|XP_010027898.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=488

 Score =   507 bits (1306),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 238/452 (53%), Positives = 322/452 (71%), Gaps = 2/452 (0%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FFFP+MA GH IP +DMAKLFA RG K+T+ITTP ++P F K++ K    GF + + 
Sbjct  12    LHIFFFPVMAPGHTIPMIDMAKLFAIRGCKSTLITTPHDEPTFLKSIAKTKDSGFDINVV  71

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              +  P  EVGLPE C  L++    +   +F +A  ML   LE L+++L PDCL++D F P
Sbjct  72    TVTLPLKEVGLPEDCDSLNKVTTVEMRKQFRRAIMMLDQQLELLIEKLAPDCLISDTFLP  131

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             W T  AAK+ IPRL FHGTS  ++     +R+Y+P   VS DSE F IPN P E+ ++++
Sbjct  132   WTTEIAAKYKIPRLAFHGTSAFSVAGTECVRLYEPHKKVSCDSEPFIIPNFPGEITMSRM  191

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+    R E + T  +F   V+ SE++S+GV+ NSFYELEP YA+HY+  LGRR+W VGP
Sbjct  192   QLPDLFREETDFT--KFYNEVKESEKRSFGVVMNSFYELEPAYADHYRTFLGRRSWFVGP  249

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             LSL N++ E KA RG +++ID+HECL+WLDSK P+SV+YICFGS+ANF  +QLHE+A+G+
Sbjct  250   LSLCNKETEGKAHRGNQASIDQHECLEWLDSKQPNSVIYICFGSMANFNAAQLHEIAVGL  309

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG  F+WV++     + G E+W+P+GFE R +  GLIIRGWAPQV+ILDH A+G  VT
Sbjct  310   EASGQQFIWVVKKDPNVEEGKEEWLPDGFESRIRNNGLIIRGWAPQVLILDHEAIGGIVT  369

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLE V  GVPMVTWPV AEQF NEK +T +L+ G  +G K+W RL  D VK + 
Sbjct  370   HCGWNSTLEAVTAGVPMVTWPVAAEQFFNEKFVTQVLKIGVNIGVKQWVRLFGDSVKSQR  429

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + EA+K+V++ EE+EEMR + K + + AK A+
Sbjct  430   VEEAVKRVLVREEAEEMRRKVKALAEMAKGAV  461



>ref|XP_010027835.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW54462.1| hypothetical protein EUGRSUZ_I00409 [Eucalyptus grandis]
Length=485

 Score =   507 bits (1305),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 238/456 (52%), Positives = 327/456 (72%), Gaps = 2/456 (0%)
 Frame = +3

Query  69    AMGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQ  248
             A   LH+FFFP MA GHMIP +DMAKLFA RG K+T+I TP ++  F K++ K+  LGF 
Sbjct  4     ASHQLHLFFFPFMAPGHMIPMIDMAKLFAMRGCKSTLIATPYDKSTFMKSIVKFKDLGFD  63

Query  249   MEIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVAD  428
             + +  +  P  EVGLPE    +++    +   +F +A  ML   LE L+++L PDCL++D
Sbjct  64    INVVTVTLPLKEVGLPEDRDNMNRVTSMEMRMQFMRAITMLDQQLELLIEKLAPDCLISD  123

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             MF PW T  AAK  IPRL+FHGTS  ++     +R+Y+    VSSDSE F IPN P E+ 
Sbjct  124   MFLPWTTEVAAKCSIPRLVFHGTSAFSVAGTECVRLYELHKKVSSDSEPFVIPNFPGEIT  183

Query  609   ITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             ++++Q+  F + E E T  + M  ++ SE++S+GV+ NSFYELEP YA+HY+  LGRR+W
Sbjct  184   LSRMQLQDFVKVETEFT--KLMDEMKESEKRSFGVVMNSFYELEPAYADHYRTFLGRRSW  241

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
              +GP SL N+D EDKA+RGK+++ID+ ECL+WLDS+  +SV+YICF S+ANF  +QLHE+
Sbjct  242   LIGPFSLCNKDTEDKAQRGKQASIDQLECLQWLDSRQTNSVIYICFDSMANFNAAQLHEI  301

Query  969   AMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVG  1148
             A+G+E SG  F+WV++     + G E+W+P+G+E R + KGLIIRGWAPQV+ILDH AVG
Sbjct  302   AVGLEASGQQFIWVVKKDPNVEEGKEEWLPDGYEPRIRNKGLIIRGWAPQVLILDHEAVG  361

Query  1149  AFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGV  1328
              FVTHCGWNSTLE +  GVP+VTWPV AEQF NEK +T +L+ G  +G K+W RL  D V
Sbjct  362   GFVTHCGWNSTLEAITAGVPVVTWPVAAEQFYNEKFVTQVLKIGFDIGVKKWARLFGDSV  421

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             K E + EA+K+V++GEE+EEMR RAK + + A+ A+
Sbjct  422   KSERVEEAVKRVLVGEEAEEMRRRAKALAEMARGAV  457



>ref|XP_009377799.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Pyrus x bretschneideri]
 ref|XP_009377807.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Pyrus x bretschneideri]
Length=477

 Score =   506 bits (1304),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 246/457 (54%), Positives = 325/457 (71%), Gaps = 13/457 (3%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH+FFFP MA GH IP ++MAKLFAS GVK+T++TTP N P+FSKA+    QLGF +EI
Sbjct  8     QLHIFFFPYMAQGHTIPLINMAKLFASHGVKSTLMTTPLNAPLFSKAIQSTKQLGFDIEI  67

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +++FP  EVGLP+ C+  +     +   +FFKA  +LQP +E +L E RP CLVAD FF
Sbjct  68    LVIKFPTEEVGLPQGCESGNLATTTEMKEKFFKATFLLQPQIEQILDEHRPHCLVADAFF  127

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWAT+ AAKF IPR++FHG    ALCA  S+ +Y+P   +SSDSE+FTIPN P E+K+  
Sbjct  128   PWATDLAAKFGIPRIVFHGVGFFALCATLSVLLYEPHLKLSSDSEVFTIPNFPVEIKLIS  187

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
              Q+  F +   E   ++  ++ R  EEKS+G I NSFYELEP +A+HY+   GR+AW +G
Sbjct  188   SQIPAFIKQNAETEFTKLFKAARECEEKSFGFIVNSFYELEPAFADHYRTAFGRKAWHIG  247

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             P+S +N+  +D+A       +D+H+ L W++SK P+SVVYICFGS+ NF  SQL E+A G
Sbjct  248   PISSWNKAADDEA------FLDQHKSLNWINSKKPNSVVYICFGSMTNFIDSQLLEIAAG  301

Query  978   IEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             +E SG  F+WV++    E N  E+W+PEGFE+R +GKGLIIRGWAPQV IL+H A+G FV
Sbjct  302   LEASGQGFIWVVKR---EKNDKEEWLPEGFEKRMEGKGLIIRGWAPQVPILEHEAIGGFV  358

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL----DSDG  1325
             THCGWNS LEGV  GVPM+TWPV AEQF NEKL+T +LRTG  VG K+W           
Sbjct  359   THCGWNSILEGVSAGVPMITWPVSAEQFYNEKLVTLVLRTGVAVGVKQWSTFVDVKKEAS  418

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VKREAI +AI +VM+ EE+E MR+RA V+++ A +A+
Sbjct  419   VKREAIEKAINQVMVSEEAEGMRARASVLREMATRAV  455



>ref|XP_008236556.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Prunus mume]
Length=481

 Score =   506 bits (1303),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 248/458 (54%), Positives = 341/458 (74%), Gaps = 9/458 (2%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH+FFFP MA GH IP +D+AKLFASRGVK+T+ITT  N P+ SKA+     LGF++EI
Sbjct  8     QLHIFFFPYMAQGHSIPLIDIAKLFASRGVKSTLITTTLNAPLLSKAIQSSKNLGFEIEI  67

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +++FP +EVGLP+  +        +   +FF+A  +L+P +E +L + RP CLVAD FF
Sbjct  68    LVIQFPAIEVGLPQGFEITSMATTHEMKEKFFQATFLLEPQIEQILDQHRPHCLVADSFF  127

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWAT+ A KF IPRLIF+G   L +CA  S+ +Y+P   VSSDSE+FTIPNLP E+KIT+
Sbjct  128   PWATDVAGKFGIPRLIFYGPGFLPMCASLSVILYEPHLKVSSDSEVFTIPNLPVEIKITR  187

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
              QV  FE++     +S+ ++  R  EE+SYG+IFN+FYELEP +A+HY+ V GR+AW +G
Sbjct  188   NQVPIFEQN-ANPFLSKLLKESRECEERSYGIIFNTFYELEPAFADHYRKVFGRKAWHIG  246

Query  798   PLSLYNRDVEDKAE-RGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAM  974
             P+SL N+   DK E RG ++++DEHECL WL++K  +SVVYICFGS+ NF+  QL E+A+
Sbjct  247   PVSLCNKAAGDKTEMRGMEASLDEHECLNWLNTKKHNSVVYICFGSLTNFSDPQLLEIAL  306

Query  975   GIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAF  1154
             G+E  G +F+WV++ +++E    E+W+PEGFE+R +GKG+IIRGWAPQV+IL+H A+G F
Sbjct  307   GLEACGQEFIWVVKKEKKE---KEEWLPEGFEQRMEGKGVIIRGWAPQVLILEHQAIGGF  363

Query  1155  VTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL----DSD  1322
             VTHCGWNS LEGV  GVPM+TWPV AEQF NEKL+T+ILR G  VGS++W  L       
Sbjct  364   VTHCGWNSILEGVSSGVPMITWPVSAEQFYNEKLVTEILRIGVAVGSEKWAPLVDVKKEA  423

Query  1323  GVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              VKR+AI +A+ +VM+G+E+EEMRS A+ + + A++A+
Sbjct  424   SVKRDAIEKAVAQVMVGDEAEEMRSTARALGEMARRAV  461



>ref|XP_008375156.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Malus domestica]
Length=475

 Score =   505 bits (1300),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 249/457 (54%), Positives = 328/457 (72%), Gaps = 15/457 (3%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH+FFFP M  GH IP ++MAKLFASRGVK+T+ITTP N P+FSKA+    +LGF ++I
Sbjct  8     QLHIFFFPYMIQGHFIPLINMAKLFASRGVKSTLITTPLNAPLFSKAIQSSKKLGFDVDI  67

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +++FP  EVGLP+ C+  +     +   +F KA  +LQP +E +L E RP CLVAD FF
Sbjct  68    LVIKFPTEEVGLPQGCENANLATTREMNEKFIKATFLLQPQIEQILYEHRPHCLVADNFF  127

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWAT+ AAKF IPR+IF G    ALCA HS+ +Y+P   +SSDSE+FTIP+ P E+K+T+
Sbjct  128   PWATDVAAKFGIPRIIFQGLGFFALCAFHSVALYEPHAKLSSDSEVFTIPSFPVEIKLTR  187

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
              Q+  F +   E T  +  +    SEEKSYG I NSFYELEP +A+HY+ VLGR+AW +G
Sbjct  188   SQIPNFPKQSAEFT--KLFKEAMESEEKSYGFIVNSFYELEPAFADHYRTVLGRKAWHIG  245

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             P+S  N+  +D+A       +D HECL WL SK P+SVVYICFGS+  F  SQL E+A G
Sbjct  246   PVSSVNKAADDEA------FLDWHECLNWLSSKKPNSVVYICFGSMTKFIDSQLLEIAAG  299

Query  978   IEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             +E SG +F+WV++    E N  E+W+PEGFE+R +GKGLIIRGWAPQV IL+H A+GAFV
Sbjct  300   LEASGQEFIWVVKR---EKNDKEEWLPEGFEKRMEGKGLIIRGWAPQVPILEHQAIGAFV  356

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKR----LDSDG  1325
             THCGWNS LEGV  GVPM+TWPV AEQF NEKL+T +L+TG  VG+K+W      +    
Sbjct  357   THCGWNSILEGVSAGVPMITWPVSAEQFYNEKLVTVVLKTGVAVGAKQWGTHLDVMTEAS  416

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VKREAI +A+ +VM+ EE+E MR RA+++++ A +A+
Sbjct  417   VKREAIEKAVNQVMVSEEAEGMRGRARMLREMAMRAV  453



>emb|CAA17559.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 emb|CAB80130.1| glucosyltransferase-like protein [Arabidopsis thaliana]
Length=478

 Score =   504 bits (1298),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 252/458 (55%), Positives = 327/458 (71%), Gaps = 13/458 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH   FP MAHGHMIPTLDMAKLFA++G K+TI+TTP N  +F +   K    G +++I+
Sbjct  10    LHFLLFPFMAHGHMIPTLDMAKLFATKGAKSTILTTPLNAKLFFEKPIKNLNPGLEIDIQ  69

Query  261   LLEFPGVEVGLPESCQRLD---QTPDDDG---LPRFFKACAMlqppledllqelrpdCLV  422
             +  FP VE+GLPE C+ +D      +DD    + +FF +    +  LE LL   RPDCL+
Sbjct  70    IFNFPCVELGLPEGCENVDFFTSNNNDDKNEMIVKFFFSTRFFKDQLEKLLGTTRPDCLI  129

Query  423   ADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHE  602
             ADMFFPWAT AA KF++PRL+FHGT + +LCA + + V+KP   V+S SE F IP LP  
Sbjct  130   ADMFFPWATEAAGKFNVPRLVFHGTGYFSLCAGYCIGVHKPQKRVASSSEPFVIPELPGN  189

Query  603   LKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRR  782
             + IT+ Q+      + E+ M +FM  VR SE KS GV+ NSFYELE DYA+ YK+ + +R
Sbjct  190   IVITEEQIID---GDGESDMGKFMTEVRESEVKSSGVVLNSFYELEHDYADFYKSCVQKR  246

Query  783   AWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLH  962
             AW +GPLS+YNR  E+KAERGKK+ IDE ECLKWLDSK P+SV+Y+ FGSVA F   QL 
Sbjct  247   AWHIGPLSVYNRGFEEKAERGKKANIDEAECLKWLDSKKPNSVIYVSFGSVAFFKNEQLF  306

Query  963   EMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPA  1142
             E+A G+E SG  F+WV+R  +E+    E+W+PEGFEER KGKG+IIRGWAPQV+ILDH A
Sbjct  307   EIAAGLEASGTSFIWVVRKTKEK----EEWLPEGFEERVKGKGMIIRGWAPQVLILDHQA  362

Query  1143  VGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD  1322
                FVTHCGWNS LEGV  G+PMVTWPV AEQF NEKL+T +LRTG  VG+K+  R   D
Sbjct  363   TCGFVTHCGWNSLLEGVAAGLPMVTWPVAAEQFYNEKLVTQVLRTGVSVGAKKNVRTTGD  422

Query  1323  GVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              + RE + +A+++V++GEE++E R RAK + + AK A+
Sbjct  423   FISREKVVKAVREVLVGEEADERRERAKKLAEMAKAAV  460



>dbj|BAG31952.1| UGT73A13 [Perilla frutescens]
Length=479

 Score =   504 bits (1298),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 243/455 (53%), Positives = 324/455 (71%), Gaps = 5/455 (1%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             M  LH+   P MA GHMIP L+MAKLF SRG+K TII TPA    F+  V K  Q G  +
Sbjct  1     MKQLHIVLIPAMAQGHMIPMLEMAKLFTSRGIKTTIIATPA----FAGPVTKSRQSGHDI  56

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
              + + +FP     LP+     DQ    D + +F +A  +LQ P+E +LQEL+P+C+V+DM
Sbjct  57    GLSVTDFPPKGSSLPDHVASFDQISTPDLVTKFLRAMELLQGPVETILQELQPNCVVSDM  116

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             F PW  ++AAKF IPRL+F G+S  + C    + + KP+ +VSSDSE F +  LPHEL  
Sbjct  117   FLPWTADSAAKFGIPRLVFFGSSCFSRCLSEEMELQKPYKNVSSDSEPFVLGGLPHELNF  176

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
              + Q+ PF   E EN   +    +  S + +YG + NSFYELE  Y +H+KNVLG++AW 
Sbjct  177   VRSQLPPFHLQEEENDFKKLFSQISESAKNTYGEVVNSFYELESAYLDHFKNVLGKKAWQ  236

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GPL L + + E K++RGK+SAIDEHECL WLDSK P+SVVY+CFGS A F  +QLHE A
Sbjct  237   IGPLLLCSNEAERKSQRGKESAIDEHECLAWLDSKRPNSVVYVCFGSSATFTKAQLHETA  296

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
              G+E+SG DF+WV+R  ++++N  +  +P+GFEER KGKGLIIRGWAPQ++ILDHPA+GA
Sbjct  297   AGLEESGQDFIWVVRKGKDQENELD-LLPQGFEERVKGKGLIIRGWAPQLMILDHPAIGA  355

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTH GWNSTLEG+C GVPM+TWPVFAEQF NEKL+T++L TG  VG+K W R+ S+GV 
Sbjct  356   FVTHSGWNSTLEGICAGVPMITWPVFAEQFYNEKLVTEVLETGVSVGNKRWMRVASEGVG  415

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             R+A+ EA++++M+G  + EMR RAK  K+ A+KAI
Sbjct  416   RDAVVEAVEQIMLGGGAAEMRRRAKYYKEMARKAI  450



>gb|KGN43914.1| hypothetical protein Csa_7G073500 [Cucumis sativus]
Length=471

 Score =   503 bits (1296),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 244/449 (54%), Positives = 328/449 (73%), Gaps = 5/449 (1%)
 Frame = +3

Query  105   MAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAV---DKYTQLGFQMEIRLLEFP  275
             MA GHMIP +DMAKL +SRGVK TI+TTP N    S ++    K      ++ + +L+FP
Sbjct  1     MAPGHMIPMVDMAKLLSSRGVKITIVTTPLNSISISNSIHNNSKSISPPPKIHLLILKFP  60

Query  276   GVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFPWATNA  455
               EVGLP+ C+ LD    +  +P+F   C +LQ P E+ + E RP C++AD+FFPWA + 
Sbjct  61    SAEVGLPDGCENLDSVTGNAMIPKFISVCNLLQTPFEEAVMEHRPHCILADIFFPWANDV  120

Query  456   AAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKLQVSPF  635
             AAKF IPRL FHGT   + CA   +R+++P+  VSS++E F IP LP E+  TK+++  F
Sbjct  121   AAKFGIPRLTFHGTGFFSTCASEFIRIHEPYKHVSSETEPFLIPCLPGEITFTKMKLPEF  180

Query  636   ERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGPLSLYN  815
                  +N +SEFM+    +  K YG+I NSFYELE +YA+ Y+NV GR+ W +GPLSL N
Sbjct  181   MWENYKNDLSEFMKRAFEASSKCYGLIMNSFYELEAEYADCYRNVFGRKVWHIGPLSLCN  240

Query  816   RDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGIEDSGM  995
             +D+E+KA+RG KSAIDEHECLKWLDS+ P+SVVY+ FGS+A F   QL E+A+G+E S  
Sbjct  241   KDIEEKAQRGNKSAIDEHECLKWLDSQKPNSVVYVSFGSMAKFNADQLKEIAIGLEASRK  300

Query  996   DFVWVIRN-KREEDNGSEK-WMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVTHCG  1169
             +F+WV+R  K +E+ G +K W+PEG+E+R +GKG+IIRGWAPQV+ILDHP VG FVTHCG
Sbjct  301   NFIWVVRKVKGDEEKGEDKDWLPEGYEQRMEGKGMIIRGWAPQVLILDHPGVGGFVTHCG  360

Query  1170  WNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREAIAE  1349
             WNSTLEGV  GVPMVTWPV AEQF NEKL+T++L+ G GVG ++W R   D +K EA+ +
Sbjct  361   WNSTLEGVAAGVPMVTWPVAAEQFYNEKLLTEVLKIGVGVGVQKWVRTVGDFIKSEAVEK  420

Query  1350  AIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             AI++VM G+E+EEMR++AK + + AKKAI
Sbjct  421   AIRRVMEGKEAEEMRNKAKELGEMAKKAI  449



>ref|XP_009779862.1| PREDICTED: scopoletin glucosyltransferase-like [Nicotiana sylvestris]
Length=485

 Score =   503 bits (1296),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 245/457 (54%), Positives = 323/457 (71%), Gaps = 7/457 (2%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH +FFP+MA GHMIP +DMA+ FA RGVKAT++TTP N P FSK + +  +LG  + I
Sbjct  7     QLHAYFFPVMAPGHMIPLVDMARQFARRGVKATLVTTPLNAPKFSKTIQRERELGSDISI  66

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
             R +EFP  E GLP+ C+ L  T   +   +F KA  + Q P+E  L+E  PDCL+A   F
Sbjct  67    RTIEFPCKEAGLPDGCENLASTTSTEMTQKFIKALYLFQQPIEQFLEEDHPDCLIASTLF  126

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PW  + AAK  IPRL+F GT  L +CA HSL  YKP   V SD+E F IP LPH +K+++
Sbjct  127   PWTVDVAAKLGIPRLVFSGTGLLPICAYHSLMEYKPHLKVESDTEEFIIPGLPHTIKMSR  186

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
              Q+S   + E EN M+E ++ V  +E  SYG I NSFYE+EP+Y +HY+ V+G++AW +G
Sbjct  187   QQLSDHIKDETENPMTEIIKDVMRAEMTSYGAIVNSFYEVEPNYVKHYREVVGKKAWHIG  246

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             P+SL N+D EDKA+RG++    EH+CL WL+SK P SVVYICFGS++ F+ +QL E+AM 
Sbjct  247   PVSLCNKDNEDKAQRGQEICFSEHQCLDWLNSKKPKSVVYICFGSMSFFSSAQLLEIAMA  306

Query  978   IEDSGMDFVWVIRN--KREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             +E S   F+WV++   K EE N   +WMPEGFEE+ KG+GLII+GWAPQV+ILDH A+G 
Sbjct  307   LEASDQQFIWVVKQNTKNEEQN---EWMPEGFEEKLKGRGLIIKGWAPQVLILDHEAIGG  363

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEW-KRLDSD-G  1325
             FVTHCGWNS+LEGV  GVPMVTWP+ AEQF NEKL+ +IL+ G  VG++ W +R DS   
Sbjct  364   FVTHCGWNSSLEGVTAGVPMVTWPLSAEQFFNEKLLVEILKIGVPVGAQAWSQRTDSRVP  423

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + RE I  A+ K+M+G E+EEMRSRA  +   AK A+
Sbjct  424   INRENIQRAMTKLMVGSEAEEMRSRAAALGKLAKMAV  460



>ref|XP_010027836.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW54463.1| hypothetical protein EUGRSUZ_I00410 [Eucalyptus grandis]
Length=485

 Score =   503 bits (1296),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 234/456 (51%), Positives = 326/456 (71%), Gaps = 2/456 (0%)
 Frame = +3

Query  69    AMGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQ  248
             A   LH+FFFP +A GHMIP +DMAK+FA+RG K+T+I TP ++P F K++ K   LGF 
Sbjct  4     ASHQLHLFFFPFIAPGHMIPMIDMAKVFATRGCKSTLIATPHDKPSFMKSITKSKDLGFD  63

Query  249   MEIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVAD  428
             +++  +  P  EVGLP  C  L++    +   +F +  AML   LE L+++L PDCL++D
Sbjct  64    IDVVTVTLPLKEVGLPADCDNLNRVTSMEMRQQFRRGTAMLDQQLELLIEKLTPDCLISD  123

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             MF PW     AK  IPRL+FHGTS  ++     +R+Y+P   VSSDSE F IPN P E+ 
Sbjct  124   MFLPWTIKVTAKCGIPRLVFHGTSAFSVAGTECVRLYEPHKKVSSDSEPFVIPNFPGEIT  183

Query  609   ITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             ++++Q+  F + E E T  + M  ++ SE++S+GV+ NSFYELE  YA+HY+  LGRR+W
Sbjct  184   LSRMQLQDFVKEETEFT--KLMDVMKESEKRSFGVVMNSFYELELAYADHYRTFLGRRSW  241

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
              +GPLSL N+++EDKA RG++++ D+ ECLKWLDS+  +SV+YICFGS+ANF  +QLHE+
Sbjct  242   LIGPLSLCNKEIEDKAHRGEQASFDQLECLKWLDSRQTNSVIYICFGSMANFTAAQLHEI  301

Query  969   AMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVG  1148
             A+G+E SG  F+WV++     + G E+W+P+G+E R + KGLIIRGWAPQV+ILDH AVG
Sbjct  302   AVGLEASGQQFIWVVKKDPNVEEGKEEWLPDGYESRIQNKGLIIRGWAPQVLILDHEAVG  361

Query  1149  AFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGV  1328
              FVTHCGWNSTLE V  GVPMVTWPV AEQF NEK +  +L+ G  +G K+W R   D V
Sbjct  362   GFVTHCGWNSTLEAVTAGVPMVTWPVAAEQFYNEKFVIQVLKIGVDIGVKKWVRWFGDSV  421

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             K + + EA+K++++GEE+EEMR RAK + + A+ A+
Sbjct  422   KSDRVEEAVKRILVGEEAEEMRRRAKALAEMARGAV  457



>ref|XP_006286265.1| hypothetical protein CARUB_v10007840mg [Capsella rubella]
 gb|EOA19163.1| hypothetical protein CARUB_v10007840mg [Capsella rubella]
Length=485

 Score =   503 bits (1296),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 247/460 (54%), Positives = 330/460 (72%), Gaps = 14/460 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQME  254
             LHV  FP+MAHGHMIPT+DMAKLF++RG K+TI+TTP N  +  K +D +  L  G  + 
Sbjct  10    LHVMLFPIMAHGHMIPTVDMAKLFSTRGAKSTILTTPLNAKILQKQIDAFKNLNPGLDIG  69

Query  255   IRLLEFPGVEVGLPESCQRLDQTPDDDGLPR------FFKACAMlqppledllqelrpdC  416
             I + +FP VE+GLP+ C+  D    D+ + R      F  +    +  LE LL+   PDC
Sbjct  70    IHIFDFPCVELGLPQGCENADFFTSDNYVGRQDLTLKFILSTRFFKDQLEKLLETTTPDC  129

Query  417   LVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLP  596
             L+ADMFFPWAT AA KF++PRL+FHGT + +LC+ + +R ++P N V+S SE F IP+LP
Sbjct  130   LIADMFFPWATEAAEKFNVPRLVFHGTGYFSLCSEYCIRAHQPQNRVTSSSETFVIPDLP  189

Query  597   HELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
               + +TK Q+S  +    E+ +  FM  V+ SE KS GV+ NSFYELEPDYA+ YK+ + 
Sbjct  190   GNILMTKEQISDLDE---ESEVGRFMIEVKESEVKSSGVVVNSFYELEPDYADFYKSFIQ  246

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             ++AW +GPLS+Y+R  E+KA RGKK++IDE EC+KWLDSK P SV+YI FGSVANF   Q
Sbjct  247   KQAWHIGPLSMYSRGFEEKAGRGKKASIDEVECMKWLDSKKPDSVIYISFGSVANFKNEQ  306

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A G+E SG +F+WV+R K   D G  +W+PEGFEER +GKG+IIRGWAPQV+ILDH
Sbjct  307   LFEIAAGLEASGTNFIWVVR-KNTGDKG--EWLPEGFEERVEGKGMIIRGWAPQVLILDH  363

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD  1316
              A G FVTHCGWNS LEGV  G+PMVTWPV AEQF NEKL+T +LRTG  VG+++  R  
Sbjct  364   QATGGFVTHCGWNSLLEGVAAGLPMVTWPVGAEQFYNEKLVTQVLRTGVSVGAQKHVRGT  423

Query  1317  SDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              D + RE + +A+++V++GEE+EE R +AK + + AK A+
Sbjct  424   GDFISREKVDKAMREVLVGEEAEERRKQAKKLAEMAKAAV  463



>dbj|BAF75893.1| tetrahydroxychalcone glucosyltransferase [Dianthus caryophyllus]
Length=486

 Score =   503 bits (1295),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 264/480 (55%), Positives = 354/480 (74%), Gaps = 7/480 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+ FFP +AHGHMIPTLD+A+LFA+R V+ATIITT  N P F+ AVD   ++G    ++
Sbjct  8     LHIVFFPFLAHGHMIPTLDVARLFAARNVEATIITTRVNAPRFTSAVDTGNRIGNNQTVK  67

Query  261   L--LEFPGVEVGLPESCQRLDQTPDDDGL-PRFFKACAMlqppledllqelrpdCLVADM  431
             L  L FP  E G+PE C+  +      G+ PRFFK   +L+  LE  L  ++P+CLVADM
Sbjct  68    LELLRFPTHEAGVPEGCENAEIAMRIPGMMPRFFKGTQLLREQLEQYLSRVKPNCLVADM  127

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             F+PWAT +A K+DIPRL+FHGTS+ +LCA   +RV++P+  V  ++E FTIP +PH++K+
Sbjct  128   FYPWATESANKYDIPRLVFHGTSYFSLCAQEIVRVHEPYKMVLCNNEKFTIPLIPHDIKL  187

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
              + Q+ P   S+ +N   + M  V+ SE +SYGVI NSFYELEPDYAE Y   LGR+AW 
Sbjct  188   LRSQMCPDLISDEDNDFRKRMDLVKKSEVESYGVIVNSFYELEPDYAEVYTKELGRKAWH  247

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             VGP+SL NR V +K  RG +++IDEHECL WLDSK   SVVYI FGS+++    QLHE+A
Sbjct  248   VGPVSLCNRSVLEKGRRGNQASIDEHECLTWLDSKKLASVVYISFGSMSSSITPQLHEIA  307

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
               +E+SG +F+WV+R+   E++  ++  P GFE+RTK KGLIIRGWAPQV+ILDH AVGA
Sbjct  308   TALENSGCNFIWVVRSGESENH--DESFPPGFEQRTKEKGLIIRGWAPQVLILDHEAVGA  365

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDS--DG  1325
             F+THCGWNSTLEG+  GVPM+TWP  AEQF NEKL+T+IL++G  VG+K W R+ S  D 
Sbjct  366   FMTHCGWNSTLEGITAGVPMITWPHAAEQFYNEKLVTEILKSGVSVGAKIWSRMPSVEDL  425

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAIeeggssylglsslldelRAYHAK  1505
             + REAI  AI++VM GE++E MR +AK +K+ A+KA+EEGGSSY  LS+L+++L+ YH +
Sbjct  426   IGREAIEIAIREVMDGEKAETMRLKAKWLKEMARKAVEEGGSSYTQLSALIEDLKNYHTQ  485



>ref|XP_008454967.1| PREDICTED: scopoletin glucosyltransferase-like [Cucumis melo]
Length=494

 Score =   503 bits (1296),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 252/475 (53%), Positives = 338/475 (71%), Gaps = 16/475 (3%)
 Frame = +3

Query  51    VSSKDFAMGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKY  230
             +SS D    +LH+F FP +A GHMIP +DMAKL +SRG+K TI+TTP N    S ++   
Sbjct  1     MSSND---SELHIFLFPYLARGHMIPMVDMAKLLSSRGIKITIVTTPINSISISNSIKIS  57

Query  231   TQL-GFQMEIRLLEFPGVEVGLPESCQRLDQT----------PDDDGLPRFFKACAMlqp  377
                   ++ + +L+FP  EVGLP+ C+ LD             +   +P+F  A  + Q 
Sbjct  58    KSFSASKIHLLILKFPSAEVGLPDGCENLDFVINGCENLDFVTNTAMIPKFISAFDLFQT  117

Query  378   pledllqelrpdCLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDV  557
             P E+ ++E RP C+V DMFFPWA + AAKF IPRL FHGT   + CA   +R+++P+  V
Sbjct  118   PFEEAVREHRPHCIVVDMFFPWANDVAAKFGIPRLNFHGTGFFSTCASEFIRIHEPYKHV  177

Query  558   SSDSELFTIPNLPHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYEL  737
             SS++E F IP LP E+  TK+++  F     +N +SEFM+    +  K YG++ NSFYEL
Sbjct  178   SSETEPFFIPCLPGEITFTKMKLPEFMWENYKNDLSEFMKRAHEANSKCYGLVMNSFYEL  237

Query  738   EPDYAEHYKNVLGRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVY  917
             E +YAE Y+NVLGR+AW +GPLSLYN+ +E+KA+RG KSAIDEHECLKWLDS+ P+SVVY
Sbjct  238   EAEYAECYRNVLGRKAWHIGPLSLYNKGIEEKAQRGNKSAIDEHECLKWLDSQKPNSVVY  297

Query  918   ICFGSVANFAPSQLHEMAMGIEDSGMDFVWVIRN-KREEDNGSEK-WMPEGFEERTKGKG  1091
             + FGS+A F   QL E+A+G+E S   F+WV+R  K +E+ G +K W+PEG+EER +GKG
Sbjct  298   VSFGSMAKFNADQLKEIAIGLEASEKFFIWVVRKVKGDEEKGEDKDWLPEGYEERMEGKG  357

Query  1092  LIIRGWAPQVVILDHPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDIL  1271
             +IIRGWAPQV+ILDHP VG FVTHCGWNSTLEGV  GVPMVTWPV AEQF NEKL+T++L
Sbjct  358   MIIRGWAPQVLILDHPGVGGFVTHCGWNSTLEGVAAGVPMVTWPVAAEQFYNEKLLTEVL  417

Query  1272  RTGTGVGSKEWKRLDSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + G GVG ++W R   D +K EA+ +AI++VM G+E+EEMR++AK + + AKKAI
Sbjct  418   KIGVGVGVQKWVRTVGDFIKSEAVEKAIRRVMEGKEAEEMRNKAKELAEMAKKAI  472



>ref|XP_010447141.1| PREDICTED: UDP-glycosyltransferase 73B3 isoform X2 [Camelina 
sativa]
Length=482

 Score =   503 bits (1294),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 251/448 (56%), Positives = 323/448 (72%), Gaps = 14/448 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQME  254
             LHV FFP MAHGHMIPT+DMAKLF+SRG K+TI+TTP N  +  K +D +  L  G +++
Sbjct  10    LHVMFFPFMAHGHMIPTVDMAKLFSSRGAKSTILTTPLNAKILQKPIDAFKNLNPGLEID  69

Query  255   IRLLEFPGVEVGLPESCQRLDQTPDDDGLPR------FFKACAMlqppledllqelrpdC  416
             I++ +FP V++GLPE C+  D    D+ + R      FF +   L+  LE LLQ  RPDC
Sbjct  70    IQIFDFPCVQLGLPEGCENADFFTSDNNVDRQDMTLKFFMSTRFLKDQLEKLLQTTRPDC  129

Query  417   LVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLP  596
             L+ADMFFPWAT AA KF++PRL+FHGT + +LC+ + +RV+ P N V+S  E F IP+LP
Sbjct  130   LIADMFFPWATKAAEKFNVPRLVFHGTGYFSLCSDYCIRVHNPQNTVASSCEPFVIPDLP  189

Query  597   HELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
               + ITK Q+        E+ M +FM  VR SE KS GV+ NSFYELEP+YA  YK+ + 
Sbjct  190   GNIVITKDQIG---DRHGESEMGKFMAEVRASEVKSSGVVVNSFYELEPEYAHFYKSFVQ  246

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             +R+W +GPLSLY+R  E+KAERGKK++IDE ECLKWLDSK P SV+YI FGSVA F   Q
Sbjct  247   KRSWHIGPLSLYSRGFEEKAERGKKASIDEVECLKWLDSKEPDSVIYISFGSVACFKNEQ  306

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A G+E  G +F+WV+R    ++   E+W+PEGFEER KGKG+IIRGWAPQV+ILDH
Sbjct  307   LIEIAAGLEACGTNFIWVVRKSTGDE---EEWLPEGFEERVKGKGMIIRGWAPQVLILDH  363

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD  1316
              A G FVTHCGWNS LEGV  G+PMVTWPV AEQF NEKL+T +LRTG  VG+K+  R  
Sbjct  364   QATGGFVTHCGWNSLLEGVAAGLPMVTWPVGAEQFYNEKLVTQVLRTGVSVGAKKHVRST  423

Query  1317  SDGVKREAIAEAIKKVMIGEESEEMRSR  1400
              D + RE + +A+++V+ GEE+EE R R
Sbjct  424   GDFISREKVDKAVREVLAGEEAEERRGR  451



>ref|XP_009354713.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Pyrus x bretschneideri]
Length=475

 Score =   502 bits (1292),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 246/457 (54%), Positives = 326/457 (71%), Gaps = 15/457 (3%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH+FFFP M  GH IP ++MAKLFASRGVK+T+ITTP N P+FSK +    +LGF +EI
Sbjct  8     QLHIFFFPYMIQGHFIPLINMAKLFASRGVKSTLITTPLNAPLFSKEIQSSKKLGFDVEI  67

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +++FP  EVGLP+ C+  +     +   +F KA  +LQP +E +L + RP CLVAD+FF
Sbjct  68    LVIKFPTEEVGLPQGCENGNLATTSEMNEKFIKATFLLQPQIEQILDKHRPHCLVADVFF  127

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWAT+ AAKF IPR+IFHG    ALCA  S+ +Y+P   +SSDSE+FT+PN P E+K+T+
Sbjct  128   PWATDVAAKFGIPRIIFHGIGFFALCASLSVALYEPHAKLSSDSEVFTMPNFPVEIKLTR  187

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
              Q+  F +   E T  +  +     EEKSYG I NSFYELEP +A+HY+ V GR+AW +G
Sbjct  188   SQMPTFPKQSSEFT--KLFKEAMEIEEKSYGFIVNSFYELEPAFADHYRTVFGRKAWHIG  245

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             P+S  N+  +D+A      ++D HECL WL+SK P+SVVYICFGS  NF  SQL E+A G
Sbjct  246   PVSSVNKAADDEA------SLDRHECLNWLNSKKPNSVVYICFGSTTNFIDSQLLEIAAG  299

Query  978   IEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             +E SG +F+WV++    E N  E+W+PEGFE+R +GKGLIIRGWAPQV IL+H A+GAFV
Sbjct  300   LEASGQEFIWVVKR---EKNDKEEWLPEGFEKRMEGKGLIIRGWAPQVPILEHQAIGAFV  356

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL----DSDG  1325
             THCGWNS LEG   GVPM+TWPV AEQF NEKL+T++L+TG  VG K+W  +        
Sbjct  357   THCGWNSILEGASAGVPMITWPVSAEQFYNEKLVTEVLKTGVVVGVKQWGTVLDVRKEAS  416

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VKREAI +A+ +VM+ EE++EMR RA+ +++ A  A+
Sbjct  417   VKREAIEKAVNQVMVSEEADEMRGRARALREMATMAV  453



>ref|XP_010057244.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW74288.1| hypothetical protein EUGRSUZ_E02951 [Eucalyptus grandis]
Length=485

 Score =   502 bits (1292),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 236/452 (52%), Positives = 318/452 (70%), Gaps = 2/452 (0%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FFFP MA GHMIP +DMAK+FA RG K+T+I TP ++P F +++ K   LGF + + 
Sbjct  8     LHIFFFPFMAPGHMIPMIDMAKMFAMRGCKSTLIATPHDEPTFLRSIAKPKDLGFDINVV  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              +  P  +VGLPE C  L +    +    F +A  ML   +E L+++L PDCL++D+F P
Sbjct  68    TVTLPLKDVGLPEDCGSLSKITTMEMRMTFVRAVMMLDRQIELLIEKLAPDCLISDIFLP  127

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             W T  AAKF IPRL+FHGTS  ++  +  +R+Y+P   VS DSE F IPN P E+ + K+
Sbjct  128   WTTEIAAKFGIPRLVFHGTSAFSMAGIECVRLYQPHKKVSCDSEPFIIPNFPGEITLCKM  187

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+    R E  N +++F  +V+ SE+ S+GV+ NSFYELEP YA+HY+  LG R+W VGP
Sbjct  188   QMQDLVREE--NELAKFFNAVKDSEKTSFGVVMNSFYELEPAYADHYRTFLGIRSWFVGP  245

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             LSL N++ EDKA RG +++ID+HECLKWLDSK P+SV+YICFGS  NF  +QLHE+A+G+
Sbjct  246   LSLCNKETEDKAHRGNEASIDQHECLKWLDSKQPNSVIYICFGSTTNFNAAQLHEIAVGL  305

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG  F+WV++     + G E+W+P+G E R + K LIIRGWAPQ +ILDH A G FVT
Sbjct  306   EASGQQFIWVVKKDPNAEEGKEEWLPDGHESRIRNKDLIIRGWAPQALILDHEATGGFVT  365

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNS LE V  GVPMVTWPV AEQF NEKL+T +L+ G  +G K+      D VK E 
Sbjct  366   HCGWNSILEAVAAGVPMVTWPVAAEQFYNEKLVTQVLKIGVDIGVKQGVISFGDSVKSER  425

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + EA+K+V++GEE+EEMR RAK + + A+ A+
Sbjct  426   VEEAVKRVLVGEEAEEMRRRAKALAEMARGAV  457



>gb|KGN43915.1| hypothetical protein Csa_7G073510 [Cucumis sativus]
Length=484

 Score =   502 bits (1292),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 247/455 (54%), Positives = 328/455 (72%), Gaps = 3/455 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL-GFQMEI  257
             LH+F FP +A GHMIP +DMAKL +SRG+K TI+TTP N    S ++     L    + +
Sbjct  8     LHIFLFPFLAQGHMIPIVDMAKLLSSRGIKITIVTTPLNSISISNSIKSSKSLYASNIHL  67

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +L+FP  EVGLP+ C+ LD       +P+F  A  +LQ P E+ + E RP C++ADMFF
Sbjct  68    LILKFPSAEVGLPDGCENLDFVISPAMIPKFISALNLLQTPFEEAVMEHRPHCIIADMFF  127

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWA + AAK  IPRL FHG+   + CA   +R+++P+N VSS++E F IP LP ++  TK
Sbjct  128   PWANDVAAKVGIPRLNFHGSCFFSFCASEFVRIHQPYNHVSSETEPFLIPCLPRDITFTK  187

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
             +++  F R  V+N +SEFM     +E   YGV+ NSFYELE +YA+ Y+NV GR+AW +G
Sbjct  188   MKLPEFVRENVKNYLSEFMEKALEAESTCYGVVMNSFYELEAEYADCYRNVFGRKAWHIG  247

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             PLSL N++ E+KA RG +S+I+EHECLKWLDSK  +SVVY+CFGS+ANF+  QL E+A G
Sbjct  248   PLSLCNKETEEKAWRGNESSINEHECLKWLDSKKSNSVVYVCFGSIANFSFDQLKEIASG  307

Query  978   IEDSGMDFVWVIRN--KREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             +E  G +F+WV+R     EE    E+W+P+GFE+R +GKG+IIRGWAPQV+IL+HPAVG 
Sbjct  308   LEACGKNFIWVVRKVKGEEEKGEDEEWLPKGFEKRVEGKGMIIRGWAPQVLILEHPAVGG  367

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLEGV  GVPMVTWPV  EQF NEKL+T++LR G GVG ++W R+  D +K
Sbjct  368   FVTHCGWNSTLEGVVAGVPMVTWPVSGEQFYNEKLVTEVLRIGVGVGVQKWVRIVGDFMK  427

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             REA+ +AI +VM GEE+EEMR+RAK     A+ AI
Sbjct  428   REAVEKAINRVMEGEEAEEMRNRAKEFAQMARNAI  462



>ref|XP_004159929.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucose flavonoid 3-O-glucosyltransferase 
7-like [Cucumis sativus]
Length=484

 Score =   501 bits (1291),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 247/455 (54%), Positives = 327/455 (72%), Gaps = 3/455 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL-GFQMEI  257
             LH+F FP +A GHMIP +DMAKL +SRG+K TI+TTP N    S ++          + +
Sbjct  8     LHIFLFPFLAQGHMIPIVDMAKLLSSRGIKITIVTTPRNSISISNSIKSSKSFYASNIHL  67

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +L+FP  EVGLP+ C+ LD       +P+F  A  +LQ P E+ + E RP C++ADMFF
Sbjct  68    LILKFPSAEVGLPDGCENLDFVISPAMIPKFISALNLLQTPFEEAVMEHRPHCIIADMFF  127

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWA + AAK  IPRL FHG+   + CA   +R+++P+N VSS++E F IP LP ++  TK
Sbjct  128   PWANDVAAKVGIPRLNFHGSCFFSFCASEFVRIHQPYNHVSSETEPFLIPCLPRDITFTK  187

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
             +++  F R  V+N +SEFM     +E   YGV+ NSFYELE +YA+ Y+NV GR+AW +G
Sbjct  188   MKLPEFVRENVKNYLSEFMEKALEAESTCYGVVMNSFYELEAEYADCYRNVFGRKAWHIG  247

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             PLSL N++ E+KA RG +S+IDEHECLKWLDSK  +SVVY+CFGS+ANF+  QL E+A G
Sbjct  248   PLSLCNKETEEKAWRGNESSIDEHECLKWLDSKKSNSVVYVCFGSIANFSFDQLKEIASG  307

Query  978   IEDSGMDFVWVIRN--KREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             +E  G +F+WV+R     EE    E+W+P+GFE+R +GKG+IIRGWAPQV+IL+HPAVG 
Sbjct  308   LEACGXNFIWVVRKVKGEEEKGEDEEWLPKGFEKRVEGKGMIIRGWAPQVLILEHPAVGG  367

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLEGV  GVPMVTWPV  EQF NEKL+T++LR G GVG ++W R+  D +K
Sbjct  368   FVTHCGWNSTLEGVVAGVPMVTWPVSGEQFYNEKLVTEVLRIGVGVGVQKWVRIVGDFMK  427

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             REA+ +AI +VM GEE+EEMR+RAK     A+ AI
Sbjct  428   REAVEKAINRVMEGEEAEEMRNRAKEFAQMARNAI  462



>ref|XP_009354714.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Pyrus x bretschneideri]
Length=477

 Score =   501 bits (1290),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 246/459 (54%), Positives = 329/459 (72%), Gaps = 17/459 (4%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH+FFFP M  GH IP +++A+LFASRGVK+T+I TP N P+FSKA+    +LG  ++I
Sbjct  8     QLHIFFFPYMVQGHFIPLINIARLFASRGVKSTLIATPLNAPLFSKAIQSSKKLGIDVDI  67

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +++FP  EVGLP+ C+  +     +   +F KA  +LQP +E +L + RP CLVAD FF
Sbjct  68    LVIKFPTEEVGLPQGCENANLVTTLEMNEKFIKATFLLQPQIEQILDKHRPHCLVADTFF  127

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWAT+ AAKF IPR+IFHG    ALCA  S+ +Y+P   +SSDSE FTIPN P E+K+T+
Sbjct  128   PWATDVAAKFGIPRIIFHGMGFFALCASRSVALYEPHAKLSSDSEAFTIPNFPVEIKLTR  187

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
              Q+    +   E  +++ ++  R S EKSYG I NSFYELEP +A+HY+ V GR+AW +G
Sbjct  188   SQMPNVPKQSAE--ITKLLKESRESGEKSYGFIVNSFYELEPAFADHYRIVFGRKAWHIG  245

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             P+S  N+   D+      S++D+HECL WL SK P+SVVYICFGS+ANF  SQL E+A G
Sbjct  246   PVSSANKAAHDE------SSLDQHECLNWLSSKKPNSVVYICFGSIANFIDSQLQEIAAG  299

Query  978   IEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             +E SG +F+WV++    E N  E+W+PEGFE+R +GKG+IIRGWAPQV IL+H A+GAFV
Sbjct  300   LEASGQEFIWVVKR---EKNDKEEWLPEGFEKRMEGKGVIIRGWAPQVPILEHEAIGAFV  356

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKR---LD---S  1319
             THCGWNS LEGV  GVPM+TWPV AEQF NEKL+T++L+TG  VG+K+W     LD    
Sbjct  357   THCGWNSILEGVSAGVPMITWPVSAEQFYNEKLVTEVLKTGVAVGAKQWGTGTFLDVKKE  416

Query  1320  DGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
               VKREAI +A+ +VM  EE+E MR RA+V+++ A +A+
Sbjct  417   ASVKREAIEKAVNQVMASEEAEGMRGRARVLREMAMRAV  455



>ref|XP_007198987.1| hypothetical protein PRUPE_ppa019354mg [Prunus persica]
 gb|EMJ00186.1| hypothetical protein PRUPE_ppa019354mg [Prunus persica]
Length=477

 Score =   501 bits (1290),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 245/452 (54%), Positives = 321/452 (71%), Gaps = 7/452 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             L +  FP MA GH+IP +DMAKLF SRG+KATIITTP + P   K ++  T     + I 
Sbjct  8     LRIALFPFMAQGHIIPFIDMAKLFVSRGLKATIITTPLDAPFIHKKIENSTS---PVHIF  64

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              ++ P +EVGLPE+CQ L      +   +FFKA  +L+P LE  LQ+ RP+CLVADMFFP
Sbjct  65    TIDLPTLEVGLPENCQSLHLATSPEMQRKFFKAAGLLEPQLEQFLQQNRPNCLVADMFFP  124

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT+ A+KF IP LIFHGTS  +LCA   + +YKP   VSSDSE   IPN P ++++T+ 
Sbjct  125   WATDVASKFGIPTLIFHGTSGFSLCATLCMFLYKPHLQVSSDSETIFIPNFPDKIELTRK  184

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             ++  F R  VEN  S      + +EE+SYGV+ NSFYELEP YA+HY NVLG +AW +GP
Sbjct  185   KLPDFIRDGVENEFSRLYDEGKKAEERSYGVLVNSFYELEPAYADHYTNVLGIKAWHIGP  244

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             L + N    + A+  K S  ++HEC+KWLDSK P+SVVY+CFGS++NF  +QL E+A  +
Sbjct  245   LWICN----EGAKEDKVSIDEQHECIKWLDSKKPNSVVYVCFGSLSNFVDAQLLEIAKAL  300

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG  F+WV++ +  +    + W+PEGFE+R +GKGLIIRGWAPQV IL H AVG FVT
Sbjct  301   ESSGQQFIWVVKKQNNDQENQQDWLPEGFEKRIEGKGLIIRGWAPQVKILSHEAVGGFVT  360

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLE VC GVPM TWPVFAEQF NEKL+T +LR G GVG+KEW R+  + VK +A
Sbjct  361   HCGWNSTLEAVCAGVPMATWPVFAEQFYNEKLITQVLRIGVGVGAKEWSRVAVESVKSDA  420

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             I +A+ + M+GEE+EEMR+RA+   + A++A+
Sbjct  421   IEKAVTRTMVGEEAEEMRNRARGYAEMARRAV  452



>gb|KFK30052.1| hypothetical protein AALP_AA7G210700 [Arabis alpina]
Length=481

 Score =   501 bits (1290),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 246/459 (54%), Positives = 330/459 (72%), Gaps = 14/459 (3%)
 Frame = +3

Query  84    HVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQMEI  257
             H   FP MAHGHMIPTLDMAKLFA++G K+TI+TTP N  +  K +D + +L    +++I
Sbjct  10    HFLLFPFMAHGHMIPTLDMAKLFATKGAKSTILTTPLNSKILQKPIDTFNKLNPTLEIDI  69

Query  258   RLLEFPGVEVGLPESCQRLD---QTPDDDG---LPRFFKACAMlqppledllqelrpdCL  419
             ++ +FP V++GLPE C+ +D      +DDG   + +F  A    +  LE LL+  RPDCL
Sbjct  70    KIFDFPCVQLGLPEGCENVDFFTSNNNDDGGYMIFKFLTATRFFKDQLEKLLEATRPDCL  129

Query  420   VADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPH  599
             +ADMFFPWAT AA KF +PRL+FHGT + +LCA H +R++ P N V+S  E F IP+LP 
Sbjct  130   IADMFFPWATEAAEKFYVPRLVFHGTGYFSLCAGHCIRMHNPQNRVASSCEPFVIPDLPG  189

Query  600   ELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGR  779
             ++ +TK Q+      + E+ M +FM  VR SE +S GVI NSF+ELEP YA+ YK  + +
Sbjct  190   DIILTKEQIV---DGDNESDMGKFMNEVRKSEVESSGVIVNSFHELEPAYADFYKKFVAK  246

Query  780   RAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQL  959
             +AW +GPLS+ NR +++KAERGKK++IDE ECLKWLDSK P SV+YI FGSVA+F   QL
Sbjct  247   KAWHIGPLSVVNRGLQEKAERGKKASIDEVECLKWLDSKKPGSVIYISFGSVASFKNEQL  306

Query  960   HEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHP  1139
              E+A G+E SG +F+WV+R  + +    E+W+PEG EERTKGKG+IIRGWAPQV+ILDH 
Sbjct  307   IEIAAGLEASGTNFIWVVRKNKGD---KEEWLPEGMEERTKGKGIIIRGWAPQVLILDHQ  363

Query  1140  AVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDS  1319
             A G FVTHCGWNS LEGV  G+PMVTWPV AEQF NEKL+T +L+TG  VG+ +  R   
Sbjct  364   ATGGFVTHCGWNSLLEGVAAGLPMVTWPVGAEQFYNEKLVTQVLKTGVSVGATKHVRFKG  423

Query  1320  DGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             D + RE + +A+++V++GEE+ E R RAK + + AK A+
Sbjct  424   DFISREKVEKAVREVLVGEEAGERRRRAKTLAEMAKAAV  462



>ref|XP_008236561.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Prunus mume]
Length=477

 Score =   500 bits (1288),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 244/452 (54%), Positives = 320/452 (71%), Gaps = 7/452 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+  FP MA GH+IP +DMAKLF SRGV+ATIIT P + P   K ++  T     + I 
Sbjct  8     LHIALFPFMAQGHIIPFIDMAKLFVSRGVEATIITAPLDAPFIHKKIENSTS---PVHIF  64

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              ++ P +EVGLPE+CQ L      +   +FFKA  +L+P LE  LQ+ RP+CLVADMFFP
Sbjct  65    TIDLPTLEVGLPENCQSLHLATSPEMQRKFFKAAGLLEPQLEQFLQQNRPNCLVADMFFP  124

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT+ A+KF IP LIFHGTS  +LCA   + +YKP   VSSDSE   IPN P E+++T+ 
Sbjct  125   WATDVASKFGIPTLIFHGTSGFSLCATLCMFLYKPHLQVSSDSETLFIPNFPDEIELTRK  184

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             ++  F R  VEN  S      + +E++SYGV+ NSFYELEP YA+HY NVLG +AW +GP
Sbjct  185   KLPDFIRDGVENDFSRLYDEGKKAEQRSYGVLVNSFYELEPAYADHYTNVLGIKAWHIGP  244

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             L + N    + A+  K S  ++HEC+KWLDSK P+SVVY+CFGS++NF  +QL E+A  +
Sbjct  245   LWICN----EGAKEDKVSIDEQHECIKWLDSKKPNSVVYVCFGSLSNFVDAQLLEIAKAL  300

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG  F+WV++ +  +    + W+PEGFE+R +GKGLII GWAPQV IL H AVG FVT
Sbjct  301   ESSGQQFIWVVKKQNNDQENQQDWLPEGFEKRIEGKGLIITGWAPQVKILSHEAVGGFVT  360

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLE VC GVPM TWPVFAEQF NEKL+T +LR G GVG+KEW R+  + VK +A
Sbjct  361   HCGWNSTLEAVCAGVPMATWPVFAEQFYNEKLITQVLRIGVGVGAKEWSRVAVESVKSDA  420

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             I +A+ + M+GEE+EEMR+RA+   + A++A+
Sbjct  421   IEKAVTRTMVGEEAEEMRNRARGYAEMARRAV  452



>dbj|BAF75887.1| tetrahydroxychalcone glucosyltransferase [Dianthus caryophyllus]
Length=489

 Score =   501 bits (1289),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 247/455 (54%), Positives = 318/455 (70%), Gaps = 3/455 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LHV FFP+MA GHMIPTLD+AKLFA+  VK TI+TTP N P F K +  YT +G  ++++
Sbjct  8     LHVVFFPLMAAGHMIPTLDIAKLFAAHHVKTTIVTTPLNAPTFLKPLQSYTNIGPPIDVQ  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlq--ppledllqelrpdCLVADMF  434
             ++ FP  E GLPE  +  +    D+   +F KA  +L+            + DCLVADM 
Sbjct  68    VIPFPAKEAGLPEGVENFEHFTSDEMSLKFLKAAELLEEPLIQVLERCNPKADCLVADML  127

Query  435   FPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKIT  614
              P+AT  AAKFDIPRL+FHG+   AL  M +   Y+P  DVS+D E F IP+LPHE+KIT
Sbjct  128   LPFATEVAAKFDIPRLVFHGSCCFALSVMDAFIKYQPHKDVSNDDEEFVIPHLPHEIKIT  187

Query  615   KLQVSPFERSEVENTM-SEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             ++Q++   +   ++TM  + +     SE KSYGVI NSFYELEP+YA+ Y+ V+GR+ W 
Sbjct  188   RMQLNEGVKQNKQDTMWMDVLGRALESEIKSYGVIVNSFYELEPEYADFYRKVMGRKTWQ  247

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GP+SL NR+ E K +RGK S+IDE+ CLKWLDSK P+SV+Y+CFGS+   +  QLHE+A
Sbjct  248   IGPVSLCNRENEAKFQRGKDSSIDENACLKWLDSKKPNSVIYVCFGSLTEVSLLQLHEIA  307

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
              G+E S  +FVWVIR        +E   P+GFEERTKGKGLIIRGWAPQV+ILDH AVG 
Sbjct  308   KGLEASEQNFVWVIRRSNTNGEETEDIFPKGFEERTKGKGLIIRGWAPQVLILDHEAVGG  367

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLEG+  GVPMVTWP FAEQF  EKL+T+IL+TG  VGSK W R     VK
Sbjct  368   FVTHCGWNSTLEGISCGVPMVTWPAFAEQFYIEKLVTEILKTGIPVGSKHWNRTIECNVK  427

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              E I E ++++M+ EE  E+RSRA  +K+ A+KAI
Sbjct  428   WEDIKEVVRRLMVEEEGMEIRSRALKLKNMARKAI  462



>ref|XP_008375157.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Malus domestica]
Length=477

 Score =   499 bits (1286),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 243/459 (53%), Positives = 328/459 (71%), Gaps = 17/459 (4%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH+FFFP M  GH +P +++A+LFASRGVK+T+I TP N+P+FSKA+    +LGF ++I
Sbjct  8     QLHIFFFPYMVQGHFVPLINIARLFASRGVKSTLIATPLNEPLFSKAIQSSKKLGFDVDI  67

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +++FP  EVGLP+ C+        +   +F KA  +LQP +E +L + RP CLVAD FF
Sbjct  68    LVIKFPAEEVGLPQGCENASLVTTTEMNEKFIKATFLLQPQIEQILDKHRPHCLVADTFF  127

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWAT  AAKFDIPR+IFHG    ALCA  S+ +Y+P   +SSDSE+FTIPN P E+K+T+
Sbjct  128   PWATEVAAKFDIPRIIFHGMGFFALCASRSVALYEPHAKLSSDSEVFTIPNFPVEIKLTR  187

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
              Q+    +   E  +++ ++  R S EKSYG I NSFYELEP +A+HY+ V GR+AW +G
Sbjct  188   SQMPTVPKQSPE--ITKLLKEARESGEKSYGFIVNSFYELEPAFADHYRTVFGRKAWHIG  245

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             P+S  N+  +D+A       + +HECL WL+SK P+SVVYICFGS+ NF  SQL E+A G
Sbjct  246   PVSSANKAADDEA------TLHQHECLNWLNSKKPNSVVYICFGSMTNFIDSQLLEIAAG  299

Query  978   IEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             +E SG +F+WV++    E N  E+W+PEGFEER +GKGLIIRGWAPQV+IL+H A+GAFV
Sbjct  300   LEASGQEFIWVVKR---EKNDKEEWLPEGFEERMEGKGLIIRGWAPQVLILEHEAIGAFV  356

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKR---LD---S  1319
             THCGWNS LEGV  GVPM+TWP  AEQF NEKL+T++L+TG  VG+K+W     LD    
Sbjct  357   THCGWNSILEGVSAGVPMITWPXSAEQFYNEKLVTEVLKTGVAVGAKQWGAGTFLDVKKE  416

Query  1320  DGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
               VKREAI +A+ +V+  EE+E M+ RA+ +++ A  A+
Sbjct  417   ASVKREAIEKAVNQVIASEEAEGMKGRARXLREMAMXAV  455



>ref|XP_004137110.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101218912 
[Cucumis sativus]
Length=987

 Score =   516 bits (1330),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 249/458 (54%), Positives = 335/458 (73%), Gaps = 5/458 (1%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAV---DKYTQLGFQ  248
              LH+F FP+MA GHMIP +DMAKL +SRGVK TI+TTP N    S ++    K      +
Sbjct  508   QLHMFLFPIMAPGHMIPMVDMAKLLSSRGVKITIVTTPLNSISISNSIHNNSKSISPPPK  567

Query  249   MEIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVAD  428
             + + +L+FP  EVGLP+ C+ LD    +  +P+F   C +LQ P E+ + E RP C++AD
Sbjct  568   IHLLILKFPSAEVGLPDGCENLDSVTGNAMIPKFISVCNLLQTPFEEAVMEHRPHCILAD  627

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             +FFPWA + AAKF IPRL FHGT   + CA   +R+++P+  VSS++E F IP LP E+ 
Sbjct  628   IFFPWANDVAAKFGIPRLTFHGTGFFSTCASEFIRIHEPYKHVSSETEPFLIPCLPGEIT  687

Query  609   ITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
              TK+++  F     +N +SEFM+    +  K YG+I NSFYELE +YA+ Y+NV GR+ W
Sbjct  688   FTKMKLPEFMWENYKNDLSEFMKRAFEASSKCYGLIMNSFYELEAEYADCYRNVFGRKVW  747

Query  789   SVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEM  968
              +GPLSL N+D+E+KA+RG KSAIDEHECLKWLDS+ P+SVVY+ FGS+A F   QL E+
Sbjct  748   HIGPLSLCNKDIEEKAQRGNKSAIDEHECLKWLDSQKPNSVVYVSFGSMAKFNADQLKEI  807

Query  969   AMGIEDSGMDFVWVIRN-KREEDNGSEK-WMPEGFEERTKGKGLIIRGWAPQVVILDHPA  1142
             A+G+E S  +F+WV+R  K +E+ G +K W+PEG+E+R +GKG+IIRGWAPQV+ILDHP 
Sbjct  808   AIGLEASRKNFIWVVRKVKGDEEKGEDKDWLPEGYEQRMEGKGMIIRGWAPQVLILDHPG  867

Query  1143  VGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD  1322
             VG FVTHCGWNSTLEGV  GVPMVTWPV AEQF NEKL+T++L+ G GVG ++W R   D
Sbjct  868   VGGFVTHCGWNSTLEGVAAGVPMVTWPVAAEQFYNEKLLTEVLKIGVGVGVQKWVRTVGD  927

Query  1323  GVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              +K EA+ +AI++VM G+E+EEMR++AK + + AKKAI
Sbjct  928   FIKSEAVEKAIRRVMEGKEAEEMRNKAKELGEMAKKAI  965


 Score =   465 bits (1197),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 235/455 (52%), Positives = 314/455 (69%), Gaps = 17/455 (4%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL-GFQMEI  257
             LH+F FP +A GHMIP +DMAKL +SRG+K TI+TTP N    S ++     L    + +
Sbjct  8     LHIFLFPFLAQGHMIPIVDMAKLLSSRGIKITIVTTPLNSISISNSIKSSKSLYASNIHL  67

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +L+FP  EVGLP+ C+ LD       +P+F  A  +LQ P E+ + E RP C++ADMFF
Sbjct  68    LILKFPSAEVGLPDGCENLDFVISPAMIPKFISALNLLQTPFEEAVMEHRPHCIIADMFF  127

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWA + AAK  IPRL FHG+   + CA   +R+++P+N VSS++E F IP LP ++  TK
Sbjct  128   PWANDVAAKVGIPRLNFHGSCFFSFCASEFVRIHQPYNHVSSETEPFLIPCLPRDITFTK  187

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
             +++  F R  V+N +SEFM     +E   YGV+ NSFYELE +YA+ Y+NV GR+AW +G
Sbjct  188   MKLPEFVRENVKNYLSEFMEKALEAESTCYGVVMNSFYELEAEYADCYRNVFGRKAWHIG  247

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             PLSL N++ E+KA RG +S+I+EHECLKWLDSK  +SVVY+CFGS+ANF+  QL E+A G
Sbjct  248   PLSLCNKETEEKAWRGNESSINEHECLKWLDSKKSNSVVYVCFGSIANFSFDQLKEIASG  307

Query  978   IEDSGMDFVWVIRN--KREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             +E  G +F+WV+R     EE    E+W+P+GFE+R +GKG+IIRGWA             
Sbjct  308   LEACGKNFIWVVRKVKGEEEKGEDEEWLPKGFEKRVEGKGMIIRGWA-------------  354

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
               THCGWNSTLEGV  GVPMVTWPV  EQF NEKL+T++LR G GVG ++W R+  D +K
Sbjct  355   -XTHCGWNSTLEGVVAGVPMVTWPVSGEQFYNEKLVTEVLRIGVGVGVQKWVRIVGDFMK  413

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             REA+ +AI +VM GEE+EEMR+RAK     A+ AI
Sbjct  414   REAVEKAINRVMEGEEAEEMRNRAKEFAQMARNAI  448



>gb|ADV71369.1| glycosyltransferase GT14A05 [Pueraria montana var. lobata]
Length=475

 Score =   498 bits (1283),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 243/457 (53%), Positives = 333/457 (73%), Gaps = 14/457 (3%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
             +LHVFFFP  A+GH+IP++D+A++FASRG++ T++TTP N+P+ S+ + K       ++I
Sbjct  7     ELHVFFFPFPANGHIIPSIDLARVFASRGIRTTVVTTPLNEPLISRTIGKAN-----IKI  61

Query  258   RLLEFPGVE-VGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMF  434
             R ++FP  E  GLPE C+  D     D +  F KA  +L+ PLE L+++ +PDC++ADMF
Sbjct  62    RTIKFPSPEQTGLPEGCENSDSALSPDMIMAFLKATVLLRDPLEHLMEQEKPDCIIADMF  121

Query  435   FPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKIT  614
             FPWAT++AAKF IPR++FHG      C    +R YKP + VSS  E F +P LP E+ ++
Sbjct  122   FPWATDSAAKFGIPRIVFHGMGFFPTCVSACVRQYKPQDKVSSYFEPFVVPKLPGEITVS  181

Query  615   KLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSV  794
             K+Q+   +  + ++  ++ +  V  SE  SYGVI NSFYELEP YA+ Y+N LGRRAW +
Sbjct  182   KMQLP--QTPKDDDVFTKLLDEVNASELNSYGVIANSFYELEPVYADFYRNELGRRAWHL  239

Query  795   GPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAM  974
             GP+ L NRD E+KA RG+++AIDEHECLKWLDSK P+SVVY+CFGS+  F  +QL E+A+
Sbjct  240   GPVCLCNRDTEEKANRGREAAIDEHECLKWLDSKEPNSVVYVCFGSMTTFPDAQLKEIAL  299

Query  975   GIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEER--TKGKGLIIRGWAPQVVILDHPAVG  1148
             G+E SG  F+WV++    E     +W+PEGFEER  ++GKGLIIRGWAPQV+ILDH AVG
Sbjct  300   GLEASGQPFIWVVKKGSSE---KLEWLPEGFEERVLSQGKGLIIRGWAPQVMILDHEAVG  356

Query  1149  AFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEW-KRLDSDG  1325
              FVTHCGWNS LEGVC GVPMVTWP++AEQF N K +TDI++ G GVG + W   +  D 
Sbjct  357   GFVTHCGWNSALEGVCAGVPMVTWPMYAEQFYNAKFLTDIVKIGLGVGVQTWIGMMGRDP  416

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VK+E I +A+K++M+GEE+EEMR+RAK +   AK+A+
Sbjct  417   VKKEPIEKAVKRIMVGEEAEEMRNRAKELAQMAKRAV  453



>ref|XP_002518717.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43642.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=480

 Score =   498 bits (1283),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 241/474 (51%), Positives = 353/474 (74%), Gaps = 3/474 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+  FP+MA GHM+P LD+A+LFASRGVK TI+TTP N P  +++         Q+  +
Sbjct  10    LHILLFPLMAQGHMLPLLDIARLFASRGVKITIVTTPGNAPRLNRSFQTTQDSSTQISFK  69

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
             +++FP  E GLPE  + LD   D +   +FF A ++L+ PLE +LQEL P  LV+D+FFP
Sbjct  70    IIKFPAKEAGLPEGLENLDSVSDKETHSKFFDALSLLREPLEQVLQELHPQGLVSDIFFP  129

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             W    A+K+ IPRLIF+GTS  ++C + +L  ++ +  VSSD+E F +P  P  +K ++L
Sbjct  130   WTAEVASKYGIPRLIFYGTSFFSMCCLENLEEHQLYKKVSSDTEKFILPGFPDPIKFSRL  189

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+      +  N  ++ + S + +E++S+G+I NSFYELE  Y ++Y+NVLGRRAW +GP
Sbjct  190   QLPDTLTVDQPNVFTKLLASAKEAEKRSFGMIVNSFYELESGYVDYYRNVLGRRAWHIGP  249

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             +SL NR++E+K++RGK+++I EHEC+KWLDSK P+SV+Y+CFG+VA F+  QL E+A+G+
Sbjct  250   VSLCNRNLEEKSQRGKEASISEHECIKWLDSKKPNSVLYVCFGTVAKFSDPQLLEIALGL  309

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG +F+WV+R+++ E+   EKW+P+G+E+R +G+GLIIRGWAPQ++IL+H AVG FVT
Sbjct  310   EASGQNFIWVVRSEKNEE---EKWLPDGYEKRIEGEGLIIRGWAPQILILEHEAVGGFVT  366

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLEGV  G+PMVTWP+FA+QF NEKL+TD+L  G  VG+++W RL  D V+   
Sbjct  367   HCGWNSTLEGVSAGLPMVTWPIFADQFFNEKLITDVLGIGVSVGAEKWVRLVGDFVESGK  426

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAIeeggssylglsslldelRAYHA  1502
             I +A+K+VM+GE++ ++RSRAK + + A +AIE GGSSY  L +L+ EL++YH+
Sbjct  427   IEKAVKEVMVGEKAVKIRSRAKKVGEMATRAIEVGGSSYNDLGALIQELKSYHS  480



>ref|XP_004137108.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Cucumis sativus]
 gb|KGN43912.1| hypothetical protein Csa_7G073480 [Cucumis sativus]
Length=480

 Score =   498 bits (1282),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 243/455 (53%), Positives = 326/455 (72%), Gaps = 2/455 (0%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGF-QME  254
              LH+F  P MA GHMIP +D+AKL +SRG+K TI+TTP N    S ++     L   Q++
Sbjct  4     QLHMFLLPFMARGHMIPMVDLAKLLSSRGIKITIVTTPLNAISISNSIQNSKSLSTSQIQ  63

Query  255   IRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMF  434
             + +L+FP  EVGLP+ C+ LD     D  P+F  A  + Q P E+ + E RP C++ADM+
Sbjct  64    LLVLKFPSAEVGLPDGCENLDSVITPDMFPKFISAFNLFQNPFEEAVMEQRPHCIIADMY  123

Query  435   FPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKIT  614
             FPWA + AAKF IPRLIFHGTS  + CA   +R+++P+N VSSD+E F IP  P ++  T
Sbjct  124   FPWANDVAAKFGIPRLIFHGTSFFSSCASEFMRIHEPYNHVSSDAEPFLIPCFPGDITFT  183

Query  615   KLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSV  794
             K ++  F R  ++N +SEF++         YG I+NSFYELE +Y +  +NVLG +AW +
Sbjct  184   KTKLPQFVRENLKNEVSEFIKRAHELGSACYGAIWNSFYELEAEYVDCCRNVLGIKAWHI  243

Query  795   GPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAM  974
             GPLSL N++ E+KA+RG +S+IDEH CLKWLDSK P+SVVY+CFGS+A F   QL E+A 
Sbjct  244   GPLSLCNKETEEKAQRGNESSIDEHACLKWLDSKKPNSVVYVCFGSMAKFNFDQLKEIAS  303

Query  975   GIEDSGMDFVWVIRN-KREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             G+E +  +F+WV R  K+EE+  +  W+PEG+E R +GKGLIIRGWAPQV+ILDHPAVG 
Sbjct  304   GLEAARKNFIWVARRVKKEEEEENHDWLPEGYEHRIEGKGLIIRGWAPQVLILDHPAVGG  363

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLEGV  GVPMVTWPV A+QF NEKL+T++L+ G  VG ++W R+  D ++
Sbjct  364   FVTHCGWNSTLEGVTAGVPMVTWPVAADQFYNEKLVTEVLKIGVAVGVQKWVRVVGDFIE  423

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             REA+  AI++VM GEE+E MR+RAK +   AKKA+
Sbjct  424   REALKNAIRRVMEGEEAEGMRNRAKELAKMAKKAV  458



>ref|XP_010691729.1| PREDICTED: scopoletin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score =   498 bits (1283),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 248/461 (54%), Positives = 335/461 (73%), Gaps = 14/461 (3%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASR-GVKATIITTPANQPVFSKAV--DKYTQLGFQ  248
             D HV  FP MAHGHMIP LD+A+LF +R  VKATIITT  N    +K +  +K T+    
Sbjct  7     DFHVVLFPFMAHGHMIPMLDIARLFTARDNVKATIITTQLNIATITKDIESNKTTRTPI-  65

Query  249   MEIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVAD  428
               I L +FP  EVGLPE  + L+Q    +   +FF+A  +L   LE  L+++RP+CLVAD
Sbjct  66    FNIELFKFPAQEVGLPEGFENLEQVLRPEFFDKFFEATELLNEQLEKYLEKVRPNCLVAD  125

Query  429   MFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELK  608
             MFFPWAT++AAKF+IPRL+FHGTS +ALCA   +R+Y+PFN+VSSD E F +P LPHE++
Sbjct  126   MFFPWATDSAAKFNIPRLVFHGTSIIALCAEEIIRLYEPFNNVSSDEEPFVLPLLPHEIQ  185

Query  609   ITKLQVSPFERSEVENTMSEFMR---SVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGR  779
             + + Q+S       EN  +++ R   +++ SE KSYGVI NSFYE+EPDYA+ Y   L R
Sbjct  186   LRRSQIS---EGLTENEETDYKRKIANIKESELKSYGVIINSFYEMEPDYAKFYSKELRR  242

Query  780   RAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQL  959
             R+W+VGP+SL NR +EDK +  K++ IDEHECL+WL+SK P SV YICFGS  +F   QL
Sbjct  243   RSWNVGPVSLSNRSIEDKNQGDKQALIDEHECLQWLNSKKPDSVTYICFGSTTSFIAPQL  302

Query  960   HEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHP  1139
             HE+AM +E SG DF+WV+++  +E+   E+W+P GF++R +GKG II GWAPQV+IL+H 
Sbjct  303   HEIAMALEASGEDFIWVVKD--DENVKGEEWLPTGFKQRMEGKGFIITGWAPQVLILEHE  360

Query  1140  AVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDS  1319
             A+ AF+THCGWNS LEG+  GVPMVTWP+FAEQF NEKL+  IL+T   +G+K+W R  S
Sbjct  361   AIRAFMTHCGWNSILEGISAGVPMVTWPIFAEQFYNEKLVNQILKTSVPIGAKKWSRRHS  420

Query  1320  --DGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
               D +K +AI +A+K++M+G+E+EE R+RAK +K KA  A+
Sbjct  421   LEDLIKCDAIEKALKEIMVGKEAEERRTRAKNLKKKAYMAV  461



>ref|XP_002518721.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43646.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=475

 Score =   498 bits (1281),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 235/452 (52%), Positives = 338/452 (75%), Gaps = 8/452 (2%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH+  FP+MA GHM+P LD+A+LF+SRGVK T ITTP N P   ++  + TQ+ F    
Sbjct  9     QLHILLFPLMAQGHMLPLLDIARLFSSRGVKITFITTPGNAPRLKRS-SQTTQISF----  63

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
             ++++FP  E GLPE  + LD   D     +FF A ++ Q PLE +LQEL P  +V+D+FF
Sbjct  64    KIIKFPSKEAGLPEGLENLDLISDLQTHIKFFNALSLFQEPLEQVLQELHPHGIVSDVFF  123

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PW  +AA K+ IPRLIF+G S   +C + +L  ++P   VSSD+E+F++P  P  +K ++
Sbjct  124   PWTADAALKYGIPRLIFNGASFFYMCCLANLEEHQPHKKVSSDTEMFSLPGFPDPIKFSR  183

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
             LQ+S   R E  N  +EF+ S + +E++S+G+IFNSFY+LE  Y ++Y+NVLGRRAW VG
Sbjct  184   LQLSATLREEQPNLFTEFLASAKEAEKRSFGMIFNSFYDLESGYVDYYRNVLGRRAWHVG  243

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             P+SL NR++E+K++RGK+++I E EC+KWLDSK P+SV+Y+CFG+VA F+  QL E+A+G
Sbjct  244   PVSLCNRNIEEKSQRGKEASISEDECMKWLDSKKPNSVLYVCFGTVAKFSDCQLLEIALG  303

Query  978   IEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             +E SG +F+WV+R+++ E+   EKW+P G+E++ +GKGLI+RGWAPQV+IL+H AVG FV
Sbjct  304   LEASGQNFIWVVRSEKNEE---EKWLPNGYEKKMEGKGLIMRGWAPQVLILEHEAVGGFV  360

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKRE  1337
             THCGWNSTLEGV  G+PMVTWPVFA+QF NEKL+TD+L+ G GVG+++W  +  D V+  
Sbjct  361   THCGWNSTLEGVSAGMPMVTWPVFADQFFNEKLITDVLKIGVGVGAQKWVAVVGDYVESG  420

Query  1338  AIAEAIKKVMIGEESEEMRSRAKVMKDKAKKA  1433
              I +A+K+VM+GE++ E+RSRAK + + A+ A
Sbjct  421   KIEKAVKEVMVGEKAVEIRSRAKKIGEMARMA  452



>ref|XP_010107893.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Morus notabilis]
 gb|EXC17293.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Morus notabilis]
Length=484

 Score =   498 bits (1282),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 246/453 (54%), Positives = 320/453 (71%), Gaps = 2/453 (0%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH+FFFP +AHG  IP LD+A LFASRG K TII TP N  +++K +++   LG Q+ +
Sbjct  8     QLHIFFFPYLAHGRTIPALDIANLFASRGFKTTIILTPVNASIYAKTIERSRNLGLQIRV  67

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              L++FP  E  LP+ C+       ++ L  F  A   L+ PLE L+ E RPDCLVAD  F
Sbjct  68    LLIKFPAEEFRLPKGCEIARLATTNEMLATFHTATIRLEHPLEQLIAEHRPDCLVADSLF  127

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
              WAT  AA+F I RL F GT+  ++CA  S+  Y+P   VSS+SE F IPNLPHE+K+T+
Sbjct  128   TWATRVAARFGITRLEFDGTNFFSMCASMSMNKYQPHKKVSSESEPFVIPNLPHEIKLTR  187

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
              Q+ PF   +  + + +       SE  SYGVI NSFYELE DYA+HY+ VLGR+AW +G
Sbjct  188   DQL-PFFMKQDSDQVPKREDQAEESELASYGVIVNSFYELERDYADHYRRVLGRKAWHIG  246

Query  798   PLSLYNRDVEDKAERGKKS-AIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAM  974
             P  L+ +D E KA+RG +S   D+HECL WLDSK P+SVVY+CFGSV NF+ +QL E+A+
Sbjct  247   PTCLFYKDEEGKAQRGDESFNTDKHECLTWLDSKEPNSVVYVCFGSVVNFSDAQLMEIAL  306

Query  975   GIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAF  1154
             G+E SG  F+ V+R  R E +  E+W+PEGFE+R +G+GLIIR WAPQV+IL+H AVG  
Sbjct  307   GLEASGKQFILVVRKARPEGSRKEEWLPEGFEKRVEGRGLIIRNWAPQVLILEHEAVGGI  366

Query  1155  VTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKR  1334
             VTHCGWNS LEG+C GVPMVTWPV A+QF NEKL+  ILR G GVG+K+W R   D V+R
Sbjct  367   VTHCGWNSILEGICAGVPMVTWPVMADQFYNEKLVVQILRIGVGVGAKKWARFVGDNVRR  426

Query  1335  EAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKA  1433
             EA+ +A+ ++M GEE+E+MRSRAKV+  KA KA
Sbjct  427   EALEKALNQLMEGEEAEKMRSRAKVLAGKASKA  459



>ref|XP_009625604.1| PREDICTED: scopoletin glucosyltransferase-like [Nicotiana tomentosiformis]
Length=485

 Score =   498 bits (1281),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 241/454 (53%), Positives = 319/454 (70%), Gaps = 3/454 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH++F PMMA GHMIP +DMA+ F  RGVKAT++TTP N P FSK + +  +LG  + IR
Sbjct  8     LHIYFLPMMAPGHMIPLVDMARQFTRRGVKATLVTTPLNAPKFSKTIQRDRELGNDISIR  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              +EFP  E GLP+ C+ L  T   +   +F KA  + Q P+E  L+E  PDCL+A   FP
Sbjct  68    TIEFPCKEAGLPDGCENLASTTSTEMTLKFIKALYLFQQPVEQFLEEDHPDCLIAGTLFP  127

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             W  + AAK  IPRL+F GT  L LCA HSL  +KP   V SD+E F IP LPH +K+++ 
Sbjct  128   WTVDVAAKLGIPRLVFSGTGLLPLCAYHSLMEHKPHLKVESDTEEFIIPGLPHTIKMSRQ  187

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+S   + E EN M+E ++ V  +E  SYG I NSFYELEP+Y +HY+ V+GR+AW +GP
Sbjct  188   QLSDHIKDETENPMTEIIKDVMRAEMTSYGAIVNSFYELEPNYVKHYREVVGRKAWHIGP  247

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             +SL N+D EDKA+RG++    E +CL WL+SK P SV+YICFGS++ F+ +QL E+AM +
Sbjct  248   VSLCNKDNEDKAQRGQEICFSEDQCLDWLNSKKPKSVIYICFGSMSIFSSAQLLEIAMAL  307

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E S   F+WV++     +  +E WMPEGFEE+ KG+GLII+GWAPQV+ILDH A+G FVT
Sbjct  308   EASDQQFIWVVKQNTTNEEQNE-WMPEGFEEKLKGRGLIIKGWAPQVLILDHEAIGGFVT  366

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEW-KRLDSD-GVKR  1334
             HCGWNS+LEGV  GVPMVTWP+ AEQF NEKL+ +IL+ G  VG++ W +R DS   + R
Sbjct  367   HCGWNSSLEGVTAGVPMVTWPLSAEQFFNEKLLVEILKIGVPVGAQAWSQRTDSRVPINR  426

Query  1335  EAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             E I  A+ K+M+G E+EEMRSRA  +   AK A+
Sbjct  427   ENIQRAVTKLMVGPEAEEMRSRAAALGKLAKMAV  460



>ref|XP_007042483.1| UDP-glucosyl transferase 73B3, putative [Theobroma cacao]
 gb|EOX98314.1| UDP-glucosyl transferase 73B3, putative [Theobroma cacao]
Length=489

 Score =   498 bits (1281),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 246/457 (54%), Positives = 333/457 (73%), Gaps = 6/457 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FF P +A GHMIP +DMAK+FA RG + TIITTP N  +FS  + +    G  ++I+
Sbjct  8     LHMFFIPFLAPGHMIPAVDMAKMFAMRGAQTTIITTPFNASLFSNTIQRCKNSGLDIDIK  67

Query  261   LLEFPGVEVGLPESCQRLD--QTPDD---DGLPRFFKACAMlqppledllqelrpdCLVA  425
             +L+FP VEVGLPE C+ LD   TP D   + + +F K  AMLQ PLE LLQEL+PDC+VA
Sbjct  68    VLKFPCVEVGLPEGCENLDLITTPKDANREMVVKFCKGAAMLQEPLEQLLQELKPDCIVA  127

Query  426   DMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHEL  605
             D+F  W  +AA KF IPRL+FHGT   +LC +  +R+Y+P   V SDSE F + NLP ++
Sbjct  128   DVFLHWTFDAANKFGIPRLVFHGTGFFSLCGLECMRLYEPQKKVESDSEPFVVTNLPGDV  187

Query  606   KITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRA  785
             K+T+ Q+S F    +    ++ +   + SE KSYGV+ NSFYELE  YA++++NV+GR+A
Sbjct  188   KLTRKQLSDFIDQRIGGDFTQLLIECKASELKSYGVVVNSFYELEATYADYFRNVMGRKA  247

Query  786   WSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHE  965
             W +GP+S  NR  E+KAERG +++IDE ECLKWLDSK P SVVY+ FGS  NFA +QL E
Sbjct  248   WHIGPVSQCNRGTEEKAERGNEASIDEQECLKWLDSKKPKSVVYVSFGSTTNFAAAQLME  307

Query  966   MAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAV  1145
             +AMG+E SG  F+WV+R K+ ++   + W+PEGFE++ +GKGLIIRGWAPQ++ILDH AV
Sbjct  308   IAMGLEASGQQFIWVVRKKKNKEEKED-WLPEGFEKKMEGKGLIIRGWAPQMLILDHEAV  366

Query  1146  GAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDG  1325
             G FVTHCGWNSTLEGV  GVPMVTWP+ AEQF+NEK +TD+L+ G  VG ++  ++  + 
Sbjct  367   GGFVTHCGWNSTLEGVTAGVPMVTWPLSAEQFLNEKFVTDVLKIGIVVGIQQSVKMLGNF  426

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VKRE I +A+K++M G+ + EMR +AK + + AK A+
Sbjct  427   VKRETIQKAVKEIMAGDRAHEMRKKAKALGEMAKTAV  463



>ref|XP_010437661.1| PREDICTED: UDP-glycosyltransferase 73B3-like [Camelina sativa]
Length=482

 Score =   497 bits (1280),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 248/448 (55%), Positives = 320/448 (71%), Gaps = 14/448 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQME  254
             LHV FFP MAHGHMIPT+DMAKLF+SRG K+TI+TTP N  +  K +D +  L  G +++
Sbjct  10    LHVMFFPFMAHGHMIPTVDMAKLFSSRGAKSTILTTPLNAKILQKPIDAFKNLNPGLEID  69

Query  255   IRLLEFPGVEVGLPESCQRLDQTPDDDGLPR------FFKACAMlqppledllqelrpdC  416
             I++ +FP V++GLPE C+  D    D+ + R      F  +    +  LE LLQ  RPDC
Sbjct  70    IQIFDFPCVQLGLPEGCENADFFTADNNIDRQDLSLKFLLSTRFFKDQLEKLLQTTRPDC  129

Query  417   LVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLP  596
             L+ADMFFPWAT AA KF++PRL+FHGT + +LC+ + +RV+ P N V+S  E F IP+LP
Sbjct  130   LIADMFFPWATEAAEKFNVPRLVFHGTGYFSLCSDYCIRVHNPQNTVASSCEPFVIPDLP  189

Query  597   HELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
               + ITK Q+        E+ M +FM  VR SE KS GV+ NSFYELEPDYA+ YK+ + 
Sbjct  190   GNIVITKGQIGD---RHGESEMGKFMAEVRESEVKSSGVVVNSFYELEPDYADFYKSFVQ  246

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             +R+W +GPLSLY+R  E+KA RGKK++IDE ECLKWLDSK P SV+YI FGSVA F   Q
Sbjct  247   KRSWHIGPLSLYSRGFEEKAGRGKKASIDEVECLKWLDSKKPDSVIYISFGSVACFKNEQ  306

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A G+E  G +F+WV+R    +    E+W+PEGFEER KGKG+IIRGWAPQV+ILDH
Sbjct  307   LIEIAAGLEACGTNFIWVVRKSTGD---KEEWLPEGFEERVKGKGMIIRGWAPQVLILDH  363

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD  1316
              A G FVTHCGWNS LEGV  G+PMVTWPV AEQF NEKL+T +LRTG  VG+K+  R  
Sbjct  364   QATGGFVTHCGWNSLLEGVAAGLPMVTWPVGAEQFYNEKLVTQVLRTGVSVGAKKHVRST  423

Query  1317  SDGVKREAIAEAIKKVMIGEESEEMRSR  1400
              D + RE + +A+++V+ GEE+E+ R R
Sbjct  424   GDFISREKVDKAVREVLAGEEAEKRRGR  451



>ref|XP_004305941.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Fragaria vesca subsp. vesca]
Length=474

 Score =   497 bits (1279),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 245/452 (54%), Positives = 322/452 (71%), Gaps = 12/452 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+ FFP MA GH+IP + + KLF SRG+KATIITTPA+ P   K ++     G Q+ I 
Sbjct  8     LHIAFFPFMAQGHVIPAIHLTKLFVSRGLKATIITTPADAPFIRKKIENS---GTQINIF  64

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              ++ P VEVGLPE+C+        +   +FFKA  +L P LE  L++ +P+CLVADMFFP
Sbjct  65    TIKVPAVEVGLPENCENFHSATSPEMQAKFFKATTLLGPQLELFLKQRKPNCLVADMFFP  124

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT+ A+K  IP LIFHG S+ ALCA   + +YKP N VSSDSE F IPNLP ++++ + 
Sbjct  125   WATDVASKLGIPTLIFHGISYFALCATLCVHLYKPHNQVSSDSEPFVIPNLPDKIELNRK  184

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             ++  F +  VEN   +       + + SYGV+ NSFYELE  YA+HY+NVLG +AW +GP
Sbjct  185   KIPDFVKDGVENEFKKMYEESMEALKSSYGVLVNSFYELEHSYADHYRNVLGLKAWHIGP  244

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             L L N +VED+     K + DEHEC+KWLD K P+SVVY+CFGS+ANF  +QL E+A+G+
Sbjct  245   LWLCN-EVEDQ-----KLSTDEHECMKWLDRKKPNSVVYVCFGSLANFGDAQLLEIAIGL  298

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG  F+WV+    +++   E W+PEGFEER +GKG+IIRGWAPQV IL H AVG FVT
Sbjct  299   EASGHHFIWVVN---KQNIIEENWLPEGFEERIEGKGMIIRGWAPQVKILSHEAVGGFVT  355

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLE VC GVPMVTWP+FAEQF NEKL+T +L  G  VG++EW R+D + VK E 
Sbjct  356   HCGWNSTLEAVCAGVPMVTWPLFAEQFYNEKLITQVLGIGVDVGAQEWIRVDGEIVKSEN  415

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             I +A++K M+GE++EEMRSRA+   + A++AI
Sbjct  416   IEKAVRKAMVGEKAEEMRSRARGYAEMARRAI  447



>ref|XP_010107895.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Morus notabilis]
 gb|EXC17295.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Morus notabilis]
Length=482

 Score =   497 bits (1279),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 241/452 (53%), Positives = 326/452 (72%), Gaps = 5/452 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LHVFF P+MA GH+IP +DMAKLF+SRG+K+T+ TT    P  SK++   T       + 
Sbjct  9     LHVFFLPLMAQGHLIPVIDMAKLFSSRGLKSTVATTSHFAPFLSKSLQNDTD----SVVV  64

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
               + P  +VGLPE  + +      D   RFFK+C +L P + D+L+  RPD LVADMFF 
Sbjct  65    TFKIPSADVGLPEDVEAVHMAKTPDMQNRFFKSCGLLGPRIADILERYRPDFLVADMFFT  124

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WA + A +F IP L+FHGTS+ +LCA  S+ +++P+  VS D E F IP+LP E++ T+ 
Sbjct  125   WAPDVAKEFGIPCLVFHGTSYFSLCAGLSVFLHQPYKTVSDDLEPFVIPDLPDEIEFTRS  184

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             +V+ F ++     +S + +  +  EE+SYGV+ NSFYELEP YA+HY N LGR+AW++GP
Sbjct  185   RVADFVKNNDGGVLSTWYKESKAMEERSYGVLMNSFYELEPGYADHYSNFLGRKAWNIGP  244

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             L +Y +  E +A+RG +++IDEHECLKWLDSK P SV+Y+ FGSVANF  +QL E+A G+
Sbjct  245   LFMYEKRTEQRAKRGMEASIDEHECLKWLDSKKPDSVIYVSFGSVANFDDNQLMELAAGL  304

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG +F+WV++ ++ E    E W+P+GFEER +GKGLIIRGWAPQV IL+H A+G FVT
Sbjct  305   EASGREFIWVVKKEKRE-GVREDWLPQGFEERIQGKGLIIRGWAPQVTILEHDAIGGFVT  363

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLE VC GVPMVTWPV AEQF NEKL+T +LR G  VG+K+W+RL  D VKR+A
Sbjct  364   HCGWNSTLESVCAGVPMVTWPVSAEQFFNEKLVTKLLRIGVEVGAKKWRRLLGDFVKRDA  423

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + +A++KVM GEE+EEMR R +   + A++AI
Sbjct  424   VEKAVRKVMEGEEAEEMRRRVRGFAEMARRAI  455



>gb|AHV78225.1| glucosyltransferase [Amaranthus hypochondriacus]
Length=487

 Score =   497 bits (1279),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 245/464 (53%), Positives = 339/464 (73%), Gaps = 10/464 (2%)
 Frame = +3

Query  63    DFAMGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG  242
             D  +  LHV FFP MA+GHMIPTLD+A+LFA+RGVK TIITTP + P+ ++A++K  + G
Sbjct  3     DDELQKLHVVFFPFMAYGHMIPTLDIARLFAARGVKTTIITTPVSLPIVTQAIEKAIKHG  62

Query  243   F-QMEIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCL  419
                +   +  FP  E GLP+ C+ ++Q      +P+F +A  ML  PLE  L++ RP CL
Sbjct  63    SPAIYTEIFSFPSAENGLPDGCETVNQAIKYYMIPKFMQAVEMLNTPLEQYLEKTRPHCL  122

Query  420   VADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPH  599
             V+DMF PW T+ AAKF++PRL+FHGTS+ ALCA   +RVYKP+ +VS+D E F +P+LPH
Sbjct  123   VSDMFLPWTTDCAAKFNVPRLVFHGTSYFALCAEEIVRVYKPYKNVSNDEETFILPSLPH  182

Query  600   ELKITKLQVSP-FERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
             E+K+TK Q S  F + E+  +  EF   ++ SE KSYGVI NSFYELE DYA+ +   LG
Sbjct  183   EVKMTKSQFSEDFMKEELNESKKEF-ELIKESEIKSYGVIVNSFYELERDYADFFSKELG  241

Query  777   RRAWSVGPLSLYNRDVEDKAERG-KKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPS  953
             RRAW +GP+SL NR +EDKA+RG  +++ DEHECLKWL+SK  +SV+YICFGS+A    S
Sbjct  242   RRAWHIGPVSLCNRSIEDKAKRGILEASKDEHECLKWLNSKKTNSVIYICFGSMAQINAS  301

Query  954   QLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILD  1133
             Q+ E+AMG+E S  DF+WV++N R+ +   E+ +P+GFE+R +GKGLIIRGW PQ+++L+
Sbjct  302   QMLEIAMGLEASQHDFIWVVKNDRQSE---EELLPQGFEQRMEGKGLIIRGWVPQLLLLE  358

Query  1134  HPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL  1313
             H A+GA +THCGWNS LEG+  G+PMVTWP   EQF NEKL+T+IL+ G  VG+K+W  +
Sbjct  359   HEAIGALLTHCGWNSILEGISTGLPMVTWPACTEQFYNEKLVTEILKIGVPVGAKKWNVV  418

Query  1314  DSDG---VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
               +    V+R AI +AI++VM G+E++E R+RA  +K+ A KA+
Sbjct  419   PYNVDYLVRRNAIEKAIREVMEGDEAQERRNRAMKLKEMALKAV  462



>ref|XP_007200246.1| hypothetical protein PRUPE_ppa015133mg [Prunus persica]
 gb|EMJ01445.1| hypothetical protein PRUPE_ppa015133mg [Prunus persica]
Length=469

 Score =   495 bits (1275),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 240/446 (54%), Positives = 324/446 (73%), Gaps = 6/446 (1%)
 Frame = +3

Query  105   MAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIRLLEFPGVE  284
             M+HGHMIPT+DMAKLFAS+G+K TII+TP N  +FSKA+++    GF++ +  L+FP VE
Sbjct  1     MSHGHMIPTIDMAKLFASKGIKTTIISTPHNLSLFSKAIERSKLSGFEIGVIALKFPVVE  60

Query  285   VGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFPWATNAAAK  464
             VGLPE C+        + L +F KA  +L   LE LL++ +P+CLVAD+FFPWAT+ AAK
Sbjct  61    VGLPEGCESAHMVETQEELQKFLKATTLLDQQLEQLLKDHQPNCLVADIFFPWATDVAAK  120

Query  465   FDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKLQVSPFERS  644
             F IPRL+FHGT+ ++LC  H L   K    + SDSE   IPNLPHE K+   Q+  F + 
Sbjct  121   FGIPRLVFHGTNFISLCVSHHL--MKMDLSIVSDSEPLVIPNLPHEHKLAGNQIPDFMKQ  178

Query  645   EVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGPLSLYNRDV  824
             E E  +  F ++   SE KS+GV+ NSFYELEP YA+HY++ LG +AW +GP  L N+++
Sbjct  179   ESE--LGSFAKAAAESEWKSHGVLVNSFYELEPAYADHYRDFLGIKAWHIGPTFLCNKEI  236

Query  825   EDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGIEDSGMDFV  1004
             EDKA RG K+++DEHECLKWL SK P+SV+Y+ FGSV  F  +QL E+A+G+E SG  F+
Sbjct  237   EDKANRGPKASLDEHECLKWLSSKEPNSVIYVSFGSVVKFDDAQLLEIALGLEASGQQFI  296

Query  1005  WVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVTHCGWNSTL  1184
             WV++ ++ +    E W+PEGFE+R +G+GL+IRGWAPQV IL+H A G FVTHCGWNST+
Sbjct  297   WVVKKEKSDQENKEDWLPEGFEDRVEGRGLVIRGWAPQVPILEHQATGGFVTHCGWNSTM  356

Query  1185  EGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGV--GSKEWKRLDSDGVKREAIAEAIK  1358
             E V  GVPM TWP FA+QF NEKL+T+IL  G  V  G+K+W R   D VK+  I +A+ 
Sbjct  357   EAVTAGVPMATWPAFADQFYNEKLVTEILGIGVRVVEGAKKWARFGGDRVKKVNIEKAVT  416

Query  1359  KVMIGEESEEMRSRAKVMKDKAKKAI  1436
             +VM+GEE+EEMRSRAK++ + A+K++
Sbjct  417   EVMVGEEAEEMRSRAKLLGEMARKSV  442



>ref|XP_011000141.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=486

 Score =   496 bits (1276),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 237/458 (52%), Positives = 334/458 (73%), Gaps = 10/458 (2%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH+ FFP MA GH+IPT+DMA+ FA  GVKATIITTP N P+FS+ +++  ++G ++ I
Sbjct  7     QLHIAFFPFMAQGHIIPTVDMARTFARHGVKATIITTPLNAPLFSRTIERDIEMGSKIRI  66

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +++FP  + GLPE C+        + +P+FFKA ++LQ PLE LL+E RP+CLVADM F
Sbjct  67    LIMKFPSADAGLPEGCENASSIETLEMVPKFFKAVSLLQQPLEYLLEECRPNCLVADMMF  126

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWAT  A KF IPRL+FHGTS+ ALC    L+ ++P+  + +D E FT+P LP ++K+T+
Sbjct  127   PWATKVANKFGIPRLVFHGTSYFALCVSDCLKRFEPYKSIETDLEPFTVPGLPDKIKLTR  186

Query  618   LQVSPF--ERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             LQ+  +  E SE    M E  R    ++ +SYGVI NSF+ELEP Y+EHYK V+GR+AW 
Sbjct  187   LQLPSYVKENSEFTKQMDEISR----ADLESYGVIMNSFHELEPAYSEHYKMVIGRKAWH  242

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSV--ANFAPSQLHE  965
             +GP+SL NRD  DK +RG  ++IDE+ECL+WL  K   SV+YICFGS+  ++F+ +QL E
Sbjct  243   IGPVSLCNRDTRDKMQRGGVASIDENECLRWLAMKKSSSVLYICFGSMSRSDFSAAQLFE  302

Query  966   MAMGIEDSGMDFVWVIRN-KREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPA  1142
             +A  +  SG +F+W ++N ++ +    E+W+PEGFE++ +G+GLIIRGWAPQ++ILDH A
Sbjct  303   IAKALTSSGQNFIWAVKNGEKTKGEDREEWLPEGFEKKMQGRGLIIRGWAPQILILDHEA  362

Query  1143  VGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD  1322
             VG F+THCGWNS LEG+  GVPMVTWP+ AEQF NEKL+TD+L+ G  VG++EW R +  
Sbjct  363   VGGFMTHCGWNSALEGITAGVPMVTWPLCAEQFYNEKLITDVLKIGVAVGAQEWSRRERK  422

Query  1323  -GVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKA  1433
               VK+E I  AI ++M+GE +E +R+R   +K+KA++A
Sbjct  423   ILVKKEEIENAITQLMVGEAAEGLRNRTTALKEKARRA  460



>gb|ACJ72160.1| UGT3 [Pueraria montana var. lobata]
Length=475

 Score =   494 bits (1273),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 242/457 (53%), Positives = 331/457 (72%), Gaps = 14/457 (3%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
             +LHVFFFP  A+GH+IP++D+A++FASRG++ T++TTP N+P+ S+ + K       ++I
Sbjct  7     ELHVFFFPFPANGHIIPSIDLARVFASRGIRTTVVTTPLNEPLISRTIGKAN-----VKI  61

Query  258   RLLEFPGVE-VGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMF  434
             R ++FP  E  GLPE C+  D     D +  F KA  +L+ PLE L+++ +PDC++ADMF
Sbjct  62    RTIKFPSPEQTGLPEGCENSDSALSPDMIMAFLKATVLLRDPLEHLMEQEKPDCIIADMF  121

Query  435   FPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKIT  614
             FPWAT++AAKF IPR++FHG      C    +R YKP + VSS  E F +P LP E+ ++
Sbjct  122   FPWATDSAAKFGIPRIVFHGMGFFPTCVSACVRQYKPQDKVSSYFEPFVVPKLPGEITVS  181

Query  615   KLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSV  794
             K+Q+   +  + ++  ++ +  V  SE  SYGVI NSFYELEP YA+ Y+N LGRRAW +
Sbjct  182   KMQLP--QTPKDDDVFTKLLDEVNASELNSYGVIANSFYELEPVYADFYRNELGRRAWHL  239

Query  795   GPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAM  974
             GP+ L +RD E+KA RG+++AIDEHECLKWLDSK P+SVVY+CFGS+  F  +QL E+A+
Sbjct  240   GPVCLCDRDTEEKANRGREAAIDEHECLKWLDSKEPNSVVYVCFGSMTTFPDAQLKEIAL  299

Query  975   GIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERT--KGKGLIIRGWAPQVVILDHPAVG  1148
             G+E SG  F+WV++    E     +W+PEGFEER   +GKGLIIRGWAPQV+ILDH AVG
Sbjct  300   GLEASGQPFIWVVKKGSSE---KLEWLPEGFEERVLGQGKGLIIRGWAPQVMILDHEAVG  356

Query  1149  AFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEW-KRLDSDG  1325
              FVTHCGWNS LEGVC GVPMVTWP++AEQF N K +TDI++ G GVG + W   +  D 
Sbjct  357   GFVTHCGWNSALEGVCAGVPMVTWPMYAEQFYNAKFLTDIVKIGLGVGVQTWIGMMGRDP  416

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VK+E I +A+K++M+GEE+EEMR+RAK     AK+A+
Sbjct  417   VKKEPIEKAVKRIMVGEEAEEMRNRAKEFAQMAKRAV  453



>ref|XP_006412271.1| hypothetical protein EUTSA_v10025048mg [Eutrema salsugineum]
 gb|ESQ53724.1| hypothetical protein EUTSA_v10025048mg [Eutrema salsugineum]
Length=485

 Score =   494 bits (1272),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 246/461 (53%), Positives = 331/461 (72%), Gaps = 14/461 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQME  254
             LHV FFP MA+GH+IPTLDMAKLF SRG ++TIITTP N  +  K ++ +  L    +++
Sbjct  11    LHVIFFPFMAYGHIIPTLDMAKLFCSRGARSTIITTPLNSKILQKPIELFKNLNPTLEID  70

Query  255   IRLLEFPGVEVGLPESCQRLD-----QTPDDDGLP-RFFKACAMlqppledllqelrpdC  416
             I + +FP V++GLPE C+ +D        D D +  +FF + +  +  LE  L+  RPDC
Sbjct  71    IHIFDFPCVDLGLPEGCENVDFFTTKNNEDRDYITLKFFLSTSFFKDQLEKFLETTRPDC  130

Query  417   LVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLP  596
             L+ADMFFPWAT AA K  +PRL+FHGT + +LCA + ++ +KP N V+S  E F IP+LP
Sbjct  131   LIADMFFPWATEAAEKSRVPRLVFHGTGYFSLCAGYCIKAHKPQNRVASSCEPFVIPDLP  190

Query  597   HELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
              ++ IT+ Q+      + E+ M +FM  VR SE KS GV+ NSFYELEP+YA+ YK  + 
Sbjct  191   GDIVITQEQIID---GDNESGMGKFMMDVRESEVKSSGVVVNSFYELEPEYADFYKRFVN  247

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             +RAW +GPLS+ NR  E+KAERGKK+++DE ECLKWLDSK P SV+YI FGSVA F   Q
Sbjct  248   KRAWHIGPLSVINRGFEEKAERGKKASVDEAECLKWLDSKKPDSVIYISFGSVAFFKNEQ  307

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A G+E SG +F+WV+R  +++    E+W+PEG EERTKGKG+IIRGWAPQV+IL+H
Sbjct  308   LIEIAAGLEASGTNFIWVVR--KDDAGEKEEWLPEGMEERTKGKGMIIRGWAPQVLILEH  365

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD  1316
              A G FVTHCGWNS LEGV  G+PMVTWP+ AEQF NEKL+T +LRTG  VG+ +  ++ 
Sbjct  366   QATGGFVTHCGWNSVLEGVAAGLPMVTWPIGAEQFYNEKLVTQVLRTGVSVGATKHVKVM  425

Query  1317  SDG-VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              D  + RE + +A+++V++GEE+EEMR RAK M + AK A+
Sbjct  426   GDFIISRENVEKAVREVLVGEEAEEMRRRAKKMAEMAKAAV  466



>ref|XP_008364526.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Malus domestica]
Length=477

 Score =   494 bits (1271),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 243/457 (53%), Positives = 321/457 (70%), Gaps = 13/457 (3%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH+FFFP MA GH IP ++MAKLFAS GVK+T+ITTP N P+FSKA+    QLGF +EI
Sbjct  8     QLHIFFFPYMAQGHTIPLINMAKLFASHGVKSTLITTPLNAPLFSKAIQGTKQLGFDIEI  67

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +++FP  EVGLP+ C+  +     +   +FFKA  +LQP +E +L E RP CLVAD FF
Sbjct  68    LVIKFPTEEVGLPQGCESGNLATTTEMKEKFFKATFLLQPQIEQVLDEHRPHCLVADAFF  127

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWAT+ AAKF IPR+IFHG    AL A  S+ +Y+P   +SSDSE+FTIPN P E+K+ +
Sbjct  128   PWATDLAAKFGIPRIIFHGVGFFALYATLSVLLYEPHLKLSSDSEVFTIPNFPVEIKLIR  187

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
              Q+  F +   E   ++  ++ R  EEKS+G I NSFYELEP +A+HY+   GR+AW +G
Sbjct  188   SQIPAFIKQNAETEFTKLFKAARECEEKSFGFIINSFYELEPAFADHYRTAFGRKAWHIG  247

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
              +  +N+   D+A  G      +H+ L WL+SK P+SVVYICFGS+ NF  SQL E+A G
Sbjct  248   LILSWNKAANDEASLG------QHKSLNWLNSKKPNSVVYICFGSMTNFIDSQLLEIATG  301

Query  978   IEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             +E S   F+WV++    E N  E+W+P+GFE+R +GKGLIIRGWAPQV IL+H A+G FV
Sbjct  302   LEASRQGFIWVVKR---EKNDKEEWLPQGFEKRMEGKGLIIRGWAPQVPILEHEAIGGFV  358

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL----DSDG  1325
             THCGWNS LEGV  GVPM+TWPV AEQF NEKL+T +LRTG  VG ++W           
Sbjct  359   THCGWNSILEGVSAGVPMITWPVSAEQFYNEKLVTVVLRTGVAVGVEQWSTFVDVKKEAS  418

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VKREAI +AI +VM+ EE+E MR+RA+V+++ A +A+
Sbjct  419   VKREAIEKAINQVMVSEEAEGMRARARVLREMATRAV  455



>ref|XP_008454969.1| PREDICTED: scopoletin glucosyltransferase-like [Cucumis melo]
Length=512

 Score =   494 bits (1273),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 239/455 (53%), Positives = 328/455 (72%), Gaps = 2/455 (0%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGF-QME  254
              LH+F  P MA GHMIP +D+AKL +SRG+K TI+TTP N    S ++     L   Q++
Sbjct  36    QLHMFLLPFMARGHMIPMVDLAKLLSSRGIKITIVTTPLNSISISNSIQNSKSLSTSQIQ  95

Query  255   IRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMF  434
             + +L+FP  EVGLP+ C+ LD     D  P+F  A  + Q P E+ + + RP C++ADM+
Sbjct  96    LLILKFPSAEVGLPDGCENLDSVITPDMFPKFISAFNLFQNPFEEAVMKQRPHCILADMY  155

Query  435   FPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKIT  614
             FPWA + AAKF IPRL FH TS  + CA   +R+++P+N V SD+E F IP LP ++  T
Sbjct  156   FPWANDVAAKFGIPRLNFHATSFFSSCASEFMRIHEPYNHVLSDTEPFLIPRLPGDITFT  215

Query  615   KLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSV  794
             K+++  F R  ++N +SEF++         YG+I NSFYELE +Y +  +NVLG +AW +
Sbjct  216   KMKLPQFVRENLKNEVSEFIKRAHELGFACYGIIMNSFYELEAEYVDCCRNVLGIKAWPI  275

Query  795   GPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAM  974
             GPLSL N++ E+KA+RG +S+IDEHECLKWLDSK P+SVVY+CFGS+A F   QL E+A 
Sbjct  276   GPLSLCNKETEEKAQRGNESSIDEHECLKWLDSKKPNSVVYVCFGSMAKFNFDQLKEIAS  335

Query  975   GIEDSGMDFVW-VIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             G+E +  +F+W V + K+EE+  +  W+PEG+E+R +GKGLII+GWAPQV+ILDHPAVG 
Sbjct  336   GLEAARKNFIWVVRKVKKEEEEENHDWLPEGYEQRMEGKGLIIKGWAPQVLILDHPAVGG  395

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK  1331
             FVTHCGWNSTLEGV  GVPMVTWP+ AEQF NEKL+TD+L+ G  +G ++W R+  D ++
Sbjct  396   FVTHCGWNSTLEGVTAGVPMVTWPMAAEQFYNEKLVTDVLKIGVAIGVQKWVRVVGDFIE  455

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             REA+  AI++VM GEE++EMR+RAK +   AKKA+
Sbjct  456   REALENAIRRVMEGEEAKEMRNRAKELAKMAKKAV  490



>emb|CAB56231.1| betanidin-5-O-glucosyltransferase [Cleretum bellidiforme]
Length=489

 Score =   493 bits (1270),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 268/477 (56%), Positives = 344/477 (72%), Gaps = 4/477 (1%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQ-LGFQME  254
             DLHV FFP +AHGHMIP+LD+AKLFA+RGVK TIITTP N  +F+KA++K  +    QME
Sbjct  9     DLHVVFFPFLAHGHMIPSLDIAKLFAARGVKTTIITTPLNASMFTKAIEKTRKNTETQME  68

Query  255   IRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMF  434
             I +  FP  E GLP  C+ L+Q         FF A  +L+  LE+ L + RP+CLVADMF
Sbjct  69    IEVFSFPSEEAGLPLGCENLEQAMAIGANNEFFNAANLLKEQLENFLVKTRPNCLVADMF  128

Query  435   FPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKIT  614
             F WA ++ AKF+IP L+FHG S  A CA   +  YKP+  VSSD+E+F++P LPHE+K+T
Sbjct  129   FTWAADSTAKFNIPTLVFHGFSFFAQCAKEVMWRYKPYKAVSSDTEVFSLPFLPHEVKMT  188

Query  615   KLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSV  794
             +LQV    R   E   ++    +R  E KSYGVI NSFYELEPDYA+  +  LGRRAW +
Sbjct  189   RLQVPESMRKGEETHFTKRTERIRELERKSYGVIVNSFYELEPDYADFLRKELGRRAWHI  248

Query  795   GPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAM  974
             GP+SL NR +EDKA+RG++++IDE ECLKWL+SK P SV+YICFGS  +    QLHE+A 
Sbjct  249   GPVSLCNRSIEDKAQRGRQTSIDEDECLKWLNSKKPDSVIYICFGSTGHLIAPQLHEIAT  308

Query  975   GIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAF  1154
              +E SG DF+W +R    + N SE+W+P G+E R +GKGLIIRGWAPQV+IL+H A G F
Sbjct  309   ALEASGQDFIWAVRGDHGQGN-SEEWLPPGYEHRLQGKGLIIRGWAPQVLILEHEATGGF  367

Query  1155  VTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDS--DGV  1328
             +THCGWNS LEG+  GVPMVTWP FAEQF NE+L+T IL+ G  VGSK+W    S  D +
Sbjct  368   LTHCGWNSALEGISAGVPMVTWPTFAEQFHNEQLLTQILKVGVAVGSKKWTLKPSIEDVI  427

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAIeeggssylglsslldelRAYH  1499
             K E I +A+++VM+GEE EE R RAK +K+ A +AIEEGGSSY  LS+L++EL+ YH
Sbjct  428   KAEDIEKAVREVMVGEEGEERRRRAKKLKEMAWRAIEEGGSSYSDLSALIEELKGYH  484



>gb|KFK40015.1| hypothetical protein AALP_AA3G318900 [Arabis alpina]
Length=483

 Score =   492 bits (1267),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 240/462 (52%), Positives = 325/462 (70%), Gaps = 15/462 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQME  254
             +H+ FFP MA GHMIP LDMAKLF++RG ++TI+TTP N  +  K ++ +  L    Q+ 
Sbjct  6     IHILFFPFMAQGHMIPMLDMAKLFSTRGARSTILTTPINSKILEKPIEAFKTLNPDLQIG  65

Query  255   IRLLEFPGVEVGLPESCQRLD-----QTPDDDGLPRFFK---ACAMlqppledllqelrp  410
             I++L FP VE+GLPE C+ +D     Q PD D    F K   +   ++  LE  ++  +P
Sbjct  66    IKILNFPCVELGLPEGCENVDFINSYQNPDSDSGDLFLKFLFSTKSMKQQLESFIETTKP  125

Query  411   dCLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPN  590
              C+VADMFFPW T +A KF++PRL+FHGT+  ALC  +++R +KP   V++ S  F IP 
Sbjct  126   SCIVADMFFPWTTESAEKFNVPRLVFHGTAFFALCCSYNMRTHKPHKKVATTSTPFVIPG  185

Query  591   LPHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNV  770
             LP E+ IT  Q +    ++ E  M + M+ +R SE  S+GV+ NSFYELEP YA+ Y++ 
Sbjct  186   LPGEIVITTEQAN---VADEETPMGKIMKEIRESESNSFGVLVNSFYELEPAYADFYRSF  242

Query  771   LGRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAP  950
             + +RAW +GPLSL NR++ +KA RGKKS IDE ECL+WL+SK P SVVY+ FGS A+F  
Sbjct  243   VAKRAWHIGPLSLCNRELAEKAGRGKKSNIDEQECLEWLESKPPGSVVYVSFGSRASFTN  302

Query  951   SQLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVIL  1130
              QL E+A+G+E SG +F+WV+  K E    SE W+PEG+EERTKGKGLIIRGWAPQV+IL
Sbjct  303   EQLLEIAVGLECSGQNFIWVV-GKNENQGESEDWLPEGYEERTKGKGLIIRGWAPQVLIL  361

Query  1131  DHPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKR  1310
             DH AVGAFVTHCGWNS +EG+  G+PMVTWP+ AEQF NEKL+T +LRTG  VG+ E  +
Sbjct  362   DHKAVGAFVTHCGWNSAIEGIAAGLPMVTWPMGAEQFYNEKLLTKVLRTGVNVGATELVK  421

Query  1311  LDSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
                  + RE + +A+K+V++GEE+EE R RAK + + AK A+
Sbjct  422   -KGKLISREEVEKAVKEVIVGEEAEERRIRAKKLGEVAKAAV  462



>gb|AFJ52930.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=495

 Score =   493 bits (1268),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 255/473 (54%), Positives = 334/473 (71%), Gaps = 16/473 (3%)
 Frame = +3

Query  57    SKDFAMGD--LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKY  230
             S + ++GD  LHVFFFP +AHGHMIP +DMAK+FASRGVK TI+TTP N P FSK + K+
Sbjct  3     SLNSSVGDHQLHVFFFPFLAHGHMIPAIDMAKIFASRGVKVTIVTTPLNVPFFSKTISKH  62

Query  231   TQ-LGFQMEIRLLEFPGVEVGLPESCQRLDQTPDDD----GLPRFFKACAMlqppledll  395
             ++  G ++ IR L+FP  E  LPE C+  +     +       +F  A   LQ  LE LL
Sbjct  63    SESTGSEIRIRTLKFPTAEFRLPEGCENTEVITSLNLGWETFSKFLLASTKLQESLEKLL  122

Query  396   qelrpdCLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSEL  575
             +E RPDCLVADMFFPWAT+++ KF IPRL+FHGTS  +L  M  +  Y+P  DVSSD+E 
Sbjct  123   EEARPDCLVADMFFPWATDSSEKFGIPRLLFHGTSFFSLSVMDVVSRYEPHKDVSSDTEP  182

Query  576   FTIPN-LPHELKITKLQV--SPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPD  746
             F +P  +P  + +TK Q+  S     + ++ + EF   V  S    YG + NSFYELEP 
Sbjct  183   FEVPGGIPDRIMLTKRQLPASAVTPGQEDSFLWEFFERVSESNSHGYGTVVNSFYELEPG  242

Query  747   YAEHYKNVLGRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICF  926
             YA++Y+NVLGR++W VGP+SL + DV+DKA RGK+S+ID   CL WLDSK P SVVYICF
Sbjct  243   YADYYRNVLGRKSWHVGPVSLCSADVDDKANRGKESSIDREHCLNWLDSKEPMSVVYICF  302

Query  927   GSVANFAPSQLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRG  1106
             GSVANF+  QL E+A GIE SG  F+WV+R  R+ DN +E W+PEGFEERTKG+G+IIRG
Sbjct  303   GSVANFSVEQLREVATGIEASGQQFIWVVRKNRQNDNDTEDWLPEGFEERTKGRGIIIRG  362

Query  1107  WAPQVVILDHPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTG  1286
             WAPQV IL+H ++GA VTHCGWNSTLE +  G+P+VTWPV AEQF NEK +TD+++ G G
Sbjct  363   WAPQVFILEHVSIGAIVTHCGWNSTLEAISAGLPIVTWPVMAEQFYNEKFVTDVVKIGVG  422

Query  1287  VGSKEWKRLDS-DGVKREAIAEAIKKVMI--GEESEEMRSRAKVMKDKAKKAI  1436
             VG+ +     + +GVK E   +AI+++M+   EE EEMR RAK + + A+KA+
Sbjct  423   VGAAQSPLGATIEGVKVE---KAIRRIMLTGDEEVEEMRRRAKNLGEMARKAV  472



>ref|XP_007042490.1| Anthocyanin 3'-O-beta-glucosyltransferase [Theobroma cacao]
 gb|EOX98321.1| Anthocyanin 3'-O-beta-glucosyltransferase [Theobroma cacao]
Length=484

 Score =   492 bits (1266),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 237/455 (52%), Positives = 321/455 (71%), Gaps = 5/455 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+ F P +AHG +IPT+DMA+L A  GVK TI TTP N  +F+K + +  + GF++   
Sbjct  8     LHIVFLPQLAHGILIPTVDMARLCARHGVKVTIATTPLNAHLFAKTIQRDRESGFEISTY  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
             +++FP  EVGLPE C+        +   +F KA  + Q PLE LL ELRPDCLVA M F 
Sbjct  68    IIKFPSAEVGLPEGCENASSLTSQEMQTKFLKAANLFQQPLEQLLAELRPDCLVAGMMFT  127

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT+ A+KF IPRL+FHGTS  ++  + S+  + P+  +++D E F +P LP ++K+TK+
Sbjct  128   WATDVASKFGIPRLVFHGTSCFSISILDSVIRHAPYKKIATDFEFFDVPGLPDQIKMTKM  187

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+  F + E  +   + +     SE  S+GVI NSFYELEP Y EHY  V+G++AW VGP
Sbjct  188   QLPDFIKEEEGSERRKMLNEALESERTSFGVIVNSFYELEPAYREHYSKVMGKKAWQVGP  247

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             +SL N+D EDKAERG  ++ID HECL+WL SK P+SV+YICFGS++ F+ +QL+EMA G+
Sbjct  248   VSLCNKDSEDKAERGNVASIDRHECLRWLASKKPNSVLYICFGSLSRFSAAQLNEMAKGL  307

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG +F+WV+R   +ED   E+W+PEGFEER +GKGLIIRGWAPQV+ILDH AVG F+T
Sbjct  308   EASGQNFIWVVRKVNDEDK--EEWLPEGFEERMEGKGLIIRGWAPQVLILDHDAVGGFMT  365

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDG---VK  1331
             HCGWNSTLE +  GVPMVTWP+ AEQF NEKL+ D+L+ G   G+KEW R   D    V 
Sbjct  366   HCGWNSTLESITAGVPMVTWPLQAEQFFNEKLIVDVLKIGVCTGAKEWSRWADDTKIIVT  425

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              E I  A+ ++M+GEE E+MR+R + +KD A++ +
Sbjct  426   SEDIERAVTQLMVGEEGEKMRNRTRELKDMARRVV  460



>ref|XP_006422970.1| hypothetical protein CICLE_v10030328mg [Citrus clementina]
 gb|ESR36210.1| hypothetical protein CICLE_v10030328mg [Citrus clementina]
Length=468

 Score =   491 bits (1263),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 244/450 (54%), Positives = 331/450 (74%), Gaps = 13/450 (3%)
 Frame = +3

Query  105   MAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIRLLEFPGVE  284
             MAHGHMIP +DMAKLFA+RGVKA++ITTPAN P  SK+V++  +LG +M+++ ++FP VE
Sbjct  1     MAHGHMIPIVDMAKLFATRGVKASVITTPANTPYVSKSVERANELGIEMDVKTVKFPSVE  60

Query  285   VGLPESCQRLDQTPDD---DGLPRFFKACAMlqppledllqelrpdCLVADMFFPWATNA  455
              GLPE C+ LD   ++   + + +FF A   LQ PLE LL++ +PDCLVAD+FF      
Sbjct  61    AGLPEGCENLDAITNEVNKELIVKFFGATTKLQEPLEQLLRDHKPDCLVADIFF------  114

Query  456   AAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKLQVSPF  635
              + F    L+F G    +LCA + L +Y+P   VSSDSE F +P+ P E+K+T+ Q+  F
Sbjct  115   LSSFTAIILVFPGC-FFSLCASNCLALYEPHKKVSSDSEPFVMPHFPGEIKLTRNQLPDF  173

Query  636   ERSEV-ENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGPLSLY  812
              + ++  N  S  +++   SE +SYGV  NSFYELE  YA+HY+  LGRRAW +GP+SL 
Sbjct  174   VKQDMGYNDFSRLLKATNESESRSYGVAVNSFYELEHAYADHYRKALGRRAWHIGPVSLC  233

Query  813   NRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGIEDSG  992
             NR+ EDKA RGK+++IDE ECLKWL+SK P+SVVYICFGS+ NF  +QL E+A G+E SG
Sbjct  234   NRNFEDKALRGKQASIDELECLKWLNSKQPNSVVYICFGSLVNFTSAQLMEIATGLEASG  293

Query  993   MDFVWVIRNKREE--DNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVTHC  1166
              +F+W +R  + +  + G E W+PEGFE+R +GKGLIIRGWAPQV+ILDH AVG FVTHC
Sbjct  294   RNFIWAVRKNKNDGGEGGKEDWLPEGFEKRMEGKGLIIRGWAPQVLILDHEAVGGFVTHC  353

Query  1167  GWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREAIA  1346
             GWNSTLE V  GVP+VTWPV AEQF NEK++ ++L+ G GVG ++W R+  D VKRE I 
Sbjct  354   GWNSTLEAVAAGVPLVTWPVAAEQFYNEKMVNEVLKIGVGVGIQKWCRIVGDFVKREKIE  413

Query  1347  EAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             +A+ ++M+G+ +EEMRSRAKV++  AK+A+
Sbjct  414   KAVNEIMVGDRAEEMRSRAKVLEKMAKRAV  443



>ref|XP_006283647.1| hypothetical protein CARUB_v10004704mg [Capsella rubella]
 gb|EOA16545.1| hypothetical protein CARUB_v10004704mg [Capsella rubella]
Length=482

 Score =   491 bits (1264),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 255/459 (56%), Positives = 330/459 (72%), Gaps = 13/459 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQME  254
             LHV FFP MAHGHMIPTLDMAKLF+SR  K+TI+TTP N  +  K +D +  L  G +++
Sbjct  11    LHVMFFPFMAHGHMIPTLDMAKLFSSRRAKSTILTTPLNAKILQKPIDAFKNLNPGLEID  70

Query  255   IRLLEFPGVEVGLPESCQRLD--QTPDDDGLP---RFFKACAMlqppledllqelrpdCL  419
             I++ +FP V++GLP+ C+  D   + +DDG     +FF +   L+  LE LL+  RPDCL
Sbjct  71    IQIFDFPCVQLGLPQGCENADFFTSNNDDGNEMELKFFFSTRFLKDQLEKLLETTRPDCL  130

Query  420   VADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPH  599
             +ADMFFPWAT  A KF++PRL+FHGT + +L   H +RV+KP N V+S  E F IP LP 
Sbjct  131   IADMFFPWATEVAGKFNVPRLVFHGTGYFSLSTGHCIRVHKPQNRVASSCEQFVIPELPG  190

Query  600   ELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGR  779
              + IT+ Q+      + E+ M +FM  VR SE KS GV+ NSFYELEPDYA+ YK+ + +
Sbjct  191   NILITEEQIID---GDGESEMGKFMTEVRESEVKSSGVVVNSFYELEPDYADFYKSSVQK  247

Query  780   RAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQL  959
             RAW +GPLS+YNR  E+KAERGKK+ +DE ECL WLDSK P SV+Y+ FGSV NF   QL
Sbjct  248   RAWHIGPLSVYNRGFEEKAERGKKANVDEVECLNWLDSKKPDSVIYVSFGSVVNFKNEQL  307

Query  960   HEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHP  1139
              E+A G+E SG  F+WV+R K   DN  E W+PEGFEER +GKG+IIRGWAPQV+IL+H 
Sbjct  308   IEIAQGLEASGSSFIWVVR-KNTGDN--EAWLPEGFEERVEGKGMIIRGWAPQVLILEHQ  364

Query  1140  AVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDS  1319
             A+G FVTHCGWNS LEGV  GVPMVTWPV AEQF NEKL+T +LRTG  VG+K   ++  
Sbjct  365   AIGGFVTHCGWNSLLEGVAAGVPMVTWPVGAEQFYNEKLVTQVLRTGVSVGAKRHMKVMG  424

Query  1320  DGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             D + RE + +A+++V++GEE+EE R RAK +   AK A+
Sbjct  425   DFISREKVDKAVREVLVGEEAEERRRRAKKLAVMAKSAV  463



>ref|XP_010447140.1| PREDICTED: UDP-glucosyl transferase 73B2 isoform X1 [Camelina 
sativa]
Length=483

 Score =   490 bits (1261),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 244/449 (54%), Positives = 319/449 (71%), Gaps = 15/449 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQME  254
             LHV FFP MA GHMIPT+DMAKLF+SRG K+TI+TTP N     K +D +  L  G +++
Sbjct  10    LHVIFFPFMADGHMIPTVDMAKLFSSRGAKSTILTTPLNAKFLQKPIDAFKNLNPGLEID  69

Query  255   IRLLEFPGVEVGLPESCQRLDQTPDDDGLPR-------FFKACAMlqppledllqelrpd  413
             I + +FP V++GLPE C+ +D    D+   R       FF +    +  LE LLQ  RPD
Sbjct  70    IMIFDFPCVQLGLPEGCENIDFFTGDNNADRQDHMTLKFFSSTRFFKDQLEKLLQTTRPD  129

Query  414   CLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNL  593
             CL+ADMFFPWAT AA KF++PRL+FHG  + +LC+++ +RV+ P N V+S  E F IP+L
Sbjct  130   CLIADMFFPWATEAAEKFNVPRLVFHGVGYFSLCSIYCMRVHNPQNTVASSCEPFVIPDL  189

Query  594   PHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVL  773
             P  + I+K Q++     + E+ M +FM  VR SE KS GV+ NSFYELEPDYA+ YK+ +
Sbjct  190   PGNIVISKDQIA---DCDGESEMGKFMTEVRESEVKSSGVVVNSFYELEPDYADFYKSFV  246

Query  774   GRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPS  953
              +R+W +GPLS+Y+R  E+KA RG K++IDE ECLKWLDSK P SV+YI FGSVA+F   
Sbjct  247   QKRSWHIGPLSVYSRGFEEKAGRGNKASIDEVECLKWLDSKKPGSVIYISFGSVASFKNE  306

Query  954   QLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILD  1133
             QL E+A G+E  G  F+WV+R    ++   E+W+ EGFEER KGKG+IIRGWAPQV+ILD
Sbjct  307   QLIEIAAGLEACGTSFIWVVRKSTGDE---EEWLLEGFEERVKGKGMIIRGWAPQVLILD  363

Query  1134  HPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL  1313
             H A G FVTHCGWNS LEGV  G+PMVTWPV AEQF NEKL+T +LRTG  VG+K+  R 
Sbjct  364   HQATGGFVTHCGWNSLLEGVAAGLPMVTWPVGAEQFYNEKLVTQVLRTGVSVGAKKHVRS  423

Query  1314  DSDGVKREAIAEAIKKVMIGEESEEMRSR  1400
               D + RE + +A+++V+ GEE+EE R R
Sbjct  424   TGDFISREKVDKAVREVLAGEEAEERRGR  452



>ref|XP_008236573.1| PREDICTED: scopoletin glucosyltransferase-like [Prunus mume]
Length=487

 Score =   490 bits (1261),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 238/440 (54%), Positives = 317/440 (72%), Gaps = 6/440 (1%)
 Frame = +3

Query  105   MAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIRLLEFPGVE  284
             M+HGHMIPT+DMAKLFAS+G+K TII+TP N  +FSKA+++    GF++ +  L+FP VE
Sbjct  1     MSHGHMIPTIDMAKLFASKGIKTTIISTPHNLSLFSKAIERSELSGFEIGVIALKFPAVE  60

Query  285   VGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFPWATNAAAK  464
             VGLPE C+        + L +F KA  +L   LE LL+E +P+CLVAD+FFPWAT+ AAK
Sbjct  61    VGLPEGCESAHMVETQEELQKFLKAATLLDQQLEQLLKEHQPNCLVADLFFPWATDVAAK  120

Query  465   FDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKLQVSPFERS  644
             F IPRL+FHGTS ++LC  H L   K    + SDSE   IPNLPH+ ++   Q+  F + 
Sbjct  121   FGIPRLVFHGTSFISLCVTHHL--MKMDLSIVSDSEPLVIPNLPHKHELAGNQIPDFMKQ  178

Query  645   EVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGPLSLYNRDV  824
             E E  +  F ++   SE KS+GV+ NSFYELEP YA+HY+N LG +AW +GP  L N+++
Sbjct  179   ESE--LGSFAKAAAESEWKSHGVLVNSFYELEPAYADHYRNFLGIKAWHIGPTFLCNKEI  236

Query  825   EDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGIEDSGMDFV  1004
             EDKA RG K+++DEHECLKWL SK P+SV+Y+ FGSV  F  +QL E+A+G+E SG  F+
Sbjct  237   EDKANRGPKASLDEHECLKWLSSKEPNSVIYVSFGSVVKFDDAQLLEIALGLEASGQQFI  296

Query  1005  WVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVTHCGWNSTL  1184
             WV++ ++ ++   E W+PEGFE+R +G+GL+IRGWAPQV IL+H A G FVTHCGWNST+
Sbjct  297   WVVKKEKSDEENKEDWLPEGFEDRVEGRGLVIRGWAPQVPILEHQATGGFVTHCGWNSTM  356

Query  1185  EGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGV--GSKEWKRLDSDGVKREAIAEAIK  1358
             E V  GVPM TWP FA+QF NEKL+T+IL  G  V  G+K+W R   D VK+  I +A+ 
Sbjct  357   EAVTAGVPMATWPAFADQFYNEKLVTEILGIGVRVVEGAKKWARFGGDRVKKVNIEKAVT  416

Query  1359  KVMIGEESEEMRSRAKVMKD  1418
             +VM+GEE+EEMR+R  V  D
Sbjct  417   EVMVGEEAEEMRTRQTVNTD  436



>gb|AID60125.1| UDP-glucosyl transferase 73B2 [Brassica napus]
 gb|AID60168.1| UDP-glucosyl transferase 73B2 [Brassica napus]
 emb|CDX75400.1| BnaA01g03020D [Brassica napus]
Length=486

 Score =   490 bits (1261),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 246/462 (53%), Positives = 327/462 (71%), Gaps = 16/462 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI-  257
             LHV FFP MA+GHMIPTLDMAKLF+S+GVK+TIITTP N  +F K +D +      +EI 
Sbjct  9     LHVMFFPYMAYGHMIPTLDMAKLFSSKGVKSTIITTPLNSKIFQKPIDVFKNQNPSLEII  68

Query  258   --RLLEFPGVEVGLPESCQRLD-----QTPDDDGLP-RFFKACAMlqppledllqelrpd  413
                + EFP V++GLPE C+ +D       P  + +  RF  +    +  LE LL+  RPD
Sbjct  69    DIHIFEFPCVQLGLPEGCENVDFFTSSNNPGRENIAFRFLSSTRFFKDQLEKLLETTRPD  128

Query  414   CLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNL  593
             CL+ADMFFPW+T  A K  +PRL+FHGT + +LCA + ++V+KP N V+S SE F IP+L
Sbjct  129   CLIADMFFPWSTQVAEKCHVPRLVFHGTGYFSLCANYCMKVHKPQNKVASSSEPFVIPDL  188

Query  594   PHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVL  773
             P +++IT+ Q+        E+ M++F+  VR SE KS GVI NSFYELEP+YA+ +K  +
Sbjct  189   PGDIEITREQII-----NSESEMAKFLLDVRESETKSTGVIVNSFYELEPEYADFFKRFV  243

Query  774   GRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPS  953
              +RAW +GPLS+ NR  E+KAERGKK+++DE EC+KWLDSK   SV+YI FGSVA F   
Sbjct  244   AKRAWQIGPLSITNRGFEEKAERGKKASVDESECIKWLDSKEKDSVIYISFGSVACFKNK  303

Query  954   QLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILD  1133
             QL E+A G+E SG  F+WV+R K   D+  E+W+PEGFEER KG+G+IIRGWAPQV+IL+
Sbjct  304   QLVEIAAGLEASGASFIWVVR-KSTGDDDKEEWLPEGFEERVKGRGMIIRGWAPQVLILE  362

Query  1134  HPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVG-SKEWKR  1310
             H A G FVTHCGWNS LEGV  G+PMVTWP+ AEQF NEKL+T +LRTG  VG +K  K 
Sbjct  363   HQATGGFVTHCGWNSLLEGVSAGLPMVTWPIGAEQFYNEKLVTQVLRTGVSVGATKHVKN  422

Query  1311  LDSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             +  + + RE + +A+++V+  EE+EE R R K + + AK A+
Sbjct  423   MGDEIISREKVEKAVREVLAWEEAEERRIRIKKLAEMAKAAV  464



>ref|XP_002518719.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43644.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=480

 Score =   489 bits (1259),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 245/474 (52%), Positives = 338/474 (71%), Gaps = 1/474 (0%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+F FP+MA GH +P LD+A+LFA RG K TIITTPAN P  +  +        Q+ ++
Sbjct  8     LHIFLFPLMASGHTLPFLDLARLFAQRGAKITIITTPANAPRIT-TIQTTKDSAAQISLK  66

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
             ++ FP  E GLPE  + LD   D     +FF A  +LQ PLE  +QEL P  +VAD+FFP
Sbjct  67    IINFPSKEAGLPEGIESLDMLSDYQLRGKFFAALTLLQEPLEQAIQELNPHAIVADVFFP  126

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT+ AAK+ IPRLIF  +S  +LC   +L  ++P  +VSSD+ELF++   P ++K T+ 
Sbjct  127   WATDLAAKYGIPRLIFQISSFFSLCCFANLEEHQPHKNVSSDTELFSLSGFPDQIKFTRS  186

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+      E  N     + S    E++SYGVI NS YELE  YA++Y+N LGRRAW +GP
Sbjct  187   QLPDSFTEENPNAFLRLIISTHEVEKRSYGVIVNSVYELELAYADYYRNTLGRRAWHIGP  246

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             +SL N++ ++K+ RGKKS+I E +C+KWLDSK P+SV+Y+ FG+V  F+ SQLHE+A+G+
Sbjct  247   VSLCNKNFQEKSHRGKKSSIGEDDCMKWLDSKKPNSVLYVSFGTVTKFSDSQLHEIAIGL  306

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E SG DF+WV+R +  E +  EKW+P+G+E+  +GKGLIIRGWAPQV+ILDH A+G FVT
Sbjct  307   EASGQDFIWVVRTEGTEKDNEEKWLPDGYEKGMEGKGLIIRGWAPQVLILDHGAIGGFVT  366

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREA  1340
             HCGWNSTLE +C G+PMVTWP+FA+QF NEKL+TDIL+ G GVG ++ K L  D V+ E 
Sbjct  367   HCGWNSTLESICAGLPMVTWPIFADQFFNEKLITDILKIGVGVGVQKSKALVGDYVESEK  426

Query  1341  IAEAIKKVMIGEESEEMRSRAKVMKDKAKKAIeeggssylglsslldelRAYHA  1502
             I +A+K++M+GE++EE R+RA    + A++AI +G SSY  L +L++ELR+Y A
Sbjct  427   IEKAVKEIMMGEKTEEFRTRANNFGEIARRAILDGASSYNDLGALIEELRSYQA  480



>gb|AFJ52945.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=492

 Score =   489 bits (1259),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 241/454 (53%), Positives = 319/454 (70%), Gaps = 4/454 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             L V FFP MA GHMIP +DMA+LFA RGVK+TIITTP N P+FS  + +    G Q++  
Sbjct  6     LQVVFFPFMAQGHMIPLVDMARLFARRGVKSTIITTPLNAPLFSDKIKRDADQGLQIQTH  65

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
             +++FP +E GLPE C+ ++     D L  FF +    + P+E+LL+  +PDC VAD+FF 
Sbjct  66    IIDFPFLEAGLPEGCENVNTIKSADMLLPFFMSMHAFKKPVEELLELWKPDCFVADLFFH  125

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             W T +A    IPRL F+GTS  A+C MH     +P+  V SDSE F +P LPH ++ TKL
Sbjct  126   WGTESAHSLGIPRLFFNGTSSFAICLMHCFTRQEPWKGVESDSEPFVMPGLPHRIEFTKL  185

Query  621   QVSPFERSE-VENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
             Q+ PF + E +     E    +  SEEKS+G + NSF+ELEP Y+EHYK V+GR+AW +G
Sbjct  186   QLPPFWKGEGITEEWLEMRDLINESEEKSFGAVVNSFHELEPGYSEHYKEVVGRKAWFIG  245

Query  798   PLSLYNRD-VEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAM  974
             PLSL N+D   +KAERGK +AID HECL+WLD + PHSV+YICFGS+++   +QL E+A 
Sbjct  246   PLSLSNKDSTLEKAERGKTAAIDGHECLRWLDCREPHSVLYICFGSMSDIPNAQLFEIAS  305

Query  975   GIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAF  1154
              +E S   F+WV++ +  ++   E W+PEGFEER +G+GLIIRGWAPQV+ILDH A G F
Sbjct  306   ALEASVQGFIWVVKKENSKEKKGE-WLPEGFEERMEGRGLIIRGWAPQVLILDHQATGGF  364

Query  1155  VTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSD-GVK  1331
             +THCGWNSTLEGV  GVPMVTWP+ AEQF+N +L+TD+LR G G+G +EW R D +  V 
Sbjct  365   MTHCGWNSTLEGVVAGVPMVTWPLGAEQFLNGRLVTDVLRVGVGIGPQEWSRNDREIMVG  424

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKA  1433
             RE I  A+++VM+GE +EEMR RA  +K KA K 
Sbjct  425   REDIERAVRQVMVGEHAEEMRERAMELKVKAVKG  458



>emb|CDY65497.1| BnaCnng47320D [Brassica napus]
Length=490

 Score =   489 bits (1258),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 244/461 (53%), Positives = 327/461 (71%), Gaps = 16/461 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQME--  254
             LH+F FP MAHGHMIPTLDMAKLF+++G K+TI+TTP N  +  K +  + +    +E  
Sbjct  7     LHIFLFPYMAHGHMIPTLDMAKLFSTKGAKSTILTTPLNAKILEKPIKSFNEDNPGLEDI  66

Query  255   -IRLLEFPGVEVGLPESCQRLD---QTPD---DDGLPRFFKACAMlqppledllqelrpd  413
              I +L FP  E+GLP+ C+  D     PD    D   +F  +    +  LE LL+ +RPD
Sbjct  67    TIHILHFPCTELGLPQGCENTDFFFSNPDLNTGDLNRKFLLSMEYFKEQLEQLLETVRPD  126

Query  414   CLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNL  593
             CLVA+MF PWAT  A KF +PRL+FHGT + +LCA H LR++KP+ +V+S SE F IP L
Sbjct  127   CLVANMFLPWATKLAEKFGVPRLVFHGTGYFSLCASHCLRLHKPYKNVASSSEPFVIPEL  186

Query  594   PHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVL  773
             P ++ IT+ QV      E E+ M +FM+ +R SE  S+GV+ NSF+ELEP Y++ YK+ +
Sbjct  187   PGDIVITEEQVI---EKEAESVMGKFMKELRDSERSSFGVLVNSFHELEPAYSDFYKSSV  243

Query  774   GRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPS  953
              +RAWS+GPLSL NR+ ++KAERGKK++IDEH+CLKWLDSK   SV+Y+ FG++ +F   
Sbjct  244   AKRAWSIGPLSLGNREFKEKAERGKKASIDEHKCLKWLDSKRCESVIYLSFGTMLSFNNE  303

Query  954   QLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILD  1133
             QL E+A G++ SG DF+WV+ NK       E+W+PEGFEE+ KG+GLIIRGWAPQVVILD
Sbjct  304   QLVEIAAGLDMSGHDFIWVV-NKSGSQGDKEEWLPEGFEEKMKGRGLIIRGWAPQVVILD  362

Query  1134  HPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL  1313
             H AVG F+THCGWNS LEGV  G+PMVTWP+ AEQF NEKL+T +L+TG  VG K+  + 
Sbjct  363   HQAVGGFLTHCGWNSLLEGVASGLPMVTWPIGAEQFYNEKLVTQVLKTGVSVGVKKMMKP  422

Query  1314  DSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             D D + +E + +A+++VM G   EEMR RAK + D AK A+
Sbjct  423   DGDFITKERVEKAVREVMAG---EEMRKRAKQLADMAKDAV  460



>ref|XP_004305939.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Fragaria vesca subsp. vesca]
Length=483

 Score =   488 bits (1257),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 236/457 (52%), Positives = 325/457 (71%), Gaps = 7/457 (2%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH+FF P MA GH +P +D+AKLFASRGVK TI+TT AN P+ S+A+      GF++++
Sbjct  8     QLHIFFLPFMAPGHTLPLIDIAKLFASRGVKCTIVTTHANAPIISQAIKTSIGFGFEIKL  67

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              L++FP  EVGL E  + +      +      KA  +LQ  +E +L +  P CLVAD  F
Sbjct  68    VLIKFPSTEVGLHEGIESIKLEKTKEMRKGLVKATTLLQQQVEQVLDQHHPHCLVADFLF  127

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
              WAT+ AAKF+IPRL+FHGT   ALCA+ S+ +Y+P   VSSDSE F IP+LP+E+K+T+
Sbjct  128   HWATDVAAKFEIPRLVFHGTGFFALCALKSIMLYQPHLKVSSDSESFVIPSLPNEIKMTR  187

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
              ++ PF     +  + + ++  R +EE+SYG+I NSFYELEPDYA+HY+ VLG+++W +G
Sbjct  188   NKLVPFLTLNGKTELIKLIKLSREAEERSYGIIVNSFYELEPDYADHYRKVLGKKSWHIG  247

Query  798   PLSLYNRDVEDKAERGKKSAIDE-HECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAM  974
             P+SL N    D++ERG +  +DE  ECL WL+SKN +SVVYICFG++  F+ SQL E+A 
Sbjct  248   PVSLCNNVEIDRSERGTEGLVDEAKECLNWLNSKNLNSVVYICFGTMTKFSDSQLVEIAY  307

Query  975   GIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAF  1154
             G+E SG  F+WV+   ++E N  E W+PEGFE+R KG+GLIIRGWAPQ++IL H A+GAF
Sbjct  308   GLEASGQQFIWVV---KKEKNDKEAWLPEGFEQRVKGEGLIIRGWAPQLLILQHEAIGAF  364

Query  1155  VTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWK--RLDSDG-  1325
             +THCGWNS LEGV  GVPM+TWPV AEQF NEKL+T IL  G  VG++ W+   L S+  
Sbjct  365   LTHCGWNSILEGVSAGVPMITWPVSAEQFYNEKLVTQILGIGVPVGAQNWEDGSLQSEAS  424

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VKREAI +A+ + M+G + EEMR+R   + + A++A+
Sbjct  425   VKREAIEKAVTEFMVGNKQEEMRTRVLALGEMARRAV  461



>ref|XP_010526965.1| PREDICTED: UDP-glucosyl transferase 73B2-like [Tarenaya hassleriana]
Length=493

 Score =   489 bits (1258),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 254/460 (55%), Positives = 328/460 (71%), Gaps = 12/460 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQME  254
             LHVFFFP MAHGHMIPTLDMAKLFASRGVK+TI+TTP N P+F + ++ +        + 
Sbjct  9     LHVFFFPFMAHGHMIPTLDMAKLFASRGVKSTILTTPLNAPIFQRPIEAFKNKNPDSDIG  68

Query  255   IRLLEFPGVEVGLPESCQRLDQTPDD---DGLP---RFFKACAMlqppledllqelrpdC  416
             I +L FP  E+GLPE C+ +D    +   D  P   + F +   L+  LE L++  RPDC
Sbjct  69    IEILNFPCPELGLPEGCESVDFIHSNFTGDIFPMVQKLFFSTKFLKDQLEHLIETARPDC  128

Query  417   LVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLP  596
             LVADMFFPWAT+A+ KF +PRL+FHGT + AL A + +R++KP   V+S SE F IP+LP
Sbjct  129   LVADMFFPWATDASEKFGVPRLVFHGTCYFALSASYCIRLHKPHKKVASSSERFVIPDLP  188

Query  597   HELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
               + IT  QV   + +E ++ M +FM+ V+ SE+ SYGV+ N+FYELE DYA+ YK  + 
Sbjct  189   GNIVITADQV--MDHNE-DSEMGKFMKEVKDSEKLSYGVLMNTFYELESDYADFYKRFVA  245

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             +RAW+VGPLSL NR  E+KAERGKK++IDEHECLKWLDSK P SV+Y+ FGS+A F   Q
Sbjct  246   KRAWNVGPLSLCNRGFEEKAERGKKASIDEHECLKWLDSKEPESVIYVSFGSMAKFTNEQ  305

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A G+E SG DF+WV+  K       E+W+PEG+EER KGKGLIIRGWAPQ++ILDH
Sbjct  306   LKEIAAGLEGSGQDFIWVVM-KNGGKGEKEEWLPEGYEERIKGKGLIIRGWAPQMLILDH  364

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD  1316
              A+G FVTHCGWNS LEGV  G+PMVTWPV AEQF NEKL+T +L+TG  VG ++W    
Sbjct  365   QAIGGFVTHCGWNSVLEGVAAGLPMVTWPVGAEQFYNEKLITQVLKTGVRVGERKWVNFV  424

Query  1317  SDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              D   R+ + +A+K VM+GE +EE R RAK +   AK  +
Sbjct  425   GDFTGRDKVEKAVKAVMVGEAAEERRRRAKELAQMAKATV  464



>ref|XP_003518710.1| PREDICTED: UDP-glucosyl transferase 73B2-like [Glycine max]
Length=475

 Score =   488 bits (1256),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 240/457 (53%), Positives = 332/457 (73%), Gaps = 14/457 (3%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
             +LHV FFP  A+GH+IP++D+A++FASRG+K T++TTP N P+ S+ + K       ++I
Sbjct  7     ELHVLFFPFPANGHIIPSIDLARVFASRGIKTTVVTTPLNVPLISRTIGKA-----NIKI  61

Query  258   RLLEFPG-VEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMF  434
             + ++FP   E GLPE C+  D     D +  F KA  +L+ PLE+L+Q+  PDC++ADMF
Sbjct  62    KTIKFPSHEETGLPEGCENSDSALSSDLIMTFLKATVLLRDPLENLMQQEHPDCVIADMF  121

Query  435   FPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKIT  614
             +PWAT++AAKF IPR++FHG      C    +R YKP ++VSS SE F +P LP E+ IT
Sbjct  122   YPWATDSAAKFGIPRVVFHGMGFFPTCVSACVRTYKPQDNVSSWSEPFAVPELPGEITIT  181

Query  615   KLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSV  794
             K+Q+   +  + +   ++ +  V  SE KS+GVI NSFYELEP YA+ Y+  LGRRAW +
Sbjct  182   KMQLP--QTPKHDEVFTKLLDEVNASELKSHGVIANSFYELEPVYADFYRKELGRRAWHL  239

Query  795   GPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAM  974
             GP+ L NRD E+KA RG+++AIDEHECLKWLDSK P+SVVY+CFGS+  F+ +QL E+A+
Sbjct  240   GPVCLSNRDAEEKACRGREAAIDEHECLKWLDSKEPNSVVYLCFGSMTAFSDAQLKEIAL  299

Query  975   GIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERT--KGKGLIIRGWAPQVVILDHPAVG  1148
             G+E SG +F+WV++    E     +W+PEGFEER   +GKGLIIRGWAPQV+ILDH +VG
Sbjct  300   GLEASGQNFIWVVKKGLNE---KLEWLPEGFEERILGQGKGLIIRGWAPQVMILDHESVG  356

Query  1149  AFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEW-KRLDSDG  1325
              FVTHCGWNS LEGVC GVPMVTWP++AEQF N K +TDI++ G  VG + W   +  D 
Sbjct  357   GFVTHCGWNSVLEGVCAGVPMVTWPMYAEQFYNAKFLTDIVKIGVSVGVQTWIGMMGRDP  416

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VK+E + +A++++M+GEE+EEMR+RAK +   AK+A+
Sbjct  417   VKKEPVEKAVRRIMVGEEAEEMRNRAKELARMAKRAV  453



>emb|CDX69029.1| BnaC01g04240D [Brassica napus]
Length=495

 Score =   488 bits (1257),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 242/470 (51%), Positives = 333/470 (71%), Gaps = 16/470 (3%)
 Frame = +3

Query  54    SSKDFAMGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYT  233
             +S + A   LH+FFFP MAHGHMIPTLDMAKLFA++G K+TI+TTP N  +F K ++ + 
Sbjct  3     TSDEAAASKLHIFFFPYMAHGHMIPTLDMAKLFATKGAKSTILTTPLNSKLFEKPINSFN  62

Query  234   QLGFQME---IRLLEFPGVEVGLPESCQRLDQTPDDDGLPR------FFKACAMlqpple  386
                 ++E   +++L FP  E+GLPE C+  D    +  L +      F  A    +  LE
Sbjct  63    DENPELEDIKLQILNFPCTELGLPEGCENTDFIFSNHDLTKGNLNMKFLLAMEYFKEQLE  122

Query  387   dllqelrpdCLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSD  566
             +LL+ ++PDCLV +MFFPWAT  A KF++PRL+FHGT + +LCA H LR++KP+ +V+S 
Sbjct  123   ELLETVKPDCLVGNMFFPWATKVAEKFNVPRLVFHGTGYFSLCASHCLRLHKPYKNVASS  182

Query  567   SELFTIPNLPHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPD  746
             SE F IP LP ++ IT  QV   E+ E E+ M +FM+ +R SE  S+GV+ NSFY+LEP 
Sbjct  183   SEPFVIPELPGDVVITDEQV--IEKEE-ESVMGKFMKDIRDSERDSFGVLVNSFYDLEPA  239

Query  747   YAEHYKNVLGRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICF  926
             YA+ +K  + +R+W +GPLSL NR+ ++KAERGKK++IDEHECLKWLD+K   SV+Y+ F
Sbjct  240   YADFFKTHVAKRSWDIGPLSLGNREFKEKAERGKKASIDEHECLKWLDTKRCESVIYLSF  299

Query  927   GSVANFAPSQLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRG  1106
             G++++F   QL E+A G+E SG DFVWV+ N+        +W+PEG+EERTKG+GLIIRG
Sbjct  300   GTMSSFDDEQLMEIAAGLEMSGHDFVWVV-NRSGSQGEKVEWLPEGYEERTKGQGLIIRG  358

Query  1107  WAPQVVILDHPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTG  1286
             WAPQV+ILDH A+G F+THCGWNS LEG   G+PMVTWP+ AEQF NEKL+T +L+TG  
Sbjct  359   WAPQVLILDHQAIGGFLTHCGWNSLLEGAASGLPMVTWPIGAEQFYNEKLVTQVLKTGVS  418

Query  1287  VGSKEWKRLDSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VG K+  +   D + RE +  A+++VM+G   +EMR RAK +   AK A+
Sbjct  419   VGVKKMVKGSGDFISREKVDIAVREVMVG---DEMRKRAKQLAVMAKDAV  465



>sp|Q2V6J9.1|UFOG7_FRAAN RecName: Full=UDP-glucose flavonoid 3-O-glucosyltransferase 7; 
AltName: Full=Flavonol 3-O-glucosyltransferase 7; Short=FaGT7 
[Fragaria x ananassa]
 gb|ABB92749.1| UDP-glucose glucosyltransferase [Fragaria x ananassa]
Length=487

 Score =   488 bits (1255),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 254/464 (55%), Positives = 332/464 (72%), Gaps = 26/464 (6%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FF P MA GH IP  D+AKLF+S G + TI+TTP N P+FSKA    TQ G ++E+ 
Sbjct  11    LHIFFLPFMARGHSIPLTDIAKLFSSHGARCTIVTTPLNAPLFSKA----TQRG-EIELV  65

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
             L++FP  E GLP+ C+  D     D L +F KA  +++P  E +L E RP CLVAD FF 
Sbjct  66    LIKFPSAEAGLPQDCESADLITTQDMLGKFVKATFLIEPHFEKILDEHRPHCLVADAFFT  125

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT+ AAKF IPRL FHGT   ALCA  S+ +Y+P +++SSDSE F IPNLP E+K+T+ 
Sbjct  126   WATDVAAKFRIPRLYFHGTGFFALCASLSVMMYQPHSNLSSDSESFVIPNLPDEIKMTRS  185

Query  621   QVSPFERSEVENTMSEFMRSVRGS---EEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             Q+  F         SEFM+ ++ S   EE+SYGVI NSFYELEP YA HY+ V GR+AW 
Sbjct  186   QLPVFPDE------SEFMKMLKASIEIEERSYGVIVNSFYELEPAYANHYRKVFGRKAWH  239

Query  792   VGPLSLYNRDVEDKAERG--KKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHE  965
             +GP+S  N+ +EDKAERG  K S  ++HECLKWLDSK P SVVY+ FGS+  FA SQL E
Sbjct  240   IGPVSFCNKAIEDKAERGSIKSSTAEKHECLKWLDSKKPRSVVYVSFGSMVRFADSQLLE  299

Query  966   MAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAV  1145
             +A G+E SG DF+WV++ +++E    E+W+PEGFE+R +GKGLIIR WAPQV+IL+H A+
Sbjct  300   IATGLEASGQDFIWVVKKEKKE---VEEWLPEGFEKRMEGKGLIIRDWAPQVLILEHEAI  356

Query  1146  GAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWK------  1307
             GAFVTHCGWNS LE V  GVPM+TWPVF EQF NEKL+T+I R G  VGS++W       
Sbjct  357   GAFVTHCGWNSILEAVSAGVPMITWPVFGEQFYNEKLVTEIHRIGVPVGSEKWALSFVDV  416

Query  1308  RLDSDG-VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
               +++G V+REAI EA+ ++M+G+E+ E RSR K + + A++A+
Sbjct  417   NAETEGRVRREAIEEAVTRIMVGDEAVETRSRVKELGENARRAV  460



>gb|AFJ52929.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=495

 Score =   487 bits (1254),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 252/463 (54%), Positives = 325/463 (70%), Gaps = 14/463 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQ-LGFQMEI  257
             LHVFFFP +AHGHMIP +DMAK+FASRGVK TI+TTP N P FSK + K+++  G ++ I
Sbjct  13    LHVFFFPFLAHGHMIPAIDMAKIFASRGVKVTIVTTPLNVPFFSKTISKHSESTGSEIRI  72

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDD----GLPRFFKACAMlqppledllqelrpdCLVA  425
             + L+FP  E GLPE C+  +     +       +FF A   LQ  LE LL+E RPDCLVA
Sbjct  73    QTLKFPTTEFGLPEGCENAEVITSMNLGWETFSKFFLASTKLQESLEKLLEEDRPDCLVA  132

Query  426   DMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPN-LPHE  602
             DMFFPWAT+++ KF IPRL+FHGTS  +L  M  L  Y+P  DVSSD+E F +P  LP +
Sbjct  133   DMFFPWATDSSEKFGIPRLLFHGTSFFSLTVMDVLSRYEPHKDVSSDTEPFEVPGGLPDK  192

Query  603   LKITKLQV--SPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
             + +TK Q+  S     + +  M EF + VR S  + YG + NSFYELEP Y ++Y+NV  
Sbjct  193   IMLTKRQLPASAVATGQGDTFMWEFFKKVRESNSQGYGTVVNSFYELEPGYVDYYRNVFQ  252

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             R+AW +GP+SL N DV+DKA RGK+S+ID   CL WLDSK P SVVYICFGSVANF+  Q
Sbjct  253   RKAWHIGPVSLCNADVDDKANRGKESSIDWDYCLNWLDSKEPKSVVYICFGSVANFSAEQ  312

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A+GIE S   F+WV+R  R  +   E W+PEGFEERTK +G+IIRGWAPQV+IL+H
Sbjct  313   LKEIAIGIEASDQKFIWVVRKNRRNNGDVEDWLPEGFEERTKSRGIIIRGWAPQVLILEH  372

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD  1316
              A+GA VTHCGWNSTLE +  G+PMVTWPV AEQF NEKL+T +++ G GVG+ +     
Sbjct  373   VAIGAIVTHCGWNSTLEAISAGLPMVTWPVMAEQFYNEKLVTHVVKIGVGVGAAQLPLGT  432

Query  1317  S-DGVKREAIAEAIKKVMIGEESE--EMRSRAKVMKDKAKKAI  1436
             + +GVK E    AIK++M  ++ E  +MRSRAK +   A+KA+
Sbjct  433   TIEGVKVE---RAIKRIMSTDDEEVAKMRSRAKYLGHMARKAV  472



>gb|KCW55160.1| hypothetical protein EUGRSUZ_I01115 [Eucalyptus grandis]
Length=465

 Score =   486 bits (1250),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 230/439 (52%), Positives = 312/439 (71%), Gaps = 2/439 (0%)
 Frame = +3

Query  120   MIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIRLLEFPGVEVGLPE  299
             MIP +DMAKLFA RG K+T+I TP ++P F K++ K    GF +++  +  P  +VGLPE
Sbjct  1     MIPMIDMAKLFAMRGCKSTLIATPHDEPTFLKSIAKPRDSGFDIDVVTVSLPLKDVGLPE  60

Query  300   SCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFPWATNAAAKFDIPR  479
              C  L++    D   +F +A  ML   LE L+++L PDCL++DMF PW T  AAK  IPR
Sbjct  61    DCDNLNKAATMDMHRQFMRAVMMLDRQLELLIEKLAPDCLISDMFLPWTTEIAAKCGIPR  120

Query  480   LIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKLQVSPFERSEVENT  659
             L+FHGTS  ++     +R+Y+P   V  DSE F IPN P E+ ++++Q+  F R E E T
Sbjct  121   LVFHGTSAFSVGGTECVRLYEPHKKVLCDSEPFVIPNFPGEITLSRMQLQDFVREETEFT  180

Query  660   MSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGPLSLYNRDVEDKAE  839
               +F   V+ SE++S+GV+ NSFYELEP YA+HY   LGRR+W +GPLSL N ++EDKA 
Sbjct  181   --KFYAQVKESEKRSFGVVMNSFYELEPAYAKHYSTFLGRRSWFIGPLSLCNEEIEDKAH  238

Query  840   RGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGIEDSGMDFVWVIRN  1019
             RG +++ID+HECLKWLDSK P+SV+YICFGS+ANF  +QLHE+A+G+E SG  F+WV++ 
Sbjct  239   RGSQASIDQHECLKWLDSKQPNSVIYICFGSMANFNAAQLHEIAVGLEASGQQFIWVVKK  298

Query  1020  KREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVTHCGWNSTLEGVCG  1199
                 + G E+W+P+G+E R + KGLIIRGWAPQV+ILD+ A+G FVTHCGWNS LE +  
Sbjct  299   DPIVEEGKEEWLPDGYESRIRNKGLIIRGWAPQVLILDNEAIGGFVTHCGWNSILEAITA  358

Query  1200  GVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREAIAEAIKKVMIGEE  1379
             GVPMVTWPV AEQF NEKL+T +L+ G  VG K W R   D VK + + EA+K+V++GEE
Sbjct  359   GVPMVTWPVAAEQFYNEKLVTRVLQIGVNVGVKRWVRYFGDSVKSDRVVEAVKRVLVGEE  418

Query  1380  SEEMRSRAKVMKDKAKKAI  1436
             + EMR R K + + A+ A+
Sbjct  419   AGEMRRRTKALSEMARGAV  437



>ref|XP_004304024.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Fragaria vesca subsp. vesca]
Length=483

 Score =   486 bits (1251),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 237/458 (52%), Positives = 327/458 (71%), Gaps = 8/458 (2%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASR-GVKATIITTPANQPVFSKAVDKYTQLGFQME  254
              LH+FF P M  GH +P LD+AKLFASR GVK+TIITTP N P+FS +++     GF++E
Sbjct  8     QLHIFFLPYMVQGHTLPLLDIAKLFASRSGVKSTIITTPVNAPLFSNSIETSKSSGFEIE  67

Query  255   IRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMF  434
             + +++FP  EVGLP+  + +      +   +F+KA   L+  +E LL + RP CLVA   
Sbjct  68    LVIIKFPSTEVGLPDGIENMKLVKTQETKEKFYKAITALEHQVEQLLDQHRPHCLVASTL  127

Query  435   FPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKIT  614
             F WATN AAKF IPRLIFHG     LCA  S+ +Y+P   VSSDSE F IPNLPHE+K T
Sbjct  128   FHWATNVAAKFGIPRLIFHGPGFFPLCAARSVTLYQPHLKVSSDSESFVIPNLPHEIKTT  187

Query  615   KLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSV  794
             + ++  F     E  + + + + R +EE+S+G+I NSFYELEPDYA+HY+ VLG+++W +
Sbjct  188   RNELPTFLTQNGETGLYKLLETCREAEERSFGIIVNSFYELEPDYADHYRKVLGKKSWHI  247

Query  795   GPLSLYNRDVEDKAERGKKSAIDE-HECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             GP+SL N++ +D + RG + ++DE HECL WL SK  +SVVYICFGS+++F+  QL E+A
Sbjct  248   GPVSLCNKEEKDISGRGAEGSVDEVHECLNWLSSKKANSVVYICFGSLSSFSDFQLLEIA  307

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             +G+E SG  F+WV+   ++E+N  E+W+PEGFE+R KGKGLIIRGWAPQ++IL H AVGA
Sbjct  308   IGLEASGQQFIWVV---KKENNDKEEWLPEGFEQRMKGKGLIIRGWAPQLLILQHEAVGA  364

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSK--EWKRLDSDG  1325
             F+THCGWNS LEGV  GVPM+TWPVFA+QF NEKL+T IL  G  VG++  E  R+ ++ 
Sbjct  365   FLTHCGWNSILEGVSAGVPMITWPVFADQFNNEKLVTQILGIGVAVGAQKSEDGRVKTEA  424

Query  1326  -VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              VK EAI +A+ + M G+E++ MR +A  + + A+ A+
Sbjct  425   SVKSEAIKKAVTETMDGDEADGMRRKAFALGETARMAV  462



>ref|XP_004304021.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Fragaria vesca subsp. vesca]
Length=487

 Score =   486 bits (1252),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 254/464 (55%), Positives = 331/464 (71%), Gaps = 26/464 (6%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+FF P MA GH IP  D+AKLF+S G + TI+TTP N P+FSKA    TQ G ++E+ 
Sbjct  11    LHIFFLPFMARGHSIPLTDIAKLFSSHGARCTIVTTPLNAPLFSKA----TQRG-EIELV  65

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
             L++FP  E GLP+ C+  D     D L +F KA  +++P  E +L E RP CLVAD FF 
Sbjct  66    LIKFPSAEAGLPQDCESADLITTQDMLGKFVKATFLIEPHFEKILDEHRPHCLVADAFFT  125

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT+ AAKF IPRL FHGT   ALCA  S+ +Y+P +++SSDSE F IPNLP E+K+T+ 
Sbjct  126   WATDVAAKFRIPRLYFHGTGFFALCASLSVMMYQPHSNLSSDSESFVIPNLPDEIKMTRS  185

Query  621   QVSPFERSEVENTMSEFMRSVRGS---EEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             Q+  F         SEFM+ ++ S   EE+SYGVI NSFYELEP YA HY+ V GR+AW 
Sbjct  186   QLPVFPDE------SEFMKMLKASIEIEERSYGVIVNSFYELEPAYANHYRKVFGRKAWH  239

Query  792   VGPLSLYNRDVEDKAERG--KKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHE  965
             +GP+S  N+ +EDKAERG  K S  ++HECLKWLDSK P SVVY+ FGS+  FA SQL E
Sbjct  240   IGPVSFCNKAIEDKAERGSIKSSTAEKHECLKWLDSKKPRSVVYVSFGSMVRFADSQLLE  299

Query  966   MAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAV  1145
             +A G+E SG DF+WV++ +++E    E+W+PEGFE+R  GKGLIIR WAPQV+IL+H A+
Sbjct  300   IATGLEASGQDFIWVVKKEKKE---VEEWLPEGFEKRMDGKGLIIRDWAPQVLILEHEAI  356

Query  1146  GAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWK------  1307
             GAFVTHCGWNS LE V  GVPM+TWPVF EQF NEKL+T+I R G  VGS++W       
Sbjct  357   GAFVTHCGWNSILEAVSAGVPMITWPVFGEQFYNEKLVTEIHRIGVPVGSEKWAFSFVDV  416

Query  1308  RLDSDG-VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
               +++G V+REAI EA+ ++M+G+E+ E RSR K + + A++A+
Sbjct  417   NAETEGRVRREAIEEAVTRIMVGDEAVETRSRVKELGENARRAV  460



>emb|CDY65498.1| BnaCnng47330D [Brassica napus]
Length=483

 Score =   486 bits (1250),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 244/461 (53%), Positives = 326/461 (71%), Gaps = 15/461 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQME  254
             LHV FFP MA+GHMIPTLDMAKL +SRG K+TIITTP N  +  K +D +  L     ++
Sbjct  10    LHVMFFPFMAYGHMIPTLDMAKLLSSRGAKSTIITTPLNSRILQKPIDVFKNLNPNLDID  69

Query  255   IRLLEFPGVEVGLPESCQRLDQTPDDDGLP------RFFKACAMlqppledllqelrpdC  416
             I + +FP VE+GLPE C+ +D    +  +       +FF + +  +  LE LL++ RPDC
Sbjct  70    IEIFDFPCVELGLPEGCENVDFFTSNTNVDSNYMAFKFFMSTSFFKDQLEVLLKKTRPDC  129

Query  417   LVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLP  596
             L+ADMFFPWAT AA K  +PRL+FHGT + +LCA + ++++KP N V+S  E F IP LP
Sbjct  130   LIADMFFPWATEAAEKSHVPRLVFHGTGYFSLCAGYCIKMHKPQNKVASSCEPFVIPELP  189

Query  597   HELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
              ++ IT+ Q+      + E+ M +FM  VR SE KS GV+ NSFYELEPD+A+ YK  + 
Sbjct  190   GDIVITQEQIID---GDNESEMGKFMIDVRESELKSSGVVVNSFYELEPDHADFYKRFVA  246

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             +RAW +GPLS+ NR  E+KAERGKK++IDE ECLKWLDSK   SV+YI FGSVA F   Q
Sbjct  247   KRAWHIGPLSVINRGFEEKAERGKKASIDEAECLKWLDSKEQDSVIYISFGSVACFKNKQ  306

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A+G+E SG +F+WV+   RE  +  E+W+ EG EER K +G+IIRGWAPQV+IL+H
Sbjct  307   LREIALGLEASGTNFIWVV---RENTDDKEEWLQEGVEERLKERGMIIRGWAPQVLILEH  363

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVG-SKEWKRL  1313
              A G FVTHCGWNS LEGV  G+PMVTWP+ AEQF NEKL+T +LRTG  VG +K  K +
Sbjct  364   QATGGFVTHCGWNSLLEGVAAGLPMVTWPIGAEQFYNEKLVTQVLRTGVNVGATKHVKAM  423

Query  1314  DSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + D + RE + +A+++V++G E+EE R RAK + + AK A+
Sbjct  424   EDDIISREKVEKAVREVLVGVEAEERRKRAKKLAEMAKAAV  464



>ref|XP_010530759.1| PREDICTED: UDP-glucosyl transferase 73B2-like [Tarenaya hassleriana]
Length=492

 Score =   486 bits (1250),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 253/470 (54%), Positives = 336/470 (71%), Gaps = 12/470 (3%)
 Frame = +3

Query  51    VSSKDFAMGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKY  230
             ++S+  A   LHVFFFP MA+GHMIPTLDMAKLFASRG+K+TI+ T  N P+F K V+ +
Sbjct  1     MASESEAPRQLHVFFFPFMAYGHMIPTLDMAKLFASRGIKSTILITHPNVPIFQKPVEVF  60

Query  231   TQLGFQMEI--RLLEFPGVEVGLPESCQR---LDQTPDDDGLP---RFFKACAMlqpple  386
                    EI  R+L+FP  E+GLP+       LD    +D  P   + F +   L+  LE
Sbjct  61    KNKNPNAEIGIRVLDFPCTELGLPQGSDNADFLDSAVIEDIFPIVQKLFFSTKFLKNQLE  120

Query  387   dllqelrpdCLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSD  566
             DL++  RPDCLVADMFFPWAT A+ KF +PRL+FHGT + +LC  + +R++KP  +V+S 
Sbjct  121   DLIETFRPDCLVADMFFPWATEASKKFGVPRLVFHGTCYFSLCVSYCIRLHKPQKNVASS  180

Query  567   SELFTIPNLPHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPD  746
             SE F IP+LP ++ IT  QV+    ++ ++ M EF+  VR SE+ SYGV+ N+F+ELEP 
Sbjct  181   SEPFVIPHLPGDIVITADQVT---DNDEDDEMGEFITEVRDSEKLSYGVLMNTFHELEPA  237

Query  747   YAEHYKNVLGRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICF  926
             YA+ YK  + + +W++GPLSL NR  E+KAERGKK +IDEHECLKWLDSK P SV+Y+ F
Sbjct  238   YADFYKKFVAKSSWNIGPLSLCNRGFEEKAERGKKVSIDEHECLKWLDSKRPDSVIYLSF  297

Query  927   GSVANFAPSQLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRG  1106
             GSVA F+  QL E+A G+E SG DF+WV+R K ++    E+W+PEGFEERT+GKG+IIRG
Sbjct  298   GSVAKFSNDQLKEIAAGLEASGHDFIWVVR-KSDDKGEKEEWLPEGFEERTRGKGMIIRG  356

Query  1107  WAPQVVILDHPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTG  1286
             WAPQV+ILDH A G FVTHCGWNS LEGV  G+PMVTWPV AEQF NEKL+T +L+TG  
Sbjct  357   WAPQVLILDHQATGGFVTHCGWNSVLEGVAAGLPMVTWPVAAEQFYNEKLITQVLKTGLS  416

Query  1287  VGSKEWKRLDSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VG ++W     D   R+ + +A++ +MIGE +EE R RAK + D A+ ++
Sbjct  417   VGERKWVDFAGDFTGRDRVEKAVRDLMIGEAAEERRRRAKELGDMARGSV  466



>ref|XP_009116435.1| PREDICTED: UDP-glycosyltransferase 73B1 [Brassica rapa]
 ref|XP_009116653.1| PREDICTED: UDP-glycosyltransferase 73B1-like [Brassica rapa]
Length=495

 Score =   486 bits (1250),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 243/465 (52%), Positives = 329/465 (71%), Gaps = 16/465 (3%)
 Frame = +3

Query  69    AMGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQ  248
             A   LH+FFFP MAHGHMIPTLDMAKLFA++G K+TI+TTP N  +F K ++ +     +
Sbjct  8     AASKLHIFFFPYMAHGHMIPTLDMAKLFATKGAKSTILTTPLNSKLFEKPINSFNDENPE  67

Query  249   ME---IRLLEFPGVEVGLPESCQRLDQTPDDDGLPR------FFKACAMlqppledllqe  401
             +E   +++L FP  E+GLPE C+  D    +  L +      F  A    +  LE+LL+ 
Sbjct  68    LEDIKLQILNFPCTELGLPEGCENTDFIFSNHDLTKGNLNMKFLLAMEYFKEQLEELLET  127

Query  402   lrpdCLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFT  581
             ++PDCLV +MFFPWAT  A KF++PRL+FHGT + +LCA H LR++KP+ +V+S SE F 
Sbjct  128   VKPDCLVGNMFFPWATKVAEKFNVPRLVFHGTGYFSLCASHCLRLHKPYKNVASSSEPFV  187

Query  582   IPNLPHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHY  761
             IP LP ++ IT  QV   E+ E E+ M +FM+ +R SE  S+GV+ NSFY+LEP YA+ +
Sbjct  188   IPELPGDVVITDEQV--IEKEE-ESVMGKFMKDIRDSERDSFGVLVNSFYDLEPAYADFF  244

Query  762   KNVLGRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVAN  941
             K  + +RAW +GPLSL NR+ ++KAERGKK++IDEHE LKWLDSK   SV+Y+ FG++++
Sbjct  245   KTHVAKRAWDIGPLSLGNREFKEKAERGKKASIDEHEYLKWLDSKRCESVIYLSFGTMSS  304

Query  942   FAPSQLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQV  1121
             F   QL E+A G+E SG DFVWV+ N+        +W+PEGFEERTKG+GLIIRGWAPQV
Sbjct  305   FDDEQLIEIAAGLEMSGHDFVWVV-NRSGSQGEKVEWLPEGFEERTKGQGLIIRGWAPQV  363

Query  1122  VILDHPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKE  1301
             +ILDH A+G F+THCGWNS LEG   G+PMVTWP+ AEQF NEKL+T +L+TG  VG K+
Sbjct  364   LILDHQAIGGFLTHCGWNSLLEGAASGLPMVTWPIGAEQFYNEKLVTQVLKTGVSVGVKK  423

Query  1302  WKRLDSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
               +   D + RE +  A+++VM+G   +EMR RAK +   AK A+
Sbjct  424   MVKGSGDFISREKVDIAVREVMVG---DEMRKRAKQLAVMAKDAV  465



>ref|XP_010432461.1| PREDICTED: UDP-glycosyltransferase 73B3-like [Camelina sativa]
Length=475

 Score =   485 bits (1248),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 241/442 (55%), Positives = 315/442 (71%), Gaps = 15/442 (3%)
 Frame = +3

Query  102   MMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQMEIRLLEFP  275
             +MAHGHMIPT+DMAKLF+SRG K+TI+TTP N     K +D +  L  G +++I++ +FP
Sbjct  9     LMAHGHMIPTVDMAKLFSSRGAKSTILTTPLNAKFLQKPIDAFKNLNPGLEIDIQIFDFP  68

Query  276   GVEVGLPESCQRLDQTPDDDGLPR-------FFKACAMlqppledllqelrpdCLVADMF  434
              V++GLPE C+ +D    D+ + R       FF +    +  LE LLQ  RPDCL+ADMF
Sbjct  69    CVQLGLPEGCENIDFFTADNNVDRQDHMTLKFFSSTRFFKDQLEKLLQTTRPDCLIADMF  128

Query  435   FPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKIT  614
             FPWAT AA KF++PRL+FHG    +LC+ + +RV+ P N V+S  E F IP+LP  + I+
Sbjct  129   FPWATEAAEKFNVPRLVFHGVGFFSLCSEYCIRVHNPQNTVASSCEPFVIPDLPVNIVIS  188

Query  615   KLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSV  794
             K Q++       E+ M +FM  VR SE KS GV+ NSFYELEPDYAE YK  + +R+W +
Sbjct  189   KDQIAD---CHGESEMGKFMTDVRESEVKSSGVVVNSFYELEPDYAEFYKRFVQKRSWHI  245

Query  795   GPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAM  974
             GPLS+Y+R  E+KA RGKK++IDE ECLKWLDSK P SV+YI FGSVA F   QL E+A 
Sbjct  246   GPLSVYSRGFEEKAGRGKKASIDEVECLKWLDSKKPDSVIYISFGSVACFKNEQLIEIAA  305

Query  975   GIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAF  1154
             G+E  G +F+W++R   +     E+W+PEGFEER KGKG+IIRGWAPQV+ILDH A G F
Sbjct  306   GLEACGTNFIWIVR---KSTGNKEEWLPEGFEERVKGKGMIIRGWAPQVLILDHQATGGF  362

Query  1155  VTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKR  1334
             VTHCGWNS LEGV  G+PMVTWPV AEQF NEKL+T +LRTG  VG+K+  R + D + R
Sbjct  363   VTHCGWNSLLEGVAAGLPMVTWPVGAEQFYNEKLVTQVLRTGVSVGAKKHFRSNGDFISR  422

Query  1335  EAIAEAIKKVMIGEESEEMRSR  1400
             E + +A+++V+ GEE+EE R R
Sbjct  423   ETVDKAVREVLAGEEAEERRGR  444



>ref|XP_010057243.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW74287.1| hypothetical protein EUGRSUZ_E02950 [Eucalyptus grandis]
Length=485

 Score =   485 bits (1248),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 230/454 (51%), Positives = 325/454 (72%), Gaps = 5/454 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+ F P+ A GHMIP +D+AK FA+RG K T+IT+PA   +FSK +++  QLG +  ++
Sbjct  8     LHISFLPLPAQGHMIPMIDIAKAFATRGAKITVITSPAFAAIFSKQIERANQLGLEFHVQ  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              ++FP  EVG+PE  +  D T     LP+F +A ++L+ P+  +L++ RPDCLV D FF 
Sbjct  68    TVKFPSTEVGMPEGWENTDATAYSQNLPKFAEALSLLREPVLHILEKHRPDCLVTDFFFA  127

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT+ AA+  IPRL+F GTS +A+CA   +  ++P   VS DSE F +P+LP ++K+T+ 
Sbjct  128   WATDVAARLKIPRLVFGGTSIIAVCAEEVIARHQPHKGVSCDSETFLMPHLPGDIKLTRN  187

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q++   R  VEN  ++       +E KS+G IFNSFYELE DYA++Y+N LGR+AW VGP
Sbjct  188   QLAEHIRRPVENDFTKHAGEAFEAEVKSFGSIFNSFYELEKDYADYYRNFLGRKAWHVGP  247

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             +SL N D  DK +RGK+++I  HECL+WLDSK P+SVVY+CFGS+  F+  QL E+A G+
Sbjct  248   VSLCNSDTADKVQRGKEASISRHECLRWLDSKMPNSVVYVCFGSLTRFSSQQLVEIAKGL  307

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E S  DF+W+++  + ++   + W+PEGFEER  GKGLIIRGWAPQ++ILDH ++G FVT
Sbjct  308   EASQQDFLWIVKGDKSQE---QDWLPEGFEERMDGKGLIIRGWAPQLLILDHESIGGFVT  364

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL--DSDGVKR  1334
             HCGWNSTLE +  GVPMVTWP+FA+QF NEKL+ ++L  G  VGSK +      +D V R
Sbjct  365   HCGWNSTLESISAGVPMVTWPMFADQFYNEKLVVEVLGIGASVGSKSFAMFGEGADLVSR  424

Query  1335  EAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + I + +++VM GEE+E MR RAKV+++ A+KA+
Sbjct  425   DDIDKVVRRVMAGEEAEVMRRRAKVIREMARKAV  458



>ref|NP_567954.1| UDP-glucosyltransferase 73B2 [Arabidopsis thaliana]
 sp|Q94C57.1|U73B2_ARATH RecName: Full=UDP-glucosyl transferase 73B2; AltName: Full=Flavonol 
7-O-glucosyltransferase; AltName: Full=UDP glucose:flavonoid 
7-O-glucosyltransferase [Arabidopsis thaliana]
 gb|AAK59668.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AAN13230.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AAR01231.1| UDP glucose:flavonoid 7-O-glucosyltransferase [Arabidopsis thaliana]
 gb|AEE86328.1| UDP-glucosyltransferase 73B2 [Arabidopsis thaliana]
Length=483

 Score =   484 bits (1247),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 245/440 (56%), Positives = 315/440 (72%), Gaps = 15/440 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQME  254
             LHV FFP MA+GHMIPTLDMAKLF+SRG K+TI+TT  N  +  K +D +  L  G +++
Sbjct  10    LHVMFFPFMAYGHMIPTLDMAKLFSSRGAKSTILTTSLNSKILQKPIDTFKNLNPGLEID  69

Query  255   IRLLEFPGVEVGLPESCQRLD---QTPDDDG---LPRFFKACAMlqppledllqelrpdC  416
             I++  FP VE+GLPE C+ +D      +DD    + +FF +    +  LE LL   RPDC
Sbjct  70    IQIFNFPCVELGLPEGCENVDFFTSNNNDDKNEMIVKFFFSTRFFKDQLEKLLGTTRPDC  129

Query  417   LVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLP  596
             L+ADMFFPWAT AA KF++PRL+FHGT + +LCA + + V+KP   V+S SE F IP LP
Sbjct  130   LIADMFFPWATEAAGKFNVPRLVFHGTGYFSLCAGYCIGVHKPQKRVASSSEPFVIPELP  189

Query  597   HELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
               + IT+ Q+      + E+ M +FM  VR SE KS GV+ NSFYELE DYA+ YK+ + 
Sbjct  190   GNIVITEEQIID---GDGESDMGKFMTEVRESEVKSSGVVLNSFYELEHDYADFYKSCVQ  246

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             +RAW +GPLS+YNR  E+KAERGKK+ IDE ECLKWLDSK P+SV+Y+ FGSVA F   Q
Sbjct  247   KRAWHIGPLSVYNRGFEEKAERGKKANIDEAECLKWLDSKKPNSVIYVSFGSVAFFKNEQ  306

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A G+E SG  F+WV+R  +++    E+W+PEGFEER KGKG+IIRGWAPQV+ILDH
Sbjct  307   LFEIAAGLEASGTSFIWVVRKTKDD---REEWLPEGFEERVKGKGMIIRGWAPQVLILDH  363

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVG-SKEWKRL  1313
              A G FVTHCGWNS LEGV  G+PMVTWPV AEQF NEKL+T +LRTG  VG SK  K +
Sbjct  364   QATGGFVTHCGWNSLLEGVAAGLPMVTWPVGAEQFYNEKLVTQVLRTGVSVGASKHMKVM  423

Query  1314  DSDGVKREAIAEAIKKVMIG  1373
               D + RE + +A+++V+ G
Sbjct  424   MGDFISREKVDKAVREVLAG  443



>gb|AID60126.1| UDP-glucosyl transferase 73B1 [Brassica napus]
 gb|AID60169.1| UDP-glucosyl transferase 73B1 [Brassica napus]
 emb|CDX75401.1| BnaA01g03010D [Brassica napus]
Length=495

 Score =   485 bits (1249),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 243/470 (52%), Positives = 332/470 (71%), Gaps = 16/470 (3%)
 Frame = +3

Query  54    SSKDFAMGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYT  233
             +S + A   LH+FFFP MAHGHMIPTLDMAK+FA++G K+TI+TTP N  +F K ++ + 
Sbjct  3     TSDEAAASKLHIFFFPYMAHGHMIPTLDMAKVFATKGAKSTILTTPLNSKLFEKPINSFN  62

Query  234   QLGFQME---IRLLEFPGVEVGLPESCQRLDQTPDDDGLPR------FFKACAMlqpple  386
                 ++E   +++L FP  E+GLPE C+  D    +  L +      F  A    +  LE
Sbjct  63    DENPELEDIKLQILNFPCTELGLPEGCENTDFIFSNHDLTKGNLNMKFLLAMEYFKEQLE  122

Query  387   dllqelrpdCLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSD  566
             +LL+ ++PDCLV +MFFPWAT  A KF++PRL+FHGT + +LCA H LR++KP+ +V+S 
Sbjct  123   ELLETVKPDCLVGNMFFPWATKVAEKFNVPRLVFHGTGYFSLCASHCLRLHKPYKNVASS  182

Query  567   SELFTIPNLPHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPD  746
             SE F IP LP ++ IT  QV   E+ E E+ M +FM+ +R SE  S+GV+ NSFY+LEP 
Sbjct  183   SEPFVIPELPGDVVITDEQV--IEKEE-ESVMGKFMKDIRDSERDSFGVLVNSFYDLEPA  239

Query  747   YAEHYKNVLGRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICF  926
             YA+ +K  + +RAW +GPLSL NR+ ++KAERGKK++IDEHE LKWLDSK   SV+Y+ F
Sbjct  240   YADFFKTHVAKRAWDIGPLSLGNREFKEKAERGKKASIDEHEYLKWLDSKRCESVIYLSF  299

Query  927   GSVANFAPSQLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRG  1106
             G++++F   QL E+A G+E SG DFVWV+ N+        +W+PEGFEERTKG+GLIIRG
Sbjct  300   GTMSSFDDEQLIEIAAGLEMSGHDFVWVV-NRSGSQGEKVEWLPEGFEERTKGQGLIIRG  358

Query  1107  WAPQVVILDHPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTG  1286
             WAPQV+ILDH A+G F+THCGWNS LEG   G+PMVTWP+ AEQF NEKL+T +L+TG  
Sbjct  359   WAPQVLILDHQAIGGFLTHCGWNSLLEGAASGLPMVTWPIGAEQFYNEKLVTQVLKTGVS  418

Query  1287  VGSKEWKRLDSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VG K+  +   D + RE +  A+++VM+G   +EMR RAK +   AK A+
Sbjct  419   VGVKKMVKGSGDFISREKVDIAVREVMVG---DEMRKRAKQLAVMAKDAV  465



>ref|XP_010028420.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=516

 Score =   486 bits (1250),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 232/476 (49%), Positives = 333/476 (70%), Gaps = 5/476 (1%)
 Frame = +3

Query  15    TAEISQSIKNFAVSSKDFAMGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPA  194
             + E  QS+ +    S +     LH+ F P+ A GHMIP +D+AK FA+RG K T+IT+PA
Sbjct  17    SIETKQSLDHSFSLSMETESNRLHISFLPLPAQGHMIPMIDIAKAFATRGAKITVITSPA  76

Query  195   NQPVFSKAVDKYTQLGFQMEIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlq  374
                +FSK +++  QLG +  ++ ++FP  EVG+PE  +  D T     LP+F +A ++L+
Sbjct  77    FAVIFSKQIERANQLGLEFHVQTVKFPSTEVGMPEGWENTDATAYSQNLPKFAEAVSLLR  136

Query  375   ppledllqelrpdCLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFND  554
              P+  +L++ RP+CLVAD  FPWAT+ AA+  IPRL+F GTS +A+CA   +  ++P   
Sbjct  137   EPVLHILEKHRPNCLVADFSFPWATDVAARLKIPRLVFGGTSIIAMCAEEVIARHQPHKG  196

Query  555   VSSDSELFTIPNLPHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYE  734
             VS DSE F +P+LP ++K+T+ Q++ + R  VEN +++       +  KS+G IFNSFYE
Sbjct  197   VSCDSETFLMPHLPGDIKLTRNQLAEYIRRPVENYITKHAGKALEAGVKSFGSIFNSFYE  256

Query  735   LEPDYAEHYKNVLGRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVV  914
             LE DYA+ Y+N LGR+AW VGP+SL N D  DK +RGK+++I  HECL+WLDSK P+SVV
Sbjct  257   LEKDYADFYRNFLGRKAWHVGPVSLCNSDTADKVQRGKEASISRHECLRWLDSKMPNSVV  316

Query  915   YICFGSVANFAPSQLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGL  1094
             Y+CFGS+  F+  QL E+A G+E S  DF+W+++  + ++   + W+PEGFEER  GKGL
Sbjct  317   YVCFGSLTRFSSQQLVEIAKGLEASQQDFLWIVKGDKSQE---QDWLPEGFEERMDGKGL  373

Query  1095  IIRGWAPQVVILDHPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILR  1274
             IIRGWAPQ++ILDH ++G FVTHCGWNSTLE +  GVPMVTWP+FA+QF NEKL+  +L 
Sbjct  374   IIRGWAPQLLILDHESIGGFVTHCGWNSTLESISAGVPMVTWPMFADQFYNEKLVVQVLG  433

Query  1275  TGTGVGSKEWKRL--DSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              G  +GSK +      +D V R+ I + +++VM GEE+E MR RAKV+++ A+KA+
Sbjct  434   IGASIGSKSFAMFGEGADLVSRDDIDKVVRRVMAGEEAEVMRRRAKVIREMARKAV  489



>ref|XP_009108748.1| PREDICTED: UDP-glycosyltransferase 73B1-like [Brassica rapa]
Length=490

 Score =   484 bits (1247),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 246/461 (53%), Positives = 325/461 (70%), Gaps = 16/461 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQME--  254
             LH+F FP MAHGHMIPTLDMAKLF+++G K+TI+TTP N  +    +  + Q    +E  
Sbjct  7     LHIFLFPYMAHGHMIPTLDMAKLFSTKGAKSTILTTPLNAKILENPIKSFNQDNPGLEDI  66

Query  255   -IRLLEFPGVEVGLPESCQRLD---QTPD---DDGLPRFFKACAMlqppledllqelrpd  413
              I +L FP  E+GLP+ C+  D     PD    D   +F  +    +  LE LLQ ++PD
Sbjct  67    TIHILHFPCTELGLPQGCENTDFFFSNPDLNTGDLNRKFLLSMEYFKEQLEQLLQTVKPD  126

Query  414   CLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNL  593
             CLVA+MF PWAT  A KF +PRL+FHGT + +LCA H LR++KP+ +V+S SE F IP L
Sbjct  127   CLVANMFLPWATKLAEKFGVPRLVFHGTGYFSLCASHCLRLHKPYKNVASSSEPFVIPEL  186

Query  594   PHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVL  773
             P ++ IT+ QV   E   V   M +FM+ +R SE  S+GV+ NSF+ELEP Y++ YK+ +
Sbjct  187   PGDIVITEEQVIEKEEESV---MGKFMKELRDSERSSFGVLVNSFHELEPAYSDFYKSSV  243

Query  774   GRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPS  953
              +RAWS+GPLSL NR+ ++KAERGKK++IDEHECLKWLDSK   SV+Y+ FG++ +F   
Sbjct  244   AKRAWSIGPLSLGNREFKEKAERGKKASIDEHECLKWLDSKRRESVIYLSFGTMLSFNNE  303

Query  954   QLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILD  1133
             QL E+A G+E SG DF+WV+ NK       E+W+PEGFEE+ KG+GLIIRGWAPQVVILD
Sbjct  304   QLVEIATGLEMSGHDFIWVV-NKSGSQGDKEEWLPEGFEEKMKGRGLIIRGWAPQVVILD  362

Query  1134  HPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL  1313
             H AVG F+THCGWNS LEGV  G+PMVTWP+ AEQF NEKL+T +L+TG  VG K+  + 
Sbjct  363   HQAVGGFLTHCGWNSLLEGVASGLPMVTWPIGAEQFYNEKLVTQVLKTGVSVGVKKMMKP  422

Query  1314  DSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             D D + +E + +A+++VM G   EEMR RAK + D AK A+
Sbjct  423   DGDFITKEKVEKAVREVMAG---EEMRKRAKQLADMAKDAV  460



>ref|XP_009108751.1| PREDICTED: UDP-glucosyl transferase 73B2-like [Brassica rapa]
Length=483

 Score =   484 bits (1246),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 243/461 (53%), Positives = 326/461 (71%), Gaps = 15/461 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQME  254
             LHV FFP MA+GHMIPTLDMAKL +SRG K+TIITTP N  +  K ++ +  L     ++
Sbjct  10    LHVMFFPFMAYGHMIPTLDMAKLLSSRGAKSTIITTPLNSKILKKPIEVFKNLNPNLDID  69

Query  255   IRLLEFPGVEVGLPESCQRLD---QTPDDDG---LPRFFKACAMlqppledllqelrpdC  416
             I + +FP +E+GLPE C+ +D      + DG     +FF + +  +  LE LL++ RP+C
Sbjct  70    IEIFDFPCLELGLPEGCENVDFFTSNTNVDGNYMALKFFISTSFFKDQLEVLLKKTRPNC  129

Query  417   LVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLP  596
             L+ADMFFPW+T  A K  +PRL+FHGT + +LCA + ++V+KP N V+   E F IP LP
Sbjct  130   LIADMFFPWSTQVAEKCHVPRLVFHGTGYFSLCANYCMKVHKPQNKVALSCEPFVIPELP  189

Query  597   HELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
              ++ IT+ Q+      + E+ M +FM  VR SE KS GV+ NSFYELEPDYA+ YK+ + 
Sbjct  190   GDIVITQEQIID---GDNESEMGKFMIDVRESELKSSGVVVNSFYELEPDYADFYKSFVA  246

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             +RAW +GPLS+ NR  E+KAERGKK++IDE ECLKWLDSK   SVVYI FGSVA F   Q
Sbjct  247   KRAWHIGPLSVINRGFEEKAERGKKASIDEAECLKWLDSKKQDSVVYISFGSVACFKNKQ  306

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A+G+E SG  F+WV+   RE  +  ++W+ EGFEER K +G+IIRGWAPQV+IL+H
Sbjct  307   LREIALGLEASGTSFIWVV---RENTDDKDEWLEEGFEERVKERGMIIRGWAPQVLILEH  363

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVG-SKEWKRL  1313
              A G FVTHCGWNS LEGV  G+PMVTWP+ AEQF NEKL+T +LRTG  VG +K  K +
Sbjct  364   QATGGFVTHCGWNSLLEGVAAGLPMVTWPIGAEQFYNEKLVTQVLRTGVSVGATKHVKAM  423

Query  1314  DSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + D + RE + +A+++V++G E+EE RSR K + + AK A+
Sbjct  424   EDDIISREKVEKAVREVLVGVEAEERRSRGKELAEMAKAAV  464



>ref|XP_010030421.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=479

 Score =   484 bits (1246),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 227/441 (51%), Positives = 311/441 (71%), Gaps = 2/441 (0%)
 Frame = +3

Query  114   GHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIRLLEFPGVEVGL  293
             GH IP +DMAKLFA RG K+T+ITTP ++P F K++ K   LGF +++  +  P  EVGL
Sbjct  14    GHTIPMIDMAKLFAIRGCKSTLITTPHDEPTFLKSIAKAKDLGFDIDVVTVILPLKEVGL  73

Query  294   PESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFPWATNAAAKFDI  473
             PE    L++    +   +F +A  ML   LE L++ L PDC+++DMF PW T  AAK+ I
Sbjct  74    PEDYDNLNKVTSMEIRKQFMRAIMMLDRQLELLIETLAPDCIISDMFLPWTTEIAAKYKI  133

Query  474   PRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKLQVSPFERSEVE  653
             P L FHGTS  ++ +   +R+Y+P   VS DSE F IPN P E+ ++++Q+    R E +
Sbjct  134   PSLAFHGTSAFSIVSTECVRLYEPHKKVSCDSEPFIIPNFPGEITMSRMQLPDLFREETD  193

Query  654   NTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGPLSLYNRDVEDK  833
              T  +F    + SE++S+GV+ NSFYELEP YA HY+  LGRR+W +GPLSL N++ EDK
Sbjct  194   FT--KFYNEAKESEKRSFGVVMNSFYELEPAYAHHYRRFLGRRSWFIGPLSLCNKETEDK  251

Query  834   AERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGIEDSGMDFVWVI  1013
             A RG +++ID+HECLKWLDSK P+SV+YICFGS+ NF  +QLHE+A+G+E SG  F+WV+
Sbjct  252   AHRGNQASIDQHECLKWLDSKQPNSVIYICFGSMENFNAAQLHEIAVGLEASGQQFIWVV  311

Query  1014  RNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVTHCGWNSTLEGV  1193
             +     + G E+ +P+G+E R + KGLIIRGWAPQV+ILDH A+G FVTHCGWNSTLE V
Sbjct  312   KKDSNVEEGKEERLPDGYESRIRNKGLIIRGWAPQVLILDHEAIGGFVTHCGWNSTLEAV  371

Query  1194  CGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREAIAEAIKKVMIG  1373
               GVPMVTWPV AEQF NEK +T +L+ G  +G K+W R   D VK E + EA+K+V++ 
Sbjct  372   TAGVPMVTWPVAAEQFFNEKFVTQVLKIGVNIGVKQWVRFFGDSVKSERVEEAVKRVLVR  431

Query  1374  EESEEMRSRAKVMKDKAKKAI  1436
             EE+EEMR + K + + A+ A+
Sbjct  432   EEAEEMRRKVKTLAEMAEGAV  452



>gb|KCW55162.1| hypothetical protein EUGRSUZ_I01117 [Eucalyptus grandis]
Length=485

 Score =   484 bits (1246),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 228/454 (50%), Positives = 325/454 (72%), Gaps = 5/454 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+ F P+ A GHMIP +D+AK FA+RG K T+IT+PA   +FSK +++  QLG +  ++
Sbjct  8     LHISFLPLPAQGHMIPMIDIAKAFATRGAKITVITSPAFAVIFSKQIERANQLGLEFHVQ  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              ++FP  EVG+PE  +  D T     LP+F +A ++L+ P+  +L++ RP+CLVAD  FP
Sbjct  68    TVKFPSTEVGMPEGWENTDATAYSQNLPKFAEAVSLLREPVLHILEKHRPNCLVADFSFP  127

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT+ AA+  IPRL+F GTS +A+CA   +  ++P   VS DSE F +P+LP ++K+T+ 
Sbjct  128   WATDVAARLKIPRLVFGGTSIIAMCAEEVIARHQPHKGVSCDSETFLMPHLPGDIKLTRN  187

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q++ + R  VEN +++       +  KS+G IFNSFYELE DYA+ Y+N LGR+AW VGP
Sbjct  188   QLAEYIRRPVENYITKHAGKALEAGVKSFGSIFNSFYELEKDYADFYRNFLGRKAWHVGP  247

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             +SL N D  DK +RGK+++I  HECL+WLDSK P+SVVY+CFGS+  F+  QL E+A G+
Sbjct  248   VSLCNSDTADKVQRGKEASISRHECLRWLDSKMPNSVVYVCFGSLTRFSSQQLVEIAKGL  307

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E S  DF+W+++  + ++   + W+PEGFEER  GKGLIIRGWAPQ++ILDH ++G FVT
Sbjct  308   EASQQDFLWIVKGDKSQE---QDWLPEGFEERMDGKGLIIRGWAPQLLILDHESIGGFVT  364

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL--DSDGVKR  1334
             HCGWNSTLE +  GVPMVTWP+FA+QF NEKL+  +L  G  +GSK +      +D V R
Sbjct  365   HCGWNSTLESISAGVPMVTWPMFADQFYNEKLVVQVLGIGASIGSKSFAMFGEGADLVSR  424

Query  1335  EAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + I + +++VM GEE+E MR RAKV+++ A+KA+
Sbjct  425   DDIDKVVRRVMAGEEAEVMRRRAKVIREMARKAV  458



>ref|XP_007157726.1| hypothetical protein PHAVU_002G093300g [Phaseolus vulgaris]
 gb|ESW29720.1| hypothetical protein PHAVU_002G093300g [Phaseolus vulgaris]
Length=472

 Score =   483 bits (1244),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 230/453 (51%), Positives = 324/453 (72%), Gaps = 9/453 (2%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LHVFF P +A+GH IPT+DMAKLFA +GVKATIITTP N P  +KA+ K       + +
Sbjct  7     SLHVFFIPFLAYGHFIPTVDMAKLFAEKGVKATIITTPLNAPFITKAIGKTKTSSTMIHV  66

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
             + +E P  E GLP  C+  +        P FF+AC +LQ P E LL E RP+C+VAD+ F
Sbjct  67    KTIELPCAEAGLPNGCENTNSLTTGTLFPAFFRACGLLQYPFEQLLLEQRPNCVVADVMF  126

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWAT++AAK  +P L++ GTS  ++CA   + +Y+P+ +VS+DSE F IPNLP E+K+T+
Sbjct  127   PWATDSAAKLGVPSLVYDGTSFFSICANQCMGLYEPYKNVSTDSEPFLIPNLPGEIKMTR  186

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
             +QVSP   S+  + +++ +  V+ S+ KSYG++ NSFYELE  YA+H +NVLGR+AW +G
Sbjct  187   MQVSPHAMSDESSGVTKLLDEVKESDLKSYGMVVNSFYELEKVYADHLRNVLGRKAWHIG  246

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             P+ L NR  E+KA       IDEHECLKWLD+K P+SV+Y+CFG+      SQL ++A G
Sbjct  247   PMFLSNRVKEEKA------CIDEHECLKWLDTKEPNSVIYVCFGTTTKLKNSQLKDIATG  300

Query  978   IEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             +E SG  F+WV+  ++E+  G   W+ + FE++ +GKGLIIRGWAPQV+IL+H A+GAFV
Sbjct  301   LEASGEQFIWVMGKRQEDGVG---WVADEFEKKMEGKGLIIRGWAPQVLILEHEAIGAFV  357

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKRE  1337
             THCGWNS LEGV  GVPMVTWP+  EQF NEKL+++IL+ G  +G+K+W     D VK E
Sbjct  358   THCGWNSILEGVVAGVPMVTWPIAYEQFFNEKLVSEILKIGVPIGAKKWAAGVGDTVKWE  417

Query  1338  AIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             A+ +A+K++M GE++ +MR++AK++   A++A+
Sbjct  418   AVEKAVKRIMSGEKAHQMRNKAKMLSRLAREAV  450



>ref|XP_007153575.1| hypothetical protein PHAVU_003G047100g [Phaseolus vulgaris]
 gb|ESW25569.1| hypothetical protein PHAVU_003G047100g [Phaseolus vulgaris]
Length=474

 Score =   483 bits (1243),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 239/457 (52%), Positives = 331/457 (72%), Gaps = 15/457 (3%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
             DLHVFFFP  A+GH+IP++++A++FASRGVK T++TTP N+P+ S+ + K       + I
Sbjct  7     DLHVFFFPFFANGHIIPSIELARVFASRGVKTTVVTTPLNEPLISRTIGKAN-----IAI  61

Query  258   RLLEFPGVE-VGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMF  434
             R ++FP  E  GLPE  +  DQ      +P F K+  +L+ PLE L+Q+  PD ++ADMF
Sbjct  62    RTIKFPSPEKTGLPEGVENSDQLTGMQIIP-FLKSTVLLRDPLEQLMQQEHPDLIIADMF  120

Query  435   FPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKIT  614
             FPWAT++AAKF IPR++FHG     LC    +R YKP + VSS +E F +PNLP E+ +T
Sbjct  121   FPWATDSAAKFGIPRIVFHGLGFFPLCVSACVRQYKPQDKVSSYTEPFVVPNLPGEITLT  180

Query  615   KLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSV  794
             K+Q+   +  + +   ++ +     SE KS+GVI NSFYELEP YA+HY+  LGR+AW +
Sbjct  181   KMQLP--QTPKHDEDFTKLLEEANASELKSFGVIANSFYELEPVYADHYRKELGRKAWHL  238

Query  795   GPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAM  974
             GP+ L NR+  +K  RG +SAIDEHECLKWLDSK P+SVVY+CFGS+ +F  +QL E+A+
Sbjct  239   GPVCLSNRESAEKVHRGNESAIDEHECLKWLDSKEPNSVVYVCFGSMTSFPNAQLKEIAL  298

Query  975   GIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERT--KGKGLIIRGWAPQVVILDHPAVG  1148
             G+E S   FVWV++    E+    +W+PEGFEERT  KGKGLIIRGWAPQV+ILDH AVG
Sbjct  299   GLEASEQAFVWVVKKGSSEN---LEWLPEGFEERTVDKGKGLIIRGWAPQVMILDHKAVG  355

Query  1149  AFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEW-KRLDSDG  1325
              FV+HCGWNST+EGVC G+PMVTWP++AEQF N K +TDI++ G  VG + W   +  + 
Sbjct  356   GFVSHCGWNSTMEGVCAGLPMVTWPMYAEQFYNAKFLTDIVKIGVSVGVQTWIGMMGGEP  415

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VK+E I +A+K++M+G+E+EE+R+RAK + + AK+A+
Sbjct  416   VKKEVIEKAVKRIMVGKEAEEIRNRAKEIAEMAKRAV  452



>ref|XP_010432459.1| PREDICTED: UDP-glycosyltransferase 73B1-like [Camelina sativa]
Length=486

 Score =   483 bits (1244),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 252/462 (55%), Positives = 324/462 (70%), Gaps = 17/462 (4%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVF-SKAVDKYTQLGFQME-  254
             LH   FP MAHGHMIPTLDMAKLFA++G K+TI+TTP N  +F  K +  + Q    +E 
Sbjct  10    LHFLLFPFMAHGHMIPTLDMAKLFATKGAKSTILTTPLNSKLFFEKPIKSFNQENPGLED  69

Query  255   --IRLLEFPGVEVGLPESCQRLD---QTPD---DDGLPRFFKACAMlqppledllqelrp  410
               I +L FP  E+GLPE C+  D    +PD    D   +F  A    + PLE +L+  +P
Sbjct  70    ISIEILNFPCTELGLPEGCENSDFIFSSPDLAKGDLSQKFLLAMKYFEEPLEKVLETTKP  129

Query  411   dCLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPN  590
             DCLV +MFFPWAT  A KF +PRL+FHGT   ++CA H +R++KP+ +V+S SELF IP+
Sbjct  130   DCLVGNMFFPWATKVAEKFGVPRLVFHGTGCFSICASHCIRLHKPYENVASSSELFVIPD  189

Query  591   LPHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNV  770
             LP ++ IT+ QV   E   V   M +FM+ +R SE +S+GV+ NSFYELEPDY++  K  
Sbjct  190   LPGDVVITEEQVIEKEEESV---MGKFMKGIRESERESFGVLVNSFYELEPDYSDFLKRF  246

Query  771   LGRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAP  950
             + +RAW +GPLSL NR  E+KA RGKK++IDEHECLKWLDSK   SVVY+ FG++++F  
Sbjct  247   VAKRAWLIGPLSLGNRKFEEKAGRGKKASIDEHECLKWLDSKKCESVVYLSFGTMSSFNN  306

Query  951   SQLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVIL  1130
              QL E+A G+E SG DFVWV+ NK       E+W+PEGFEE+TKGKGLIIRGWAPQV+IL
Sbjct  307   EQLIEIAAGLEMSGHDFVWVV-NKNGSQGEKEEWLPEGFEEKTKGKGLIIRGWAPQVLIL  365

Query  1131  DHPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKR  1310
             DH A+G FVTHCGWNS LEGV  G+PMVTWPV AEQF NEKL+T +L+TG  VG K+  +
Sbjct  366   DHQALGGFVTHCGWNSLLEGVAAGLPMVTWPVGAEQFYNEKLVTQVLKTGVSVGVKKLMQ  425

Query  1311  LDSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             +  D V RE +  A+K+VM+GEE    R RAK   + AK A+
Sbjct  426   VVGDFVSREKVERAVKEVMVGEER---RKRAKEFAEMAKNAV  464



>ref|XP_009116544.1| PREDICTED: UDP-glycosyltransferase 73B3-like [Brassica rapa]
Length=451

 Score =   481 bits (1239),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 241/449 (54%), Positives = 320/449 (71%), Gaps = 15/449 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVD--KYTQLGFQME  254
             LHV FFP MA+GHMIPTLDMAKLF+S+GVK+TIITTP N  +F K +D  K      +++
Sbjct  9     LHVMFFPYMAYGHMIPTLDMAKLFSSKGVKSTIITTPLNSKIFQKPIDVFKNQNPSLEID  68

Query  255   IRLLEFPGVEVGLPESCQRLD-----QTPDDDGLP-RFFKACAMlqppledllqelrpdC  416
             I + EFP V++GLPE C+ +D       P  + +  +F  +    +  LE LL+  RPDC
Sbjct  69    IHIFEFPCVQLGLPEGCENVDFFTSSNNPGRENIAFKFLSSTRFFKDQLEKLLETTRPDC  128

Query  417   LVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLP  596
             L+ADMFFPW+T  A K  +PRL+FHGT + +LCA + ++V+KP N V+S SE F IP+LP
Sbjct  129   LIADMFFPWSTQVAEKCHVPRLVFHGTGYFSLCANYCMKVHKPQNKVASSSEPFVIPDLP  188

Query  597   HELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
              +++IT+ Q+        E+ M++F+  VR SE KS GVI NSFYELEP+YA+ +K  + 
Sbjct  189   GDIEITREQII-----NSESEMAKFLLDVRESETKSTGVIVNSFYELEPEYADFFKRFVA  243

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             +RAW +GPLS+ NR  E+KAERGKK+++DE EC+KWLDSK   SV+YI FGSVA F   Q
Sbjct  244   KRAWQIGPLSVTNRGFEEKAERGKKASVDESECIKWLDSKEKDSVIYISFGSVACFKNKQ  303

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A G+E SG  F+WV+R K   D+  E+W+PEGFEER KG+G+IIRGWAPQV+IL+H
Sbjct  304   LVEIAAGLEASGASFIWVVR-KSTGDDDKEEWLPEGFEERVKGRGMIIRGWAPQVLILEH  362

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVG-SKEWKRL  1313
              A G FVTHCGWNS LEGV  G+PMVTWP+ AEQF NEKL+T +LRTG  VG +K  K +
Sbjct  363   QATGGFVTHCGWNSLLEGVAAGLPMVTWPIGAEQFYNEKLVTQVLRTGVSVGATKHVKNM  422

Query  1314  DSDGVKREAIAEAIKKVMIGEESEEMRSR  1400
               + + RE + +A+++V+  EE EE R R
Sbjct  423   GDEIISREKVEKAVREVLAWEEGEERRIR  451



>gb|AHL38663.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=483

 Score =   482 bits (1241),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 244/440 (55%), Positives = 315/440 (72%), Gaps = 15/440 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQME  254
             LHV FFP MA+G+MIPTLDMAKLF+SRG K+TI+TT  N  +  K +D +  L  G +++
Sbjct  10    LHVMFFPFMAYGNMIPTLDMAKLFSSRGAKSTILTTSLNSKILQKPIDTFKNLNPGLEID  69

Query  255   IRLLEFPGVEVGLPESCQRLD---QTPDDDG---LPRFFKACAMlqppledllqelrpdC  416
             I++  FP VE+GLPE C+ +D      +DD    + +FF +    +  LE LL   RPDC
Sbjct  70    IQIFNFPCVELGLPEGCENVDFFTSNNNDDKNEMIVKFFFSTRFFKDQLEKLLGTTRPDC  129

Query  417   LVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLP  596
             L+ADMFFPWAT AA KF++PRL+FHGT + +LCA + + V+KP   V+S SE F IP LP
Sbjct  130   LIADMFFPWATEAAGKFNVPRLVFHGTGYFSLCAGYCIGVHKPQKRVASSSEPFVIPELP  189

Query  597   HELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
               + IT+ Q+      + E+ M +FM  VR SE KS GV+ NSFYELE DYA+ YK+ + 
Sbjct  190   GNIVITEEQIID---GDGESDMGKFMTEVRESEVKSSGVVLNSFYELEHDYADFYKSCVQ  246

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             +RAW +GPLS+YNR  E+KAERGKK+ IDE ECLKWLDSK P+SV+Y+ FGSVA F   Q
Sbjct  247   KRAWHIGPLSVYNRGFEEKAERGKKANIDEAECLKWLDSKKPNSVIYVSFGSVAFFKNEQ  306

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A G+E SG  F+WV+R  +++    E+W+PEGFEER KGKG+IIRGWAPQV+ILDH
Sbjct  307   LFEIAAGLEASGTSFIWVVRKTKDD---REEWLPEGFEERVKGKGMIIRGWAPQVLILDH  363

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVG-SKEWKRL  1313
              A G FVTHCGWNS LEGV  G+PMVTWPV AEQF NEKL+T +LRTG  VG SK  K +
Sbjct  364   QATGGFVTHCGWNSLLEGVAAGLPMVTWPVGAEQFYNEKLVTQVLRTGVSVGASKHMKVM  423

Query  1314  DSDGVKREAIAEAIKKVMIG  1373
               D + RE + +A+++V+ G
Sbjct  424   MGDFISREKVDKAVREVLAG  443



>ref|XP_010048320.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW80575.1| hypothetical protein EUGRSUZ_C01938 [Eucalyptus grandis]
Length=495

 Score =   483 bits (1242),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 232/468 (50%), Positives = 337/468 (72%), Gaps = 12/468 (3%)
 Frame = +3

Query  63    DFAMGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG  242
             D  +  LH+FF P MAHGHMIPT++MA+LFA+RG+KATI+TT  N  V+ K +++    G
Sbjct  2     DSELHRLHIFFLPFMAHGHMIPTIEMARLFATRGIKATIVTTHLNLAVYLKHIERTKHSG  61

Query  243   FQMEIRLLEFPGVEVGLPESCQRLDQTPDDDG------LPRFFKACAMlqppledllqel  404
               ++I  ++ P VE+GLPE C+ ++      G      + +F KA +ML+ PL  LLQE 
Sbjct  62    LDIDILTVKLPSVELGLPEGCENIEAIISSSGANSRELVVKFVKALSMLREPLLRLLQEH  121

Query  405   rpdCLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTI  584
             RPDCL+ADMFFPWAT+ AA+ +IPR++ +     ++ A  ++  Y+P   VSSDSE F +
Sbjct  122   RPDCLIADMFFPWATDVAAECNIPRIVVNALCLFSMSAYETISRYEPHRKVSSDSEAFIV  181

Query  585   PNLPHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYK  764
             P+LP E+++T+ Q++   + +  N  ++ +R V  S+ KS+G + NS Y+LE DYA++++
Sbjct  182   PDLPGEIQLTRHQLADHHKQD--NDFAKLLREVYASQLKSFGNVVNSCYQLEKDYADYFR  239

Query  765   NVLGRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANF  944
             NVLGR+AW VGPL LYN+DVEDK  RGK+++ID+ ECLKWLDSK P+SV+Y+CFGS A+F
Sbjct  240   NVLGRKAWLVGPLLLYNKDVEDKTHRGKEASIDKDECLKWLDSKEPNSVIYVCFGSEASF  299

Query  945   APSQLHEMAMGIEDSGMDFVWVI-RNKREEDNG-SEKWMPEGFEERTKGKGLIIRGWAPQ  1118
                QL E+A+G+E S  +F+WV  + K+EE NG  + W+P+GFEER +G+GLIIRGWAPQ
Sbjct  300   NSQQLMEIALGLEASEQNFIWVAGKGKKEEQNGDDDDWLPQGFEERMEGQGLIIRGWAPQ  359

Query  1119  VVILDHPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSK  1298
             ++ILDH +VG F+THCGWNS LEG+C G+PMVT P+  + F+ EKL+T +L+ G GVG K
Sbjct  360   MLILDHVSVGGFMTHCGWNSILEGICAGLPMVTRPMTHDHFLTEKLVTQVLQVGIGVGVK  419

Query  1299  EWKRLDSDG--VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              W  +   G  V R+ I +A++++M+GEE+EEMR R K +++ A+ A+
Sbjct  420   RWVDIGVAGDIVSRDDICKAVRQIMVGEEAEEMRRRTKALQEIARAAV  467



>ref|XP_004307464.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Fragaria vesca subsp. vesca]
Length=485

 Score =   482 bits (1240),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 251/465 (54%), Positives = 327/465 (70%), Gaps = 26/465 (6%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH+F  P MA GH IP  D+AKLF+S G + TI+TTP N P+FSKA    TQ G ++E+
Sbjct  10    QLHIFILPYMARGHSIPLTDIAKLFSSHGARCTIVTTPLNAPLFSKA----TQRG-EIEL  64

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              L++FP  E GLP+ C+  D     D + +F KA  +L+P  E +L E RP CLVAD FF
Sbjct  65    VLIKFPSAEAGLPQDCESADLIITQDMVGKFIKATFLLEPQFEKILDEHRPHCLVADAFF  124

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
              WAT+ AAKF IPRL FHGT    LCA  S+ +Y+P  ++SSDSE F IPNLP E+K+T+
Sbjct  125   TWATDVAAKFRIPRLYFHGTGFFPLCATLSVMMYQPHCNLSSDSESFAIPNLPDEIKMTR  184

Query  618   LQVSPFERSEVENTMSEFMRSVRGS---EEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
              Q+  F         SEFM+ ++ S   EE+SYGVI NSFYELEP YA HY+ V GR+AW
Sbjct  185   SQLPVFPDE------SEFMKMLKASIEIEERSYGVIVNSFYELEPAYANHYRKVFGRKAW  238

Query  789   SVGPLSLYNRDVEDKAERG--KKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLH  962
              +GP+SL N+ +EDKAERG  K S  ++HECLKWLDSK P SVVY+ FGS+  FA SQL 
Sbjct  239   HIGPVSLCNKAIEDKAERGSIKSSTAEKHECLKWLDSKKPRSVVYVSFGSMVRFADSQLL  298

Query  963   EMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPA  1142
             E+A G+E SG DF+W     ++E    E+W+PEGFE+R +GKGLIIR WAPQV+IL+H A
Sbjct  299   EIATGLEASGQDFIW---VVKKEKKEVEEWLPEGFEKRMEGKGLIIRDWAPQVLILEHEA  355

Query  1143  VGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWK-----  1307
             +GAFVTHCGWNS +E V  GVPM+TWPV  EQF NEKL+T+ILR G  VGS++W      
Sbjct  356   IGAFVTHCGWNSIIEAVSAGVPMITWPVIGEQFYNEKLVTEILRIGVPVGSEKWAFSFVD  415

Query  1308  -RLDSDG-VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
                +++G V+REAI EA+ ++M+G+E+ EMRS+ K + + A++A+
Sbjct  416   VEAETEGRVRREAIEEAVTRIMVGDEAVEMRSKVKELGENARRAV  460



>emb|CDX69028.1| BnaC01g04250D [Brassica napus]
Length=483

 Score =   481 bits (1239),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 242/463 (52%), Positives = 323/463 (70%), Gaps = 16/463 (3%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
             +LHV FFP MA+GHMIPTLDMAKLF+S+GVK+TIITTP N  +F K +D +      +EI
Sbjct  8     ELHVMFFPYMAYGHMIPTLDMAKLFSSKGVKSTIITTPLNSKIFQKPIDVFKNQNPSLEI  67

Query  258   ---RLLEFPGVEVGLPESCQRLD-----QTPDDDGLP-RFFKACAMlqppledllqelrp  410
                 + +FP V++GLPE C+ +D       P  + +  +F  +    +  LE LL+  RP
Sbjct  68    IDIHIFDFPCVQLGLPEGCENVDFFTSSNNPGRENIAFKFLSSTRFFKDQLEKLLETTRP  127

Query  411   dCLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPN  590
             DCL+ADMFFPWAT  A K  +PRL+FHGT + +LCA + ++V+KP N V+S SE F IP+
Sbjct  128   DCLIADMFFPWATQVAEKCHVPRLVFHGTGYFSLCANYCMKVHKPQNKVASSSEPFVIPD  187

Query  591   LPHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNV  770
             LP +++IT+ Q+      + E+ M  F+  VR SE KS GVI NSFYELEP+YA+ +K  
Sbjct  188   LPGDIEITREQII-----DNESEMGMFLLDVRESETKSSGVIVNSFYELEPEYADFFKRF  242

Query  771   LGRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAP  950
             + +R W +GPLS+ NR  E+KAERGKK+++DE ECLKWLDSK   SV+YI FGSVA F  
Sbjct  243   VAKRTWQIGPLSVTNRGFEEKAERGKKASVDESECLKWLDSKEKDSVIYISFGSVACFKN  302

Query  951   SQLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVIL  1130
              QL E+A G+E  G  F+WV+R K   D+  E+W+PEGFEER KG+G+IIRGWAPQV+IL
Sbjct  303   KQLVEIAAGLEACGASFIWVVR-KSTSDDDKEEWLPEGFEERVKGRGMIIRGWAPQVLIL  361

Query  1131  DHPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVG-SKEWK  1307
             +H   G F+THCGWNS LEGV  G+PMVTWP+ AEQF NEKL+T +LRTG  VG +K  K
Sbjct  362   EHQVTGGFLTHCGWNSLLEGVAAGLPMVTWPIGAEQFYNEKLVTQVLRTGVSVGATKHVK  421

Query  1308  RLDSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              +  + + RE + +A+++V+  EE EE R R K + + AK A+
Sbjct  422   NMGDEIISREKVEKAVREVLAWEEGEERRIRIKKLAEMAKAAV  464



>gb|AIS71990.1| UDP-glycosyl transferase 1, partial [Haloxylon ammodendron]
Length=490

 Score =   481 bits (1239),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 242/457 (53%), Positives = 338/457 (74%), Gaps = 8/457 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL-GFQMEI  257
             LHV FFP+MAHGHMIPTLD A+LFA+RGVKATIITTP N P+F++A++K  +  G  ++I
Sbjct  4     LHVVFFPLMAHGHMIPTLDTARLFAARGVKATIITTPCNMPIFTQAIEKSKESEGPMIDI  63

Query  258   RLLEFPGVEVGLPESCQRLDQTPDD-DGLPRFFKACAMlqppledllqelrpdCLVADMF  434
              + +F  VE GLP+ C+ L Q     D   +FF+A +MLQ  LE  L+ +RP  LVADMF
Sbjct  64    EVFKFSLVEDGLPKGCENLKQAMSSLDMAQKFFRAASMLQQQLEVYLERVRPHVLVADMF  123

Query  435   FPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKIT  614
             F WAT  AAKF+IPRL+F+GTS  A C    + V++P+  VSSD E F IP+LPHE+ +T
Sbjct  124   FTWATECAAKFNIPRLVFYGTSFFADCVRDMIMVHQPYKHVSSDYEPFVIPSLPHEIMLT  183

Query  615   KLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSV  794
             + Q+ P   +  E+ + +    ++ SE +SYGVI NSFYELEP+YA+ ++  LGRRAW V
Sbjct  184   RSQL-PEGLTMNESELKKRHEMMQESEVQSYGVIVNSFYELEPNYADFFRRQLGRRAWHV  242

Query  795   GPLSLYNRDVEDKAERGKKS-AIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             GP+SL N   ++KA+RG+++ +IDEHECLKWL+ K P+SV+Y+ FGS+A+F   QL E+A
Sbjct  243   GPVSLCNETFKEKAQRGRETNSIDEHECLKWLNLKKPNSVIYLSFGSLAHFIVPQLQEIA  302

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
             M +E    +F+WV+R   ++   SE+W+P+GF+ERT+GKGL++ GW PQ++IL+H A+GA
Sbjct  303   MALEVLQYEFIWVVRE--DKLAMSEEWLPQGFKERTQGKGLVLGGWVPQLLILEHEAIGA  360

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDS--DG  1325
             FVTHCGWNSTLE +  GVPMVTWP FAEQF NEKL+ ++L+ GT VG+K+W+ + S  D 
Sbjct  361   FVTHCGWNSTLEAISAGVPMVTWPFFAEQFYNEKLVNEVLQIGTPVGAKKWRVIYSVKDV  420

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VK +AI +AI + M G++++E RS+ K +KD A++A+
Sbjct  421   VKHDAIKKAIIETMEGDKAQEKRSKVKKLKDSARQAM  457



>ref|XP_010028421.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW55164.1| hypothetical protein EUGRSUZ_I01120 [Eucalyptus grandis]
Length=485

 Score =   481 bits (1237),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 231/455 (51%), Positives = 322/455 (71%), Gaps = 7/455 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH+ F P+ A GHMIP +D+AK FA+RG K T+IT+PA   +FSK +++  QLG +  ++
Sbjct  8     LHISFLPLPAQGHMIPMIDIAKAFATRGAKITVITSPAFAAIFSKQIERANQLGLEFHVQ  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              ++FP  EVG+PE  +  D T      P+F +A ++L+ P+  +L++ R DCLV D FF 
Sbjct  68    TVKFPSTEVGMPEGWENTDATAYSQNQPKFGEALSLLREPVLRILEKHRTDCLVTDFFFA  127

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT+ AA+  IPRL+F GTS +A+CA   +  ++P   VS DSE F +P+LP ++K+T+ 
Sbjct  128   WATDVAARLKIPRLVFGGTSIIAVCAEEVIARHQPHKGVSCDSETFLVPHLPGDIKLTRN  187

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+    R  VEN   +       SE KS+G IFNSFYELE DYA++Y+NVLGR+AW +GP
Sbjct  188   QLPEHLRLLVENDFFKHAGEALESELKSFGSIFNSFYELEKDYADYYRNVLGRKAWHIGP  247

Query  801   LSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGI  980
             +SL N D  DK +RGK+++I  HECL+WLDSK P+SVVY+CFGS+  F+  QL E+A G+
Sbjct  248   VSLCNSDTADKVQRGKEASIGRHECLQWLDSKKPNSVVYVCFGSLTRFSSQQLSEIAKGL  307

Query  981   EDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVT  1160
             E S  DF+W+++  +   N  + W+PEGFEER  GKGLIIRGWAPQ++ILDH ++G FVT
Sbjct  308   EASQQDFLWIVKGDK---NQEQDWLPEGFEERMDGKGLIIRGWAPQLLILDHESIGGFVT  364

Query  1161  HCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVK---  1331
             HCGWNSTLE +  GVPMVTWP+FA+QF NEKL+  +L  G GVGS  +  + ++G K   
Sbjct  365   HCGWNSTLESISAGVPMVTWPMFADQFYNEKLVVQVLGIGAGVGSNLFA-IFAEGAKLVS  423

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             R+ I +A+++VM GEE+E MR RAKV+ + A+KA+
Sbjct  424   RDDIDKAVRRVMAGEEAEVMRRRAKVIHEMARKAV  458



>gb|KEH30902.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=478

 Score =   480 bits (1236),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 230/457 (50%), Positives = 333/457 (73%), Gaps = 11/457 (2%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
             +LH+ FFP +A+GH+IP +D+A++F+SRG+K TI+TT  N P+ S+ + K      ++ I
Sbjct  7     ELHIIFFPFLANGHIIPCVDLARVFSSRGLKVTIVTTHLNVPLISRTIGKA-----KINI  61

Query  258   RLLEFPGVE-VGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMF  434
             + ++FP  E  GLPE C+  +     D   +F K+  +L+ PLE +L++ +PDCLVADMF
Sbjct  62    KTIKFPSPEETGLPEGCENSESALAPDKFIKFMKSTLLLREPLEHVLEQEKPDCLVADMF  121

Query  435   FPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKIT  614
             FPW+T++AAKF+IPR++FHG     LC +   R YKP + VSS +E F +PNLP E+ +T
Sbjct  122   FPWSTDSAAKFNIPRIVFHGLGFFPLCVLACTRQYKPQDKVSSYTEPFVVPNLPGEITLT  181

Query  615   KLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSV  794
             K+Q+    + +     ++ +     SE KS+GVI N+FYELEP YA+HY+N LGR+AW +
Sbjct  182   KMQLPQLPQHD--KVFTKLLEESNESEVKSFGVIANTFYELEPVYADHYRNELGRKAWHL  239

Query  795   GPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAM  974
             GP+SL NRD E+KA RG++++IDEHECLKWL SK P+SV+Y+CFGS+  F+ +QL E+AM
Sbjct  240   GPVSLCNRDTEEKACRGREASIDEHECLKWLQSKEPNSVIYVCFGSMTVFSDAQLKEIAM  299

Query  975   GIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTK--GKGLIIRGWAPQVVILDHPAVG  1148
             G+E S + F+WV+R   + +  + +W+PEGFEER +  GKGLIIRGWAPQV+ILDH +VG
Sbjct  300   GLEASEVPFIWVVRKSAKSEGENLEWLPEGFEERIEGSGKGLIIRGWAPQVMILDHESVG  359

Query  1149  AFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL-DSDG  1325
              FVTHCGWNSTLEGV  G+PMVTWP++ EQF N K ++DI++ G GVG + W  +   + 
Sbjct  360   GFVTHCGWNSTLEGVSAGLPMVTWPMYGEQFYNAKFLSDIVKIGVGVGVQTWIGMGGGEP  419

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VK++ I +A++++M+G+E+EEMRSRAK     A++A+
Sbjct  420   VKKDVIEKAVRRIMVGDEAEEMRSRAKEFGKMARRAV  456



>ref|XP_010107901.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Morus notabilis]
 gb|EXC17301.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Morus notabilis]
Length=474

 Score =   480 bits (1235),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 237/460 (52%), Positives = 325/460 (71%), Gaps = 28/460 (6%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQ-LGFQME  254
             +LH+FFFP M+HGHMIPT+DMAKLF+ RGV++TIITTP N  + SK + +  Q L  +++
Sbjct  14    ELHIFFFPFMSHGHMIPTIDMAKLFSKRGVRSTIITTPLNAILLSKTIQQTNQFLVSEIQ  73

Query  255   IRLLEFPGVE-VGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
             I+ + FP  +  GLP+ C+ +D  P  D +  F++A A L+ PLE LL +  P CLVADM
Sbjct  74    IKTINFPCTDRSGLPQHCENIDSVPSQDMIAAFYEATAELREPLERLLSKHMPTCLVADM  133

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FFPWAT+AAAKF IPRL              S++ ++P+    SD E F IP+LP E+ +
Sbjct  134   FFPWATDAAAKFGIPRL--------------SIKAHEPYIRALSDFEPFVIPDLPGEISL  179

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
             T +++    R  VE+ M++ +   R SE +SYGV+ NSFY+LEP+YA+HY  VLGR+AW 
Sbjct  180   TTMELPELVRRNVESYMTKLLEEARESEVRSYGVVVNSFYDLEPEYADHYMKVLGRKAWH  239

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             +GP+SL N+D        K+  + +H CLKWLDSK P+S+VY+ FGSVA F  SQL E+A
Sbjct  240   IGPVSLCNKD-------DKEREVKQHNCLKWLDSKRPNSIVYVSFGSVAKFTDSQLAEIA  292

Query  972   MGIEDSGMDFVWVIRNKREEDNGSE-----KWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
              G+E SG +F+W +R  ++ ++ +E     KW+P+ FE+R +GKGL+IR WAPQV IL+H
Sbjct  293   SGLEASGHEFIWAVRRSKQNESENEERDEEKWLPKDFEKRMEGKGLVIRDWAPQVGILEH  352

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD  1316
              A+G FVTHCGWNSTLE V  GVPMVTWP+FAEQF NEKL+T ILR G GVG ++W R  
Sbjct  353   EAIGGFVTHCGWNSTLEAVSSGVPMVTWPMFAEQFFNEKLVTKILRIGVGVGVRKWVRFV  412

Query  1317  SDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              D VKREA+ +A+++VM GEE+EEM+ RAK +++ AK+A+
Sbjct  413   GDSVKREALDKAVRRVMEGEEAEEMKGRAKRLRETAKRAV  452



>emb|CDX76263.1| BnaA08g11370D [Brassica napus]
Length=490

 Score =   480 bits (1235),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 244/461 (53%), Positives = 324/461 (70%), Gaps = 16/461 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQME--  254
             LH+F FP MAHGHMIPTLDMAKLF+++G K+TI+TTP N  +    +  + Q    +E  
Sbjct  7     LHIFLFPYMAHGHMIPTLDMAKLFSTKGAKSTILTTPLNAKILENPIKSFNQDNPGLEDI  66

Query  255   -IRLLEFPGVEVGLPESCQRLD---QTPD---DDGLPRFFKACAMlqppledllqelrpd  413
              I +L FP  E+GLP+ C+  D     PD    D   +F  +    +  LE LLQ ++PD
Sbjct  67    TIHILHFPCTELGLPQGCENTDFFFSNPDLNTGDLNRKFLLSMEYFKEQLEQLLQTVKPD  126

Query  414   CLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNL  593
             CLVA+MF PWAT  A KF +PRL+FHGT + +LCA H LR++KP+ +V+S SE F IP L
Sbjct  127   CLVANMFLPWATKLAEKFGVPRLVFHGTGYFSLCASHCLRLHKPYKNVASSSEPFVIPEL  186

Query  594   PHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVL  773
             P ++ IT+ QV   E   V   M +FM+ +R SE  S+GV+ NSF+ELEP Y++ YK+ +
Sbjct  187   PGDIVITEEQVIEKEEESV---MGKFMKELRDSERSSFGVLVNSFHELEPAYSDFYKSSV  243

Query  774   GRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPS  953
              +RAWS+GPLSL NR+ ++KAERGKK++IDEHECLKWLDSK   SV+Y+ FG++ +F   
Sbjct  244   AKRAWSIGPLSLGNREFKEKAERGKKASIDEHECLKWLDSKRRESVIYLSFGTMLSFNNE  303

Query  954   QLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILD  1133
             QL E+A G++ SG DF+WV+ NK       E+W+PE FEE+ KG+GLIIRGWAPQVVILD
Sbjct  304   QLVEIAAGLDMSGHDFIWVV-NKSGSQGDKEEWLPERFEEKMKGRGLIIRGWAPQVVILD  362

Query  1134  HPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL  1313
             H AVG F+THCGWNS LEGV  G+PMVTWP+ AEQF NEKL+T +L+TG  VG K+  + 
Sbjct  363   HQAVGGFLTHCGWNSLLEGVASGLPMVTWPIGAEQFYNEKLVTQVLKTGVSVGVKKMMKP  422

Query  1314  DSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             D D + +E + +A+++VM G   EEMR RAK + D AK A+
Sbjct  423   DGDFITKEKVEKAVREVMAG---EEMRKRAKQLADMAKDAV  460



>ref|XP_011088228.1| PREDICTED: scopoletin glucosyltransferase-like [Sesamum indicum]
Length=464

 Score =   479 bits (1232),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 241/456 (53%), Positives = 317/456 (70%), Gaps = 20/456 (4%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             M  LH+F  P+ A+GHMIP LDM KLF SRG K TIITTP     F K V+   Q GF++
Sbjct  1     MDQLHIFLLPLTAYGHMIPALDMTKLFLSRGAKTTIITTPE----FVKEVEHIRQQGFEI  56

Query  252   EIRLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
              I  ++FP  +VG+ +          DD     F   A+ +P  E L +     CLVADM
Sbjct  57    GIECVKFP--QVGIRDG--------GDDAFSYQFAIYALQEPVEELLERLRPD-CLVADM  105

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FFPWA++AAAKF+IPRL FHGTS  A+    ++R+Y+PF  VS+D E F +P+LPH++  
Sbjct  106   FFPWASDAAAKFNIPRLAFHGTSCFAVSVAENMRLYRPFEKVSTDFEPFVVPDLPHQITF  165

Query  612   TKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWS  791
              + QVS  +R E+++   + +     S ++SYGVIFNSFYELEP+Y + YK + G  AW 
Sbjct  166   YRTQVSANDRGEIKSDFDKVLEEAIESVKRSYGVIFNSFYELEPEYLDRYKEIFGGNAWH  225

Query  792   VGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             VGPLSL N  + D+A RGK ++IDE EC KWLDSKNP+SV+Y+CFGS+A F+ SQLHE+A
Sbjct  226   VGPLSLCNDKI-DEAHRGKIASIDEQECRKWLDSKNPNSVIYLCFGSIAEFSDSQLHEIA  284

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
               +E SG +F+WV++       G EKW+PEGF+ERTKGKGLII GWAPQ++IL H AVGA
Sbjct  285   SALEVSGQEFIWVVKKSF---TGDEKWLPEGFKERTKGKGLIINGWAPQLLILSHAAVGA  341

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWK-RLDSDGV  1328
             FVTHCGWNSTLE V  GVPMVTWP+FAEQF NEKL+TD+L+ G  VG+++W   +  D V
Sbjct  342   FVTHCGWNSTLEAVAAGVPMVTWPLFAEQFYNEKLVTDVLKVGIPVGNRKWSVGVHDDEV  401

Query  1329  KREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             KRE IA+A++++M   ES E+R RA  + + A+KA+
Sbjct  402   KREEIAKALERIMSNVESLEIRRRAGELGEIARKAV  437



>ref|XP_006409549.1| hypothetical protein EUTSA_v10022663mg [Eutrema salsugineum]
 gb|ESQ51002.1| hypothetical protein EUTSA_v10022663mg [Eutrema salsugineum]
Length=484

 Score =   479 bits (1234),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 239/460 (52%), Positives = 316/460 (69%), Gaps = 13/460 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI-  257
             +HV FFP MA GHMIP LDMAKLF+SRG K+TIITTP N  +  K ++ +      +EI 
Sbjct  9     IHVCFFPFMAQGHMIPVLDMAKLFSSRGAKSTIITTPINSKILEKPIEAFKNQNPDLEIG  68

Query  258   -RLLEFPGVEVGLPESCQRLD-----QTPD-DDGLPRFFKACAMlqppledllqelrpdC  416
              ++ +FP VE+ LPE C+ +D     Q PD  D   +   +   ++  LE  ++  +P C
Sbjct  69    IKIFDFPSVELKLPEGCENVDFINSYQKPDAGDLFLKLLFSTKYMKQQLESFIETTKPSC  128

Query  417   LVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLP  596
             LVADMFFPWAT +A KF +PRL+FHGTS  +LC  +S+R +KP   V + S  F I  LP
Sbjct  129   LVADMFFPWATESAEKFGVPRLVFHGTSFFSLCCSYSMRTHKPHKKVPTSSTPFVITGLP  188

Query  597   HELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
              ++ IT+ Q +    +  E  M +FM+ VR SE  S+GV+ NSFYELEP YA+ Y++ + 
Sbjct  189   GDIVITEEQANI---ASEETPMGKFMKEVRESESNSFGVLVNSFYELEPAYADFYRSFVA  245

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             +RAW +GPLSL NR   +KAERGKKS IDE ECLKWLDSK P SVVY+ FGS  NF   Q
Sbjct  246   KRAWHIGPLSLSNRGFAEKAERGKKSNIDEQECLKWLDSKTPGSVVYVSFGSGTNFTNEQ  305

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A G+E S  +F+WV+R K +    +E+W+PEG+EERTKGKG+IIRGWAPQV+ILDH
Sbjct  306   LLEIAFGLEASCQNFIWVVR-KNDNQGENEEWLPEGYEERTKGKGIIIRGWAPQVLILDH  364

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD  1316
              +VG FVTHCGWNS LEG+  G+PMVTWP+ AEQF NEKL+T +LRTG  VG+ E  +  
Sbjct  365   KSVGGFVTHCGWNSALEGIAAGLPMVTWPMGAEQFYNEKLLTKVLRTGVNVGATELVK-K  423

Query  1317  SDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
                + RE + +A+++V+ GEE+EE R  AK + + AK A+
Sbjct  424   GKLISREEVNKAVREVIAGEEAEERRKWAKKLGEMAKAAV  463



>ref|XP_009117049.1| PREDICTED: UDP-glycosyltransferase 73B3-like [Brassica rapa]
Length=482

 Score =   479 bits (1232),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 244/462 (53%), Positives = 325/462 (70%), Gaps = 19/462 (4%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQME  254
             LHV FFP M +GHMIPTLDMAKLF+SRG K+TIITTP N  +  K ++ +  L  G ++E
Sbjct  11    LHVMFFPFMGYGHMIPTLDMAKLFSSRGAKSTIITTPLNAKILQKPINTFKSLNPGLKIE  70

Query  255   IRLLEFPGVEVGLPESCQRLD-----QTPDDDG--LPRFFKACAMlqppledllqelrpd  413
             I++++FP V++GLPE C+  D       PD+    + +FF +    +  LE +L+  RP 
Sbjct  71    IQIIDFPCVQLGLPEGCENPDFFTSNNNPDERQTMMLKFFASMRFFKDQLEKILETTRPS  130

Query  414   CLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLR-VYKPFNDVSSDSELFTIPN  590
             CL+ADMFFPWAT AA KF++PRL+FHGT + +LC+ H +R ++KP       SE F +P+
Sbjct  131   CLIADMFFPWATEAAEKFNVPRLVFHGTGYFSLCSEHCIRRMHKP----KMISEPFKVPD  186

Query  591   LPHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNV  770
             LP ++ +T+ Q+   +    E  M +F+  V  SE KS GV+ NSFYELEP+YA+ YK  
Sbjct  187   LPGDITMTQGQMRDLDE---ETDMGKFLIEVIESEVKSSGVVVNSFYELEPEYADFYKGS  243

Query  771   LGRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAP  950
                RAW +GPLS+ NR  E+KA+RGKK++IDE ECLKWL+SK   SVVY+ FGSVA    
Sbjct  244   GVTRAWHIGPLSVQNRGFEEKAKRGKKASIDEVECLKWLNSKKQDSVVYVSFGSVAYIKN  303

Query  951   SQLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVIL  1130
              QL E+A G+E  G  F+WV+R KR E  G E+W+PEGFEER KG+GLIIRGWAPQV+IL
Sbjct  304   EQLIEVAAGLEACGASFIWVVR-KRGESTGGEEWLPEGFEERVKGRGLIIRGWAPQVMIL  362

Query  1131  DHPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKR  1310
             DH A G FVTHCGWNS LEGV  G+PMVTWPV AEQF NE L+T +LRTG  VG+K+   
Sbjct  363   DHQATGVFVTHCGWNSVLEGVAAGLPMVTWPVGAEQFYNEILVTQVLRTGVSVGTKKHAS  422

Query  1311  LDSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             +  D + RE++ +A+++V++GEE+EE R RAK + + AK A+
Sbjct  423   M-GDFIGRESVEKAVREVLVGEEAEERRGRAKKLAEMAKAAV  463



>ref|XP_010068736.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=499

 Score =   479 bits (1232),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 235/465 (51%), Positives = 327/465 (70%), Gaps = 15/465 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             +HV FFP+MAHGHM+PTLDMA+LF +RG +ATIITTP N PVF  ++      G ++++R
Sbjct  9     VHVLFFPLMAHGHMLPTLDMARLFTARGARATIITTPHNAPVFQNSLQ--IDAGSRIDLR  66

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              +EFP  EVGLPE  + LD     D   +FF+A +ML  PLE L++EL PD LVAD+FFP
Sbjct  67    TIEFPTREVGLPEGLENLDMVTTQDIQLKFFRAISMLSRPLEALVEELAPDALVADIFFP  126

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             +A + AA   IPRL FHGTS  ++CA  S++ ++P   VSSD ELF +P LP E+ +T+ 
Sbjct  127   FANDIAAGHGIPRLAFHGTSFFSMCAAESVQRHRPHEKVSSDDELFRLPGLPDEIMMTRS  186

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+    +  VE   +  ++    +  + +G+I NSF+ELEP Y +HY+N LG+RAW +GP
Sbjct  187   QIRDELKISVETDFTRLLKRSHQAAGRCFGMIVNSFHELEPSYVDHYRNALGKRAWHIGP  246

Query  801   LSLYNRDVEDKAERGKKS-AIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             +SL NR++++KA+RG K  +ID HECLKWLDS+ P SVVY+CFG+ + F+ +QL E+A G
Sbjct  247   VSLCNRNLQEKAQRGGKGVSIDGHECLKWLDSRGPGSVVYVCFGTTSKFSDAQLQEIATG  306

Query  978   IEDSGMDFVWVIRNKREEDNGSE-----KWMPEGFEERTKGKGLIIRGWAPQVVILDHPA  1142
             +E SG DFVWV+   R+++ G+E      W+PEGF +R +G+GLIIRGWAPQV+ILDH +
Sbjct  307   LEASGQDFVWVVSRDRKQEKGNEGEGQDDWLPEGFGKRIQGRGLIIRGWAPQVLILDHRS  366

Query  1143  VGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTD--ILRTGTGVGSKEWKR--  1310
             VG FVTHCGWNS LEG+  G+PMVTWP+FAEQ    KL+T       G G G + W +  
Sbjct  367   VGGFVTHCGWNSVLEGISAGLPMVTWPIFAEQSTTRKLVTRGPWRIGGRGSGPRRWGKWV  426

Query  1311  ---LDSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
                 D + V ++ I +A+++VM+G+E+E MR RAK++ DKA++AI
Sbjct  427   GIVADREIVSKDRIEKALRQVMVGDEAEAMRDRAKLLADKARRAI  471



>ref|XP_007201019.1| hypothetical protein PRUPE_ppa005572mg [Prunus persica]
 gb|EMJ02218.1| hypothetical protein PRUPE_ppa005572mg [Prunus persica]
Length=454

 Score =   477 bits (1228),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 241/457 (53%), Positives = 320/457 (70%), Gaps = 36/457 (8%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH+FFFP MA GH IP +D+AKLFAS GVK+T+ITTP N P+FSKA+     LGF++E+
Sbjct  8     QLHMFFFPFMAQGHNIPFIDIAKLFASHGVKSTLITTPVNAPLFSKAIQSSKNLGFEIEL  67

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
              +++FP  EVGLP+ C+                   +L+P +E +L + RP CLVAD FF
Sbjct  68    LVIKFPNEEVGLPQGCE---------------STTFLLEPQIEQILDQHRPHCLVADSFF  112

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PWAT+ AAKF I RLIFHGT     CA  ++ +++P   V SDSELFTIPN   E+K+T+
Sbjct  113   PWATDVAAKFGISRLIFHGTGFFPSCASLTVILHQPHKKVESDSELFTIPNF--EIKMTR  170

Query  618   LQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
              Q+  F     E+ M++  +  R SEE+SYG+I NSFYELEPD+A+HY+NV GR+AW +G
Sbjct  171   TQILRFFEKNSESIMTKLFKESRESEERSYGIIVNSFYELEPDFADHYRNVFGRKAWHIG  230

Query  798   PLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMG  977
             P+            RG ++++DEHECL WL+SK P+SVVYICFGS  NFA  +L E+A+ 
Sbjct  231   PI------------RGMEASLDEHECLNWLNSKKPNSVVYICFGSQTNFADVELLEIALR  278

Query  978   IEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFV  1157
             +E SG +F+WV++ +++E +   +W+PEGFE R +GKGLIIRGW PQV+IL+H A+GAFV
Sbjct  279   LEASGQEFIWVVKKEKKEKD---EWLPEGFESRVEGKGLIIRGWGPQVLILEHQAIGAFV  335

Query  1158  THCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL----DSDG  1325
             THCGWNS LEGV  GVPM+TWPV AEQF NEKL+TDI  TG  VGSK+W           
Sbjct  336   THCGWNSILEGVSSGVPMITWPVSAEQFYNEKLVTDIHSTGVAVGSKQWASFVDVKKEAS  395

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             VKREAI +A+  VM+G+ +EEMR RA+ + + AK+A+
Sbjct  396   VKREAIEKAVTLVMVGDAAEEMRGRARTLGEMAKRAV  432



>ref|XP_010691724.1| PREDICTED: scopoletin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=517

 Score =   479 bits (1234),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 240/457 (53%), Positives = 325/457 (71%), Gaps = 11/457 (2%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGF-QMEI  257
             LH+ FFP MAHGHMIP LD A LFA+RG+KATIITTP N P+F++A     + G   +EI
Sbjct  44    LHIVFFPFMAHGHMIPMLDTATLFAARGIKATIITTPRNFPIFARA----NETGHPSIEI  99

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLP-RFFKACAMlqppledllqelrpdCLVADMF  434
              +  FP +E GLPE C+ L Q      +  +F K+ AML+  LE  L++ RP  LVADMF
Sbjct  100   EVFRFPSLENGLPEGCENLGQAMKSIEMAEKFIKSAAMLRQQLEQYLEKSRPHFLVADMF  159

Query  435   FPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKIT  614
             FPWAT  AAKF+IPRL+FHG S  A C    + VY+P+  VSSD + F IP LP+E+ +T
Sbjct  160   FPWATECAAKFNIPRLVFHGISFFAHCTKDMIMVYQPYKHVSSDEDPFVIPYLPNEITLT  219

Query  615   KLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSV  794
             + Q+        ++ + +    ++ SE + YGVI NSFYELEPDY + +K  LGRRAW +
Sbjct  220   RSQIPEDLMKHEQSELKKRHEKIQESELQCYGVIVNSFYELEPDYVDFFKKKLGRRAWHI  279

Query  795   GPLSLYNRDVEDKAER-GKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             GP+S  N+ ++DKA+R G +++++EHECLKWL+ + P+SV+YICFGS+ANF   QL E+A
Sbjct  280   GPVSSCNKSLKDKAQRGGGEASMNEHECLKWLNLRKPNSVIYICFGSLANFIVPQLQEIA  339

Query  972   MGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGA  1151
               +E    DF+WV+R+ R   N  E+W+P GF++RT+GKGL+I GW PQV+IL+H A GA
Sbjct  340   KALESLEYDFIWVLRDDRIAKN--EEWLPLGFKKRTQGKGLLIGGWVPQVLILEHEATGA  397

Query  1152  FVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDS--DG  1325
             FVTHCGWNSTLE +  G+PMVTWP+FAEQF NEKL+  IL+ GT VG+K+WK + S  D 
Sbjct  398   FVTHCGWNSTLEAISAGIPMVTWPLFAEQFYNEKLVNQILKIGTPVGAKKWKAVHSIEDV  457

Query  1326  VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             V+   I +AIK +M G+E++EMR+RAK +K+ A+KA+
Sbjct  458   VEHNDIEKAIKNIMEGDEAQEMRNRAKNLKEMARKAM  494



>ref|XP_004505250.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Cicer arietinum]
Length=508

 Score =   479 bits (1233),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 240/472 (51%), Positives = 336/472 (71%), Gaps = 13/472 (3%)
 Frame = +3

Query  39    KNFAVSSKDFAMG----DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPV  206
             KNF       +MG    DLH+  FP +A+GH+IP +D+A+LF SRG+K TIITT  N P+
Sbjct  22    KNFIKLFTKLSMGNENNDLHIILFPFLANGHIIPCIDLARLFFSRGLKVTIITTHLNVPL  81

Query  207   FSKAVDKYTQLGFQMEIRLLEFPGVE-VGLPESCQRLDQTPDDDGLPRFFKACAMlqppl  383
              S+ + K      ++ I+ ++FP  +  GLPE C+  +     D   +F KA  +L+ PL
Sbjct  82    ISRTIGKS-----KINIKTIQFPSPQHTGLPEGCENSESALAPDKFIKFMKATILLREPL  136

Query  384   edllqelrpdCLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSS  563
             E +LQ+ +P+CLV+DMFFPW+T++AAKF+IPR++FHG     LC +  +R YKP   VSS
Sbjct  137   EHVLQQEQPNCLVSDMFFPWSTDSAAKFNIPRIVFHGLGFFPLCVLACIRQYKPQEKVSS  196

Query  564   DSELFTIPNLPHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEP  743
              +E F +PNLP E+ +TK+Q+   +  + +   ++ +     SE KSYGVI NSFYELEP
Sbjct  197   YTEPFLVPNLPGEITLTKMQLP--QVPQHDKVFAQLLEESNESELKSYGVIANSFYELEP  254

Query  744   DYAEHYKNVLGRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYIC  923
              YA+HY+N LGR+AW +GP+SL NR+ E+KA RG++S+IDEHECLKWL SK P+SVVY+C
Sbjct  255   VYADHYRNELGRKAWHLGPVSLCNRETEEKACRGRESSIDEHECLKWLQSKQPNSVVYVC  314

Query  924   FGSVANFAPSQLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIR  1103
             FGS+  F  +QL E+AMG+E S + F+WV++   + +    +W+PEGFEER KGKGLIIR
Sbjct  315   FGSMTVFGDAQLKEIAMGLEASEVPFIWVVKKGAKSEGEKSEWLPEGFEERIKGKGLIIR  374

Query  1104  GWAPQVVILDHPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGT  1283
             GWAPQV+ILDH  VG FVTHCGWNSTLEGVCGG  MVTWP++ EQF N K ++D+++ G 
Sbjct  375   GWAPQVMILDHECVGGFVTHCGWNSTLEGVCGGCSMVTWPMYGEQFYNAKFLSDVVKIGV  434

Query  1284  GVGSKEWKRL-DSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             GVG + W  +   + VK++ I +A+K++M+G+E+EEMR+RAK   + AK+A+
Sbjct  435   GVGVQTWIGMGGGEVVKKDVIEKAVKRIMVGDEAEEMRNRAKEFGNMAKRAV  486



>gb|KFK30050.1| hypothetical protein AALP_AA7G210500 [Arabis alpina]
Length=490

 Score =   478 bits (1231),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 242/464 (52%), Positives = 332/464 (72%), Gaps = 16/464 (3%)
 Frame = +3

Query  72    MGDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQM  251
             +  LH   FP MAHGHMIPTLDMAKLFA++G K+TI+TTP N  +F K +  +     ++
Sbjct  7     ISKLHFLLFPFMAHGHMIPTLDMAKLFATKGAKSTILTTPLNSILFEKPIKSFNNENPKL  66

Query  252   E---IRLLEFPGVEVGLPESCQRLD---QTPD---DDGLPRFFKACAMlqppledllqel  404
             E   I++L FP  E+ LP+ C+  D    +PD    +   +F  A +  +  LE +L+ +
Sbjct  67    ENITIKILNFPCTELCLPQGCENTDFIFSSPDLSKGELNLKFLLAMSYFEEQLEHVLETM  126

Query  405   rpdCLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTI  584
             +PDCLVA+MFFPWAT  A KF++PRL+FHGT + +LCA H LR++KP+ +V+S  E F I
Sbjct  127   KPDCLVANMFFPWATKVAEKFNVPRLVFHGTGYFSLCASHCLRLHKPYKNVASSCEPFVI  186

Query  585   PNLPHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYK  764
             P+LP ++ IT+ Q+   E   V   M +FM+ +R +E  S+GV+ NSFYELEP Y++ +K
Sbjct  187   PDLPGDIVITEEQIIEKEEESV---MGKFMKEMRETERNSFGVLVNSFYELEPAYSDFFK  243

Query  765   NVLGRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANF  944
             + + +RAW++GPLSL NR+ ++KAERGKK++IDEHECLKWLDSK   SV+Y+ FG++ +F
Sbjct  244   SSVAKRAWNIGPLSLGNREFKEKAERGKKASIDEHECLKWLDSKRCDSVIYLSFGTMTSF  303

Query  945   APSQLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVV  1124
                QL E+A G+E SG DFVWV+ NK       E+W+PEGFEERTKGKGLIIRGWAPQV+
Sbjct  304   NNEQLIEIAAGLEMSGHDFVWVV-NKNGIKGEKEEWLPEGFEERTKGKGLIIRGWAPQVL  362

Query  1125  ILDHPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEW  1304
             ILDH A+G F+THCGWNSTLEGV  G+PMVTWPV AEQF NEKL+T +L+TG  VG K+ 
Sbjct  363   ILDHQAIGGFLTHCGWNSTLEGVASGLPMVTWPVGAEQFYNEKLVTQVLKTGVSVGVKKM  422

Query  1305  KRLDSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              ++  D + RE + +A+++VM+G+E    R RAK + + AK A+
Sbjct  423   MKVVGDFISREKVDKAVREVMVGKER---RRRAKELAEMAKDAV  463



>ref|XP_010263455.1| PREDICTED: scopoletin glucosyltransferase-like [Nelumbo nucifera]
Length=496

 Score =   478 bits (1231),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 244/463 (53%), Positives = 319/463 (69%), Gaps = 14/463 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LHVF FP MAHGHMIP +DMA+ FA RGVK TI+TTP N  + SK VD+  +LG +++I 
Sbjct  8     LHVFLFPFMAHGHMIPFMDMARQFALRGVKVTIVTTPLNAILLSKTVDRDRELGIEIDIH  67

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
              + FP  E GLPE C+ ++     +    FFKA  MLQ P + LL+E  PDC+VADMFFP
Sbjct  68    SIPFPTKEAGLPEGCENVNSITTPELSSNFFKALNMLQQPFQKLLEEHHPDCIVADMFFP  127

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             W T+ A K  IPRL+FHG+   + C   S+  Y P N+VSS++E F +P LP  +++TK 
Sbjct  128   WTTDFAGKLGIPRLVFHGSCFFSSCVPDSISRYAPHNNVSSETETFVVPGLPDPIEMTKS  187

Query  621   QVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGP  800
             Q+   +  +++N  +  M  ++ +E KSYGV+ NSFYELEP YAEHY+ V+GRRAW +GP
Sbjct  188   QLP--DHMKIQNDFTRAMEQIKEAEVKSYGVVMNSFYELEPAYAEHYRKVMGRRAWHIGP  245

Query  801   LSLYNRDVEDKA---ERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMA  971
             LSLYNR+   KA    RG  ++IDE+ECL WLDSK P SV+Y+CFGS  +F+  QL E+A
Sbjct  246   LSLYNREKIGKAAQSRRGNTASIDENECLTWLDSKEPDSVLYVCFGSGPSFSTDQLVEIA  305

Query  972   MGIEDSGMDFVWVIRNKREEDNGS----EKWMPEGFEERTKGKGLIIRGWAPQVVILDHP  1139
             MG+E SG  F+WV+R K E   GS    E W+P+GFE+R   KGLIIRGWAPQV+IL H 
Sbjct  306   MGLEASGHAFIWVVR-KDETSAGSVAEVEPWLPQGFEDRVGSKGLIIRGWAPQVLILQHH  364

Query  1140  AVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL--  1313
             A+G FVTHCGWNS LE VC GVP++TWPV AEQF NEKL+T +LR G  VG + W     
Sbjct  365   AIGGFVTHCGWNSLLESVCVGVPLITWPVTAEQFYNEKLVTQVLRIGVPVGVQHWNSWLG  424

Query  1314  -DSDGVKREAIAEAIKKVMI-GEESEEMRSRAKVMKDKAKKAI  1436
                  VKRE I +A+ ++M  G+E+ +M+ R K +K+ AK+AI
Sbjct  425   KREHLVKREEIKKAVTRLMDGGDEAAQMKGRVKELKEMAKRAI  467



>ref|XP_002883897.1| UDP-glucosyl transferase 73B5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60156.1| UDP-glucosyl transferase 73B5 [Arabidopsis lyrata subsp. lyrata]
Length=484

 Score =   478 bits (1229),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 232/460 (50%), Positives = 317/460 (69%), Gaps = 13/460 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI-  257
             +H+ FFP MA GHMIP LDMAKLF+SRG K+T++TTP N  +F K+++ +      +EI 
Sbjct  9     IHILFFPFMAQGHMIPILDMAKLFSSRGAKSTLLTTPINAKIFEKSIEAFKNQNPDLEIG  68

Query  258   -RLLEFPGVEVGLPESCQRLD------QTPDDDGLPRFFKACAMlqppledllqelrpdC  416
              ++  FP VE+GLPE C+  D      ++   D   +F  +   ++  LE  ++  +P  
Sbjct  69    IKIFNFPCVELGLPEGCENADFINSYQKSDSGDLFLKFLFSTKYMKQQLESFIETTKPSA  128

Query  417   LVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLP  596
             LVADMFFPWAT +A KF +PRL+FHGTS  +LC  +++R++KP   V++ S  F IP LP
Sbjct  129   LVADMFFPWATESAEKFGVPRLVFHGTSFFSLCCSYNMRIHKPHKKVATSSTPFVIPGLP  188

Query  597   HELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
              E+ IT+ Q +    +  E  M +FM+ VR SE  S+GV+ NSFYELE  YA+ Y++ + 
Sbjct  189   GEIVITEDQANV---ANEETPMGKFMKEVRESETNSFGVLVNSFYELESAYADFYRSFVA  245

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             +RAW +GPLSL NR+  +KA RGKK+ IDE ECLKWLDSK P SV+Y+ FGS  NF   Q
Sbjct  246   KRAWHIGPLSLSNREFAEKAGRGKKANIDEQECLKWLDSKTPGSVIYLSFGSGTNFTNDQ  305

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A G+E SG +F+WV+R K E    +E+W+PEGFEERT GKGLIIRGWAPQV+ILDH
Sbjct  306   LLEIAFGLEGSGQNFIWVVR-KNENQGENEEWLPEGFEERTTGKGLIIRGWAPQVLILDH  364

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD  1316
              A+G FVTHCGWNS +EG+  G+PMVTWP+ AEQF NEKL+T +LR G  VG+ E  +  
Sbjct  365   KAIGGFVTHCGWNSAIEGIAAGLPMVTWPMGAEQFYNEKLLTKVLRIGVNVGATELVK-K  423

Query  1317  SDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
                + RE + +A+++V+ GE++EE R  AK + + AK A+
Sbjct  424   GKLISREQVEKAVREVIAGEKAEERRLCAKKLGEMAKAAV  463



>ref|XP_010447136.1| PREDICTED: UDP-glycosyltransferase 73B1 isoform X1 [Camelina 
sativa]
 ref|XP_010447137.1| PREDICTED: UDP-glycosyltransferase 73B1 isoform X2 [Camelina 
sativa]
Length=492

 Score =   478 bits (1229),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 249/462 (54%), Positives = 322/462 (70%), Gaps = 17/462 (4%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVF-SKAVDKYTQLGFQME-  254
             LH   FP MAHGHMIPTLDMAKLFA++G K+TI+TT  N  +F  K +  + Q    +E 
Sbjct  10    LHFLLFPFMAHGHMIPTLDMAKLFATKGAKSTILTTSLNSKLFFEKPIKSFNQENPGLED  69

Query  255   --IRLLEFPGVEVGLPESCQRLD---QTPD---DDGLPRFFKACAMlqppledllqelrp  410
               I +L FP  E+GLPE C+  D    +PD    D   +F  A    + PLE +L+  +P
Sbjct  70    ISIEILNFPCTELGLPEGCENSDFIFSSPDLAKGDLSQKFLLAMKYFEEPLEKVLETTKP  129

Query  411   dCLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPN  590
             DCLV +MFFPWAT  A KF +PRL+FHGT   ++CA H +R++KP+ +V+S SELF IP 
Sbjct  130   DCLVGNMFFPWATKVAEKFGVPRLVFHGTGCFSICASHCIRLHKPYENVASSSELFVIPE  189

Query  591   LPHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNV  770
             LP ++ IT+ QV   E   V   M +FM+ +R SE +S+GV+ NSFYELEP Y++  K+ 
Sbjct  190   LPGDIVITEEQVIEKEEESV---MGKFMKEIRESERESFGVLVNSFYELEPAYSDFLKSF  246

Query  771   LGRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAP  950
             + +RAW +GPLSL NR  E+KA RGKK++IDEHECLKWLDSK   SVVY+ FG++++F  
Sbjct  247   VAKRAWLIGPLSLGNRKFEEKAGRGKKASIDEHECLKWLDSKKCDSVVYLSFGTMSSFNN  306

Query  951   SQLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVIL  1130
              QL E+A G+E SG DFVWV+ NK       E+W+PEGFEE+TKGKGLIIRGWAPQV+IL
Sbjct  307   EQLIEIAAGLEMSGHDFVWVV-NKNGSQGEKEEWLPEGFEEKTKGKGLIIRGWAPQVLIL  365

Query  1131  DHPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKR  1310
             DH A+G FVTHCGWNS LEGV  G+PMVTWPV AEQF NEKL+T +L+TG  VG K+  +
Sbjct  366   DHQALGGFVTHCGWNSLLEGVAAGLPMVTWPVGAEQFYNEKLVTQVLKTGVSVGVKKLMQ  425

Query  1311  LDSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             +  D + RE +  A+K+VM+GEE    R RAK +   AK A+
Sbjct  426   VVGDFISREKVERAVKEVMVGEER---RKRAKELGKMAKNAV  464



>ref|XP_006283463.1| hypothetical protein CARUB_v10004508mg [Capsella rubella]
 gb|EOA16361.1| hypothetical protein CARUB_v10004508mg [Capsella rubella]
Length=554

 Score =   480 bits (1235),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 252/462 (55%), Positives = 323/462 (70%), Gaps = 17/462 (4%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVF-SKAVDKYTQLGFQME-  254
             LH   FP MAHGHMIPTLDMAKLFA++G K+TI+TTP N  +F  K +  + Q    +E 
Sbjct  63    LHFLLFPFMAHGHMIPTLDMAKLFATKGAKSTILTTPLNSKLFFEKPIKSFNQENPGLED  122

Query  255   --IRLLEFPGVEVGLPESCQRLD---QTPD---DDGLPRFFKACAMlqppledllqelrp  410
                ++L+FP  E+GLPE C+  D    +PD    D   +F  A    Q PLE +L+ ++P
Sbjct  123   ITTQILDFPCTELGLPEGCENTDFIFSSPDLDKGDLGQKFLLAMKYFQEPLEHVLETMKP  182

Query  411   dCLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPN  590
             DCLV +MFFPWAT  A KF +PRL+FHGT   +LCA H LR++KP+ +V+S SELF IP 
Sbjct  183   DCLVGNMFFPWATKVAEKFGVPRLVFHGTGCFSLCASHCLRLHKPYKNVASSSELFVIPE  242

Query  591   LPHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNV  770
             LP ++ IT+ QV   E   V   M +FM+ +R SE +S+GV+ NSFYELEP YA   K  
Sbjct  243   LPGDIVITEEQVIEKEEESV---MGKFMKGIRESERESFGVLVNSFYELEPAYAGFLKRF  299

Query  771   LGRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAP  950
             + RRAW +GPLSL NR  E+KA RGKK++IDEHECLKWLDSK   SVVY+ FG++++F  
Sbjct  300   VARRAWHIGPLSLGNRKFEEKAGRGKKASIDEHECLKWLDSKKCDSVVYLSFGTMSSFNK  359

Query  951   SQLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVIL  1130
              QL E+A G+E SG DFVWV+ NK       E+W+PEGFEE+TKGKGLIIRGWAPQV+IL
Sbjct  360   DQLIEIAAGMEMSGHDFVWVV-NKYGSQGEKEEWLPEGFEEKTKGKGLIIRGWAPQVLIL  418

Query  1131  DHPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKR  1310
             +H A+G FVTHCGWNS LEGV  G+PMVTWPV AEQF NEKL+T +L+TG  VG K+  +
Sbjct  419   EHQAIGGFVTHCGWNSLLEGVASGLPMVTWPVGAEQFYNEKLVTQVLKTGVSVGVKKMMK  478

Query  1311  LDSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             +  D + RE +  A+K+VM G+E    R RAK + + AK A+
Sbjct  479   VVGDFISREKVERAVKEVMAGDER---RKRAKELGEMAKTAV  517



>gb|AFJ52946.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=496

 Score =   477 bits (1228),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 233/457 (51%), Positives = 322/457 (70%), Gaps = 6/457 (1%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LH  FFP MA GHMIP +DMA+LFA RG K+TI+TTP N P+FS  + + TQ G Q++  
Sbjct  6     LHAVFFPFMAQGHMIPLVDMARLFARRGAKSTIVTTPLNAPLFSDKIKRETQQGLQIQTH  65

Query  261   LLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFP  440
             +++FP +E GLPE C+ +        + +FF +  + + P+E+LL+  +PDC+VAD+ F 
Sbjct  66    VIDFPFLEAGLPEGCENVTSLKSPAMIFQFFLSMHVFKQPIEELLKLWKPDCIVADVVFH  125

Query  441   WATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKL  620
             WAT +A +  IPRL F+GT   ++C +   + Y P   V SDSE   +P LPH+++  K 
Sbjct  126   WATESAHRLGIPRLFFNGTGSFSMCLIDCFKRYDPCKGVESDSEPVVLPGLPHKIEFKKS  185

Query  621   QVSPFERSE-VENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVG  797
             Q+ PF + E V++ + E    +  SEE+S+G + NSF+ELEP Y+EHY+ V+GR+AW VG
Sbjct  186   QLPPFWKGEKVDDKIEELRHLIDKSEEESFGAVVNSFHELEPGYSEHYREVIGRKAWFVG  245

Query  798   PLSLYNRDVE-DKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAM  974
             PLS+ N+D   DKA+RG  +AID  +CL+WLD + P+SV+YICFGS++    +QL E+A 
Sbjct  246   PLSVCNKDTTLDKADRGDAAAIDGRQCLRWLDGRVPNSVLYICFGSISGLPDAQLLEIAA  305

Query  975   GIEDSGMDFVWVIRNKRE---EDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAV  1145
              +E SG  F+WV++   +    +   E+W+P+GFEER +GKGLIIRGWAPQV+ILDH A 
Sbjct  306   ALEASGQSFIWVVKKGAKGISTEEEKEEWLPKGFEERMEGKGLIIRGWAPQVLILDHLAT  365

Query  1146  GAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD-SD  1322
             G F+THCGWNSTLEGV  GVPMVTWP+ AEQF+NEKL+TD+LR G GVGS+EW R +   
Sbjct  366   GGFMTHCGWNSTLEGVAAGVPMVTWPLQAEQFLNEKLVTDVLRVGVGVGSQEWSRGEWKT  425

Query  1323  GVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKA  1433
              V RE I  A+++VM+GE +EEMR RA  +K+KA KA
Sbjct  426   VVGREDIERAVRQVMVGEHAEEMRERAMELKEKAVKA  462



>gb|AGU14082.1| UDP-glycosyltransferase [Cicer arietinum]
Length=476

 Score =   476 bits (1226),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 235/455 (52%), Positives = 330/455 (73%), Gaps = 9/455 (2%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
             DLH+  FP +A+GH+IP +D+A+LF SRG+K TIITT  N P+ S+ + K      ++ I
Sbjct  7     DLHIILFPFLANGHIIPCIDLARLFFSRGLKVTIITTHLNVPLISRTIGKS-----KINI  61

Query  258   RLLEFPGVE-VGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMF  434
             + ++FP  +  GLPE C+  +     D   +F KA  +L+ PLE +LQ+ +P+CLV+DMF
Sbjct  62    KTIQFPSPQHTGLPEGCENSESALAPDKFIKFMKATILLREPLEHVLQQEQPNCLVSDMF  121

Query  435   FPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKIT  614
             FPW+T++AAKF+IPR++FHG     LC +  +R YKP   VSS +E F +PNLP E+ +T
Sbjct  122   FPWSTDSAAKFNIPRIVFHGLGFFPLCVLACIRQYKPQEKVSSYTEPFLVPNLPGEITLT  181

Query  615   KLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSV  794
             K+Q+   +  + +   ++ +     SE KSYGVI NSFYELEP YA+HY+N LGR+AW +
Sbjct  182   KMQLP--QVPQHDKVFAQLLEESNESELKSYGVIANSFYELEPVYADHYRNELGRKAWHL  239

Query  795   GPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAM  974
             GP+SL NR+ E+KA RG++S+IDEHECLKWL SK P+SVVY+CFGS+  F  +QL E+AM
Sbjct  240   GPVSLCNRETEEKACRGRESSIDEHECLKWLQSKQPNSVVYVCFGSMTVFGDAQLKEIAM  299

Query  975   GIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAF  1154
             G+E S + F+WV++   + +    +W+PEGFEER KGKGLIIRGWAPQV+ILDH  VG F
Sbjct  300   GLEASEVPFIWVVKKGAKSEGEKSEWLPEGFEERIKGKGLIIRGWAPQVMILDHECVGGF  359

Query  1155  VTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL-DSDGVK  1331
             VTHCGWNSTLEGVCGG  MVTWP++ EQF N K ++D+++ G GVG + W  +   + VK
Sbjct  360   VTHCGWNSTLEGVCGGCSMVTWPMYGEQFYNAKFLSDVVKIGVGVGVQTWIGMGGGEVVK  419

Query  1332  REAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             ++ I +A+K++M+G+E+EEMR+RAK   + AK+A+
Sbjct  420   KDVIEKAVKRIMVGDEAEEMRNRAKEFGNMAKRAV  454



>ref|XP_007153574.1| hypothetical protein PHAVU_003G047000g [Phaseolus vulgaris]
 gb|ESW25568.1| hypothetical protein PHAVU_003G047000g [Phaseolus vulgaris]
Length=461

 Score =   476 bits (1224),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 238/462 (52%), Positives = 329/462 (71%), Gaps = 16/462 (3%)
 Frame = +3

Query  75    GDLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQME  254
               LH+FFFP +AHGH IP +DMA LFA++GV+ TIITTP N P+ SKA++K  ++  Q  
Sbjct  6     ASLHIFFFPFLAHGHTIPCIDMAILFAAKGVRTTIITTPLNAPIISKAIEKTKEINIQT-  64

Query  255   IRLLEFPGVE-VGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADM  431
                ++FP  +  GLP+ C+ +   P    LP F KA  +LQ P E LL++  P+C+VADM
Sbjct  65    ---IKFPSTDHTGLPQGCEHVSTLPSLHLLPAFHKATTLLQEPFEQLLRDQHPNCVVADM  121

Query  432   FFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKI  611
             FFPW T++AAKF IPRL+FHG S  +LCA   +R+Y+P+N+ S DSELF +PN P ++K+
Sbjct  122   FFPWTTDSAAKFGIPRLVFHGMSFFSLCAYEVMRLYEPYNNTSFDSELFLLPNFPGQIKM  181

Query  612   TKLQV-SPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAW  788
             T+LQV S F +++VE   + F + +  SE +SYGV+ NS YE+E DYA+HY+   GR+AW
Sbjct  182   TRLQVGSFFRKNDVE--ANRFWKQIHESEVRSYGVVVNSVYEVEKDYADHYRKEFGRKAW  239

Query  789   SVGPLSLYNRDVEDKAERGKKSA-IDEHE--CLKWLDSKNPHSVVYICFGSVANFAPSQL  959
             ++GPLSL N++ E K  RG K A +DE E   LKWL++K   SVVY+CFGS+  F  SQ 
Sbjct  240   AIGPLSLCNKEKEPKTYRGGKEACVDEMENAWLKWLNTKTTGSVVYVCFGSMTEFRDSQS  299

Query  960   HEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHP  1139
              E+A+G+E SG +F+WV+  ++E  N  ++W+PEGFE+R K KG+IIRGW PQ +IL+H 
Sbjct  300   REIALGLEASGKEFMWVVGKRKE--NKEDQWLPEGFEKRMKEKGMIIRGWVPQALILEHE  357

Query  1140  AVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL--  1313
             A+GAFVTHCGWNSTLEGV  GVPM+TWPV AEQF NE+L+ ++L+ G  VG+++W     
Sbjct  358   AIGAFVTHCGWNSTLEGVVAGVPMITWPVGAEQFYNERLVIEVLKIGVAVGARKWSHFVG  417

Query  1314  DSDG-VKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             D DG +K +A+  A+K+VM  EE E +R RAK+    AK+A+
Sbjct  418   DEDGDIKWDAVEMAVKRVMEEEEGEAIRIRAKLFARMAKRAV  459



>ref|XP_011009740.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=392

 Score =   473 bits (1216),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 214/341 (63%), Positives = 272/341 (80%), Gaps = 0/341 (0%)
 Frame = +3

Query  414   CLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNL  593
             C+VADMFFPWAT+AAAKF IPRL+FHGTS+ AL A   +R+Y+P   VSSDSE F +P+L
Sbjct  30    CIVADMFFPWATDAAAKFGIPRLLFHGTSNFALSASECMRLYEPHKKVSSDSEPFVVPDL  89

Query  594   PHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVL  773
             P ++K+TK Q+  F R + EN  S+F+++ + +E +S+GV+ NSFYELEP YA++Y+ VL
Sbjct  90    PGDIKLTKKQLPDFAREDAENDFSKFLKASKEAELRSFGVVVNSFYELEPAYADYYRLVL  149

Query  774   GRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPS  953
             GRRAW+VGP+SL NRD EDKA RGK+++ID+HECLKWLDSK P+SVVYICFGS+  F  S
Sbjct  150   GRRAWNVGPVSLCNRDTEDKAGRGKETSIDQHECLKWLDSKKPNSVVYICFGSMTVFTDS  209

Query  954   QLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILD  1133
             QL E+A G+E SG  F+WV+R  +      E W+PEGFEER +G GLIIRGWAPQV+ILD
Sbjct  210   QLKEIAAGLEASGQQFIWVVRRNKNGQEDKEDWLPEGFEERMEGMGLIIRGWAPQVLILD  269

Query  1134  HPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRL  1313
             H A+GAFVTHCGWNSTLEG+  G PMVTWP+FAEQF NEKL+TD+L+TG GVG KEW R+
Sbjct  270   HEAIGAFVTHCGWNSTLEGITAGKPMVTWPIFAEQFYNEKLVTDVLKTGVGVGVKEWVRV  329

Query  1314  DSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
               D VK EA+   I ++M+GEE+EEMRSRAK + + A+KA+
Sbjct  330   HGDHVKSEAVERTITQIMVGEEAEEMRSRAKKLGETARKAV  370



>gb|KFK30045.1| hypothetical protein AALP_AA7G209900 [Arabis alpina]
Length=476

 Score =   475 bits (1223),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 243/460 (53%), Positives = 322/460 (70%), Gaps = 19/460 (4%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQME  254
             LHV FFP MAHGHMIP LD+AKLF+SRG K+TI+TTP N  +  K +D +       Q++
Sbjct  9     LHVMFFPFMAHGHMIPALDLAKLFSSRGAKSTILTTPLNSKILQKPIDAFKNRNPSLQID  68

Query  255   IRLLEFPGVEVGLPESCQRLD----QTPDDDG--LPRFFKACAMlqppledllqelrpdC  416
             + + +FP V++GLPE C+ +D        D G  + +FFK+    +  LE LL+  RPDC
Sbjct  69    LEIFDFPCVQLGLPEGCENVDFFTSNRNSDVGYMIFKFFKSTKFFKDQLEKLLETTRPDC  128

Query  417   LVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLP  596
             L+ADMFFPWAT AA KF +PR +FHGT + +L   + +RV++P   ++S SE F IP+LP
Sbjct  129   LIADMFFPWATEAAEKFQVPRFVFHGTGYFSLSTGYCIRVHQPQKRIASSSEPFVIPDLP  188

Query  597   HELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
              ++ +T+ Q+      E E+ M +FM  VR SE KS GV+ NSFYELEPDYA+ YK  + 
Sbjct  189   GDIVLTQDQIID---GEDESEMGKFMTEVRESEVKSSGVVVNSFYELEPDYADFYKRFVA  245

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             +RAW +GPLS+ NR  EDK ERGKK+ IDE ECLKWLDSK P SV+Y+ FGS+A+F   Q
Sbjct  246   KRAWHIGPLSVLNRGFEDKVERGKKTTIDEMECLKWLDSKKPESVIYVSFGSMASFKNEQ  305

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A G+E SG +F+WV+R K E D   E+W+P GFEER K KG+IIRGWAPQV+ILDH
Sbjct  306   LIEIAAGLEASGTNFIWVVR-KNEGDK--EEWLPNGFEERVKEKGMIIRGWAPQVLILDH  362

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD  1316
              A G FVTHCGWNS LEGV  G+PMVTWPV AEQF NEKL+T++LR G  VG++      
Sbjct  363   KATGGFVTHCGWNSILEGVAAGLPMVTWPVEAEQFYNEKLVTEVLRIGVSVGARR-----  417

Query  1317  SDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
                + RE + +A+++V++GEE+EE + R K + + AK A+
Sbjct  418   EGFISREKVEKAVREVLVGEEAEERQGRVKKLAEMAKAAV  457



>emb|CDY36633.1| BnaA07g04240D [Brassica napus]
Length=484

 Score =   476 bits (1224),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 240/460 (52%), Positives = 323/460 (70%), Gaps = 13/460 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQME  254
             +HV FFP MAHGHMIP LDMAKLF+SRG K+TIITTP+N  +  K ++ +     G ++ 
Sbjct  9     IHVCFFPFMAHGHMIPILDMAKLFSSRGAKSTIITTPSNSKILEKPIEAFRNQNPGLEIG  68

Query  255   IRLLEFPGVEVGLPESCQRLD-----QTPDDDGLP-RFFKACAMlqppledllqelrpdC  416
             IR+ +FP VE+GLPE C+ +D     Q PD   L  +F  +   ++   E  ++  +P C
Sbjct  69    IRIFDFPSVELGLPEGCENVDFINSNQKPDAGDLSLKFLFSTKHMKQQWESFIETTKPSC  128

Query  417   LVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLP  596
             +VADMFFPWAT AA KF +PRL+FHGTS  +LC  +++R +KP   V++ S  F IP LP
Sbjct  129   IVADMFFPWATEAAEKFGVPRLVFHGTSFFSLCCSYNMRTHKPHKKVATTSTPFVIPGLP  188

Query  597   HELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
              ++ IT  Q +    ++ E  M +FM+ VR SE  S+GV+ NSFYELE  YA+ Y+  + 
Sbjct  189   GDIVITAEQAN---VADEETPMGKFMKEVRESESISFGVLVNSFYELESTYADFYRCFVA  245

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             +RAW +GPLSL N ++ +KA RGKK++IDE ECL+WLDSK P SVVY+ FGS  NF   Q
Sbjct  246   KRAWHIGPLSLSNTEIAEKAGRGKKASIDERECLQWLDSKTPGSVVYMSFGSGTNFTNEQ  305

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A G+E SG +F+WV+R K      +E+W+PEGFEERTKGKGLIIRGWAPQV+ILDH
Sbjct  306   LLEIAAGLEGSGQNFIWVVR-KNNNKGENEEWLPEGFEERTKGKGLIIRGWAPQVLILDH  364

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD  1316
              AVG FVTHCGWNS +EG+  G+PMVTWP+ AEQF NEKL+T +L+TG  VG+ E  +  
Sbjct  365   KAVGGFVTHCGWNSAIEGIAAGLPMVTWPMGAEQFYNEKLLTKVLKTGVNVGATELVK-K  423

Query  1317  SDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
                + RE + +A+++V++GEE+EE R RAK + + AK A+
Sbjct  424   GKLISREEVEKAVREVIVGEEAEERRERAKKLGEMAKAAV  463



>emb|CDX75399.1| BnaA01g03030D [Brassica napus]
Length=482

 Score =   475 bits (1223),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 240/462 (52%), Positives = 325/462 (70%), Gaps = 19/462 (4%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQME  254
             LHV FFP M +GHMIPTLDMAKLF+SRG K+TIITTP N  +  K ++ +  L    ++E
Sbjct  11    LHVMFFPFMGYGHMIPTLDMAKLFSSRGAKSTIITTPLNAKILQKPINTFKSLNPSLKIE  70

Query  255   IRLLEFPGVEVGLPESCQRLD-----QTPDDDG--LPRFFKACAMlqppledllqelrpd  413
             I++++FP V++GLPE C+  D       PD+    + +FF A +  +  LE +L+  RP 
Sbjct  71    IQIIDFPCVQLGLPEGCENPDFFTSNNNPDERQTMMLKFFAAMSFFKDQLEKILETTRPS  130

Query  414   CLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLR-VYKPFNDVSSDSELFTIPN  590
             CL+ADMFFPWAT +A KF++PRL+FHGT + +LC+ H +R ++KP        E F IP+
Sbjct  131   CLIADMFFPWATESAQKFNVPRLVFHGTGYFSLCSEHCIRRMHKP----KKICEPFKIPD  186

Query  591   LPHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNV  770
             LP ++ +T+ Q+   +    E  M +F+  V  SE KS GV+ NSFYELEP+YA+ YK+ 
Sbjct  187   LPGDIMMTQGQMRDLDE---ETEMGKFLIEVIESEVKSSGVVVNSFYELEPEYADFYKSS  243

Query  771   LGRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAP  950
             +  +AW +GPLS+ NR  E+KA+RGKK++IDE ECLKWL+SK   SV+Y+ FGSVA    
Sbjct  244   VVTKAWHIGPLSVQNRGFEEKAKRGKKASIDEVECLKWLNSKKQDSVIYVSFGSVAYIKN  303

Query  951   SQLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVIL  1130
              QL E+A G+E  G  F+WV+R KR E  G E+W+PEGFEER KG+G+IIRGWAPQV+IL
Sbjct  304   EQLLEIAAGLEACGASFIWVVR-KRGESKGEEEWLPEGFEERVKGRGMIIRGWAPQVMIL  362

Query  1131  DHPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKR  1310
             DH A G FVTHCGWNS LEGV  G+PMVTWPV AEQF NE L+T +LRTG  VG+K+   
Sbjct  363   DHQATGVFVTHCGWNSVLEGVAAGLPMVTWPVGAEQFYNEILVTQVLRTGVSVGTKKHAS  422

Query  1311  LDSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             +  D + RE + +A+++V++GEE+EE R RAK + + AK A+
Sbjct  423   M-GDFIARENVEKAVREVLVGEEAEERRGRAKKLAEMAKVAV  463



>gb|AID60124.1| UDP-glucosyl transferase 73B3 [Brassica napus]
 gb|AID60167.1| UDP-glucosyl transferase 73B3 [Brassica napus]
Length=479

 Score =   475 bits (1223),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 240/462 (52%), Positives = 325/462 (70%), Gaps = 19/462 (4%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLG--FQME  254
             LHV FFP M +GHMIPTLDMAKLF+SRG K+TIITTP N  +  K ++ +  L    ++E
Sbjct  8     LHVMFFPFMGYGHMIPTLDMAKLFSSRGAKSTIITTPLNAKILQKPINTFKSLNPSLKIE  67

Query  255   IRLLEFPGVEVGLPESCQRLD-----QTPDDDG--LPRFFKACAMlqppledllqelrpd  413
             I++++FP V++GLPE C+  D       PD+    + +FF A +  +  LE +L+  RP 
Sbjct  68    IQIIDFPCVQLGLPEGCENPDFFTSNNNPDERQTMMLKFFAAMSFFKDQLEKILETTRPS  127

Query  414   CLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLR-VYKPFNDVSSDSELFTIPN  590
             CL+ADMFFPWAT +A KF++PRL+FHGT + +LC+ H +R ++KP        E F IP+
Sbjct  128   CLIADMFFPWATESAQKFNVPRLVFHGTGYFSLCSEHCIRRMHKP----KKICEPFKIPD  183

Query  591   LPHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNV  770
             LP ++ +T+ Q+   +    E  M +F+  V  SE KS GV+ NSFYELEP+YA+ YK+ 
Sbjct  184   LPGDIMMTQGQMRDLDE---ETEMGKFLIEVIESEVKSSGVVVNSFYELEPEYADFYKSS  240

Query  771   LGRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAP  950
             +  +AW +GPLS+ NR  E+KA+RGKK++IDE ECLKWL+SK   SV+Y+ FGSVA    
Sbjct  241   VVTKAWHIGPLSVQNRGFEEKAKRGKKASIDEVECLKWLNSKKQDSVIYVSFGSVAYIKN  300

Query  951   SQLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVIL  1130
              QL E+A G+E  G  F+WV+R KR E  G E+W+PEGFEER KG+G+IIRGWAPQV+IL
Sbjct  301   EQLLEIAAGLEACGASFIWVVR-KRGESKGEEEWLPEGFEERVKGRGMIIRGWAPQVMIL  359

Query  1131  DHPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKR  1310
             DH A G FVTHCGWNS LEGV  G+PMVTWPV AEQF NE L+T +LRTG  VG+K+   
Sbjct  360   DHQATGVFVTHCGWNSVLEGVAAGLPMVTWPVGAEQFYNEILVTQVLRTGVSVGTKKHAS  419

Query  1311  LDSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             +  D + RE + +A+++V++GEE+EE R RAK + + AK A+
Sbjct  420   M-GDFIARENVEKAVREVLVGEEAEERRGRAKKLAEMAKVAV  460



>ref|XP_004505253.1| PREDICTED: UDP-glucosyl transferase 73B2-like [Cicer arietinum]
Length=475

 Score =   475 bits (1222),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 234/454 (52%), Positives = 322/454 (71%), Gaps = 9/454 (2%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEI  257
              LH+FFFP   HGH+ PT+DMAKLFAS+GVKATIITTP+N+ + SK + K    G  + I
Sbjct  8     SLHIFFFPYFGHGHIKPTVDMAKLFASKGVKATIITTPSNETLISKFIQKSKISGHNIHI  67

Query  258   RLLEFPGVEVGLPESCQRLDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFF  437
             + +EF   +  LP   + +D  P  +    F KA   LQ PLE LL E  PDC+VADMFF
Sbjct  68    QTIEFTSPKTCLPNGSEIIDSIPSPESFFSFLKATESLQEPLEKLLVEQNPDCVVADMFF  127

Query  438   PWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITK  617
             PW T++A+KF IPR++FHGTS  +LCA + ++ ++PF +VSSD E F I +LP  +K+TK
Sbjct  128   PWVTDSASKFGIPRIVFHGTSFFSLCATYCIKRFEPFKNVSSDFEPFVITDLPGNVKMTK  187

Query  618   LQVSPFERSEVENT-MSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSV  794
               + PFE S+     + +F R +  SE KS+GV+ NSFYELE DYA++Y+  +GR+AW +
Sbjct  188   SFLQPFEISKGSTEGLGKFFREIHESEMKSFGVVVNSFYELEKDYADYYRKGIGRKAWHI  247

Query  795   GPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAM  974
             GPL + N+  E+K     + +I EHECLKWLD K P+SVVYICFGS      SQL E+A+
Sbjct  248   GPLCICNKSTEEK-----EGSIYEHECLKWLDMKKPNSVVYICFGSSTKVLDSQLKEIAV  302

Query  975   GIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAF  1154
             G+E SG +F+WV+R K+EE    E+W+P+GFE+R +GKGLI+RGWAPQV+IL+H AVGAF
Sbjct  303   GLEASGKNFIWVVRKKKEE---GEEWLPKGFEKRMEGKGLIVRGWAPQVLILEHEAVGAF  359

Query  1155  VTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKR  1334
             VTHCGWNS LEGVC G+P VTWPV AEQF NE  +T +L+ G  VG  +W     + ++ 
Sbjct  360   VTHCGWNSILEGVCAGMPFVTWPVAAEQFYNEIWVTQVLKIGVPVGVTKWVESFGESIEW  419

Query  1335  EAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             + + +A+K+++ GEE++E+R+R K++ + AKKA+
Sbjct  420   DLVEKAVKRILEGEEAQEIRNRVKLLSELAKKAV  453



>gb|KCW54502.1| hypothetical protein EUGRSUZ_I00446 [Eucalyptus grandis]
Length=461

 Score =   474 bits (1219),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 223/435 (51%), Positives = 307/435 (71%), Gaps = 2/435 (0%)
 Frame = +3

Query  132   LDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIRLLEFPGVEVGLPESCQR  311
             +DMAKLFA RG K+T+ITTP ++P F K++ K   LGF +++  +  P  EVGLPE    
Sbjct  2     IDMAKLFAIRGCKSTLITTPHDEPTFLKSIAKAKDLGFDIDVVTVILPLKEVGLPEDYDN  61

Query  312   LDQTPDDDGLPRFFKACAMlqppledllqelrpdCLVADMFFPWATNAAAKFDIPRLIFH  491
             L++    +   +F +A  ML   LE L++ L PDC+++DMF PW T  AAK+ IP L FH
Sbjct  62    LNKVTSMEIRKQFMRAIMMLDRQLELLIETLAPDCIISDMFLPWTTEIAAKYKIPSLAFH  121

Query  492   GTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPHELKITKLQVSPFERSEVENTMSEF  671
             GTS  ++ +   +R+Y+P   VS DSE F IPN P E+ ++++Q+    R E + T  +F
Sbjct  122   GTSAFSIVSTECVRLYEPHKKVSCDSEPFIIPNFPGEITMSRMQLPDLFREETDFT--KF  179

Query  672   MRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGRRAWSVGPLSLYNRDVEDKAERGKK  851
                 + SE++S+GV+ NSFYELEP YA HY+  LGRR+W +GPLSL N++ EDKA RG +
Sbjct  180   YNEAKESEKRSFGVVMNSFYELEPAYAHHYRRFLGRRSWFIGPLSLCNKETEDKAHRGNQ  239

Query  852   SAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQLHEMAMGIEDSGMDFVWVIRNKREE  1031
             ++ID+HECLKWLDSK P+SV+YICFGS+ NF  +QLHE+A+G+E SG  F+WV++     
Sbjct  240   ASIDQHECLKWLDSKQPNSVIYICFGSMENFNAAQLHEIAVGLEASGQQFIWVVKKDSNV  299

Query  1032  DNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHPAVGAFVTHCGWNSTLEGVCGGVPM  1211
             + G E+ +P+G+E R + KGLIIRGWAPQV+ILDH A+G FVTHCGWNSTLE V  GVPM
Sbjct  300   EEGKEERLPDGYESRIRNKGLIIRGWAPQVLILDHEAIGGFVTHCGWNSTLEAVTAGVPM  359

Query  1212  VTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDSDGVKREAIAEAIKKVMIGEESEEM  1391
             VTWPV AEQF NEK +T +L+ G  +G K+W R   D VK E + EA+K+V++ EE+EEM
Sbjct  360   VTWPVAAEQFFNEKFVTQVLKIGVNIGVKQWVRFFGDSVKSERVEEAVKRVLVREEAEEM  419

Query  1392  RSRAKVMKDKAKKAI  1436
             R + K + + A+ A+
Sbjct  420   RRKVKTLAEMAEGAV  434



>ref|XP_006297553.1| hypothetical protein CARUB_v10013576mg [Capsella rubella]
 gb|EOA30451.1| hypothetical protein CARUB_v10013576mg [Capsella rubella]
Length=482

 Score =   474 bits (1221),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 233/459 (51%), Positives = 316/459 (69%), Gaps = 12/459 (3%)
 Frame = +3

Query  84    HVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVD--KYTQLGFQMEI  257
             H+ FFP MAHGHMIPTLDMAKLFASRG K+T++TTP N  +  K ++  K      ++ I
Sbjct  7     HILFFPFMAHGHMIPTLDMAKLFASRGAKSTLLTTPINAKILEKPIEAFKVQNPDLEIGI  66

Query  258   RLLEFPGVEVGLPESCQRLD------QTPDDDGLPRFFKACAMlqppledllqelrpdCL  419
             ++ +FP VE+GLPE C+ +D      ++   D   +F  +   ++  LE  ++  +P  L
Sbjct  67    KIFDFPCVELGLPEGCENVDFINSYKESDSGDLFFKFLFSIKYMKQQLESFIETTKPSAL  126

Query  420   VADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLPH  599
             VADMFFPWAT +A KF +PRL+FHGTS  ALC  +++R++KP   V++ S  F IP LP 
Sbjct  127   VADMFFPWATESAEKFGVPRLVFHGTSFFALCCSYNMRIHKPHKKVATSSTPFVIPGLPG  186

Query  600   ELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLGR  779
             ++ IT  Q +     + E     F + VR SE  SYGV+ NSFYELE  Y + Y++ + +
Sbjct  187   DIVITTDQANVV--VDEETPFGNFWKEVRESEISSYGVLVNSFYELESTYVDFYRSFVAK  244

Query  780   RAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQL  959
             R W +GPLSL NR++ +KA RGKK+ IDE ECLKWLDSK   SVVY+ FGS A+F   QL
Sbjct  245   RTWHIGPLSLSNRELAEKAGRGKKANIDEQECLKWLDSKTQGSVVYLSFGSRASFTNEQL  304

Query  960   HEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDHP  1139
              E+A G+E SG +F+WV+ +K E    SE+W+P+GFEERTKGKG+IIRGWAPQV+ILDH 
Sbjct  305   LEIAFGLEGSGQNFIWVV-SKNENQGESEEWLPKGFEERTKGKGMIIRGWAPQVLILDHK  363

Query  1140  AVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLDS  1319
             A+G FVTHCGWNST+EG+  G+PMVTWP+ AEQF NEK +T +LR G  VG+ E  +   
Sbjct  364   AIGGFVTHCGWNSTMEGIAAGLPMVTWPMGAEQFYNEKQLTKVLRIGVNVGATELVK-KG  422

Query  1320  DGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
               + RE + +A+K+V++GEE+EE R RAK + + AK A+
Sbjct  423   KLISREEVEKAVKEVLVGEEAEERRIRAKKLGEMAKAAV  461



>emb|CDX71221.1| BnaC07g05000D [Brassica napus]
Length=484

 Score =   474 bits (1220),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 240/460 (52%), Positives = 326/460 (71%), Gaps = 13/460 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVD--KYTQLGFQME  254
             +HV FFP MAHGHMIP LDMAKLF+SRG K+TIITTP+N  +  K ++  K+   G ++ 
Sbjct  9     IHVCFFPFMAHGHMIPILDMAKLFSSRGAKSTIITTPSNSNILEKPIEAFKHQNPGLEIG  68

Query  255   IRLLEFPGVEVGLPESCQRLD-----QTPD-DDGLPRFFKACAMlqppledllqelrpdC  416
             I++ +FP VE+GLPE C+ +D     Q PD  D   +F  +   ++  LE  ++  +P C
Sbjct  69    IKIFDFPSVELGLPEGCENVDFITSYQKPDAGDLFLKFLFSTKHMKQQLESFIETTKPSC  128

Query  417   LVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLP  596
             +VADMFFPWAT +A KF +PRL+FHGTS  +LC  +++R +KP   V++ S  F IP LP
Sbjct  129   IVADMFFPWATESAEKFGVPRLVFHGTSFFSLCCSYNMRTHKPHKKVATTSTPFVIPGLP  188

Query  597   HELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
              ++ IT  Q +    ++ E  M +FM+ VR SE  S+GV+ NSFYELE  YA+ Y + + 
Sbjct  189   GDVVITAEQAN---VADEETPMGKFMKEVRESESISFGVLVNSFYELESTYADFYPSFVA  245

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             +RAW +GPLSL NR++ +KA RGKK++IDE ECL+WLDSK P SVVY+ FGS  NF   Q
Sbjct  246   KRAWHIGPLSLCNREIAEKAGRGKKASIDEQECLQWLDSKTPGSVVYMSFGSGTNFTNEQ  305

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A G+E S  +F+WV+R K +    +E+W+PEGFEERTKGKGLIIRGWAPQV+ILDH
Sbjct  306   LLEIAAGLEGSEQNFIWVVR-KNDNKGENEEWLPEGFEERTKGKGLIIRGWAPQVLILDH  364

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD  1316
              AVG FVTHCGWNS +EG+  G+PMVTWP+ AEQF NEKL+T +L+TG  VG+ E  +  
Sbjct  365   KAVGGFVTHCGWNSAIEGIAAGLPMVTWPMGAEQFYNEKLLTKVLKTGVNVGATELVK-K  423

Query  1317  SDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
                + RE + +A+++V++GEE+EE R RAK + + AK A+
Sbjct  424   GKLISREEVEKAVREVIVGEEAEERRERAKKLGEMAKAAV  463



>gb|KFK30053.1| hypothetical protein AALP_AA7G210800 [Arabis alpina]
Length=480

 Score =   474 bits (1219),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 248/460 (54%), Positives = 329/460 (72%), Gaps = 14/460 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQMEIR  260
             LHV FFP MAHGHMIPTLD+AKLF+SRG K+TI+TTP N  +  K +D +      +EI 
Sbjct  8     LHVVFFPFMAHGHMIPTLDLAKLFSSRGAKSTILTTPLNSKILQKPIDAFKNQNPDLEID  67

Query  261   L--LEFPGVEVGLPESCQRLD----QTPDDDG--LPRFFKACAMlqppledllqelrpdC  416
             L   +FP V++GLPE  + +D     T +D G  + +FFKA    +  LE LL+  RPDC
Sbjct  68    LEIFDFPCVQLGLPEGWENVDFFTSNTNNDGGYMIFKFFKATRFFKEQLEKLLETTRPDC  127

Query  417   LVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLP  596
             L+ADMFFPWAT AA KF +PR +FHGT + +LCA + +RV++P N V+S SE F IP+LP
Sbjct  128   LIADMFFPWATEAAEKFHVPRFVFHGTGYFSLCAGYCIRVHQPQNKVASSSEPFVIPDLP  187

Query  597   HELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
              ++ +T+ Q+   ++   EN + +F   VR SE +S GVI NSFYELEP YA+  K  + 
Sbjct  188   GDIFLTREQIVIVDK---ENEIGKFRIEVRQSEMESSGVIVNSFYELEPAYADFCKRFVA  244

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             +RAW +GPLS+ NR +++K ERGKK++IDE ECLKWLDSK P SV+YI FGSVA+F   Q
Sbjct  245   KRAWHIGPLSVINRGLQEKTERGKKASIDEVECLKWLDSKKPESVIYISFGSVASFKNEQ  304

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A G+E SG +F+WV++ K E D   E+W+PEG EERTKGKG+IIRGWAPQ++ILDH
Sbjct  305   LIEIAAGLEASGTNFIWVVK-KNEGDK--EEWLPEGMEERTKGKGMIIRGWAPQMLILDH  361

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD  1316
              A G FV HCGWNS LEGV  G+PMVTWPV AEQF NEKL+T + +TG  VG+ +   + 
Sbjct  362   QATGGFVIHCGWNSLLEGVAAGLPMVTWPVGAEQFYNEKLVTQVHKTGVSVGATKHVEVK  421

Query  1317  SDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
              D + RE + +A+++V++GEE+EE R RAK + + AK A+
Sbjct  422   EDFISREKVEKAVREVLVGEEAEERRRRAKKLAEMAKAAV  461



>ref|XP_009119412.1| PREDICTED: UDP-glycosyltransferase 73B5 [Brassica rapa]
Length=484

 Score =   474 bits (1219),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 238/460 (52%), Positives = 325/460 (71%), Gaps = 13/460 (3%)
 Frame = +3

Query  81    LHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQL--GFQME  254
             +HV FFP MAHGHMIP LDMAKLF+SRG K+TIITTP+N  +  K ++ +     G ++ 
Sbjct  9     IHVCFFPFMAHGHMIPILDMAKLFSSRGAKSTIITTPSNSKISEKPIEAFRNQNPGLEIG  68

Query  255   IRLLEFPGVEVGLPESCQRLD-----QTPD-DDGLPRFFKACAMlqppledllqelrpdC  416
             I++ +FP VE+GLPE C+ +D     Q PD  D   +F  +   ++  LE  ++  +P C
Sbjct  69    IKIFDFPSVELGLPEGCENVDFITSYQKPDAGDLFLKFLFSTKHMKQQLESFIETTKPSC  128

Query  417   LVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPNLP  596
             +VADMFFPWAT AA KF +PRL+FHGTS  +LC  +++R +KP   V++ S  F IP LP
Sbjct  129   IVADMFFPWATEAAEKFGVPRLVFHGTSFFSLCCSYNMRTHKPHKKVATTSTPFVIPGLP  188

Query  597   HELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNVLG  776
              ++ IT  Q +    ++ E  M +FM+ VR SE  S+GV+ NSFYE+E  YA+ Y++ + 
Sbjct  189   GDIVITAEQAN---VADEETPMGKFMKEVRESESISFGVLVNSFYEMESTYADFYRSFVA  245

Query  777   RRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAPSQ  956
             +RAW +GPLSL N ++ +KA RGKK++IDE ECL+WLDSK P SVV++ FGS  NF   Q
Sbjct  246   KRAWHIGPLSLSNTEIAEKAGRGKKASIDEQECLQWLDSKTPGSVVFMSFGSGTNFTKEQ  305

Query  957   LHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVILDH  1136
             L E+A G+E SG +F+WV+R K      +E+W+PEGFEERTKGKGLIIRGWAPQV+ILDH
Sbjct  306   LLEIAAGLEGSGQNFIWVVR-KNNNKGENEEWLPEGFEERTKGKGLIIRGWAPQVLILDH  364

Query  1137  PAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKRLD  1316
              AVG FVTHCGWNS +EG+  G+PMVTWP+ AEQF NEKL+T +L+TG  VG+ E  +  
Sbjct  365   KAVGGFVTHCGWNSAIEGIAAGLPMVTWPMGAEQFYNEKLLTKVLKTGVNVGATELVK-K  423

Query  1317  SDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
                + RE + +A+++V++GEE+EE R RAK + + AK A+
Sbjct  424   GKLISREEVEKAVREVIVGEEAEERRERAKKLGEMAKAAV  463



>ref|XP_006412270.1| hypothetical protein EUTSA_v10024935mg [Eutrema salsugineum]
 gb|ESQ53723.1| hypothetical protein EUTSA_v10024935mg [Eutrema salsugineum]
Length=518

 Score =   474 bits (1221),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 241/462 (52%), Positives = 324/462 (70%), Gaps = 16/462 (3%)
 Frame = +3

Query  78    DLHVFFFPMMAHGHMIPTLDMAKLFASRGVKATIITTPANQPVFSKAVDKYTQLGFQME-  254
             +LH F FP MAHGHMIPTLDMAKLFA++G K+TI+TTP N  +F K +  +     +++ 
Sbjct  34    ELHFFLFPFMAHGHMIPTLDMAKLFATKGAKSTILTTPLNSNLFEKPIKSFNNENPKLQD  93

Query  255   --IRLLEFPGVEVGLPESCQRLD---QTPD---DDGLPRFFKACAMlqppledllqelrp  410
               I++L FP  E+GLP  C+  D    +PD    +   +F  A    +  LE L++ ++P
Sbjct  94    ISIQILSFPCTELGLPRGCENTDFIFSSPDLGRGNLNQKFLLAMTYFKEQLEQLIETVKP  153

Query  411   dCLVADMFFPWATNAAAKFDIPRLIFHGTSHLALCAMHSLRVYKPFNDVSSDSELFTIPN  590
             DCLVA+MFFPWA+  A KF +P L+FHGT + +LCA H LR++KP+   +S  E F IP+
Sbjct  154   DCLVANMFFPWASKVAEKFGVPSLVFHGTGYFSLCASHCLRLHKPYKKAASSCEPFVIPD  213

Query  591   LPHELKITKLQVSPFERSEVENTMSEFMRSVRGSEEKSYGVIFNSFYELEPDYAEHYKNV  770
             LP  + I + QV   E   V   M +FM+ +R SE  S+GV+ NSFYELEP Y++ +K+ 
Sbjct  214   LPGNIVIIEEQVIEKEEESV---MGKFMKEIRDSETNSFGVLVNSFYELEPAYSDFFKSF  270

Query  771   LGRRAWSVGPLSLYNRDVEDKAERGKKSAIDEHECLKWLDSKNPHSVVYICFGSVANFAP  950
             + +RAW +GPLSL NR+ ++KAERGKK++IDEHECLKWLDSK   SV+Y+ FG++++F  
Sbjct  271   VAKRAWDIGPLSLGNREFKEKAERGKKASIDEHECLKWLDSKRCDSVIYLSFGTMSSFND  330

Query  951   SQLHEMAMGIEDSGMDFVWVIRNKREEDNGSEKWMPEGFEERTKGKGLIIRGWAPQVVIL  1130
              QL E+A G+E SG DFVWV+ NK       E+W+PEG EERTKGKGLIIRGWAPQV+IL
Sbjct  331   EQLIEIAAGLEMSGHDFVWVV-NKNCSQGEKEEWLPEGLEERTKGKGLIIRGWAPQVLIL  389

Query  1131  DHPAVGAFVTHCGWNSTLEGVCGGVPMVTWPVFAEQFINEKLMTDILRTGTGVGSKEWKR  1310
             DH A+GAF+THCGWNS LEGV  G+PMVTWPV AEQF NEKL+T +L+TG  VG K+  +
Sbjct  390   DHQAIGAFLTHCGWNSLLEGVASGLPMVTWPVGAEQFYNEKLVTQVLKTGVSVGVKKMIQ  449

Query  1311  LDSDGVKREAIAEAIKKVMIGEESEEMRSRAKVMKDKAKKAI  1436
             +  D + RE + +A+++VM+GEE    R RAK +   AK A+
Sbjct  450   VVGDFISREKVEKAVREVMVGEER---RKRAKELAVMAKDAV  488



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5398010991296