BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25529_g1_i2 len=2004 path=[1:0-102 104:103-150 152:151-285
287:286-348 10891:349-357 359:358-358 360:359-370 10907:371-386
388:387-390 392:391-402 404:403-434 436:435-515 517:516-557
10992:558-572 5396:573-609 611:610-689 691:690-699 701:700-708
710:709-749 751:750-923 5572:924-948 950:949-1013 5786:1014-1060
1050:1061-1211 1201:1212-1241 1231:1242-1313 5930:1314-1320
1310:1321-1556 1546:1557-1566 1556:1567-1610 1600:1611-2003]

Length=2004
                                                                      Score     E

emb|CDP09265.1|  unnamed protein product                                683   0.0      
ref|XP_011080360.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    674   0.0      
ref|XP_009801144.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    673   0.0      
ref|XP_004250927.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    667   0.0      
ref|XP_002285367.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    664   0.0      Vitis vinifera
ref|XP_009622048.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    655   0.0      
ref|XP_007015095.1|  Alpha/beta-Hydrolases superfamily protein          653   0.0      
ref|XP_010246745.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    649   0.0      
ref|XP_007211838.1|  hypothetical protein PRUPE_ppa004631mg             642   0.0      
ref|XP_008227339.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    642   0.0      
ref|XP_010031778.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    638   0.0      
ref|XP_002313345.2|  hypothetical protein POPTR_0009s05660g             635   0.0      Populus trichocarpa [western balsam poplar]
gb|EYU31376.1|  hypothetical protein MIMGU_mgv1a004679mg                633   0.0      
gb|KDP22109.1|  hypothetical protein JCGZ_25940                         630   0.0      
emb|CAN83233.1|  hypothetical protein VITISV_005768                     622   0.0      Vitis vinifera
ref|XP_010269807.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    622   0.0      
ref|XP_011032046.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    623   0.0      
ref|XP_010102366.1|  Phospholipase A1-Igamma3                           622   0.0      
ref|XP_010673678.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    619   0.0      
ref|XP_003538937.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    618   0.0      
gb|KCW51163.1|  hypothetical protein EUGRSUZ_J00755                     618   0.0      
ref|XP_006446147.1|  hypothetical protein CICLE_v10014848mg             615   0.0      
ref|XP_006470637.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    615   0.0      
ref|XP_008450415.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    610   0.0      
ref|XP_010938722.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    609   0.0      
gb|KGN66495.1|  hypothetical protein Csa_1G614650                       610   0.0      
ref|XP_004154680.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    606   0.0      
ref|XP_004139114.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    605   0.0      
gb|EYU46244.1|  hypothetical protein MIMGU_mgv1a004190mg                607   0.0      
ref|XP_004505625.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    593   0.0      
ref|XP_003607369.1|  Lipase                                             592   0.0      
ref|XP_007131548.1|  hypothetical protein PHAVU_011G022500g             580   0.0      
ref|XP_002891639.1|  lipase class 3 family protein                      578   0.0      
ref|XP_010461974.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    578   0.0      
ref|XP_010479626.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    577   0.0      
ref|XP_010544180.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    577   0.0      
ref|XP_006307213.1|  hypothetical protein CARUB_v10008812mg             576   0.0      
ref|XP_010500719.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    575   0.0      
ref|XP_009147767.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    574   0.0      
ref|XP_006393053.1|  hypothetical protein EUTSA_v10011370mg             574   0.0      
emb|CDY22842.1|  BnaA06g02350D                                          572   0.0      
gb|KFK35847.1|  hypothetical protein AALP_AA4G044700                    570   0.0      
ref|NP_564590.1|  DAD1-like lipase 2                                    570   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY49813.1|  BnaC06g04560D                                          562   0.0      
ref|XP_006853086.1|  hypothetical protein AMTR_s00038p00106840          533   6e-179   
ref|XP_002513514.1|  triacylglycerol lipase, putative                   522   4e-176   Ricinus communis
ref|XP_011042424.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    520   1e-174   
gb|ABR16123.1|  unknown                                                 521   3e-174   Picea sitchensis
ref|XP_002306818.1|  hypothetical protein POPTR_0005s24000g             515   1e-172   Populus trichocarpa [western balsam poplar]
ref|XP_002302074.2|  hypothetical protein POPTR_0002s04560g             515   2e-172   Populus trichocarpa [western balsam poplar]
ref|XP_007050417.1|  Alpha/beta-Hydrolases superfamily protein          507   2e-169   
ref|XP_011026041.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    505   1e-168   
ref|XP_008235325.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    504   1e-168   
gb|KDP21366.1|  hypothetical protein JCGZ_21837                         504   2e-168   
ref|XP_009782117.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    504   5e-168   
ref|XP_004289898.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    503   9e-168   
ref|XP_009603052.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    502   3e-167   
ref|XP_006349747.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    498   3e-166   
ref|XP_007201554.1|  hypothetical protein PRUPE_ppa017780mg             496   9e-166   
ref|XP_008346158.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    493   4e-164   
ref|XP_009367748.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    493   5e-164   
gb|KCW49834.1|  hypothetical protein EUGRSUZ_K03311                     493   5e-164   
ref|XP_002281907.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    493   6e-164   Vitis vinifera
ref|XP_008783171.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    493   6e-164   
ref|XP_009384367.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    493   9e-164   
ref|XP_011079988.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    492   1e-163   
ref|XP_008372307.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    492   1e-163   
ref|XP_010038036.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    492   1e-163   
ref|XP_009354875.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    492   1e-163   
ref|XP_010274199.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    491   6e-163   
emb|CAN74039.1|  hypothetical protein VITISV_012945                     489   1e-162   Vitis vinifera
ref|XP_010679169.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    489   6e-162   
ref|XP_010087133.1|  Phospholipase A1-Igamma1                           487   9e-162   
ref|XP_006443915.1|  hypothetical protein CICLE_v10019700mg             488   1e-161   
ref|XP_006410159.1|  hypothetical protein EUTSA_v10016488mg             486   6e-161   
ref|XP_009119028.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    486   1e-160   
emb|CDY29665.1|  BnaA04g17620D                                          484   3e-160   
ref|NP_565701.1|  phospholipase A1-Igamma2                              484   4e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879267.1|  lipase class 3 family protein                      484   4e-160   
ref|XP_009141072.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    483   7e-160   
gb|KFK42995.1|  hypothetical protein AALP_AA1G065900                    482   1e-159   
emb|CDX97819.1|  BnaC04g41200D                                          481   1e-159   
gb|ACJ76846.1|  chloroplast lipase protein                              481   2e-159   Brassica napus [oilseed rape]
emb|CDY10228.1|  BnaC05g04710D                                          481   2e-159   
ref|XP_010927018.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    481   3e-159   
ref|XP_010522024.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    481   6e-159   
ref|XP_010469840.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    481   1e-158   
ref|XP_010278159.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    479   1e-158   
ref|XP_006853087.1|  hypothetical protein AMTR_s00038p00110060          478   3e-158   
ref|XP_006293988.1|  hypothetical protein CARUB_v10022980mg             478   7e-158   
ref|XP_010469841.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    478   1e-157   
ref|XP_010475428.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    476   2e-157   
ref|XP_007144693.1|  hypothetical protein PHAVU_007G177100g             475   3e-157   
ref|XP_004168244.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    475   4e-157   
ref|XP_004146954.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    475   4e-157   
ref|XP_010510341.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    476   4e-157   
ref|XP_010938535.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    476   4e-157   
ref|XP_010558870.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    476   5e-157   
ref|XP_010414252.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    476   5e-157   
ref|XP_010457831.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    473   7e-157   
ref|XP_006417878.1|  hypothetical protein EUTSA_v10007393mg             474   8e-157   
ref|XP_010457830.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    472   2e-156   
ref|XP_008802654.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    474   2e-156   
ref|NP_849603.1|  phospholipase A1-Igamma1                              472   9e-156   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307284.1|  hypothetical protein CARUB_v10008898mg             471   1e-155   
ref|XP_002892359.1|  lipase class 3 family protein                      471   1e-155   
gb|KGN44761.1|  hypothetical protein Csa_7G378500                       470   5e-155   
ref|XP_004146990.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    469   6e-155   
ref|XP_008451275.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    469   7e-155   
ref|XP_008451272.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    469   1e-154   
ref|XP_003566295.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    468   4e-154   
ref|XP_006655277.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    464   9e-154   
ref|XP_003518894.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    467   9e-154   
ref|XP_008451639.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    465   3e-153   
ref|XP_004146952.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    465   3e-153   
gb|EEC79153.1|  hypothetical protein OsI_19824                          465   3e-152   Oryza sativa Indica Group [Indian rice]
ref|XP_006576919.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    461   6e-152   
emb|CDP03693.1|  unnamed protein product                                457   7e-152   
ref|XP_009414857.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    458   1e-150   
ref|XP_006853094.1|  hypothetical protein AMTR_s00038p00116940          457   6e-150   
ref|XP_004962195.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    459   1e-149   
ref|XP_010326538.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    454   2e-149   
ref|XP_008656338.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    456   6e-149   
ref|XP_004962194.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    457   1e-148   
gb|KDP21364.1|  hypothetical protein JCGZ_21835                         453   2e-148   
gb|KDO53917.1|  hypothetical protein CISIN_1g048560mg                   445   2e-146   
ref|XP_006420095.1|  hypothetical protein CICLE_v10006964mg             444   2e-145   
ref|XP_007034959.1|  Alpha/beta-Hydrolases superfamily protein, p...    440   1e-143   
ref|XP_004493750.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    435   1e-141   
ref|XP_004493749.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    435   2e-141   
gb|KEH23856.1|  phospholipase A1                                        432   2e-140   
emb|CDM86669.1|  unnamed protein product                                431   2e-139   
ref|XP_007162494.1|  hypothetical protein PHAVU_001G156900g             428   8e-139   
dbj|BAJ85518.1|  predicted protein                                      428   2e-138   
ref|XP_011042425.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    423   6e-138   
dbj|BAJ99811.1|  predicted protein                                      424   3e-137   
ref|XP_002437873.1|  hypothetical protein SORBIDRAFT_10g004170          423   3e-136   Sorghum bicolor [broomcorn]
ref|XP_002456959.1|  hypothetical protein SORBIDRAFT_03g046400          421   5e-136   Sorghum bicolor [broomcorn]
ref|XP_002455039.1|  hypothetical protein SORBIDRAFT_03g003410          419   3e-135   Sorghum bicolor [broomcorn]
ref|XP_008648833.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    418   4e-135   
tpg|DAA53109.1|  TPA: hypothetical protein ZEAMMB73_566262              418   5e-135   
emb|CDM86668.1|  unnamed protein product                                417   2e-134   
ref|XP_011028727.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    412   1e-133   
ref|XP_011079989.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    408   5e-132   
gb|KEH23857.1|  phospholipase A1                                        407   3e-131   
ref|XP_008382954.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    405   4e-131   
ref|NP_850148.1|  phospholipase A1-Igamma2                              401   4e-129   Arabidopsis thaliana [mouse-ear cress]
emb|CDY54880.1|  BnaA10g27930D                                          400   7e-129   
ref|XP_010414253.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    398   1e-127   
ref|XP_004968489.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    400   2e-127   
gb|AFW75599.1|  hypothetical protein ZEAMMB73_741719                    421   2e-127   
ref|XP_010274200.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    394   1e-126   
ref|NP_563772.1|  phospholipase A1-Igamma1                              394   2e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010414254.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    393   6e-126   
ref|XP_010486704.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    391   2e-125   
ref|XP_010486634.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    391   3e-125   
ref|XP_010486640.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    390   3e-125   
ref|XP_010486696.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    390   5e-125   
gb|EEE63596.1|  hypothetical protein OsJ_18413                          390   1e-123   Oryza sativa Japonica Group [Japonica rice]
gb|KCW57435.1|  hypothetical protein EUGRSUZ_H00215                     386   2e-123   
ref|NP_001055438.1|  Os05g0390000                                       387   3e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010069172.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    387   6e-123   
ref|XP_008451277.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    382   7e-122   
ref|XP_008451276.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    379   9e-121   
ref|XP_006576920.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    377   2e-120   
emb|CBI16352.3|  unnamed protein product                                378   1e-119   
ref|XP_002441042.1|  hypothetical protein SORBIDRAFT_09g019276          376   5e-119   Sorghum bicolor [broomcorn]
ref|XP_003518892.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    374   2e-118   
ref|XP_006489506.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    367   6e-116   
ref|XP_010685025.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    361   5e-113   
ref|XP_003518893.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    358   2e-112   
emb|CDO99150.1|  unnamed protein product                                355   9e-112   
ref|XP_009362274.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    355   9e-111   
ref|XP_008371801.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    354   3e-110   
ref|XP_008371821.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    353   5e-110   
ref|XP_009614944.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    349   1e-109   
ref|XP_008371806.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    352   3e-109   
ref|XP_006827274.1|  hypothetical protein AMTR_s00010p00263480          348   1e-108   
ref|XP_009362273.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    347   1e-107   
ref|XP_009399031.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    345   4e-107   
gb|KDP38020.1|  hypothetical protein JCGZ_04663                         345   6e-107   
ref|XP_010940258.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    345   6e-107   
gb|EYU19151.1|  hypothetical protein MIMGU_mgv1a006227mg                343   1e-106   
ref|XP_010245170.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    345   2e-106   
ref|XP_008784887.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    343   2e-106   
ref|XP_011096641.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    344   2e-106   
emb|CBI17935.3|  unnamed protein product                                340   3e-106   
ref|XP_010655697.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    343   3e-106   
ref|XP_008444745.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    344   4e-106   
gb|EPS66180.1|  hypothetical protein M569_08597                         340   5e-106   
emb|CDP21091.1|  unnamed protein product                                343   7e-106   
ref|XP_004167249.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    342   2e-105   
ref|XP_003532708.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    341   2e-105   
ref|XP_004135535.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    342   2e-105   
ref|XP_006304825.1|  hypothetical protein CARUB_v10012471mg             342   3e-105   
ref|XP_010540608.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    342   3e-105   
ref|XP_002531054.1|  triacylglycerol lipase, putative                   341   6e-105   Ricinus communis
ref|XP_010655698.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    340   9e-105   
ref|XP_007024951.1|  Alpha/beta-Hydrolases superfamily protein          340   1e-104   
ref|XP_009399030.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    338   2e-104   
ref|XP_009115161.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    339   2e-104   
ref|XP_007212825.1|  hypothetical protein PRUPE_ppa020655mg             338   2e-104   
gb|ABR17156.1|  unknown                                                 337   4e-104   Picea sitchensis
ref|XP_008225538.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    338   5e-104   
ref|XP_009102705.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    338   7e-104   
ref|XP_002272780.2|  PREDICTED: phospholipase A1-Igamma1, chlorop...    337   1e-103   Vitis vinifera
ref|XP_001781080.1|  predicted protein                                  332   4e-103   
ref|XP_006415481.1|  hypothetical protein EUTSA_v10007346mg             336   4e-103   
ref|XP_009792730.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    335   7e-103   
ref|XP_006448978.1|  hypothetical protein CICLE_v10014927mg             335   1e-102   
ref|XP_009605461.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    333   2e-102   
emb|CDX77597.1|  BnaA07g07350D                                          331   2e-102   
gb|KHN12425.1|  Phospholipase A1-Igamma1, chloroplastic                 342   4e-102   
gb|KFK44851.1|  hypothetical protein AALP_AA1G310600                    333   4e-102   
ref|XP_002893614.1|  lipase class 3 family protein                      333   6e-102   
ref|XP_002314049.2|  hypothetical protein POPTR_0009s06300g             333   8e-102   Populus trichocarpa [western balsam poplar]
ref|XP_009408789.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    331   1e-101   
ref|XP_007024952.1|  Alpha/beta-Hydrolases superfamily protein          332   1e-101   
emb|CDY02287.1|  BnaA09g26150D                                          331   3e-101   
ref|XP_011025479.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    331   3e-101   
emb|CDY09593.1|  BnaC05g23260D                                          329   9e-101   
gb|KDO75376.1|  hypothetical protein CISIN_1g037474mg                   329   1e-100   
ref|XP_004244860.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    328   2e-100   
ref|XP_006468077.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    328   3e-100   
ref|XP_010460828.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    328   3e-100   
ref|XP_010499568.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    328   6e-100   
ref|XP_010478423.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    328   6e-100   
ref|NP_174326.1|  DAD1-like acylhydrolase                               325   8e-99    Arabidopsis thaliana [mouse-ear cress]
gb|KCW75867.1|  hypothetical protein EUGRSUZ_D00253                     320   3e-98    
ref|XP_010052014.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    322   5e-98    
ref|XP_006364888.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    322   5e-98    
ref|XP_002298419.2|  hypothetical protein POPTR_0001s27040g             320   6e-98    Populus trichocarpa [western balsam poplar]
ref|XP_001779106.1|  predicted protein                                  320   6e-98    
gb|EMT07991.1|  Lipase                                                  318   4e-97    
ref|XP_011047360.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    320   7e-97    
ref|XP_011000043.1|  PREDICTED: galactolipase DONGLE, chloroplastic     296   1e-88    
ref|XP_002321113.2|  hypothetical protein POPTR_0014s14860g             293   2e-88    Populus trichocarpa [western balsam poplar]
ref|XP_008783953.1|  PREDICTED: galactolipase DONGLE, chloroplast...    294   3e-88    
ref|XP_009631504.1|  PREDICTED: galactolipase DONGLE, chloroplast...    293   6e-88    
ref|XP_002272558.2|  PREDICTED: phospholipase A1-Igamma1, chlorop...    295   2e-87    Vitis vinifera
ref|XP_004232943.1|  PREDICTED: phospholipase A1-II 1                   291   2e-87    
ref|XP_001779107.1|  predicted protein                                  293   2e-87    
emb|CAN64309.1|  hypothetical protein VITISV_037470                     294   2e-87    Vitis vinifera
ref|XP_002268142.1|  PREDICTED: galactolipase DONGLE, chloroplastic     291   4e-87    Vitis vinifera
ref|XP_003551855.1|  PREDICTED: galactolipase DONGLE, chloroplast...    292   9e-87    
ref|XP_003530907.1|  PREDICTED: galactolipase DONGLE, chloroplast...    291   1e-86    
ref|XP_006478993.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    290   1e-86    
ref|XP_010930439.1|  PREDICTED: galactolipase DONGLE, chloroplast...    290   2e-86    
ref|XP_007033998.1|  Alpha/beta-Hydrolases superfamily protein          289   3e-86    
ref|XP_008791829.1|  PREDICTED: galactolipase DONGLE, chloroplastic     287   3e-86    
ref|XP_004298041.1|  PREDICTED: galactolipase DONGLE, chloroplast...    290   4e-86    
ref|XP_006443133.1|  hypothetical protein CICLE_v10024085mg             290   4e-86    
ref|XP_006349966.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    286   6e-86    
ref|XP_002301637.2|  hypothetical protein POPTR_0002s23240g             286   8e-86    Populus trichocarpa [western balsam poplar]
ref|XP_009791702.1|  PREDICTED: galactolipase DONGLE, chloroplast...    287   8e-86    
ref|XP_010105205.1|  Galactolipase DONGLE                               288   1e-85    
emb|CDO96758.1|  unnamed protein product                                286   2e-85    
ref|XP_004979188.1|  PREDICTED: galactolipase DONGLE, chloroplast...    287   2e-85    
ref|XP_010025922.1|  PREDICTED: galactolipase DONGLE, chloroplast...    288   2e-85    
ref|XP_011042808.1|  PREDICTED: galactolipase DONGLE, chloroplast...    287   3e-85    
ref|XP_002450711.1|  hypothetical protein SORBIDRAFT_05g013160          286   4e-85    Sorghum bicolor [broomcorn]
ref|XP_010314737.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    285   1e-84    
ref|NP_001168442.1|  uncharacterized protein LOC100382214               285   2e-84    Zea mays [maize]
ref|XP_009798317.1|  PREDICTED: galactolipase DONGLE, chloroplastic     284   4e-84    
ref|XP_009420257.1|  PREDICTED: galactolipase DONGLE, chloroplast...    289   7e-84    
ref|XP_006364325.1|  PREDICTED: phospholipase A1-IIgamma-like           281   8e-84    
ref|XP_007223991.1|  hypothetical protein PRUPE_ppa014790mg             282   8e-84    
ref|XP_008222660.1|  PREDICTED: galactolipase DONGLE, chloroplastic     283   8e-84    
ref|XP_004293927.1|  PREDICTED: phospholipase A1-IIgamma-like           282   1e-83    
ref|XP_009403651.1|  PREDICTED: galactolipase DONGLE, chloroplast...    282   1e-83    
ref|XP_009339909.1|  PREDICTED: galactolipase DONGLE, chloroplastic     281   2e-83    
ref|XP_009589831.1|  PREDICTED: galactolipase DONGLE, chloroplast...    282   2e-83    
ref|XP_010912884.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    281   2e-83    
ref|XP_006364696.1|  PREDICTED: galactolipase DONGLE, chloroplast...    289   4e-83    
ref|XP_007139124.1|  hypothetical protein PHAVU_008G003400g             282   5e-83    
ref|XP_008380696.1|  PREDICTED: galactolipase DONGLE, chloroplastic     281   7e-83    
ref|XP_006359231.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    283   7e-83    
gb|ABK24664.1|  unknown                                                 279   9e-83    Picea sitchensis
ref|XP_003569464.1|  PREDICTED: phospholipase A1-II 3-like              278   1e-82    
ref|XP_008439757.1|  PREDICTED: phospholipase A1-IIgamma                279   2e-82    
ref|XP_004233849.2|  PREDICTED: phospholipase A1-IIgamma-like           277   2e-82    
ref|XP_010245971.1|  PREDICTED: LOW QUALITY PROTEIN: galactolipas...    280   3e-82    
ref|XP_004232965.1|  PREDICTED: phospholipase A1-IIgamma-like           276   3e-82    
ref|XP_004232966.1|  PREDICTED: phospholipase A1-IIgamma-like           276   6e-82    
ref|XP_008794177.1|  PREDICTED: galactolipase DONGLE, chloroplast...    279   7e-82    
ref|XP_004134929.1|  PREDICTED: phospholipase A1-IIgamma-like           276   1e-81    
ref|XP_009353256.1|  PREDICTED: phospholipase A1-IIgamma-like           276   1e-81    
ref|XP_010686320.1|  PREDICTED: phospholipase A1-IIgamma-like           275   2e-81    
ref|XP_009628626.1|  PREDICTED: phospholipase A1-IIgamma-like           275   2e-81    
ref|XP_009775805.1|  PREDICTED: phospholipase A1-IIgamma-like           275   3e-81    
ref|XP_010279083.1|  PREDICTED: phospholipase A1-IIgamma-like           274   3e-81    
gb|KGN49294.1|  hypothetical protein Csa_6G519470                       275   4e-81    
ref|XP_006362430.1|  PREDICTED: phospholipase A1-IIgamma-like           274   4e-81    
ref|XP_007213350.1|  hypothetical protein PRUPE_ppa1027164mg            274   5e-81    
ref|XP_010326961.1|  PREDICTED: galactolipase DONGLE, chloroplastic     275   7e-81    
gb|KHN18833.1|  Phospholipase A1-Igamma2, chloroplastic                 273   7e-81    
ref|XP_006417987.1|  hypothetical protein EUTSA_v10009478mg             275   9e-81    
ref|XP_009619316.1|  PREDICTED: phospholipase A1-IIgamma-like           273   1e-80    
ref|XP_010910337.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    274   1e-80    
ref|XP_010457679.1|  PREDICTED: galactolipase DONGLE, chloroplastic     275   1e-80    
ref|XP_010543058.1|  PREDICTED: galactolipase DONGLE, chloroplastic     275   1e-80    
ref|XP_006304384.1|  hypothetical protein CARUB_v10010888mg             275   2e-80    
ref|XP_004489153.1|  PREDICTED: galactolipase DONGLE, chloroplast...    275   2e-80    
ref|XP_004245812.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    277   2e-80    
ref|XP_009401159.1|  PREDICTED: galactolipase DONGLE, chloroplast...    273   2e-80    
ref|XP_008225210.1|  PREDICTED: phospholipase A1-IIgamma                273   2e-80    
ref|XP_009628625.1|  PREDICTED: phospholipase A1-IIgamma-like           272   3e-80    
ref|XP_010475298.1|  PREDICTED: galactolipase DONGLE, chloroplast...    274   3e-80    
ref|XP_009757707.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    271   3e-80    
gb|KDP42875.1|  hypothetical protein JCGZ_23817                         274   5e-80    
emb|CDP14642.1|  unnamed protein product                                273   5e-80    
gb|EAY80695.1|  hypothetical protein OsI_35877                          273   6e-80    
ref|XP_004963940.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    273   6e-80    
ref|XP_002889566.1|  lipase class 3 family protein                      273   6e-80    
ref|XP_009757709.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    271   6e-80    
ref|XP_002266982.2|  PREDICTED: phospholipase A1-IIgamma isoform X1     271   7e-80    
gb|AFW79273.1|  hypothetical protein ZEAMMB73_515320                    271   8e-80    
ref|NP_001067729.1|  Os11g0299300                                       273   8e-80    
gb|KHN08451.1|  Phospholipase A1-IIgamma                                270   8e-80    
gb|KHN18919.1|  Phospholipase A1-IIgamma                                270   1e-79    
gb|ABR18391.1|  unknown                                                 271   1e-79    
ref|XP_004232962.1|  PREDICTED: phospholipase A1-IIgamma-like           270   1e-79    
emb|CDY10148.1|  BnaC05g03910D                                          272   1e-79    
ref|XP_003593747.1|  Lipase                                             270   1e-79    
gb|EAY80693.1|  hypothetical protein OsI_35875                          272   1e-79    
ref|XP_003547164.1|  PREDICTED: phospholipase A1-IIgamma-like           271   2e-79    
ref|NP_001149813.1|  triacylglycerol lipase                             270   2e-79    
ref|XP_009787871.1|  PREDICTED: phospholipase A1-IIgamma-like           270   2e-79    
ref|XP_009383384.1|  PREDICTED: galactolipase DONGLE, chloroplast...    271   2e-79    
gb|ABK23399.1|  unknown                                                 270   2e-79    
ref|XP_009119115.1|  PREDICTED: galactolipase DONGLE, chloroplastic     271   3e-79    
gb|EYU32751.1|  hypothetical protein MIMGU_mgv1a019991mg                270   4e-79    
ref|XP_007039723.1|  Alpha/beta-Hydrolases superfamily protein          273   5e-79    
emb|CDM85400.1|  unnamed protein product                                269   5e-79    
ref|XP_008439078.1|  PREDICTED: galactolipase DONGLE, chloroplast...    271   6e-79    
ref|XP_003541709.1|  PREDICTED: phospholipase A1-IIgamma-like           269   6e-79    
ref|XP_009789580.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    272   7e-79    
ref|XP_004232963.1|  PREDICTED: phospholipase A1-IIgamma-like           268   8e-79    
ref|XP_010108436.1|  Phospholipase A1-IIgamma                           269   8e-79    
ref|NP_563748.1|  galactolipase DONGLE                                  270   8e-79    
ref|XP_002881190.1|  lipase class 3 family protein                      270   9e-79    
ref|XP_009606132.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    272   1e-78    
ref|XP_004232942.2|  PREDICTED: phospholipase A1-IIgamma-like           268   1e-78    
ref|XP_009405777.1|  PREDICTED: galactolipase DONGLE, chloroplast...    269   1e-78    
ref|XP_006852124.1|  hypothetical protein AMTR_s00049p00044160          266   1e-78    
gb|ABQ95989.1|  phospholipase A1                                        267   1e-78    
ref|XP_003621036.1|  Lipase                                             270   2e-78    
ref|XP_007148062.1|  hypothetical protein PHAVU_006G177300g             268   2e-78    
ref|XP_009352805.1|  PREDICTED: phospholipase A1-IIgamma-like           268   2e-78    
ref|XP_004232957.2|  PREDICTED: phospholipase A1-II 1-like              268   2e-78    
gb|AAX96672.1|  Lipase, putative                                        268   3e-78    
ref|XP_008656977.1|  PREDICTED: galactolipase DONGLE, chloroplast...    268   3e-78    
gb|KFK42913.1|  hypothetical protein AALP_AA1G054600                    267   3e-78    
ref|XP_009599019.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    270   4e-78    
gb|KDP21073.1|  hypothetical protein JCGZ_21544                         266   4e-78    
ref|XP_004485882.1|  PREDICTED: phospholipase A1-IIgamma-like           267   4e-78    
ref|XP_007025426.1|  Alpha/beta-Hydrolases superfamily protein          267   4e-78    
ref|NP_001152663.1|  triacylglycerol lipase precursor                   267   4e-78    
ref|XP_011073877.1|  PREDICTED: galactolipase DONGLE, chloroplastic     268   5e-78    
ref|XP_006362432.1|  PREDICTED: phospholipase A1-IIgamma-like           266   5e-78    
ref|XP_006362433.1|  PREDICTED: phospholipase A1-II 1-like              266   7e-78    
ref|XP_003608599.1|  Lipase                                             269   7e-78    
ref|XP_006410299.1|  hypothetical protein EUTSA_v10017922mg             268   8e-78    
ref|XP_010912683.1|  PREDICTED: phospholipase A1-II 1                   265   9e-78    
ref|XP_010518795.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    266   9e-78    
ref|XP_006340582.1|  PREDICTED: phospholipase A1-IIgamma-like           265   1e-77    
ref|XP_006364324.1|  PREDICTED: phospholipase A1-IIgamma-like           265   1e-77    
ref|XP_004241988.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    269   1e-77    
ref|XP_010277744.1|  PREDICTED: phospholipase A1-IIgamma-like           265   1e-77    
ref|XP_008383647.1|  PREDICTED: phospholipase A1-IIgamma                266   1e-77    
emb|CDY34503.1|  BnaC04g12960D                                          267   1e-77    
ref|XP_009626666.1|  PREDICTED: phospholipase A1-IIgamma-like           265   1e-77    
ref|XP_010279086.1|  PREDICTED: phospholipase A1-IIgamma-like           265   2e-77    
ref|XP_004253384.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    269   2e-77    
ref|XP_003528480.1|  PREDICTED: phospholipase A1-IIgamma-like           265   2e-77    
ref|XP_004164687.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    267   2e-77    
ref|XP_004148168.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    267   2e-77    
ref|XP_006362440.1|  PREDICTED: phospholipase A1-II 1-like              265   2e-77    
ref|XP_011081332.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    268   2e-77    
gb|EMT30786.1|  Lipase                                                  265   2e-77    
ref|XP_009773480.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    268   2e-77    
ref|XP_009387098.1|  PREDICTED: galactolipase DONGLE, chloroplast...    267   2e-77    
ref|XP_004231490.1|  PREDICTED: phospholipase A1-II 1                   264   2e-77    
gb|AFK47098.1|  unknown                                                 264   3e-77    
sp|Q6F358.1|PLA6_ORYSJ  RecName: Full=Phospholipase A1-II 6             264   3e-77    
ref|XP_010677111.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    268   3e-77    
ref|XP_006362445.1|  PREDICTED: phospholipase A1-IIgamma-like           263   4e-77    
ref|XP_010647255.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    267   6e-77    
ref|XP_006362431.1|  PREDICTED: phospholipase A1-II 1-like              263   6e-77    
ref|XP_009145395.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    266   1e-76    
ref|XP_002456062.1|  hypothetical protein SORBIDRAFT_03g029680          263   1e-76    
ref|XP_007153706.1|  hypothetical protein PHAVU_003G058000g             262   2e-76    
gb|ACZ57767.1|  glycerolipase A1                                        266   2e-76    
ref|XP_003577614.1|  PREDICTED: galactolipase DONGLE, chloroplast...    263   2e-76    
emb|CAN77244.1|  hypothetical protein VITISV_035465                     266   3e-76    
ref|XP_009795642.1|  PREDICTED: phospholipase A1-IIgamma-like           261   3e-76    
ref|XP_010469684.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    264   3e-76    
ref|XP_008373668.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    265   4e-76    
ref|NP_180727.1|  triacylglycerol lipase                                263   4e-76    
ref|XP_004969332.1|  PREDICTED: phospholipase A1-II 3-like              261   4e-76    
ref|XP_004232964.1|  PREDICTED: phospholipase A1-IIgamma-like           261   5e-76    
ref|XP_004980419.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    263   5e-76    
ref|XP_009144055.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    263   5e-76    
ref|XP_009773996.1|  PREDICTED: phospholipase A1-II 1-like              261   5e-76    
emb|CDP08362.1|  unnamed protein product                                265   6e-76    
emb|CDX79431.1|  BnaC03g17670D                                          263   6e-76    
ref|XP_009368157.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    265   6e-76    
ref|XP_009765842.1|  PREDICTED: phospholipase A1-II 1-like              261   6e-76    
emb|CDX84763.1|  BnaA03g14670D                                          263   7e-76    
gb|KHN32323.1|  Phospholipase A1-Igamma1, chloroplastic                 256   9e-76    
gb|KDO46424.1|  hypothetical protein CISIN_1g041669mg                   258   9e-76    
ref|XP_006362471.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    264   1e-75    
ref|XP_003608120.1|  Lipase                                             260   1e-75    
ref|XP_010054330.1|  PREDICTED: phospholipase A1-IIgamma-like           260   1e-75    
ref|XP_008674694.1|  PREDICTED: galactolipase DONGLE, chloroplast...    261   1e-75    
ref|XP_006837391.1|  hypothetical protein AMTR_s00111p00133140          260   2e-75    
ref|XP_009343932.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    263   2e-75    
ref|XP_006296490.1|  hypothetical protein CARUB_v10025676mg             261   2e-75    
ref|XP_011031953.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    262   3e-75    
gb|EYU19471.1|  hypothetical protein MIMGU_mgv1a004169mg                263   3e-75    
ref|XP_006414297.1|  hypothetical protein EUTSA_v10027304mg             262   4e-75    
ref|XP_010414097.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    261   4e-75    
dbj|BAB89948.1|  putative DAD1                                          259   5e-75    
ref|XP_010510171.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    260   5e-75    
ref|XP_009368221.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    262   5e-75    
ref|XP_009772191.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    262   5e-75    
gb|KDO37674.1|  hypothetical protein CISIN_1g039426mg                   262   6e-75    
ref|XP_009772200.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    261   6e-75    
ref|XP_006440208.1|  hypothetical protein CICLE_v10019666mg             261   7e-75    
ref|XP_007208875.1|  hypothetical protein PRUPE_ppa026090mg             262   7e-75    
gb|KCW74072.1|  hypothetical protein EUGRSUZ_E02710                     258   8e-75    
ref|XP_009133156.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    259   8e-75    
ref|XP_008238400.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    261   9e-75    
ref|XP_006367468.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    261   1e-74    
ref|XP_002303372.1|  hypothetical protein POPTR_0003s07940g             261   1e-74    
ref|XP_007153707.1|  hypothetical protein PHAVU_003G058100g             257   1e-74    
ref|XP_006852476.1|  hypothetical protein AMTR_s00021p00129470          257   1e-74    
ref|XP_009777406.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    257   1e-74    
ref|XP_006449477.1|  hypothetical protein CICLE_v10015361mg             257   2e-74    
ref|XP_006467671.1|  PREDICTED: phospholipase A1-IIgamma-like           257   2e-74    
ref|XP_009393076.1|  PREDICTED: phospholipase A1-II 1                   256   2e-74    
ref|XP_010475356.1|  PREDICTED: phospholipase A1-IIalpha-like           257   2e-74    
ref|XP_004251807.1|  PREDICTED: phospholipase A1-IIdelta-like           256   2e-74    
ref|XP_006477114.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    260   2e-74    
ref|XP_008369207.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    260   3e-74    
ref|XP_011047585.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    259   3e-74    
ref|XP_010057070.1|  PREDICTED: phospholipase A1-IIgamma-like           258   3e-74    
ref|XP_009601720.1|  PREDICTED: phospholipase A1-II 1-like              256   4e-74    
ref|XP_006368966.1|  hypothetical protein POPTR_0001s15300g             259   4e-74    
ref|XP_008369208.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    259   4e-74    
ref|XP_009607511.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    258   5e-74    
ref|XP_009607510.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    259   6e-74    
gb|KFK42950.1|  hypothetical protein AALP_AA1G060100                    255   7e-74    
ref|XP_008812184.1|  PREDICTED: phospholipase A1-II 1                   254   8e-74    
emb|CBI29538.3|  unnamed protein product                                258   1e-73    
ref|XP_002316835.2|  lipase class 3 family protein                      254   1e-73    
ref|XP_010501341.1|  PREDICTED: phospholipase A1-IIalpha-like           255   1e-73    
ref|XP_003576087.1|  PREDICTED: galactolipase DONGLE, chloroplast...    255   2e-73    
gb|KEH31635.1|  glycerolipase A1                                        257   2e-73    
ref|XP_009143069.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    255   2e-73    
ref|XP_009136810.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    257   2e-73    
ref|XP_010054329.1|  PREDICTED: phospholipase A1-IIgamma-like           254   3e-73    
gb|EAY99121.1|  hypothetical protein OsI_21080                          253   3e-73    
ref|XP_011074749.1|  PREDICTED: phospholipase A1-IIgamma                254   3e-73    
ref|NP_567515.1|  phospholipase A1-Ibeta2                               256   5e-73    
ref|XP_011101305.1|  PREDICTED: phospholipase A1-II 1-like              253   5e-73    
ref|XP_006654823.1|  PREDICTED: phospholipase A1-II 6-like              253   6e-73    
ref|XP_010053518.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    256   6e-73    
gb|EEE55822.1|  hypothetical protein OsJ_04428                          250   7e-73    
ref|XP_010064368.1|  PREDICTED: galactolipase DONGLE, chloroplast...    253   7e-73    
gb|KFK22257.1|  phospholipase a1- chloroplastic-like                    255   7e-73    
emb|CDY48263.1|  BnaC04g05220D                                          254   7e-73    
ref|XP_008655140.1|  PREDICTED: triacylglycerol lipase isoform X1       265   7e-73    
gb|ABP35955.1|  phospholipase A1                                        253   9e-73    
ref|XP_003611369.1|  Lipase                                             256   1e-72    
dbj|BAC23081.1|  DAD1                                                   253   1e-72    
ref|XP_002522554.1|  triacylglycerol lipase, putative                   252   1e-72    
ref|XP_006282944.1|  hypothetical protein CARUB_v10007507mg             254   2e-72    
ref|XP_003549939.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    255   2e-72    
ref|XP_003608122.1|  Lipase                                             251   2e-72    
ref|XP_010696586.1|  PREDICTED: phospholipase A1-IIgamma-like           252   2e-72    
gb|KDO63393.1|  hypothetical protein CISIN_1g014927mg                   251   2e-72    
ref|XP_009401938.1|  PREDICTED: phospholipase A1-II 5                   253   2e-72    
ref|XP_010052794.1|  PREDICTED: phospholipase A1-IIdelta                253   2e-72    
emb|CDO96757.1|  unnamed protein product                                250   2e-72    
ref|XP_010529190.1|  PREDICTED: phospholipase A1-IIgamma-like           251   3e-72    
ref|XP_010538355.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    254   3e-72    
ref|XP_004300344.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    255   3e-72    
ref|XP_004508952.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    254   3e-72    
ref|XP_003517405.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    254   3e-72    
ref|XP_011045903.1|  PREDICTED: phospholipase A1-IIgamma                251   3e-72    
ref|XP_006468997.1|  PREDICTED: phospholipase A1-IIdelta-like           251   4e-72    
ref|XP_006397662.1|  hypothetical protein EUTSA_v10001768mg             249   4e-72    
gb|KDO85502.1|  hypothetical protein CISIN_1g035710mg                   251   5e-72    
ref|XP_010457749.1|  PREDICTED: phospholipase A1-IIalpha                251   5e-72    
ref|XP_010449712.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    253   5e-72    
ref|XP_006306316.1|  hypothetical protein CARUB_v10012192mg             251   5e-72    
ref|XP_010275455.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    254   5e-72    
ref|XP_004303191.1|  PREDICTED: phospholipase A1-IIdelta-like           251   6e-72    
ref|XP_006293380.1|  hypothetical protein CARUB_v10023210mg             251   7e-72    



>emb|CDP09265.1| unnamed protein product [Coffea canephora]
Length=502

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/501 (70%), Positives = 402/501 (80%), Gaps = 28/501 (6%)
 Frame = +2

Query  134   TAKPSNSFFPLTLSSPQKPYSSL-KCRD--SLPAAIPESSNKHdeeeedgddeegRNLHE  304
             T + SN FF     SP+K    L KC     L + + E+             ++ R  ++
Sbjct  27    TIETSNLFFLKQSFSPKKSIRKLIKCASVSRLTSEVKEAQE---------YAQDSRTFNQ  77

Query  305   IWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFF  484
             +W EIQG   WEGLLDPM+SHLR+EIIRYGEFAQACYDSFDFDPHSKYCGTCKY  A FF
Sbjct  78    VWREIQGCYHWEGLLDPMNSHLRQEIIRYGEFAQACYDSFDFDPHSKYCGTCKYQPADFF  137

Query  485   EKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLG  664
             +KL MADRGY++ RYLYATSNI+LP FFQ S+++ IWSQHANWMGYVAV  DE EI+RLG
Sbjct  138   DKLDMADRGYQMRRYLYATSNIDLPKFFQKSNMSSIWSQHANWMGYVAVTVDEDEIKRLG  197

Query  665   RRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSY  844
             RRDI+I+WRGTVTYLEWIHDLK+ LHP HFRDDP IKIESGFFDLYT   K+  C +CS+
Sbjct  198   RRDILISWRGTVTYLEWIHDLKDFLHPAHFRDDPSIKIESGFFDLYTT--KENTCKYCSF  255

Query  845   SAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegdg  1024
             SAREQ+LAEVNRLI+RY+GE LSIT+TGHSLGAALALLSAYDIAEMK+N+ +        
Sbjct  256   SAREQVLAEVNRLIQRYEGEELSITITGHSLGAALALLSAYDIAEMKLNITK--------  307

Query  1025  esssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEK  1204
                  +   KIPI+VFSFAGPRVGNLRFKERCDELG+KVLRIVNV DKVPTVPGII NEK
Sbjct  308   -----TGTKKIPITVFSFAGPRVGNLRFKERCDELGVKVLRIVNVHDKVPTVPGIITNEK  362

Query  1205  FQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGD  1384
             FQYQK +E ++ SFPWSYAHVGVELALDH++SPFLK  +DLGCAHNLE HLHLVDG+HG 
Sbjct  363   FQYQKYIEEVI-SFPWSYAHVGVELALDHTHSPFLKANSDLGCAHNLEAHLHLVDGFHGR  421

Query  1385  GRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHP  1564
             GR FR  T RDIALVNKDS+FLKR++GVPP+WRQDENKGMVR SDGRWV+PER R+EAHP
Sbjct  422   GRPFRLVTKRDIALVNKDSDFLKRDYGVPPKWRQDENKGMVRNSDGRWVLPERPRVEAHP  481

Query  1565  SDTGHHFRKVLRLARARFELF  1627
             +DT HHF +VL+ AR+ FEL 
Sbjct  482   ADTAHHFEQVLKYARSGFELL  502



>ref|XP_011080360.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Sesamum indicum]
Length=507

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/527 (67%), Positives = 407/527 (77%), Gaps = 23/527 (4%)
 Frame = +2

Query  47    MGSLQPISLNHNYHTIFAEPPLMNITKPTTAKPSNSFFPLTLSS--PQKPYSSLKCRDSL  220
             M SLQ  S N++ H I     L++ +  +T    N FFP   SS  P +   +++C    
Sbjct  1     MASLQS-SFNNSTHKIQTPGQLLS-SWNSTKGTRNLFFPNKRSSIFPSRRLIAVRCSALS  58

Query  221   PAAIPESSNKHdeeeedgddeegRNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEF  400
                + E+  +          E+ R L EIW EIQG  DWE LLDPM+SHLRREI+RYGE 
Sbjct  59    GLEVQETDEE-------LSPEDSRPLREIWREIQGENDWEDLLDPMNSHLRREIVRYGEM  111

Query  401   AQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSS  580
             AQACYDSFDFDPHSKYCGTCKY GA FFE+LGMADRGY ++R+LYATSNINLPNFFQ S 
Sbjct  112   AQACYDSFDFDPHSKYCGTCKYQGAHFFERLGMADRGYTLTRFLYATSNINLPNFFQKSK  171

Query  581   VNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD  760
              + IWSQHANWMGYVAVATDE EIRRLGRRDI+IAWRGTVTYLEWIHDLK+IL P HFRD
Sbjct  172   ASSIWSQHANWMGYVAVATDEEEIRRLGRRDIIIAWRGTVTYLEWIHDLKDILQPAHFRD  231

Query  761   DPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslg  940
             DP IKIESGFFDLYT   K+  C +CS+SAREQ+LAE+ R+I RY+GENLSIT+TGHSLG
Sbjct  232   DPSIKIESGFFDLYTT--KENTCKYCSFSAREQVLAELRRIIHRYRGENLSITITGHSLG  289

Query  941   aalallsaYDIAEMKVNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERC  1120
             AALALLSAYDIAEMK+N++                  KIPISVFSF+GPRVGNL+FKERC
Sbjct  290   AALALLSAYDIAEMKLNIID---------DRQEEVITKIPISVFSFSGPRVGNLKFKERC  340

Query  1121  DELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYS  1300
             DELGIKVLR++NV DKVPTVPGII NEKFQYQK LE ++ SFPWSYAHVGVELALDH++S
Sbjct  341   DELGIKVLRVINVHDKVPTVPGIITNEKFQYQKYLEEVI-SFPWSYAHVGVELALDHTHS  399

Query  1301  PFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRW  1480
             PFLK  +DL CAHNLE HLHLVDGYHG  +RF  A+ RDIALVNK  +FLK ++GVPP W
Sbjct  400   PFLKRNSDLRCAHNLEAHLHLVDGYHGKNKRFCLASKRDIALVNKSCDFLKSDYGVPPYW  459

Query  1481  RQDENKGMVRTSDGRWVVPERSRIEAHPSDTGHHFRKVLRLARARFE  1621
              QDE+KGMVRT+DGRW +PER  IEAHP DT HHF +V++ ARA+ E
Sbjct  460   WQDEHKGMVRTADGRWTLPERPGIEAHPPDTAHHFEQVIKYARAKLE  506



>ref|XP_009801144.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Nicotiana 
sylvestris]
Length=507

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/517 (67%), Positives = 410/517 (79%), Gaps = 26/517 (5%)
 Frame = +2

Query  74    NHNYHTIFAEPPLMNITKPTTAKPSNSFFPLTLSSPQKPYSSLKCRDSLPAAIPESSNKH  253
             NH +  +F   PL       T K  N  F   ++SP K  S L  R S P+ +   +   
Sbjct  16    NHTFREVF---PLYC----KTFKAKNLSFSSKITSP-KLSSDLSLRPSSPSILAPKNT--  65

Query  254   deeeedgddeegRNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFD  433
                     +EE + L+E+W EIQG K+WEGLLDPM+S+LR+EIIRYGEFAQ+CYDSFD+D
Sbjct  66    ---TIQQYEEEKKPLYEMWREIQGLKNWEGLLDPMNSNLRKEIIRYGEFAQSCYDSFDYD  122

Query  434   PHSKYCGTCKYDGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANW  613
             PHSKYCGTCKY  + FFEKL M  +GY + RYLYATSNINLPNFFQ S  + +WSQHANW
Sbjct  123   PHSKYCGTCKYQPSHFFEKLNMVKKGYEMRRYLYATSNINLPNFFQKSKDSMVWSQHANW  182

Query  614   MGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFF  793
             MGYVAVATD  EI+RLGRRDIV+AWRGTVTYLEW+HDLK+ILHP HFRDDP+IKIESGFF
Sbjct  183   MGYVAVATDPVEIKRLGRRDIVVAWRGTVTYLEWLHDLKDILHPAHFRDDPNIKIESGFF  242

Query  794   DLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDI  973
             DLYT  +K+  C++CS+SAREQ+LAE+NRLIE+Y+GE +SIT+TGHSLGAALALLSAYDI
Sbjct  243   DLYT--QKENSCHYCSFSAREQILAEINRLIEKYEGEEVSITITGHSLGAALALLSAYDI  300

Query  974   AEMKVNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIV  1153
             AEMK+N++           +  S   +IPI+VFSFAGPRVGNL+FK+RC+ELGI+VLR++
Sbjct  301   AEMKLNILH----------NGKSIIKRIPITVFSFAGPRVGNLKFKQRCEELGIRVLRVI  350

Query  1154  NVRDKVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGC  1333
             NV D+VPTVPGII NEKFQ+QKQLE ++ SFPWSYAHVGVELALDH +SPFLK   DLGC
Sbjct  351   NVHDRVPTVPGIITNEKFQFQKQLEEIV-SFPWSYAHVGVELALDHHHSPFLKPNNDLGC  409

Query  1334  AHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRT  1513
             AHNLE HLHLVDGYHG  R F SATGRDIALVNKDS+FLK ++GVPP W QDENKGMVRT
Sbjct  410   AHNLEAHLHLVDGYHGKDRAFCSATGRDIALVNKDSSFLKEDYGVPPLWWQDENKGMVRT  469

Query  1514  SDGRWVVPERSRIEAHPSDTGHHFRKVLRLARARFEL  1624
              DGRWV+PER  IEAHP DT HHF++VL+LARAR  L
Sbjct  470   PDGRWVLPERPIIEAHPPDTAHHFQQVLKLARARLHL  506



>ref|XP_004250927.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Solanum lycopersicum]
Length=504

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/513 (67%), Positives = 401/513 (78%), Gaps = 26/513 (5%)
 Frame = +2

Query  86    HTIFAEPPLMNITKPTTAKPSNSFFPLTLSSPQKPYSSLKCRDSLPAAIPESSNKHdeee  265
             HT     PL N  K      SN  FP    SP     +  C  +L        + +  E 
Sbjct  17    HTCLEVFPLWNTFK------SNLSFPNKRLSPSLSLKTSSCLSNL-------EDNNTIEL  63

Query  266   edgddeegRNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSK  445
             +  D+EE + LHE+W EIQG  +W+GLLDPMD HLR+EIIRYGEFAQ+CYDSFD+DPHSK
Sbjct  64    QQYDEEEKKPLHEMWREIQGCNNWKGLLDPMDCHLRKEIIRYGEFAQSCYDSFDYDPHSK  123

Query  446   YCGTCKYDGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYV  625
             YCGTCKY  +QFF+K+ M  +GY + RYLYATSNINLPNFFQ S +  +WSQHANWMGYV
Sbjct  124   YCGTCKYQPSQFFDKINMLKKGYEMKRYLYATSNINLPNFFQKSKMRNVWSQHANWMGYV  183

Query  626   AVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYT  805
             AVATD  EI+RLGRRDIV+AWRGTVTYLEWIHDL++ILHP HFRDDP+IKIE+GFFD+YT
Sbjct  184   AVATDPEEIKRLGRRDIVVAWRGTVTYLEWIHDLQDILHPAHFRDDPNIKIETGFFDMYT  243

Query  806   NSKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMK  985
               KK+ +C++ S+SAREQ+LAE+NRLIE+Y+GE LSIT+TGHSLGAALALLSAYDIAEMK
Sbjct  244   --KKENNCHYASFSAREQILAEINRLIEKYQGEELSITITGHSLGAALALLSAYDIAEMK  301

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
             +N++           +  S    IPI+VFSFAGPRVGNL+FKERC+ELGIKVLR+VNV D
Sbjct  302   LNILH----------NGKSITKIIPITVFSFAGPRVGNLKFKERCEELGIKVLRVVNVHD  351

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
             KVP VPGIIANEKFQ+QKQLE    SF WSYAHVG ELALDH  SPFLK  +DLG AHNL
Sbjct  352   KVPKVPGIIANEKFQFQKQLEEKF-SFAWSYAHVGAELALDHHRSPFLKPNSDLGSAHNL  410

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGR  1525
             E HLHLVDGYHG  R FRSAT RD+ALVNKDS+FLK E+GVPP W QDENKGMVRTSDG+
Sbjct  411   EAHLHLVDGYHGKVRAFRSATSRDVALVNKDSSFLKEEYGVPPFWWQDENKGMVRTSDGQ  470

Query  1526  WVVPERSRIEAHPSDTGHHFRKVLRLARARFEL  1624
             WV+PER  IEAHP DT HHF++VL+LARAR  L
Sbjct  471   WVLPERPIIEAHPPDTAHHFQQVLKLARARLNL  503



>ref|XP_002285367.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Vitis vinifera]
Length=502

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/518 (66%), Positives = 397/518 (77%), Gaps = 37/518 (7%)
 Frame = +2

Query  110   LMNITKPTTAKPSNSFFPL---------TLSSPQKPYSS-----LKCRDSLPAAIPESSN  247
             L  +  PT   PS S              L+ P KP+S      +KC  S+ +  P   +
Sbjct  5     LQTLNNPTYTSPSASLSVFRRWNRNSIRVLTIPNKPFSPKPTTLIKC-SSVSSLTPRLDH  63

Query  248   KHdeeeedgddeegRNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFD  427
             +          +E + L ++W EIQG  +WEGLLDPM+ +LR+EIIRYGEFAQACYDSFD
Sbjct  64    E----PARELKQEDKPLRDVWEEIQGCNNWEGLLDPMNPNLRKEIIRYGEFAQACYDSFD  119

Query  428   FDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHA  607
             FDPHSKYCGTCKY GA FF+KL MADRGY+ISRYLYATSNINLPNFFQ S ++ +WS HA
Sbjct  120   FDPHSKYCGTCKYQGAHFFQKLDMADRGYQISRYLYATSNINLPNFFQKSKMSSVWSPHA  179

Query  608   NWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESG  787
             NWMGY+AV TDE EI+RLGRRDI+IAWRGTVTYLEWIHDLK+IL P HFRDDP+IKIESG
Sbjct  180   NWMGYIAVTTDEKEIKRLGRRDIIIAWRGTVTYLEWIHDLKDILCPAHFRDDPNIKIESG  239

Query  788   FFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaY  967
             F+DLYT  KK+ +C FCS+SAREQ+LAE+ RL+ERYK E +SIT+TGHSLGAALALLSAY
Sbjct  240   FYDLYT--KKENNCKFCSFSAREQVLAEIKRLVERYKDEEISITITGHSLGAALALLSAY  297

Query  968   DIAEMKVNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLR  1147
             DIAEM +NV                   +IPISVFSF+GPRVGNL+FKERCDELG+KVLR
Sbjct  298   DIAEMNLNV---------------RNKSRIPISVFSFSGPRVGNLKFKERCDELGVKVLR  342

Query  1148  IVNVRDKVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDL  1327
             ++NV DKVPTVPGII NEKFQYQK +E  + SFPWSYAHVGVELALDH++SPFLK   DL
Sbjct  343   VINVHDKVPTVPGIITNEKFQYQKYIEETI-SFPWSYAHVGVELALDHTHSPFLKPTNDL  401

Query  1328  GCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV  1507
             GCAHNLE HLHLVDGYHG  R+F  AT RDIALVNK  +FL+ E+GVP  WRQDENKGMV
Sbjct  402   GCAHNLEAHLHLVDGYHGKDRKFSLATKRDIALVNKSCDFLRSEYGVPGNWRQDENKGMV  461

Query  1508  RTSDGRWVVPERSRIEAHPSDTGHHFRKVLRLARARFE  1621
             R SDGRWV+PER R+EAHP DT HH  +VL+L+R+  E
Sbjct  462   RASDGRWVLPERPRMEAHPPDTAHHLEQVLKLSRSTLE  499



>ref|XP_009622048.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase A1-Igamma3, chloroplastic 
[Nicotiana tomentosiformis]
Length=505

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/443 (73%), Positives = 371/443 (84%), Gaps = 14/443 (3%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L+EIW EIQG  +WEGLLDPM+S+LR+EIIRYGEFAQ+CYDSFD+DPHSKYCGTCKY  +
Sbjct  76    LYEIWREIQGCNNWEGLLDPMNSNLRKEIIRYGEFAQSCYDSFDYDPHSKYCGTCKYQPS  135

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
              FFEKL M  +GY++ RYLYATSNINLPNFFQ S    +W +HANWMGYVAVATD  EI+
Sbjct  136   HFFEKLNMVKKGYKMRRYLYATSNINLPNFFQKSKX-IVWFEHANWMGYVAVATDPDEIK  194

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  835
             RLGRRDIV+AWRGTVTYLEWIHDLK+ILHP HFRDDP+IKIESGFFDLYT ++K+  C++
Sbjct  195   RLGRRDIVVAWRGTVTYLEWIHDLKDILHPAHFRDDPNIKIESGFFDLYTQNEKN--CHY  252

Query  836   CSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegege  1015
             CS+SAREQ+LAE+NRLIE+Y+GE LSIT+TGHSLGAALALLSAYDIAEMK+N++  G+  
Sbjct  253   CSFSAREQILAEINRLIEKYEGEELSITITGHSLGAALALLSAYDIAEMKLNILHNGKSM  312

Query  1016  gdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1195
                   +          VFSFAGPRVGNL+FKERC+ LGI+VLR++NV DKVP VPGII 
Sbjct  313   IKRIPIT----------VFSFAGPRVGNLKFKERCEVLGIRVLRVINVHDKVPKVPGIIT  362

Query  1196  NEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1375
             NEKFQ+QKQLE  + SFPWSYAHVGVE ALDH +SPFLK   DLGCAHNLE HLH VDGY
Sbjct  363   NEKFQFQKQLEETI-SFPWSYAHVGVEFALDHHHSPFLKPNGDLGCAHNLEAHLHFVDGY  421

Query  1376  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIE  1555
             HG  R F SATGRD+ALVNKDSNFLK ++GVPP W QDENKGMVRT DGRWV+PER  IE
Sbjct  422   HGKDRAFCSATGRDVALVNKDSNFLKEDYGVPPLWWQDENKGMVRTPDGRWVLPERPIIE  481

Query  1556  AHPSDTGHHFRKVLRLARARFEL  1624
             AHP DT HHF++VL+LAR R  L
Sbjct  482   AHPPDTAHHFQQVLKLARERLHL  504



>ref|XP_007015095.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY32714.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=508

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/439 (73%), Positives = 368/439 (84%), Gaps = 14/439 (3%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L +IW EIQG  DW+GLLDPM+ HLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY 
Sbjct  75    RPLCQIWKEIQGCNDWDGLLDPMNPHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYQ  134

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
             GA FFEKLGMADRGY+ISRYLYATSNINLPNFFQ S+++ +WS HANWMGYVAV TDE E
Sbjct  135   GAHFFEKLGMADRGYQISRYLYATSNINLPNFFQKSNLSSVWSTHANWMGYVAVCTDEDE  194

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  829
             I+RLGRRDIVI+WRGTVTYLEWI+DLK+ILH  +F  DP IK+E GF+DLYT  KK+  C
Sbjct  195   IKRLGRRDIVISWRGTVTYLEWIYDLKDILHQANFTKDPSIKMELGFYDLYT--KKENAC  252

Query  830   NFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1009
             N+CS+SAREQ+LAE+ RL+E Y GE +SIT+TGHSLGAALAL++AYDIAE+ +N+V+   
Sbjct  253   NYCSFSAREQVLAEIKRLLEYYDGEEISITITGHSLGAALALITAYDIAELGLNLVE---  309

Query  1010  gegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1189
                         + K+PI+V+SFAGPRVGNL+FKERCDELG+KVLR VNV DKVPTVPGI
Sbjct  310   --------EGELSNKVPITVYSFAGPRVGNLKFKERCDELGVKVLRAVNVHDKVPTVPGI  361

Query  1190  IANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1369
              ANEK Q+QK LE  + SFPWSYAHVGVELALDH+ SPFLK+  DL CAHNLE HLHL+D
Sbjct  362   FANEKLQFQKYLEEAV-SFPWSYAHVGVELALDHTCSPFLKSTNDLACAHNLEAHLHLLD  420

Query  1370  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1549
             GYHG GRRF  A  RDIALVNKDSNFLK ++GVPP WRQDENKGMVR SDGRWV+PER R
Sbjct  421   GYHGKGRRFCLANKRDIALVNKDSNFLKSDYGVPPYWRQDENKGMVRNSDGRWVLPERPR  480

Query  1550  IEAHPSDTGHHFRKVLRLA  1606
             +EAHP D  HH  K+L++A
Sbjct  481   VEAHPHDISHHLEKILKVA  499



>ref|XP_010246745.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Nelumbo 
nucifera]
Length=507

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/515 (65%), Positives = 397/515 (77%), Gaps = 25/515 (5%)
 Frame = +2

Query  107   PLMNITKPTTAKPSNSFFPLTLSSPQ----------KPYSSLKCRDSLPAAIPESSNKHd  256
             P ++ TKP    PS   + L+  +P           KP +SLKC                
Sbjct  4     PSLSFTKPKCFFPSLPGWNLS-QTPNLIISKKPISLKPRTSLKCSSVSSLTSISDEEIVV  62

Query  257   eeeedgddeegRNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDP  436
             EE E    EE ++L EIW EIQG  DWEGLLDP +  LR+EIIRYGEFAQACYDSFDFDP
Sbjct  63    EEAEKLVMEEEKSLREIWQEIQGCNDWEGLLDPTNPVLRKEIIRYGEFAQACYDSFDFDP  122

Query  437   HSKYCGTCKYDGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWM  616
              SKYCGTCKY GA FF+KL M + GY++SRY+YAT+NINLPNFFQ + ++ +WS HANWM
Sbjct  123   RSKYCGTCKYQGAHFFQKLYMTNLGYQVSRYVYATTNINLPNFFQKAKISSVWSPHANWM  182

Query  617   GYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFD  796
             GYVAVATDE EI+RLGRRDI++AWRGTVTYLEWIHDLK+ILHP  F DDP IKIESGFFD
Sbjct  183   GYVAVATDEQEIKRLGRRDILVAWRGTVTYLEWIHDLKDILHPARFGDDPSIKIESGFFD  242

Query  797   LYTNSKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIA  976
             LYT  KK+  CN+CS+SAREQ+LAE+ RL+ERYKGE LSIT+TGHSLGAALALLSAYDIA
Sbjct  243   LYT--KKEHKCNYCSFSAREQILAEIKRLVERYKGEELSITITGHSLGAALALLSAYDIA  300

Query  977   EMKVNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVN  1156
             EMK+N+             S     +IPI+VFSFAGPRVGNL+FKERCDELG+KVLR++N
Sbjct  301   EMKLNI-----------GDSGHIQARIPITVFSFAGPRVGNLKFKERCDELGVKVLRVIN  349

Query  1157  VRDKVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCA  1336
             V DKVPTVPG+IANEKFQ+QK +E ++ SFPWSYAHVG+ELALDH++SPFLK   DL CA
Sbjct  350   VHDKVPTVPGVIANEKFQFQKYMEEVM-SFPWSYAHVGLELALDHTHSPFLKPTFDLFCA  408

Query  1337  HNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTS  1516
             HNLE HLHLVDGYHG  RRF  AT RDIALVNK  +FL+ ++GVPP WRQDENKGMVRT+
Sbjct  409   HNLEVHLHLVDGYHGKERRFCLATKRDIALVNKSCDFLRVDYGVPPFWRQDENKGMVRTT  468

Query  1517  DGRWVVPERSRIEAHPSDTGHHFRKVLRLARARFE  1621
             DGRW++PER R+EAHP DT HH  +VL++ ++  E
Sbjct  469   DGRWILPERPRMEAHPPDTAHHVEQVLKVFKSSAE  503



>ref|XP_007211838.1| hypothetical protein PRUPE_ppa004631mg [Prunus persica]
 gb|EMJ13037.1| hypothetical protein PRUPE_ppa004631mg [Prunus persica]
Length=499

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/445 (72%), Positives = 368/445 (83%), Gaps = 12/445 (3%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDP-MDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKY  466
             R LHEIW EIQG  +WEGLLDP ++SHLR+EIIRYGEFAQACYDSFDFDPHSKYCGTCKY
Sbjct  64    RPLHEIWKEIQGLNNWEGLLDPTLNSHLRQEIIRYGEFAQACYDSFDFDPHSKYCGTCKY  123

Query  467   DGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEA  646
              GA FFE L MADRGY+ISRYLYATSNINLPNFFQ S +  +WS+HANWMG+VAVATD  
Sbjct  124   QGAHFFENLDMADRGYQISRYLYATSNINLPNFFQKSKLGSVWSRHANWMGFVAVATDPD  183

Query  647   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTD  826
             +I+RLGRRDIVIAWRGTVTYLEWI+DLK+ILHP  FR+DP IKIESGF+DLYT  KK+ +
Sbjct  184   QIKRLGRRDIVIAWRGTVTYLEWIYDLKDILHPAQFRNDPSIKIESGFYDLYT--KKEDE  241

Query  827   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
             C FCS+SAREQLLAEV RL E Y+GE +SIT+TGHSLGAALA+LSAYDIAEM +N+V   
Sbjct  242   CRFCSFSAREQLLAEVKRLRELYQGEEISITITGHSLGAALAILSAYDIAEMGLNIVH--  299

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                   +      + KIPI+V+SF+GPRVGNLRFKERCDELG+KVLR+VNV DKVP VPG
Sbjct  300   ------DGHHELESTKIPITVYSFSGPRVGNLRFKERCDELGVKVLRVVNVHDKVPRVPG  353

Query  1187  IIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1366
             II NEKF++QK +E  + +FPWSYAHVGV L LDH+ SPFLK   D GCAHNLE HLHLV
Sbjct  354   IITNEKFRFQKYIEDTI-AFPWSYAHVGVALELDHNQSPFLKPTNDFGCAHNLEAHLHLV  412

Query  1367  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1546
             DGYHG G++F   T RDIALVNK  +FL+ E+GVPP WRQDENKGMVR+ DGRWV+PER 
Sbjct  413   DGYHGKGQKFCLVTKRDIALVNKSCDFLRAEYGVPPHWRQDENKGMVRSKDGRWVLPERP  472

Query  1547  RIEAHPSDTGHHFRKVLRLARARFE  1621
             R+EAHP DT HH ++VL +   + E
Sbjct  473   RVEAHPPDTAHHLQQVLNMCSTQLE  497



>ref|XP_008227339.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Prunus mume]
Length=517

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/445 (72%), Positives = 370/445 (83%), Gaps = 12/445 (3%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDP-MDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKY  466
             R LHEIW EIQG  +WEGLLDP ++SHLR+EIIRYGEFAQACYDSFDFDPHSKYCGTCKY
Sbjct  82    RPLHEIWKEIQGLNNWEGLLDPTLNSHLRQEIIRYGEFAQACYDSFDFDPHSKYCGTCKY  141

Query  467   DGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEA  646
              GA+FFE L MADRGY+ISRYLYATSNINLPNFFQ S +  +WS+HANWMG+VAVATD  
Sbjct  142   QGARFFENLDMADRGYQISRYLYATSNINLPNFFQKSKLGSVWSRHANWMGFVAVATDPY  201

Query  647   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTD  826
             +I+RLGRRDIVIAWRGTVTYLEWI+DLK+ILHP  FR+DP IKIESGF+DLYT  KK+ +
Sbjct  202   QIKRLGRRDIVIAWRGTVTYLEWIYDLKDILHPAQFRNDPSIKIESGFYDLYT--KKEDE  259

Query  827   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
             C FCS+SAREQLLAEV RL E Y+GE +SIT+TGHSLGAALA+LSAYDIAEM +N+V   
Sbjct  260   CRFCSFSAREQLLAEVKRLRELYQGEEISITITGHSLGAALAILSAYDIAEMGLNIVH--  317

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                   E      + KIPI+V+SF+GPRVGNLRFKERCD+LG+KVLR+VNV DKVP VPG
Sbjct  318   ------EGHHELESTKIPITVYSFSGPRVGNLRFKERCDKLGVKVLRVVNVHDKVPRVPG  371

Query  1187  IIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1366
             II NEKF++QK +E  + +FPWSYAHVGVEL LDH+ SPFLK   D GCAHNLE HLHLV
Sbjct  372   IITNEKFRFQKYIEDTI-AFPWSYAHVGVELELDHNQSPFLKPTNDFGCAHNLEAHLHLV  430

Query  1367  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1546
             DGYHG G++F   T RDIALVNK  +FL+ E+GVPP WRQDENKGMVR+ DGRWV+PER 
Sbjct  431   DGYHGKGQKFCLVTKRDIALVNKSCDFLRAEYGVPPHWRQDENKGMVRSKDGRWVLPERP  490

Query  1547  RIEAHPSDTGHHFRKVLRLARARFE  1621
             ++EAHP DT HH ++VL +   + E
Sbjct  491   KVEAHPPDTAHHLQQVLNMCSTQLE  515



>ref|XP_010031778.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Eucalyptus 
grandis]
Length=524

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/444 (72%), Positives = 367/444 (83%), Gaps = 15/444 (3%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L ++W EIQG   WEGLLDPM+SH+R+EIIRYGEFAQACYDSFDFDP+SKYCGTCKY 
Sbjct  94    RPLSQVWREIQGCNHWEGLLDPMNSHVRQEIIRYGEFAQACYDSFDFDPNSKYCGTCKYQ  153

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
             G+QFFEKLGM   GY+ISRYLYATSNINLPNFFQHS ++++WS +ANWMGY+AV TDE E
Sbjct  154   GSQFFEKLGMNHFGYQISRYLYATSNINLPNFFQHSRLSKVWSTYANWMGYIAVTTDEEE  213

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  829
             IRRLGRRDIVIAWRGTVTYLEWI+DLK+ILHP HF+DDP IKIE+GF+DLYT  KK+  C
Sbjct  214   IRRLGRRDIVIAWRGTVTYLEWIYDLKDILHPAHFKDDPTIKIEAGFYDLYT--KKEKSC  271

Query  830   NFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1009
             +FCS+SAREQ+LAEV RL++ Y+ E +SIT+TGHSLGAALA++SAYDIAEM VNVV    
Sbjct  272   HFCSFSAREQILAEVKRLLDYYRDEEISITITGHSLGAALAIISAYDIAEMGVNVVN---  328

Query  1010  gegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1189
                           K+PI+V+SFAGPRVGNL+FKERCDELG+KVLR+ NV D VPTVPGI
Sbjct  329   --------DGGEMKKVPITVYSFAGPRVGNLKFKERCDELGVKVLRLTNVHDMVPTVPGI  380

Query  1190  IANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1369
             IANEK Q+QK LE  L SFPWSYAHVG ELALD ++SPFLK+  D  CAHNLE  LHLVD
Sbjct  381   IANEKMQFQKYLEETL-SFPWSYAHVGTELALDQTHSPFLKSTNDPSCAHNLEALLHLVD  439

Query  1370  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1549
             GYHG+GRRF+  T RDIALVNK  +FLK E+GVPP WRQDENKGMVR+SDGRWVVPER  
Sbjct  440   GYHGEGRRFKLVTRRDIALVNKSCDFLKGEYGVPPCWRQDENKGMVRSSDGRWVVPER-L  498

Query  1550  IEAHPSDTGHHFRKVLRLARARFE  1621
             ++AH SDT HH  +VL +A    E
Sbjct  499   VDAHRSDTAHHLAQVLGVANLPLE  522



>ref|XP_002313345.2| hypothetical protein POPTR_0009s05660g [Populus trichocarpa]
 gb|EEE87300.2| hypothetical protein POPTR_0009s05660g [Populus trichocarpa]
Length=508

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/481 (67%), Positives = 379/481 (79%), Gaps = 15/481 (3%)
 Frame = +2

Query  161   PLTLSSPQKPYSSLKCRDSLPAAIPESSNKHdeeeedgddeegRNLHEIWAEIQGSKDWE  340
             P +LS   KP+S       +  +   S+      E   + E+ R L EIW EIQG  DWE
Sbjct  31    PKSLSLLNKPFSPNSTTLKIKGSSVSSALTPQLNETLVNQEDERPLSEIWKEIQGCNDWE  90

Query  341   GLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADR-GYR  517
             GLLDPM+SHLR+EIIRYGEFAQA YDSFDFDPHSKYCG+CKY GAQFFEKL M     Y+
Sbjct  91    GLLDPMNSHLRKEIIRYGEFAQASYDSFDFDPHSKYCGSCKYRGAQFFEKLDMQGHVNYQ  150

Query  518   ISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGT  697
             ISRYLYATSNINLPNFFQ S ++R+WS HANWMGYVAV T+E EI+RLGRRDIV+AWRGT
Sbjct  151   ISRYLYATSNINLPNFFQKSKLSRVWSTHANWMGYVAVTTNEEEIKRLGRRDIVVAWRGT  210

Query  698   VTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVN  877
             VTYLEWI+DLK+IL   +F +DP IKIE GF+DLYT  KK+  C +C++SAREQ+LAE+ 
Sbjct  211   VTYLEWIYDLKDILCVANFTNDPSIKIELGFYDLYT--KKENSCKYCTFSAREQVLAEIK  268

Query  878   RLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegdgesssasaaiki  1057
             RL++ Y+GE +SIT+TGHSLGAALA LSAYDIAEM++N + +GE       +        
Sbjct  269   RLLDYYRGEEISITITGHSLGAALATLSAYDIAEMRLNYMDDGEYRTRIPIT--------  320

Query  1058  pisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETML  1237
                V+SF+GPRVGNL+FKERCDELG+KVLR++NVRDKVPTVPGIIANEK Q+QK +E  +
Sbjct  321   ---VYSFSGPRVGNLKFKERCDELGVKVLRVINVRDKVPTVPGIIANEKLQFQKYIEDNM  377

Query  1238  KSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRD  1417
              SFPWSYAHVGVELALDH++SPFLK   DLGCAHNLE HLHLVDGYHG G+RF  AT RD
Sbjct  378   -SFPWSYAHVGVELALDHTHSPFLKPTKDLGCAHNLEAHLHLVDGYHGKGQRFCLATKRD  436

Query  1418  IALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPSDTGHHFRKVL  1597
             IALVNK  +FL+RE+GVPP WRQDENKGMVR +DGRWV+PER R +AHP+DT HH  +VL
Sbjct  437   IALVNKSCDFLRREYGVPPYWRQDENKGMVRNADGRWVLPERPRADAHPADTAHHVEQVL  496

Query  1598  R  1600
             +
Sbjct  497   K  497



>gb|EYU31376.1| hypothetical protein MIMGU_mgv1a004679mg [Erythranthe guttata]
Length=515

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/446 (71%), Positives = 365/446 (82%), Gaps = 12/446 (3%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             + L EIW EIQG  +WE LL+PM+  LR+EIIRYGE AQACYDSFDFDP+SKYCGTCKY+
Sbjct  82    KQLDEIWMEIQGCNNWENLLEPMNPLLRQEIIRYGEMAQACYDSFDFDPNSKYCGTCKYE  141

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
             GA FFE++G++ RGY ++RYLYATSNINLPNFFQ S ++ +WSQHANWMGYVAVATDEAE
Sbjct  142   GANFFERVGLSGRGYTLTRYLYATSNINLPNFFQKSKISSVWSQHANWMGYVAVATDEAE  201

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  829
             IRRLGRRDI +AWRGTVTYLEWIHDLK+ILHP HFR DP IKIESGFFDLYT+  K++ C
Sbjct  202   IRRLGRRDITVAWRGTVTYLEWIHDLKDILHPAHFRADPSIKIESGFFDLYTS--KESSC  259

Query  830   NFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1009
              +CS+SAREQ+LAEV RLI RY+GE LSIT+TGHSLGAALALLSAYD+AEMK+N+     
Sbjct  260   EYCSFSAREQVLAEVRRLIHRYRGEKLSITITGHSLGAALALLSAYDMAEMKLNLT----  315

Query  1010  gegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1189
                        A  KIP++VFSFAGPRVGNL+FKERCD LGIKVLR+VN  DKVP +PGI
Sbjct  316   -----GDHGDDAVSKIPLTVFSFAGPRVGNLKFKERCDYLGIKVLRVVNAHDKVPKMPGI  370

Query  1190  IANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1369
             I NEKF +Q+ +E  L SFPWSYAHVGVELALDH+ SPFLK   DL  AHNLE HLHL+D
Sbjct  371   ITNEKFPHQRYIEDKL-SFPWSYAHVGVELALDHTRSPFLKKTGDLRDAHNLEAHLHLLD  429

Query  1370  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1549
             GYHG    FRSA GRDIALVNK   FLK E  VPP W QDE+KGMVRT DGRWV+PER R
Sbjct  430   GYHGKDGEFRSAGGRDIALVNKSCGFLKSECEVPPNWWQDEHKGMVRTGDGRWVLPERPR  489

Query  1550  IEAHPSDTGHHFRKVLRLARARFELF  1627
             +E+HP DT HHF +V++ ARA+ ELF
Sbjct  490   VESHPPDTAHHFAQVIKYARAKLELF  515



>gb|KDP22109.1| hypothetical protein JCGZ_25940 [Jatropha curcas]
Length=501

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/519 (63%), Positives = 390/519 (75%), Gaps = 25/519 (5%)
 Frame = +2

Query  47    MGSLQPISLNHNYHTIFAEPPLMNITKPT-TAKPSNSFFPLTLSSPQKPYSSLKCRDSLP  223
             M +L  I LN    T+   PP+     P      S SF   +      P + +KC  S+ 
Sbjct  1     MATLLIIPLNTLKTTL---PPIHERFLPIFKLSKSKSFIFQSKLFSLNPKTLIKCSSSVS  57

Query  224   AAIPESSNKHdeeeedgddeegRNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFA  403
                P+  ++        + E+ R L +IW EIQG  DWEGLLDPM+SHLR+EIIRYGEFA
Sbjct  58    RLTPQLDDE----TLVYNQEDERPLSQIWKEIQGCNDWEGLLDPMNSHLRKEIIRYGEFA  113

Query  404   QACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSV  583
             Q CYDSFDFDPHSKYCGTCKY GA FF+KL M   GY+ISRYLYATSNINLPNFFQ S +
Sbjct  114   QTCYDSFDFDPHSKYCGTCKYQGAHFFDKLDMQGHGYQISRYLYATSNINLPNFFQKSKL  173

Query  584   NRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDD  763
             + +WS HANWMGYVAV+TDE EI+RLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F +D
Sbjct  174   SSVWSIHANWMGYVAVSTDEEEIQRLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFTND  233

Query  764   PDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslga  943
             P IKIE GF+DLYT  KK+  C +C++SAREQ+LAE+ RL++ Y+GE +SIT+TGHSLGA
Sbjct  234   PSIKIELGFYDLYT--KKENSCKYCTFSAREQVLAEIKRLLDYYRGEEISITITGHSLGA  291

Query  944   alallsaYDIAEMKVNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD  1123
             ALA+LSAYDIAEMKVN +                  KIPI+V+SF+GPRVGNL+FKERC+
Sbjct  292   ALAILSAYDIAEMKVNYMD--------------DKTKIPITVYSFSGPRVGNLKFKERCE  337

Query  1124  ELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSP  1303
             EL +KVLR++NV DKVP VPGI ANEKFQ+QK +E  + SFPWSYAHVGVELALDH++SP
Sbjct  338   ELDVKVLRVINVHDKVPKVPGIFANEKFQFQKYVEETM-SFPWSYAHVGVELALDHTHSP  396

Query  1304  FLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWR  1483
             FL+   DLGCAHNLE HLHLVDGYHG GR+F  AT RDIALVNK  +FL+ E+GVPP WR
Sbjct  397   FLRPTNDLGCAHNLEVHLHLVDGYHGKGRKFVLATKRDIALVNKSCDFLRSEYGVPPHWR  456

Query  1484  QDENKGMVRTSDGRWVVPERSRIEAHPSDTGHHFRKVLR  1600
             QDENKGM+R  +GRWVVP+R R+EAH +DT HH  +VL+
Sbjct  457   QDENKGMIRNREGRWVVPDRPRVEAHRADTAHHLEQVLK  495



>emb|CAN83233.1| hypothetical protein VITISV_005768 [Vitis vinifera]
Length=467

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/518 (60%), Positives = 365/518 (70%), Gaps = 72/518 (14%)
 Frame = +2

Query  110   LMNITKPTTAKPSNSFFPL---------TLSSPQKPYSS-----LKCRDSLPAAIPESSN  247
             L  +  PT   PS S              L+ P KP+S      +KC  S+ +  P   +
Sbjct  5     LQTLNNPTYTSPSASLSVFRRWNRNSIRVLTIPNKPFSRKPXTLIKC-SSVSSLTPRLDH  63

Query  248   KHdeeeedgddeegRNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFD  427
             +          +E + L ++W EIQG  DWEGLLDPM+ +LR+EIIRYGEFAQACYDSFD
Sbjct  64    E----PARELKQEDKPLRDVWEEIQGCNDWEGLLDPMNPNLRKEIIRYGEFAQACYDSFD  119

Query  428   FDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHA  607
             FDPHSKYCGTCKY GA FF+KL MADRGY+ISRYLYATSNINLPNFFQ S ++ +WS HA
Sbjct  120   FDPHSKYCGTCKYQGAHFFQKLDMADRGYQISRYLYATSNINLPNFFQKSKMSSVWSPHA  179

Query  608   NWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESG  787
             NWMGY+AV TDE EI+RLGRRDI+IAWRGTVTYLEWIHDLK+IL P HFRDDP+IKIESG
Sbjct  180   NWMGYIAVTTDEKEIKRLGRRDIIIAWRGTVTYLEWIHDLKDILCPAHFRDDPNIKIESG  239

Query  788   FFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaY  967
             F+DLYT  KK+ +C FCS+SAREQ+LAE+ RL+ER K     I ++              
Sbjct  240   FYDLYT--KKENNCKFCSFSAREQVLAEIKRLVERNKSR---IPIS--------------  280

Query  968   DIAEMKVNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLR  1147
                                              VFSF+GPRVGNL+FKERCDELG+KVLR
Sbjct  281   ---------------------------------VFSFSGPRVGNLKFKERCDELGVKVLR  307

Query  1148  IVNVRDKVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDL  1327
             ++NV DKVPTVPGII NEKFQYQK +E  + SFPWSYAHVGVELALDH++SPFLK   DL
Sbjct  308   VINVHDKVPTVPGIITNEKFQYQKYIEETI-SFPWSYAHVGVELALDHTHSPFLKPTNDL  366

Query  1328  GCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV  1507
             GCAHNLE HLHLVDGYHG  R+F  AT RDIALVNK  +FL+ E+GVP  WRQDENKGMV
Sbjct  367   GCAHNLEAHLHLVDGYHGKDRKFSLATKRDIALVNKSCDFLRSEYGVPGNWRQDENKGMV  426

Query  1508  RTSDGRWVVPERSRIEAHPSDTGHHFRKVLRLARARFE  1621
             R SDGRWV+PER R+EAHP DT HH  +VL+L+R+  E
Sbjct  427   RASDGRWVLPERPRMEAHPPDTAHHLEQVLKLSRSTLE  464



>ref|XP_010269807.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like, partial 
[Nelumbo nucifera]
Length=488

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/486 (66%), Positives = 382/486 (79%), Gaps = 19/486 (4%)
 Frame = +2

Query  164   LTLSSPQKPYSSLKCRDSLPAAIPESSNKHdeeeedgddeegRNLHEIWAEIQGSKDWEG  343
             L L S  KP + LKC  S+ + I     K          EE + L ++W EIQG  DWEG
Sbjct  20    LILPSSPKPRTLLKC-SSVSSLISIWDEK----AVVEHVEEEKPLRDVWQEIQGCNDWEG  74

Query  344   LLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRIS  523
             LLDPMD  LR+EIIRYGEFAQA YDSFDF+PHSKYCGTCK+ GA FFE+L MA+ GY+IS
Sbjct  75    LLDPMDPVLRKEIIRYGEFAQASYDSFDFNPHSKYCGTCKFQGAHFFERLHMANLGYQIS  134

Query  524   RYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVT  703
             RYLYATSNI+LPNFFQ + ++++WS HANWMGYVAVATDE EI R GRRDIVIAWRGTVT
Sbjct  135   RYLYATSNISLPNFFQKAKISKVWSPHANWMGYVAVATDEKEIVRSGRRDIVIAWRGTVT  194

Query  704   YLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRL  883
             YLEWIHDLK+IL P  F  DP IKIESGF DLYT  K+   CN+C++SA EQ+LAE+ RL
Sbjct  195   YLEWIHDLKDILRPACFGGDPSIKIESGFLDLYTTKKQ--GCNYCTFSAXEQVLAEIKRL  252

Query  884   IERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegdgesssasaaikipi  1063
             +ERYKG+ LSIT+TGHSLGAALALLSAYD+AEMK++V +           +  +  +IP+
Sbjct  253   VERYKGDELSITITGHSLGAALALLSAYDVAEMKLDVRR-----------NGHSQTRIPV  301

Query  1064  sVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETMLKS  1243
             +VFSF+GPRVGNL+FKE CDELGIKVLR++NV DKVPTVPG+IANEK Q+QK +E ++ S
Sbjct  302   TVFSFSGPRVGNLKFKEMCDELGIKVLRVINVHDKVPTVPGVIANEKSQFQKYIEKVI-S  360

Query  1244  FPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIA  1423
             FPWSYAHVGVE+ALDH+ SPFLK+  DL CAHNLE HLHLVDGYHG GRRF  A  RDIA
Sbjct  361   FPWSYAHVGVEIALDHTNSPFLKSTFDLSCAHNLEAHLHLVDGYHGKGRRFCLANKRDIA  420

Query  1424  LVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPSDTGHHFRKVLRL  1603
             LVNK S+FL+ ++GVPP W QDENKGMVR+SDGRWV+PER R+EAHP DT +H  +VL++
Sbjct  421   LVNKSSDFLREDYGVPPHWLQDENKGMVRSSDGRWVLPERPRMEAHPPDTAYHVEQVLKV  480

Query  1604  ARARFE  1621
               +  E
Sbjct  481   FNSPVE  486



>ref|XP_011032046.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Populus euphratica]
Length=508

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/481 (65%), Positives = 376/481 (78%), Gaps = 15/481 (3%)
 Frame = +2

Query  161   PLTLSSPQKPYSSLKCRDSLPAAIPESSNKHdeeeedgddeegRNLHEIWAEIQGSKDWE  340
             P +LS   KP+S       +  +   S+      E   + E+ R L EIW EIQG  DWE
Sbjct  31    PKSLSLLNKPFSPNSKTLKIKGSSVSSALTPQLYETLVNQEDERPLSEIWKEIQGCNDWE  90

Query  341   GLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADR-GYR  517
             GLLDPM+SHLR+EIIRYGEFAQA YDSFDFDPHSKYCG+CKY GAQFFEKL M     Y+
Sbjct  91    GLLDPMNSHLRKEIIRYGEFAQASYDSFDFDPHSKYCGSCKYRGAQFFEKLDMQGHVKYQ  150

Query  518   ISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGT  697
             ISRYLYATSNINLPNFFQ S ++R+WS HANWMGYVAV T+E EI+RLGRRDIV+AWRGT
Sbjct  151   ISRYLYATSNINLPNFFQKSKLSRVWSTHANWMGYVAVTTNEEEIKRLGRRDIVVAWRGT  210

Query  698   VTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVN  877
             VTYLEWI+DLK+IL   +F +DP IKIE GF+DLYT  KK+  C +C++SAREQ+LAE+ 
Sbjct  211   VTYLEWIYDLKDILCVANFTNDPSIKIELGFYDLYT--KKENSCKYCTFSAREQVLAEIK  268

Query  878   RLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegdgesssasaaiki  1057
             RL++ Y+GE +SIT+TGHSLGAALA LSAYDIAEM++N + +GE       +        
Sbjct  269   RLLDYYRGEEISITITGHSLGAALATLSAYDIAEMRLNYMDDGEYRTKIPIT--------  320

Query  1058  pisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETML  1237
                V+SF+GPRVGNL+FKERCDELG+KVLR++NV D VP VPG+IANEK Q+Q+ +E  +
Sbjct  321   ---VYSFSGPRVGNLKFKERCDELGVKVLRVINVHDMVPNVPGMIANEKLQFQRYIEDNM  377

Query  1238  KSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRD  1417
              SFPWSYAHVGVELALDH++SPFLK   DLGCAHNLE HLHLVDGYHG G+RF  AT RD
Sbjct  378   -SFPWSYAHVGVELALDHTHSPFLKPTKDLGCAHNLEAHLHLVDGYHGKGQRFCLATKRD  436

Query  1418  IALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPSDTGHHFRKVL  1597
             IALVNK  +FL+RE+GVPP WRQDENKGMVR +DGRW++PER R +AHP+DT HH  +VL
Sbjct  437   IALVNKSCDFLRREYGVPPYWRQDENKGMVRNADGRWILPERPRADAHPADTAHHVEQVL  496

Query  1598  R  1600
             +
Sbjct  497   K  497



>ref|XP_010102366.1| Phospholipase A1-Igamma3 [Morus notabilis]
 gb|EXB93327.1| Phospholipase A1-Igamma3 [Morus notabilis]
Length=547

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/440 (71%), Positives = 360/440 (82%), Gaps = 17/440 (4%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L EIW EIQGS DWEGL+DP++S LRREIIRYGEFAQACYDSFDFDP+SKYCGTCKY 
Sbjct  106   RPLREIWREIQGSNDWEGLVDPLNSCLRREIIRYGEFAQACYDSFDFDPNSKYCGTCKYP  165

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
             GA FFEKL MADRGY+ISRYLYATSNINLPNFFQ S ++ +WSQHANWMGYVAV+TDE E
Sbjct  166   GAHFFEKLEMADRGYKISRYLYATSNINLPNFFQRSKMSSVWSQHANWMGYVAVSTDEDE  225

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  829
             IRRLGRRDIVIAWRGTVTYLEWI DLK+IL    F  DP +KIESGF+DLYT  KK+  C
Sbjct  226   IRRLGRRDIVIAWRGTVTYLEWICDLKDILRSADFGPDPTVKIESGFYDLYT--KKERGC  283

Query  830   NFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1009
              +CS+SAREQ+LAE+ RL++ Y+GE +SITVTGHSLG+ALA+LSAYD+AE+ +NVV    
Sbjct  284   KYCSFSAREQVLAEIKRLLDYYEGEEISITVTGHSLGSALAILSAYDMAEVGLNVV----  339

Query  1010  gegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1189
                       ++  K+PI+V+SFAGPRVGNL+FK RCDELGIKVLR+VNV D VPTVPGI
Sbjct  340   ----------ASGKKVPITVYSFAGPRVGNLKFKGRCDELGIKVLRVVNVHDVVPTVPGI  389

Query  1190  IANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1369
             IANEK Q+QK +E  + SFPWSYAHVGVEL LD S+SPFLK   D GCAHNLE HLHLVD
Sbjct  390   IANEKRQFQKYIEETM-SFPWSYAHVGVELRLDQSHSPFLKPTKDPGCAHNLEVHLHLVD  448

Query  1370  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1549
             GYHG G+RF   T RDIALVNK+ + L+ E+GVP +WRQDENKGMVR +DGRWV+PER R
Sbjct  449   GYHGKGKRFCLETKRDIALVNKNCDLLRSEYGVPSQWRQDENKGMVRNTDGRWVLPERPR  508

Query  1550  IEAHPSDTGHHFRKVLRLAR  1609
             +E HP D   H  KVL + R
Sbjct  509   LEGHPPDMAEHLEKVLMIKR  528



>ref|XP_010673678.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=514

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/440 (69%), Positives = 355/440 (81%), Gaps = 14/440 (3%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L EIW +IQG  DWEGLLDPM+SHLRRE++RYGEFAQ+CYDSFDFDPHS+YCG+CKY 
Sbjct  79    RLLREIWRDIQGRNDWEGLLDPMNSHLRREVLRYGEFAQSCYDSFDFDPHSRYCGSCKYP  138

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSS-VNRIWSQHANWMGYVAVATDEA  646
              A+FFEK+ M+  GY I RYLYATSNINL  FFQ SS +  IWS HANWMGYVAV +DE 
Sbjct  139   RAEFFEKMDMSHYGYDICRYLYATSNINLEKFFQKSSSIRSIWSPHANWMGYVAVTSDEE  198

Query  647   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTD  826
             EI+RLGRRDI+I WRGTVTYLEWIHDLKNIL P HFRD+P I+IESGF+DLYT   K+ +
Sbjct  199   EIKRLGRRDILITWRGTVTYLEWIHDLKNILRPAHFRDNPHIQIESGFYDLYTT--KEEN  256

Query  827   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
             C +CS+SAREQ+LAEV RL+ER+KGE LSITVTGHSLG ALALL AYDIAEM +N+ ++ 
Sbjct  257   CKYCSFSAREQVLAEVKRLVERFKGEKLSITVTGHSLGGALALLCAYDIAEMSLNIGRDE  316

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
             +        +          VFSFA PRVGNL+FKERCDELG+K LRI+NV D++PT+PG
Sbjct  317   KNHLKKLPIT----------VFSFASPRVGNLKFKERCDELGVKQLRIINVHDRIPTMPG  366

Query  1187  IIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1366
             +IANEK + QK LE  +  FPWSYAHVG ELAL+H++SPFLK  TDL CAHNLE HLHL+
Sbjct  367   LIANEKNKLQKYLEDKVH-FPWSYAHVGNELALNHTHSPFLKPATDLSCAHNLEAHLHLI  425

Query  1367  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1546
             DGYHG GR+F   T RDIALVNKDSNFLK E+ VPPRWRQD NKGMVR S+GRWVVP+R+
Sbjct  426   DGYHGKGRKFSLVTKRDIALVNKDSNFLKNEYEVPPRWRQDYNKGMVRNSEGRWVVPDRA  485

Query  1547  RIEAHPSDTGHHFRKVLRLA  1606
             R+E HP DT HHF   +++A
Sbjct  486   RVEHHPPDTAHHFALAMKVA  505



>ref|XP_003538937.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Glycine 
max]
Length=505

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/532 (61%), Positives = 390/532 (73%), Gaps = 37/532 (7%)
 Frame = +2

Query  47    MGSLQPISLNHNYHTIFAEPPLMNITKPTTA--KPSNSFFPLTLSSPQKPYSSLKCRDSL  220
             M S+ PI     YH     P  + ++KP+T    P   FFP T     KP  +LKC  S 
Sbjct  1     MASVLPI-----YHNYVNLPCPLPLSKPSTTFNTPIILFFPKT-----KPSLTLKCSSSA  50

Query  221   PAAIPESSNKHdeeeedgddeegRNLHEIWAEIQGSKDWEGLLDP-MDSHLRREIIRYGE  397
              +  PE   + +      +      L E W EIQG  +W+GL+DP M+ HLRREIIRYGE
Sbjct  51    SSLTPELDQEEETFGNFDEPP----LSESWKEIQGLNNWDGLIDPTMNPHLRREIIRYGE  106

Query  398   FAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHS  577
              AQACYDSFDFDPHSKYCGTCKY  +Q FEKL M+  GY ISRYLYATSN+NLPNFFQ S
Sbjct  107   LAQACYDSFDFDPHSKYCGTCKYHPSQLFEKLNMSQTGYMISRYLYATSNVNLPNFFQKS  166

Query  578   SVN-RIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHF  754
              ++  +WS HANWMGYVAV+TD  +I+RLGRRDIVIAWRGTVTY+EWI+DLK+IL P  F
Sbjct  167   RLSTSVWSPHANWMGYVAVSTDRDQIKRLGRRDIVIAWRGTVTYVEWIYDLKDILRPALF  226

Query  755   RDDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHs  934
              DDP IK+ESGF+DLYT  KK+  C +CS+SAREQ+L+EV RL+  YK E +SIT+TGHS
Sbjct  227   SDDPTIKVESGFYDLYT--KKEDSCTYCSFSAREQVLSEVKRLLHYYKNEEISITITGHS  284

Query  935   lgaalallsaYDIAEMKVNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKE  1114
             LGAALA+LSAYDIAE+K+NVV++G  +                 VFSFAGPRVGNL+FKE
Sbjct  285   LGAALAILSAYDIAELKLNVVEDGRNKIPVT-------------VFSFAGPRVGNLKFKE  331

Query  1115  RCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHS  1294
             RC+ELG+KVLR+VNV+D VPTVPGII NEKFQ+Q+ +E  L SFPWSYAH+G E+ALDH 
Sbjct  332   RCEELGVKVLRVVNVQDVVPTVPGIITNEKFQFQRYIEETL-SFPWSYAHLGTEMALDHR  390

Query  1295  YSPFLKTG-TDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVP  1471
              SPFLK G  DLGCAHNLE HLHLVDGYHG G+RF  AT RDIALVNK  +FL+ E+GVP
Sbjct  391   ESPFLKGGMNDLGCAHNLEVHLHLVDGYHGKGKRFCLATKRDIALVNKSCDFLRSEYGVP  450

Query  1472  PRWRQDENKGMVRTSDGRWVVPERSRIEAHPSDTGHHFRKVLR--LARARFE  1621
               WRQDENKGMVR+ DGRWV+P+R  +EAHP D  HH ++VL   LA  +FE
Sbjct  451   SHWRQDENKGMVRSRDGRWVLPDRPILEAHPPDMAHHLQQVLNNHLAAQQFE  502



>gb|KCW51163.1| hypothetical protein EUGRSUZ_J00755 [Eucalyptus grandis]
Length=517

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/444 (70%), Positives = 361/444 (81%), Gaps = 22/444 (5%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L ++W EIQG   WEGLLDPM+SH+R+EIIRYGEFAQACYDSFDFDP+SKYCGTCKY 
Sbjct  94    RPLSQVWREIQGCNHWEGLLDPMNSHVRQEIIRYGEFAQACYDSFDFDPNSKYCGTCKYQ  153

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
             G+QFFEKLGM   GY+ISRYLYATSNINLPNFFQHS ++++WS +ANWMGY+AV TDE E
Sbjct  154   GSQFFEKLGMNHFGYQISRYLYATSNINLPNFFQHSRLSKVWSTYANWMGYIAVTTDEEE  213

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  829
             IRRLGRRDIVIAWRGTVTYLEWI+DLK+ILHP HF+DDP IKIE+GF+DLYT  KK+  C
Sbjct  214   IRRLGRRDIVIAWRGTVTYLEWIYDLKDILHPAHFKDDPTIKIEAGFYDLYT--KKEKSC  271

Query  830   NFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1009
             +FCS+SAREQ+LAEV RL++ Y+ E +SIT+TGHSLGAALA++SAYDIAEM VNVV    
Sbjct  272   HFCSFSAREQILAEVKRLLDYYRDEEISITITGHSLGAALAIISAYDIAEMGVNVVN---  328

Query  1010  gegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1189
                           K+PI+V+SFAGPRVGNL+FKERCDELG+KVLR+ NV D VPTVPGI
Sbjct  329   --------DGGEMKKVPITVYSFAGPRVGNLKFKERCDELGVKVLRLTNVHDMVPTVPGI  380

Query  1190  IANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1369
             IANEK Q+QK LE  L SFPWSYAHVG ELALD ++SPFLK+  D  CAHNLE  LHLVD
Sbjct  381   IANEKMQFQKYLEETL-SFPWSYAHVGTELALDQTHSPFLKSTNDPSCAHNLEALLHLVD  439

Query  1370  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1549
             GYHG+GRRF+  T RDIALVNK  +FLK E+G       DENKGMVR+SDGRWVVPER  
Sbjct  440   GYHGEGRRFKLVTRRDIALVNKSCDFLKGEYG-------DENKGMVRSSDGRWVVPER-L  491

Query  1550  IEAHPSDTGHHFRKVLRLARARFE  1621
             ++AH SDT HH  +VL +A    E
Sbjct  492   VDAHRSDTAHHLAQVLGVANLPLE  515



>ref|XP_006446147.1| hypothetical protein CICLE_v10014848mg [Citrus clementina]
 gb|ESR59387.1| hypothetical protein CICLE_v10014848mg [Citrus clementina]
Length=535

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/438 (69%), Positives = 357/438 (82%), Gaps = 12/438 (3%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             + LHE+W  IQG  DW+GLLDPM+ HLR+EIIRYGEF+QACYDSFDFDPHSKYCGTCKY 
Sbjct  86    KELHEMWKAIQGCNDWQGLLDPMNCHLRKEIIRYGEFSQACYDSFDFDPHSKYCGTCKYS  145

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
              A FF+KL MAD GY+ISRYLYATSNINLP FFQ S ++ +WS +ANWMGY+AV TDE E
Sbjct  146   AASFFKKLDMADSGYQISRYLYATSNINLPKFFQKSRLSSVWSTYANWMGYIAVTTDEEE  205

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  829
             I+RLGRRDIV+AWRGTVTY+EWI+DLK+ILH  +F  DP IKIE GF DLYT  KK+  C
Sbjct  206   IKRLGRRDIVVAWRGTVTYIEWIYDLKDILHTANFGSDPSIKIELGFHDLYT--KKEQSC  263

Query  830   NFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1009
             N+C++SAREQ+LAE+ RLIE Y+GE +SIT TGHSLGAALA++SAYD+AE+ +N+V    
Sbjct  264   NYCTFSAREQVLAEIKRLIEYYEGEEISITFTGHSLGAALAIVSAYDVAELGLNIVN---  320

Query  1010  gegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1189
                  +  S+S+  KIPI+V+SFAGPRVGNL+FKERCDELG+KVLR+VNV DKVPTVPGI
Sbjct  321   -----DGESSSSTKKIPITVYSFAGPRVGNLKFKERCDELGVKVLRVVNVHDKVPTVPGI  375

Query  1190  IANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1369
             +ANEKFQ+QK  E   K FPWSYAHVGVELALDH+ SPFLK   D GCAHNLE  LHL+D
Sbjct  376   LANEKFQFQKHFEEATK-FPWSYAHVGVELALDHTNSPFLKNTKDFGCAHNLEALLHLLD  434

Query  1370  GYHGDGRRF-RSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1546
             GY G   +F    T RDIALVNK  +FLK E+ VPP WRQDENKGMVR +DGRWV+PER 
Sbjct  435   GYCGKENQFCLETTKRDIALVNKSCDFLKSEYEVPPHWRQDENKGMVRNTDGRWVLPERP  494

Query  1547  RIEAHPSDTGHHFRKVLR  1600
             R+EA P DT HH +KVL+
Sbjct  495   RLEALPEDTAHHLQKVLK  512



>ref|XP_006470637.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Citrus 
sinensis]
 gb|KDO61218.1| hypothetical protein CISIN_1g009412mg [Citrus sinensis]
Length=535

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/438 (69%), Positives = 357/438 (82%), Gaps = 12/438 (3%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             + LHE+W  IQG  DW+GLLDPM+ HLR+EIIRYGEF+QACYDSFDFDPHSKYCGTCKY 
Sbjct  86    KELHEMWKAIQGCNDWQGLLDPMNCHLRKEIIRYGEFSQACYDSFDFDPHSKYCGTCKYS  145

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
              A FF+KL MAD GY+ISRYLYATSNINLP FFQ S ++ +WS +ANWMGY+AV TDE E
Sbjct  146   AASFFKKLDMADSGYQISRYLYATSNINLPKFFQKSRLSSVWSTYANWMGYIAVTTDEEE  205

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  829
             I+RLGRRDIV+AWRGTVTY+EWI+DLK+ILH  +F  DP IKIE GF DLYT  KK+  C
Sbjct  206   IKRLGRRDIVVAWRGTVTYIEWIYDLKDILHTANFGSDPSIKIELGFHDLYT--KKEQSC  263

Query  830   NFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1009
             N+C++SAREQ+LAE+ RLIE Y+GE +SIT TGHSLGAALA++SAYD+AE+ +N+V    
Sbjct  264   NYCTFSAREQVLAEIKRLIEYYEGEEISITFTGHSLGAALAIVSAYDVAELGLNIVN---  320

Query  1010  gegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1189
                  +  S+S+  KIPI+V+SFAGPRVGNL+FKERCDELG+KVLR+VNV DKVPTVPGI
Sbjct  321   -----DGESSSSTKKIPITVYSFAGPRVGNLKFKERCDELGVKVLRVVNVHDKVPTVPGI  375

Query  1190  IANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1369
             +ANEKFQ+QK  E   K FPWSYAHVGVELALDH+ SPFLK   D GCAHNLE  LHL+D
Sbjct  376   LANEKFQFQKHFEEATK-FPWSYAHVGVELALDHTNSPFLKNTKDFGCAHNLEALLHLLD  434

Query  1370  GYHGDGRRF-RSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1546
             GY G   +F    T RDIALVNK  +FLK E+ VPP WRQDENKGMVR +DGRWV+PER 
Sbjct  435   GYCGKENQFCLETTKRDIALVNKSCDFLKSEYEVPPHWRQDENKGMVRNTDGRWVLPERP  494

Query  1547  RIEAHPSDTGHHFRKVLR  1600
             R+EA P DT HH +KVL+
Sbjct  495   RLEALPEDTAHHLQKVLK  512



>ref|XP_008450415.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Cucumis melo]
Length=505

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/528 (60%), Positives = 389/528 (74%), Gaps = 47/528 (9%)
 Frame = +2

Query  71    LNHNYHTIFAEPPLMNITKPTTAKPSNSFFPLTLSSPQKPYSSLKCRDSLPAAIPESSNK  250
             +N+N +++F+  P ++I           +F   L +        KC  SLP+       +
Sbjct  2     INNNNNSLFSTNPTLSI----------HYFNFILPTS-------KCSSSLPSLTTMEDQE  44

Query  251   HdeeeedgddeegRN-----LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACY  415
              +++++        N     L EIW +IQG  +WEGLLDP++ HLR+EIIRYGEF+QACY
Sbjct  45    DEDQDDVEAITMETNNNFAPLSEIWRDIQGMNNWEGLLDPLNLHLRKEIIRYGEFSQACY  104

Query  416   DSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSV----  583
             DSFDFDPHSKYCGTCKY  + FF KL M D GY I+RYLYATSNINLPNFF+ S+     
Sbjct  105   DSFDFDPHSKYCGTCKYQASHFFNKLLMPDPGYNITRYLYATSNINLPNFFKKSNFTRDE  164

Query  584   -----NRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPT  748
                  NR+WSQHANWMGYVAVATD  EI+RLGRRDIVIAWRGTVTYLEWIHDLK+IL P 
Sbjct  165   SRNFSNRVWSQHANWMGYVAVATDADEIKRLGRRDIVIAWRGTVTYLEWIHDLKDILRPA  224

Query  749   HF-RDDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSI  916
              F  DD  +KIESGF+DLYT   K+ +CN+  +SAREQ+LAEV RL+E+Y    GE +SI
Sbjct  225   GFIPDDTSVKIESGFYDLYT--MKEENCNYSGFSAREQILAEVKRLVEKYCKLGGEEISI  282

Query  917   TVTGHslgaalallsaYDIAEMKVNVVQegegegdgesssasaaikipisVFSFAGPRVG  1096
             TVTGHSLGAALAL++AYDIAEMK+N+V  G+G    E             V+SFAGPRVG
Sbjct  283   TVTGHSLGAALALITAYDIAEMKLNIVARGDGSSPVEVPIT---------VYSFAGPRVG  333

Query  1097  NLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVE  1276
             NL+FKERC+ELG+K LR++N+ DKVP VPGIIANEK Q+QK LE  + +FPWSYAHVG E
Sbjct  334   NLKFKERCEELGVKALRVINIHDKVPMVPGIIANEKLQFQKYLEEAI-AFPWSYAHVGTE  392

Query  1277  LALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKR  1456
             LALDH++SPFL +  DLGCAHNLE HLHL+DGYHG GR+FR  T RDIALVNK  +FL++
Sbjct  393   LALDHTHSPFLMSTNDLGCAHNLEAHLHLIDGYHGKGRKFRLETKRDIALVNKSCDFLRK  452

Query  1457  EHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPSDTGHHFRKVLR  1600
             E+GVPP WRQDENKGMVR S+GRWVVP+R R++ HPSDT +H ++VL+
Sbjct  453   EYGVPPCWRQDENKGMVRNSEGRWVVPDRPRLDDHPSDTANHLQQVLK  500



>ref|XP_010938722.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Elaeis guineensis]
Length=499

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/513 (63%), Positives = 376/513 (73%), Gaps = 31/513 (6%)
 Frame = +2

Query  80    NYHTIFAEPPLMNITKPT-TAKPSNSFFPLTLSSPQKPYSSLKCRDSLPAAIPESSNKHd  256
             +++  F  PPL++   PT T      F   +L       +SLKC   LP  +  +S+   
Sbjct  8     SFYPQFHTPPLLSFPSPTPTISKPTIFNTKSLFLNSNTTTSLKC---LPTPLELASH---  61

Query  257   eeeedgddeegRNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDP  436
                    +EE + LH +W +I GS DW GLLDPM+  LR EIIRYGEFAQACYD+FDFDP
Sbjct  62    -----CVEEEEQLLHHVWRKIHGSDDWTGLLDPMNPLLRSEIIRYGEFAQACYDAFDFDP  116

Query  437   HSKYCGTCKYDGAQFFEKLGM--ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHAN  610
             HSKYCGTCKY G  FF++L M  A  GY ISRYLYATSNINLPNFFQ   +  +WS HAN
Sbjct  117   HSKYCGTCKYSGNHFFDRLHMPAAGHGYEISRYLYATSNINLPNFFQKKRLRNVWSTHAN  176

Query  611   WMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGF  790
             WMGY+A ATD  EI RLGRRDIVIAWRGTVTYLEWIHDLK+IL P +F DDP IK+ESGF
Sbjct  177   WMGYIAFATDPLEIARLGRRDIVIAWRGTVTYLEWIHDLKDILTPVYFGDDPSIKVESGF  236

Query  791   FDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYD  970
              DLYT   K+  CN+CS+SAREQ+LA++ RL+ER+ GE LSITVTGHSLGAALALLSAYD
Sbjct  237   LDLYT--MKEHRCNYCSFSAREQVLADIKRLVERFSGEELSITVTGHSLGAALALLSAYD  294

Query  971   IAEMKVNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRI  1150
             IAEM +N+ ++GE                   VFSF+GPRVGNLRFK RC+ELG+KVLR+
Sbjct  295   IAEMGLNIREDGEMIPVT--------------VFSFSGPRVGNLRFKLRCEELGVKVLRV  340

Query  1151  VNVRDKVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLG  1330
             +NV D+VP+VPGIIANEKFQYQ+ +E ++  FPWSYAHVGVELALDH  SPFLK   D+ 
Sbjct  341   INVHDRVPSVPGIIANEKFQYQRVVEEVM-WFPWSYAHVGVELALDHRESPFLKESGDVR  399

Query  1331  CAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVR  1510
             C HNLE HLHLVDGY G GR F SA GRD+ALVNK  +FL+ E GVPPRW QDENKGMVR
Sbjct  400   CVHNLEAHLHLVDGYQGKGRGFESAGGRDVALVNKSCDFLREELGVPPRWWQDENKGMVR  459

Query  1511  TSDGRWVVPERSRIEAHPSDTGHHFRKVLRLAR  1609
               DGRWVVPER R+EAHP DT HH  KVL+  R
Sbjct  460   GEDGRWVVPERPRVEAHPPDTAHHLDKVLKGGR  492



>gb|KGN66495.1| hypothetical protein Csa_1G614650 [Cucumis sativus]
Length=536

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/511 (62%), Positives = 380/511 (74%), Gaps = 41/511 (8%)
 Frame = +2

Query  122   TKPTTAKPSNSFFPLTLSSPQKPYSSLKCRDSLPAAIPESSNKHdeeeedgddeegRN--  295
             TKPT    S  +F  TL +        KC  SLP+       + +++++D       N  
Sbjct  44    TKPTF---SIHYFNFTLPTS-------KCSSSLPSLTTMEDQEDEDQDDDEAITVETNNN  93

Query  296   ---LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKY  466
                L EIW +IQG  +WE LLDP++ HLR+EIIRYGEF+QACYDSFDFDPHSKYCGTCKY
Sbjct  94    FPPLSEIWRDIQGMNNWEALLDPLNLHLRKEIIRYGEFSQACYDSFDFDPHSKYCGTCKY  153

Query  467   DGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSV---------NRIWSQHANWMG  619
               + FF KL M D GY I+RYLYATSNINLPNFF+ S           NR+WSQHANWMG
Sbjct  154   QASHFFNKLLMPDPGYNITRYLYATSNINLPNFFKKSKFTRDESRDFSNRVWSQHANWMG  213

Query  620   YVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHF-RDDPDIKIESGFFD  796
             YVAVATD  EI+RLGRRDIVIAWRGTVTYLEWIHDLK+IL P  F  DD  +KIESGF+D
Sbjct  214   YVAVATDADEIKRLGRRDIVIAWRGTVTYLEWIHDLKDILRPAGFIPDDTSVKIESGFYD  273

Query  797   LYTNSKKDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaY  967
             LYT   K+ +CN+C +SAREQ+LAEV RL+E+Y    GE +SITVTGHSLGAALAL++AY
Sbjct  274   LYT--MKEENCNYCGFSAREQILAEVKRLVEKYCKLGGEEISITVTGHSLGAALALITAY  331

Query  968   DIAEMKVNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLR  1147
             DIAEMK+N+V  G         +          V+SFAGPRVGNL+FKERC+ELG+KVLR
Sbjct  332   DIAEMKLNIVARGGSSAVAVPIT----------VYSFAGPRVGNLKFKERCEELGVKVLR  381

Query  1148  IVNVRDKVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDL  1327
             ++NV DKVP VPGIIANEK Q+QK LE  + +FPWS AHVG ELALDH++SPFL + +DL
Sbjct  382   VINVHDKVPMVPGIIANEKLQFQKYLEEAI-AFPWSCAHVGTELALDHTHSPFLMSTSDL  440

Query  1328  GCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV  1507
             GCAHNLE +LHL+DGYHG GR+FR  T RDIALVNK  +FL++E+GVPP WRQDENKGMV
Sbjct  441   GCAHNLEAYLHLIDGYHGKGRKFRLETKRDIALVNKSCDFLRKEYGVPPCWRQDENKGMV  500

Query  1508  RTSDGRWVVPERSRIEAHPSDTGHHFRKVLR  1600
             R ++GRWVVP+R R+E HP DT HH ++VL+
Sbjct  501   RNNEGRWVVPDRPRLEDHPPDTAHHLQQVLK  531



>ref|XP_004154680.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Cucumis 
sativus]
Length=455

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/439 (68%), Positives = 354/439 (81%), Gaps = 18/439 (4%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L EIW +IQG  +WE LLDP++ HLR+EIIRYGEF+QACYDSFDFDPHSKYCGTCKY  +
Sbjct  26    LSEIWRDIQGMNNWEALLDPLNLHLRKEIIRYGEFSQACYDSFDFDPHSKYCGTCKYQAS  85

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
              FF KL M D GY I+RYLYATSNINLPNFF+ S    +WSQHANWMGYVAVATD  EI+
Sbjct  86    HFFNKLLMPDPGYNITRYLYATSNINLPNFFKKSKFT-LWSQHANWMGYVAVATDADEIK  144

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHF-RDDPDIKIESGFFDLYTNSKKDTDCN  832
             RLGRRDIVIAWRGTVTYLEWIHDLK+IL P  F  DD  +KIESGF+DLYT   K+ +CN
Sbjct  145   RLGRRDIVIAWRGTVTYLEWIHDLKDILRPAGFIPDDTSVKIESGFYDLYT--MKEENCN  202

Query  833   FCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
             +C +SAREQ+LAEV RL+E+Y    GE +SITVTGHSLGAALAL++AYDIAEMK+N+V  
Sbjct  203   YCGFSAREQILAEVKRLVEKYCKLGGEEISITVTGHSLGAALALITAYDIAEMKLNIVAR  262

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1183
             G         +          V+SFAGPRVGNL+FKERC+ELG+KVLR++NV DKVP VP
Sbjct  263   GGSSAVAVPIT----------VYSFAGPRVGNLKFKERCEELGVKVLRVINVHDKVPMVP  312

Query  1184  GIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1363
             GIIANEK Q+QK LE  + +FPWSYAHVG EL+LDH++SPFL +  DLGCAHNLE +LHL
Sbjct  313   GIIANEKLQFQKYLEEAI-AFPWSYAHVGTELSLDHTHSPFLMSTNDLGCAHNLEAYLHL  371

Query  1364  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             +DGYHG GR+FR  T RDIALVNK  +FL++E+GVPP WRQDENKGMVR ++GRWVVP+R
Sbjct  372   IDGYHGKGRKFRLETKRDIALVNKSCDFLRKEYGVPPCWRQDENKGMVRNNEGRWVVPDR  431

Query  1544  SRIEAHPSDTGHHFRKVLR  1600
              R+E HP DT HH ++VL+
Sbjct  432   PRLEDHPPDTAHHLQQVLK  450



>ref|XP_004139114.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Cucumis 
sativus]
Length=455

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/439 (68%), Positives = 354/439 (81%), Gaps = 18/439 (4%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L EIW +IQG  +WE LLDP++ HLR+EIIRYGEF+QACYDSFDFDPHSKYCGTCKY  +
Sbjct  26    LSEIWRDIQGMNNWEALLDPLNLHLRKEIIRYGEFSQACYDSFDFDPHSKYCGTCKYQAS  85

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
              FF KL M D GY I+RYLYATSNINLPNFF+ S    +WSQHANWMGYVAVATD  EI+
Sbjct  86    HFFNKLLMPDPGYNITRYLYATSNINLPNFFKKSKFT-LWSQHANWMGYVAVATDADEIK  144

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHF-RDDPDIKIESGFFDLYTNSKKDTDCN  832
             RLGRRDIVIAWRGTVTYLEWIHDLK+IL P  F  DD  +KIESGF+DLYT   K+ +CN
Sbjct  145   RLGRRDIVIAWRGTVTYLEWIHDLKDILRPAGFIPDDTSVKIESGFYDLYT--MKEENCN  202

Query  833   FCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
             +C +SAREQ+LAEV RL+E+Y    GE +SITVTGHSLGAALAL++AYDIAEMK+N+V  
Sbjct  203   YCGFSAREQILAEVKRLVEKYCKLGGEEISITVTGHSLGAALALITAYDIAEMKLNIVAR  262

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1183
             G         +          V+SFAGPRVGNL+FKERC+ELG+KVLR++NV DKVP VP
Sbjct  263   GGSSAVAVPIT----------VYSFAGPRVGNLKFKERCEELGVKVLRVINVHDKVPMVP  312

Query  1184  GIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1363
             GIIANEK Q+QK LE  + +FPWS AHVG ELALDH++SPFL + +DLGCAHNLE +LHL
Sbjct  313   GIIANEKLQFQKYLEEAI-AFPWSCAHVGTELALDHTHSPFLMSTSDLGCAHNLEAYLHL  371

Query  1364  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             +DGYHG GR+FR  T RDIALVNK  +FL++E+GVPP WRQDENKGMVR ++GRWVVP+R
Sbjct  372   IDGYHGKGRKFRLETKRDIALVNKSCDFLRKEYGVPPCWRQDENKGMVRNNEGRWVVPDR  431

Query  1544  SRIEAHPSDTGHHFRKVLR  1600
              R+E HP DT HH ++VL+
Sbjct  432   PRLEDHPPDTAHHLQQVLK  450



>gb|EYU46244.1| hypothetical protein MIMGU_mgv1a004190mg [Erythranthe guttata]
Length=540

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/426 (72%), Positives = 348/426 (82%), Gaps = 14/426 (3%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L +IW EI G  +W+ LLDPM+SHLRREIIRYGE AQACYDSFDFDP+SKYCGTCKY 
Sbjct  86    RPLSQIWREISGENNWQNLLDPMNSHLRREIIRYGEMAQACYDSFDFDPNSKYCGTCKYQ  145

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSS-VNRIWSQHANWMGYVAVATDEA  646
             G+ FFEKLGMA RGY ++R+LYATSNINLPNFFQ SS    +WS HANWMGYVAV+TDE 
Sbjct  146   GSHFFEKLGMAGRGYTLTRFLYATSNINLPNFFQKSSAAGSVWSPHANWMGYVAVSTDED  205

Query  647   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTD  826
             E+RRLGRRD+V+AWRGTVTYLEWIHDLK+IL P HFR+DP IKIESGFFDLYT+  K+  
Sbjct  206   EVRRLGRRDVVVAWRGTVTYLEWIHDLKDILRPAHFRNDPSIKIESGFFDLYTS--KEKT  263

Query  827   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
             CN+C++SAREQ+LAE+ R+I+RY GENLSIT+TGHSLGA+LALLSAYDIAEMK+N+V   
Sbjct  264   CNYCAFSAREQVLAELRRIIQRYSGENLSITITGHSLGASLALLSAYDIAEMKLNIVD--  321

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                            KIPI+VFSF+GPRVGNL+FKERC+ELGIKVLRIVNV DKVPTVPG
Sbjct  322   --------DGQEILNKIPITVFSFSGPRVGNLKFKERCEELGIKVLRIVNVHDKVPTVPG  373

Query  1187  IIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1366
             IIANEKFQYQK +E  + SFPWSYAHVGVELALDH  SPFLK  +DL CAHNLE HLHLV
Sbjct  374   IIANEKFQYQKYIEDAI-SFPWSYAHVGVELALDHKRSPFLKKTSDLRCAHNLEAHLHLV  432

Query  1367  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1546
             DGYHG  RRF     RDIALVNK  +FLK E GVPP W QDE+KGMVR+ DGRW+  E +
Sbjct  433   DGYHGKDRRFCLVEKRDIALVNKCCDFLKGEFGVPPNWWQDEHKGMVRSGDGRWIGLESN  492

Query  1547  RIEAHP  1564
             +    P
Sbjct  493   KAGRSP  498



>ref|XP_004505625.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Cicer 
arietinum]
Length=516

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/438 (66%), Positives = 351/438 (80%), Gaps = 17/438 (4%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             +L ++W EIQG  +WEGLLDPM+ +LRREIIRYGE AQACYDSFDFDPHSKYCGTCKY  
Sbjct  80    SLSDVWKEIQGMNNWEGLLDPMNPNLRREIIRYGELAQACYDSFDFDPHSKYCGTCKYHP  139

Query  473   AQFFEKLGMADR---GYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDE  643
             A FFEK+ M +    GY I+RYLYATSNINLPNFF  S ++ +WS HANWMGYVAVAT+ 
Sbjct  140   ADFFEKVEMGENTVSGYTITRYLYATSNINLPNFFHKSKLSTVWSPHANWMGYVAVATNL  199

Query  644   AEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDT  823
              EI+RLGRRDIVIAWRGTVTY+EWI+DLK+IL   +F++DP IK+ESGF+DLYT  KK+ 
Sbjct  200   QEIKRLGRRDIVIAWRGTVTYIEWIYDLKDILRAANFKNDPTIKVESGFYDLYT--KKED  257

Query  824   DCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
              C +CS+SAREQ+L+E+ RLI+ Y+ E +SIT+TGHSLGAALA+LSAYDI E+K+NVV  
Sbjct  258   SCGYCSFSAREQVLSEIMRLIQYYQDEQISITITGHSLGAALAILSAYDITELKLNVVNN  317

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1183
             G  + +   +           V+SFAGPRVGNL+FKERC+ELG+KVLR++N+ D VPTVP
Sbjct  318   GNDKINIPVT-----------VYSFAGPRVGNLKFKERCEELGVKVLRVINIHDMVPTVP  366

Query  1184  GIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1363
             GI+ NEK ++QK +E  L SFPWSYAHVG E+ALDH  SPFLK   D+GCAHNLE  LHL
Sbjct  367   GILTNEKLKFQKYIEDNL-SFPWSYAHVGTEIALDHRKSPFLKENGDIGCAHNLELLLHL  425

Query  1364  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             +DGYHG  ++FR  + RDIALVNK  +FL+ E+GVPP WRQDENKGMVR+ DGRW++PER
Sbjct  426   MDGYHGKEKKFRLVSERDIALVNKSCDFLRSEYGVPPHWRQDENKGMVRSGDGRWILPER  485

Query  1544  SRIEAHPSDTGHHFRKVL  1597
              R+EAHP DT HH R VL
Sbjct  486   PRLEAHPPDTAHHLRLVL  503



>ref|XP_003607369.1| Lipase [Medicago truncatula]
 gb|AES89566.1| phospholipase A1 [Medicago truncatula]
Length=534

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/435 (67%), Positives = 347/435 (80%), Gaps = 15/435 (3%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L E+W EIQG  DWEGLLDPMD  LR+EIIRYGE AQACYDSFDFD +SKYCGTCKY  A
Sbjct  100   LSEVWREIQGENDWEGLLDPMDPILRKEIIRYGELAQACYDSFDFDQNSKYCGTCKYHPA  159

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
              FFEKL M D GY ISRYLYATSNINLP FF+ S ++ +WS +ANWMGY+AV+T+E EI+
Sbjct  160   HFFEKLYMGD-GYTISRYLYATSNINLPKFFKKSKISSVWSPYANWMGYIAVSTNEEEIK  218

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  835
             RLGRRDIVIAWRGTVTY+EWI+DLK+ILH  +F++DP IK+E+GF+DLYT  KK+  C +
Sbjct  219   RLGRRDIVIAWRGTVTYIEWIYDLKDILHEANFKNDPSIKVETGFYDLYT--KKEQSCTY  276

Query  836   CSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegege  1015
             CS+SAREQ+L+E+ RL++ Y+GE +SITVTGHSLGAALA+LSAYDIAE+ VN++++G+  
Sbjct  277   CSFSAREQVLSEIKRLLQFYQGEKISITVTGHSLGAALAVLSAYDIAELGVNIIEDGDKT  336

Query  1016  gdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1195
              +   +           V+SFAGPRVGNL FKERC+ELG+KVLRI N+ DKVPTVPGII 
Sbjct  337   TNVPIT-----------VYSFAGPRVGNLHFKERCEELGVKVLRIHNIHDKVPTVPGIIT  385

Query  1196  NEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1375
             NEKFQ+QK +E  L SFPWSYAHVG E+ LDH  SPFLK   DLGC HNLE  LHL+DGY
Sbjct  386   NEKFQFQKYIEDTL-SFPWSYAHVGTEIKLDHRNSPFLKENGDLGCTHNLEVLLHLMDGY  444

Query  1376  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIE  1555
             HG  ++F   T RDIALVNK  + L+ E GVPP WRQDENKGMV+T+DGRWVVPER  +E
Sbjct  445   HGKDKKFNMVTERDIALVNKSCDLLRSEFGVPPHWRQDENKGMVQTADGRWVVPERPLLE  504

Query  1556  AHPSDTGHHFRKVLR  1600
             AHP D  HH   VL+
Sbjct  505   AHPPDIAHHLALVLK  519



>ref|XP_007131548.1| hypothetical protein PHAVU_011G022500g [Phaseolus vulgaris]
 gb|ESW03542.1| hypothetical protein PHAVU_011G022500g [Phaseolus vulgaris]
Length=502

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/475 (63%), Positives = 362/475 (76%), Gaps = 20/475 (4%)
 Frame = +2

Query  176   SPQKPYSSLKCRDSLPAAIPESSNKHdeeeedgddeegRNLHEIWAEIQGSKDWEGLLDP  355
             S  KP  +LKC  S     P+   +H + +E    +    L ++W EIQG+ DW+GL++P
Sbjct  35    SKTKPSPTLKC-SSTSNLTPK--QEHLQGKEQETCDFEAPLSQVWREIQGTNDWKGLIEP  91

Query  356   -MDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYL  532
              M+ +LRREIIRYGE AQACYDSFDFDPHSKYCGTCKY  + FF +L +   GY I+RYL
Sbjct  92    SMNPNLRREIIRYGELAQACYDSFDFDPHSKYCGTCKYHPSHFFHQLNIPHAGYTITRYL  151

Query  533   YATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLE  712
             YATSNINLPNFFQ S++  +WS HANWMGYVAV TD+  I+ LGRRDI+IAWRGTVTY+E
Sbjct  152   YATSNINLPNFFQKSNLAAVWSPHANWMGYVAVITDKEHIKHLGRRDILIAWRGTVTYVE  211

Query  713   WIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIER  892
             WIHDLK+IL P  F  D  IK+ESGF +LYT  KK+  C +CS+SAREQ+L+EV RL+  
Sbjct  212   WIHDLKDILRPAFFSRDQTIKVESGFHELYT--KKEDSCTYCSFSAREQVLSEVKRLLNY  269

Query  893   YKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegdgesssasaaikipisVF  1072
             YK E +SIT+TGHSLGAALA+LSAYDIAE+++NVV                  ++P++VF
Sbjct  270   YKDEEISITITGHSLGAALAVLSAYDIAEVRLNVVD-------------DGGERVPVTVF  316

Query  1073  SFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETMLKSFPW  1252
             SFAGPRVGNL+FKERC+ELG+KVLR+VNV D VPTVPGII NEKF++QK +E  L SFPW
Sbjct  317   SFAGPRVGNLKFKERCEELGVKVLRVVNVHDVVPTVPGIITNEKFRFQKYIEDTL-SFPW  375

Query  1253  SYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVN  1432
             SYAHVG E+ALDH+ SPF+K   DL  AHNLE HLHL+DGYHG G+RF  A+ RDIALVN
Sbjct  376   SYAHVGREIALDHTESPFVKGSMDLVSAHNLEVHLHLLDGYHGKGKRFCLASKRDIALVN  435

Query  1433  KDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPSDTGHHFRKVL  1597
             K  +FLK E+GVPP WRQDENKGMVR  DGRWV+PER R+EAHP D  HH ++VL
Sbjct  436   KSCDFLKSEYGVPPHWRQDENKGMVRGGDGRWVLPERPRLEAHPPDMTHHLQQVL  490



>ref|XP_002891639.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67898.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=526

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/445 (68%), Positives = 348/445 (78%), Gaps = 26/445 (6%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             +L EIW E+QG  +WEGLLDPM++HLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY  
Sbjct  85    SLREIWREVQGCNNWEGLLDPMNNHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHP  144

Query  473   AQFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
             + FF  L +   +GY I+RYLYATSNINLPNFFQ S ++ IWSQHANWMGYVAVATDE E
Sbjct  145   SDFFSNLDLHLHKGYTITRYLYATSNINLPNFFQKSKLSSIWSQHANWMGYVAVATDEEE  204

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  829
             + RLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F DDP IKIE GF DLYT  KK+  C
Sbjct  205   VGRLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPSIKIELGFHDLYT--KKEDSC  262

Query  830   NFCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVNVV  997
              F S+SAREQ+LAEV RL+E Y    +G  +SITVTGHSLGA+LAL+SAYDIAE+ +N V
Sbjct  263   KFSSFSAREQVLAEVKRLLEYYGTGEEGHEISITVTGHSLGASLALVSAYDIAELNLNHV  322

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1177
                               K+PI+VFSF+GPRVGNLRFKERCDELG+KVLR+VNV DKVP+
Sbjct  323   P-------------ENNYKVPITVFSFSGPRVGNLRFKERCDELGVKVLRVVNVHDKVPS  369

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
             VPGI ANEKFQ+QK +E    SFPWSYAHVGVELALDH  SPFLK   DLGCAHNLE  L
Sbjct  370   VPGIFANEKFQFQKYVEEK-TSFPWSYAHVGVELALDHKKSPFLKQTKDLGCAHNLEALL  428

Query  1358  HLVDGYHGDG----RRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGR  1525
             HLVDGYHG      +RF   T RDIALVNK  +FL+ E+ VPP WRQDENKGMV++SDGR
Sbjct  429   HLVDGYHGKDEEAQKRFCLVTKRDIALVNKSCDFLRSEYHVPPCWRQDENKGMVKSSDGR  488

Query  1526  WVVPERSRIEAH-PSDTGHHFRKVL  1597
             WV+P+R ++E H   D  HH ++VL
Sbjct  489   WVLPDRPQLEPHRQEDIAHHLQQVL  513



>ref|XP_010461974.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Camelina 
sativa]
Length=524

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/443 (68%), Positives = 347/443 (78%), Gaps = 25/443 (6%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L +IW E+QG  +WEGLLDPM++HLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY  +
Sbjct  85    LRDIWREVQGCNNWEGLLDPMNNHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHPS  144

Query  476   QFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              FF  L +   +GY I+RYLYATSNINLPNFFQ S ++ IWSQHANWMGYVAVATDE E+
Sbjct  145   DFFSNLDLHLHKGYTITRYLYATSNINLPNFFQKSKLSSIWSQHANWMGYVAVATDEEEV  204

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
              RLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F DDP IKIE GF DLYT  KK+  C 
Sbjct  205   SRLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPLIKIELGFHDLYT--KKEVSCK  262

Query  833   FCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
             F S+SAREQ+LAEV RL+E Y    +G  +SITVTGHSLGA+LAL+SAYDIAE+ +N + 
Sbjct  263   FSSFSAREQVLAEVKRLLEYYCTGEEGHEISITVTGHSLGASLALVSAYDIAELNLNYLP  322

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1180
                              K+PI+VFSF+GPRVGNLRFKERCDELG+KVLR+VNV DKVP+V
Sbjct  323   -------------ENNNKVPITVFSFSGPRVGNLRFKERCDELGVKVLRVVNVHDKVPSV  369

Query  1181  PGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLH  1360
             PGI ANEKF +QK +E    SFPWSYAHVGVELALDH  SPFLK   DLGCAHNLE  LH
Sbjct  370   PGIFANEKFHFQKYVEEK-TSFPWSYAHVGVELALDHKKSPFLKQTRDLGCAHNLEALLH  428

Query  1361  LVDGYHGDGR---RFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
             LVDGYHG       F SAT RDIALVNK  +FL+ E+ VPP WRQDENKGMV++SDGRWV
Sbjct  429   LVDGYHGKEEAETMFCSATNRDIALVNKSCDFLRSEYHVPPCWRQDENKGMVKSSDGRWV  488

Query  1532  VPERSRIEAH-PSDTGHHFRKVL  1597
             +P+R ++E H P D  HH +KVL
Sbjct  489   LPDRPQLEPHWPEDIAHHLQKVL  511



>ref|XP_010479626.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Camelina 
sativa]
Length=523

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/443 (67%), Positives = 347/443 (78%), Gaps = 25/443 (6%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L +IW E+QG  +WEGLL PM++HLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY  +
Sbjct  84    LRDIWREVQGCNNWEGLLHPMNNHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHPS  143

Query  476   QFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              FF  L +   +GY I+RYLYATSNINLPNFFQ S ++ IWSQHANWMGYVAVATDE E+
Sbjct  144   DFFSNLDLHLHKGYTITRYLYATSNINLPNFFQKSKLSSIWSQHANWMGYVAVATDEEEV  203

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
              RLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F DDP IKIE GF+DLYT  KK+  C 
Sbjct  204   SRLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPLIKIELGFYDLYT--KKEVSCK  261

Query  833   FCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
             F S+SAREQ+LAEV RL+E Y    +G  +SITVTGHSLGA+LAL+SAYDIAE+ +N + 
Sbjct  262   FSSFSAREQVLAEVKRLLEYYGTGEEGHEISITVTGHSLGASLALVSAYDIAELNLNYLP  321

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1180
                              K+PI+VFSF+GPRVGNLRFKERCDELG+KVLR+VN+ DKVP+V
Sbjct  322   -------------ENNNKVPITVFSFSGPRVGNLRFKERCDELGVKVLRVVNIHDKVPSV  368

Query  1181  PGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLH  1360
             PGI ANEKF +QK +E    SFPWSYAHVGVELALDH  SPFLK   DLGCAHNLE  LH
Sbjct  369   PGIFANEKFHFQKYVEEK-TSFPWSYAHVGVELALDHKKSPFLKQTKDLGCAHNLEALLH  427

Query  1361  LVDGYHGDGR---RFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
             LVDGYHG       F SAT RDIALVNK  +FL+ E+ VPP WRQDENKGMV++SDGRWV
Sbjct  428   LVDGYHGKKEAETMFCSATNRDIALVNKSCDFLRSEYHVPPCWRQDENKGMVKSSDGRWV  487

Query  1532  VPERSRIEAH-PSDTGHHFRKVL  1597
             +P+R ++E H P D  HH ++VL
Sbjct  488   LPDRPQLEPHWPEDITHHLQQVL  510



>ref|XP_010544180.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Tarenaya 
hassleriana]
Length=525

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/438 (67%), Positives = 344/438 (79%), Gaps = 20/438 (5%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             LH +W EIQG   WEGLLDPM+SHLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY  +
Sbjct  98    LHRVWREIQGCNSWEGLLDPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHPS  157

Query  476   QFFEKLGMAD-RGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              FF +L +A  + Y I+RYLYATSNINLP FFQ S ++ +WS+HANWMGYVAV TDE E+
Sbjct  158   DFFARLDLATHKAYTITRYLYATSNINLPKFFQKSKLSSVWSKHANWMGYVAVVTDEEEV  217

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
             +RLGRRDIVIAWRGTVTYLEWI+DLK+IL+P +F +DP IKIE GF DLYT  KK+  C 
Sbjct  218   KRLGRRDIVIAWRGTVTYLEWIYDLKDILYPPNFSEDPSIKIECGFHDLYT--KKEDSCK  275

Query  833   FCSYSAREQLLAEVNRLIERYKGE--NLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
             F S+SAREQ+LAEV RL++ Y  E  ++SIT+TGHSLGAALAL+SAYDIAE+ +N + E 
Sbjct  276   FSSFSAREQVLAEVKRLLDYYGREEHDISITITGHSLGAALALVSAYDIAELNINRIPEN  335

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
               +                 VFSF+GPRVGNL+FKERC+ELGIKVLR+VNV DKVPTVPG
Sbjct  336   SYQVPIS-------------VFSFSGPRVGNLKFKERCEELGIKVLRVVNVHDKVPTVPG  382

Query  1187  IIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1366
             I ANEK Q+QK +E    SFPWSYAHVGVELALDH+ SPFLK   DLGCAH+LE  LHLV
Sbjct  383   IFANEKSQFQKYIEET-TSFPWSYAHVGVELALDHTKSPFLKPTKDLGCAHSLEALLHLV  441

Query  1367  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1546
             DG+HG+G RF   T RD+ALVNK  +FLK E+GVPP WRQDENKGMVR  +GRWV+ ER+
Sbjct  442   DGFHGEGGRFHLETKRDVALVNKSCDFLKSEYGVPPCWRQDENKGMVRNGEGRWVLSERA  501

Query  1547  RIEAH-PSDTGHHFRKVL  1597
             R EAH P +     ++VL
Sbjct  502   RPEAHLPEEIALQLQRVL  519



>ref|XP_006307213.1| hypothetical protein CARUB_v10008812mg [Capsella rubella]
 gb|EOA40111.1| hypothetical protein CARUB_v10008812mg [Capsella rubella]
Length=533

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/443 (68%), Positives = 348/443 (79%), Gaps = 25/443 (6%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L +IW E++G  +WEGLLDPM++HLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY  +
Sbjct  94    LRDIWREVEGCNNWEGLLDPMNNHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHPS  153

Query  476   QFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              FF  L +   +GY I+RYLYATSNINLPNFFQ S ++ IWSQHANWMGYVAVATDE E+
Sbjct  154   DFFSNLDLHLHKGYTITRYLYATSNINLPNFFQKSKLSSIWSQHANWMGYVAVATDEEEV  213

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
             RRLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F DDP IKIE GF DLYT  KK+  C 
Sbjct  214   RRLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPLIKIELGFHDLYT--KKEYSCK  271

Query  833   FCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
             F S+SAREQ+LAEV RL+E Y    +G  +SITVTGHSLGA+LAL+SAYDIAE+K+N + 
Sbjct  272   FSSFSAREQVLAEVKRLLEYYGTGEEGNEISITVTGHSLGASLALVSAYDIAELKLNHLP  331

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1180
                              K+PI+VFSF+GPRVGNLRFKERCDELG+KVLR++NV DKVP V
Sbjct  332   -------------ENNYKVPITVFSFSGPRVGNLRFKERCDELGVKVLRVINVHDKVPYV  378

Query  1181  PGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLH  1360
             PGI ANEKFQ+QK +E    SFPWSYAHVGVELALDH  SPFLK   DLGCAHNLE  LH
Sbjct  379   PGIFANEKFQFQKYVEEK-TSFPWSYAHVGVELALDHKKSPFLKQTKDLGCAHNLEALLH  437

Query  1361  LVDGYHGDGR---RFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
             LVDGYHG       F SAT RDIALVNK  +FL+ E+ VPP WRQDENKGMV++SDGRW+
Sbjct  438   LVDGYHGKKEAETMFCSATKRDIALVNKSCDFLRSEYHVPPCWRQDENKGMVKSSDGRWI  497

Query  1532  VPERSRIEAH-PSDTGHHFRKVL  1597
             V +R ++E H P D  HH ++VL
Sbjct  498   VQDRPQLEPHRPEDIAHHLQEVL  520



>ref|XP_010500719.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Camelina 
sativa]
Length=527

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/443 (67%), Positives = 346/443 (78%), Gaps = 25/443 (6%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L +IW E+QG  +WEGLLDPM++HLRREIIRYGEFAQ CYDSFDFDPHSKYCG+CKY  +
Sbjct  88    LRDIWREVQGCNNWEGLLDPMNNHLRREIIRYGEFAQGCYDSFDFDPHSKYCGSCKYHPS  147

Query  476   QFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              FF  L +   +GY I+ YLYATSNINLPNFFQ S ++ IWSQHANWMGYVAVATDE E+
Sbjct  148   DFFSNLDLHLHKGYTITCYLYATSNINLPNFFQKSKLSSIWSQHANWMGYVAVATDEEEV  207

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
              RLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F DDP IKIE GF+DLYT  KK+  C 
Sbjct  208   SRLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPLIKIELGFYDLYT--KKEVSCK  265

Query  833   FCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
             F S+SAREQ+LAEV RL+E Y    +G  +SITVTGHSLGA+LAL+SAYDIAE+ +N + 
Sbjct  266   FSSFSAREQVLAEVKRLLEYYGTGEEGHEISITVTGHSLGASLALVSAYDIAELNLNYLP  325

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1180
                              K+PI+VFSF+GPRVGNLRFKERCDELG+KVLR+VN+ DKVP+V
Sbjct  326   -------------ENNNKVPITVFSFSGPRVGNLRFKERCDELGLKVLRVVNIHDKVPSV  372

Query  1181  PGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLH  1360
             PGI ANEKF +QK +E    SFPWSYAHVGVELALDH  SPFLK   DLGCAHNLE  LH
Sbjct  373   PGIFANEKFHFQKYVEEK-TSFPWSYAHVGVELALDHKKSPFLKQTRDLGCAHNLEALLH  431

Query  1361  LVDGYHGDGR---RFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
             LVDGYHG       F SAT RDIALVNK  +FL+ E+ VPP WRQDENKGMV++SDGRWV
Sbjct  432   LVDGYHGKEEAETMFCSATNRDIALVNKSCDFLRSEYHVPPCWRQDENKGMVKSSDGRWV  491

Query  1532  VPERSRIEAH-PSDTGHHFRKVL  1597
             +PER ++E H P D  HH ++VL
Sbjct  492   LPERPQLEPHWPEDIAHHLQQVL  514



>ref|XP_009147767.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Brassica 
rapa]
Length=518

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/443 (67%), Positives = 346/443 (78%), Gaps = 24/443 (5%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             NL  IW E+QG  +WEGLLDPM++HLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY  
Sbjct  81    NLGSIWREVQGCNNWEGLLDPMNNHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHP  140

Query  473   AQFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
             + FF  L +   +GY I+RYLYATSNINLPNFFQ S ++ IWSQHANWMGY+AVATDE E
Sbjct  141   SDFFSNLDLNLHKGYTITRYLYATSNINLPNFFQRSKLSSIWSQHANWMGYIAVATDEEE  200

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  829
             + RLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F DDP IKIE GF DLYT  KK+  C
Sbjct  201   VARLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPSIKIELGFHDLYT--KKEDSC  258

Query  830   NFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
              F S+SAREQ+L+EV RLIE Y   G  +SITVTGHSLGAALAL+SAYD+AE+ +N +  
Sbjct  259   KFSSFSAREQVLSEVKRLIEYYGQAGHEISITVTGHSLGAALALVSAYDVAELNLNHIP-  317

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1183
                             K+P+SVFSF+GPRVGNLRFKERC+ELG+KVLR++NV DKVP+VP
Sbjct  318   ------------DNNTKVPVSVFSFSGPRVGNLRFKERCEELGVKVLRVINVHDKVPSVP  365

Query  1184  GIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1363
             GI ANEKFQ+QK +E    SFPWSYAHVG ELALDH  SPFLK   DLGCAHNLE  LHL
Sbjct  366   GIFANEKFQFQKYIEEA-TSFPWSYAHVGTELALDHKKSPFLKPTKDLGCAHNLEALLHL  424

Query  1364  VDGYH----GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
             VDGYH    G+ ++F   T RDIALVNK  +FLK ++ VPP WRQDENKGMV+T DGRWV
Sbjct  425   VDGYHGGEEGEEKKFCLVTKRDIALVNKSCDFLKSDYHVPPCWRQDENKGMVKTGDGRWV  484

Query  1532  VPERSRIEAH-PSDTGHHFRKVL  1597
             +P+R R+E H P D  HH +KVL
Sbjct  485   LPDRPRLEPHRPEDITHHLQKVL  507



>ref|XP_006393053.1| hypothetical protein EUTSA_v10011370mg [Eutrema salsugineum]
 gb|ESQ30339.1| hypothetical protein EUTSA_v10011370mg [Eutrema salsugineum]
Length=542

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/445 (67%), Positives = 346/445 (78%), Gaps = 26/445 (6%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             NL EIW E+QG  +WEGLLDPM++HLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY  
Sbjct  94    NLREIWREVQGCNNWEGLLDPMNNHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHP  153

Query  473   AQFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
             + FF  L +   +GY I+RYLYATSNINLPNFFQ S ++ IWSQHANWMGYVAVAT+E E
Sbjct  154   SDFFPNLDLNLHKGYTITRYLYATSNINLPNFFQRSKLSSIWSQHANWMGYVAVATNEEE  213

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  829
             + RLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F DDP IKIE GF DLYT  KK+  C
Sbjct  214   VARLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPLIKIELGFHDLYT--KKEDSC  271

Query  830   NFCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVNVV  997
              F S+SAREQ+LAEV RL+E Y    +G  +SITVTGHSLGAALAL+SAYDIAE+ +N +
Sbjct  272   KFSSFSAREQVLAEVKRLLEYYGTGEEGHEISITVTGHSLGAALALVSAYDIAELNLNHI  331

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1177
                               K+PISVFSF+GPRVGNLRFKERC+ELG+KVLR+VNV DKVP+
Sbjct  332   P-------------EKNYKVPISVFSFSGPRVGNLRFKERCEELGLKVLRVVNVHDKVPS  378

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
             VPGI  NEKFQ+QK +E    SFPWSYAHVGVELALDH  SPFLK   DLGCAHNLE  L
Sbjct  379   VPGIFTNEKFQFQKYIEET-TSFPWSYAHVGVELALDHKKSPFLKQTKDLGCAHNLEALL  437

Query  1358  HLVDGYHGD----GRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGR  1525
             HLVDGYHG      ++F   T RDIALVNK  +FL+ ++ VPP WRQDENKGMV+  DGR
Sbjct  438   HLVDGYHGKEEGGEKKFCLVTKRDIALVNKSCDFLRSDYHVPPCWRQDENKGMVKNEDGR  497

Query  1526  WVVPERSRIEAH-PSDTGHHFRKVL  1597
             W++P+R R+E H P D  HH +KV+
Sbjct  498   WILPDRPRLEPHQPEDITHHLQKVI  522



>emb|CDY22842.1| BnaA06g02350D [Brassica napus]
Length=518

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/443 (67%), Positives = 345/443 (78%), Gaps = 24/443 (5%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             NL  IW E+QG  +WEGLLDPM++HLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY  
Sbjct  81    NLGSIWREVQGCNNWEGLLDPMNNHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHP  140

Query  473   AQFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
             + FF  L +   +GY I+RYLYATSNINLPNFFQ S ++ IWSQHANWMGY+AVATDE E
Sbjct  141   SDFFSNLDLNLHKGYTITRYLYATSNINLPNFFQRSKLSSIWSQHANWMGYIAVATDEEE  200

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  829
             + RLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F DDP IKIE GF DLYT  KK+  C
Sbjct  201   VARLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPSIKIELGFHDLYT--KKEDSC  258

Query  830   NFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
              F S+SAREQ+L+EV RLIE Y   G  +SITVTGHSLGAALAL+SAYDIAE+ +N +  
Sbjct  259   KFSSFSAREQVLSEVKRLIEYYGQAGHEISITVTGHSLGAALALVSAYDIAELNLNHIP-  317

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1183
                             K+P+SVFSF+GPRVGNLRFKERC+ELG+KVLR++NV DKVP+VP
Sbjct  318   ------------ENNTKVPVSVFSFSGPRVGNLRFKERCEELGVKVLRVINVHDKVPSVP  365

Query  1184  GIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1363
             GI ANEKF +QK +E    SFPWSYAHVG ELALDH  SPFLK   DLGCAHNLE  LHL
Sbjct  366   GIFANEKFLFQKYIEEA-TSFPWSYAHVGTELALDHKKSPFLKPTKDLGCAHNLEALLHL  424

Query  1364  VDGYH----GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
             VDGYH    G+ ++F   T RDIALVNK  +FLK ++ VPP WRQDENKGMV+T DGRWV
Sbjct  425   VDGYHGGEEGEEKKFCLVTKRDIALVNKSCDFLKSDYHVPPCWRQDENKGMVKTGDGRWV  484

Query  1532  VPERSRIEAH-PSDTGHHFRKVL  1597
             +P+R R+E H P D  HH +KVL
Sbjct  485   LPDRPRLEPHRPEDITHHLQKVL  507



>gb|KFK35847.1| hypothetical protein AALP_AA4G044700 [Arabis alpina]
Length=522

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/439 (68%), Positives = 346/439 (79%), Gaps = 25/439 (6%)
 Frame = +2

Query  305   IWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFF  484
             IW E+QG  +WEGLLDPM++HLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY  + FF
Sbjct  90    IWREVQGCNNWEGLLDPMNNHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHPSNFF  149

Query  485   EKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRL  661
               L +   +GY I+RYLYATSNINLPNFFQ S ++ IWSQHANWMGY+AVATDE E+ RL
Sbjct  150   SNLDLNLHKGYTITRYLYATSNINLPNFFQKSKLSSIWSQHANWMGYIAVATDEEEVARL  209

Query  662   GRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCS  841
             GRRDIVI+WRGTVTYLEWI+DLK+IL   +F DDP IKIE GF DLYT  KK+  C F S
Sbjct  210   GRRDIVISWRGTVTYLEWIYDLKDILCSANFGDDPLIKIELGFHDLYT--KKEDSCKFSS  267

Query  842   YSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1009
             +SAREQ+LAEV RL+E Y    +   +SITVTGHSLGAALAL+SAYDIAE+K+N +    
Sbjct  268   FSAREQVLAEVKRLLEYYGTGEEAHEISITVTGHSLGAALALVSAYDIAELKLNHI----  323

Query  1010  gegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1189
                      A    K+PISVFSF+GPRVGNLRFKERC+ELG+KVLR+VNV DKVP+VPGI
Sbjct  324   ---------AENNYKVPISVFSFSGPRVGNLRFKERCEELGVKVLRVVNVHDKVPSVPGI  374

Query  1190  IANEKFQYQKQLE-TMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1366
              ANEKFQ+QK +E T L  FPWSYAHVGVELALDH  SPFLK   DLGCAHNLE  LHLV
Sbjct  375   FANEKFQFQKYIEDTTL--FPWSYAHVGVELALDHKKSPFLKQTKDLGCAHNLEALLHLV  432

Query  1367  DGYHG-DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             DGYHG +  RF   T RDIALVNK  +FL+ ++ VPP WRQDENKGMV+  DGRWV+P+R
Sbjct  433   DGYHGKEEERFSLVTKRDIALVNKSCDFLRSDYHVPPCWRQDENKGMVKNGDGRWVLPDR  492

Query  1544  SRIEAH-PSDTGHHFRKVL  1597
              R+E H P D  HH +++L
Sbjct  493   PRLEPHLPEDMTHHLQQLL  511



>ref|NP_564590.1| DAD1-like lipase 2 [Arabidopsis thaliana]
 sp|Q9C8J6.1|PLA17_ARATH RecName: Full=Phospholipase A1-Igamma3, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG52635.1|AC024261_22 hypothetical protein; 69776-68193 [Arabidopsis thaliana]
 gb|AAL11566.1|AF424572_1 At1g51440/F5D21_19 [Arabidopsis thaliana]
 gb|AAM98287.1| At1g51440/F5D21_19 [Arabidopsis thaliana]
 dbj|BAE99030.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32668.1| phospholipase A1-Igamma3 [Arabidopsis thaliana]
Length=527

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/445 (67%), Positives = 343/445 (77%), Gaps = 26/445 (6%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             +L EIW E+QG  +WEG LDPM++HLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY  
Sbjct  86    SLREIWREVQGCNNWEGQLDPMNNHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHP  145

Query  473   AQFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
             + FF  L +   +GY I+RYLYATSNINLPNFFQ S ++ IWSQHANWMG+VAVATDE E
Sbjct  146   SDFFLNLDLHLHKGYTITRYLYATSNINLPNFFQKSKLSSIWSQHANWMGFVAVATDEEE  205

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  829
             + RLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F DDP IKIE GF DLYT  KK+  C
Sbjct  206   VSRLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPSIKIELGFHDLYT--KKEDSC  263

Query  830   NFCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVNVV  997
              F S+SAREQ+LAEV RLIE Y    +G   SITVTGHSLGA+LAL+SAYDIAE+ +N V
Sbjct  264   KFSSFSAREQVLAEVKRLIEYYGTEEEGHKTSITVTGHSLGASLALVSAYDIAELNLNHV  323

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1177
                               KIPI+VFSF+GPRVGNLRFKERCDELG+KVLR+VNV DKVP+
Sbjct  324   P-------------ENNYKIPITVFSFSGPRVGNLRFKERCDELGVKVLRVVNVHDKVPS  370

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
             VPGI  NEKFQ+QK +E    SFPWSYAHVGVELALDH  SPFLK   DLGCAHNLE  L
Sbjct  371   VPGIFTNEKFQFQKYVEEK-TSFPWSYAHVGVELALDHKKSPFLKPTKDLGCAHNLEALL  429

Query  1358  HLVDGYHGDG----RRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGR  1525
             HLVDGYHG      +RF   T RDIALVNK  +FL+ E+ VPP WRQDENKGMV+  DG+
Sbjct  430   HLVDGYHGKDEEAEKRFCLVTKRDIALVNKSCDFLRGEYHVPPCWRQDENKGMVKNGDGQ  489

Query  1526  WVVPERSRIEAH-PSDTGHHFRKVL  1597
             WV+P+R  +E H P D  HH ++VL
Sbjct  490   WVLPDRPLLEPHGPEDIAHHLQQVL  514



>emb|CDY49813.1| BnaC06g04560D [Brassica napus]
Length=517

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/453 (65%), Positives = 346/453 (76%), Gaps = 24/453 (5%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             +L  IW E+QG  +WEGLLDPM++HLR EIIRYGEFAQACYDSFDFDPHSKYCG+CKY  
Sbjct  80    SLGSIWREVQGCNNWEGLLDPMNNHLRSEIIRYGEFAQACYDSFDFDPHSKYCGSCKYHP  139

Query  473   AQFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
             +  F  L +   +GY I+RYLYATSNINLPNFFQ S ++ IWSQHANWMGY+AVATDE E
Sbjct  140   SDLFSNLDLNLHKGYTITRYLYATSNINLPNFFQRSKLSSIWSQHANWMGYIAVATDEEE  199

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  829
             + RLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F DDP +KIE GF DLYT  KK+  C
Sbjct  200   VARLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPSVKIELGFHDLYT--KKEDSC  257

Query  830   NFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
              F S+SAREQ+L+EV RL+E Y   G  +SITVTGHSLGAALAL+SAYDIAE+ +N +  
Sbjct  258   KFSSFSAREQVLSEVKRLVEYYGQAGHEISITVTGHSLGAALALVSAYDIAELNLNHIP-  316

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1183
                             K+P++VFSF+GPRVGNLRFKERC+EL +KVLR++NV DKVP+VP
Sbjct  317   ------------ENNTKVPVTVFSFSGPRVGNLRFKERCEELDVKVLRVINVHDKVPSVP  364

Query  1184  GIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1363
             GI ANEKFQ+QK +E    SFPWSYAHVG ELALDH  SPFLK   DLGCAHNLE  LHL
Sbjct  365   GIFANEKFQFQKYIEEA-TSFPWSYAHVGTELALDHKKSPFLKPTKDLGCAHNLEALLHL  423

Query  1364  VDGYH----GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
             VDGYH    G+ ++F   T RDIALVNK  +FLK ++ VPP WRQDENKGMV+T DGRWV
Sbjct  424   VDGYHGEEEGEEKKFCLVTKRDIALVNKSCDFLKSDYHVPPCWRQDENKGMVKTGDGRWV  483

Query  1532  VPERSRIEAH-PSDTGHHFRKVLRLARARFELF  1627
             +P+R R+E H P D  HH +KVL  +    +L 
Sbjct  484   LPDRPRLEPHRPEDITHHLQKVLGTSNGEPKLL  516



>ref|XP_006853086.1| hypothetical protein AMTR_s00038p00106840 [Amborella trichopoda]
 gb|ERN14553.1| hypothetical protein AMTR_s00038p00106840 [Amborella trichopoda]
Length=559

 Score =   533 bits (1373),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 272/441 (62%), Positives = 321/441 (73%), Gaps = 21/441 (5%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L E W EIQG   W GLLDPMD  LRREIIRYGEFAQACYD+FDFDP+SKYCGTCKY G 
Sbjct  97    LSERWREIQGENHWNGLLDPMDGLLRREIIRYGEFAQACYDAFDFDPYSKYCGTCKYTGG  156

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
              FFEKLGMAD G+ +SRYLYATSNINL NFF+ S + ++WS HANWMGYVAV  D  E++
Sbjct  157   HFFEKLGMADSGHDLSRYLYATSNINLRNFFRKSKLTKVWSTHANWMGYVAVTMDPHEVQ  216

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  835
             RLGRRD+VIAWRGTVTYLEW+ DL + L    F  D  +K+ESGF DLYT  +K+  CN+
Sbjct  217   RLGRRDVVIAWRGTVTYLEWLEDLMDYLAVPGFGPDGSVKVESGFLDLYT--QKEHSCNY  274

Query  836   CSYSAREQLLAEVNRLIERYKGE--NLSITVTGHslgaalallsaYDIAEMKVNVVQege  1009
             CS+SAREQ+L+++ RL+ERYK +   LSITVTGHSLG ALALLSAYDIAE  +N++    
Sbjct  275   CSFSAREQVLSDIRRLMERYKDDEHELSITVTGHSLGGALALLSAYDIAETGLNILP---  331

Query  1010  gegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1189
                           + P++VFSF  PRVGN RF+ERC ELG+ VLR VNV D VP VPG+
Sbjct  332   -----------DGRRAPVTVFSFGAPRVGNRRFRERCKELGVSVLRTVNVHDSVPKVPGV  380

Query  1190  IANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1369
             + NE     + L   L   PWSYAHVGVELALD + SPFLK G D    HN+E HLHLVD
Sbjct  381   LVNEHVSVPRALADGL---PWSYAHVGVELALDDTKSPFLKPGLDPASRHNMELHLHLVD  437

Query  1370  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1549
             G+ G G +F  A  RD+AL+NK    L+ E+GVPP WRQDENKGMVR  DGR+VVPER R
Sbjct  438   GHRGPGHKFLLADKRDVALLNKSGGLLRDEYGVPPNWRQDENKGMVRGPDGRYVVPERPR  497

Query  1550  IEAHPSDTGHHFRKVLRLARA  1612
             I+AHP DT HH +  L++  A
Sbjct  498   IDAHPPDTAHHLQHALKIVDA  518



>ref|XP_002513514.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF48917.1| triacylglycerol lipase, putative [Ricinus communis]
Length=469

 Score =   522 bits (1345),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 284/486 (58%), Positives = 335/486 (69%), Gaps = 68/486 (14%)
 Frame = +2

Query  143   PSNSFFPLTLSSPQKPYSSLKCRDSLPAAIPESSNKHdeeeedgddeegRNLHEIWAEIQ  322
             PSN F P        P + +KC  S+ +  P+       +E     E+ R L EIW +IQ
Sbjct  38    PSNPFSP-------NPGALIKCTSSVSSLTPQ------LDETLVYQEDERPLTEIWKDIQ  84

Query  323   GSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMA  502
             G  DWEGLLDPM+SHLR+EIIRYGEFAQACYDSFDFDPHSKYCGTCKY G+ FF+KL M 
Sbjct  85    GCNDWEGLLDPMNSHLRKEIIRYGEFAQACYDSFDFDPHSKYCGTCKYQGSHFFDKLDMH  144

Query  503   DRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVI  682
               GY+ISRYLYATSNINLPNFFQ S ++ IWS HANWMGYVAV TDE EI RLGRRDIVI
Sbjct  145   GHGYQISRYLYATSNINLPNFFQKSKLSNIWSTHANWMGYVAVTTDEEEIIRLGRRDIVI  204

Query  683   AWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQL  862
             AWRGTVTYLEWI+DLK+IL   +F +DP IKIE GF+DLYT  KK+  C +C++SAREQ+
Sbjct  205   AWRGTVTYLEWIYDLKDILCSANFINDPSIKIELGFYDLYT--KKEDSCKYCTFSAREQV  262

Query  863   LAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegdgesssas  1042
             LAE+ RL++ Y+GE +SIT+TGHSLGAALA+LSAYDIAEMK+N +               
Sbjct  263   LAEIKRLLDYYRGEEISITLTGHSLGAALAVLSAYDIAEMKLNYMD--------------  308

Query  1043  aaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQ  1222
                +IPI+V+SF+    G                 I N+++                   
Sbjct  309   DGTEIPITVYSFSALEWG-----------------ISNLKNDA-----------------  334

Query  1223  LETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRS  1402
                   S   +YAHVGVELALDH++SPFLK   DL CAHNLE HLHLVDGYHG GRRF  
Sbjct  335   -----MSLELNYAHVGVELALDHTHSPFLKPTNDLACAHNLEVHLHLVDGYHGKGRRFFL  389

Query  1403  ATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPSDTGHH  1582
             AT RDIALVNK  +FL+ E+GVPP WRQDENKGMVR S+GRWVVPER R+EA P DT HH
Sbjct  390   ATKRDIALVNKSCDFLRAEYGVPPHWRQDENKGMVRNSEGRWVVPERPRVEALPPDTAHH  449

Query  1583  FRKVLR  1600
               +VL+
Sbjct  450   LEQVLK  455



>ref|XP_011042424.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X1 [Populus euphratica]
Length=513

 Score =   520 bits (1340),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 276/491 (56%), Positives = 333/491 (68%), Gaps = 32/491 (7%)
 Frame = +2

Query  134   TAKPSNSFFPLTLSSPQKPYSSLKCRDSLPAAIPESSNKHdeeeedgddeegRNLHEIWA  313
             T K S S  P  LS         K  +SL + I E   + D        E  R L ++W 
Sbjct  45    TGKTSTSTIPCVLS---------KTSESLTSIITELEKEQDHGTNTNTKEPERRLADVWR  95

Query  314   EIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKL  493
             EIQG  DW GLLDPMD  LR E+IRYGE AQACYD+FDFDP SKYCG+C++   +F E L
Sbjct  96    EIQGQDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFIRRRFLESL  155

Query  494   GMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRD  673
             GMA  GY ++RYLYATSNI+LPNFF+ S   ++WS  ANW+GYVAV+ DE   + LGRRD
Sbjct  156   GMAHHGYEVTRYLYATSNIDLPNFFKKSRWPKVWSNKANWIGYVAVSDDET-TKCLGRRD  214

Query  674   IVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNFCS  841
             I IAWRGTVT+LEWI DL + L P +       DP +K+E GF DLYT+  KD +C FC 
Sbjct  215   ISIAWRGTVTHLEWISDLMDFLKPINANKIPCPDPTVKVEYGFLDLYTD--KDENCRFCK  272

Query  842   YSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegd  1021
             YSAREQ+L+EV RL E Y  E +SIT+TGHSLG+ALA+LSAYDIAE  ++V+Q+G     
Sbjct  273   YSAREQILSEVKRLTEMYADEEMSITITGHSLGSALAMLSAYDIAETGLHVMQDGRALPV  332

Query  1022  gesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1201
                            VFSF+GPRVGN+RFKER + LG+KVLR+VNV+D VP  PG+  NE
Sbjct  333   S--------------VFSFSGPRVGNVRFKERIESLGVKVLRVVNVQDMVPKSPGLFFNE  378

Query  1202  KFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1381
               Q    L  M +  PW+Y+HVGVELALDH  SPFLK  +D  CAHNLE HLHL+DGYHG
Sbjct  379   --QMPPPLMKMAEGLPWAYSHVGVELALDHRNSPFLKQTSDPACAHNLEAHLHLLDGYHG  436

Query  1382  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAH  1561
              G RF  A+GRD ALVNK  +FLK  H VPP WRQDENKGM+R +DGRWV PER +++ H
Sbjct  437   KGHRFVLASGRDPALVNKACDFLKDHHLVPPNWRQDENKGMIRNNDGRWVQPERPKLDDH  496

Query  1562  PSDTGHHFRKV  1594
             P DT  H RK+
Sbjct  497   PLDTHDHLRKL  507



>gb|ABR16123.1| unknown [Picea sitchensis]
Length=554

 Score =   521 bits (1341),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 269/436 (62%), Positives = 323/436 (74%), Gaps = 22/436 (5%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             RNL +IW EIQG+ +WEGLLDPMD  LR+EIIRYGEFAQACYD FDFDP SKYCG+CKY 
Sbjct  108   RNLEDIWREIQGANNWEGLLDPMDGILRKEIIRYGEFAQACYDGFDFDPFSKYCGSCKYH  167

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
               + F+ +GM+D GY +++YLYATSNINL   FQ   V ++WS HANWMG++AVATDE E
Sbjct  168   RRELFQGVGMSDYGYEVTKYLYATSNINLTGLFQKPRVQKMWSTHANWMGFIAVATDEEE  227

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPT---HFRDDPDIKIESGFFDLYTNSKKD  820
             I+RLGRRDIVIAWRGTVTYLEWI DL + L P    +    PD+KIESGF  LYT   ++
Sbjct  228   IKRLGRRDIVIAWRGTVTYLEWIADLMDYLRPAELNYVHPHPDVKIESGFLSLYT--ARE  285

Query  821   TDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
              DC FC  SAR+Q+L+E+ RL+++YKGE LSIT+TGHSLG+ALA+LSAYDIAE+ +N   
Sbjct  286   RDCRFCKSSARDQVLSELRRLLQKYKGEQLSITITGHSLGSALAMLSAYDIAELGLN---  342

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1180
                     +S S   A  IPI+VFSFAGPRVGN  FK+RC+ELG+K LR+VNV D VP V
Sbjct  343   --------QSESDDRAESIPITVFSFAGPRVGNAAFKDRCEELGLKFLRVVNVHDIVPKV  394

Query  1181  PGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLH  1360
             PGI+ NE F+  KQ    +   PWSY HVGV+L LDH+ SPFLK   D  C HNLE HLH
Sbjct  395   PGILFNETFKMMKQ---WIDKLPWSYCHVGVKLVLDHTQSPFLKPTNDSSCFHNLEAHLH  451

Query  1361  LVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPE  1540
             L+DGYHG G+RF   + RD ALVNK  +FLK  H VPP WRQD NKG+++ S+GRWV PE
Sbjct  452   LLDGYHGRGQRFCLTSRRDPALVNKSCDFLKEHHLVPPFWRQDANKGLIQNSEGRWVQPE  511

Query  1541  RSRI--EAHPSDTGHH  1582
             R RI  E+H  D  HH
Sbjct  512   RIRIIEESH-MDPDHH  526



>ref|XP_002306818.1| hypothetical protein POPTR_0005s24000g [Populus trichocarpa]
 gb|EEE93814.1| hypothetical protein POPTR_0005s24000g [Populus trichocarpa]
Length=513

 Score =   515 bits (1327),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 275/491 (56%), Positives = 333/491 (68%), Gaps = 32/491 (7%)
 Frame = +2

Query  134   TAKPSNSFFPLTLSSPQKPYSSLKCRDSLPAAIPESSNKHdeeeedgddeegRNLHEIWA  313
             T K S S  P  LS         K  +SL + I E   + D E      E  R L ++W 
Sbjct  45    TGKTSTSAIPCVLS---------KTSESLTSIITELEKEQDHETNTNTKEPERKLADVWR  95

Query  314   EIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKL  493
             EIQG  DW GLLDPMD  LR E+IRYGE AQACYD+FDFDP SKYCG+C++   +F E L
Sbjct  96    EIQGQDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFIRRRFLESL  155

Query  494   GMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRD  673
             GMA  GY ++RYLYATSNI+L NFF+ S   ++WS  ANW+GYVAV+ DE   + LGRRD
Sbjct  156   GMAHHGYEVTRYLYATSNIDLSNFFKKSRWPKVWSNKANWIGYVAVSDDET-TKCLGRRD  214

Query  674   IVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNFCS  841
             I IAWRGTVT+LEWI DL + L P +       DP +K+E GF DLYT+  KD +C FC 
Sbjct  215   ISIAWRGTVTHLEWISDLMDFLKPINGNKIPCPDPTVKVEYGFLDLYTD--KDENCRFCK  272

Query  842   YSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegd  1021
             YSAREQ+L+EV RL E Y  E +SIT+TGHSLG+ALA+LSAYDIAE  ++V+Q+G     
Sbjct  273   YSAREQILSEVKRLTEMYADEEMSITITGHSLGSALAILSAYDIAETGLHVMQDGRALPV  332

Query  1022  gesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1201
                            VFSF+GPRVGN+RFKER + LG+KVLR+VNV+D VP  PG+  NE
Sbjct  333   S--------------VFSFSGPRVGNVRFKERIESLGVKVLRVVNVQDMVPKSPGLFFNE  378

Query  1202  KFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1381
               Q    L  + +  PW+Y+HVGVELALDH  SPFLK  +D  CAHNLE HLHL+DGYHG
Sbjct  379   --QVPPPLMKLAEGLPWAYSHVGVELALDHRNSPFLKQTSDPACAHNLEAHLHLLDGYHG  436

Query  1382  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAH  1561
              G RF  A+GRD ALVNK  +FLK  H VPP WRQDENKGM+R +DGRWV PER +++ H
Sbjct  437   KGHRFVLASGRDPALVNKACDFLKDHHLVPPNWRQDENKGMIRNNDGRWVQPERPKLDEH  496

Query  1562  PSDTGHHFRKV  1594
             P DT  H RK+
Sbjct  497   PLDTHDHLRKL  507



>ref|XP_002302074.2| hypothetical protein POPTR_0002s04560g [Populus trichocarpa]
 gb|EEE81347.2| hypothetical protein POPTR_0002s04560g [Populus trichocarpa]
Length=515

 Score =   515 bits (1326),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 274/489 (56%), Positives = 331/489 (68%), Gaps = 32/489 (7%)
 Frame = +2

Query  140   KPSNSFFPLTLSSPQKPYSSLKCRDSLPAAIPESSNKHdeeeedgddeegRNLHEIWAEI  319
             K S S  P  LS         K  +SL + I +   + D        E  R L ++W EI
Sbjct  47    KTSTSAIPRVLS---------KASESLTSTITKHEKEEDYNTNTNTKEPERKLADVWREI  97

Query  320   QGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGM  499
             QG  DW GLLDPMD  LR E+IRYGE AQACYD+FDFDP SKYCG+C++   +FFE LGM
Sbjct  98    QGKDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFMSHRFFESLGM  157

Query  500   ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIV  679
                GY ++RYLY TSNINLPNFF+ S   ++WS  ANW+GYVAV+ DE   +RLGRRDI 
Sbjct  158   TRHGYEVTRYLYGTSNINLPNFFKKSRWPKVWSNVANWIGYVAVSNDET-TKRLGRRDIT  216

Query  680   IAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNFCSYS  847
             +AWRGTVT LEWI DL + L P +       DP +K+ESGF DLYT+  KD +C FC YS
Sbjct  217   VAWRGTVTRLEWIADLMDFLKPVNGNKIPCPDPTVKVESGFLDLYTD--KDENCRFCKYS  274

Query  848   AREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegdge  1027
             AREQ+LAEV RL E Y  E +SIT+TGHSLG ALA+LSAYDI E  ++V+Q         
Sbjct  275   AREQILAEVKRLTEMYADEEMSITITGHSLGGALAMLSAYDIVETGLHVMQ---------  325

Query  1028  sssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKF  1207
                   +  +P+SVFSF+GPRVGN+RFKER + LG+KVLR+VNV+D VP  PG+  NE  
Sbjct  326   -----DSRALPVSVFSFSGPRVGNVRFKERIESLGVKVLRVVNVQDVVPKSPGLFFNE--  378

Query  1208  QYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDG  1387
             Q    L  + +  PW Y+HVGVELALDH  SPFLK   D  CAHNLE  LHL+DGYHG G
Sbjct  379   QVPPMLMKLTEGLPWCYSHVGVELALDHKNSPFLKQTGDPVCAHNLEALLHLLDGYHGKG  438

Query  1388  RRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPS  1567
             +RF  A+GRD ALVNK  +FLK  + VPP WRQDENKGMVR  DGRWV P+R +++ HP 
Sbjct  439   QRFVLASGRDPALVNKACDFLKDHYLVPPNWRQDENKGMVRNGDGRWVQPDRPKLDDHPV  498

Query  1568  DTGHHFRKV  1594
             DT HH RK+
Sbjct  499   DTHHHLRKL  507



>ref|XP_007050417.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOX94574.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=516

 Score =   507 bits (1305),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 259/439 (59%), Positives = 316/439 (72%), Gaps = 23/439 (5%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R + ++W EI G  DW G+LDPMD  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  91    RRVADVWKEIHGQDDWVGMLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFA  150

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
              +QFF+ LGMA  GY +SRYL+ATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE  
Sbjct  151   QSQFFDSLGMAHHGYLVSRYLFATSNINLPNFFKKSRWPKVWSKNANWIGYVAVSNDEMS  210

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  817
              +RLGRRDI IAWRGTVT LEWI DL + L P         D  +K+ESGF DLYT+  K
Sbjct  211   -KRLGRRDITIAWRGTVTRLEWIADLMDFLKPISSNKIPCPDSTVKVESGFLDLYTD--K  267

Query  818   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  997
             D  C FC +SAREQ+L EV RL+E Y+ E +SIT+TGHSLG+ALA+LSAYDI E  +NV+
Sbjct  268   DEKCLFCKFSAREQILTEVKRLVEMYQDEEISITITGHSLGSALAILSAYDIVETGLNVL  327

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1177
             Q               +  +P+SVFSF+GPRVGN+RFKER + LG+KVLR+VNV D VP 
Sbjct  328   Q--------------DSRAVPVSVFSFSGPRVGNVRFKERIETLGVKVLRVVNVHDIVPK  373

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
              PG+  NE       L  + +  PWSY+HVGVELALDH  SPFL+   D  CAHNLE HL
Sbjct  374   SPGLFFNE--NVSPVLMKLAEGLPWSYSHVGVELALDHKNSPFLEDTGDPTCAHNLEAHL  431

Query  1358  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1537
             HL+DGYHG G RF  A+GRD ALVNK  +FLK  + VPP WRQDENKGMVR  DGRW+ P
Sbjct  432   HLLDGYHGKGHRFVLASGRDPALVNKACDFLKDHYLVPPYWRQDENKGMVRNKDGRWMQP  491

Query  1538  ERSRIEAHPSDTGHHFRKV  1594
             ER + + HP DT HH R++
Sbjct  492   ERPKFDDHPEDTLHHLRQL  510



>ref|XP_011026041.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Populus 
euphratica]
Length=513

 Score =   505 bits (1300),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 269/489 (55%), Positives = 328/489 (67%), Gaps = 32/489 (7%)
 Frame = +2

Query  140   KPSNSFFPLTLSSPQKPYSSLKCRDSLPAAIPESSNKHdeeeedgddeegRNLHEIWAEI  319
             K S S  P  LS         K  +SL + I +   + D        E  R L ++W EI
Sbjct  47    KTSTSAIPRVLS---------KASESLTSTITKHEKEQDYNTNTNTKEPERKLADVWREI  97

Query  320   QGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGM  499
             QG  DW GLLDPMD  LR E+IRYGE AQACYD+FDFDP SKYCG+C++   +FFE LGM
Sbjct  98    QGKDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFMSHRFFESLGM  157

Query  500   ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIV  679
                GY ++RYLYATS I LPNFF+ S   ++WS  A+W+GYVAV+ DE   +RLGRRDI 
Sbjct  158   TRHGYEVTRYLYATSTIKLPNFFKKSRWPKVWSNSASWIGYVAVSDDET-TKRLGRRDIT  216

Query  680   IAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNFCSYS  847
             +AWRGTVT LEWI DL + L P +       DP +K+ESGF DLYT+  KD +C FC YS
Sbjct  217   VAWRGTVTRLEWIADLMDFLKPVNDNKIPCPDPTVKVESGFLDLYTD--KDENCRFCKYS  274

Query  848   AREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegdge  1027
             AREQ+LAE  RL E Y  E +SIT+TGHSLG ALA+LSAYDI E  ++V+Q         
Sbjct  275   AREQILAEGKRLTEMYADEEMSITITGHSLGGALAMLSAYDIVETGLHVMQ---------  325

Query  1028  sssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKF  1207
                   +  +P+SVFSF+GPRVGN+RFKER + LG+KVLR+VNV+D VP  PG+  NE  
Sbjct  326   -----DSRALPVSVFSFSGPRVGNVRFKERIESLGVKVLRVVNVQDVVPKSPGLFLNE--  378

Query  1208  QYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDG  1387
             Q    L  + +  PW Y+HVGVELALDH  SPFLK   D  CAHNLE  LHL+DGYHG G
Sbjct  379   QVPPMLMKLTEGLPWCYSHVGVELALDHKNSPFLKQTGDPVCAHNLEALLHLLDGYHGKG  438

Query  1388  RRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPS  1567
             +RF  A+GRD A+VN   +FLK  + VPP WRQDENKGMVR  DGRWV P+R +++ HP 
Sbjct  439   QRFVLASGRDPAMVNTACDFLKDHYLVPPNWRQDENKGMVRNGDGRWVQPDRPKLDDHPV  498

Query  1568  DTGHHFRKV  1594
             DT HH RK+
Sbjct  499   DTHHHLRKL  507



>ref|XP_008235325.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic [Prunus mume]
Length=510

 Score =   504 bits (1299),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 274/519 (53%), Positives = 344/519 (66%), Gaps = 35/519 (7%)
 Frame = +2

Query  83    YHTIFAEPPLMNITKPT----TAKPSNSFFPLTLSSPQKPYSSLKCRDSLPAAIPE----  238
             Y T+   P L   ++ +     + PSN   P T +   K   S K  DSL + I E    
Sbjct  6     YSTLLPFPKLTVSSRKSHTFAGSNPSNLTIPTTSTVCAKALHS-KTSDSLSSIITELEKE  64

Query  239   ---SSNKHdeeeedgddeegRNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQA  409
                  +++  +E+     + R L  +W E+ G  DW GLLDPMD  LR E+IRYGE AQA
Sbjct  65    SLNKDDQNQRQEDINTTHDERRLSNVWRELHGQDDWVGLLDPMDPLLRSELIRYGEMAQA  124

Query  410   CYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNR  589
             CYD+FDFDP SKYCG+C++    FF  LGMA  GYR+SRYL+ATSNINLPNFF+ S   +
Sbjct  125   CYDAFDFDPFSKYCGSCRFVPRSFFPSLGMAHLGYRVSRYLFATSNINLPNFFKKSRWPK  184

Query  590   IWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD---  760
             +WS++ANW+GYVAV+ DE    RLGRRDI IAWRGTVT LEWI DL + L P        
Sbjct  185   VWSKNANWIGYVAVSDDET-TARLGRRDISIAWRGTVTRLEWIVDLMDFLKPVSGNKIPC  243

Query  761   -DPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHsl  937
              DP +K+ESGF DLYT+  KD  C + ++SAREQ+L E+ RL+E Y GE LSIT+TGHSL
Sbjct  244   PDPTVKVESGFLDLYTD--KDVTCRYSTFSAREQILTEIKRLVEMYTGEELSITITGHSL  301

Query  938   gaalallsaYDIAEMKVNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKER  1117
             G+ALA+LSAYDI E  +NV               +    +P+SV SF+GPRVGN+RFKER
Sbjct  302   GSALAILSAYDITETGLNVT--------------ADGQVVPVSVLSFSGPRVGNVRFKER  347

Query  1118  CDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSY  1297
              + LG+KVLR+VNV D VP  PG+  NE      +L  + +  PWSY+HVGV+L LDH  
Sbjct  348   LESLGVKVLRVVNVHDVVPKSPGLFFNE--HVAPRLMKLAEGLPWSYSHVGVQLELDHKN  405

Query  1298  SPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPR  1477
             SPFLK  +D  CAHNLE HLHL+DGYHG G RF  A+GRD ALVNK S+FLK  + VPP 
Sbjct  406   SPFLKQTSDPVCAHNLEAHLHLLDGYHGKGHRFVLASGRDPALVNKASDFLKDHYLVPPY  465

Query  1478  WRQDENKGMVRTSDGRWVVPERSRIEAHPSDTGHHFRKV  1594
             WRQDENKGMVR+ DGRW+ PER +++ HP D  HH +++
Sbjct  466   WRQDENKGMVRSKDGRWIQPERPKLDDHPEDIHHHLKQL  504



>gb|KDP21366.1| hypothetical protein JCGZ_21837 [Jatropha curcas]
Length=500

 Score =   504 bits (1298),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 257/439 (59%), Positives = 314/439 (72%), Gaps = 23/439 (5%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L +IW EI G  DW GLLDP+D  LR E+IRYGE AQACYD+FD+DP+SKYCG+C++ 
Sbjct  74    RKLADIWREIHGQDDWVGLLDPIDPILRTELIRYGEIAQACYDAFDYDPYSKYCGSCRFM  133

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
               +FF+ LGM   GY +SRYLYAT+NI+LPNFF+ S   ++WS+ ANW+GYVAV+ DE  
Sbjct  134   RRRFFDSLGMGHHGYEVSRYLYATTNIDLPNFFKESRWPKVWSRKANWIGYVAVSNDET-  192

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  817
              +RLGRRDIVIAWRGTVT LEWI DL + L P +       DP +K+ESGF DLYT+  K
Sbjct  193   TKRLGRRDIVIAWRGTVTRLEWIADLMDFLKPINGNKIPCPDPAVKVESGFLDLYTD--K  250

Query  818   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  997
             D +C FC +SAREQ+L EV RL E +  E +SIT+TGHSLG+ALA+LSAYD+ E  ++V+
Sbjct  251   DENCRFCKFSAREQVLTEVKRLTEMHSNEEVSITITGHSLGSALAILSAYDLVETGLHVM  310

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1177
             Q+                     VFSF+GPRVGN RFKER + LG+KVLR+VNV D VP 
Sbjct  311   QDCRALPVC--------------VFSFSGPRVGNARFKERIESLGVKVLRVVNVHDVVPK  356

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
              PG   NE  Q    L  +    PW Y+HVGVELALDH++SPFLK  +D  CAHNLE HL
Sbjct  357   APGFFFNE--QVPPMLMKLAGGLPWCYSHVGVELALDHTHSPFLKETSDPVCAHNLEAHL  414

Query  1358  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1537
             HL+DGYHG GRRF  A GRD ALVNK S+FLK  + VPP WRQDENKGMVR +DGRW+ P
Sbjct  415   HLLDGYHGKGRRFVLAGGRDPALVNKASDFLKDHYLVPPFWRQDENKGMVRNNDGRWIQP  474

Query  1538  ERSRIEAHPSDTGHHFRKV  1594
             ER R++ HP D  HH +K+
Sbjct  475   ERPRLDDHPPDIHHHLKKL  493



>ref|XP_009782117.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Nicotiana 
sylvestris]
Length=521

 Score =   504 bits (1297),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 259/436 (59%), Positives = 314/436 (72%), Gaps = 24/436 (6%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L + W EI G  DW G+LDP+D  LR E+IRYGE AQACYD+FDFDP+SKYCG+CK+   
Sbjct  98    LADYWLEILGKDDWVGILDPLDPLLRNELIRYGEMAQACYDAFDFDPYSKYCGSCKFPRH  157

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             +FF+ L MA+ GY I+RYLYATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE   +
Sbjct  158   KFFDGLDMANYGYDITRYLYATSNINLPNFFKQSRWPKVWSKNANWIGYVAVSNDETS-K  216

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  823
             RLGRRDI I+WRGTVT LEWI DL + L P         DP++K+ESGF DLYT+  KD 
Sbjct  217   RLGRRDITISWRGTVTRLEWIADLMDFLRPISSDKIPCPDPNVKVESGFLDLYTD--KDE  274

Query  824   DCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
             +C +C +SAREQ+L EV RL+E+Y  E +SITVTGHSLG+ALA+LSAYDI E  VNV   
Sbjct  275   NCRYCKFSAREQILTEVKRLVEKYPTEEMSITVTGHSLGSALAILSAYDIVETGVNV---  331

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1183
                         +    +PI VFSFAGPRVGN RFK+R + LG+KVLR+VNV D VP  P
Sbjct  332   -----------RANTRAVPIGVFSFAGPRVGNTRFKQRLEMLGVKVLRVVNVHDIVPKSP  380

Query  1184  GIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1363
             G++ NE       +  + +  PWSY+HVGVELALDH  SPFLK   DL CAHNLE HLHL
Sbjct  381   GLVFNE--HSPSMVMKICEGLPWSYSHVGVELALDHKNSPFLKPTNDLVCAHNLEAHLHL  438

Query  1364  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             +DGYHG GRRF  A GRDIALVNK  +FLK  + VPP WRQDENKGM+R  DGRW+ PER
Sbjct  439   LDGYHGKGRRFVLAKGRDIALVNKACDFLKDHYCVPPNWRQDENKGMIRDKDGRWIQPER  498

Query  1544  SRI-EAHPSDTGHHFR  1588
              R+ + HP D  HH +
Sbjct  499   PRVLDDHPPDIHHHLK  514



>ref|XP_004289898.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=537

 Score =   503 bits (1296),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 258/439 (59%), Positives = 316/439 (72%), Gaps = 23/439 (5%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L + W E+ G  DW GLLDPMD  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  100   RRLPDAWRELHGEDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFT  159

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
              A FF+ LGM+  GY +SRYL+ATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE  
Sbjct  160   RANFFDSLGMSHHGYHVSRYLFATSNINLPNFFKKSRWPKVWSKNANWIGYVAVSDDET-  218

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  817
               RLGRRDI IAWRGTVT LEWI DL + L P         DP +K ESGF DLYT+  K
Sbjct  219   TARLGRRDISIAWRGTVTRLEWIVDLMDFLKPLSNNKIPCPDPHVKAESGFLDLYTD--K  276

Query  818   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  997
             D  C FC+YSAREQ+L E+ RL+E+Y+ E LSIT+TGHSLG+ALA+LSAYDIAE  +NV 
Sbjct  277   DQTCRFCTYSAREQILTEIKRLMEKYRNEELSITITGHSLGSALAILSAYDIAETGLNV-  335

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1177
                           +    +P+SVFSF+GPRVGN+ FKER + LG+KVLR+VNV D VP 
Sbjct  336   -------------KADGRVVPVSVFSFSGPRVGNVHFKERLEALGVKVLRVVNVHDVVPK  382

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
              PG++ NE       +  + ++ PWSY+HVGVEL LDH  SPFLK   D GC+HNLE HL
Sbjct  383   SPGLLINE--HVPAMMLKLTENLPWSYSHVGVELELDHKNSPFLKQTNDPGCSHNLEAHL  440

Query  1358  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1537
             HL+DGYHG G RF  A+GRD ALVNK S+FLK  + VPP WRQDENKGMVR  DGRW+ P
Sbjct  441   HLLDGYHGKGHRFVLASGRDPALVNKASDFLKDHYLVPPFWRQDENKGMVRCKDGRWMQP  500

Query  1538  ERSRIEAHPSDTGHHFRKV  1594
             ER +++ HP D  HH +++
Sbjct  501   ERPKLDDHPEDIHHHLKQL  519



>ref|XP_009603052.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=522

 Score =   502 bits (1292),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 258/436 (59%), Positives = 314/436 (72%), Gaps = 24/436 (6%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L + W EI G  DW G+LDP+D  LR E+IRYGE AQACYD+FDFDP+SKYCG+CK+   
Sbjct  99    LADRWLEIFGKDDWVGMLDPLDPLLRNELIRYGEMAQACYDAFDFDPYSKYCGSCKFPRH  158

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             +FF+ L M + GY I+RYLYATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE   +
Sbjct  159   KFFDGLDMVNYGYDITRYLYATSNINLPNFFKQSRWPKVWSKNANWIGYVAVSNDETS-K  217

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  823
             RLGRRDI IAWRGTVT LEWI DL + L P         DP++K+ESGF DLYT+  KD 
Sbjct  218   RLGRRDITIAWRGTVTRLEWIADLMDFLRPISSDKIPCPDPNVKVESGFLDLYTD--KDE  275

Query  824   DCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
             +C +C +SAREQ+L EV RL+E+Y  E +SITVTGHSLG+ALA+LSAYDI E  +N+   
Sbjct  276   NCRYCKFSAREQILTEVKRLVEKYPNEEMSITVTGHSLGSALAILSAYDIVETGLNI---  332

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1183
                         +    +PI VFSFAGPRVGN RFKER ++LG+KVLR+VNV D VP  P
Sbjct  333   -----------RADTRTVPIGVFSFAGPRVGNARFKERLEKLGVKVLRVVNVHDIVPKSP  381

Query  1184  GIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1363
             G++ NE       +  + +  PWSY+HVGVELALDH  SPFLK   DL CAHNLE HLHL
Sbjct  382   GLVFNE--HSPSMVMKICEGLPWSYSHVGVELALDHKNSPFLKPTNDLVCAHNLEAHLHL  439

Query  1364  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             +DGYHG GRRF  A GRDIALVNK  +FLK  + VPP WRQDENKGM+R  DGRW+ PER
Sbjct  440   LDGYHGKGRRFVLAKGRDIALVNKACDFLKDHYCVPPNWRQDENKGMIRDKDGRWIQPER  499

Query  1544  SRI-EAHPSDTGHHFR  1588
              R+ + HP D  HH +
Sbjct  500   PRVLDDHPPDIHHHLK  515



>ref|XP_006349747.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Solanum 
tuberosum]
Length=507

 Score =   498 bits (1283),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 256/419 (61%), Positives = 307/419 (73%), Gaps = 23/419 (5%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI G  DW G+LDPMD  LR E+IRYGE AQACYD+FDFDP+SKYCG+CK+   +FF+
Sbjct  92    WLEIHGQDDWVGMLDPMDPILRNELIRYGEMAQACYDAFDFDPYSKYCGSCKFPRRKFFD  151

Query  488   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  667
              LGMA+ GY I+RYLYATSNINLPNFF+ S   +IWS++ANW+GYVAV+ DE   +RLGR
Sbjct  152   GLGMAEYGYDITRYLYATSNINLPNFFKQSRWPKIWSKNANWIGYVAVSNDET-TKRLGR  210

Query  668   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNF  835
             RDI IAWRGTVT LEWI DL + L P    +    DP++K+ESGF DLYT+  KD  C +
Sbjct  211   RDITIAWRGTVTRLEWIADLMDYLRPISSDNIPCPDPNVKVESGFLDLYTD--KDEKCRY  268

Query  836   CSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegege  1015
             C +SAREQ+L EV RLIE Y  E +SITVTGHSLG+ALA+LSAYDI E  +NV       
Sbjct  269   CKFSAREQILTEVKRLIEMYPDEEMSITVTGHSLGSALAILSAYDIVETGLNV-------  321

Query  1016  gdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1195
                     +    +PI VFSF+GPRVGN+RFKER ++LG+KVLR+VNV D VP  PG++ 
Sbjct  322   -------KADTSAVPICVFSFSGPRVGNVRFKERIEKLGVKVLRVVNVHDIVPKSPGLVL  374

Query  1196  NEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1375
             NE       +  + +  PWSY+HVGVELALDH  SPFLK  +DL CAHNLE HLHL+DGY
Sbjct  375   NE--HSPSMVMKICEKLPWSYSHVGVELALDHKNSPFLKPTSDLVCAHNLEAHLHLLDGY  432

Query  1376  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRI  1552
             HG GRRF    GRDIALVNK  +FLK  + VPP WRQDENKGM+R  DGRW+ PER R+
Sbjct  433   HGKGRRFVLEKGRDIALVNKACDFLKDHYCVPPNWRQDENKGMIRDKDGRWLQPERPRL  491



>ref|XP_007201554.1| hypothetical protein PRUPE_ppa017780mg, partial [Prunus persica]
 gb|EMJ02753.1| hypothetical protein PRUPE_ppa017780mg, partial [Prunus persica]
Length=468

 Score =   496 bits (1276),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 253/439 (58%), Positives = 314/439 (72%), Gaps = 23/439 (5%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L ++W E+ G  DW GLLDPMD  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  43    RRLSDVWRELHGQDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFV  102

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
                FF  LGMA  GY +SRYL+ATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE  
Sbjct  103   RRSFFPSLGMAHHGYHVSRYLFATSNINLPNFFKKSRWPKVWSKNANWIGYVAVSDDET-  161

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSKK  817
               RLGRRDI IAWRGTVT LEWI DL + L P      P     +K+ESGF DLYT+  K
Sbjct  162   TARLGRRDISIAWRGTVTRLEWIVDLMDFLKPVSGNKIPCPDRTVKVESGFLDLYTD--K  219

Query  818   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  997
             D  C + ++SAREQ+L E+ RL+E Y GE LSIT+TGHSLG+ALA+LS+YDI E  +NV 
Sbjct  220   DETCRYSTFSAREQILTEIKRLVEEYSGEELSITITGHSLGSALAILSSYDITETGLNVT  279

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1177
                           +    +P+SV SF+GPRVGN+RFKER + LG+KVLR+VNV D VP 
Sbjct  280   --------------ADGQVVPVSVLSFSGPRVGNVRFKERLESLGVKVLRVVNVHDVVPK  325

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
              PG+  NE      +L  + +  PWSY+HVGV+L LDH++SPFLK  +D  CAHNLE HL
Sbjct  326   SPGLFFNE--HVAPRLMKLAEGLPWSYSHVGVQLELDHTHSPFLKQTSDPVCAHNLEAHL  383

Query  1358  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1537
             HL+DGYHG G RF  A+GRD ALVNK S+FLK  + VPP WRQDENKGMVR+ DGRW+ P
Sbjct  384   HLLDGYHGKGHRFVLASGRDPALVNKASDFLKDHYLVPPYWRQDENKGMVRSKDGRWIQP  443

Query  1538  ERSRIEAHPSDTGHHFRKV  1594
             ER +++ HP D  HH +++
Sbjct  444   ERPKLDDHPEDIHHHLKQL  462



>ref|XP_008346158.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Malus 
domestica]
Length=512

 Score =   493 bits (1270),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 268/500 (54%), Positives = 328/500 (66%), Gaps = 34/500 (7%)
 Frame = +2

Query  134   TAKPSNSFFPLTLSSPQKPYSSLKCRDSLPAAIPE-------SSNKHdeeeedgddeegR  292
             ++ PS     ++  +P+  +S  K  DS  + I E       + N+   +      E  R
Sbjct  28    SSNPSKLTLSISTVAPRVLHS--KATDSFTSIIAELEKERAQNQNERKTDSNSTTHENER  85

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
              L + W E+ G  DW GLLDPMD  LR E+IRYGE AQACYD+FDFDP SKYCG+C++  
Sbjct  86    RLSDTWRELHGQDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFTR  145

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
               FFE LGMA  GY +SRY+YATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE   
Sbjct  146   RDFFESLGMAHHGYHVSRYIYATSNINLPNFFKKSRWPKVWSKNANWIGYVAVSDDET-T  204

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNSKKD  820
              RLGRRDI IAWRGTVT LEWI DL + L P         DP +K+ESGF DLYT+  KD
Sbjct  205   ARLGRRDISIAWRGTVTRLEWIVDLMDFLKPVSSNRIPCPDPTVKVESGFLDLYTD--KD  262

Query  821   TDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
               C FC YSAREQ+L E+ RL+E+Y  E LSIT+TGHSLG+ALA LSAYDI E  +NV  
Sbjct  263   EACRFCQYSAREQILTEMKRLVEKYSDEELSITITGHSLGSALAXLSAYDITETGLNVTS  322

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1180
                               +P+SV SFAGPRVGN+RFKER + LGIKVLR+VNV D VP  
Sbjct  323   --------------DGRGVPVSVLSFAGPRVGNVRFKERLESLGIKVLRVVNVHDVVPKS  368

Query  1181  PGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLH  1360
             PG+  NE       +  + +  PWSY HVGV+L LDH  SPFLK   D   AHNLE HLH
Sbjct  369   PGLFFNE--HVAPMVMKLXEGLPWSYTHVGVQLELDHKNSPFLKPTNDPVGAHNLEAHLH  426

Query  1361  LVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPE  1540
             L+DGYHG G RF  A+GRD ALVNK  +FLK  + VPP WRQDENKGMVR+ DGRW+ PE
Sbjct  427   LLDGYHGKGHRFVLASGRDPALVNKACDFLKDHYLVPPYWRQDENKGMVRSKDGRWIQPE  486

Query  1541  RSRIEA--HPSDTGHHFRKV  1594
             R +++   HP D  HH +++
Sbjct  487   RPKLDDDHHPEDIHHHLKQL  506



>ref|XP_009367748.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Pyrus 
x bretschneideri]
Length=511

 Score =   493 bits (1269),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 263/479 (55%), Positives = 323/479 (67%), Gaps = 34/479 (7%)
 Frame = +2

Query  203   KCRDSLPAAIPE----------SSNKHdeeeedgddeegRNLHEIWAEIQGSKDWEGLLD  352
             K  DSLP+ I E            ++++ E      E  R L ++W E+ G  DW GLLD
Sbjct  46    KTTDSLPSIITELEKERAHSKEEDDQNERETNTTTHENERRLSDVWRELHGQDDWVGLLD  105

Query  353   PMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYL  532
             PMD  LR E+IRYGE AQACYD+FDFDP SKYCG+C++    FFE LGMA  GY +SRYL
Sbjct  106   PMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFTRHAFFESLGMAQNGYHVSRYL  165

Query  533   YATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLE  712
             +ATSNINLPNFF+ S   ++WS++ANW+GYVAV+ D+     LGRRDI IAWRGTVT LE
Sbjct  166   FATSNINLPNFFKKSRWPKVWSKNANWIGYVAVSDDDTSA-SLGRRDISIAWRGTVTRLE  224

Query  713   WIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNR  880
             WI DL + L P         D  +K+ESGF DLYT+  KD  C FC YSAREQ+L E+ R
Sbjct  225   WIVDLMDFLKPVSANRIPCPDQTVKVESGFLDLYTD--KDVTCRFCHYSAREQILTEIKR  282

Query  881   LIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegdgesssasaaikip  1060
             L+E+Y  E LSIT+TGHSLG+ALA+LSAYDI E  +NV+                   +P
Sbjct  283   LVEKYSDEELSITITGHSLGSALAILSAYDITETGLNVMS--------------DGRVVP  328

Query  1061  isVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETMLK  1240
             +SV SF+GPRVGN+RFKER + LG+KVLR+VNV D VP  PG+  NE      ++  + +
Sbjct  329   VSVLSFSGPRVGNVRFKERLESLGVKVLRVVNVHDVVPKSPGLFFNE--HVAPRVMKLAE  386

Query  1241  SFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDI  1420
               PWSY+HVGVEL LDH  SPFLK   D GCAHNLE HLHL+DGYHG G RF  A+GRD 
Sbjct  387   GLPWSYSHVGVELKLDHKNSPFLKPTNDPGCAHNLEAHLHLLDGYHGKGHRFVLASGRDP  446

Query  1421  ALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEA-HPSDTGHHFRKV  1594
             ALVNK S+FLK  + VPP WRQD NKGMVR  DGRW+  ER +++  HP D  HH +++
Sbjct  447   ALVNKASDFLKDHYLVPPYWRQDHNKGMVRCKDGRWIQAERPKLDDHHPEDIHHHLKQL  505



>gb|KCW49834.1| hypothetical protein EUGRSUZ_K03311 [Eucalyptus grandis]
Length=501

 Score =   493 bits (1268),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 254/440 (58%), Positives = 308/440 (70%), Gaps = 24/440 (5%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L ++W EI G  DW G+LDPMD  LR E+IRYGE AQACYD+FDF+P SKYCG+C+Y 
Sbjct  74    RRLSDVWREIHGEDDWVGMLDPMDPLLRSELIRYGEMAQACYDAFDFEPFSKYCGSCRYG  133

Query  470   GAQFFEKLGMADR-GYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEA  646
               +FFE+L M  R GY ++RYLYATSNINLPNFF  S   ++WS+HANW+GY+AV+ DE 
Sbjct  134   KQEFFERLDMKGRPGYDVTRYLYATSNINLPNFFMKSRWPKVWSKHANWIGYMAVSDDET  193

Query  647   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNSK  814
               RRLGRRDI +AWRGTVT LEW+ DL + L P   +     DP +K ESGF  LYT+  
Sbjct  194   -TRRLGRRDIAVAWRGTVTRLEWVADLMDFLVPVSSQRVPCPDPAVKAESGFLSLYTD--  250

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNV  994
             K+ DC F  YSAREQ+L EV RLIE+Y  E LSIT+TGHSLG+ALA+LSAYDIAE  +NV
Sbjct  251   KEDDCKFAKYSAREQILTEVKRLIEKYPDEELSITMTGHSLGSALAVLSAYDIAETGINV  310

Query  995   VQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVP  1174
              Q+                     VFSFAGPRVGN RFKER + LG+KVLR+VNV D VP
Sbjct  311   RQDSRAVPVC--------------VFSFAGPRVGNARFKERAEVLGVKVLRVVNVHDMVP  356

Query  1175  TVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1354
               PG++ NE+    + +  +    PWSY+HVG EL LDH  SPFLK   D  CAHNLE H
Sbjct  357   KSPGLVFNERLP--RAVMKLAGGLPWSYSHVGAELELDHERSPFLKPTGDPACAHNLEAH  414

Query  1355  LHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVV  1534
             LHL+DGYHG G+RF  A+GRD ALVNKD++FLK  H VPP WRQ  NKG+VR  +GRW+ 
Sbjct  415   LHLLDGYHGKGQRFVLASGRDPALVNKDADFLKDHHLVPPFWRQGHNKGLVRNHEGRWMQ  474

Query  1535  PERSRIEAHPSDTGHHFRKV  1594
             PER + E HP+   HH  ++
Sbjct  475   PERPKPEDHPAYMDHHVEQL  494



>ref|XP_002281907.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Vitis 
vinifera]
Length=514

 Score =   493 bits (1269),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 261/440 (59%), Positives = 310/440 (70%), Gaps = 26/440 (6%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             + E W EI G  DW G+LDPMD  LR E+IRYGE AQACYD+FDFDP SKYCGTC++   
Sbjct  88    VSERWREIHGEDDWTGMLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGTCRFMPR  147

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             +FF+ LGMA  GY +SRYLYATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE   R
Sbjct  148   KFFDSLGMAGHGYDVSRYLYATSNINLPNFFKKSRWPKVWSKNANWIGYVAVSNDEKS-R  206

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSKKDT  823
              LGRRDI IAWRGTVT LEWI DL + L P    + P     +K+ESGF DLYT+  KD 
Sbjct  207   VLGRRDITIAWRGTVTRLEWIADLMDFLKPVSSENIPCPDRTVKVESGFLDLYTD--KDE  264

Query  824   DCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
              C FC +SAREQ+L EV RLIE Y  E LSIT TGHSLG ALA+LSAYD+AE  +NV+  
Sbjct  265   SCKFCKFSAREQILTEVKRLIEMYPNEELSITFTGHSLGGALAVLSAYDVAETGLNVLN-  323

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1183
                              +P+SV SF+GPRVGN+RFKER + LG+KVLR+VNV D VP  P
Sbjct  324   -------------NGRVLPVSVLSFSGPRVGNVRFKERLEGLGVKVLRVVNVHDVVPKSP  370

Query  1184  GIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1363
             G+  NE  Q    +  + +  PWSY+HVGVELALDH  SPFLK   D   AHNLE HLHL
Sbjct  371   GLFFNE--QVPAMVMKLAEGLPWSYSHVGVELALDHKNSPFLKQNADPISAHNLEAHLHL  428

Query  1364  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             +DGYHG G+RF  A+GRD ALVNK S+FLK  + VPP WRQDENKGMVR+SDGRWV PER
Sbjct  429   LDGYHGKGQRFVLASGRDPALVNKASDFLKDHYLVPPYWRQDENKGMVRSSDGRWVQPER  488

Query  1544  SRIEAHP---SDTGHHFRKV  1594
              + E H    +D  HH  ++
Sbjct  489   PKHELHDHNHADMHHHLGQL  508



>ref|XP_008783171.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Phoenix 
dactylifera]
Length=520

 Score =   493 bits (1269),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 257/439 (59%), Positives = 310/439 (71%), Gaps = 25/439 (6%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L + W EI GS DW GLLDPMD  LR E+IRYGEFAQACYD+FD+DP S+YCG+CKY+  
Sbjct  95    LADRWREIHGSDDWAGLLDPMDPLLRSELIRYGEFAQACYDAFDYDPFSRYCGSCKYNRR  154

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             +FF  LGM   GY I+RYL+ATSNINL NFF  +  ++ WSQ ANW+GY+AV+ D+A   
Sbjct  155   KFFASLGMDSSGYEITRYLFATSNINLSNFFTKTQGSKTWSQKANWIGYIAVSDDDATA-  213

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNSKKDT  823
             RLGRRDIVIAWRGTVT LEW+ DL + L P         DP++K+ESGF DLYT+  KD 
Sbjct  214   RLGRRDIVIAWRGTVTRLEWVADLMDFLRPAASEGIPCSDPEVKVESGFLDLYTD--KDP  271

Query  824   DCNFCSYSAREQLLAEVNRLIER--YKGENLSITVTGHslgaalallsaYDIAEMKVNVV  997
              C FC YSAR+Q+L EV RL+E+    GE +SITVTGHSLG+ALA+LSAYDIAE  ++V 
Sbjct  272   TCRFCKYSARQQVLTEVRRLVEQCTKAGETVSITVTGHSLGSALAMLSAYDIAETGLDV-  330

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1177
                               K+ I+VFSF+GPRVGN RFKER + LG+K LR+VNV D VP 
Sbjct  331   -------------GVDGEKVAITVFSFSGPRVGNGRFKERFESLGVKALRVVNVHDTVPK  377

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
             VPGI+ NE       +    +  PWSY+HVGVELALDH  SPFLK   D  C+HNLE HL
Sbjct  378   VPGILVNE--HVPAFVRKFAEGLPWSYSHVGVELALDHKRSPFLKDTGDPSCSHNLEAHL  435

Query  1358  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1537
             HL+DGYHG G RF  A+ RD ALVNK  +FLK    VPP WRQDENKGM+R  DGRWV P
Sbjct  436   HLLDGYHGSGVRFYLASKRDPALVNKACDFLKDHLMVPPFWRQDENKGMIRAHDGRWVQP  495

Query  1538  ERSRIEAHPSDTGHHFRKV  1594
             ER +++ HP+D  HH R++
Sbjct  496   ERQKLDDHPADMHHHLRRL  514



>ref|XP_009384367.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=516

 Score =   493 bits (1268),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 271/496 (55%), Positives = 331/496 (67%), Gaps = 26/496 (5%)
 Frame = +2

Query  128   PTTAKPSNSFFPLTLSSPQKPYSSLKCRDSLPAAIPESSNKHdeeeedgddeegRNLHEI  307
             P  + P      +  ++  +  S++K   SL + I E   + +E+E    ++  R L E 
Sbjct  32    PARSSPIPVLRAVRRTAKARALSAVKDDQSLSSIITELEQEQEEDETAAGEDVTRRLPER  91

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W+EI G  DW GLLDPMD  LR E+IRYGEFAQACYDSFD+DP S+YCG+CKY+  +FF 
Sbjct  92    WSEIHGRDDWAGLLDPMDPLLRSELIRYGEFAQACYDSFDYDPFSRYCGSCKYNRRRFFS  151

Query  488   KLGMADRGYRISRYLYATSNINLPNFFQHSSVN-RIWSQHANWMGYVAVATDEAEIRRLG  664
              LG+   GY ++RYLYATSNINLPNFF  S    +IWSQ ANWMGYVAV+ DE   R LG
Sbjct  152   SLGLEGIGYEVTRYLYATSNINLPNFFTKSRAGAKIWSQRANWMGYVAVSDDETTAR-LG  210

Query  665   RRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCN  832
             RRDIV+AWRGTVT LEWI DL + L P         DP +K+ESGF +LYT+  KD  C 
Sbjct  211   RRDIVVAWRGTVTRLEWIADLMDFLRPVTSVGIPCPDPSVKVESGFAELYTD--KDPTCR  268

Query  833   FCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
             FC YSAREQLL EV +L+E +   GE +SI+VTGHSLG+ALA+LSAYDIAEM +NV + G
Sbjct  269   FCKYSAREQLLTEVRKLVELHSRAGEEVSISVTGHSLGSALAMLSAYDIAEMGLNVGEGG  328

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
             E                   VFSF+GPRVGN  FKER + LGIK +R+VNV D VP VPG
Sbjct  329   ERVATT--------------VFSFSGPRVGNGHFKERFEGLGIKAIRVVNVHDTVPKVPG  374

Query  1187  IIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1366
             I+ NE+      L  + ++ PWSY+H+GVEL LDH  SPFLK   D  C HNLE HLHL+
Sbjct  375   ILFNERVP--AFLRRLAEALPWSYSHIGVELPLDHRRSPFLKETVDPSCFHNLEAHLHLL  432

Query  1367  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1546
             DGYHG G RF  A+GRD ALVNK  +FLK  H VPP WRQDENKGM R  DGRW   +R 
Sbjct  433   DGYHGKGHRFVLASGRDPALVNKACDFLKEHHMVPPFWRQDENKGMTRAHDGRWGQTDRR  492

Query  1547  RIEAHPSDTGHHFRKV  1594
              ++ HP DT HH +++
Sbjct  493   EVDDHPEDTQHHVQRL  508



>ref|XP_011079988.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic isoform X1 
[Sesamum indicum]
Length=509

 Score =   492 bits (1266),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 253/440 (58%), Positives = 313/440 (71%), Gaps = 25/440 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L + W+E+ G  DW GLLDPMD  LR E+IRYG  AQACYD+FDFDP+SKYCG+C++ 
Sbjct  83    RELADCWSEMLGEDDWAGLLDPMDPLLRNELIRYGVMAQACYDAFDFDPYSKYCGSCRFT  142

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
               +FFE+LGMA+ GY I+RYLYATSNINLPNFF++S   ++WS++ANW+GY+AV+ DE  
Sbjct  143   RREFFERLGMAEAGYDITRYLYATSNINLPNFFKNSRWPKVWSKNANWIGYIAVSNDETS  202

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  817
              ++LGRRDI +AWRGTVT LEW+ DL + L P         DP +++ESGF DLYT+  K
Sbjct  203   -KKLGRRDICVAWRGTVTRLEWVADLMDFLRPISSDKIPSPDPTVRVESGFLDLYTD--K  259

Query  818   DTDCNFCSYSAREQLLAEVNRLI-ERYKGENLSITVTGHslgaalallsaYDIAEMKVNV  994
             D  C +C +SAREQ+L EVNRLI E Y  E +S+T+TGHSLG A ALLSAYDI E  +NV
Sbjct  260   DESCKYCKFSAREQILTEVNRLINEVYPKEEVSVTITGHSLGGASALLSAYDIVETGINV  319

Query  995   VQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVP  1174
                              +  +P+ VF+FAGPRVGN RFK R + LG+KVLR+VNV D VP
Sbjct  320   --------------RGDSRAVPVCVFTFAGPRVGNARFKARLELLGVKVLRVVNVHDVVP  365

Query  1175  TVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1354
               PG++ NEK      +  M ++FPWSY HVGVELALDH  SPFL+   DL CAHNLE H
Sbjct  366   KSPGLLVNEK--AHPLVIKMAENFPWSYVHVGVELALDHKNSPFLRHDGDLVCAHNLEAH  423

Query  1355  LHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVV  1534
             LHL+DGYHG G RFR   GRD ALVNKD +FLK E  +PP WRQD NKGMV+  +GRWV 
Sbjct  424   LHLLDGYHGRGERFR-LNGRDYALVNKDCDFLKDEFEIPPNWRQDHNKGMVKNKEGRWVQ  482

Query  1535  PERSRIEAHPSDTGHHFRKV  1594
              ER+  + HP+D  HH  K+
Sbjct  483   QERAVHDDHPADMHHHLNKL  502



>ref|XP_008372307.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Malus 
domestica]
Length=512

 Score =   492 bits (1266),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 272/504 (54%), Positives = 329/504 (65%), Gaps = 35/504 (7%)
 Frame = +2

Query  134   TAKPSNSFFPLTLSSPQKPYSSLKCRDSLPAAIPE-------SSNKHdeeeedgddeegR  292
             ++ PS     ++  +P+  +S  K  DS  + I E       + N+   +      E  R
Sbjct  28    SSNPSKLTLSISTVAPRVLHS--KATDSFTSIIAELEKERAQNQNERKTDSNSTTHENER  85

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
              L + W E+ G  DW GLLDPMD  LR E+IRYGE AQACYD+FDFDP SKYCG+C++  
Sbjct  86    RLSDTWRELHGQDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFTR  145

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
               FFE LGMA  GY +SRY+YATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE   
Sbjct  146   RDFFESLGMAHHGYHVSRYIYATSNINLPNFFKKSRWPKVWSKNANWIGYVAVSDDET-T  204

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNSKKD  820
              RLGRRDI IAWRGTVT LEWI DL + L P         DP +K+ESGF DLYT+  KD
Sbjct  205   ARLGRRDISIAWRGTVTRLEWIVDLMDFLKPVSSNRIPCPDPTVKVESGFLDLYTD--KD  262

Query  821   TDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
               C FC YSAREQ+L E+ RL+E+Y  E LSIT+TGHSLG+ALA LSAYDI E  +NV  
Sbjct  263   EACRFCQYSAREQILTEMKRLVEKYSDEELSITITGHSLGSALAXLSAYDITETGLNVTS  322

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1180
                               +P+SV SFAGPRVGN+RFKER + LGIKVLR+VNV D VP  
Sbjct  323   --------------DGRGVPVSVLSFAGPRVGNVRFKERLESLGIKVLRVVNVHDVVPKS  368

Query  1181  PGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLH  1360
             PG+  NE       +  + +  PWSY HVGV+L LDH  SPFLK   D   AHNLE HLH
Sbjct  369   PGLFFNE--HVAPMVMKLXEGLPWSYTHVGVQLELDHKNSPFLKPTNDPVGAHNLEAHLH  426

Query  1361  LVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPE  1540
             L+DGYHG G RF  A+GRD ALVNK  +FLK  + VPP WRQDENKGMVR+ DGRW+ PE
Sbjct  427   LLDGYHGKGHRFVLASGRDPALVNKACDFLKDHYLVPPYWRQDENKGMVRSKDGRWIQPE  486

Query  1541  RSRIEA--HPSDTGHHFRKVLRLA  1606
             R +++   HP D  HH  K L LA
Sbjct  487   RPKLDDDHHPEDI-HHXXKQLGLA  509



>ref|XP_010038036.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Eucalyptus 
grandis]
Length=523

 Score =   492 bits (1267),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 254/440 (58%), Positives = 308/440 (70%), Gaps = 24/440 (5%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L ++W EI G  DW G+LDPMD  LR E+IRYGE AQACYD+FDF+P SKYCG+C+Y 
Sbjct  96    RRLSDVWREIHGEDDWVGMLDPMDPLLRSELIRYGEMAQACYDAFDFEPFSKYCGSCRYG  155

Query  470   GAQFFEKLGMADR-GYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEA  646
               +FFE+L M  R GY ++RYLYATSNINLPNFF  S   ++WS+HANW+GY+AV+ DE 
Sbjct  156   KQEFFERLDMKGRPGYDVTRYLYATSNINLPNFFMKSRWPKVWSKHANWIGYMAVSDDET  215

Query  647   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNSK  814
               RRLGRRDI +AWRGTVT LEW+ DL + L P   +     DP +K ESGF  LYT+  
Sbjct  216   -TRRLGRRDIAVAWRGTVTRLEWVADLMDFLVPVSSQRVPCPDPAVKAESGFLSLYTD--  272

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNV  994
             K+ DC F  YSAREQ+L EV RLIE+Y  E LSIT+TGHSLG+ALA+LSAYDIAE  +NV
Sbjct  273   KEDDCKFAKYSAREQILTEVKRLIEKYPDEELSITMTGHSLGSALAVLSAYDIAETGINV  332

Query  995   VQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVP  1174
              Q+                     VFSFAGPRVGN RFKER + LG+KVLR+VNV D VP
Sbjct  333   RQDSRAVPVC--------------VFSFAGPRVGNARFKERAEVLGVKVLRVVNVHDMVP  378

Query  1175  TVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1354
               PG++ NE+    + +  +    PWSY+HVG EL LDH  SPFLK   D  CAHNLE H
Sbjct  379   KSPGLVFNERLP--RAVMKLAGGLPWSYSHVGAELELDHERSPFLKPTGDPACAHNLEAH  436

Query  1355  LHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVV  1534
             LHL+DGYHG G+RF  A+GRD ALVNKD++FLK  H VPP WRQ  NKG+VR  +GRW+ 
Sbjct  437   LHLLDGYHGKGQRFVLASGRDPALVNKDADFLKDHHLVPPFWRQGHNKGLVRNHEGRWMQ  496

Query  1535  PERSRIEAHPSDTGHHFRKV  1594
             PER + E HP+   HH  ++
Sbjct  497   PERPKPEDHPAYMDHHVEQL  516



>ref|XP_009354875.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Pyrus 
x bretschneideri]
Length=512

 Score =   492 bits (1266),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 268/500 (54%), Positives = 330/500 (66%), Gaps = 34/500 (7%)
 Frame = +2

Query  134   TAKPSNSFFPLTLSSPQKPYSSLKCRDSLPAAIP-------ESSNKHdeeeedgddeegR  292
             T+ PS   F  +  +P+  +S  K  DS  + I        ++ N+   +      E  R
Sbjct  28    TSNPSKLTFSTSTVAPRVLHS--KDTDSFTSIIADLGKERAQNQNERQTDTNSTTHENER  85

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
              L + W E+ G  DW GLLDPMD  LR E+IRYGE AQACYD+FDFDP SKYCG+C++  
Sbjct  86    RLSDTWRELHGQDDWVGLLDPMDPILRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFPR  145

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
               FFE LGMA  GY +SRY++ATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE   
Sbjct  146   RDFFESLGMAHHGYHVSRYIFATSNINLPNFFKKSRWPKVWSKNANWIGYVAVSDDET-T  204

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNSKKD  820
              RLGRRDI IAWRGTVT LEWI DL + L P         DP +K+ESGF DLYT+  KD
Sbjct  205   ARLGRRDISIAWRGTVTRLEWIVDLMDFLKPVSSNRIPCPDPTLKVESGFLDLYTD--KD  262

Query  821   TDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
               C FC YSAREQ+L E+ RL+E+Y  E LSIT+TGHSLG+ALA+LSAYDI E  +NV  
Sbjct  263   ETCRFCQYSAREQILTEMKRLVEKYSDEELSITITGHSLGSALAILSAYDITETGLNVTS  322

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1180
                               +P+SV SFAGPRVGN+RFKER + LG+KVLR+VNV D VP  
Sbjct  323   --------------DGRGVPVSVLSFAGPRVGNVRFKERLESLGVKVLRVVNVHDVVPKS  368

Query  1181  PGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLH  1360
             PG+  NE      +L  + +  PWSY HVGV+L LDH +SPFLK   D   AHNLE HLH
Sbjct  369   PGLFFNE--HVAPRLMKLAEGLPWSYTHVGVQLELDHKHSPFLKPTNDPVGAHNLEAHLH  426

Query  1361  LVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPE  1540
             L+DGYHG G RF  A+GRD ALVNK  +FLK  + VPP WRQDENKGMVR+ DGRW+ PE
Sbjct  427   LLDGYHGKGHRFVLASGRDPALVNKACDFLKDHYLVPPYWRQDENKGMVRSKDGRWIQPE  486

Query  1541  RSRIEA--HPSDTGHHFRKV  1594
             R + +   HP D  HH +++
Sbjct  487   RPKFDDDHHPEDIHHHLKQL  506



>ref|XP_010274199.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X1 [Nelumbo nucifera]
Length=537

 Score =   491 bits (1264),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 253/439 (58%), Positives = 313/439 (71%), Gaps = 23/439 (5%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R + + W EI G  DW G+LDP+D  LR E+IRYGE AQACYD+FD+DP S+YCG+C++ 
Sbjct  112   RRIADFWREIHGQGDWTGMLDPIDPLLRSELIRYGEMAQACYDAFDYDPSSRYCGSCRFM  171

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
               +FF+ LGMA+ GY +SRYLYAT+NINLPNFF+ S   ++WS++ANW+GYVAV+ DE  
Sbjct  172   RRKFFDCLGMANFGYDVSRYLYATTNINLPNFFKKSRWPKVWSRNANWIGYVAVSNDETS  231

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  817
                LGRRDI IAWRGTVT LEWI DL + L P         DP +K+ESGF D+YT+  K
Sbjct  232   A-SLGRRDITIAWRGTVTRLEWIADLMDFLRPVSSDKIPCPDPSVKVESGFLDVYTD--K  288

Query  818   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  997
             D  C FC YSAREQ+L+EV RL ++Y  E LSIT+TGHSLG+ALA+LSAYDIAE  VNV 
Sbjct  289   DETCRFCKYSAREQILSEVKRLTQQYPDEELSITMTGHSLGSALAMLSAYDIAETGVNVT  348

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1177
                                +P++VFSF+GPRVGN+RFKER + LG+KVLR+VNV D VP 
Sbjct  349   --------------GDGRAVPVTVFSFSGPRVGNVRFKERVERLGVKVLRVVNVHDTVPK  394

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
             VPGI+ NE     + +  + +  PW Y+HVGVEL LDH +SPFL    D  C HNLE  L
Sbjct  395   VPGILFNE--HVPELVHRLAQWLPWCYSHVGVELTLDHKHSPFLNGTGDPSCFHNLEALL  452

Query  1358  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1537
             HL+DGYHG G+RF  ++GRD ALVNK S+FLK  + VPP WRQDENKGMVR  +GRWV P
Sbjct  453   HLLDGYHGKGQRFVLSSGRDPALVNKASDFLKDHYLVPPYWRQDENKGMVRNQEGRWVQP  512

Query  1538  ERSRIEAHPSDTGHHFRKV  1594
             ER + E HPSD  HH R++
Sbjct  513   ERPKHEDHPSDIHHHLRQL  531



>emb|CAN74039.1| hypothetical protein VITISV_012945 [Vitis vinifera]
Length=514

 Score =   489 bits (1260),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 257/424 (61%), Positives = 303/424 (71%), Gaps = 23/424 (5%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             + E W EI G  DW G+LDPMD  LR E+IRYGE AQACYD+FDFDP SKYCGTC++   
Sbjct  88    VSERWREIHGEDDWTGMLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGTCRFMPR  147

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             +FF+ LGMA  GY +SRYLYATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE   R
Sbjct  148   KFFDSLGMAGHGYDVSRYLYATSNINLPNFFKKSRWPKVWSKNANWIGYVAVSNDEKS-R  206

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSKKDT  823
              LGRRDI IAWRGTVT LEWI DL + L P    + P     +K+ESGF DLYT+  KD 
Sbjct  207   VLGRRDITIAWRGTVTRLEWIADLMDFLKPVSSENIPCPDRTVKVESGFLDLYTD--KDE  264

Query  824   DCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
              C FC +SAREQ+L EV RLIE Y  E LSIT TGHSLG ALA+LSAYD+AE  +NV+  
Sbjct  265   SCKFCKFSAREQILTEVKRLIEMYPDEELSITFTGHSLGGALAVLSAYDVAETGLNVLN-  323

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1183
                              +P+SV SF+GPRVGN+RFKER + LG+KVLR+VNV D VP  P
Sbjct  324   -------------NGRVLPVSVLSFSGPRVGNVRFKERLEGLGVKVLRVVNVHDVVPKSP  370

Query  1184  GIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1363
             G+  NE  Q    +  + +  PWSY+HVGVELALDH  SPFLK   D   AHNLE HLHL
Sbjct  371   GLFFNE--QVPAMVMKLAEGLPWSYSHVGVELALDHKNSPFLKQNADPISAHNLEAHLHL  428

Query  1364  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             +DGYHG G+RF  A+GRD ALVNK S+FLK  + VPP WRQDENKGMVR+SDGRWV PER
Sbjct  429   LDGYHGKGQRFVLASGRDPALVNKASDFLKDHYLVPPYWRQDENKGMVRSSDGRWVQPER  488

Query  1544  SRIE  1555
              + E
Sbjct  489   PKHE  492



>ref|XP_010679169.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=549

 Score =   489 bits (1258),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 251/433 (58%), Positives = 308/433 (71%), Gaps = 23/433 (5%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI G  +W GLLDPMDS LR E+IRYGE AQACYD FDFDP SKYCG+CKY    FF+
Sbjct  130   WREIHGEDEWVGLLDPMDSLLRAELIRYGEMAQACYDGFDFDPFSKYCGSCKYPRHSFFK  189

Query  488   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  667
              L M   GY ++RYLYATSNINLPNFF++S   ++WS++ANW+GYVAV+ DE   +RLGR
Sbjct  190   GLEMEAHGYEVTRYLYATSNINLPNFFKNSRWPKVWSKNANWIGYVAVSNDEMS-KRLGR  248

Query  668   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSKKDTDCNF  835
             RDI+I+WRGTVT LEW+HDL + L P    + P     +K ESGF DLYT+  KD +C +
Sbjct  249   RDIIISWRGTVTRLEWVHDLMDFLRPVSDENIPCPDRSVKAESGFLDLYTD--KDPNCKY  306

Query  836   CSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegege  1015
             C +SAREQ+L+EV RL E +  E +SI++TGHSLG+ALA+LSAYDIAE  ++V       
Sbjct  307   CKFSAREQILSEVKRLSELFHNEEISISITGHSLGSALAILSAYDIAETGIHV-------  359

Query  1016  gdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1195
                      +    PISVFSF+GPRVGN+RFKER +ELG+KVLR+VNV D VP  PG++ 
Sbjct  360   -------GPSTRSRPISVFSFSGPRVGNVRFKERLEELGVKVLRVVNVHDMVPKAPGLVF  412

Query  1196  NEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1375
             NE          + +  PWSY HVGVELALDH  SPF+K   D  CAHNLE HLHL+DGY
Sbjct  413   NEHL--PSDWMKIAQGLPWSYCHVGVELALDHKNSPFIKDTNDPSCAHNLEAHLHLLDGY  470

Query  1376  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIE  1555
             HG GRRF    GRDIALVNK  +FLK  + +PP WRQDEN+GMVR+ DGRW+  ER  ++
Sbjct  471   HGKGRRFHLTIGRDIALVNKACDFLKDHYQIPPFWRQDENRGMVRSKDGRWIQAERPILD  530

Query  1556  AHPSDTGHHFRKV  1594
              HP  T HH R++
Sbjct  531   DHPEYTHHHLRQL  543



>ref|XP_010087133.1| Phospholipase A1-Igamma1 [Morus notabilis]
 gb|EXB26573.1| Phospholipase A1-Igamma1 [Morus notabilis]
Length=505

 Score =   487 bits (1253),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 257/441 (58%), Positives = 311/441 (71%), Gaps = 25/441 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L ++W+EI G  +W GLLDPMD  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  75    RRLADVWSEIHGQDEWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFI  134

Query  470   GAQFFEKLGMAD--RGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDE  643
               +FFE L M+   + Y +SRYLYATSNINL NFF+ S   ++WS++ANW+GYVAV++DE
Sbjct  135   RRKFFESLEMSSTHQNYDVSRYLYATSNINLANFFKKSRWPKVWSKNANWIGYVAVSSDE  194

Query  644   AEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNS  811
             A  R LGRRDI +AWRGTVT+LEWI DL + L P         D ++K ESGF DLYTN 
Sbjct  195   AS-RTLGRRDITVAWRGTVTHLEWISDLMDFLRPISANRIPCPDSNVKAESGFLDLYTN-  252

Query  812   KKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVN  991
              KD  C FC YSAREQ+L EV RL+E Y GE LSIT+TGHSLGAALA+LSAYDIAE  +N
Sbjct  253   -KDETCRFCKYSAREQILTEVKRLMEIYSGEELSITITGHSLGAALAILSAYDIAETGLN  311

Query  992   VVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKV  1171
             V               +    +P+SVFSF+GPRVGN RFKER + LG+KVLR+VN  D V
Sbjct  312   VA--------------ADGRVVPVSVFSFSGPRVGNSRFKERLEWLGVKVLRVVNAHDVV  357

Query  1172  PTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1351
             P  PG++ NE       L  M +  PWSY+HVGV L LDH  SPFLK   DL C HNLE 
Sbjct  358   PKSPGLVFNE--CAPAMLMKMAEGLPWSYSHVGVGLELDHCNSPFLKPTKDLVCTHNLEA  415

Query  1352  HLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
              LHL+DGYHG G RF  A+GRD ALVNK S+FLK  + VPP WRQ+ENKGMVR  DGRW+
Sbjct  416   LLHLLDGYHGKGHRFVLASGRDPALVNKASDFLKEHYLVPPYWRQNENKGMVRHKDGRWI  475

Query  1532  VPERSRIEAHPSDTGHHFRKV  1594
              PER +++ HP D   H +++
Sbjct  476   QPERPKLDDHPDDIHRHLKQI  496



>ref|XP_006443915.1| hypothetical protein CICLE_v10019700mg [Citrus clementina]
 ref|XP_006479594.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Citrus 
sinensis]
 gb|ESR57155.1| hypothetical protein CICLE_v10019700mg [Citrus clementina]
 gb|KDO68539.1| hypothetical protein CISIN_1g009776mg [Citrus sinensis]
Length=526

 Score =   488 bits (1255),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 251/439 (57%), Positives = 312/439 (71%), Gaps = 23/439 (5%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L ++W EI G  DW G++DPMD  LR E+IRYGE AQA YD+FDFDP SKYCG+C++ 
Sbjct  99    RKLGDVWREIHGQDDWVGMIDPMDPILRSELIRYGEMAQASYDAFDFDPFSKYCGSCRFM  158

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
               +FF  L M+  GY +SRYLYATSNINLPNFF+ S   ++WS++ANWMGYVAV+ DE  
Sbjct  159   QREFFNSLEMSHHGYDVSRYLYATSNINLPNFFKKSRWPKMWSKNANWMGYVAVSNDET-  217

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  817
              +RLGRRDI IAWRGTVT LEWI DL + L P         DP +K ESGF DLYT+  K
Sbjct  218   TKRLGRRDITIAWRGTVTRLEWIADLMDFLKPFSNNKIPCPDPTVKAESGFLDLYTD--K  275

Query  818   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  997
             D  C FC +SAREQ+L EV RL+E Y  E++SITVTGHSLG+ALA+LSAYDI E  +NV+
Sbjct  276   DVTCRFCKFSAREQILTEVKRLLELYYDEDVSITVTGHSLGSALAILSAYDIVETGINVL  335

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1177
             +               +  +P+ V+SF+GPRVGN+RFKER + LG+KVLR++NV D VP 
Sbjct  336   R--------------DSRAVPVCVYSFSGPRVGNVRFKERIEILGLKVLRVINVHDVVPK  381

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
              PG + NE       L  M + FPWSY+HVGVELALDH  SPFL    D  CAHNLE  L
Sbjct  382   TPGFLFNE--NVSPVLMKMAEGFPWSYSHVGVELALDHKNSPFLNPAADPTCAHNLEALL  439

Query  1358  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1537
             HL+DGYHG G RF  A+GRD ALVNK S+FLK  + VPP WRQ++NKG+VR+ DGRWV P
Sbjct  440   HLLDGYHGKGHRFVLASGRDPALVNKASDFLKDHYLVPPYWRQNQNKGLVRSKDGRWVQP  499

Query  1538  ERSRIEAHPSDTGHHFRKV  1594
             ER +++ HP +  +H +++
Sbjct  500   ERPKLDDHPPNIHNHLKQL  518



>ref|XP_006410159.1| hypothetical protein EUTSA_v10016488mg [Eutrema salsugineum]
 gb|ESQ51612.1| hypothetical protein EUTSA_v10016488mg [Eutrema salsugineum]
Length=539

 Score =   486 bits (1251),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 255/439 (58%), Positives = 309/439 (70%), Gaps = 25/439 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L + W +IQG  DW GL+DPMD  LR E+IRYGE AQACYD+FDFDP S+YCG+ ++ 
Sbjct  109   RRLRDTWRKIQGEDDWAGLIDPMDPVLRSELIRYGEMAQACYDAFDFDPSSRYCGSSRFS  168

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
                FF+ LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DEA 
Sbjct  169   RHDFFDSLGIFDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEAT  228

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  817
               RLGRRDI IAWRGTVT LEWI DLK+ L P    +    DP +K+ESGF DLYT+  K
Sbjct  229   RNRLGRRDIAIAWRGTVTRLEWIADLKDYLKPVSGNNLRCPDPAVKVESGFLDLYTD--K  286

Query  818   DTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMKV  988
             DT C F  +SAREQ+LAEV RL+E+Y   + E LSITVTGHSLG ALA+LSAYD+AEM +
Sbjct  287   DTTCRFARFSAREQILAEVKRLVEKYGDDEDEELSITVTGHSLGGALAILSAYDVAEMGL  346

Query  989   NVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDK  1168
             N               + +   IP++V ++ GPRVGNLRFKER +ELG+KV+R+VNV D 
Sbjct  347   N--------------RSRSGKVIPVTVLTYGGPRVGNLRFKERIEELGVKVMRVVNVHDV  392

Query  1169  VPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLE  1348
             VP  PG+  NE   +   L  + +  PW Y HVG ELALDH  SPFLK+  DL  AHNLE
Sbjct  393   VPKSPGLFLNESVPH--ALMKIAEGLPWCYCHVGEELALDHQNSPFLKSSVDLSNAHNLE  450

Query  1349  GHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRW  1528
               LHL+DGYHG G RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMVR S+GRW
Sbjct  451   AMLHLLDGYHGKGERFVLSSGRDPALVNKASDFLKEHFMVPPFWRQDANKGMVRNSEGRW  510

Query  1529  VVPERSRIEAHPSDTGHHF  1585
             +  ER R E H S   HH+
Sbjct  511   IQAERLRSEDHHSPDIHHY  529



>ref|XP_009119028.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Brassica 
rapa]
Length=546

 Score =   486 bits (1250),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 255/440 (58%), Positives = 310/440 (70%), Gaps = 26/440 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             ++L + W +IQG  DW GL+DPMD  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  117   KSLRDTWRKIQGEDDWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFT  176

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATD-EA  646
               + F+ LG+ D GY  +RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D EA
Sbjct  177   RKKLFDSLGIFDSGYEAARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDSEA  236

Query  647   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH---FR-DDPDIKIESGFFDLYTNSK  814
                RLGRRDI IAWRGTVT LEWI DLK+ L P     FR  DP +K ESGF DLYT+  
Sbjct  237   TRHRLGRRDIAIAWRGTVTQLEWIADLKDFLKPVSGNGFRCRDPAVKAESGFLDLYTD--  294

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  985
             KDT CNF  +SAREQLL EV RL+ERY   +G++LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  295   KDTSCNFSKFSAREQLLTEVKRLVERYGDEEGDDLSITVTGHSLGGALAVLSAYDVAEMG  354

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
             +N  +                  +P++VF+++ PRVGN+RFKER +ELG+KVLR+VN  D
Sbjct  355   LNRTK--------------KGKVVPVTVFTYSAPRVGNIRFKERMEELGVKVLRVVNKHD  400

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              VP  PG+  NE       L+ +    PW Y HVG +LALDH  SPFLK   DL  AHNL
Sbjct  401   VVPKSPGLFLNE--HAPDALKQLAGGLPWCYCHVGEKLALDHQNSPFLKPSVDLSTAHNL  458

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGR  1525
             E  LHL+DGYHG G+RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMVR +DGR
Sbjct  459   EALLHLLDGYHGKGQRFVLSSGRDPALVNKASDFLKDHFMVPPYWRQDANKGMVRHTDGR  518

Query  1526  WVVPERSRIEAHPSDTGHHF  1585
             W+ P+R R E H +   HH 
Sbjct  519   WIQPDRIRAEDHHAPDIHHL  538



>emb|CDY29665.1| BnaA04g17620D [Brassica napus]
Length=523

 Score =   484 bits (1245),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 257/446 (58%), Positives = 311/446 (70%), Gaps = 26/446 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L + W +IQG  DW GL DPMD  LR E+IRYGE AQACYD+FDFDP S+YCG+ ++ 
Sbjct  93    RRLRDTWRKIQGEDDWAGLTDPMDPVLRSELIRYGEMAQACYDAFDFDPSSRYCGSSRFS  152

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
               +FF+ LGM   GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DEA 
Sbjct  153   RHEFFDSLGMKGSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEAA  212

Query  650   IR-RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  814
              R RLGRRDI IAWRGTVT LEWI DLK+ L P +  +    DP +K+ESGF DLYT+  
Sbjct  213   TRQRLGRRDIAIAWRGTVTRLEWIADLKDYLKPVYRNNLRCPDPAVKVESGFLDLYTD--  270

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  985
             KDT C F  +SAREQ+LAEV RL+ERY   + E LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  271   KDTSCKFSRFSAREQVLAEVKRLVERYGDDEEEELSITVTGHSLGGALAILSAYDVAEMG  330

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
             +N               + +   IP++V ++ GPRVGN+RFKER  ELG+KV+R+VNV D
Sbjct  331   LN--------------RSRSGKVIPVTVLTYGGPRVGNVRFKERLKELGVKVMRVVNVHD  376

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              VP  PG+  NE+  +   +  + +  PW Y HVG ELALDH  SPFLK+  D   AHNL
Sbjct  377   VVPKSPGLFLNERAPH--AVMKIAEGLPWCYCHVGEELALDHQNSPFLKSSVDPSNAHNL  434

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGR  1525
             E  LHL+DGYHG G RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMVR S+GR
Sbjct  435   EALLHLLDGYHGKGERFVLSSGRDPALVNKASDFLKEHFMVPPFWRQDANKGMVRNSEGR  494

Query  1526  WVVPERSRIEAHPSDTGHHFRKVLRL  1603
             W+  ER R E H S   HH    LRL
Sbjct  495   WIQAERLRSEDHHSPDIHHHLSQLRL  520



>ref|NP_565701.1| phospholipase A1-Igamma2 [Arabidopsis thaliana]
 sp|Q3EBR6.2|PLA16_ARATH RecName: Full=Phospholipase A1-Igamma2, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAB63082.2| putative lipase [Arabidopsis thaliana]
 gb|AAM14092.1| putative lipase [Arabidopsis thaliana]
 gb|AAM63231.1| putative lipase [Arabidopsis thaliana]
 gb|AAN13163.1| putative lipase [Arabidopsis thaliana]
 gb|AEC08407.1| phospholipase A1-Igamma2 [Arabidopsis thaliana]
Length=529

 Score =   484 bits (1245),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 254/445 (57%), Positives = 308/445 (69%), Gaps = 25/445 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L + W +IQG  DW GL+DPMD  LR E+IRYGE AQACYD+FDFDP SKYCGT ++ 
Sbjct  99    RRLRDTWRKIQGEDDWAGLMDPMDPILRSELIRYGEMAQACYDAFDFDPASKYCGTSRFT  158

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
               +FF+ LGM D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE  
Sbjct  159   RLEFFDSLGMIDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETS  218

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  817
               RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  K
Sbjct  219   RNRLGRRDIAIAWRGTVTKLEWIADLKDYLKPVTENKIRCPDPAVKVESGFLDLYTD--K  276

Query  818   DTDCNFCSYSAREQLLAEVNRLIERYKGE---NLSITVTGHslgaalallsaYDIAEMKV  988
             DT C F  +SAREQ+L EV RL+E +  +   +LSITVTGHSLG ALA+LSAYDIAEM++
Sbjct  277   DTTCKFARFSAREQILTEVKRLVEEHGDDDDSDLSITVTGHSLGGALAILSAYDIAEMRL  336

Query  989   NVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDK  1168
             N               +     IP++V ++ GPRVGN+RF+ER +ELG+KV+R+VNV D 
Sbjct  337   N--------------RSKKGKVIPVTVLTYGGPRVGNVRFRERMEELGVKVMRVVNVHDV  382

Query  1169  VPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLE  1348
             VP  PG+  NE   +   L  + +  PW Y+HVG ELALDH  SPFLK   D+  AHNLE
Sbjct  383   VPKSPGLFLNESRPH--ALMKIAEGLPWCYSHVGEELALDHQNSPFLKPSVDVSTAHNLE  440

Query  1349  GHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRW  1528
               LHL+DGYHG G RF  ++GRD ALVNK S+FLK    +PP WRQD NKGMVR S+GRW
Sbjct  441   AMLHLLDGYHGKGERFVLSSGRDHALVNKASDFLKEHLQIPPFWRQDANKGMVRNSEGRW  500

Query  1529  VVPERSRIEAHPSDTGHHFRKVLRL  1603
             +  ER R E H S   HH    LRL
Sbjct  501   IQAERLRFEDHHSPDIHHHLSQLRL  525



>ref|XP_002879267.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55526.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=530

 Score =   484 bits (1245),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 256/445 (58%), Positives = 307/445 (69%), Gaps = 25/445 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L + W +IQG  DW GL+DPMD  LR E+IRYGE AQACYD+FDFDP SKYCGT ++ 
Sbjct  100   RRLRDTWRKIQGEDDWAGLIDPMDPILRSELIRYGEMAQACYDAFDFDPASKYCGTSRFS  159

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
                FF+ LGM D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE  
Sbjct  160   RLDFFDSLGMIDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETS  219

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  817
               RLGRRDI IAWRGTVT LEWI DLK+ L P    +    DP +K+ESGF DLYT+  K
Sbjct  220   RNRLGRRDIAIAWRGTVTKLEWIADLKDYLKPVSGNNIRCPDPAVKVESGFLDLYTD--K  277

Query  818   DTDCNFCSYSAREQLLAEVNRLIERYKGE---NLSITVTGHslgaalallsaYDIAEMKV  988
             DT C F  +SAREQ+L EV RL+E Y  +   +LSITVTGHSLG ALA+LSAYDIAEM +
Sbjct  278   DTTCKFAKFSAREQILTEVKRLVEIYGDDDDSDLSITVTGHSLGGALAMLSAYDIAEMGL  337

Query  989   NVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDK  1168
             N               +     IP++V ++ GPRVGN+RFK+R +ELG+KVLR+VNV D 
Sbjct  338   N--------------RSKNGKVIPVTVLTYGGPRVGNVRFKDRMEELGVKVLRVVNVHDV  383

Query  1169  VPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLE  1348
             VP  PG+  NE   +   L  + +  PW Y+HVG ELALDH  SPFLK   DL  +HNLE
Sbjct  384   VPKSPGLFLNESRPH--ALMKIAEGLPWCYSHVGEELALDHQNSPFLKPSVDLSTSHNLE  441

Query  1349  GHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRW  1528
               LHL+DGYHG G RF  ++GRD ALVNK S+FLK    +PP WRQD NKGMVR S+GRW
Sbjct  442   AMLHLLDGYHGKGERFVLSSGRDHALVNKASDFLKEHLQIPPFWRQDANKGMVRNSEGRW  501

Query  1529  VVPERSRIEAHPSDTGHHFRKVLRL  1603
             +  ER R E H S   HH    LRL
Sbjct  502   IQAERLRSEDHHSPDIHHHLSQLRL  526



>ref|XP_009141072.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic [Brassica 
rapa]
Length=523

 Score =   483 bits (1242),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 257/446 (58%), Positives = 311/446 (70%), Gaps = 26/446 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L + W +IQG  DW GL DPMD  LR E+IRYGE AQACYD+FDFDP S+YCG+ ++ 
Sbjct  93    RRLRDTWRKIQGEDDWAGLTDPMDPVLRSELIRYGEMAQACYDAFDFDPSSRYCGSSRFS  152

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
               +FF+ LGM   GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DEA 
Sbjct  153   RHEFFDSLGMKGSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEAA  212

Query  650   IR-RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  814
              R RLGRRDI IAWRGTVT LEWI DLK+ L P +  +    DP +K+ESGF DLYT+  
Sbjct  213   TRHRLGRRDIAIAWRGTVTRLEWIADLKDYLKPVYRNNLRCPDPAVKVESGFLDLYTD--  270

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  985
             KDT C F  +SAREQ+LAEV RL+ERY   + E LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  271   KDTSCKFSRFSAREQVLAEVKRLVERYGDDEEEELSITVTGHSLGGALAILSAYDVAEMG  330

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
             +N               + +   IP++V ++ GPRVGN+RFKER  ELG+KV+R+VNV D
Sbjct  331   LN--------------RSRSGKVIPVTVLTYGGPRVGNVRFKERLKELGVKVMRVVNVHD  376

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              VP  PG+  NE+  +   +  + +  PW Y HVG ELALDH  SPFLK+  D   AHNL
Sbjct  377   VVPKSPGLFLNERAPH--AVMKIAEGLPWCYCHVGEELALDHQNSPFLKSSVDPSNAHNL  434

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGR  1525
             E  LHL+DGYHG G RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMVR S+GR
Sbjct  435   EALLHLLDGYHGKGERFVLSSGRDPALVNKASDFLKEHFMVPPFWRQDANKGMVRNSEGR  494

Query  1526  WVVPERSRIEAHPSDTGHHFRKVLRL  1603
             W+  ER R E H S   HH    LRL
Sbjct  495   WIQAERLRSEDHHSPDIHHHLSQLRL  520



>gb|KFK42995.1| hypothetical protein AALP_AA1G065900 [Arabis alpina]
Length=507

 Score =   482 bits (1240),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 255/442 (58%), Positives = 309/442 (70%), Gaps = 28/442 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             ++L + W +IQG  DW GLL+PMD  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  76    KSLRDTWRKIQGEDDWAGLLNPMDPVLRSELIRYGELAQACYDAFDFDPFSKYCGSCRFT  135

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATD-EA  646
               + F+ LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D E+
Sbjct  136   RHKLFDSLGIFDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDVES  195

Query  647   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH---FR-DDPDIKIESGFFDLYTNSK  814
               RRLGRRDI IAWRGTVT LEWI DLK+ L P     FR  DP +K ESGF DLYT+  
Sbjct  196   TRRRLGRRDIAIAWRGTVTRLEWIADLKDFLKPVSGNGFRCSDPAVKAESGFLDLYTD--  253

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERYKGE-----NLSITVTGHslgaalallsaYDIAE  979
             KDT CNF  +SAREQ+L EV RL+E+Y  E     +LSITVTGHSLG ALA+LSAYD+AE
Sbjct  254   KDTSCNFSKFSAREQVLTEVKRLVEKYGDEEDGGLDLSITVTGHSLGGALAVLSAYDVAE  313

Query  980   MKVNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNV  1159
             M +N  +                  IP++VF++ GPRVGN+RFKER +ELG+KVLR+VN 
Sbjct  314   MGLNRTK--------------RGKVIPVTVFTYGGPRVGNVRFKERMEELGVKVLRVVNE  359

Query  1160  RDKVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAH  1339
              D VP  PG+  NE+  +   L  +    PW Y HVG EL LDH  SPFLK   DL  AH
Sbjct  360   HDVVPKSPGLFLNERAPH--ALMKLAGGLPWCYCHVGEELPLDHRNSPFLKGSVDLSTAH  417

Query  1340  NLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSD  1519
             NLE  LHL+DGYHG G RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMVR +D
Sbjct  418   NLEALLHLLDGYHGKGERFVLSSGRDPALVNKASDFLKEHFMVPPNWRQDANKGMVRNND  477

Query  1520  GRWVVPERSRIEAHPSDTGHHF  1585
             GRW+ P+R R E H +   HH 
Sbjct  478   GRWIQPDRIRAEDHHAPDIHHL  499



>emb|CDX97819.1| BnaC04g41200D [Brassica napus]
Length=491

 Score =   481 bits (1237),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 256/445 (58%), Positives = 308/445 (69%), Gaps = 25/445 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L + W +IQG  DW GL DPMD  LR E+IRYGE AQACYD+FDFDP S+YCG+ ++ 
Sbjct  62    RRLRDTWRKIQGEDDWAGLTDPMDPVLRSELIRYGEMAQACYDAFDFDPSSRYCGSSRFS  121

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
               +FF+ LGM   GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DEA 
Sbjct  122   RHEFFDSLGMKGSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEAT  181

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  817
               RLGRRDI IAWRGTVT LEWI DLK+ L P    +    DP +K+ESGF DLYT+  K
Sbjct  182   RHRLGRRDIAIAWRGTVTQLEWIADLKDYLKPVSGNNLRCPDPAVKVESGFLDLYTD--K  239

Query  818   DTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMKV  988
             DT C F  +SAREQ+LAEV RL+ERY   + E LSITVTGHSLG ALA+LSAYD+AEM +
Sbjct  240   DTSCKFSRFSAREQVLAEVKRLVERYGDDEDEELSITVTGHSLGGALAILSAYDVAEMGL  299

Query  989   NVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDK  1168
             N               + +   IP++V ++ GPRVGN+RFKER  ELG+KV+R+VNV D 
Sbjct  300   N--------------RSRSGKVIPVTVLTYGGPRVGNVRFKERLKELGVKVMRVVNVHDV  345

Query  1169  VPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLE  1348
             VP  PG+  NE+  +   +  + +  PW Y HVG ELALDH  SPFLK+  D   AHNLE
Sbjct  346   VPKSPGLFLNERAPH--AVMKIAEGLPWCYCHVGEELALDHQNSPFLKSSVDPSNAHNLE  403

Query  1349  GHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRW  1528
               LHL+DGYHG G RF  + GRD ALVNK S+FLK    VPP WRQD NKGMVR S+GRW
Sbjct  404   ALLHLLDGYHGKGERFVLSNGRDPALVNKASDFLKEHFMVPPFWRQDANKGMVRNSEGRW  463

Query  1529  VVPERSRIEAHPSDTGHHFRKVLRL  1603
             +  ER R E H S   HH    LRL
Sbjct  464   IQAERLRSEDHHSPDIHHHLSQLRL  488



>gb|ACJ76846.1| chloroplast lipase protein [Brassica napus]
Length=513

 Score =   481 bits (1239),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 253/440 (58%), Positives = 310/440 (70%), Gaps = 26/440 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             ++L + W +IQG  DW GL+DPMD  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  84    KSLRDTWRKIQGEDDWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  143

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATD-EA  646
               + F+ LG+ D GY  +RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D EA
Sbjct  144   RKKLFDSLGIFDSGYEAARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDSEA  203

Query  647   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH---FR-DDPDIKIESGFFDLYTNSK  814
                RLGRRDI IAWRGTVT LEWI DLK+ L P     FR  DP +K ESGF DLYT+  
Sbjct  204   TRHRLGRRDIAIAWRGTVTQLEWIADLKDFLKPVSGNGFRCRDPAVKAESGFLDLYTD--  261

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  985
             KDT CNF  +SAREQLL EV RL+ERY   +G +LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  262   KDTSCNFSKFSAREQLLTEVKRLVERYGDEEGGDLSITVTGHSLGGALAVLSAYDVAEMG  321

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
             +N  +                  +P++VF+++ PRVGN+RFKER +ELG+KVLR+VN  D
Sbjct  322   LNRTK--------------NGKVVPVTVFTYSAPRVGNIRFKERMEELGVKVLRVVNKHD  367

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              VP  PG+  NE   +   L+ +    PW Y HVG +LALDH  SPFLK   D+  AHNL
Sbjct  368   VVPKSPGLFLNEHAPH--ALKQLAGGLPWCYCHVGEKLALDHQNSPFLKPSVDISTAHNL  425

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGR  1525
             E  LHL+DGYHG G+RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMVR +DGR
Sbjct  426   EALLHLLDGYHGKGQRFVLSSGRDPALVNKASDFLKDHFMVPPYWRQDANKGMVRHTDGR  485

Query  1526  WVVPERSRIEAHPSDTGHHF  1585
             W+ P+R R E H +   HH 
Sbjct  486   WIQPDRIRAEDHHAPDIHHL  505



>emb|CDY10228.1| BnaC05g04710D [Brassica napus]
Length=513

 Score =   481 bits (1239),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 252/440 (57%), Positives = 308/440 (70%), Gaps = 26/440 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             ++L + W +IQG  DW GL+DPMD  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  84    KSLRDTWRKIQGEDDWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  143

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATD-EA  646
               + F+ LG+ D GY  +RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D EA
Sbjct  144   RKKLFDSLGIFDSGYEAARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDSEA  203

Query  647   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  814
                RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K ESGF DLYT+  
Sbjct  204   TRHRLGRRDIAIAWRGTVTQLEWIADLKDFLKPVSGNGFQCRDPAVKAESGFLDLYTD--  261

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  985
             KDT CNF  +SAREQLL EV RL+ERY   +G +LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  262   KDTSCNFSKFSAREQLLTEVKRLVERYGDEEGVDLSITVTGHSLGGALAVLSAYDVAEMG  321

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
             +N  +                  +P++VF+++ PRVGN+RFKER +ELG+KVLR+VN  D
Sbjct  322   LNRTK--------------KGKVVPVTVFTYSAPRVGNIRFKERMEELGVKVLRVVNKHD  367

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              VP  PG+  NE   +   L+ +    PW Y HVG +LALDH  SPFLK   DL  AHNL
Sbjct  368   VVPKSPGLFLNEHAPH--ALKQLAGGLPWCYCHVGEKLALDHQNSPFLKPSVDLSTAHNL  425

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGR  1525
             E  LHL+DGYHG G+RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMVR +DGR
Sbjct  426   EALLHLLDGYHGKGQRFVLSSGRDPALVNKASDFLKDHFMVPPYWRQDANKGMVRHTDGR  485

Query  1526  WVVPERSRIEAHPSDTGHHF  1585
             W+ P+R R E H +   HH 
Sbjct  486   WIQPDRIRAEDHHAPDIHHL  505



>ref|XP_010927018.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Elaeis 
guineensis]
Length=523

 Score =   481 bits (1238),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 256/439 (58%), Positives = 305/439 (69%), Gaps = 25/439 (6%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L + W EI GS DW GLLDPMD  LR E+IRYGEFAQACYD FD+DP S+YCG+CKY+  
Sbjct  98    LADRWREIHGSDDWAGLLDPMDPLLRSELIRYGEFAQACYDGFDYDPFSRYCGSCKYNRR  157

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             +FF  LGM + GY I+RYLYATSN+NL NFF  +  ++ WSQ ANW+GY+AV+ D+A   
Sbjct  158   KFFGSLGMDNAGYEITRYLYATSNLNLSNFFTQTRGSKTWSQKANWIGYIAVSDDDATA-  216

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNSKKDT  823
             RLGRRDIVIAWRGTVT LEW+ DL + L P         +P++K+ESGF DLYT+  KD 
Sbjct  217   RLGRRDIVIAWRGTVTRLEWVADLMDFLRPVASEGIPCSNPEVKVESGFLDLYTD--KDP  274

Query  824   DCNFCSYSAREQLLAEVNRLIER--YKGENLSITVTGHslgaalallsaYDIAEMKVNVV  997
              C FC YSAR+Q+L EV RL+E+    GE +SITVTGHSLG+ALA+LSAYDIAE   +V 
Sbjct  275   TCRFCKYSARQQVLTEVRRLVEQCTKAGETVSITVTGHSLGSALAMLSAYDIAETGQDV-  333

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1177
                               K+ I+VFSF+GPRVGN RFKER + LG+K LR+VNV D VP 
Sbjct  334   -------------GVDGEKVAITVFSFSGPRVGNGRFKERFEGLGVKALRVVNVHDTVPK  380

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
             VPGI+ NE            +  PWSY+HVGVELALDH  SPFLK   D  C HNLE HL
Sbjct  381   VPGILFNE--HVPAFFRKFAEGLPWSYSHVGVELALDHKRSPFLKDTGDPSCFHNLEAHL  438

Query  1358  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1537
             HL+DGYHG G RF  A+ RD ALVNK  +FLK    VPP WRQDENKGM+R  DGRWV P
Sbjct  439   HLLDGYHGSGVRFFLASKRDPALVNKACDFLKDHLMVPPFWRQDENKGMIRAHDGRWVQP  498

Query  1538  ERSRIEAHPSDTGHHFRKV  1594
             ER +I+ HP D  HH  ++
Sbjct  499   ERQKIDDHPPDMHHHIGRL  517



>ref|XP_010522024.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Tarenaya 
hassleriana]
Length=528

 Score =   481 bits (1237),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 255/445 (57%), Positives = 311/445 (70%), Gaps = 26/445 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             + L + W ++ G  DW GLLDPMD  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  100   KRLRDTWRKVHGEDDWVGLLDPMDPVLRSELIRYGELAQACYDAFDFDPFSRYCGSCRFT  159

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
               +FFE LGMAD GY ++RYLYATSNINLPNFF+ S   ++WS++ANWMGYVAV+ DE  
Sbjct  160   RHKFFESLGMADCGYTVARYLYATSNINLPNFFKRSRWPKVWSKNANWMGYVAVSDDETS  219

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  817
               RLGRRDI +AWRGTVT LEWI DL + L P    +    DP  K ESGF DLYT+  K
Sbjct  220   RNRLGRRDIAVAWRGTVTRLEWIADLMDYLKPVTGNNLRCPDPGAKAESGFLDLYTD--K  277

Query  818   DTDCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVN  991
             D  CNF  +SAREQ+L EV R++E +    E +SITVTGHSLG ALA+LSAYDIAEM +N
Sbjct  278   DEACNFSKFSAREQILTEVKRMVEMHGDGNEEMSITVTGHSLGGALAILSAYDIAEMGLN  337

Query  992   VVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKV  1171
               +              +   +P++VF++AGPRVGN+RFKER +ELG+KVLR+VNV D V
Sbjct  338   RTR--------------SGRVLPVTVFTYAGPRVGNVRFKERMEELGVKVLRVVNVHDVV  383

Query  1172  PTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1351
             P  PG+  NE+  +   L  M +  PW Y+HVG ELALDH  SPFLK   D   AHNLE 
Sbjct  384   PKSPGLFLNERAPH--ALMKMAEGLPWCYSHVGCELALDHQNSPFLKPSVDPSNAHNLEA  441

Query  1352  HLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
              LHL+DGYHG G+RF  A+GRD ALVNK S+FLK    +PP WRQD NKGMVR  +GRW+
Sbjct  442   LLHLLDGYHGKGQRFVLASGRDPALVNKASDFLKDHFMIPPFWRQDANKGMVRNHEGRWI  501

Query  1532  VPERSRIEA-HPSDTGHHFRKVLRL  1603
              PER R+E  HP D   H  + LRL
Sbjct  502   QPERLRVEDHHPPDIHLHLSQ-LRL  525



>ref|XP_010469840.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=551

 Score =   481 bits (1237),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 254/444 (57%), Positives = 306/444 (69%), Gaps = 26/444 (6%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L + W +IQG  DW GL++PMD  LR E+IRYGE AQACYD+FDFDP SKYCG+ ++   
Sbjct  122   LIDTWRKIQGEDDWAGLMEPMDPVLRSELIRYGEMAQACYDAFDFDPASKYCGSSRFSRL  181

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             +FF+ LGM+  GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE    
Sbjct  182   EFFDSLGMSGSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETSRN  241

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  823
             RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  KDT
Sbjct  242   RLGRRDIAIAWRGTVTKLEWIADLKDYLKPVSENKIRCPDPAVKVESGFLDLYTD--KDT  299

Query  824   DCNFCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVN  991
              C F  +SAREQ+LAEV RL+E Y       +LSITVTGHSLG ALA+LSAYDIAEM +N
Sbjct  300   SCKFAKFSAREQILAEVKRLVETYDDEDDDCDLSITVTGHSLGGALAILSAYDIAEMGLN  359

Query  992   VVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKV  1171
                            + +   IP++V ++ GPRVGN+RFKER +ELG+KV+R+VNV D V
Sbjct  360   --------------RSKSGKVIPVTVLTYGGPRVGNVRFKERMEELGVKVMRVVNVHDMV  405

Query  1172  PTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1351
             P  PG+  NE     + L  + +  PW Y HVG ELALDH  SPFLK   DL  AHNLE 
Sbjct  406   PKSPGLFLNE--SAPQALMKIAEGLPWCYCHVGEELALDHQNSPFLKPSVDLSNAHNLEA  463

Query  1352  HLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
              LHL+DGYHG G RF  ++GRD ALVNK S+FLK    +PP WRQD NKGMVR S+GRW+
Sbjct  464   MLHLLDGYHGKGERFVLSSGRDHALVNKASDFLKEHLQIPPFWRQDANKGMVRNSEGRWI  523

Query  1532  VPERSRIEAHPSDTGHHFRKVLRL  1603
               ER R E H S   HH    LRL
Sbjct  524   QAERLRSEDHHSPDIHHHLSQLRL  547



>ref|XP_010278159.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Nelumbo 
nucifera]
Length=525

 Score =   479 bits (1234),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 246/431 (57%), Positives = 307/431 (71%), Gaps = 23/431 (5%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             + + + W EIQG  DW GLLDPMD  LR E+IRYG+ AQACYD+FDFD  SKYCG+C++ 
Sbjct  100   KRIADCWREIQGQDDWAGLLDPMDPLLRSELIRYGDMAQACYDAFDFDSFSKYCGSCRFT  159

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
               +FF+ LG+   GY +SRYLY+T+NINLPNFF+ S   ++WS++ANWMGYVAV+ D+  
Sbjct  160   RRKFFDCLGLTSLGYDVSRYLYSTANINLPNFFKKSRWPKVWSRNANWMGYVAVSNDDTS  219

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  817
               RLGRRDI +AWRGTVT LEW+ DL + L P         DP+ K+ESGF DLYT+  K
Sbjct  220   A-RLGRRDIAVAWRGTVTRLEWVADLMDFLRPVSADKIPCPDPNAKVESGFLDLYTD--K  276

Query  818   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  997
             D  C FC +SAREQ+L E+ R I++Y  E LSITVTGHSLG+ALA+LSAYDI E  +NV 
Sbjct  277   DDKCRFCKFSAREQVLTEIKRSIQQYPNEELSITVTGHSLGSALAILSAYDIEETGLNVT  336

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1177
                           +    IP++VFSF+GPRVGN+RFKER + LG+KVLR+ NV D VP 
Sbjct  337   --------------ADGRIIPVTVFSFSGPRVGNVRFKERVEGLGVKVLRVFNVHDSVPK  382

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
             VPGI+ NE     + ++ ML+  PW+Y+HVGVEL LDH  SPFL   +D GC HNLE  L
Sbjct  383   VPGIVFNE--HVPEMVQKMLEWLPWNYSHVGVELCLDHKKSPFLNDTSDPGCFHNLEALL  440

Query  1358  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1537
             HL+DGYHG G+RF  ++ RD ALVNK S+FLK  + VPP WRQ ENKGMVR  +GRWV P
Sbjct  441   HLIDGYHGKGQRFVLSSRRDPALVNKASDFLKDHYLVPPYWRQHENKGMVRNQEGRWVQP  500

Query  1538  ERSRIEAHPSD  1570
             ER ++E HP D
Sbjct  501   ERPKLEEHPPD  511



>ref|XP_006853087.1| hypothetical protein AMTR_s00038p00110060 [Amborella trichopoda]
 gb|ERN14554.1| hypothetical protein AMTR_s00038p00110060 [Amborella trichopoda]
Length=514

 Score =   478 bits (1231),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 249/439 (57%), Positives = 308/439 (70%), Gaps = 21/439 (5%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L E W EIQG   W+GLL+PMD  LRREIIRYGEFAQACYDSF+F  +S+YCGTC Y  +
Sbjct  84    LLERWREIQGENKWKGLLEPMDPLLRREIIRYGEFAQACYDSFNFSTYSRYCGTCNYPMS  143

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
              FF  LGM D GY +SRYLYATS  NL  FF+ S   ++WSQHANW+GYV+VATD   ++
Sbjct  144   SFFRALGMDDLGYEVSRYLYATSASNLRKFFRKSLHAQVWSQHANWIGYVSVATDPKVVK  203

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  835
              LGRRDI+ AWRGTVTYLEW+ D+ +     +F  D ++K+ESGF DLY +  K+T C F
Sbjct  204   ELGRRDILFAWRGTVTYLEWVEDVMDYQVKPNFGPDANVKVESGFLDLYNS--KETACGF  261

Query  836   CSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1009
             CSYSAREQ+++E  RL+ERYK  G  LSIT+TGHSLG ALALLSAYDIAE  +NV+    
Sbjct  262   CSYSAREQVISETRRLMERYKDEGNELSITITGHSLGGALALLSAYDIAETGLNVLP---  318

Query  1010  gegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1189
                           ++PI+VF+F  PRVGN RF +RCDELGI VLR+ N  DKVPTVPG+
Sbjct  319   -----------DGRRVPITVFTFGSPRVGNRRFADRCDELGIHVLRVFNKHDKVPTVPGM  367

Query  1190  IANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1369
             I NE       +  ++   PWSY+HVGVEL LDH+ SP ++ G  +   HNLE +LHLV+
Sbjct  368   IINEDVAVPDIVADIM---PWSYSHVGVELELDHNVSPVVEAGLAIPARHNLELYLHLVN  424

Query  1370  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1549
              Y+G    F+ A  RD AL+NK    LK +  +PP WRQDENKG+VR  DGRWVVPER+ 
Sbjct  425   AYNGPKGGFKPAYKRDPALLNKSDTILKEKFHMPPCWRQDENKGLVRAQDGRWVVPERTS  484

Query  1550  IEAHPSDTGHHFRKVLRLA  1606
             I+AHP DT HH  + L++A
Sbjct  485   IDAHPPDTDHHLEQALKIA  503



>ref|XP_006293988.1| hypothetical protein CARUB_v10022980mg [Capsella rubella]
 gb|EOA26886.1| hypothetical protein CARUB_v10022980mg [Capsella rubella]
Length=530

 Score =   478 bits (1230),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 252/445 (57%), Positives = 305/445 (69%), Gaps = 25/445 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L + W +IQG  DW GL+DPMD  LR E+IRYGE AQACYD+FDFDP SKYCG+ ++ 
Sbjct  100   RRLIDTWRKIQGEDDWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPASKYCGSSRFS  159

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
                FF+ LGM+  GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE  
Sbjct  160   RLDFFDSLGMSGSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETS  219

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  817
               RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  K
Sbjct  220   RNRLGRRDIAIAWRGTVTKLEWIADLKDYLKPVSENKIRCPDPAVKVESGFLDLYTD--K  277

Query  818   DTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMKV  988
             DT C F  +SAREQ+LAEV RL++++      +LSITVTGHSLG ALA+LSAYDIAEM +
Sbjct  278   DTSCKFAKFSAREQILAEVKRLVDKHGDDSSSDLSITVTGHSLGGALAILSAYDIAEMGL  337

Query  989   NVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDK  1168
             N               +     IP++V ++ GPRVGN+RFKER +ELG+KV+R+VNV D 
Sbjct  338   N--------------RSKTGKVIPVTVLTYGGPRVGNVRFKERMEELGVKVMRVVNVHDV  383

Query  1169  VPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLE  1348
             V   PG+  NE   +   L  + +  PW Y HVG ELALDH  SPFLK   DL  AHNLE
Sbjct  384   VSKSPGLFLNESAPH--ALMKIAEGLPWCYCHVGEELALDHQNSPFLKPSVDLSNAHNLE  441

Query  1349  GHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRW  1528
               LHL+DGYHG G RF  ++GRD ALVNK S+FLK    +PP WRQD NKGM+R S+GRW
Sbjct  442   AMLHLLDGYHGKGERFVLSSGRDHALVNKASDFLKEHLQIPPFWRQDANKGMIRNSEGRW  501

Query  1529  VVPERSRIEAHPSDTGHHFRKVLRL  1603
             +  ER R E H S   HH    LRL
Sbjct  502   IQAERLRSEDHHSPDIHHHLSQLRL  526



>ref|XP_010469841.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=551

 Score =   478 bits (1230),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 253/444 (57%), Positives = 305/444 (69%), Gaps = 26/444 (6%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L + W +IQG  DW GL++PMD  LR E+IRYGE AQACYD+FDFDP SKYCG+ ++   
Sbjct  122   LIDTWRKIQGEDDWAGLMEPMDPVLRSELIRYGEMAQACYDAFDFDPASKYCGSSRFSRL  181

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             +FF+ LGM   GY ++RYLYATSNINLPNF+  S  +++WS++ANWMGYVAV+ DE    
Sbjct  182   EFFDSLGMNGSGYEVARYLYATSNINLPNFYSKSRWSKVWSKNANWMGYVAVSDDETSRN  241

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  823
             RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  KDT
Sbjct  242   RLGRRDIAIAWRGTVTKLEWIADLKDYLKPVSENKIRCPDPAVKVESGFLDLYTD--KDT  299

Query  824   DCNFCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVN  991
              C F  +SAREQ+LAEV RL+E Y       +LSITVTGHSLG ALA+LSAYDIAEM +N
Sbjct  300   SCKFAKFSAREQILAEVKRLVETYDDEDDDCDLSITVTGHSLGGALAILSAYDIAEMGLN  359

Query  992   VVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKV  1171
                            + +   IP++V ++ GPRVGN+RFKER +ELG+KV+R+VNV D V
Sbjct  360   --------------RSKSGKVIPVTVLTYGGPRVGNVRFKERMEELGVKVMRVVNVHDMV  405

Query  1172  PTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1351
             P  PG+  NE     + L  + +  PW Y HVG ELALDH  SPFLK   DL  AHNLE 
Sbjct  406   PKSPGLFLNE--SAPQALMKIAEGLPWCYCHVGEELALDHQNSPFLKPSVDLSNAHNLEA  463

Query  1352  HLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
              LHL+DGYHG G RF  ++GRD ALVNK S+FLK    +PP WRQD NKGMVR S+GRW+
Sbjct  464   MLHLLDGYHGKGERFVLSSGRDHALVNKASDFLKEHLQIPPFWRQDANKGMVRNSEGRWI  523

Query  1532  VPERSRIEAHPSDTGHHFRKVLRL  1603
               ER R E H S   HH    LRL
Sbjct  524   QAERLRSEDHHSPDIHHHLSQLRL  547



>ref|XP_010475428.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Camelina 
sativa]
Length=511

 Score =   476 bits (1225),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 247/432 (57%), Positives = 305/432 (71%), Gaps = 26/432 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             ++L + W +IQG  +W GL+DPMD  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  81    KSLKDTWRKIQGEDNWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  140

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
                 FE LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE  
Sbjct  141   RRHLFESLGILDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEEA  200

Query  650   IR-RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNSK  814
              R RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  
Sbjct  201   TRGRLGRRDIAIAWRGTVTRLEWIADLKDYLKPVSGNGIRCSDPAVKVESGFLDLYTD--  258

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  985
             KDT C F  +SAREQ+L EV RL+ERY   +GE+LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  259   KDTSCKFSKFSAREQVLTEVKRLVERYGDEEGEDLSITVTGHSLGGALAVLSAYDVAEMG  318

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
             +N  +                  IP++VF++ GPRVGN+RFKER ++LG+KVLR+VN  D
Sbjct  319   LNRTR--------------KGKLIPVTVFTYGGPRVGNIRFKERIEKLGVKVLRVVNQHD  364

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              V   PG+  NE+  +   L  +    PW Y HVG +L LDH  SPFLK   DL  AHNL
Sbjct  365   VVAKSPGLFLNERAPH--ALMKLAGGLPWCYCHVGEKLPLDHQNSPFLKPTVDLSTAHNL  422

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGR  1525
             E  LHL+DGYHG G+RF  ++GRD ALVNK S+FLK    VPP WRQD NKGM+++SDGR
Sbjct  423   EALLHLLDGYHGKGKRFVLSSGRDPALVNKASDFLKDHFMVPPYWRQDANKGMIKSSDGR  482

Query  1526  WVVPERSRIEAH  1561
             W+ P+R R E H
Sbjct  483   WIQPDRIRAEDH  494



>ref|XP_007144693.1| hypothetical protein PHAVU_007G177100g [Phaseolus vulgaris]
 gb|ESW16687.1| hypothetical protein PHAVU_007G177100g [Phaseolus vulgaris]
Length=504

 Score =   475 bits (1223),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 255/505 (50%), Positives = 325/505 (64%), Gaps = 42/505 (8%)
 Frame = +2

Query  140   KPSNSFFPLTLSSPQKPYSSLKCRDSLPAAIPESSNK----------------Hdeeeed  271
             KP    FPL  S  Q P+   + ++S+  A  E S+                 H    + 
Sbjct  15    KPHQLTFPLGHSKFQTPFR--RTQNSIKLATGEKSSTSTVREQEHEEATTLHTHTSNYKP  72

Query  272   gddeegRNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYC  451
               ++    L E W +IQG  DW GLL+PMD  LR E IRYG+ AQACYD+FDFDP SKYC
Sbjct  73    KLEDHLERLPEAWRQIQGESDWAGLLEPMDPLLRMETIRYGDMAQACYDAFDFDPFSKYC  132

Query  452   GTCKYDGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAV  631
             G+C++    FF  L M   GY ++RYLYAT+NINLPNFF+HS  +++WS++ANW GYVAV
Sbjct  133   GSCRFTPRNFFSSLEMPLVGYTVTRYLYATANINLPNFFKHSRWSKMWSKNANWAGYVAV  192

Query  632   ATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDL  799
              +D A   RLGRRDI IAWRGTVT LEW+ DL + L P      P     +K+ESGF +L
Sbjct  193   -SDHAMTTRLGRRDITIAWRGTVTCLEWVADLMDFLKPISSNGIPCPDQTVKVESGFLEL  251

Query  800   YTNSKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAE  979
             YT+  K+  C++C +SAREQ+L EV RL+E Y+ E +SIT+TGHSLG+ALA+LSAYDIAE
Sbjct  252   YTD--KEESCSYCKFSAREQVLTEVKRLLEIYRDEEVSITITGHSLGSALAILSAYDIAE  309

Query  980   MKVNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNV  1159
                N ++                  + ++V SF+GPRVGN+RFKER + LG+KVLR+VN 
Sbjct  310   TGANTMR--------------DGRGVGVTVMSFSGPRVGNVRFKERLERLGVKVLRVVNK  355

Query  1160  RDKVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAH  1339
              D VP  PG+  NE  Q    +  + +  PWSY+HVGVELALDH  SPFL    D  CAH
Sbjct  356   HDVVPKAPGLFFNE--QLPAAVMKVAEGLPWSYSHVGVELALDHKKSPFLNPNGDAVCAH  413

Query  1340  NLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSD  1519
             NLE  LHL+DGYHG G RF  A+GRD ALVNK  +FLK  H +PP WRQD NKGM+R S+
Sbjct  414   NLEALLHLLDGYHGKGERFVLASGRDPALVNKGCDFLKDHHMIPPNWRQDANKGMIR-SN  472

Query  1520  GRWVVPERSRIEAHPSDTGHHFRKV  1594
             GRW+ PER +++ HP D  HH  ++
Sbjct  473   GRWMQPERPKLQVHPQDMHHHLTQL  497



>ref|XP_004168244.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Cucumis 
sativus]
 gb|KGN44760.1| hypothetical protein Csa_7G378490 [Cucumis sativus]
Length=508

 Score =   475 bits (1223),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 256/481 (53%), Positives = 320/481 (67%), Gaps = 28/481 (6%)
 Frame = +2

Query  164   LTLSSPQKPYSSLKCRDSLPAAIPESSNKHdeeeedgddeegRNLHEIWAEIQGSKDWEG  343
             L L  P  P S  + R ++ +AI   S   +     G+ E    L + W EI GS DW  
Sbjct  45    LLLHQPALPISK-RTRKNVVSAI---STDSEVSTRSGETENETELAKKWREIHGSGDWAN  100

Query  344   LLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRIS  523
             LLDPM+  LR E+IRYGE  QACYDSF +DP+SKYCGT +Y    FF+ LG+   GY+++
Sbjct  101   LLDPMNPILRSELIRYGEMTQACYDSFVYDPYSKYCGTSRYPLESFFQSLGLESEGYQVT  160

Query  524   RYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVT  703
             R+LYAT N  +PN F      ++WS  ANW+GYVAV+ DE   +RLGRRDI+IAWRGTVT
Sbjct  161   RFLYATGNTQMPNLFIKPRFPKLWSTRANWIGYVAVS-DEETSKRLGRRDILIAWRGTVT  219

Query  704   YLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAE  871
              LEW+ D+ NIL+P   R     DP +K+E GF DLYT+  KD +C FC YSAREQ+LAE
Sbjct  220   RLEWVADMTNILNPISSRKIQCPDPSVKVEFGFLDLYTD--KDEECEFCKYSAREQILAE  277

Query  872   VNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegdgesssasaai  1051
             + RL+E+YK E +SIT+TGHSLG+ALA LSAYDIAE  +N                SA  
Sbjct  278   MKRLLEKYKEEEVSITITGHSLGSALATLSAYDIAETGLN--------------KTSAGR  323

Query  1052  kipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLET  1231
              + ISVFSF GPRVGN+RF ER ++LG+KVLR+VN+ D VP  PG+  NEK      L  
Sbjct  324   DVHISVFSFGGPRVGNMRFSERMNDLGVKVLRVVNIHDIVPKSPGLFLNEKL--PPWLLK  381

Query  1232  MLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATG  1411
             M    PWSY HVGVEL LDH  SP+L+  TD GC+HNLE HLHL+DGY G G +F  A G
Sbjct  382   MTTWLPWSYVHVGVELELDHLESPYLRRSTDAGCSHNLEAHLHLLDGYQGKGMKFELAIG  441

Query  1412  RDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPSDTGHHFRK  1591
             RD ALVNK  +FL+ ++ VPP WRQDENKGM+   DGRWV  +RS I+ HP DT +H ++
Sbjct  442   RDPALVNKSCDFLEDKYMVPPMWRQDENKGMIYV-DGRWVFADRSDIDGHPEDTHYHLKE  500

Query  1592  V  1594
             +
Sbjct  501   I  501



>ref|XP_004146954.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Cucumis 
sativus]
Length=508

 Score =   475 bits (1223),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 256/481 (53%), Positives = 320/481 (67%), Gaps = 28/481 (6%)
 Frame = +2

Query  164   LTLSSPQKPYSSLKCRDSLPAAIPESSNKHdeeeedgddeegRNLHEIWAEIQGSKDWEG  343
             L L  P  P S  + R ++ +AI   S   +     G+ E    L + W EI GS DW  
Sbjct  45    LLLHQPALPISK-RTRKNVVSAI---STDSEVSTRSGETENETELAKKWREIHGSGDWAN  100

Query  344   LLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRIS  523
             LLDPM+  LR E+IRYGE  QACYDSF +DP+SKYCGT +Y    FF+ LG+   GY+++
Sbjct  101   LLDPMNPILRSELIRYGEMTQACYDSFVYDPYSKYCGTSRYPLESFFQSLGLESEGYQVT  160

Query  524   RYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVT  703
             R+LYAT N  +PN F      ++WS  ANW+GYVAV+ DE   +RLGRRDI+IAWRGTVT
Sbjct  161   RFLYATGNTQMPNLFIKPRFPKLWSTRANWIGYVAVS-DEETSKRLGRRDILIAWRGTVT  219

Query  704   YLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAE  871
              LEW+ D+ NIL+P   R     DP +K+E GF DLYT+  KD +C FC YSAREQ+LAE
Sbjct  220   RLEWVADMTNILNPISSRKIQCPDPSVKVEFGFLDLYTD--KDEECEFCKYSAREQILAE  277

Query  872   VNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegdgesssasaai  1051
             + RL+E+YK E +SIT+TGHSLG+ALA LSAYDIAE  +N                SA  
Sbjct  278   MKRLLEKYKEEEVSITITGHSLGSALATLSAYDIAETGLN--------------KTSAGR  323

Query  1052  kipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLET  1231
              + ISVFSF GPRVGN+RF ER ++LG+KVLR+VN+ D VP  PG+  NEK      L  
Sbjct  324   DVHISVFSFGGPRVGNMRFSERMNDLGVKVLRVVNIHDIVPKSPGLFLNEKL--PPWLLK  381

Query  1232  MLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATG  1411
             M    PWSY HVGVEL LDH  SP+L+  TD GC+HNLE HLHL+DGY G G +F  A G
Sbjct  382   MTTWLPWSYVHVGVELELDHLESPYLRRSTDAGCSHNLEAHLHLLDGYQGKGMKFERAVG  441

Query  1412  RDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPSDTGHHFRK  1591
             RD ALVNK  +FL+ ++ VPP WRQDENKGM+   DGRWV  +RS I+ HP DT +H ++
Sbjct  442   RDPALVNKSCDFLEDKYMVPPMWRQDENKGMIYV-DGRWVFADRSDIDGHPEDTHYHLKE  500

Query  1592  V  1594
             +
Sbjct  501   I  501



>ref|XP_010510341.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic [Camelina 
sativa]
Length=526

 Score =   476 bits (1224),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 254/444 (57%), Positives = 307/444 (69%), Gaps = 26/444 (6%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L + W +IQG  DW GL++PMD  LR E+IRYGE AQACYD+FDFDP SKYCG+ ++   
Sbjct  97    LIDTWRKIQGEDDWAGLMEPMDPVLRSELIRYGEMAQACYDAFDFDPASKYCGSSRFSRL  156

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             +FF+ LGM+  GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE    
Sbjct  157   EFFDSLGMSGSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETSRN  216

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  823
             RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  KDT
Sbjct  217   RLGRRDIAIAWRGTVTKLEWIADLKDYLKPVSENKIRCPDPAVKVESGFLDLYTD--KDT  274

Query  824   DCNFCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVN  991
              C F  +SAREQ+LAEV RL+E Y    +  +LSITVTGHSLG ALA+LSAYDIAEM +N
Sbjct  275   SCKFAKFSAREQILAEVKRLVETYDDEDEDSDLSITVTGHSLGGALAILSAYDIAEMGLN  334

Query  992   VVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKV  1171
                            + +   IP++V ++ GPRVGN+RFKER +ELG+KV+R+VNV D V
Sbjct  335   --------------RSKSGKVIPVTVLTYGGPRVGNVRFKERMEELGVKVMRVVNVHDMV  380

Query  1172  PTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1351
             P  PG+  NE   +   L  + +  PW Y HVG ELALDH  SPFLK   DL  AHNLE 
Sbjct  381   PKSPGLFLNESAPH--ALMKIAEGLPWCYCHVGEELALDHQNSPFLKPSVDLSNAHNLEA  438

Query  1352  HLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
              LHL+DGYHG G RF  ++GRD ALVNK S+FLK    +PP WRQD NKGMVR S+GRW+
Sbjct  439   TLHLLDGYHGKGERFVLSSGRDHALVNKASDFLKEHLQIPPFWRQDANKGMVRNSEGRWI  498

Query  1532  VPERSRIEAHPSDTGHHFRKVLRL  1603
               ER R E H S   HH    LRL
Sbjct  499   QAERLRSEDHHSPDIHHHLSQLRL  522



>ref|XP_010938535.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Elaeis 
guineensis]
Length=524

 Score =   476 bits (1224),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 249/439 (57%), Positives = 306/439 (70%), Gaps = 25/439 (6%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L + W EI G   W GLLDPMD  LR E+IRYGEFAQACYD+FD+DP S+YCG+C+Y   
Sbjct  98    LADRWREIHGRDHWAGLLDPMDPLLRSELIRYGEFAQACYDAFDYDPFSRYCGSCRYSRR  157

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             +FF  LGM   GY ++ YLYATSNINLPNFF  +   + WSQ ANW+GY+AV +D+A   
Sbjct  158   KFFASLGMDTAGYDVTHYLYATSNINLPNFFTKTRGPKSWSQKANWIGYIAV-SDDATTA  216

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  823
              LGRRDIVIAWRGTVT LEW+ DL + L P         DP++K+ESGF DLYT+  KD 
Sbjct  217   LLGRRDIVIAWRGTVTRLEWVADLMDFLRPVASEGIPCPDPEVKVESGFVDLYTD--KDP  274

Query  824   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVV  997
              C FC YSAR+Q+L EV RL+E++   GE +SITVTGHSLG+ALA++SA+DIAE  V+V 
Sbjct  275   TCRFCKYSARQQVLTEVRRLVEQHTKMGETVSITVTGHSLGSALAMVSAFDIAETGVDV-  333

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1177
                               K+ ++V SF+GPRVGN RFKER +ELG+K LR+VNV D VP 
Sbjct  334   -------------GVDGEKVAVTVLSFSGPRVGNGRFKERFEELGLKALRVVNVHDTVPK  380

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
             VPG++ NE     + +  +++  PWSY+HVGVELALDH  SPF K   D  C HNLE HL
Sbjct  381   VPGVLFNE--HVPEFVRRLVEGLPWSYSHVGVELALDHKRSPFFKDTGDPSCFHNLEAHL  438

Query  1358  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1537
             HL+DGYHG G RF  A+ RD ALVNK  +FLK    VPP WRQDENKGMVR  DGRWV  
Sbjct  439   HLLDGYHGSGHRFYLASKRDPALVNKACDFLKDHLMVPPFWRQDENKGMVRAHDGRWVQR  498

Query  1538  ERSRIEAHPSDTGHHFRKV  1594
             ER +++ HPSD  HH +++
Sbjct  499   ERQKMDDHPSDMHHHLQRL  517



>ref|XP_010558870.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Tarenaya 
hassleriana]
Length=533

 Score =   476 bits (1224),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 249/433 (58%), Positives = 303/433 (70%), Gaps = 28/433 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             + L + W E+ G  DW GLLDPMD  LR E+IRYGE AQ CYD+FDFDP S+YCG+C++ 
Sbjct  103   KKLKDTWREVHGEDDWVGLLDPMDPVLRSELIRYGELAQTCYDAFDFDPFSRYCGSCRFA  162

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
               +FFE LG+AD GY ++RY+YATSNINLPNFF+ S   ++WS++ANWMGYVAV+ D+  
Sbjct  163   RHKFFESLGLADSGYTVARYIYATSNINLPNFFKRSRWPKVWSKNANWMGYVAVSDDDTS  222

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  817
               RLGRRDI IAWRGTVT LEWI DL + L P    +    DP +K+ESGF DLYT+  K
Sbjct  223   RNRLGRRDIAIAWRGTVTRLEWIADLMDYLKPVAGNNLRCPDPAVKVESGFLDLYTD--K  280

Query  818   DTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMKV  988
             D  CNF  +SAREQ+L EV RL+E Y   K E LSITVTGHSLG ALA+LSAYD+AEM +
Sbjct  281   DEACNFSKFSAREQILTEVKRLVETYGDDKDEELSITVTGHSLGGALAILSAYDVAEMGL  340

Query  989   NVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDK  1168
             N  +              +   +P++V ++AGPRVGN+RFKER +ELG+KV+R+VNV D 
Sbjct  341   NRTR--------------SGRVVPVTVMTYAGPRVGNVRFKERMEELGVKVMRVVNVHDV  386

Query  1169  VPTVPGIIANEKF--QYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHN  1342
             VP  PG+  NE+      K  E +L   PW Y HVGVE+ALDH  SPFLK   D   AHN
Sbjct  387   VPKSPGLFLNERAPRSLMKMAENLL---PWCYCHVGVEVALDHQNSPFLKPSVDPSNAHN  443

Query  1343  LEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDG  1522
             LE  LHL+DGYHG G+RF  A+GRD ALVNK S+FLK    VPP WRQD NKGMV   +G
Sbjct  444   LEALLHLLDGYHGKGQRFVLASGRDPALVNKASDFLKDHFMVPPFWRQDANKGMVMNHEG  503

Query  1523  RWVVPERSRIEAH  1561
             RW+  ER RIE H
Sbjct  504   RWIQSERPRIEDH  516



>ref|XP_010414252.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=529

 Score =   476 bits (1224),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 254/444 (57%), Positives = 307/444 (69%), Gaps = 26/444 (6%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L + W +IQG  DW GL++PMD  LR E+IRYGE AQACYD+FDFDP SKYCG+ ++   
Sbjct  100   LIDTWRKIQGEDDWAGLMEPMDPVLRSELIRYGEMAQACYDAFDFDPASKYCGSSRFSRL  159

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             +FF+ LGM+  GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE    
Sbjct  160   EFFDSLGMSGSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETSRN  219

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  823
             RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  KDT
Sbjct  220   RLGRRDIAIAWRGTVTKLEWIADLKDYLKPVSENKIRCPDPAVKVESGFLDLYTD--KDT  277

Query  824   DCNFCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVN  991
              C F  +SAREQ+LAEV RL+E Y    +  +LSITVTGHSLG ALA+LSAYDIAEM +N
Sbjct  278   SCKFAKFSAREQILAEVKRLVETYDDEDEDSDLSITVTGHSLGGALAILSAYDIAEMGLN  337

Query  992   VVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKV  1171
                            + +   IP++V ++ GPRVGN+RFKER +ELG+KV+R+VNV D V
Sbjct  338   --------------RSKSGKVIPVTVLTYGGPRVGNVRFKERMEELGVKVMRVVNVHDMV  383

Query  1172  PTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1351
             P  PG+  NE   +   L  + +  PW Y HVG ELALDH  SPFLK   DL  AHNLE 
Sbjct  384   PKSPGLFLNESAPH--ALMKIAEGLPWCYCHVGEELALDHQNSPFLKPSVDLSNAHNLEA  441

Query  1352  HLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
              LHL+DGYHG G RF  ++GRD ALVNK S+FLK    +PP WRQD NKGMVR S+GRW+
Sbjct  442   MLHLLDGYHGKGERFVLSSGRDHALVNKASDFLKEHLQIPPFWRQDANKGMVRNSEGRWI  501

Query  1532  VPERSRIEAHPSDTGHHFRKVLRL  1603
               ER R E H S   HH    LRL
Sbjct  502   QAERLRSEDHHSPDIHHHLSQLRL  525



>ref|XP_010457831.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic isoform X2 
[Camelina sativa]
Length=469

 Score =   473 bits (1217),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 247/432 (57%), Positives = 302/432 (70%), Gaps = 26/432 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             ++L + W +IQG  +W GL+DPMD  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  39    KSLRDTWRKIQGEDNWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  98

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
                 FE LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV  DE  
Sbjct  99    RRHLFESLGILDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVTDDEEA  158

Query  650   IR-RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  814
              R RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  
Sbjct  159   TRGRLGRRDIAIAWRGTVTRLEWIADLKDYLKPVSGNGIRCPDPAVKVESGFLDLYTD--  216

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  985
             KDT C F  +SAREQ+L EV RL+ERY   +GE+LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  217   KDTSCKFSKFSAREQVLTEVKRLVERYGDEEGEDLSITVTGHSLGGALAVLSAYDVAEMG  276

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
             +N  +                  IP++ F++ GPRVGN+RFKER ++LG+KVLR+VN  D
Sbjct  277   LNRTR--------------KGKVIPVTAFTYGGPRVGNIRFKERIEKLGVKVLRVVNEHD  322

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              V   PG+  NE+  +   L  +    PW Y HVG +L LDH  SPFLK   DL  AHNL
Sbjct  323   VVAKSPGLFLNERAPH--ALMKLAGGLPWCYCHVGEKLPLDHQNSPFLKPTVDLSTAHNL  380

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGR  1525
             E  LHL+DGYHG G+RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMV+ SDGR
Sbjct  381   EALLHLLDGYHGKGKRFVLSSGRDPALVNKASDFLKDHFMVPPYWRQDANKGMVKNSDGR  440

Query  1526  WVVPERSRIEAH  1561
             W+ P+R R E H
Sbjct  441   WIQPDRIRAEDH  452



>ref|XP_006417878.1| hypothetical protein EUTSA_v10007393mg [Eutrema salsugineum]
 gb|ESQ36231.1| hypothetical protein EUTSA_v10007393mg [Eutrema salsugineum]
Length=512

 Score =   474 bits (1221),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 250/437 (57%), Positives = 304/437 (70%), Gaps = 24/437 (5%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             +L + W +IQG  DW GL+DPMD  LR E+IRYGE AQACYD+FDFDP S+YCG+C++  
Sbjct  86    SLRDTWRKIQGEDDWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFTR  145

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + F+ LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DEA  
Sbjct  146   HKLFDSLGIFDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEATR  205

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH---FR-DDPDIKIESGFFDLYTNSKKD  820
              RLGRRDI IAWRGTVT LEWI DLK+ L P     FR  DP++K ESGF DLYT+  KD
Sbjct  206   SRLGRRDIAIAWRGTVTRLEWIADLKDFLKPVSGNGFRCPDPEVKAESGFLDLYTD--KD  263

Query  821   TDCNFCSYSAREQLLAEVNRLIERYKGE--NLSITVTGHslgaalallsaYDIAEMKVNV  994
             T CNF  +SAREQ+L EV R++ERY  E  +LSITVTGHSLG ALA+LSAYD+AEM +N 
Sbjct  264   TACNFSKFSAREQVLTEVKRMVERYGDEEDDLSITVTGHSLGGALAVLSAYDVAEMGMNR  323

Query  995   VQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVP  1174
              +                  IP++ F++ GPRVGN+RFKER  ELG+KVLR+VN  D V 
Sbjct  324   TR--------------RGKVIPVTAFTYGGPRVGNIRFKERMVELGVKVLRVVNEHDVVT  369

Query  1175  TVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1354
               PG+  NE   +   L  +    PW Y HVG +L LDH  SPFLK   D   AHNLE  
Sbjct  370   KSPGLFLNESAPH--ALMKLAGGLPWCYCHVGEKLPLDHQNSPFLKPSVDPSTAHNLEAL  427

Query  1355  LHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVV  1534
             LHL+DGYHG G+RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMVR S+GRW+ 
Sbjct  428   LHLLDGYHGKGQRFVLSSGRDPALVNKASDFLKDHFMVPPYWRQDANKGMVRNSEGRWIQ  487

Query  1535  PERSRIEAHPSDTGHHF  1585
             P+R R E H +   HH 
Sbjct  488   PDRIRAEDHHAPDIHHL  504



>ref|XP_010457830.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic isoform X1 
[Camelina sativa]
Length=469

 Score =   472 bits (1214),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 246/432 (57%), Positives = 302/432 (70%), Gaps = 26/432 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             ++L + W +IQG  +W GL+DPMD  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  39    KSLRDTWRKIQGEDNWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  98

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
                 FE LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV  DE  
Sbjct  99    RRHLFESLGILDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVTDDEEA  158

Query  650   IR-RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  814
              R R+GRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  
Sbjct  159   TRGRVGRRDIAIAWRGTVTRLEWIADLKDYLKPVSGNGIRCPDPAVKVESGFLDLYTD--  216

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  985
             KDT C F  +SAREQ+L EV RL+ERY   +GE+LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  217   KDTSCKFSKFSAREQVLTEVKRLVERYGDEEGEDLSITVTGHSLGGALAVLSAYDVAEMG  276

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
             +N  +                  IP++ F++ GPRVGN+RFKER ++LG+KVLR+VN  D
Sbjct  277   LNRTR--------------KGKVIPVTAFTYGGPRVGNIRFKERIEKLGVKVLRVVNEHD  322

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              V   PG+  NE+  +   L  +    PW Y HVG +L LDH  SPFLK   DL  AHNL
Sbjct  323   VVAKSPGLFLNERAPH--ALMKLAGGLPWCYCHVGEKLPLDHQNSPFLKPTVDLSTAHNL  380

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGR  1525
             E  LHL+DGYHG G+RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMV+ SDGR
Sbjct  381   EALLHLLDGYHGKGKRFVLSSGRDPALVNKASDFLKDHFMVPPYWRQDANKGMVKNSDGR  440

Query  1526  WVVPERSRIEAH  1561
             W+ P+R R E H
Sbjct  441   WIQPDRIRAEDH  452



>ref|XP_008802654.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Phoenix 
dactylifera]
Length=522

 Score =   474 bits (1219),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 249/439 (57%), Positives = 305/439 (69%), Gaps = 25/439 (6%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L + W EI G  DW GLLDPMD  LR E+IRYGEFAQACYD+FD+ P S+YCG+C+Y+  
Sbjct  97    LADRWREIHGRDDWTGLLDPMDPLLRSELIRYGEFAQACYDAFDYQPFSRYCGSCRYNRR  156

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             QFF  LGM    Y ++ YLYATSNINLPNFF  +   + WSQ ANW+GY+AV +D+A   
Sbjct  157   QFFASLGMDAADYEVAHYLYATSNINLPNFFTTTRGGKTWSQKANWIGYIAV-SDDAATA  215

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  823
             RLGRRD+VIAWRGTVT LEW+ DL + L P         DP++K+ESGF DLYT+  KD 
Sbjct  216   RLGRRDVVIAWRGTVTRLEWVADLMDFLRPVASEGIPCPDPEVKVESGFIDLYTD--KDP  273

Query  824   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVV  997
              C FC YSAR+Q+L EV RL+E++   GE +SITVTGHSLG+ALA+LSAYDIAE  ++V 
Sbjct  274   SCRFCKYSARQQVLTEVRRLVEQHTKMGETVSITVTGHSLGSALAMLSAYDIAETGLDV-  332

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1177
                               K+ ++VFSF+GPRVGN +FKER + LG+K LR+VNV D VP 
Sbjct  333   -------------GVDGEKVAVTVFSFSGPRVGNGKFKERFEGLGLKALRVVNVHDTVPK  379

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
             VPGI+ NE     + L  + +  PWSY+HVGVELALDH  SPFLK   D  C HNLE  L
Sbjct  380   VPGILVNE--HVPELLRKLAEGLPWSYSHVGVELALDHKSSPFLKDTGDRSCFHNLEALL  437

Query  1358  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1537
             HL+DGYHG G++F  A+ RD ALVNK  +FLK    VPP WRQ+ENKGMVR  DGRWV  
Sbjct  438   HLIDGYHGSGQKFYLASKRDPALVNKACDFLKDHLMVPPFWRQEENKGMVRAHDGRWVQR  497

Query  1538  ERSRIEAHPSDTGHHFRKV  1594
             ER +IE H  D  HH +++
Sbjct  498   ERQKIEDHALDIHHHLQRL  516



>ref|NP_849603.1| phospholipase A1-Igamma1 [Arabidopsis thaliana]
 sp|Q941F1.2|PLA15_ARATH RecName: Full=Phospholipase A1-Igamma1, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF63138.1|AC011001_8 Similar to lipases [Arabidopsis thaliana]
 gb|AAM20450.1| lipase, putative [Arabidopsis thaliana]
 gb|AEE28039.1| phospholipase A1-Igamma1 [Arabidopsis thaliana]
Length=515

 Score =   472 bits (1214),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 248/430 (58%), Positives = 301/430 (70%), Gaps = 26/430 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             + L + W +IQG  DW GL+DPMD  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  83    KRLRDTWRKIQGEDDWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  142

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
                 F+ LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D   
Sbjct  143   RRHLFDSLGIIDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDNEA  202

Query  650   IR-RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH---FR-DDPDIKIESGFFDLYTNSK  814
              R RLGRRDI IAWRGTVT LEWI DLK+ L P     FR  DP +K ESGF DLYT+  
Sbjct  203   TRCRLGRRDIAIAWRGTVTRLEWIADLKDFLKPVSGNGFRCPDPAVKAESGFLDLYTD--  260

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  985
             KDT CNF  +SAREQ+L EV RL+ERY   +GE LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  261   KDTSCNFSKFSAREQVLTEVKRLVERYGDEEGEELSITVTGHSLGGALAVLSAYDVAEMG  320

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
             VN  +                  IP++ F++ GPRVGN+RFKER ++LG+KVLR+VN  D
Sbjct  321   VNRTR--------------KGKVIPVTAFTYGGPRVGNIRFKERIEKLGVKVLRVVNEHD  366

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              V   PG+  NE+    + L  +    PW Y+HVG  L LDH  SPFLK   DL  AHNL
Sbjct  367   VVAKSPGLFLNER--APQALMKLAGGLPWCYSHVGEMLPLDHQKSPFLKPTVDLSTAHNL  424

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGR  1525
             E  LHL+DGYHG G+RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMVR +DGR
Sbjct  425   EALLHLLDGYHGKGQRFVLSSGRDPALVNKASDFLKDHFMVPPYWRQDANKGMVRNTDGR  484

Query  1526  WVVPERSRIE  1555
             W+ P+R R +
Sbjct  485   WIQPDRIRAD  494



>ref|XP_006307284.1| hypothetical protein CARUB_v10008898mg [Capsella rubella]
 gb|EOA40182.1| hypothetical protein CARUB_v10008898mg [Capsella rubella]
Length=508

 Score =   471 bits (1212),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 247/432 (57%), Positives = 301/432 (70%), Gaps = 26/432 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             ++L + W +IQG  +W GLLDPMD  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  79    KSLRDTWRKIQGEDNWAGLLDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  138

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
                 FE LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE  
Sbjct  139   RRHLFESLGIIDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEEA  198

Query  650   IR-RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  814
              R RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  
Sbjct  199   SRPRLGRRDIAIAWRGTVTRLEWIADLKDFLKPVSGNGIRCPDPAVKVESGFLDLYTD--  256

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  985
             KDT C F  +SAREQ+L EV RL+ERY   +GE+LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  257   KDTSCKFSKFSAREQILTEVKRLVERYGDEEGEDLSITVTGHSLGGALAVLSAYDVAEMG  316

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
             +N  +                  IP++ F++ GPRVGN+RFKER + LG+KVLR+VN  D
Sbjct  317   LNRTR--------------KGKVIPVTAFTYGGPRVGNIRFKERIEGLGVKVLRVVNEHD  362

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              V   PG+  NE   +   L  +    PW Y HVG +L LDH  SPFLK   DL  AHNL
Sbjct  363   VVAKSPGLFLNESAPH--ALMKLAGGLPWCYCHVGEKLPLDHQNSPFLKPTVDLSTAHNL  420

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGR  1525
             E  LHL+DGYHG G+RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMV+ +DGR
Sbjct  421   EALLHLLDGYHGKGQRFVLSSGRDPALVNKASDFLKDHFMVPPYWRQDANKGMVKNTDGR  480

Query  1526  WVVPERSRIEAH  1561
             W+ P+R R E H
Sbjct  481   WIQPDRIRAEDH  492



>ref|XP_002892359.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68618.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=518

 Score =   471 bits (1213),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 248/432 (57%), Positives = 303/432 (70%), Gaps = 26/432 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             + L + W +IQG  DW GL+DPMD  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  86    KRLRDTWRKIQGEDDWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  145

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
                 F+ LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANW+GYVAV+ D+  
Sbjct  146   RRHLFDSLGIIDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWIGYVAVSDDDEA  205

Query  650   IR-RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH---FR-DDPDIKIESGFFDLYTNSK  814
              R RLGRRDI IAWRGTVT LEWI DLK+ L P     FR  DP +K ESGF DLYT+  
Sbjct  206   TRCRLGRRDIAIAWRGTVTRLEWIADLKDFLKPVSGNGFRCPDPAVKAESGFLDLYTD--  263

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  985
             KDT CNF  +SAREQ+L EV RL+ERY   +GE LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  264   KDTCCNFSKFSAREQVLTEVKRLVERYGDEEGEELSITVTGHSLGGALAVLSAYDVAEMG  323

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
             +N  +                  IP++ F++ GPRVGN+RFKER +ELG+KVLR+VN  D
Sbjct  324   LNRTR--------------KGKVIPVTAFTYGGPRVGNIRFKERIEELGVKVLRVVNEHD  369

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              V   PG+  NE+    + L  +    PW Y+HVG  L LDH  SPFLK   DL  AHNL
Sbjct  370   VVAKSPGLFLNER--APQALMKLAGGLPWCYSHVGEMLPLDHQKSPFLKPTVDLSTAHNL  427

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGR  1525
             E  LHL+DGYHG G+RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMVR +DGR
Sbjct  428   EALLHLLDGYHGKGQRFVLSSGRDPALVNKASDFLKDHFMVPPYWRQDANKGMVRNTDGR  487

Query  1526  WVVPERSRIEAH  1561
             W+ P+R R + H
Sbjct  488   WIQPDRIRADDH  499



>gb|KGN44761.1| hypothetical protein Csa_7G378500 [Cucumis sativus]
Length=514

 Score =   470 bits (1209),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 246/481 (51%), Positives = 321/481 (67%), Gaps = 27/481 (6%)
 Frame = +2

Query  164   LTLSSPQKPYSSLKCRDSLPAAIPESSNKHdeeeedgddeegRNLHEIWAEIQGSKDWEG  343
             L L  P  P S+   ++ LPA    S +  +   +  + E    L + W EI GS DW  
Sbjct  50    LLLHQPSLPISTRSRKNVLPAL---SDDDSEVSTQSSETENETELAKKWREIHGSGDWAD  106

Query  344   LLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRIS  523
             LLDPM+  LR E+IRYGE AQACYDSF +DP+SKYCGT +Y    FF+ LGM + GY+++
Sbjct  107   LLDPMNPILRSELIRYGEMAQACYDSFVYDPYSKYCGTSRYPLESFFQSLGMENEGYQVT  166

Query  524   RYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVT  703
             R+LYAT NI +PN F       +WS+HANW+GYVAV+ DE   +RLGRRDIV+AWRGTVT
Sbjct  167   RFLYATGNIQMPNVFIKPRFPELWSKHANWIGYVAVSDDETS-KRLGRRDIVVAWRGTVT  225

Query  704   YLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAE  871
              LEW+ DL + L P   ++    DP + +ESGF DLYT+  K+  C FC +SAREQ+LAE
Sbjct  226   KLEWVEDLTDYLTPISAKNIRCHDPRVMVESGFLDLYTD--KEDGCEFCKFSAREQILAE  283

Query  872   VNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegdgesssasaai  1051
             + RL+E++ GE +SIT+TGHSLG+ALA++SAYDIAEM +N                S   
Sbjct  284   MKRLLEKFDGEEMSITITGHSLGSALAMISAYDIAEMGLN--------------KTSDGG  329

Query  1052  kipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLET  1231
                +SVFSFAGPRVGN++F+ER + LG+KVLR+VN+ D VP  PG   NE       +  
Sbjct  330   NAHVSVFSFAGPRVGNVQFRERLNNLGVKVLRVVNIHDVVPKSPGFFFNENL--PSWVLK  387

Query  1232  MLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATG  1411
             M++  P++Y HVGV L LDH  SP+L+  T  GC+HNLE +LHL+DGY G G +F  A G
Sbjct  388   MIERLPFTYVHVGVLLQLDHLDSPYLRRSTSPGCSHNLEAYLHLLDGYQGKGMKFERAVG  447

Query  1412  RDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPSDTGHHFRK  1591
             RD ALVNK  +FL+ ++ VPP WRQD+NKGM+   DGRWV  +RS I+ HP DT HH +K
Sbjct  448   RDPALVNKSCDFLEDKYVVPPMWRQDQNKGMIYV-DGRWVFADRSDIDGHPKDTHHHLKK  506

Query  1592  V  1594
             +
Sbjct  507   I  507



>ref|XP_004146990.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004168245.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Cucumis 
sativus]
Length=510

 Score =   469 bits (1208),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 246/481 (51%), Positives = 321/481 (67%), Gaps = 27/481 (6%)
 Frame = +2

Query  164   LTLSSPQKPYSSLKCRDSLPAAIPESSNKHdeeeedgddeegRNLHEIWAEIQGSKDWEG  343
             L L  P  P S+   ++ LPA    S +  +   +  + E    L + W EI GS DW  
Sbjct  46    LLLHQPSLPISTRSRKNVLPAL---SDDDSEVSTQSSETENETELAKKWREIHGSGDWAD  102

Query  344   LLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRIS  523
             LLDPM+  LR E+IRYGE AQACYDSF +DP+SKYCGT +Y    FF+ LGM + GY+++
Sbjct  103   LLDPMNPILRSELIRYGEMAQACYDSFVYDPYSKYCGTSRYPLESFFQSLGMENEGYQVT  162

Query  524   RYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVT  703
             R+LYAT NI +PN F       +WS+HANW+GYVAV+ DE   +RLGRRDIV+AWRGTVT
Sbjct  163   RFLYATGNIQMPNVFIKPRFPELWSKHANWIGYVAVSDDETS-KRLGRRDIVVAWRGTVT  221

Query  704   YLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAE  871
              LEW+ DL + L P   ++    DP + +ESGF DLYT+  K+  C FC +SAREQ+LAE
Sbjct  222   KLEWVEDLTDYLTPISAKNIRCHDPRVMVESGFLDLYTD--KEDGCEFCKFSAREQILAE  279

Query  872   VNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegdgesssasaai  1051
             + RL+E++ GE +SIT+TGHSLG+ALA++SAYDIAEM +N                S   
Sbjct  280   MKRLLEKFDGEEMSITITGHSLGSALAMISAYDIAEMGLN--------------KTSDGG  325

Query  1052  kipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLET  1231
                +SVFSFAGPRVGN++F+ER + LG+KVLR+VN+ D VP  PG   NE       +  
Sbjct  326   NAHVSVFSFAGPRVGNVQFRERLNNLGVKVLRVVNIHDVVPKSPGFFFNENL--PSWVLK  383

Query  1232  MLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATG  1411
             M++  P++Y HVGV L LDH  SP+L+  T  GC+HNLE +LHL+DGY G G +F  A G
Sbjct  384   MIERLPFTYVHVGVLLQLDHLDSPYLRRSTSPGCSHNLEAYLHLLDGYQGKGMKFERAVG  443

Query  1412  RDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPSDTGHHFRK  1591
             RD ALVNK  +FL+ ++ VPP WRQD+NKGM+   DGRWV  +RS I+ HP DT HH +K
Sbjct  444   RDPALVNKSCDFLEDKYVVPPMWRQDQNKGMIYV-DGRWVFADRSDIDGHPKDTHHHLKK  502

Query  1592  V  1594
             +
Sbjct  503   I  503



>ref|XP_008451275.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X1 [Cucumis melo]
Length=513

 Score =   469 bits (1208),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 239/435 (55%), Positives = 302/435 (69%), Gaps = 24/435 (6%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI GS DW GLLDPM+  LR E+IRYGE +Q+CYD+FD+DP SKYCG+C++   +FFE
Sbjct  91    WREIHGSNDWTGLLDPMNDLLRSELIRYGEMSQSCYDAFDYDPFSKYCGSCRFSRGKFFE  150

Query  488   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  667
             +LGM + GY ++RYLYATSNIN+PNFF+ S   ++WS+ ANW+GYVAV+ DE   + LGR
Sbjct  151   RLGMENVGYEVTRYLYATSNINMPNFFKKSRWPKVWSKSANWIGYVAVSNDEKS-KELGR  209

Query  668   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNF  835
             RDIV+AWRGTVT LEWI DL + L P         +  +K+ESGF DLYT  K++  C +
Sbjct  210   RDIVVAWRGTVTRLEWITDLMDFLKPIAEAKIGCPNSGVKVESGFVDLYTE-KEEKGCGY  268

Query  836   CSYSAREQLLAEVNRLIERYKG--ENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1009
             C +SAREQ++AEV RL ER+ G  E +SIT+TGHSLG+ALA+LS +DIAE  +N +    
Sbjct  269   CRFSAREQVMAEVKRLTERFGGAEEEMSITITGHSLGSALAVLSGFDIAETGLNRL----  324

Query  1010  gegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1189
                            +P+ VFSF+GPRVGN  FKE   ELG+KVLR+VN+ D VP  PG 
Sbjct  325   ----------GNGRLVPVCVFSFSGPRVGNFSFKEHLHELGVKVLRVVNIHDIVPKTPGF  374

Query  1190  IANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1369
             + NE     + +    +  PWSY+HVGVEL LDH  SPFLK   D  CAHNLE  LHL+D
Sbjct  375   LFNESI--PRAVMQFAEGLPWSYSHVGVELKLDHKVSPFLKQTNDPVCAHNLEALLHLLD  432

Query  1370  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1549
             GYHG G RF  A+GRD ALVNK  +FLK  + VPP WRQDENKGM+R  DGRW+ P+R +
Sbjct  433   GYHGKGGRFVLASGRDPALVNKGCDFLKDHYLVPPNWRQDENKGMIRNQDGRWIQPDRLK  492

Query  1550  IEAHPSDTGHHFRKV  1594
              + HP D  HH  ++
Sbjct  493   FDDHPQDIHHHLTQL  507



>ref|XP_008451272.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Cucumis 
melo]
Length=508

 Score =   469 bits (1206),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 241/433 (56%), Positives = 303/433 (70%), Gaps = 24/433 (6%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI GS DW  LLDPM+  LR E+IR+GE  QACYD+F +DP+SKYCGT +Y    FF+
Sbjct  89    WREIHGSGDWANLLDPMNPILRSELIRFGEMTQACYDAFVYDPYSKYCGTSRYPSESFFQ  148

Query  488   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  667
              LG+ + GY+++R+LYAT N  +PN F      ++WS+ ANW+GYVAV+ DE   +RLGR
Sbjct  149   SLGLENEGYQVTRFLYATGNNQMPNLFIKPRFPKLWSKRANWIGYVAVSGDETS-KRLGR  207

Query  668   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNF  835
             RDI+IAWRGTVT LEW+ D+ N L+P   R     DP +K+E GF DLYT+  KD +C+F
Sbjct  208   RDILIAWRGTVTRLEWVADMTNFLNPISSRKIQCPDPSVKVEFGFLDLYTD--KDEECDF  265

Query  836   CSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegege  1015
             C YSAREQ+LAE+ RL+E+YK E +SIT+TGHSLG+ALA++SAYDIA   +N        
Sbjct  266   CKYSAREQILAEMKRLLEKYKEEEVSITITGHSLGSALAIISAYDIAATGLN--------  317

Query  1016  gdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1195
                     S    + ISVFSFAGPRVGN+RF ER +ELG+KVLRIVNV D VP  PGI  
Sbjct  318   ------KTSDGHNVHISVFSFAGPRVGNMRFGERLNELGVKVLRIVNVHDIVPKSPGIFF  371

Query  1196  NEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1375
             NE       L  + +  PWSY HVGVEL LDH  SP+L+  TD GC+HNLE HLHL+DGY
Sbjct  372   NENL--PPWLLKITEWLPWSYIHVGVELELDHLESPYLRRSTDAGCSHNLEAHLHLLDGY  429

Query  1376  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIE  1555
              G G +F  A GRD ALVNK  +FL+ ++ VPP WRQDENKGM+   DGRWV  +RS I+
Sbjct  430   QGKGMKFELAIGRDPALVNKSCDFLEDKYMVPPMWRQDENKGMIYV-DGRWVFADRSDID  488

Query  1556  AHPSDTGHHFRKV  1594
              HP DT +H +++
Sbjct  489   GHPEDTHYHLKEI  501



>ref|XP_003566295.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Brachypodium 
distachyon]
Length=537

 Score =   468 bits (1205),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 250/424 (59%), Positives = 294/424 (69%), Gaps = 28/424 (7%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI G  DW GLLDPMD  LR E+IRYGE AQACYD+FD+D  S+YCG+CKY    FF+
Sbjct  105   WREIHGCDDWAGLLDPMDPQLRSELIRYGELAQACYDAFDYDLASRYCGSCKYPRRAFFD  164

Query  488   KLGMAD--RGYRISRYLYATSNINLPNFF---QHSSVNRIWSQHANWMGYVAVATDEAEI  652
             +LGM D  RGY +SRYLYATSN   PNFF   Q  +  ++WSQ ANW+GYVAV+TDE E 
Sbjct  165   RLGMPDAARGYAVSRYLYATSNFRFPNFFPSQQSRADAKVWSQRANWIGYVAVSTDE-ES  223

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKD  820
              RLGRRD+ IAWRGT+T LEW+ DL + L P         DP++K+ESGF DLYT+  KD
Sbjct  224   ARLGRRDVAIAWRGTITRLEWVSDLMDFLRPVADEGIPCPDPEVKVESGFVDLYTD--KD  281

Query  821   TDCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNV  994
               C FC YSAREQ+L EV +L+  Y   GE++SITVTGHSLG++LA+LSAYDIAE   N+
Sbjct  282   PSCRFCKYSAREQVLLEVRKLVTHYTALGEDVSITVTGHSLGSSLAVLSAYDIAETGANL  341

Query  995   VQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKV  1171
                           A    K  + VFSF+GPRVGN RFKER + ELG+K LR+VNV D V
Sbjct  342   -------------GADGKTKAAVCVFSFSGPRVGNGRFKERFEGELGVKALRVVNVHDNV  388

Query  1172  PTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1351
             P +PGI  NE      +        PW Y+HVGVELALDH  SPFLK   D GC+HNLE 
Sbjct  389   PRMPGIFLNEGVPEMVRRVAEGLRMPWCYSHVGVELALDHKRSPFLKDTLDPGCSHNLEA  448

Query  1352  HLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
             HLHL+DGYHG G RF  A+GRD ALVNK S+FLK  H VPP WRQDENKGMVR  DGRW+
Sbjct  449   HLHLLDGYHGSGERFVLASGRDPALVNKASDFLKDHHCVPPFWRQDENKGMVRALDGRWI  508

Query  1532  VPER  1543
              P+R
Sbjct  509   QPDR  512



>ref|XP_006655277.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Oryza 
brachyantha]
Length=440

 Score =   464 bits (1194),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 253/423 (60%), Positives = 291/423 (69%), Gaps = 29/423 (7%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI G  DW GLLDPMD  LR E+IRYGEFAQACYD+FD+D  S+YCG+CKY    FFE
Sbjct  9     WREIHGRDDWAGLLDPMDPLLRSELIRYGEFAQACYDAFDYDQASRYCGSCKYPRRAFFE  68

Query  488   KLGM--ADRGYRISRYLYATSNINLPNFFQHSSVN-RIWSQHANWMGYVAVATDEAEIRR  658
             +LGM  A RGY +SRYLYATSN   PNFF  S    +IWSQ ANW+GYVAV+TDE E  R
Sbjct  69    RLGMPAAARGYAVSRYLYATSNFRFPNFFSQSRAGAKIWSQRANWIGYVAVSTDE-ETAR  127

Query  659   LGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTD  826
             LGRRDI IAWRGTV  LEW+ DL + L P         DP++K+ESGF DLYT+  KD  
Sbjct  128   LGRRDIAIAWRGTVPRLEWVSDLMDFLRPVADEGIPCPDPEVKVESGFVDLYTD--KDPT  185

Query  827   CNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
             C FC YSAREQ+L EV RL+ RY   GE++SITVTGHSLG+ALA++SAYDIAE   N+  
Sbjct  186   CRFCKYSAREQVLMEVRRLVARYTALGEDVSITVTGHSLGSALAMISAYDIAESGANL--  243

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPT  1177
                                 + V+SFAGPRVGN RFKER + ELG+K LR+VNV D V  
Sbjct  244   -------------HNDKSAAVCVYSFAGPRVGNARFKERFEAELGVKALRVVNVHDGVAR  290

Query  1178  VPGIIANEKFQYQ-KQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1354
             +PGI+ NE      +++   L   PW YAHVGVELALDH  SPFLK   D  C HNLE H
Sbjct  291   MPGILLNEGAPAMLRRVAEGLLRVPWCYAHVGVELALDHKRSPFLKDTLDPACHHNLEAH  350

Query  1355  LHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVV  1534
             LHL+DGYHG G RF  A+GRD ALVNK  +FLK  H VP  WRQDENKGMVR  DGRWV 
Sbjct  351   LHLLDGYHGRGERFVLASGRDPALVNKACDFLKDHHCVPACWRQDENKGMVRALDGRWVQ  410

Query  1535  PER  1543
             P+R
Sbjct  411   PDR  413



>ref|XP_003518894.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Glycine 
max]
Length=513

 Score =   467 bits (1201),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 241/435 (55%), Positives = 300/435 (69%), Gaps = 24/435 (6%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L E W +I G  DW GLL+PMD  LR E+IRYGE AQACYD+FDFDP SKYCG+C++   
Sbjct  88    LPEEWRQIHGESDWAGLLEPMDPLLRSEVIRYGEMAQACYDAFDFDPFSKYCGSCRFTRR  147

Query  476   QFFEKLGMADR-GYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              FF  L M    GY ++RYLYAT+NINLPNFF+HS  +++WS+HANW GYVAV +D+A  
Sbjct  148   SFFSSLEMPHHLGYAVTRYLYATANINLPNFFKHSRWSKMWSKHANWAGYVAV-SDDATT  206

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSKKD  820
             + LGRRDI IA+RGTVT LEW+ DL + L P      P     +K+ESGF DLYT+  K+
Sbjct  207   KLLGRRDITIAFRGTVTRLEWVADLMDFLKPISSNGIPCPDHTVKVESGFLDLYTD--KE  264

Query  821   TDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
               C +  YSAREQ+L+EV RL+E Y  E +S+T+TGHSLG+ALA+LSAYDI E  VNV++
Sbjct  265   ESCGYAKYSAREQVLSEVKRLLEIYNKEEVSVTITGHSLGSALAILSAYDIVETGVNVMR  324

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1180
             +  G                  V SF+GPRVGN+RFKER + LG+KVLR+VNV D VP  
Sbjct  325   DSRGVAVT--------------VMSFSGPRVGNVRFKERLEGLGVKVLRVVNVHDVVPKA  370

Query  1181  PGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLH  1360
             PG++ NE       +  + +  PWSY HVGVELALDH  SPFL    D   AHNLE  LH
Sbjct  371   PGVVFNEHLP--AAVMKVAEGLPWSYWHVGVELALDHKKSPFLNPNADAVSAHNLEALLH  428

Query  1361  LVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPE  1540
             L+DGYHG G RF  A+GRD ALVNK  +FLK  + +PP WRQD NKGM+R+++GRW+ PE
Sbjct  429   LLDGYHGKGERFVLASGRDPALVNKGCDFLKDHYLIPPNWRQDANKGMIRSNNGRWMQPE  488

Query  1541  RSRIEAHPSDTGHHF  1585
             R ++E HP D  HH 
Sbjct  489   RPKLEDHPEDMHHHL  503



>ref|XP_008451639.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Cucumis 
melo]
Length=508

 Score =   465 bits (1196),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 249/481 (52%), Positives = 325/481 (68%), Gaps = 28/481 (6%)
 Frame = +2

Query  164   LTLSSPQKPYSSLKCRDSLPAAIPESSNKHdeeeedgddeegRNLHEIWAEIQGSKDWEG  343
             L L  P  P S+ + R+ L A    S +  +   + G+ E    L + W EI GS DW  
Sbjct  45    LLLHQPSLPIST-RTRNVLSAI---SDDDSEVSTQFGETENETELAKKWREIHGSGDWAD  100

Query  344   LLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRIS  523
             LLDPM+  LR E+IRYGE AQ CYD+F +DP+SKYCGT +Y    FF+ LG  + GY+++
Sbjct  101   LLDPMNPILRSELIRYGEMAQLCYDAFVYDPYSKYCGTSRYPLESFFQSLGKENEGYQVT  160

Query  524   RYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVT  703
             R+LYAT NI +PN F      ++WS+HANW+GYVAV+ DE   +RLGRRDIV+AWRGTVT
Sbjct  161   RFLYATGNIQMPNSFIKPRFPKLWSKHANWIGYVAVSDDETS-KRLGRRDIVVAWRGTVT  219

Query  704   YLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAE  871
              LEW+ DL + L P   R     +P + +ESGF DLYT+  K+ +C FC +SAREQ+LAE
Sbjct  220   KLEWVEDLTDYLVPVSSRKIKCPNPGVMVESGFLDLYTD--KEDECEFCKFSAREQILAE  277

Query  872   VNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegdgesssasaai  1051
             + RL+E++ GE +SIT+TGHSLG+ALA++SAYDIAEM +N                S   
Sbjct  278   MKRLMEKFNGEEVSITITGHSLGSALAMISAYDIAEMGLN--------------KTSDGS  323

Query  1052  kipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLET  1231
                +SVFSFAGPRVGN++F+ER ++LGIKVLR+VN+ D VP  PG I NE       +  
Sbjct  324   SAHVSVFSFAGPRVGNVQFRERLNKLGIKVLRVVNIHDIVPKSPGFIFNESL--PSWVLK  381

Query  1232  MLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATG  1411
             M++  P +Y HVGV L LDH  SP+L+  TD GC+HNLE +LHL+DGY G G +F  A G
Sbjct  382   MIERLPMTYVHVGVLLKLDHLDSPYLRRSTDPGCSHNLEAYLHLLDGYQGKGMKFERAIG  441

Query  1412  RDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPSDTGHHFRK  1591
             RD ALVNK  +FL+ ++ VPP+WRQDENKGMV   DGRWV  +RS I++HP DT +H +K
Sbjct  442   RDPALVNKSCDFLEDKYVVPPKWRQDENKGMVYV-DGRWVFADRSDIDSHPEDTHYHLKK  500

Query  1592  V  1594
             V
Sbjct  501   V  501



>ref|XP_004146952.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004165635.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Cucumis 
sativus]
 gb|KGN44758.1| hypothetical protein Csa_7G378470 [Cucumis sativus]
Length=505

 Score =   465 bits (1196),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 238/435 (55%), Positives = 302/435 (69%), Gaps = 24/435 (6%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI GS DW GLLDPM+  LR E+IRYGE +Q+CYD+FD+DP SKYCG+C++   +FFE
Sbjct  83    WREIHGSNDWTGLLDPMNDLLRSELIRYGEMSQSCYDAFDYDPFSKYCGSCRFSRGKFFE  142

Query  488   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  667
             +LGM + GY ++RYLYATSNIN+PNFF+ S   ++WS+ ANW+GYVAV+ DE   + LGR
Sbjct  143   RLGMENVGYEVTRYLYATSNINMPNFFKKSRWPKVWSKSANWIGYVAVSNDEKS-KELGR  201

Query  668   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNF  835
             RDIV+AWRGTVT LEWI DL + L P         +  +K+ESGF DLYT  K++  C +
Sbjct  202   RDIVVAWRGTVTRLEWITDLMDFLKPIAAAKIGCPNLGVKVESGFVDLYT-EKEEEGCGY  260

Query  836   CSYSAREQLLAEVNRLIERYKG--ENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1009
             C +SAREQ++AEV RL ER+ G  E +SIT+TGHSLG+ALA+LSA+D+AE  +N +    
Sbjct  261   CRFSAREQVMAEVKRLTERFGGAEEEMSITITGHSLGSALAVLSAFDLAETGLNRL----  316

Query  1010  gegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1189
                            +P+ VFSF+GPRVGN  FKER  ELG+KVLR++N+ D VP  PG 
Sbjct  317   ----------GNGRVVPVCVFSFSGPRVGNFSFKERLHELGVKVLRVINIHDIVPKSPGF  366

Query  1190  IANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1369
             + NE     + +    +  PWSY+HVGVEL LDH  SPFLK   D  CAHNLE  LHL+D
Sbjct  367   LLNESI--PRAVMQYAEGLPWSYSHVGVELKLDHKVSPFLKQTNDPVCAHNLEALLHLLD  424

Query  1370  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1549
             GYH    RF  A+GRD ALVNK  +FLK  + VPP WRQDENKGM+R  DGRW+ P+R +
Sbjct  425   GYHEKDGRFVLASGRDPALVNKGCDFLKDHYLVPPNWRQDENKGMIRNKDGRWIQPDRLK  484

Query  1550  IEAHPSDTGHHFRKV  1594
              E HP D  HH  ++
Sbjct  485   FEDHPHDIHHHLTQL  499



>gb|EEC79153.1| hypothetical protein OsI_19824 [Oryza sativa Indica Group]
Length=574

 Score =   465 bits (1196),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 254/430 (59%), Positives = 296/430 (69%), Gaps = 29/430 (7%)
 Frame = +2

Query  299   HEI---WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             HE+   W EI G  DW GLLDPMD  LR E+IRYGEFAQACYD+FD+DP S+YCG+CKY 
Sbjct  117   HELAARWREIHGRDDWAGLLDPMDPLLRSELIRYGEFAQACYDAFDYDPSSRYCGSCKYP  176

Query  470   GAQFFEKLGMAD--RGYRISRYLYATSNINLPNFFQHSSVN-RIWSQHANWMGYVAVATD  640
                FF++LGM D  RGY ++RYLYATSN   PNFF  S    +IWSQ ANW+GYVAV+TD
Sbjct  177   RRAFFDRLGMPDAARGYTVTRYLYATSNFRFPNFFSQSRAGAKIWSQRANWIGYVAVSTD  236

Query  641   EAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTN  808
             E E  RLGRRDI IAWRGTVT LEW+ DL + L P      P    ++K+ESGF DLYT+
Sbjct  237   E-ETARLGRRDIAIAWRGTVTRLEWVSDLMDFLRPVADEGIPCPDREVKVESGFVDLYTD  295

Query  809   SKKDTDCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEM  982
               KD  C FC YSAREQ+L EV RL+ RY   GE++S+TVTGHSLG+ALA++SAYDIAE 
Sbjct  296   --KDPTCRFCKYSAREQVLTEVRRLVTRYAALGEDVSVTVTGHSLGSALAMISAYDIAES  353

Query  983   KVNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNV  1159
                                       + V+SFAGPRVGN RFKER + ELG+K LR+VNV
Sbjct  354   GAASAA----------HGGGNEAAAAVCVYSFAGPRVGNARFKERFEGELGVKALRVVNV  403

Query  1160  RDKVPTVPGIIANE--KFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGC  1333
              D V  +PGI+ NE      ++  E +L+  PW YAHVGVELALDH  SPFLK   D  C
Sbjct  404   HDGVARMPGILLNEGAPAALRRVAEGILR-VPWCYAHVGVELALDHKRSPFLKDTLDPAC  462

Query  1334  AHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRT  1513
              HNLE HLHL+DGYHG G RF  A+GRD ALVNK  +FLK  H VPP WRQDENKGMVR 
Sbjct  463   FHNLEAHLHLLDGYHGRGERFVLASGRDPALVNKACDFLKDHHCVPPCWRQDENKGMVRA  522

Query  1514  SDGRWVVPER  1543
              DGRWV P+R
Sbjct  523   PDGRWVQPDR  532



>ref|XP_006576919.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X1 [Glycine max]
Length=497

 Score =   461 bits (1187),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 251/499 (50%), Positives = 332/499 (67%), Gaps = 29/499 (6%)
 Frame = +2

Query  119   ITKPTTAKPSNSFF--PLTLSSPQKPYSSLKCRDSLPAAIPESSNKHdeeeedgddeegR  292
             +  P T +  ++F   P  LS   KP +++ C+ +L   +  S     ++++  DD++ +
Sbjct  10    VALPQTPQCRSTFRSDPPKLSLTLKPKATVTCKATLSTTLETS----IQQQQQQDDQKQK  65

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
              + E+W +I G  +W GLLDPMD  +R E+ RYGE AQACYD+FDFDP+SKYCG+C++  
Sbjct  66    PVAEVWRKIHGEDNWAGLLDPMDPVMRGELTRYGEMAQACYDAFDFDPYSKYCGSCRFPL  125

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSS-VNRIWSQHANWMGYVAVATDEAE  649
              +FF+ LGM + GY ++RYLYAT NINLPNFF+ S   +++WS+HANW G++AV+ DE  
Sbjct  126   PEFFDSLGMTNVGYTMTRYLYATGNINLPNFFRKSRWPHKMWSKHANWAGFIAVSDDETS  185

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR---DDPDIKIESGFFDLYTNSKKD  820
              +RLGRRDIVI+WRGTVT++EW+ DL N L P        D  +K+E+GF DLYT+  ++
Sbjct  186   -KRLGRRDIVISWRGTVTHVEWVADLLNFLKPISPDIPCSDRKVKVEAGFLDLYTD--RE  242

Query  821   TDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
               C +C YSAREQ+L EV RL+E+Y  E +S+T+ GHSLG+A+A+LSA+DI E  VNV +
Sbjct  243   PGCGYCKYSAREQVLGEVKRLMEKYADEEVSVTIAGHSLGSAMAILSAFDIVETGVNVGK  302

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPT  1177
             +G                    VFSF+GPRVGN+RFKER + ELGIKVLR+ N  D VP 
Sbjct  303   DGRKAHVS--------------VFSFSGPRVGNVRFKERLEGELGIKVLRVHNAHDMVPQ  348

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
              PG+I NE    Q  L+ +   FPW Y HVG EL LDH  SPFL    D  CAHNLE HL
Sbjct  349   SPGLIFNED-SPQWLLKLVEGWFPWCYLHVGEELQLDHKKSPFLNPDGDASCAHNLEAHL  407

Query  1358  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1537
             HL+DGYHG  R F   + RD+ALVNKD +FLK EH VPPRWRQD NK MVRT DGRWV+ 
Sbjct  408   HLLDGYHGKNRGFERTSERDLALVNKDCDFLKDEHSVPPRWRQDLNKNMVRTEDGRWVLA  467

Query  1538  ERSRIEAHPSDTGHHFRKV  1594
             +R   +    D  HH  ++
Sbjct  468   DRPLAQDPHEDIDHHLGEL  486



>emb|CDP03693.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   457 bits (1177),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 239/410 (58%), Positives = 292/410 (71%), Gaps = 25/410 (6%)
 Frame = +2

Query  344   LLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRIS  523
             +LDPMD  LR E+IRYGE AQACYD+FDFDP+S YCG+CK+   +FFE+L M   GY ++
Sbjct  1     MLDPMDPLLRTELIRYGEMAQACYDAFDFDPYSIYCGSCKFTRTKFFEELEMLQYGYDVT  60

Query  524   RYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVT  703
             RYLYATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE   R+LGRRDI IAWRGTVT
Sbjct  61    RYLYATSNINLPNFFKQSRWPKVWSKNANWIGYVAVSNDETS-RKLGRRDICIAWRGTVT  119

Query  704   YLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAE  871
              LEWI D+ + L P         DP +K+ESGF DLYT+  KD  C FC +SAREQ+L E
Sbjct  120   RLEWIADMMDFLRPISSDKIPCPDPTVKVESGFLDLYTD--KDESCRFCKFSAREQILTE  177

Query  872   VNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegdgesssasa  1045
             V RLIE Y  + E LSI++TGHSLG+ALA LS YDI E  +NV ++  G           
Sbjct  178   VKRLIEMYSDEEEELSISITGHSLGSALATLSGYDIVETGINVSRDSRGVPVC-------  230

Query  1046  aikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQL  1225
                    V+SF+GPRVGN+RFK+R + LG+KVLR+VNV D VP  PG+  NE       +
Sbjct  231   -------VYSFSGPRVGNVRFKQRVEGLGLKVLRVVNVHDVVPKSPGMFFNENVP--PVV  281

Query  1226  ETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSA  1405
               + +  PWSY+HVGVELALDH+ SPFLK  TD  CAHNLE HLHL+DGYHG G+RF  A
Sbjct  282   MKLAEGLPWSYSHVGVELALDHNNSPFLKPTTDPVCAHNLEAHLHLLDGYHGKGQRFVLA  341

Query  1406  TGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIE  1555
             +GRDIALVNK  +FLK  H +PP WRQ ENKGMVR  +GRWV  ER R++
Sbjct  342   SGRDIALVNKACDFLKDHHCIPPNWRQVENKGMVRNREGRWVQAERPRLD  391



>ref|XP_009414857.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=508

 Score =   458 bits (1179),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 244/445 (55%), Positives = 301/445 (68%), Gaps = 33/445 (7%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W  I G  DW GLLDP+D  LR E+IRYGEF QACYDSFD+D  S+YCG+CKY   QFF 
Sbjct  90    WRVIHGRDDWAGLLDPIDPLLRTELIRYGEFVQACYDSFDYDKFSRYCGSCKYSRRQFFY  149

Query  488   KLGMADRGYRISRYLYATSNINLPNFFQHSSV-NRIWSQHANWMGYVAVATDEAEIRRLG  664
              LGM   GY ++RYLYATSN+ +P FF  S + +R WS+ ANW+GYV+V+ DE   R LG
Sbjct  150   SLGMESAGYDVTRYLYATSNVKVPKFFAKSVMGSRTWSERANWIGYVSVSNDETTAR-LG  208

Query  665   RRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCN  832
             RRDI+IAWRGTVT LEWIHD    + P         D  +K+E+GF DLY   +KD+ C 
Sbjct  209   RRDILIAWRGTVTRLEWIHDFMAKMQPVRSAGIPCPDTRVKVETGFVDLYI--EKDSTCR  266

Query  833   FCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
             FC YSAREQ+L EV +L+ +Y   GE +SITV GHSLG+ALA L+AYDIAEM++      
Sbjct  267   FCKYSAREQVLTEVRKLVAQYTEAGEEVSITVAGHSLGSALATLNAYDIAEMEL------  320

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                        +   ++P++VFS+ GPRVGN  FKERCD+LG+KVLR+VNV DKVPTVPG
Sbjct  321   --------IKGADGKQVPMAVFSYGGPRVGNEHFKERCDKLGLKVLRVVNVHDKVPTVPG  372

Query  1187  IIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1366
             ++ NE        E ML++    Y HVGVEL LDH +SPFLK   D    HNLE HLHL+
Sbjct  373   VLINEHMP-----EFMLRAMD-GYVHVGVELLLDHKHSPFLKDSLDPSNYHNLEAHLHLL  426

Query  1367  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1546
             DG+ G GR+F   TGRD ALVNK  +FL     VPP WRQDENKGM+R+ +GRW  PER 
Sbjct  427   DGFQGKGRKFAPTTGRDPALVNKSCDFLHEHLMVPPNWRQDENKGMMRSQEGRWAQPERQ  486

Query  1547  RIEAHPSDTGHHFRKVLRLARARFE  1621
             +I+ HP D  HH+++   L   RFE
Sbjct  487   KIDDHPEDIHHHYQQ---LGLDRFE  508



>ref|XP_006853094.1| hypothetical protein AMTR_s00038p00116940 [Amborella trichopoda]
 gb|ERN14561.1| hypothetical protein AMTR_s00038p00116940 [Amborella trichopoda]
Length=536

 Score =   457 bits (1177),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 252/440 (57%), Positives = 297/440 (68%), Gaps = 26/440 (6%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L E W EIQG   W GLL+PMD  LR E+IRYGE AQACYD+FD+DP S+YCG+C+++  
Sbjct  113   LSERWREIQGENHWTGLLEPMDPLLRSELIRYGEHAQACYDAFDYDPFSRYCGSCRHNRR  172

Query  476   QFFEKLGMADR-GYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              FFE+L + +   Y ++RYLYATSN NL NFF+ S   R WS  ANW+GYVA A  +  I
Sbjct  173   HFFEELTLDNHCSYEVTRYLYATSNPNLRNFFRRSQWPRTWSTAANWIGYVASAGGKDGI  232

Query  653   ----RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHF-RDDPDIKIESGFFDLYTNSKK  817
                   LGRRDIV+AWRGTVT LEWI DL + L P      D  +K+ESGF DLY +  K
Sbjct  233   DTGKSELGRRDIVVAWRGTVTRLEWIADLMDCLKPVGLSHGDRLVKVESGFLDLYLS--K  290

Query  818   DTDCNFCSYSAREQLLAEVNRLIERYKGE-NLSITVTGHslgaalallsaYDIAEMKVNV  994
             D  C F  YSAREQ+L+EV RL+ERYK E  LSITVTGHSLG ALALLSAYDIAE  +N+
Sbjct  291   DPACRFSKYSAREQVLSEVRRLMERYKDEPELSITVTGHSLGGALALLSAYDIAESGLNL  350

Query  995   VQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVP  1174
                                +  I+VFSFA PRVGN  F +RC+ELG+ VLR+VNV D VP
Sbjct  351   --------------RLDGTRALITVFSFAAPRVGNRHFAKRCEELGVHVLRVVNVHDTVP  396

Query  1175  TVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1354
              VPG + NE  Q  + L   L   PWSYAHVGVEL LDH  SPFLK   D  C HNLE H
Sbjct  397   KVPGFLINEHVQVPQALTDGL---PWSYAHVGVELTLDHRRSPFLKETGDPSCYHNLEAH  453

Query  1355  LHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVV  1534
             LHL+DGYHG G+RF  A+GRD ALVNK S+FLK  H VPP WRQ+ NKGMV+   GRWV 
Sbjct  454   LHLLDGYHGRGQRFVLASGRDPALVNKASDFLKEHHMVPPNWRQERNKGMVKGPHGRWVQ  513

Query  1535  PERSRIEAHPSDTGHHFRKV  1594
             PER+R+E HP D   H  ++
Sbjct  514   PERNRVEDHPLDIKGHLDQI  533



>ref|XP_004962195.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X2 [Setaria italica]
Length=583

 Score =   459 bits (1180),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 291/423 (69%), Gaps = 32/423 (8%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI G  DW GLLDPMD  LR E+IRYGE AQACYD+FD+DP S+YCG+CKY    FFE
Sbjct  114   WREIHGRDDWAGLLDPMDPLLRSELIRYGELAQACYDAFDYDPSSRYCGSCKYPRRDFFE  173

Query  488   KLGM--ADRGYRISRYLYATSNINLPNFFQHSSVN-RIWSQHANWMGYVAVATDEAEIRR  658
             +LGM  A RGY +SRYLYATSN   PNFF  S    +IWSQ ANW+GYVAV+ DE E  R
Sbjct  174   RLGMPEAARGYAVSRYLYATSNFRFPNFFPQSRAGAKIWSQSANWIGYVAVSGDE-ESAR  232

Query  659   LGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTD  826
             LGRRDI IAWRGTVT LEW+ DL + L P         DP++K+ +GF DLYT+  KD  
Sbjct  233   LGRRDIAIAWRGTVTRLEWVSDLMDFLRPVADEGIPCPDPEVKVLAGFADLYTD--KDPT  290

Query  827   CNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
             C FC YSAREQ+L EV RL+ RY  +GE++SITVTGHSLG+ALA+LSAYDIAE   N   
Sbjct  291   CRFCKYSAREQVLMEVRRLVARYAARGEDVSITVTGHSLGSALAMLSAYDIAESGAN---  347

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPT  1177
                                P+ V+SFAGPRVGN  FK R + ELG++ LR+VNV D V  
Sbjct  348   ---------------RAVAPVCVYSFAGPRVGNAAFKRRFESELGVRALRVVNVHDNVTR  392

Query  1178  VPGIIANEKF-QYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1354
             +PGI+ NE   +  +++   L   PW Y HVGVELALDH  SPFLK   D  C H+LE H
Sbjct  393   MPGILLNEGAPEAVRRVAERLLRVPWCYTHVGVELALDHKRSPFLKDTMDPACYHDLEAH  452

Query  1355  LHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVV  1534
             LHL+DGYHG G RF  A+GRD ALVNK  +FLK  HGVPP WRQDENKGMVR  DGRWV 
Sbjct  453   LHLIDGYHGRGERFVLASGRDPALVNKACDFLKDHHGVPPCWRQDENKGMVRGRDGRWVQ  512

Query  1535  PER  1543
             P+R
Sbjct  513   PDR  515



>ref|XP_010326538.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase A1-Igamma2, chloroplastic-like 
[Solanum lycopersicum]
Length=474

 Score =   454 bits (1168),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 252/466 (54%), Positives = 309/466 (66%), Gaps = 37/466 (8%)
 Frame = +2

Query  131   TTAKPSNSF----FPLTLSSPQKPYSSLKCR--DSLPAAIPESSNKHdeeeedgddeegR  292
             T  KP++SF    +PLT         SL  R   S  + I E    +   ++  + E   
Sbjct  24    TNFKPADSFLPPSYPLTRVKSSTKTRSLSSRTSQSFTSIINEKEKTNLSIDQLEESENTS  83

Query  293   NLHEI--------WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKY  448
             N   I        W EI G  DW G+LDPMD  LR E+IRYGE AQACYD+FDFDP+SKY
Sbjct  84    NRTNIYEAEVVDRWLEIHGQDDWVGMLDPMDPLLRSELIRYGEMAQACYDAFDFDPYSKY  143

Query  449   CGTCKYDGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVA  628
             CG+CK+   +FF+ LGMA+ GY I+RYLYATSNINLPNFF+ S   +IWS++ANW+GYVA
Sbjct  144   CGSCKFPRRKFFDGLGMAEYGYDITRYLYATSNINLPNFFKQSRWPKIWSKNANWIGYVA  203

Query  629   VATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFD  796
             V+ DE   +RLGRRDI IAWRGTVT LEWI DL + L P    +    DP++K+ESGF D
Sbjct  204   VSNDET-TKRLGRRDITIAWRGTVTRLEWIADLMDYLRPISSDNIPCPDPNVKVESGFLD  262

Query  797   LYTNSKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIA  976
             LYT+  KD  C +C +SAREQ+L EV RLIE Y  E +SITVTGHSLG+ALA+LSAYD+ 
Sbjct  263   LYTD--KDESCRYCKFSAREQILTEVKRLIEMYPDEEMSITVTGHSLGSALAILSAYDLV  320

Query  977   EMKVNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVN  1156
             E  +NV               +    +PI VFSF+GPRVGN+RFKER ++LG+KVLR+VN
Sbjct  321   ETGLNV--------------KADTSGVPICVFSFSGPRVGNVRFKERIEKLGVKVLRVVN  366

Query  1157  VRDKVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCA  1336
             V D VP  PG++ NE       +  + +  PWSY+HVGVELALDH  SPFLK  +DL CA
Sbjct  367   VHDIVPKSPGLVLNE--HSPSMVMKICEKLPWSYSHVGVELALDHKNSPFLKPTSDLVCA  424

Query  1337  HNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPP  1474
             HNLE HLHL+DGYHG GRRF    G DI LVNK  +FLK  + VPP
Sbjct  425   HNLEAHLHLLDGYHGKGRRFVLEKGIDIPLVNKACDFLKEHYCVPP  470



>ref|XP_008656338.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Zea 
mays]
 gb|AFW82142.1| hypothetical protein ZEAMMB73_402058 [Zea mays]
Length=576

 Score =   456 bits (1174),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 248/428 (58%), Positives = 291/428 (68%), Gaps = 32/428 (7%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
              L   W EI G  DW GLLDPMD  LR E+IRYGE AQACYD+FD+DP S+YCG+CKY  
Sbjct  114   ELRSRWREIHGCDDWAGLLDPMDPLLRSELIRYGELAQACYDAFDYDPSSRYCGSCKYSR  173

Query  473   AQFFEKLGMAD--RGYRISRYLYATSNINLPNFFQHSSVN-RIWSQHANWMGYVAVATDE  643
                FE+LGMAD  RGY +SRYL+ATSNI  PN F  S    RIWSQ A+W+GYVAV+TDE
Sbjct  174   RDLFERLGMADAARGYVVSRYLFATSNIRFPNLFPQSRAGARIWSQSASWIGYVAVSTDE  233

Query  644   AEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNS  811
              E  RLGRRDI IAWRGTVT LEW+ DL + L P      P    ++K+ +GF DLYT+ 
Sbjct  234   -ESARLGRRDIAIAWRGTVTRLEWVSDLMDFLRPVAEEGIPCPDREVKVLAGFVDLYTD-  291

Query  812   KKDTDCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMK  985
              +D  C FC YSAREQ+L EV RL+ RY   GE++S+TVTGHSLG+ALA+LSAYDIAE  
Sbjct  292   -RDPSCRFCKYSAREQVLTEVRRLVGRYTAAGEDVSVTVTGHSLGSALAMLSAYDIAETG  350

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDE-LGIKVLRIVNVR  1162
              N+                     P+ VFSF GPRVGN  FK R +E LG++ LR+VNV 
Sbjct  351   ANM------------------EAAPVCVFSFGGPRVGNTAFKRRFEEELGVRALRVVNVH  392

Query  1163  DKVPTVPGIIANEKF-QYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAH  1339
             D V  +PGI+ NE   +  +++   L   PW YAHVGVEL LDH  SPFLK   D  C H
Sbjct  393   DNVTRMPGILLNEGAPEVVRRVAEGLLRVPWCYAHVGVELPLDHKRSPFLKDTLDPACYH  452

Query  1340  NLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSD  1519
             +LE HLHL+DGYHG G RF  A+GRD ALVNK  +FLK  HGVPP WRQDENKGMVR  D
Sbjct  453   DLEAHLHLIDGYHGRGERFVLASGRDPALVNKACDFLKDHHGVPPCWRQDENKGMVRARD  512

Query  1520  GRWVVPER  1543
             GRWV P+R
Sbjct  513   GRWVQPDR  520



>ref|XP_004962194.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X1 [Setaria italica]
Length=594

 Score =   457 bits (1175),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 251/423 (59%), Positives = 293/423 (69%), Gaps = 21/423 (5%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI G  DW GLLDPMD  LR E+IRYGE AQACYD+FD+DP S+YCG+CKY    FFE
Sbjct  114   WREIHGRDDWAGLLDPMDPLLRSELIRYGELAQACYDAFDYDPSSRYCGSCKYPRRDFFE  173

Query  488   KLGM--ADRGYRISRYLYATSNINLPNFFQHSSVN-RIWSQHANWMGYVAVATDEAEIRR  658
             +LGM  A RGY +SRYLYATSN   PNFF  S    +IWSQ ANW+GYVAV+ DE E  R
Sbjct  174   RLGMPEAARGYAVSRYLYATSNFRFPNFFPQSRAGAKIWSQSANWIGYVAVSGDE-ESAR  232

Query  659   LGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTD  826
             LGRRDI IAWRGTVT LEW+ DL + L P         DP++K+ +GF DLYT+  KD  
Sbjct  233   LGRRDIAIAWRGTVTRLEWVSDLMDFLRPVADEGIPCPDPEVKVLAGFADLYTD--KDPT  290

Query  827   CNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
             C FC YSAREQ+L EV RL+ RY  +GE++SITVTGHSLG+ALA+LSAYDIAE   NV  
Sbjct  291   CRFCKYSAREQVLMEVRRLVARYAARGEDVSITVTGHSLGSALAMLSAYDIAESGANVAG  350

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPT  1177
                  G   + +          V+SFAGPRVGN  FK R + ELG++ LR+VNV D V  
Sbjct  351   GAGDGGGQRAVAPVC-------VYSFAGPRVGNAAFKRRFESELGVRALRVVNVHDNVTR  403

Query  1178  VPGIIANEKF-QYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1354
             +PGI+ NE   +  +++   L   PW Y HVGVELALDH  SPFLK   D  C H+LE H
Sbjct  404   MPGILLNEGAPEAVRRVAERLLRVPWCYTHVGVELALDHKRSPFLKDTMDPACYHDLEAH  463

Query  1355  LHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVV  1534
             LHL+DGYHG G RF  A+GRD ALVNK  +FLK  HGVPP WRQDENKGMVR  DGRWV 
Sbjct  464   LHLIDGYHGRGERFVLASGRDPALVNKACDFLKDHHGVPPCWRQDENKGMVRGRDGRWVQ  523

Query  1535  PER  1543
             P+R
Sbjct  524   PDR  526



>gb|KDP21364.1| hypothetical protein JCGZ_21835 [Jatropha curcas]
Length=512

 Score =   453 bits (1165),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 236/439 (54%), Positives = 297/439 (68%), Gaps = 24/439 (5%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             RN+ + W EI G  +W GLLDPMD  LR E+IRYGE  QA YD F FD +S+YCGTC+Y 
Sbjct  86    RNIADKWQEIHGKNNWSGLLDPMDPILRSELIRYGEMTQATYDGFFFDQYSQYCGTCRYM  145

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
               +FF+KLG+   GY +SRYL+ATS +  P FF+ S     WS +ANW+GYVAV+ DE  
Sbjct  146   HLEFFQKLGLDHLGYYVSRYLFATSTLKFPKFFRKSVFPTKWSSNANWIGYVAVSNDET-  204

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH----FRDDPDIKIESGFFDLYTNSKK  817
               RLGRRDIVI WRGTVT LEW+ DL +   P         +P++K ESGF DLYT+  K
Sbjct  205   TARLGRRDIVICWRGTVTGLEWLEDLMSFQKPISDYKIQSPEPNVKAESGFLDLYTD--K  262

Query  818   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  997
             D  C +C +SAREQ+LAE+ +L E+Y GE LSIT+TGHSLG ALA+LSA+DIAE  +  +
Sbjct  263   DPSCRYCKFSAREQILAEIKKLTEKYPGEELSITITGHSLGGALAVLSAFDIAETALQKM  322

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1177
             +               + ++ +  F+FAGPRVGN+RF+ER ++LG+KVLR+ NV D VP 
Sbjct  323   E--------------DSKRVKVCAFTFAGPRVGNVRFRERMEKLGVKVLRVFNVHDVVPK  368

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
              PG++ NEK         +++  PW Y HVGVELALDH+ SP+LK    L  AHNLE  L
Sbjct  369   SPGLLLNEKL--PDAALKVVEGLPWCYTHVGVELALDHTNSPYLKEHASLPNAHNLEAQL  426

Query  1358  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1537
             HL+DGYHG G +F  A  RDIALVNK S+FLK E  VPP W+QDENKGMV   +GRWV P
Sbjct  427   HLLDGYHGKGTKFELAIERDIALVNKSSDFLKDELLVPPSWKQDENKGMV-FQNGRWVEP  485

Query  1538  ERSRIEAHPSDTGHHFRKV  1594
             ER + + H SD  HH +KV
Sbjct  486   ERPKPDDHSSDVHHHLQKV  504



>gb|KDO53917.1| hypothetical protein CISIN_1g048560mg, partial [Citrus sinensis]
Length=431

 Score =   445 bits (1144),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 235/429 (55%), Positives = 290/429 (68%), Gaps = 23/429 (5%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L +IW +I G  DW+G+LDP+D  LR E+IRYGE  QAC+D+FDF+P SKYCG+CKY 
Sbjct  22    RKLADIWHDIHGVDDWDGMLDPLDPLLRSELIRYGEMVQACHDAFDFEPFSKYCGSCKYA  81

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
              ++FFE LGMA  GY+++ Y++AT NINLPN FQ S     WS  ANW+GY+AV+ DE  
Sbjct  82    PSEFFECLGMAQHGYQVNSYIHATYNINLPNIFQRSLRPDAWSHTANWIGYIAVSNDEMS  141

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  817
                LGRRDI IAWRGT T LEWI D    L P   +     DP +K+ESGF +LYTN  K
Sbjct  142   A-HLGRRDITIAWRGTKTKLEWIADFMYFLRPITLKKIPCPDPRVKVESGFLNLYTN--K  198

Query  818   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  997
             D     C  SARE +L EV RL+ +Y+ ENLSIT+TGHSLG+ALA+LSAYDIAE  V+V+
Sbjct  199   DQSSQICKRSAREHVLEEVRRLVSQYQNENLSITITGHSLGSALAILSAYDIAETGVDVM  258

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1177
                                +PI VFSFAGPRVGN RFKER  +LG+KVLR+VN+ DK+P 
Sbjct  259   D--------------DGQAVPICVFSFAGPRVGNTRFKERLAQLGVKVLRVVNIHDKIPE  304

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
              PG+  NE       L  + ++  W Y+HVG EL LDH  SPFLK   DL C HNLE HL
Sbjct  305   APGLFLNEHI--PPMLRKLGEASLWFYSHVGAELTLDHKSSPFLKETNDLACYHNLEAHL  362

Query  1358  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1537
             HL+DGY G G+RF   +GRDIALVNK ++FLK    VPP W+Q ENKG+VR ++GRWV  
Sbjct  363   HLLDGYQGKGQRFVLTSGRDIALVNKQADFLKDHLLVPPNWQQHENKGLVRNNEGRWVQR  422

Query  1538  ERSRIEAHP  1564
             ER  +  +P
Sbjct  423   ERLNLGDYP  431



>ref|XP_006420095.1| hypothetical protein CICLE_v10006964mg [Citrus clementina]
 gb|ESR33335.1| hypothetical protein CICLE_v10006964mg [Citrus clementina]
Length=481

 Score =   444 bits (1142),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 234/429 (55%), Positives = 288/429 (67%), Gaps = 23/429 (5%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L +IW +I G  DW+G+LDP+D  LR E+IRYGE  QACYD+FDF+P SKYCG CKY 
Sbjct  72    RKLADIWRDIHGVDDWDGMLDPLDPLLRSELIRYGEMVQACYDAFDFEPFSKYCGCCKYA  131

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
              ++FFE LGM   GY+++ Y++AT NINLPN FQ S     WS  ANW+GY+AV+ DE  
Sbjct  132   PSEFFECLGMTQHGYQVNSYIHATYNINLPNIFQRSLRPDAWSHTANWIGYIAVSNDEMS  191

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  817
                LG+RDI IAWRGT T LEWI D    L P   +     DP +K+ESGF +LYTN  K
Sbjct  192   A-HLGQRDITIAWRGTKTKLEWIADFMYFLRPITLKKIPCPDPRVKVESGFLNLYTN--K  248

Query  818   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  997
             D     C  SARE +L EV RL+ +Y+ ENLSIT+TGHSLG+ALA+LSAYDIAE  V+V+
Sbjct  249   DQSSQICKRSAREHVLEEVRRLVSQYQNENLSITITGHSLGSALAILSAYDIAETGVDVM  308

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1177
                                +PI VFSFAGPRVGN RFKER  +LG+KVLR+VN+ DK+P 
Sbjct  309   D--------------DGQAVPICVFSFAGPRVGNTRFKERLAQLGVKVLRVVNIHDKIPE  354

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
              PG+  NE       L  + ++  W Y+HVG EL LDH  SPFLK   DL C HNLE HL
Sbjct  355   APGLFLNEHI--PPMLRKLGEASLWFYSHVGAELTLDHKSSPFLKETNDLACYHNLEAHL  412

Query  1358  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1537
             HL+DGY G G+RF   +GRDIALVNK ++FLK    VPP W+Q ENKG+VR ++GRWV  
Sbjct  413   HLLDGYQGKGQRFVLTSGRDIALVNKQADFLKDHLLVPPNWQQHENKGLVRNNEGRWVQR  472

Query  1538  ERSRIEAHP  1564
             ER  +  +P
Sbjct  473   ERLNLGDYP  481



>ref|XP_007034959.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
 gb|EOY05885.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
Length=500

 Score =   440 bits (1132),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 228/426 (54%), Positives = 289/426 (68%), Gaps = 23/426 (5%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L + W ++ G  DW G+LDP    LR E+ RYGE AQACYD+FDFDP S YCG+CK+   
Sbjct  82    LADTWRKLHGEDDWVGMLDPFHPLLRSELTRYGEMAQACYDAFDFDPFSIYCGSCKFSPG  141

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             +FF+ LG+   GY ++ YL+AT NIN P+FF+ S  +  WSQ ANW+G+VAV+ DE    
Sbjct  142   KFFQSLGLTQHGYEVTCYLHATCNINFPSFFKRSLRSEKWSQAANWIGFVAVSNDETSA-  200

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNSKKDT  823
              LGRRDI IAWRGTVT LEW+ D    L P   R     DP +++E+GF  LYT+  ++ 
Sbjct  201   HLGRRDITIAWRGTVTRLEWLADFMYFLRPIKVRMIPCPDPRVEVETGFLHLYTD--RNR  258

Query  824   DCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
             +C F  YSAREQ+L EV RL++++KGE LSIT+TGHSLG+ALA+L+AYDIAE  V ++  
Sbjct  259   NCPFSKYSAREQVLTEVKRLMQQHKGEKLSITITGHSLGSALAILNAYDIAETGVEIMD-  317

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1183
                               PI VFSF+GPRVGN+RFKER D+LG+KVLR+ NV D+VP  P
Sbjct  318   -------------DGQAAPICVFSFSGPRVGNIRFKERIDKLGVKVLRVRNVHDQVPLAP  364

Query  1184  GIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1363
             GI  NE+      L+ + + F W Y+HVGVELAL+H  SPFLK   DL C HNLE HLHL
Sbjct  365   GIFFNERV--PSTLQKLAERFSWWYSHVGVELALNHKDSPFLKETNDLACFHNLEAHLHL  422

Query  1364  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             +DGYHG GR+F  A GRDIALVNK ++FLK  + VPP W Q ENKG+V+   G W+  ER
Sbjct  423   IDGYHGKGRKFVLANGRDIALVNKATDFLKDHYLVPPNWWQRENKGLVQNHKGHWIQLER  482

Query  1544  SRIEAH  1561
               +E H
Sbjct  483   QDLEDH  488



>ref|XP_004493750.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X2 [Cicer arietinum]
Length=501

 Score =   435 bits (1118),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 224/441 (51%), Positives = 298/441 (68%), Gaps = 28/441 (6%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             +  +W +I G  +W  LLDPMD  +R E+IRYGE AQACYD+FDFDP+SKYCG+CK    
Sbjct  70    IQNVWRKIHGEDNWAELLDPMDPLMRSELIRYGEMAQACYDAFDFDPYSKYCGSCKLRSQ  129

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSS-VNRIWSQHANWMGYVAVATDEAEI  652
             +FF  L +   GY ++RYLYAT+N+N+P+FF+ S   ++ WS+HANWMGYVAV+ DE   
Sbjct  130   EFFPSLDLPHIGYTVTRYLYATANVNVPDFFKRSRWPDKYWSEHANWMGYVAVSNDET-T  188

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSKKD  820
             +RLGRRDIVIAWRGTVT++EW+ +L+N L P  + D P    D+++E+GF D+YT+  K 
Sbjct  189   KRLGRRDIVIAWRGTVTHVEWVANLQNFLKPI-YEDIPCPDNDVRVEAGFLDMYTD--KQ  245

Query  821   TDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
                 +C YSAREQ+L E+ RL+E+Y  E +S+T+TGHSLG+A+A LSA+DIAE  +N+ +
Sbjct  246   IKDGYCKYSAREQVLGELKRLLEKYSNEEVSVTLTGHSLGSAMATLSAFDIAETGLNIRE  305

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDE-LGIKVLRIVNVRDKVPT  1177
              GE                   VFSF+GPRVGN++FK R +  LGIKVLR+ N  D VP 
Sbjct  306   NGEKIHVS--------------VFSFSGPRVGNVKFKGRLERHLGIKVLRVRNKHDLVPK  351

Query  1178  VPGIIANEKFQYQKQLETMLKSF--PWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1351
              PG   NE       L  + + F  PW Y HVGV+L LDH  SPFL    D  CAHNLE 
Sbjct  352   SPGFFINE--TSPAWLLKIAEDFDMPWCYTHVGVDLELDHKISPFLNPDGDAACAHNLEA  409

Query  1352  HLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
             HLH++DGYHG  R + + T RDIALVNK  +F+K EH VPP WRQD N+ MV+T DG+WV
Sbjct  410   HLHVLDGYHGRNRGYEATTNRDIALVNKACDFVKDEHSVPPSWRQDLNRNMVKTEDGKWV  469

Query  1532  VPERSRIEAHPSDTGHHFRKV  1594
             + +R +++ +  D   H  ++
Sbjct  470   LAQRPQLDDNYEDIQPHLSQL  490



>ref|XP_004493749.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X1 [Cicer arietinum]
Length=506

 Score =   435 bits (1118),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 224/441 (51%), Positives = 298/441 (68%), Gaps = 28/441 (6%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             +  +W +I G  +W  LLDPMD  +R E+IRYGE AQACYD+FDFDP+SKYCG+CK    
Sbjct  70    IQNVWRKIHGEDNWAELLDPMDPLMRSELIRYGEMAQACYDAFDFDPYSKYCGSCKLRSQ  129

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSS-VNRIWSQHANWMGYVAVATDEAEI  652
             +FF  L +   GY ++RYLYAT+N+N+P+FF+ S   ++ WS+HANWMGYVAV+ DE   
Sbjct  130   EFFPSLDLPHIGYTVTRYLYATANVNVPDFFKRSRWPDKYWSEHANWMGYVAVSNDET-T  188

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSKKD  820
             +RLGRRDIVIAWRGTVT++EW+ +L+N L P  + D P    D+++E+GF D+YT+  K 
Sbjct  189   KRLGRRDIVIAWRGTVTHVEWVANLQNFLKPI-YEDIPCPDNDVRVEAGFLDMYTD--KQ  245

Query  821   TDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
                 +C YSAREQ+L E+ RL+E+Y  E +S+T+TGHSLG+A+A LSA+DIAE  +N+ +
Sbjct  246   IKDGYCKYSAREQVLGELKRLLEKYSNEEVSVTLTGHSLGSAMATLSAFDIAETGLNIRE  305

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDE-LGIKVLRIVNVRDKVPT  1177
              GE                   VFSF+GPRVGN++FK R +  LGIKVLR+ N  D VP 
Sbjct  306   NGEKIHVS--------------VFSFSGPRVGNVKFKGRLERHLGIKVLRVRNKHDLVPK  351

Query  1178  VPGIIANEKFQYQKQLETMLKSF--PWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1351
              PG   NE       L  + + F  PW Y HVGV+L LDH  SPFL    D  CAHNLE 
Sbjct  352   SPGFFINET--SPAWLLKIAEDFDMPWCYTHVGVDLELDHKISPFLNPDGDAACAHNLEA  409

Query  1352  HLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
             HLH++DGYHG  R + + T RDIALVNK  +F+K EH VPP WRQD N+ MV+T DG+WV
Sbjct  410   HLHVLDGYHGRNRGYEATTNRDIALVNKACDFVKDEHSVPPSWRQDLNRNMVKTEDGKWV  469

Query  1532  VPERSRIEAHPSDTGHHFRKV  1594
             + +R +++ +  D   H  ++
Sbjct  470   LAQRPQLDDNYEDIQPHLSQL  490



>gb|KEH23856.1| phospholipase A1 [Medicago truncatula]
Length=503

 Score =   432 bits (1110),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 222/445 (50%), Positives = 304/445 (68%), Gaps = 35/445 (8%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             + + W +I G  DW GLLDPMD  +R E+IRYGE +QACYD+FDFDP+SKYCG+CK+   
Sbjct  74    IEKAWRKIHGEDDWVGLLDPMDPIMRSELIRYGEKSQACYDAFDFDPYSKYCGSCKHPHL  133

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSS-VNRIWSQHANWMGYVAVATDEAEI  652
             +FF  L +   GY ++RYLYAT+N+N+P+FF+ S   ++ WS+HANWMGY+AV+ DEA  
Sbjct  134   EFFPSLDLPHIGYDVTRYLYATANVNVPDFFKKSRWPDKYWSEHANWMGYIAVSNDEA-T  192

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSKKD  820
             +++GRRDIVIAWRGTVT++EW+ +L+N L P  ++D P    D+++E+GF D+YT+  + 
Sbjct  193   KQIGRRDIVIAWRGTVTHVEWVANLQNYLKPL-YKDIPCPDNDVRVEAGFLDMYTD--RH  249

Query  821   TDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
                 +C YSAREQ+L EV RL+ ++  E +SIT+TGHSLG+A+A LSA+DIAE  +NV +
Sbjct  250   IKDGYCKYSAREQVLGEVRRLLAKFPNEEVSITLTGHSLGSAMATLSAFDIAETGLNVRE  309

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDE-LGIKVLRIVNVRDKVPT  1177
              GE                   VFSF+GPRVGN++FK R ++ LG+K+LR+ N  D VP 
Sbjct  310   NGEKIHVS--------------VFSFSGPRVGNVKFKGRLEKHLGVKILRVHNKHDMVPK  355

Query  1178  VPGIIANEK-----FQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHN  1342
              PG + NEK      ++ + ++      PW Y HVGVEL LDH  SPFL    D  CAHN
Sbjct  356   SPGFLINEKSPAWLLKFAEDID-----IPWCYTHVGVELELDHKISPFLNPNADAACAHN  410

Query  1343  LEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDG  1522
             LE HLH++DGYHG  R + + T RDIALVNK  +F+K EH VPP WRQD N+ MV+T DG
Sbjct  411   LEAHLHILDGYHGSNRGYEATTDRDIALVNKSCDFVKDEHYVPPNWRQDLNRNMVKTEDG  470

Query  1523  RWVVPERSR-IEAHPSDTGHHFRKV  1594
             RW++  R + ++ H  D   H  ++
Sbjct  471   RWMLAHRPQVVDTHHEDLEPHLSQI  495



>emb|CDM86669.1| unnamed protein product [Triticum aestivum]
Length=540

 Score =   431 bits (1108),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 235/440 (53%), Positives = 298/440 (68%), Gaps = 29/440 (7%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W E+ G  DW+GLLDP+D  LR E+IRYGEF+QACYDSFD+D +S+Y GTCKY    FF+
Sbjct  101   WREMHGCNDWDGLLDPIDRTLRGELIRYGEFSQACYDSFDYDRYSRYAGTCKYAQESFFK  160

Query  488   KLGMADRGYRISRYLYATSNINLPNFF---QHSSVNRIWSQHANWMGYVAVATDEAEIRR  658
              +G+A  GY ++RYLYATS+   P+F     + S +R+WS+   ++G++AV+TDE E  R
Sbjct  161   DVGLAGVGYEVARYLYATSHARFPSFGVKKHNPSDDRMWSETGTFIGFIAVSTDE-ETAR  219

Query  659   LGRRDIVIAWRGTVTYLEWIHDLKNILHPT-HFR---DDPDIKIESGFFDLYTNSKKDTD  826
             +GRRDI +AWRGTVT LEWI D+   L P   F     DP +K+E GF +LYT+  K+ D
Sbjct  220   IGRRDIAVAWRGTVTKLEWIADVTAFLKPVGQFGLPCPDPSVKVEEGFAELYTS--KNPD  277

Query  827   CNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
             C +C YSAREQ+LAEV +L+ERY  +GE +S+TVTGHSLGAALA+L AYDIAE +VNV  
Sbjct  278   CKYCKYSAREQVLAEVRKLVERYTAQGEEVSVTVTGHSLGAALAVLCAYDIAETRVNV--  335

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPT  1177
                         ++   K P+ VFS++GPRVGN  F+ER + ELG+K LRI+NV D VP 
Sbjct  336   ------------STTGAKAPVCVFSYSGPRVGNPMFRERFEGELGVKALRILNVHDSVPK  383

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
             VPGI                   P  Y+H+GVELALDH  SPFLK   DL C HNLE HL
Sbjct  384   VPGIFTEAVLPMPLLRVAGALGLPSVYSHIGVELALDHKLSPFLKDVFDLACYHNLEAHL  443

Query  1358  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1537
             HL+DGY G G+ F+   GRD ALVNK ++FL  EH VP  WRQ+ NKGMVRT DGRW++P
Sbjct  444   HLLDGYQGRGKEFKLG-GRDPALVNKAADFLMDEHMVPDGWRQELNKGMVRTEDGRWMLP  502

Query  1538  ERSR-IEAHPSDTGHHFRKV  1594
              R R +E HP DT  H  ++
Sbjct  503   HRPRNVEEHPEDTDLHLAEL  522



>ref|XP_007162494.1| hypothetical protein PHAVU_001G156900g [Phaseolus vulgaris]
 gb|ESW34488.1| hypothetical protein PHAVU_001G156900g [Phaseolus vulgaris]
Length=501

 Score =   428 bits (1100),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 224/421 (53%), Positives = 287/421 (68%), Gaps = 24/421 (6%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L E+W +I G  +W GLLDPMD  +R E+I YGE AQACYD+FD+DP+SKYCG+C++   
Sbjct  71    LAEVWRKIHGEDNWAGLLDPMDPVMRAELIHYGEMAQACYDAFDYDPYSKYCGSCRFSVP  130

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSS-VNRIWSQHANWMGYVAVATDEAEI  652
             +FF+ L M + GY I+RYLYAT+NI LP  F+ S   ++ WS+HANW G++AV +D+A  
Sbjct  131   EFFQSLDMPNVGYTITRYLYATANIKLPKLFRKSRWPDKRWSKHANWAGFIAV-SDDATS  189

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPT--HFRDDPD-IKIESGFFDLYTNSKKDT  823
             +RLGRRDI IAWRGTVT +EW+ DL N L P   H     + +K+E+GF DLYT+  K+T
Sbjct  190   KRLGRRDITIAWRGTVTNVEWVADLTNYLRPITPHVPCSVEGVKVEAGFLDLYTD--KET  247

Query  824   DCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
             +C FC YSAREQ+L EV RL++ Y+ E +SIT TGHSLG+A+A LSA+D+ E  VNV ++
Sbjct  248   ECGFCKYSAREQVLGEVRRLMKVYENEEVSITTTGHSLGSAMATLSAFDVVENGVNVGKD  307

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPTV  1180
             G                    VFSF+GPRVGN+RFKER + ELGIKVLR++N  D V   
Sbjct  308   GRKAHVS--------------VFSFSGPRVGNVRFKERLEKELGIKVLRVLNKHDLVSQS  353

Query  1181  PGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLH  1360
             PG+  NE     + L  +++  PW Y HVG +L LDH  SPFL    D+ CAHNLE  LH
Sbjct  354   PGLFFNE--DSPRWLVKLVEWLPWCYLHVGEQLELDHKKSPFLNPDADVACAHNLEAQLH  411

Query  1361  LVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPE  1540
             L+DGYHG    F+  + RDIALVNK  +FLK EH VPP WRQD NK M +T +G WV  E
Sbjct  412   LLDGYHGKNDAFKRTSLRDIALVNKACDFLKDEHSVPPYWRQDLNKNMTKTEEGTWVFSE  471

Query  1541  R  1543
             R
Sbjct  472   R  472



>dbj|BAJ85518.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=535

 Score =   428 bits (1100),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 233/440 (53%), Positives = 297/440 (68%), Gaps = 29/440 (7%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W E+ G  DW+GLLDP+D  LR E+IRYGEF+QACYDSFD+D  S+Y GTCKY    FF+
Sbjct  96    WREMHGCNDWDGLLDPIDRTLRGELIRYGEFSQACYDSFDYDRFSRYAGTCKYAQETFFK  155

Query  488   KLGMADRGYRISRYLYATSNINLPNFF---QHSSVNRIWSQHANWMGYVAVATDEAEIRR  658
              +G+   GY ++RYLYATS+   P+F     + S +R+WS+   ++G++AV+TDE E  R
Sbjct  156   DVGLTGVGYEVARYLYATSHARFPSFGVQKHNPSDDRMWSETGTFIGFIAVSTDE-ETAR  214

Query  659   LGRRDIVIAWRGTVTYLEWIHDLKNILHPT-HFR---DDPDIKIESGFFDLYTNSKKDTD  826
             +GRRDI +AWRGTVT LEWI D+   L P   F     DP +K+E GF +LYT+  K+TD
Sbjct  215   IGRRDIAVAWRGTVTKLEWIADITAFLKPVGQFGLPCPDPSVKVEEGFAELYTS--KNTD  272

Query  827   CNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
             C +C YSAREQ+LAEV +L+ERY  +GE +S+TVTGHSLGAALA+L AYDIAE + NV  
Sbjct  273   CKYCKYSAREQVLAEVRKLVERYTGQGEEVSVTVTGHSLGAALAVLCAYDIAETRANV--  330

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPT  1177
                         ++   K P+ VFS++GPRVGN RF+ER + +LG+K LRI+NV D VP 
Sbjct  331   ------------STTGAKAPVCVFSYSGPRVGNPRFRERFEGDLGVKALRILNVHDSVPK  378

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
             VPGI                   P  Y+H+GVELAL+H  SPFLK   DL C HNLE HL
Sbjct  379   VPGIFTEAVLPMPLLRVAGALGLPSVYSHIGVELALNHRLSPFLKNVFDLACYHNLEAHL  438

Query  1358  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1537
             HL+DGY G G+ F+   GRD ALVNK ++FL  EH VPP WRQ+ NKG+VRT DGRW +P
Sbjct  439   HLLDGYQGRGKEFKLG-GRDPALVNKAADFLVDEHMVPPVWRQEFNKGLVRTEDGRWQLP  497

Query  1538  ERSR-IEAHPSDTGHHFRKV  1594
              R R +E HP DT  H  ++
Sbjct  498   HRPRHVEGHPEDTDLHLAEL  517



>ref|XP_011042425.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X2 [Populus euphratica]
Length=435

 Score =   423 bits (1088),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 230/418 (55%), Positives = 281/418 (67%), Gaps = 32/418 (8%)
 Frame = +2

Query  134   TAKPSNSFFPLTLSSPQKPYSSLKCRDSLPAAIPESSNKHdeeeedgddeegRNLHEIWA  313
             T K S S  P  LS         K  +SL + I E   + D        E  R L ++W 
Sbjct  45    TGKTSTSTIPCVLS---------KTSESLTSIITELEKEQDHGTNTNTKEPERRLADVWR  95

Query  314   EIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKL  493
             EIQG  DW GLLDPMD  LR E+IRYGE AQACYD+FDFDP SKYCG+C++   +F E L
Sbjct  96    EIQGQDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFIRRRFLESL  155

Query  494   GMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRD  673
             GMA  GY ++RYLYATSNI+LPNFF+ S   ++WS  ANW+GYVAV+ DE   + LGRRD
Sbjct  156   GMAHHGYEVTRYLYATSNIDLPNFFKKSRWPKVWSNKANWIGYVAVSDDET-TKCLGRRD  214

Query  674   IVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNFCS  841
             I IAWRGTVT+LEWI DL + L P +       DP +K+E GF DLYT+  KD +C FC 
Sbjct  215   ISIAWRGTVTHLEWISDLMDFLKPINANKIPCPDPTVKVEYGFLDLYTD--KDENCRFCK  272

Query  842   YSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegd  1021
             YSAREQ+L+EV RL E Y  E +SIT+TGHSLG+ALA+LSAYDIAE  ++V+Q       
Sbjct  273   YSAREQILSEVKRLTEMYADEEMSITITGHSLGSALAMLSAYDIAETGLHVMQ-------  325

Query  1022  gesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1201
                        +P+SVFSF+GPRVGN+RFKER + LG+KVLR+VNV+D VP  PG+  NE
Sbjct  326   -------DGRALPVSVFSFSGPRVGNVRFKERIESLGVKVLRVVNVQDMVPKSPGLFFNE  378

Query  1202  KFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1375
               Q    L  M +  PW+Y+HVGVELALDH  SPFLK  +D  CAHNLE HLHL+DG+
Sbjct  379   --QMPPPLMKMAEGLPWAYSHVGVELALDHRNSPFLKQTSDPACAHNLEAHLHLLDGF  434



>dbj|BAJ99811.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=517

 Score =   424 bits (1091),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 239/432 (55%), Positives = 300/432 (69%), Gaps = 30/432 (7%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W E+ GS DW+GLLDP+D+ LR E+IRYGEFAQACYDSFD+D  S+Y G+CKY    FFE
Sbjct  81    WRELHGSNDWQGLLDPIDTVLRGELIRYGEFAQACYDSFDYDRFSRYSGSCKYPTRTFFE  140

Query  488   KLGMADRGYRISRYLYATSNINLPNF--FQHS-SVNRIWSQHANWMGYVAVATDEAEIRR  658
              +G+A  GY ++RYLYATS+ + PNF  ++H+   +++WS+ A ++G+VAV+TDE E  R
Sbjct  141   DVGLAGVGYEVTRYLYATSHPSYPNFSIWKHNPGDDKLWSESATFIGFVAVSTDE-ETAR  199

Query  659   LGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTD  826
             +GRRDI +AWRGTVT LEW+ DL  +L P         DP +K+E+GF DLY    KD+ 
Sbjct  200   IGRRDIAVAWRGTVTRLEWVADLTAMLKPLSACGVPCPDPSVKVETGFVDLYVG--KDSA  257

Query  827   CNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
             C F SYSAREQ+LAEV +L+ERY  +GE +S+TVTGHSLG+ALA++SA+DIAE   NV  
Sbjct  258   CRFSSYSAREQVLAEVRKLVERYAGRGEEVSVTVTGHSLGSALAMISAFDIAESGANV--  315

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPT  1177
                       S ++   K P+ VFSFAGPRVGN RFK+R + ELG+K LRI NV D VP 
Sbjct  316   ----------SPSAGGKKAPVCVFSFAGPRVGNTRFKKRFEGELGVKTLRIRNVHDMVPK  365

Query  1178  VPGIIANEKF--QYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1351
             VPG + NE        ++  ML+  P  Y HVGVEL LDH  SPFLK   DL   HNLE 
Sbjct  366   VPGFLFNEAIFPAVLLRVADMLR-VPSVYTHVGVELTLDHIVSPFLKPTGDLASYHNLEA  424

Query  1352  HLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
             HLHL+DGY   G+ F    GRD ALVNK  +FL+ EH VPP WRQ+ENKGMVRT DGRW 
Sbjct  425   HLHLLDGYRAHGQPFELG-GRDPALVNKAIDFLRDEHMVPPGWRQEENKGMVRTEDGRWA  483

Query  1532  VPERSR-IEAHP  1564
             + +  R +EAHP
Sbjct  484   LLQLPRDVEAHP  495



>ref|XP_002437873.1| hypothetical protein SORBIDRAFT_10g004170 [Sorghum bicolor]
 gb|EER89240.1| hypothetical protein SORBIDRAFT_10g004170 [Sorghum bicolor]
Length=546

 Score =   423 bits (1087),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 235/448 (52%), Positives = 298/448 (67%), Gaps = 29/448 (6%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI GS  WEGLLDP+D+ LR E+IRYGE AQACYDSFD+D  S YCG+C++    FF+
Sbjct  101   WREIHGSDHWEGLLDPIDAVLRGELIRYGELAQACYDSFDYDRFSPYCGSCRFPAKTFFQ  160

Query  488   KLGMADRGYRISRYLYATSN-INLPNFFQH------SSVNRIWSQHANWMGYVAVATDEA  646
              +G+   GY ++RYLYATSN + LPNF         ++ +++WS+   ++GYVAV+TDE 
Sbjct  161   DVGLGGAGYEVTRYLYATSNDLKLPNFRSRKHRSAAAAADKLWSEMGTFIGYVAVSTDE-  219

Query  647   EIRRLGRRDIVIAWRGTVTYLEWIHD-------LKNILHPTHFRDDPDIKIESGFFDLYT  805
             E  RLGRRDIV++WRGTVT LEW+ D       L  +  P     DPD+K+E GF +LYT
Sbjct  220   ETARLGRRDIVVSWRGTVTRLEWVADVTANQTRLSGMGVPC---PDPDVKVEMGFAELYT  276

Query  806   NSKKDTDCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAE  979
                KD  C FC YSAREQ LAEV + +E Y  +GE +S+TVTGHSLG+ALA+L+A+DIAE
Sbjct  277   G--KDAACRFCRYSAREQALAEVRKQVEVYHGRGEQVSVTVTGHSLGSALAMLNAFDIAE  334

Query  980   MKVNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELGIKVLRIVN  1156
                N           +        + P+ VFSFAGPRVGNLRF+ER + ELG++ LR+VN
Sbjct  335   TGANA---SPEPELDDDGRRCRKAQAPVCVFSFAGPRVGNLRFRERFERELGVRALRVVN  391

Query  1157  VRDKVPTVPGIIANEKFQYQKQLETMLK-SFPWSYAHVGVELALDHSYSPFLKTGTDLGC  1333
             V D VP VPG+  NE    +  L  +        Y H+GV LALDH  SPFLK   D+ C
Sbjct  392   VHDGVPKVPGVFFNEAAFPEAVLRAVDGLGAAGVYTHLGVPLALDHRASPFLKETMDISC  451

Query  1334  AHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRT  1513
              HNLE HLHL+DG+ G G  F+   GRD ALVNK ++FL+ EH VPP W Q+ENKGMVRT
Sbjct  452   YHNLEAHLHLLDGFRGSGEVFQ-LRGRDPALVNKSADFLRDEHMVPPVWYQEENKGMVRT  510

Query  1514  SDGRWVVPERSR-IEAHPSDTGHHFRKV  1594
              DGRWV+P R R I+ HP DT HH +++
Sbjct  511   EDGRWVLPPRHRDIDEHPDDTDHHLQQL  538



>ref|XP_002456959.1| hypothetical protein SORBIDRAFT_03g046400 [Sorghum bicolor]
 gb|EES02079.1| hypothetical protein SORBIDRAFT_03g046400 [Sorghum bicolor]
Length=529

 Score =   421 bits (1083),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 241/449 (54%), Positives = 299/449 (67%), Gaps = 37/449 (8%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI G  DWEGLLDP+D+ LR E+IRYGEFAQACYD+FD+D  S+YCG+ +Y    FF 
Sbjct  93    WREIHGRGDWEGLLDPIDTVLRGELIRYGEFAQACYDAFDYDRFSRYCGSSRYPPPTFFR  152

Query  488   KLGMADRGYRISRYLYATSNINLPNFF----QHSSVN----RIWSQHANWMGYVAVATDE  643
              +G+   GY ++R+LYATSN  LPNF     +H S +    R+WS+ A+++G+VAV+TDE
Sbjct  153   DVGLDGVGYEVTRFLYATSNARLPNFVGARRKHRSGDDPDARLWSETASFIGFVAVSTDE  212

Query  644   AEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNS  811
              E  R+GRRDI +AWRGTVT LEW+ DL     P      P      K+ESGF +LYT  
Sbjct  213   -ETARIGRRDIAVAWRGTVTRLEWVADLTAAPRPAADFGIPCPDHGAKVESGFAELYTG-  270

Query  812   KKDTDCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMK  985
              KD  C +C YSAREQ+LAEV +L++ Y  +GE +S+TVTGHSLG+ALA LSA+D+AE  
Sbjct  271   -KDPSCRWCRYSAREQVLAEVRKLVDLYHGRGEEVSVTVTGHSLGSALATLSAFDVAETG  329

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVR  1162
              NV             S       P+ VFSF+GPRVGN RFK R + ELG+KVLR+VNV 
Sbjct  330   ANV-------------SPDGGRTAPVCVFSFSGPRVGNTRFKTRLERELGVKVLRVVNVH  376

Query  1163  DKVPTVPGI--IANEKFQYQKQLETMLK-SFPWSYAHVGVELALDHSYSPFLKTGT-DLG  1330
             D VPTVPG+  + +E+   +  L  M        Y HVGVELALDH  SP+LK  T DL 
Sbjct  377   DMVPTVPGVLYVLDERSFPEAVLRLMDNLGMGAVYVHVGVELALDHKVSPYLKAETLDLA  436

Query  1331  CAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVR  1510
             C HNLE HLHL+DGY G  R FR   GRD ALVNK ++FL+ EH VPP WRQD NKGMVR
Sbjct  437   CFHNLEAHLHLLDGYQGRAREFR-LCGRDPALVNKAADFLRDEHMVPPVWRQDANKGMVR  495

Query  1511  TSDGRWVVPERSR-IEAHPSDTGHHFRKV  1594
               DGRWV+P R R +  HP DT HH +++
Sbjct  496   AEDGRWVLPPRHREVHDHPEDTDHHLQRL  524



>ref|XP_002455039.1| hypothetical protein SORBIDRAFT_03g003410 [Sorghum bicolor]
 gb|EES00159.1| hypothetical protein SORBIDRAFT_03g003410 [Sorghum bicolor]
Length=513

 Score =   419 bits (1077),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 232/442 (52%), Positives = 293/442 (66%), Gaps = 28/442 (6%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI GS +WEGLLDP+D  LR E+IRYGEFAQA YDSFD+D  S YCG+CKY    FF 
Sbjct  81    WREIHGSNNWEGLLDPIDDVLRGELIRYGEFAQATYDSFDYDRFSPYCGSCKYPARTFFH  140

Query  488   KLGMADRGYRISRYLYATSN-INLPNFF--QHSSVN-RIWSQHANWMGYVAVATDEAEIR  655
              +G+   GY +SRYLYAT N + LPNF   +H++ + ++WS+   ++GYVAV+TDE E  
Sbjct  141   DVGLGGVGYEVSRYLYATCNGLKLPNFANRKHTAADAKLWSESGTFIGYVAVSTDE-ETA  199

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  823
             RLGRRDI +AWRGT+T LEW+ DL +   P         DPD+K+E GF  LYT+  KD 
Sbjct  200   RLGRRDIAVAWRGTITRLEWVADLTSDQIPLRETGVPCPDPDVKVERGFAALYTD--KDA  257

Query  824   DCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVV  997
              C FC YSAREQ LAEV +L+E Y  +GE +S+TVTGHSLG+ LA+L A+D+AE + N  
Sbjct  258   GCRFCRYSAREQALAEVRKLVELYHGRGEQVSVTVTGHSLGSGLAMLCAFDVAETRANA-  316

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVP  1174
                       S         P+ VFSFAGPRVGN+ F+ R + ELG++ LR+VNV D+VP
Sbjct  317   ----------SPDDGRVRVAPVCVFSFAGPRVGNVGFRRRFERELGVRALRVVNVHDRVP  366

Query  1175  TVPGIIANEKFQYQKQLETMLK-SFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1351
              VPG+  NE    +  L  + +      Y H+GV L LDH  SPFLK   D+ C HNLE 
Sbjct  367   KVPGVFFNEAAFPELVLRAVGRLGVGGVYTHLGVALELDHRASPFLKETLDISCYHNLEA  426

Query  1352  HLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
             HLHL+DG+ G G  F    GRD ALVNK S+FL+ +H VPP W Q ENKGMVRT DGRWV
Sbjct  427   HLHLLDGFRGSGEGF-ELRGRDPALVNKSSDFLREDHMVPPVWYQAENKGMVRTEDGRWV  485

Query  1532  VPERSR-IEAHPSDTGHHFRKV  1594
             +P R R ++ HP DT HH +++
Sbjct  486   LPPRQRELDQHPEDTDHHLQRL  507



>ref|XP_008648833.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Zea 
mays]
Length=492

 Score =   418 bits (1074),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 235/443 (53%), Positives = 296/443 (67%), Gaps = 32/443 (7%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI GS  WEG LDP+D+ LR E+IRYGEFAQACYDSFD+D  S YCG+C++    FF+
Sbjct  60    WREIHGSDHWEGQLDPIDAVLRGELIRYGEFAQACYDSFDYDRFSPYCGSCRFPAKTFFQ  119

Query  488   KLGMADRGYRISRYLYATSN-INLPNFF--QHSSV--NRIWSQHANWMGYVAVATDEAEI  652
              +G+   GY++SRYLYAT N + LPNF   +HSS   +++WS+   ++GYVAV+TDE E 
Sbjct  120   DVGLGGAGYQVSRYLYATCNDLKLPNFGGRKHSSAANDKLWSELGTFIGYVAVSTDE-ET  178

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDL----KNILHPTHFRDDPDIKIESGFFDLYTNSKKD  820
              RLGRRDI ++WRGT+T LEW+ DL    K +        DPD+K+E GF +LYT   KD
Sbjct  179   ARLGRRDIAVSWRGTITRLEWVADLTANQKRLSELGVPCPDPDVKVEMGFAELYTG--KD  236

Query  821   TDCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNV  994
               C FC YSAREQ LAEV + +E Y  +GE +S+TVTGHSLG+ALA+L+A+D+AE   N 
Sbjct  237   AACRFCRYSAREQALAEVRKQVELYHGRGEQVSVTVTGHSLGSALAMLNAFDVAETGANA  296

Query  995   VQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKV  1171
                           +    K P+ VFSFAGPRVGNLRF+ER   ELG++ LR+ NV D V
Sbjct  297   --------------SPDGRKAPVCVFSFAGPRVGNLRFRERFQRELGVRALRVFNVHDGV  342

Query  1172  PTVPGIIANEKFQYQKQLETMLK-SFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLE  1348
             P VPG+  N+    +  L  +        Y H+GV LALDH  SPFLK   D+ C HNLE
Sbjct  343   PKVPGVFFNDAAFPEAVLRVVDGLGAGGVYTHLGVPLALDHKVSPFLKETMDISCYHNLE  402

Query  1349  GHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRW  1528
              HLHL+DGY G G  F+   GRD ALVNK ++FL+ EH VPP W Q ENKGMVRT DGRW
Sbjct  403   AHLHLLDGYRGSGEGFQ-LRGRDPALVNKSADFLRDEHMVPPVWYQAENKGMVRTEDGRW  461

Query  1529  VVPERSR-IEAHPSDTGHHFRKV  1594
             V+P R R I+ HP DT HH +++
Sbjct  462   VLPPRHRDIDEHPDDTDHHLQQL  484



>tpg|DAA53109.1| TPA: hypothetical protein ZEAMMB73_566262 [Zea mays]
Length=505

 Score =   418 bits (1075),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 230/440 (52%), Positives = 290/440 (66%), Gaps = 29/440 (7%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI GS +WEGLLDP+D  L +E+IRYGEFAQA YDSFD+D  S YCG+CKY    FF 
Sbjct  80    WPEIHGSNNWEGLLDPIDGVLLQELIRYGEFAQATYDSFDYDRFSPYCGSCKYPAKTFFH  139

Query  488   KLGMADRGYRISRYLYATSN-INLPNFFQHSSVN-RIWSQHANWMGYVAVATDEAEIRRL  661
              +G+   GY ++RYLYAT N +  PNF   ++ N ++WS+   ++GYVAV+TDE E  RL
Sbjct  140   DVGLGGIGYEVTRYLYATCNDLKFPNFGIKTAANAKMWSESGTFIGYVAVSTDE-ETARL  198

Query  662   GRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDC  829
             GRRDI +AWRGT+T LEW+ DL     P         DPD+K+E GF  LYT+  K T C
Sbjct  199   GRRDIAVAWRGTITRLEWVADLTANQIPLRETGVPCPDPDVKVERGFVALYTD--KGTGC  256

Query  830   NFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
              FC YSAREQ+LAEV +L++ Y  +GE +S+TVTGHSLG+ALA+L A+DIAE + NV   
Sbjct  257   RFCRYSAREQVLAEVRKLVDLYHGRGEQVSVTVTGHSLGSALAMLCAFDIAETRANV---  313

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPTV  1180
                        +      P+ VFSFAGPRVGN+ F+ R + ELG++ LR+VNV D VP V
Sbjct  314   -----------SPGDRVAPVCVFSFAGPRVGNVAFRRRFERELGVRALRVVNVHDSVPKV  362

Query  1181  PGIIANEKFQYQKQLETMLK-SFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
             PG+  NE    +  L    +      Y H+GV L LDH  SPFLK   DL C HNLE HL
Sbjct  363   PGVFFNESAFPELVLRAADRLGLGGVYTHLGVLLQLDHKVSPFLKETLDLSCYHNLEAHL  422

Query  1358  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1537
             HL+DG+ G G  F    GRD ALVNK ++FL+ +H VPP W Q ENKGMVRT DGRWV+P
Sbjct  423   HLLDGFRGSGAGFEP-RGRDPALVNKSTDFLREDHMVPPVWYQAENKGMVRTEDGRWVLP  481

Query  1538  ERSRI-EAHPSDTGHHFRKV  1594
              R R+ + HP DT HH +++
Sbjct  482   PRQRVLDDHPEDTDHHLQRL  501



>emb|CDM86668.1| unnamed protein product [Triticum aestivum]
Length=517

 Score =   417 bits (1072),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 252/506 (50%), Positives = 319/506 (63%), Gaps = 39/506 (8%)
 Frame = +2

Query  116   NITKPTTAKPSNSFFPLTLSS--------PQKPYSSLKCRDSLPAAIPESSNKHdeeeed  271
             N+ +     P+    P +L S        P +  +S    D  PA +   S   D E   
Sbjct  6     NLARSLPDSPAGDLRPASLLSKMASRGRRPSQLVTSAVSTDEAPANMSPGSVVGDMERGT  65

Query  272   gddeegRN---LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHS  442
               ++ GR+   L   W E+ GS DW+GLLDP+D+ LR E+IRYGEFAQACYDSFD+D  S
Sbjct  66    LAEKTGRSDGQLTSRWRELHGSNDWQGLLDPIDTVLRGELIRYGEFAQACYDSFDYDRFS  125

Query  443   KYCGTCKYDGAQFFEKLGMADRGYRISRYLYATSNINLPNF--FQHS-SVNRIWSQHANW  613
             +Y G+CKY    FF+ +G+A  GY ++RYLYATS+ + PNF  ++H+   +++WS+ A +
Sbjct  126   RYSGSCKYPTRTFFQDVGLAGVGYEVTRYLYATSHPSYPNFSIWKHNPGDDKLWSESATF  185

Query  614   MGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIE  781
             +G+VAV+TDE E  R+GRRDI +AWRGTVT LEW+ DL  +L P         DP +K+E
Sbjct  186   IGFVAVSTDE-ETARIGRRDIAVAWRGTVTRLEWVADLTAMLKPLSACGVPCPDPSVKVE  244

Query  782   SGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalal  955
              GF DLY    KD  C F SYSAREQ+LAEV +L+ERY  +GE + +TVTGHSLG+ALA+
Sbjct  245   RGFVDLYIG--KDPTCRFSSYSAREQVLAEVRKLVERYAGRGEEVGVTVTGHSLGSALAM  302

Query  956   lsaYDIAEMKVNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELG  1132
             LSA+DIAE   NV            S ++   K P+ VFSFAGPRVGN RFK+R + ELG
Sbjct  303   LSAFDIAESGANV------------SPSAGGKKAPVCVFSFAGPRVGNTRFKQRFEGELG  350

Query  1133  IKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETM-LKSFPWSYAHVGVELALDHSYSPFL  1309
             +K LRI NV D VP VPG + NE       L        P  Y HVGVEL LDH  SPFL
Sbjct  351   VKALRIRNVHDMVPKVPGFLFNEVIFPAVLLRVADALRVPSVYTHVGVELVLDHIVSPFL  410

Query  1310  KTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQD  1489
             K   DL   HNLE HLHL+DGY   G+ F    GRD ALVNK ++FL+ EH VPP WRQ+
Sbjct  411   KPTGDLASYHNLEAHLHLLDGYRAHGQPFELG-GRDPALVNKAADFLRDEHMVPPGWRQE  469

Query  1490  ENKGMVRTSDGRWVVPERSR-IEAHP  1564
             ENKGMVRT  GRW + +  R +EAHP
Sbjct  470   ENKGMVRTEGGRWALLQLPRDVEAHP  495



>ref|XP_011028727.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Populus 
euphratica]
Length=433

 Score =   412 bits (1059),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 225/415 (54%), Positives = 274/415 (66%), Gaps = 32/415 (8%)
 Frame = +2

Query  140   KPSNSFFPLTLSSPQKPYSSLKCRDSLPAAIPESSNKHdeeeedgddeegRNLHEIWAEI  319
             K S S  P  LS         K  +SL + I +   + D        E  R L ++W EI
Sbjct  47    KTSTSAIPRVLS---------KASESLTSTITKHEKEQDYNTNTNTKEPERKLADVWREI  97

Query  320   QGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGM  499
             QG  DW GLLDPMD  LR E+IRYGE AQACYD+FDFDP SKYCG+C++   +FFE LGM
Sbjct  98    QGKDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFMSHRFFESLGM  157

Query  500   ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIV  679
                GY ++RYLYATS I LPNFF+ S   ++WS  A+W+GYVAV+ DE   +RLGRRDI 
Sbjct  158   TRHGYEVTRYLYATSTIKLPNFFKKSRWPKVWSNSASWIGYVAVSDDET-TKRLGRRDIT  216

Query  680   IAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNFCSYS  847
             +AWRGTVT LEWI DL + L P +       DP +K+ESGF DLYT+  KD +C FC YS
Sbjct  217   VAWRGTVTRLEWIADLMDFLKPVNDNKIPCPDPTVKVESGFLDLYTD--KDENCRFCKYS  274

Query  848   AREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegdge  1027
             AREQ+LAEV RL E Y  E +SIT+TGHSLG ALA+LSAYDI E  ++V+Q         
Sbjct  275   AREQILAEVKRLTEMYADEEMSITITGHSLGGALAMLSAYDIVETGLHVMQ---------  325

Query  1028  sssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKF  1207
                   +  +P+SVFSF+GPRVGN+RFKER + LG+KVLR+VNV+D VP  PG+  NE  
Sbjct  326   -----DSRALPVSVFSFSGPRVGNVRFKERIESLGVKVLRVVNVQDVVPKSPGLFLNE--  378

Query  1208  QYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDG  1372
             Q    L  + +  PW Y+HVGVELALDH  SPFLK   D  CAHNLE  LHL+DG
Sbjct  379   QVPPMLMKLTEGLPWCYSHVGVELALDHKNSPFLKQTGDPVCAHNLEALLHLLDG  433



>ref|XP_011079989.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic isoform X2 
[Sesamum indicum]
Length=435

 Score =   408 bits (1048),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 210/367 (57%), Positives = 263/367 (72%), Gaps = 24/367 (7%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L + W+E+ G  DW GLLDPMD  LR E+IRYG  AQACYD+FDFDP+SKYCG+C++ 
Sbjct  83    RELADCWSEMLGEDDWAGLLDPMDPLLRNELIRYGVMAQACYDAFDFDPYSKYCGSCRFT  142

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
               +FFE+LGMA+ GY I+RYLYATSNINLPNFF++S   ++WS++ANW+GY+AV+ DE  
Sbjct  143   RREFFERLGMAEAGYDITRYLYATSNINLPNFFKNSRWPKVWSKNANWIGYIAVSNDETS  202

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHF----RDDPDIKIESGFFDLYTNSKK  817
              ++LGRRDI +AWRGTVT LEW+ DL + L P         DP +++ESGF DLYT+  K
Sbjct  203   -KKLGRRDICVAWRGTVTRLEWVADLMDFLRPISSDKIPSPDPTVRVESGFLDLYTD--K  259

Query  818   DTDCNFCSYSAREQLLAEVNRLI-ERYKGENLSITVTGHslgaalallsaYDIAEMKVNV  994
             D  C +C +SAREQ+L EVNRLI E Y  E +S+T+TGHSLG A ALLSAYDI E  +NV
Sbjct  260   DESCKYCKFSAREQILTEVNRLINEVYPKEEVSVTITGHSLGGASALLSAYDIVETGINV  319

Query  995   VQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVP  1174
                              +  +P+ VF+FAGPRVGN RFK R + LG+KVLR+VNV D VP
Sbjct  320   --------------RGDSRAVPVCVFTFAGPRVGNARFKARLELLGVKVLRVVNVHDVVP  365

Query  1175  TVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1354
               PG++ NEK      +  M ++FPWSY HVGVELALDH  SPFL+   DL CAHNLE H
Sbjct  366   KSPGLLVNEK--AHPLVIKMAENFPWSYVHVGVELALDHKNSPFLRHDGDLVCAHNLEAH  423

Query  1355  LHLVDGY  1375
             LHL+DG+
Sbjct  424   LHLLDGW  430



>gb|KEH23857.1| phospholipase A1 [Medicago truncatula]
Length=461

 Score =   407 bits (1045),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 209/408 (51%), Positives = 284/408 (70%), Gaps = 34/408 (8%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             + + W +I G  DW GLLDPMD  +R E+IRYGE +QACYD+FDFDP+SKYCG+CK+   
Sbjct  74    IEKAWRKIHGEDDWVGLLDPMDPIMRSELIRYGEMSQACYDAFDFDPYSKYCGSCKHPHL  133

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSS-VNRIWSQHANWMGYVAVATDEAEI  652
             +FF  L +   GY ++RYLYAT+N+N+P+FF+ S   ++ WS+HANWMGY+AV+ DE   
Sbjct  134   EFFPSLDLPHIGYDVTRYLYATANVNVPDFFKKSRWPDKYWSEHANWMGYIAVSNDET-T  192

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSKKD  820
             +++GRRDIVIAWRGTVT++EW+ +L+N L P  ++D P    D+++E+GF D+YT+  + 
Sbjct  193   KQIGRRDIVIAWRGTVTHVEWVANLQNFLKPI-YQDIPCPDNDVRVEAGFLDMYTD--RH  249

Query  821   TDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
                 +C YSAREQ+L EV RL+ ++  E +SIT+TGHSLG+A+A LSA+DIAE ++NV +
Sbjct  250   IKDGYCKYSAREQVLGEVRRLLAKFPNEEVSITLTGHSLGSAMATLSAFDIAETRLNVRE  309

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDE-LGIKVLRIVNVRDKVPT  1177
                              KI +SVFSF+GPRVGN++FK R ++ LG+K+LR+ N  D VP 
Sbjct  310   --------------NGEKIHVSVFSFSGPRVGNVKFKGRLEKHLGVKILRVHNKHDMVPK  355

Query  1178  VPGIIANEK-----FQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHN  1342
              PG + NEK      ++ + ++      PW Y HVGVEL LDH  SPFL    D  CAHN
Sbjct  356   SPGFLINEKSPAWLLKFAEDID-----IPWCYTHVGVELELDHKISPFLNPNADAACAHN  410

Query  1343  LEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQ  1486
             LE HLH++DGYHG  R + + T RDIALVNK  +F+K EH VPP WRQ
Sbjct  411   LEAHLHILDGYHGSNRGYEATTNRDIALVNKACDFVKDEHSVPPNWRQ  458



>ref|XP_008382954.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Malus 
domestica]
Length=435

 Score =   405 bits (1042),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 218/404 (54%), Positives = 270/404 (67%), Gaps = 33/404 (8%)
 Frame = +2

Query  203   KCRDSLPAAIPE----------SSNKHdeeeedgddeegRNLHEIWAEIQGSKDWEGLLD  352
             K  DSLP+ I E            ++++ E      E  R L ++W E+ G  DW GLLD
Sbjct  46    KTTDSLPSIITELEKERAHSKEEDDQNERETNTTTHENERRLSDVWRELHGQDDWVGLLD  105

Query  353   PMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYL  532
             PMD  LR E+IRYGE AQACYD+FDFDP SKYCG+C++    FFE LGMA  GY +SRYL
Sbjct  106   PMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFTRHAFFESLGMAQNGYHVSRYL  165

Query  533   YATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLE  712
             +ATSNINLPNFF+ S   ++WS++ANW+GYVAV+ D+    RLGRRDI IAWRGTVT  E
Sbjct  166   FATSNINLPNFFKKSRWPKVWSKNANWIGYVAVSDDDTSA-RLGRRDISIAWRGTVTRXE  224

Query  713   WIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNR  880
             WI DL + L P         D  +K+ESGF DLYT+  KD  C FC +SAREQ+L E+ R
Sbjct  225   WIVDLMDFLKPVSANRIPCPDQTVKVESGFLDLYTD--KDATCRFCQFSAREQILTEIKR  282

Query  881   LIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegdgesssasaaikip  1060
             L+E+Y  E LSIT+TGHSLG+ALA+LSAYDI E  +NV+                   +P
Sbjct  283   LVEKYSDEELSITITGHSLGSALAILSAYDITETGLNVMS--------------DGRVVP  328

Query  1061  isVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETMLK  1240
             +SV S++GPRVGN+RFKER + LG+KVLR+VNV D VP  PG+  NE      +L  + +
Sbjct  329   VSVLSYSGPRVGNVRFKERLESLGVKVLRVVNVHDVVPKSPGLFFNE--HVAPRLMKLAE  386

Query  1241  SFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDG  1372
               PWSY+HVGV+L LDH  SPFLK   D GCAHNLE HLHL+DG
Sbjct  387   GLPWSYSHVGVQLELDHKNSPFLKPTNDPGCAHNLEAHLHLLDG  430



>ref|NP_850148.1| phospholipase A1-Igamma2 [Arabidopsis thaliana]
 gb|AEC08406.1| phospholipase A1-Igamma2 [Arabidopsis thaliana]
Length=464

 Score =   401 bits (1031),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 210/369 (57%), Positives = 258/369 (70%), Gaps = 25/369 (7%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L + W +IQG  DW GL+DPMD  LR E+IRYGE AQACYD+FDFDP SKYCGT ++ 
Sbjct  99    RRLRDTWRKIQGEDDWAGLMDPMDPILRSELIRYGEMAQACYDAFDFDPASKYCGTSRFT  158

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
               +FF+ LGM D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE  
Sbjct  159   RLEFFDSLGMIDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETS  218

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  817
               RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  K
Sbjct  219   RNRLGRRDIAIAWRGTVTKLEWIADLKDYLKPVTENKIRCPDPAVKVESGFLDLYTD--K  276

Query  818   DTDCNFCSYSAREQLLAEVNRLIERYKGE---NLSITVTGHslgaalallsaYDIAEMKV  988
             DT C F  +SAREQ+L EV RL+E +  +   +LSITVTGHSLG ALA+LSAYDIAEM++
Sbjct  277   DTTCKFARFSAREQILTEVKRLVEEHGDDDDSDLSITVTGHSLGGALAILSAYDIAEMRL  336

Query  989   NVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDK  1168
             N               +     IP++V ++ GPRVGN+RF+ER +ELG+KV+R+VNV D 
Sbjct  337   N--------------RSKKGKVIPVTVLTYGGPRVGNVRFRERMEELGVKVMRVVNVHDV  382

Query  1169  VPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLE  1348
             VP  PG+  NE   +   L  + +  PW Y+HVG ELALDH  SPFLK   D+  AHNLE
Sbjct  383   VPKSPGLFLNESRPH--ALMKIAEGLPWCYSHVGEELALDHQNSPFLKPSVDVSTAHNLE  440

Query  1349  GHLHLVDGY  1375
               LHL+DGY
Sbjct  441   AMLHLLDGY  449



>emb|CDY54880.1| BnaA10g27930D [Brassica napus]
Length=452

 Score =   400 bits (1028),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 212/369 (57%), Positives = 260/369 (70%), Gaps = 26/369 (7%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             ++L + W +IQG  DW GL+DPMD  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  84    KSLRDTWRKIQGEDDWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  143

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATD-EA  646
               + F+ LG+ D GY  +RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D EA
Sbjct  144   RKKLFDSLGIFDSGYEAARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDSEA  203

Query  647   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH---FR-DDPDIKIESGFFDLYTNSK  814
                RLGRRDI IAWRGTVT LEWI DLK+ L P     FR  DP +K ESGF DLYT+  
Sbjct  204   TRHRLGRRDIAIAWRGTVTQLEWIADLKDFLKPVSGNGFRCRDPAVKAESGFLDLYTD--  261

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  985
             KDT CNF  +SAREQLL EV RL+ERY   +G++LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  262   KDTSCNFSKFSAREQLLTEVKRLVERYGDEEGDDLSITVTGHSLGGALAVLSAYDVAEMG  321

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
             +N  +                  +P++VF+++ PRVGN+RFKER +ELG+KVLR+VN  D
Sbjct  322   LNRTK--------------KGKVVPVTVFTYSAPRVGNIRFKERMEELGVKVLRVVNKHD  367

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              VP  PG+  NE       L+ +    PW Y HVG +LALDH  SPFLK   DL  AHNL
Sbjct  368   VVPKSPGLFLNE--HAPDALKQLAGGLPWCYCHVGEKLALDHQNSPFLKPSVDLSTAHNL  425

Query  1346  EGHLHLVDG  1372
             E  LHL+DG
Sbjct  426   EALLHLLDG  434



>ref|XP_010414253.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=471

 Score =   398 bits (1022),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 212/370 (57%), Positives = 259/370 (70%), Gaps = 26/370 (7%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L + W +IQG  DW GL++PMD  LR E+IRYGE AQACYD+FDFDP SKYCG+ ++   
Sbjct  100   LIDTWRKIQGEDDWAGLMEPMDPVLRSELIRYGEMAQACYDAFDFDPASKYCGSSRFSRL  159

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             +FF+ LGM+  GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE    
Sbjct  160   EFFDSLGMSGSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETSRN  219

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  823
             RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  KDT
Sbjct  220   RLGRRDIAIAWRGTVTKLEWIADLKDYLKPVSENKIRCPDPAVKVESGFLDLYTD--KDT  277

Query  824   DCNFCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVN  991
              C F  +SAREQ+LAEV RL+E Y    +  +LSITVTGHSLG ALA+LSAYDIAEM +N
Sbjct  278   SCKFAKFSAREQILAEVKRLVETYDDEDEDSDLSITVTGHSLGGALAILSAYDIAEMGLN  337

Query  992   VVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKV  1171
                            + +   IP++V ++ GPRVGN+RFKER +ELG+KV+R+VNV D V
Sbjct  338   --------------RSKSGKVIPVTVLTYGGPRVGNVRFKERMEELGVKVMRVVNVHDMV  383

Query  1172  PTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1351
             P  PG+  NE   +   L  + +  PW Y HVG ELALDH  SPFLK   DL  AHNLE 
Sbjct  384   PKSPGLFLNESAPH--ALMKIAEGLPWCYCHVGEELALDHQNSPFLKPSVDLSNAHNLEA  441

Query  1352  HLHLVDGYHG  1381
              LHL+DGYHG
Sbjct  442   MLHLLDGYHG  451



>ref|XP_004968489.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Setaria 
italica]
Length=570

 Score =   400 bits (1029),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 226/443 (51%), Positives = 287/443 (65%), Gaps = 32/443 (7%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI GS +WEGLLDP+D  LR E+IRYGEFAQA YDSFD++  S Y G+C+Y    FFE
Sbjct  89    WREIHGSSNWEGLLDPIDPVLRAELIRYGEFAQATYDSFDYERFSPYSGSCRYPAKTFFE  148

Query  488   KLGMADRGYRISRYLYATSN-INLPNFF--QHSSV--NRIWSQHANWMGYVAVATDEAEI  652
              +G+   GY +SRYLYAT N + LPNF   +H S   +++WS+   ++GYVAV+TDE E 
Sbjct  149   DVGLVGAGYEVSRYLYATCNDLKLPNFGNPKHKSADDDKLWSESGTFIGYVAVSTDE-ET  207

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKD  820
              R+GRRDI + WRGT T LEW+ DL     P         D ++K+E GF +LYT   KD
Sbjct  208   ARIGRRDIAVVWRGTTTRLEWVADLTTNQRPLCEMGIPCPDSNVKVEMGFAELYTG--KD  265

Query  821   TDCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNV  994
              DC FC YSAREQ LAEV +L+E Y  +GE +S+T+TGHSLG+ALA+L+A+D+AE   N 
Sbjct  266   VDCRFCRYSAREQALAEVRKLVELYHGRGEEVSVTITGHSLGSALAMLNAFDVAETGANA  325

Query  995   VQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKV  1171
                             +    P+ VFSFAGPRVGNL F+ER + ELG++ LR+VNV D V
Sbjct  326   TP--------------SGGAAPVCVFSFAGPRVGNLGFRERFERELGVRALRVVNVHDWV  371

Query  1172  PTVPGIIANEKFQYQKQLETMLK-SFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLE  1348
             P VPG I NE    +  L  +        Y H+GV L LDH  SPFLK   D+ C HNLE
Sbjct  372   PKVPGAIFNEAAFPEAVLRAVDGLGVAGVYTHLGVALELDHRASPFLKDTIDITCYHNLE  431

Query  1349  GHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRW  1528
              HLHL+DG+   G  F   +GRD ALVNK ++FL+ EH VPP W Q ENKG+V+T DGRW
Sbjct  432   AHLHLLDGFRSRGEGFE-LSGRDPALVNKSTDFLRDEHKVPPVWYQAENKGLVKTEDGRW  490

Query  1529  VVPERSR-IEAHPSDTGHHFRKV  1594
             V+  R R I  HP DT H+ +++
Sbjct  491   VLRPRHRDIAEHPEDTDHYLQRL  513



>gb|AFW75599.1| hypothetical protein ZEAMMB73_741719 [Zea mays]
Length=1364

 Score =   421 bits (1081),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 235/443 (53%), Positives = 296/443 (67%), Gaps = 32/443 (7%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI GS  WEG LDP+D+ LR E+IRYGEFAQACYDSFD+D  S YCG+C++    FF+
Sbjct  932   WREIHGSDHWEGQLDPIDAVLRGELIRYGEFAQACYDSFDYDRFSPYCGSCRFPAKTFFQ  991

Query  488   KLGMADRGYRISRYLYATSN-INLPNFF--QHSSV--NRIWSQHANWMGYVAVATDEAEI  652
              +G+   GY++SRYLYAT N + LPNF   +HSS   +++WS+   ++GYVAV+TDE E 
Sbjct  992   DVGLGGAGYQVSRYLYATCNDLKLPNFGGRKHSSAANDKLWSELGTFIGYVAVSTDE-ET  1050

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDL----KNILHPTHFRDDPDIKIESGFFDLYTNSKKD  820
              RLGRRDI ++WRGT+T LEW+ DL    K +        DPD+K+E GF +LYT   KD
Sbjct  1051  ARLGRRDIAVSWRGTITRLEWVADLTANQKRLSELGVPCPDPDVKVEMGFAELYTG--KD  1108

Query  821   TDCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNV  994
               C FC YSAREQ LAEV + +E Y  +GE +S+TVTGHSLG+ALA+L+A+D+AE   N 
Sbjct  1109  AACRFCRYSAREQALAEVRKQVELYHGRGEQVSVTVTGHSLGSALAMLNAFDVAETGANA  1168

Query  995   VQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKV  1171
                           +    K P+ VFSFAGPRVGNLRF+ER   ELG++ LR+ NV D V
Sbjct  1169  --------------SPDGRKAPVCVFSFAGPRVGNLRFRERFQRELGVRALRVFNVHDGV  1214

Query  1172  PTVPGIIANEKFQYQKQLETMLK-SFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLE  1348
             P VPG+  N+    +  L  +        Y H+GV LALDH  SPFLK   D+ C HNLE
Sbjct  1215  PKVPGVFFNDAAFPEAVLRVVDGLGAGGVYTHLGVPLALDHKVSPFLKETMDISCYHNLE  1274

Query  1349  GHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRW  1528
              HLHL+DGY G G  F+   GRD ALVNK ++FL+ EH VPP W Q ENKGMVRT DGRW
Sbjct  1275  AHLHLLDGYRGSGEGFQ-LRGRDPALVNKSADFLRDEHMVPPVWYQAENKGMVRTEDGRW  1333

Query  1529  VVPERSR-IEAHPSDTGHHFRKV  1594
             V+P R R I+ HP DT HH +++
Sbjct  1334  VLPPRHRDIDEHPDDTDHHLQQL  1356



>ref|XP_010274200.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X2 [Nelumbo nucifera]
Length=458

 Score =   394 bits (1013),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 206/365 (56%), Positives = 257/365 (70%), Gaps = 23/365 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R + + W EI G  DW G+LDP+D  LR E+IRYGE AQACYD+FD+DP S+YCG+C++ 
Sbjct  112   RRIADFWREIHGQGDWTGMLDPIDPLLRSELIRYGEMAQACYDAFDYDPSSRYCGSCRFM  171

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
               +FF+ LGMA+ GY +SRYLYAT+NINLPNFF+ S   ++WS++ANW+GYVAV+ DE  
Sbjct  172   RRKFFDCLGMANFGYDVSRYLYATTNINLPNFFKKSRWPKVWSRNANWIGYVAVSNDETS  231

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  817
                LGRRDI IAWRGTVT LEWI DL + L P         DP +K+ESGF D+YT+  K
Sbjct  232   A-SLGRRDITIAWRGTVTRLEWIADLMDFLRPVSSDKIPCPDPSVKVESGFLDVYTD--K  288

Query  818   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  997
             D  C FC YSAREQ+L+EV RL ++Y  E LSIT+TGHSLG+ALA+LSAYDIAE  VNV 
Sbjct  289   DETCRFCKYSAREQILSEVKRLTQQYPDEELSITMTGHSLGSALAMLSAYDIAETGVNVT  348

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1177
                                +P++VFSF+GPRVGN+RFKER + LG+KVLR+VNV D VP 
Sbjct  349   --------------GDGRAVPVTVFSFSGPRVGNVRFKERVERLGVKVLRVVNVHDTVPK  394

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
             VPGI+ NE     + +  + +  PW Y+HVGVEL LDH +SPFL    D  C HNLE  L
Sbjct  395   VPGILFNE--HVPELVHRLAQWLPWCYSHVGVELTLDHKHSPFLNGTGDPSCFHNLEALL  452

Query  1358  HLVDG  1372
             HL+DG
Sbjct  453   HLLDG  457



>ref|NP_563772.1| phospholipase A1-Igamma1 [Arabidopsis thaliana]
 gb|AAK97670.1| At1g06800/F4H5_10 [Arabidopsis thaliana]
 gb|AAO11634.1| At1g06800/F4H5_10 [Arabidopsis thaliana]
 gb|AEE28040.1| phospholipase A1-Igamma1 [Arabidopsis thaliana]
Length=444

 Score =   394 bits (1011),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 210/369 (57%), Positives = 255/369 (69%), Gaps = 26/369 (7%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             + L + W +IQG  DW GL+DPMD  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  83    KRLRDTWRKIQGEDDWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  142

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
                 F+ LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D   
Sbjct  143   RRHLFDSLGIIDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDNEA  202

Query  650   IR-RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH---FR-DDPDIKIESGFFDLYTNSK  814
              R RLGRRDI IAWRGTVT LEWI DLK+ L P     FR  DP +K ESGF DLYT+  
Sbjct  203   TRCRLGRRDIAIAWRGTVTRLEWIADLKDFLKPVSGNGFRCPDPAVKAESGFLDLYTD--  260

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  985
             KDT CNF  +SAREQ+L EV RL+ERY   +GE LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  261   KDTSCNFSKFSAREQVLTEVKRLVERYGDEEGEELSITVTGHSLGGALAVLSAYDVAEMG  320

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
             VN  +                  IP++ F++ GPRVGN+RFKER ++LG+KVLR+VN  D
Sbjct  321   VNRTR--------------KGKVIPVTAFTYGGPRVGNIRFKERIEKLGVKVLRVVNEHD  366

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              V   PG+  NE+    + L  +    PW Y+HVG  L LDH  SPFLK   DL  AHNL
Sbjct  367   VVAKSPGLFLNER--APQALMKLAGGLPWCYSHVGEMLPLDHQKSPFLKPTVDLSTAHNL  424

Query  1346  EGHLHLVDG  1372
             E  LHL+DG
Sbjct  425   EALLHLLDG  433



>ref|XP_010414254.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X3 [Camelina sativa]
Length=469

 Score =   393 bits (1010),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 210/368 (57%), Positives = 257/368 (70%), Gaps = 26/368 (7%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L + W +IQG  DW GL++PMD  LR E+IRYGE AQACYD+FDFDP SKYCG+ ++   
Sbjct  100   LIDTWRKIQGEDDWAGLMEPMDPVLRSELIRYGEMAQACYDAFDFDPASKYCGSSRFSRL  159

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             +FF+ LGM+  GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE    
Sbjct  160   EFFDSLGMSGSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETSRN  219

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  823
             RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  KDT
Sbjct  220   RLGRRDIAIAWRGTVTKLEWIADLKDYLKPVSENKIRCPDPAVKVESGFLDLYTD--KDT  277

Query  824   DCNFCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVN  991
              C F  +SAREQ+LAEV RL+E Y    +  +LSITVTGHSLG ALA+LSAYDIAEM +N
Sbjct  278   SCKFAKFSAREQILAEVKRLVETYDDEDEDSDLSITVTGHSLGGALAILSAYDIAEMGLN  337

Query  992   VVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKV  1171
                            + +   IP++V ++ GPRVGN+RFKER +ELG+KV+R+VNV D V
Sbjct  338   --------------RSKSGKVIPVTVLTYGGPRVGNVRFKERMEELGVKVMRVVNVHDMV  383

Query  1172  PTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1351
             P  PG+  NE   +   L  + +  PW Y HVG ELALDH  SPFLK   DL  AHNLE 
Sbjct  384   PKSPGLFLNESAPH--ALMKIAEGLPWCYCHVGEELALDHQNSPFLKPSVDLSNAHNLEA  441

Query  1352  HLHLVDGY  1375
              LHL+DGY
Sbjct  442   MLHLLDGY  449



>ref|XP_010486704.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=442

 Score =   391 bits (1005),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 207/369 (56%), Positives = 256/369 (69%), Gaps = 26/369 (7%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             ++L + W +IQG  +W GL+DPMD  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  81    KSLKDTWRKIQGEDNWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  140

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATD-EA  646
                 FE LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D EA
Sbjct  141   RRHLFESLGILDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEEA  200

Query  647   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  814
                RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  
Sbjct  201   THGRLGRRDIAIAWRGTVTRLEWIADLKDYLKPVSGNGIRCPDPAVKVESGFLDLYTD--  258

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  985
             KDT C F  +SAREQ+L EV RL+ERY   +GE+LSITVTGHSLG ALA+LS YD+AEM 
Sbjct  259   KDTSCKFSKFSAREQVLTEVKRLVERYGDEEGEDLSITVTGHSLGGALAVLSGYDVAEMG  318

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
             +N  +                  IP++VF++ GPRVGN+RFKER ++LG+KVLR+VN  D
Sbjct  319   LNRTR--------------KGKVIPVTVFTYGGPRVGNIRFKERIEKLGVKVLRVVNEHD  364

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              V   PG+  NE+  +   L  +    PW Y HVG +L LDH  SPFLK   DL  AHNL
Sbjct  365   VVAKSPGLFLNERAPH--ALMKLAGGLPWCYCHVGEKLPLDHQNSPFLKPTVDLSTAHNL  422

Query  1346  EGHLHLVDG  1372
             E  LHL+DG
Sbjct  423   EALLHLLDG  431



>ref|XP_010486634.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=455

 Score =   391 bits (1004),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 207/371 (56%), Positives = 256/371 (69%), Gaps = 26/371 (7%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             ++L   W +IQG  +W GL+DPMD  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  81    KSLKNTWRKIQGEDNWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  140

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATD-EA  646
                 FE LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D EA
Sbjct  141   RRHLFESLGILDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEEA  200

Query  647   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  814
                RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  
Sbjct  201   THGRLGRRDIAIAWRGTVTRLEWIADLKDYLKPVSGNGIRCPDPAVKVESGFLDLYTD--  258

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  985
             KDT C F  +SAREQ+L EV RL+ERY   +GE+LSITVTGHSLG ALA+LS YD+AEM 
Sbjct  259   KDTSCKFSKFSAREQVLTEVKRLVERYGDEEGEDLSITVTGHSLGGALAVLSGYDVAEMG  318

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
             +N  +                  IP++VF++ GPRVGN+RFKER ++LG+KVLR+VN  D
Sbjct  319   LNRTR--------------KGKVIPVTVFTYGGPRVGNIRFKERIEKLGVKVLRVVNEHD  364

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              V   PG+  NE+  +   L  +    PW Y HVG +L LDH  SPFLK   DL  AHNL
Sbjct  365   VVAKSPGLFLNERAPH--ALMKLAGGLPWCYCHVGEKLPLDHQNSPFLKPTVDLSTAHNL  422

Query  1346  EGHLHLVDGYH  1378
             E  LHL+DG +
Sbjct  423   EALLHLLDGAY  433



>ref|XP_010486640.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X2 [Camelina sativa]
 ref|XP_010486663.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Camelina 
sativa]
 ref|XP_010486740.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Camelina 
sativa]
Length=442

 Score =   390 bits (1003),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 207/369 (56%), Positives = 255/369 (69%), Gaps = 26/369 (7%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             ++L   W +IQG  +W GL+DPMD  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  81    KSLKNTWRKIQGEDNWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  140

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATD-EA  646
                 FE LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D EA
Sbjct  141   RRHLFESLGILDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEEA  200

Query  647   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  814
                RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  
Sbjct  201   THGRLGRRDIAIAWRGTVTRLEWIADLKDYLKPVSGNGIRCPDPAVKVESGFLDLYTD--  258

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  985
             KDT C F  +SAREQ+L EV RL+ERY   +GE+LSITVTGHSLG ALA+LS YD+AEM 
Sbjct  259   KDTSCKFSKFSAREQVLTEVKRLVERYGDEEGEDLSITVTGHSLGGALAVLSGYDVAEMG  318

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
             +N  +                  IP++VF++ GPRVGN+RFKER ++LG+KVLR+VN  D
Sbjct  319   LNRTR--------------KGKVIPVTVFTYGGPRVGNIRFKERIEKLGVKVLRVVNEHD  364

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              V   PG+  NE+  +   L  +    PW Y HVG +L LDH  SPFLK   DL  AHNL
Sbjct  365   VVAKSPGLFLNERAPH--ALMKLAGGLPWCYCHVGEKLPLDHQNSPFLKPTVDLSTAHNL  422

Query  1346  EGHLHLVDG  1372
             E  LHL+DG
Sbjct  423   EALLHLLDG  431



>ref|XP_010486696.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=445

 Score =   390 bits (1002),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 207/369 (56%), Positives = 256/369 (69%), Gaps = 26/369 (7%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             ++L + W +IQG  +W GL+DPMD  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  81    KSLKDTWRKIQGEDNWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  140

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATD-EA  646
                 FE LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D EA
Sbjct  141   RRHLFESLGILDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEEA  200

Query  647   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  814
                RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  
Sbjct  201   THGRLGRRDIAIAWRGTVTRLEWIADLKDYLKPVSGNGIRCPDPAVKVESGFLDLYTD--  258

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  985
             KDT C F  +SAREQ+L EV RL+ERY   +GE+LSITVTGHSLG ALA+LS YD+AEM 
Sbjct  259   KDTSCKFSKFSAREQVLTEVKRLVERYGDEEGEDLSITVTGHSLGGALAVLSGYDVAEMG  318

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
             +N  +                  IP++VF++ GPRVGN+RFKER ++LG+KVLR+VN  D
Sbjct  319   LNRTR--------------KGKVIPVTVFTYGGPRVGNIRFKERIEKLGVKVLRVVNEHD  364

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              V   PG+  NE+  +   L  +    PW Y HVG +L LDH  SPFLK   DL  AHNL
Sbjct  365   VVAKSPGLFLNERAPH--ALMKLAGGLPWCYCHVGEKLPLDHQNSPFLKPTVDLSTAHNL  422

Query  1346  EGHLHLVDG  1372
             E  LHL+DG
Sbjct  423   EALLHLLDG  431



>gb|EEE63596.1| hypothetical protein OsJ_18413 [Oryza sativa Japonica Group]
Length=534

 Score =   390 bits (1001),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 228/429 (53%), Positives = 266/429 (62%), Gaps = 70/429 (16%)
 Frame = +2

Query  299   HEI---WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             HE+   W EI G  DW GLLDPMD  LR E+IRYGEFAQACYD+FD+DP S+YCG+CKY 
Sbjct  120   HELAARWREIHGRDDWAGLLDPMDPLLRSELIRYGEFAQACYDAFDYDPSSRYCGSCKYP  179

Query  470   GAQFFEKLGM--ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDE  643
                FF++LGM  A RGY                                           
Sbjct  180   RRAFFDRLGMPAAARGY-------------------------------------------  196

Query  644   AEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNS  811
              E  RLGRRDI IAWRGTVT LEW+ DL + L P      P    ++K+ESGF DLYT+ 
Sbjct  197   TETARLGRRDIAIAWRGTVTRLEWVSDLMDFLRPVADEGIPCPDREVKVESGFVDLYTD-  255

Query  812   KKDTDCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMK  985
              KD  C FC YSAREQ+L EV RL+ RY   GE++S+TVTGHSLG+ALA++SAYDIAE  
Sbjct  256   -KDPTCRFCKYSAREQVLTEVRRLVTRYAALGEDVSVTVTGHSLGSALAMISAYDIAESG  314

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVR  1162
                   G G+    +            V+SFAGPRVGN RFKER + ELG+K LR+VNV 
Sbjct  315   AASAAHGGGKEAAAAVC----------VYSFAGPRVGNARFKERFEGELGVKALRVVNVH  364

Query  1163  DKVPTVPGIIANE--KFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCA  1336
             D V  +PGI+ NE      ++  E +L+  PW YAHVGVELALDH  SPFLK   D  C 
Sbjct  365   DGVARMPGILLNEGAPAALRRVAEGILR-VPWCYAHVGVELALDHKRSPFLKDTLDPACF  423

Query  1337  HNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTS  1516
             HNLE HLHL+DGYHG G RF  A+GRD ALVNK  +FLK  H VPP WRQDENKGMVR  
Sbjct  424   HNLEAHLHLLDGYHGRGERFVLASGRDPALVNKACDFLKDHHCVPPCWRQDENKGMVRAP  483

Query  1517  DGRWVVPER  1543
             DGRWV P+R
Sbjct  484   DGRWVQPDR  492



>gb|KCW57435.1| hypothetical protein EUGRSUZ_H00215 [Eucalyptus grandis]
Length=462

 Score =   386 bits (992),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 220/444 (50%), Positives = 286/444 (64%), Gaps = 37/444 (8%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             RNL  IW EI G  +W  LLDP+D  LR E+IRYGE AQA YD+FD DP SKYCG+C+Y 
Sbjct  48    RNLASIWEEIHGKSNWVSLLDPIDPLLRAELIRYGEMAQASYDAFDADPFSKYCGSCRYK  107

Query  470   GAQFFEKLGMADRGYRISRYLYATSNI-NLPNFFQHSSVNRIWSQHANWMGYVAVATDEA  646
              ++FF  L     GY ++RYLYA+ NI + P+FF+ S     WS+ ANW GYVAV+ DE 
Sbjct  108   LSEFFCSLEFPRAGYILTRYLYASCNIHHRPHFFKKSLWPEAWSESANWFGYVAVSDDEM  167

Query  647   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSK  814
               + LGRRDI I WRGT+   EWI D +  + P   +  P      K+ESGF  LYT  +
Sbjct  168   S-KALGRRDIAIVWRGTMRKPEWIVDARYSMSPVRQKGIPCPDRKAKVESGFLHLYT--E  224

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNV  994
             KD +  FC +S RE +L E+ RLI+++  E+LSITVTGHSLG+A+A+LSAYDIAE   ++
Sbjct  225   KDENSRFCKHSTREHVLQEIKRLIQKHADEDLSITVTGHSLGSAIAILSAYDIAETGTDI  284

Query  995   VQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVP  1174
              Q                  +P  VFSFAGPRVGN++FK+R +ELG+KVLR++NV D+VP
Sbjct  285   RQ--------------DGKIVPKCVFSFAGPRVGNVKFKKRVEELGVKVLRVLNVHDRVP  330

Query  1175  TVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1354
             TVPG+I NE         ++L    + Y+HVG+EL L+H  SP+LK   DL C H++E  
Sbjct  331   TVPGMIFNE------NAPSVLPKI-YCYSHVGIELVLNHENSPYLKDKGDLLCYHDMEVL  383

Query  1355  LHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVV  1534
             LHL+DGY   G+RF     RDIALVNK ++FLK ++ +PP+W+Q EN+G+VR  DGRW  
Sbjct  384   LHLLDGYKEKGQRF-ELPRRDIALVNKATDFLKDKYLIPPKWKQLENRGLVRGQDGRWTQ  442

Query  1535  PERSRIEAHPSDTGHHFRKVLRLA  1606
              ER        D G HF  V R A
Sbjct  443   SER-------QDLGDHFEGVDREA  459



>ref|NP_001055438.1| Os05g0390000 [Oryza sativa Japonica Group]
 gb|AAT47444.1| putative lipase class 3 family protein, PF01764 [Oryza sativa 
Japonica Group]
 dbj|BAF17352.1| Os05g0390000 [Oryza sativa Japonica Group]
Length=478

 Score =   387 bits (993),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 214/373 (57%), Positives = 253/373 (68%), Gaps = 29/373 (8%)
 Frame = +2

Query  299   HEI---WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             HE+   W EI G  DW GLLDPMD  LR E+IRYGEFAQACYD+FD+DP S+YCG+CKY 
Sbjct  120   HELAARWREIHGRDDWAGLLDPMDPLLRSELIRYGEFAQACYDAFDYDPSSRYCGSCKYP  179

Query  470   GAQFFEKLGM--ADRGYRISRYLYATSNINLPNFFQHSSVN-RIWSQHANWMGYVAVATD  640
                FF++LGM  A RGY ++RYLYATSN   PNFF  S    +IWSQ ANW+GYVAV+TD
Sbjct  180   RRAFFDRLGMPAAARGYTVTRYLYATSNFRFPNFFSQSRAGAKIWSQRANWIGYVAVSTD  239

Query  641   EAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTN  808
             E E  RLGRRDI IAWRGTVT LEW+ DL + L P      P    ++K+ESGF DLYT+
Sbjct  240   E-ETARLGRRDIAIAWRGTVTRLEWVSDLMDFLRPVADEGIPCPDREVKVESGFVDLYTD  298

Query  809   SKKDTDCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEM  982
               KD  C FC YSAREQ+L EV RL+ RY   GE++S+TVTGHSLG+ALA++SAYDIAE 
Sbjct  299   --KDPTCRFCKYSAREQVLTEVRRLVTRYAALGEDVSVTVTGHSLGSALAMISAYDIAES  356

Query  983   KVNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNV  1159
                                       + V+SFAGPRVGN RFKER + ELG+K LR+VNV
Sbjct  357   GAASAA----------HGGGKEAAAAVCVYSFAGPRVGNARFKERFEGELGVKALRVVNV  406

Query  1160  RDKVPTVPGIIANE--KFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGC  1333
              D V  +PGI+ NE      ++  E +L+  PW YAHVGVELALDH  SPFLK   D  C
Sbjct  407   HDGVARMPGILLNEGAPAALRRVAEGILR-VPWCYAHVGVELALDHKRSPFLKDTLDPAC  465

Query  1334  AHNLEGHLHLVDG  1372
              HNLE HLHL+DG
Sbjct  466   FHNLEAHLHLLDG  478



>ref|XP_010069172.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Eucalyptus 
grandis]
Length=502

 Score =   387 bits (993),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 220/444 (50%), Positives = 286/444 (64%), Gaps = 37/444 (8%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             RNL  IW EI G  +W  LLDP+D  LR E+IRYGE AQA YD+FD DP SKYCG+C+Y 
Sbjct  88    RNLASIWEEIHGKSNWVSLLDPIDPLLRAELIRYGEMAQASYDAFDADPFSKYCGSCRYK  147

Query  470   GAQFFEKLGMADRGYRISRYLYATSNI-NLPNFFQHSSVNRIWSQHANWMGYVAVATDEA  646
              ++FF  L     GY ++RYLYA+ NI + P+FF+ S     WS+ ANW GYVAV+ DE 
Sbjct  148   LSEFFCSLEFPRAGYILTRYLYASCNIHHRPHFFKKSLWPEAWSESANWFGYVAVSDDEM  207

Query  647   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSK  814
               + LGRRDI I WRGT+   EWI D +  + P   +  P      K+ESGF  LYT  +
Sbjct  208   S-KALGRRDIAIVWRGTMRKPEWIVDARYSMSPVRQKGIPCPDRKAKVESGFLHLYT--E  264

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNV  994
             KD +  FC +S RE +L E+ RLI+++  E+LSITVTGHSLG+A+A+LSAYDIAE   ++
Sbjct  265   KDENSRFCKHSTREHVLQEIKRLIQKHADEDLSITVTGHSLGSAIAILSAYDIAETGTDI  324

Query  995   VQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVP  1174
              Q                  +P  VFSFAGPRVGN++FK+R +ELG+KVLR++NV D+VP
Sbjct  325   RQ--------------DGKIVPKCVFSFAGPRVGNVKFKKRVEELGVKVLRVLNVHDRVP  370

Query  1175  TVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1354
             TVPG+I NE         ++L    + Y+HVG+EL L+H  SP+LK   DL C H++E  
Sbjct  371   TVPGMIFNE------NAPSVLPKI-YCYSHVGIELVLNHENSPYLKDKGDLLCYHDMEVL  423

Query  1355  LHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVV  1534
             LHL+DGY   G+RF     RDIALVNK ++FLK ++ +PP+W+Q EN+G+VR  DGRW  
Sbjct  424   LHLLDGYKEKGQRF-ELPRRDIALVNKATDFLKDKYLIPPKWKQLENRGLVRGQDGRWTQ  482

Query  1535  PERSRIEAHPSDTGHHFRKVLRLA  1606
              ER        D G HF  V R A
Sbjct  483   SER-------QDLGDHFEGVDREA  499



>ref|XP_008451277.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X3 [Cucumis melo]
Length=440

 Score =   382 bits (981),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 198/364 (54%), Positives = 251/364 (69%), Gaps = 24/364 (7%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI GS DW GLLDPM+  LR E+IRYGE +Q+CYD+FD+DP SKYCG+C++   +FFE
Sbjct  91    WREIHGSNDWTGLLDPMNDLLRSELIRYGEMSQSCYDAFDYDPFSKYCGSCRFSRGKFFE  150

Query  488   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  667
             +LGM + GY ++RYLYATSNIN+PNFF+ S   ++WS+ ANW+GYVAV+ DE   + LGR
Sbjct  151   RLGMENVGYEVTRYLYATSNINMPNFFKKSRWPKVWSKSANWIGYVAVSNDEKS-KELGR  209

Query  668   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNF  835
             RDIV+AWRGTVT LEWI DL + L P         +  +K+ESGF DLYT  K++  C +
Sbjct  210   RDIVVAWRGTVTRLEWITDLMDFLKPIAEAKIGCPNSGVKVESGFVDLYTE-KEEKGCGY  268

Query  836   CSYSAREQLLAEVNRLIERYKG--ENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1009
             C +SAREQ++AEV RL ER+ G  E +SIT+TGHSLG+ALA+LS +DIAE  +N +    
Sbjct  269   CRFSAREQVMAEVKRLTERFGGAEEEMSITITGHSLGSALAVLSGFDIAETGLNRL----  324

Query  1010  gegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1189
                            +P+ VFSF+GPRVGN  FKE   ELG+KVLR+VN+ D VP  PG 
Sbjct  325   ----------GNGRLVPVCVFSFSGPRVGNFSFKEHLHELGVKVLRVVNIHDIVPKTPGF  374

Query  1190  IANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1369
             + NE     + +    +  PWSY+HVGVEL LDH  SPFLK   D  CAHNLE  LHL+D
Sbjct  375   LFNESI--PRAVMQFAEGLPWSYSHVGVELKLDHKVSPFLKQTNDPVCAHNLEALLHLLD  432

Query  1370  GYHG  1381
             G  G
Sbjct  433   GLEG  436



>ref|XP_008451276.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X2 [Cucumis melo]
Length=452

 Score =   379 bits (974),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 197/361 (55%), Positives = 250/361 (69%), Gaps = 24/361 (7%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI GS DW GLLDPM+  LR E+IRYGE +Q+CYD+FD+DP SKYCG+C++   +FFE
Sbjct  91    WREIHGSNDWTGLLDPMNDLLRSELIRYGEMSQSCYDAFDYDPFSKYCGSCRFSRGKFFE  150

Query  488   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  667
             +LGM + GY ++RYLYATSNIN+PNFF+ S   ++WS+ ANW+GYVAV+ DE   + LGR
Sbjct  151   RLGMENVGYEVTRYLYATSNINMPNFFKKSRWPKVWSKSANWIGYVAVSNDEKS-KELGR  209

Query  668   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNF  835
             RDIV+AWRGTVT LEWI DL + L P         +  +K+ESGF DLYT  K++  C +
Sbjct  210   RDIVVAWRGTVTRLEWITDLMDFLKPIAEAKIGCPNSGVKVESGFVDLYTE-KEEKGCGY  268

Query  836   CSYSAREQLLAEVNRLIERYKG--ENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1009
             C +SAREQ++AEV RL ER+ G  E +SIT+TGHSLG+ALA+LS +DIAE  +N +    
Sbjct  269   CRFSAREQVMAEVKRLTERFGGAEEEMSITITGHSLGSALAVLSGFDIAETGLNRL----  324

Query  1010  gegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1189
                            +P+ VFSF+GPRVGN  FKE   ELG+KVLR+VN+ D VP  PG 
Sbjct  325   ----------GNGRLVPVCVFSFSGPRVGNFSFKEHLHELGVKVLRVVNIHDIVPKTPGF  374

Query  1190  IANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1369
             + NE     + +    +  PWSY+HVGVEL LDH  SPFLK   D  CAHNLE  LHL+D
Sbjct  375   LFNESI--PRAVMQFAEGLPWSYSHVGVELKLDHKVSPFLKQTNDPVCAHNLEALLHLLD  432

Query  1370  G  1372
             G
Sbjct  433   G  433



>ref|XP_006576920.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X2 [Glycine max]
Length=422

 Score =   377 bits (969),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 211/425 (50%), Positives = 284/425 (67%), Gaps = 29/425 (7%)
 Frame = +2

Query  119   ITKPTTAKPSNSFF--PLTLSSPQKPYSSLKCRDSLPAAIPESSNKHdeeeedgddeegR  292
             +  P T +  ++F   P  LS   KP +++ C+ +L   +  S     ++++  DD++ +
Sbjct  10    VALPQTPQCRSTFRSDPPKLSLTLKPKATVTCKATLSTTLETS----IQQQQQQDDQKQK  65

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
              + E+W +I G  +W GLLDPMD  +R E+ RYGE AQACYD+FDFDP+SKYCG+C++  
Sbjct  66    PVAEVWRKIHGEDNWAGLLDPMDPVMRGELTRYGEMAQACYDAFDFDPYSKYCGSCRFPL  125

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSS-VNRIWSQHANWMGYVAVATDEAE  649
              +FF+ LGM + GY ++RYLYAT NINLPNFF+ S   +++WS+HANW G++AV+ DE  
Sbjct  126   PEFFDSLGMTNVGYTMTRYLYATGNINLPNFFRKSRWPHKMWSKHANWAGFIAVSDDETS  185

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR---DDPDIKIESGFFDLYTNSKKD  820
              +RLGRRDIVI+WRGTVT++EW+ DL N L P        D  +K+E+GF DLYT+  ++
Sbjct  186   -KRLGRRDIVISWRGTVTHVEWVADLLNFLKPISPDIPCSDRKVKVEAGFLDLYTD--RE  242

Query  821   TDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
               C +C YSAREQ+L EV RL+E+Y  E +S+T+ GHSLG+A+A+LSA+DI E  VNV +
Sbjct  243   PGCGYCKYSAREQVLGEVKRLMEKYADEEVSVTIAGHSLGSAMAILSAFDIVETGVNVGK  302

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPT  1177
                              K  +SVFSF+GPRVGN+RFKER + ELGIKVLR+ N  D VP 
Sbjct  303   --------------DGRKAHVSVFSFSGPRVGNVRFKERLEGELGIKVLRVHNAHDMVPQ  348

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
              PG+I NE    Q  L+ +   FPW Y HVG EL LDH  SPFL    D  CAHNLE HL
Sbjct  349   SPGLIFNED-SPQWLLKLVEGWFPWCYLHVGEELQLDHKKSPFLNPDGDASCAHNLEAHL  407

Query  1358  HLVDG  1372
             HL+DG
Sbjct  408   HLLDG  412



>emb|CBI16352.3| unnamed protein product [Vitis vinifera]
Length=497

 Score =   378 bits (970),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 193/281 (69%), Positives = 228/281 (81%), Gaps = 12/281 (4%)
 Frame = +2

Query  167  TLSSPQKPYSS-----LKCRDSLPAAIPESSNKHdeeeedgddeegRNLHEIWAEIQGSK  331
             L+ P KP+S      +KC  S+ +  P   ++          +E + L ++W EIQG  
Sbjct  59   VLTIPNKPFSPKPTTLIKC-SSVSSLTPRLDHE----PARELKQEDKPLRDVWEEIQGCN  113

Query  332  DWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRG  511
            +WEGLLDPM+ +LR+EIIRYGEFAQACYDSFDFDPHSKYCGTCKY GA FF+KL MADRG
Sbjct  114  NWEGLLDPMNPNLRKEIIRYGEFAQACYDSFDFDPHSKYCGTCKYQGAHFFQKLDMADRG  173

Query  512  YRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWR  691
            Y+ISRYLYATSNINLPNFFQ S ++ +WS HANWMGY+AV TDE EI+RLGRRDI+IAWR
Sbjct  174  YQISRYLYATSNINLPNFFQKSKMSSVWSPHANWMGYIAVTTDEKEIKRLGRRDIIIAWR  233

Query  692  GTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAE  871
            GTVTYLEWIHDLK+IL P HFRDDP+IKIESGF+DLYT  KK+ +C FCS+SAREQ+LAE
Sbjct  234  GTVTYLEWIHDLKDILCPAHFRDDPNIKIESGFYDLYT--KKENNCKFCSFSAREQVLAE  291

Query  872  VNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNV  994
            + RL+ERYK E +SIT+TGHSLGAALALLSAYDIAEM +NV
Sbjct  292  IKRLVERYKDEEISITITGHSLGAALALLSAYDIAEMNLNV  332


 Score =   196 bits (497),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +2

Query  1241  SFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDI  1420
             SFPWSYAHVGVELALDH++SPFLK   DLGCAHNLE HLHLVDGYHG  R+F  AT RDI
Sbjct  348   SFPWSYAHVGVELALDHTHSPFLKPTNDLGCAHNLEAHLHLVDGYHGKDRKFSLATKRDI  407

Query  1421  ALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPSDTGHHFRKV  1594
             ALVNK  +FL+ E+GVP  WRQDENKGMVR SDGRWV+PER R+EAHP DT HH  + 
Sbjct  408   ALVNKSCDFLRSEYGVPGNWRQDENKGMVRASDGRWVLPERPRMEAHPPDTAHHLEQT  465



>ref|XP_002441042.1| hypothetical protein SORBIDRAFT_09g019276 [Sorghum bicolor]
 gb|EES19472.1| hypothetical protein SORBIDRAFT_09g019276 [Sorghum bicolor]
Length=478

 Score =   376 bits (965),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 210/371 (57%), Positives = 248/371 (67%), Gaps = 26/371 (7%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
              L   W EI G  DW GLLDPMD  LR E+IRYGE AQACYD+FD+DP S+YCG+CKY  
Sbjct  122   ELRRRWREIHGCDDWAGLLDPMDPLLRSELIRYGELAQACYDAFDYDPSSRYCGSCKYPR  181

Query  473   AQFFEKLGMAD--RGYRISRYLYATSNINLPNFFQHSSVN-RIWSQHANWMGYVAVATDE  643
              + F +LGM D  RGY +SRYL+ATSNI  PNFF  S    RIWSQ ANW+GYVAV+TD 
Sbjct  182   RELFSRLGMPDAARGYAVSRYLFATSNIRFPNFFPQSRAGARIWSQSANWIGYVAVSTD-  240

Query  644   AEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNS  811
             AE   LGRRDI IAWRGTVT LEW+ DL + L P        DDP++K+ +GF DLYT+ 
Sbjct  241   AETALLGRRDIAIAWRGTVTRLEWVSDLMDFLRPVAEEGIPCDDPEVKVLAGFVDLYTD-  299

Query  812   KKDTDCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMK  985
              +D  C FC YSAR+Q+LAEV RL+ RY   GE++SITVTGHSLG+ALA+LSAYDIAE  
Sbjct  300   -RDPGCRFCKYSARQQVLAEVRRLVARYAAAGEDVSITVTGHSLGSALAMLSAYDIAETG  358

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVR  1162
              NV                     P+ V+SF GPRVGN  FK R + ELG+K LR+VNV 
Sbjct  359   ANVGV----------GVGGVGTAAPVCVYSFGGPRVGNAAFKRRFETELGVKALRVVNVH  408

Query  1163  DKVPTVPGIIANEKFQ--YQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCA  1336
             D V  +PGI+ NE      ++  E ML+  PW Y HVGVEL LDH  SPFLK   D  C 
Sbjct  409   DNVTRMPGILLNEGAPEVVRRVAEGMLR-LPWCYTHVGVELRLDHKRSPFLKDTLDPACY  467

Query  1337  HNLEGHLHLVD  1369
             H+LE HLHL+D
Sbjct  468   HDLEAHLHLID  478



>ref|XP_003518892.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Glycine 
max]
Length=465

 Score =   374 bits (960),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 211/431 (49%), Positives = 279/431 (65%), Gaps = 48/431 (11%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             ++L E+W +I G K+WEGLLDPMD  LR E+IRYGE AQACYD+FD++P S++CGTC+++
Sbjct  77    KDLSEMWRQIHGEKNWEGLLDPMDPLLRSEVIRYGELAQACYDAFDYEPFSRFCGTCRFE  136

Query  470   GAQFFEKLGMADRGYRISRYLYATSNIN-LPNFFQHSSVNRIWSQHANWMGYVAVATDEA  646
               +FF  LGM   GY+++RY++ T+N + L  +  HS     WS+  NW GYVAV +D+A
Sbjct  137   EEKFFSSLGMTHHGYKVTRYIHLTANTDFLLKWLIHSKWPTAWSK-VNWGGYVAV-SDDA  194

Query  647   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSK  814
               RRLGRRDIVIAWRGT T+LEW+ D K  L P   +  P     +K+++GF D+YT   
Sbjct  195   TSRRLGRRDIVIAWRGTATHLEWVEDFKTSLTPVSSKGIPCHDDGVKVDNGFLDMYTG--  252

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNV  994
             KD    +C +SAR+ +L EV RL++ Y  E +SITVTGHSLG+ALA+LSAYDI E  ++ 
Sbjct  253   KDETSEYCQHSARDHVLREVKRLMDMYSEEEVSITVTGHSLGSALAILSAYDIVEKGLD-  311

Query  995   VQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVP  1174
                                 +P+SV SF+GP VGN  FK R + LG+KVLR++N  D VP
Sbjct  312   ------------------RGVPVSVMSFSGPAVGNKSFKNRLNRLGVKVLRVINENDWVP  353

Query  1175  TVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1354
              +   +                  P+SY HVG EL LD++ SPFLK   D  CAHNLE  
Sbjct  354   WLSPWLP-----------------PFSYCHVGEELKLDNNKSPFLK--PDNNCAHNLEVL  394

Query  1355  LHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVV  1534
             LHL+DGYHG+   F  A+ RD ALVNK  +FLK  + VPP W QDENKG+ R+SDGRWV 
Sbjct  395   LHLLDGYHGERGEFMLASDRDHALVNKGGDFLKESYLVPPNWWQDENKGLKRSSDGRWVQ  454

Query  1535  PERS-RIEAHP  1564
             PER+  ++ +P
Sbjct  455   PERTIEVDGYP  465



>ref|XP_006489506.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Citrus 
sinensis]
Length=444

 Score =   367 bits (941),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 197/365 (54%), Positives = 242/365 (66%), Gaps = 23/365 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             R L +IW +I G  DW+G+LDP+D  LR E+IRYGE  QAC+D+FDF+P SKYCG+CKY 
Sbjct  87    RKLADIWHDIHGVDDWDGMLDPLDPLLRSELIRYGEMVQACHDAFDFEPFSKYCGSCKYA  146

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
              ++FFE LGMA  GY+++ Y++AT NINLPN FQ S     WS  ANW+GY+AV+ DE  
Sbjct  147   PSEFFECLGMAQHGYQVNSYIHATYNINLPNIFQRSLRPDAWSHTANWIGYIAVSNDEMS  206

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  817
                LGRRDI IAWRGT T L WI D    L P   +     DP +K+ESGF +LYTN  K
Sbjct  207   -AHLGRRDITIAWRGTKTKLAWIADFMYFLRPVTLKKIPCPDPRVKVESGFLNLYTN--K  263

Query  818   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  997
                   C  SARE +L EV RL+ +Y+ ENLSIT+TGHSLG+ALA+LSAYDIAE  V+V+
Sbjct  264   SQSSQICKRSAREHVLEEVRRLVSQYQNENLSITITGHSLGSALAILSAYDIAETGVDVM  323

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1177
                                +PI VFSFAGPRVGN  FKER  +LG+KVLR+VN+ DK+P 
Sbjct  324   D--------------DGQAVPICVFSFAGPRVGNTWFKERFAQLGVKVLRVVNIHDKIPE  369

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
              PG+  NE       L  + ++  W Y+HVG EL LDH  SPFLK   DL C HNLE HL
Sbjct  370   APGLFLNEHI--PPMLRKLGEASLWFYSHVGAELTLDHKSSPFLKETNDLACYHNLEAHL  427

Query  1358  HLVDG  1372
             HL+DG
Sbjct  428   HLLDG  432



>ref|XP_010685025.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=496

 Score =   361 bits (926),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 206/439 (47%), Positives = 275/439 (63%), Gaps = 36/439 (8%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             ++ E W E  G  DW+  LDP+   LRRE+++YGEFAQA YD+FDFDP+S+YCG+C+Y+ 
Sbjct  88    DISEKWQEFHGFNDWDSHLDPLHPSLRRELVKYGEFAQATYDAFDFDPYSEYCGSCRYNR  147

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + FEK+G+   GY +++Y+YATS I+LP + + S V   WS H+NWMG+V V+ DE E 
Sbjct  148   NKLFEKVGLTRHGYNVTKYIYATSQIDLPQWLEKSQVAETWSTHSNWMGFVGVSDDE-ES  206

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDL-KNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  829
             +R+GRRDIV+AWRGTV+  EW  DL +N+    H     D K+E GF  +YT+  + +  
Sbjct  207   QRIGRRDIVVAWRGTVSVSEWYEDLQRNLERFGH----GDAKVEEGFLSIYTSKCQSSRY  262

Query  830   NFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
             N    SA EQ++ E+ RLI  YK  GE +S+T+TGHSLG ALALL+AY+ A + VNV   
Sbjct  263   N--KTSASEQVMTELARLIRFYKKRGEEVSLTITGHSLGGALALLNAYEAAAIFVNV---  317

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1183
                               PISV SFA PRVGN  F++   ELG+K LR+V  +D VP +P
Sbjct  318   ------------------PISVISFAAPRVGNSGFRDELHELGVKTLRVVIKQDVVPWMP  359

Query  1184  GIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1363
             G++ NE+ Q     E + +   W Y HVGVEL LD   SP+LK G  L   H LE +LHL
Sbjct  360   GMVFNERLQ---NFEEITRGLEWVYTHVGVELRLDARSSPYLKRGLQLQGHHMLETYLHL  416

Query  1364  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             +DG+      FR    RDIALVNK+ + L  E  +PPRW Q  NKG+V+ + GRWV P+R
Sbjct  417   LDGFGSSKLPFRHNARRDIALVNKECDLLINELRIPPRWYQASNKGLVQNAHGRWVKPKR  476

Query  1544  SRIEAHPSDTGH-HFRKVL  1597
                E  PS T   H+  VL
Sbjct  477   DP-EDIPSPTCEPHYHHVL  494



>ref|XP_003518893.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Glycine 
max]
Length=466

 Score =   358 bits (919),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 205/431 (48%), Positives = 274/431 (64%), Gaps = 47/431 (11%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             ++L E+W +I G K+WEGLL+PMD  LR E+IRYGE AQAC+D+FD++P S+YCGTC+++
Sbjct  77    KDLSEMWRQIHGEKNWEGLLEPMDPLLRSEVIRYGELAQACHDAFDYEPFSRYCGTCRFE  136

Query  470   GAQFFEKLGMADRGYRISRYLYATSNIN-LPNFFQHSSVNRIWSQHANWMGYVAVATDEA  646
               +FF  LGM   GY+++RY++ T+N + L  +  HS          NW GYVAV+ D+ 
Sbjct  137   EEKFFSSLGMTHHGYKVTRYIHLTANTDFLLKWLIHSKWPTAMGSKVNWGGYVAVSNDDT  196

Query  647   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSK  814
               R LGRRDIVIAWRGT T+LE   DL++ L P   +  P     +K+++GF D+YT   
Sbjct  197   S-RCLGRRDIVIAWRGTTTHLEGEKDLRSSLTPVSSKGIPCHDDGVKVDNGFLDMYTG--  253

Query  815   KDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNV  994
             KD    +C +SAR+ +L EV RL++ Y  E +SITVTGHSLG+ALA+LSAYDI E  ++ 
Sbjct  254   KDETSEYCQHSARDHVLREVKRLMDMYSEEEVSITVTGHSLGSALAILSAYDIVEKGLD-  312

Query  995   VQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVP  1174
                                 +P+SV SF+GP VGN  F +R  +LGIKVLR++N  D VP
Sbjct  313   ------------------RGVPVSVMSFSGPAVGNKSFHKRLKKLGIKVLRVINANDWVP  354

Query  1175  TVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1354
                  +                  P+ Y HVGVEL LD++ SPFLK   D+ CAHNLE  
Sbjct  355   WFSLWLP-----------------PFQYYHVGVELKLDNNKSPFLK--HDVDCAHNLEVL  395

Query  1355  LHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVV  1534
             LHL+DGYHG+   F  A+ RD ALVNK  +FLK  + VPP W QDENKG+ R+SDGRWV 
Sbjct  396   LHLLDGYHGERGEFMLASDRDHALVNKGGDFLKESYLVPPNWWQDENKGLKRSSDGRWVQ  455

Query  1535  PERS-RIEAHP  1564
             PER+  ++ +P
Sbjct  456   PERTIEVDGYP  466



>emb|CDO99150.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   355 bits (912),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 193/365 (53%), Positives = 245/365 (67%), Gaps = 23/365 (6%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             + L + W EIQG  DW G+LDP+D  LR E+IRYG+ AQACYD+++FDP+SKYCG+CK  
Sbjct  86    KKLADAWREIQGQNDWAGMLDPLDPLLRAELIRYGDMAQACYDAYEFDPYSKYCGSCKVK  145

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
              + FFE LG     Y ++ Y+Y+T N+N P FF  S     WS  ANW+GYVAV+ +E  
Sbjct  146   PSMFFENLGWKKCSYEVTSYIYSTYNVNFPKFFNVSLNPDGWSHSANWIGYVAVSNEEYS  205

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  817
              + LGRRDI+IAWRGTVT  E I DL +  +PT +      DP IK+E+GF DLY    +
Sbjct  206   -KYLGRRDIMIAWRGTVTNAEKIADLMDFQNPTTYHTIPSRDPTIKVEAGFLDLYAG--R  262

Query  818   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  997
             + DC +C YSAREQ+LAEV RL E Y GE LSIT+TGHSLG+ALA L+AYDIAE+ ++V+
Sbjct  263   NVDCQYCKYSAREQVLAEVKRLKELYPGEELSITITGHSLGSALATLNAYDIAEIGLDVM  322

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1177
             +                  IP++VFSF+GPRVGN RFKER + LG+K+LRI NV D+VP 
Sbjct  323   E--------------DGRVIPVTVFSFSGPRVGNARFKERLEGLGVKILRIFNVHDQVPK  368

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
             VPGI  NE     K L+ +    PW Y HVG EL L+H  SPFLK  ++L   HNLE  L
Sbjct  369   VPGIFLNELV--PKVLQQLGGWLPWCYFHVGEELPLNHENSPFLKDESNLVFFHNLEVLL  426

Query  1358  HLVDG  1372
             HL+DG
Sbjct  427   HLLDG  431



>ref|XP_009362274.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=519

 Score =   355 bits (912),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 198/420 (47%), Positives = 268/420 (64%), Gaps = 33/420 (8%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             N+ E W EI GS DWEGLLDP+   +RREI++YGEFAQA YD+FDFD  S+YCG+C+Y+ 
Sbjct  94    NISEKWREIHGSNDWEGLLDPLHPWIRREIVKYGEFAQATYDAFDFDFFSEYCGSCRYNK  153

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + F+ LG+   GY +S+Y+YA S+I++P + + S +   WS+H+NWMGYVAV +DE E 
Sbjct  154   NKLFDVLGLDKNGYNVSKYIYAMSHIDMPQWLERSHLADTWSKHSNWMGYVAV-SDEEET  212

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
             RR+GRRDIV+AWRGTV   EW  D++  L P       D K+E GF  +YT +K DT   
Sbjct  213   RRIGRRDIVVAWRGTVVPSEWYEDMQRKLEPI---GGGDAKVEHGFHGIYT-AKSDT-TR  267

Query  833   FCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
             +   SA EQ++ EV RL+E Y  KGE +S+T+TGHSLG ALAL++AY+ AE    +    
Sbjct  268   YNKSSASEQVMKEVTRLVELYQAKGEEVSLTITGHSLGGALALVNAYEAAEKLPGL----  323

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                              PISV SF  PRVGN+ FKE   ++G+K LR+V  +D VP +PG
Sbjct  324   -----------------PISVISFGAPRVGNIAFKEELHQMGVKTLRVVVKQDMVPKMPG  366

Query  1187  IIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGT-DLGCAHNLEGHLHL  1363
             ++ NE  Q   + + +  +  W Y HVG EL L+  +SP+LK G  +L   H+LE +LHL
Sbjct  367   LVLNESLQ---KFDDITGTLDWVYTHVGAELKLEVGFSPYLKRGGFNLPGFHSLETYLHL  423

Query  1364  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             VDG+      FRS   RDIALVNK  + L  +  +P  W Q  +KG+VR + GRWV P+R
Sbjct  424   VDGFLSTETTFRSNARRDIALVNKGCDMLVDDLRIPQCWYQLPHKGLVRNAHGRWVKPKR  483



>ref|XP_008371801.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Malus 
domestica]
 ref|XP_008371802.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Malus 
domestica]
 ref|XP_008371803.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Malus 
domestica]
Length=518

 Score =   354 bits (909),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 198/419 (47%), Positives = 267/419 (64%), Gaps = 33/419 (8%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             + E W EI GS DWEGLLDP+   LRREI++YGEFAQA YD+FDFD  S+YCG+C+Y+ +
Sbjct  92    ISEKWREIHGSNDWEGLLDPLHPWLRREIVKYGEFAQATYDAFDFDSFSEYCGSCRYNKS  151

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             + F+ LG+   GY +S+Y+YA S+I++P + + S +   WS+H+NWMGYVAV+ DE E R
Sbjct  152   KLFDVLGLDKNGYNVSKYIYAMSHIDMPQWLERSHLADTWSKHSNWMGYVAVSDDE-ETR  210

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  835
             R+GRRDIV+AWRGTV   EW  D++  L P       D K+E GF  +YT +K DT   +
Sbjct  211   RIGRRDIVVAWRGTVVPSEWYEDMQRKLEPI---GGGDAKVEHGFHGIYT-AKSDT-TRY  265

Query  836   CSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1009
                SA EQ++ EV RL+E Y  KGE +S+T+TGHSLG ALALL+AY+ AE    +     
Sbjct  266   NRSSASEQVMKEVTRLVELYQAKGEEVSLTITGHSLGGALALLNAYEAAEKLPGL-----  320

Query  1010  gegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1189
                             PISV SF  PRVGN+ FKE   ++G+  LR+V  +D VP +PG+
Sbjct  321   ----------------PISVISFGAPRVGNIAFKEELHQMGVNTLRVVVKQDMVPKMPGL  364

Query  1190  IANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGT-DLGCAHNLEGHLHLV  1366
             + NE     K+ + +  +  W Y HVG EL L+  +SP+LK G  +L   H+LE +LHLV
Sbjct  365   VLNESL---KKFDDITGTLDWVYTHVGAELKLEVGFSPYLKRGGFNLQGFHSLETYLHLV  421

Query  1367  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             DG+      FRS   RDIALVNK  + L  +  +P  W Q  +KG+VR + GRWV P+R
Sbjct  422   DGFFSTDTTFRSNARRDIALVNKGCDMLVDDLRIPQCWYQLPHKGLVRNAHGRWVKPKR  480



>ref|XP_008371821.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Malus 
domestica]
Length=516

 Score =   353 bits (907),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 198/419 (47%), Positives = 265/419 (63%), Gaps = 33/419 (8%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             + E W EI GS DWEGLLDP+   LRREI++YGEFAQA YD+FDFD  S+YCG+C+Y+  
Sbjct  90    MSEKWREIHGSNDWEGLLDPLHPWLRREIVKYGEFAQATYDAFDFDSFSEYCGSCRYNKN  149

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             + F+ LG+   GY +S+Y+YA S+I++P + + S +   WS+H+NWMGYVAV+ DE E R
Sbjct  150   KLFDVLGLDKNGYNVSKYIYAMSHIDMPQWLERSHLADTWSKHSNWMGYVAVSDDE-ETR  208

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  835
             R+GRRDIV+AWRGTV   EW  D++  L P       D K+E GF  +YT +K DT   +
Sbjct  209   RIGRRDIVVAWRGTVVPSEWYEDMQRKLEPI---GSGDAKVEHGFHGIYT-AKSDT-TRY  263

Query  836   CSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1009
                SA EQ++ EV RL+E Y  KGE +S+T+TGHSLG ALALL+AY+ AE    ++    
Sbjct  264   NKSSASEQVMKEVTRLVELYQAKGEEVSLTITGHSLGGALALLNAYEAAEKLPGIM----  319

Query  1010  gegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1189
                              ISV SF  PRVGN+ FKE   ++G+K LR+V  +D VP +PG+
Sbjct  320   -----------------ISVISFGAPRVGNIAFKEELHQMGVKTLRVVVKQDMVPKMPGL  362

Query  1190  IANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGT-DLGCAHNLEGHLHLV  1366
             + NE  Q   + + +  +  W YAHVG EL L+   SP+LK G  +L   H+LE +LHLV
Sbjct  363   VLNESLQ---KFDDITGTLDWVYAHVGAELKLEIGSSPYLKHGGFNLPGFHSLETYLHLV  419

Query  1367  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             DG+      FRS   RDI LVNK  + L  +  +P  W Q  +KG+VR   GRWV P+R
Sbjct  420   DGFLSTETTFRSNARRDITLVNKGCDMLVDDLRIPQCWYQLPHKGLVRNVHGRWVKPKR  478



>ref|XP_009614944.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=404

 Score =   349 bits (895),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 195/366 (53%), Positives = 244/366 (67%), Gaps = 27/366 (7%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             + E W +I G  DWEG+LDP++  LR E+IRYGE AQACYD+F  D  SK+CG+CK D  
Sbjct  57    IAEKWKDIHGQNDWEGMLDPINPLLRAELIRYGEMAQACYDAFHLDQDSKFCGSCKIDPG  116

Query  476   QFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              FF+ LG+ A+ GY ++ Y+Y+  +IN+P+FF+       WS  ANW+GYVAV+ DE   
Sbjct  117   LFFQSLGLSANHGYNVTSYIYSMYHINIPSFFKVPLWPDAWSHKANWIGYVAVSNDEYS-  175

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKD  820
               LGRRDI IAWRGTVT LE I D  +   PT +      DP IK+E+GF ++YT+  KD
Sbjct  176   THLGRRDITIAWRGTVTDLEKIADFMDFQKPTRYHKIPSRDPTIKVEAGFLEIYTS--KD  233

Query  821   TDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
              +CNFC  SAREQ+LAEV RLI+RY  E +SIT+TGHSLG+ALA ++AYDIAE+ ++V +
Sbjct  234   DECNFCKVSAREQVLAEVKRLIDRYSNEEISITITGHSLGSALATINAYDIAEIGLDVRE  293

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1180
                               IPI VFSF+GPRVGN+RFK+R + LG+KVLR+VN  DKVP V
Sbjct  294   --------------DGRVIPICVFSFSGPRVGNIRFKQRLEGLGVKVLRVVNKHDKVPAV  339

Query  1181  PGIIANEKFQ--YQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1354
             PGI  NE      QK  E  L   PW Y HVG EL LDH  SPFLK   +L   HNLE H
Sbjct  340   PGIFLNENVPTFVQKVGELFL---PWCYLHVGEELVLDHKTSPFLKDIDNLTYFHNLEVH  396

Query  1355  LHLVDG  1372
             LHL+DG
Sbjct  397   LHLLDG  402



>ref|XP_008371806.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Malus 
domestica]
Length=519

 Score =   352 bits (902),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 198/419 (47%), Positives = 266/419 (63%), Gaps = 33/419 (8%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             + E W EI GS DWEGLLDP+   LRREI++YGEFAQA YD+FDFD  S+YCG+C+Y+  
Sbjct  95    ISEKWREIHGSNDWEGLLDPLHPWLRREIVKYGEFAQATYDAFDFDSFSEYCGSCRYNKN  154

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             + F+ LG+   GY +S+Y+YA S+I++P + + S +   WS+H+NWMGYVAV +DE E R
Sbjct  155   KLFDVLGLDKNGYNVSKYIYAMSHIDMPQWLERSHLADTWSKHSNWMGYVAV-SDEEETR  213

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  835
             R+GRRDIV+AWRGTV   EW  D++  L P       D K+E GF  +YT +K DT   +
Sbjct  214   RIGRRDIVVAWRGTVAPSEWYEDMQRKLEPI---GSGDAKVEHGFHGIYT-AKSDT-TRY  268

Query  836   CSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1009
                SA EQ++ EV RL+E Y  +GE +S+T+TGHSLG ALALL+AY+ AE    +     
Sbjct  269   NRSSASEQVMKEVARLVELYQARGEEVSLTITGHSLGGALALLNAYEAAEKLPGL-----  323

Query  1010  gegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1189
                             PISV SF  PRVGN+ FKE   ++G+K LR+V  +D VP +PG+
Sbjct  324   ----------------PISVISFGAPRVGNIAFKEELHQMGVKTLRVVVKQDMVPKMPGL  367

Query  1190  IANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGT-DLGCAHNLEGHLHLV  1366
             + NE  Q   + + +  +  W Y HVG EL L+   SP+LK G  +L   H+LE +LHLV
Sbjct  368   VLNESLQ---KFDDITGTLDWVYTHVGAELKLEVGSSPYLKHGRFNLPGFHSLETYLHLV  424

Query  1367  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             DG+      FRS   RDIALVNK  + L  +  +P  W Q  +KG+VR + GRWV P+R
Sbjct  425   DGFFSTETTFRSNARRDIALVNKGCDMLVDDLKIPQCWYQLPHKGLVRNAHGRWVKPKR  483



>ref|XP_006827274.1| hypothetical protein AMTR_s00010p00263480 [Amborella trichopoda]
 gb|ERM94511.1| hypothetical protein AMTR_s00010p00263480 [Amborella trichopoda]
Length=450

 Score =   348 bits (892),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 196/431 (45%), Positives = 272/431 (63%), Gaps = 31/431 (7%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             +++HE W EI GS  W+GLL+P+   L+REII+YGE AQA YD+FDFD  S YCG+C+Y 
Sbjct  43    QDIHERWQEIHGSNHWQGLLNPLHPWLQREIIKYGELAQATYDAFDFDCFSHYCGSCRYS  102

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
              ++ F+KLG+   GY++++YLYA S+++LP+    S     WS+ +NWMGYVAV +D+ E
Sbjct  103   PSRLFQKLGLTRCGYKVTKYLYAMSHVDLPHLLNRSLTGNKWSRDSNWMGYVAV-SDDNE  161

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  829
              +R+GRRD+++AWRGTVT LEW+ +++  L     + D D+K+E GF  ++ +  + T  
Sbjct  162   SQRIGRRDVIVAWRGTVTPLEWVENIQERLESIE-QHDVDVKVEHGFLSIFRSKSEATRY  220

Query  830   NFCSYSAREQLLAEVNRLIE--RYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
             N    SA EQ + E+ R++   R +GE +S+T+TGHSLG ALALL+AY+ A  ++++   
Sbjct  221   N--KSSACEQAMREIERVVSFHRERGEGVSLTITGHSLGGALALLNAYEAAISQLDI---  275

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1183
                               PI+VFSFA PRVGN  F++R   LG K LR+V  +D VP +P
Sbjct  276   ------------------PIAVFSFAAPRVGNTAFRDRLKHLGAKTLRVVIKQDVVPKMP  317

Query  1184  GIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1363
             GI+ NE     K+ E +  S  W Y H+G EL+LD S SPFLK   +    H+LE +LHL
Sbjct  318   GIVFNEGM---KKFEEITGSLQWMYTHLGEELSLDVSSSPFLKHAWNPIGFHSLETYLHL  374

Query  1364  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             VDGY      F  A  RDIALVNK  N +  E  +PP W Q  NKG+V+ S GRWV PER
Sbjct  375   VDGYSSQNEPFSHAAKRDIALVNKACNMVVDELRIPPCWHQLANKGLVQNSYGRWVHPER  434

Query  1544  SRIEAHPSDTG  1576
               +E  P   G
Sbjct  435   D-VEDIPCPLG  444



>ref|XP_009362273.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=519

 Score =   347 bits (891),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 196/419 (47%), Positives = 264/419 (63%), Gaps = 33/419 (8%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             + E W +I GS DWEGLLDP+   LRREI++YGEFAQA YD+FDF   S+YCG+C+Y+  
Sbjct  95    ISEKWRKIHGSNDWEGLLDPLHPWLRREIVKYGEFAQATYDAFDFVSFSEYCGSCRYNKN  154

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             + F+ LG+   GY +S+Y+YA S+I++P + + S +   WS+H+NWMGYVAV +DE E R
Sbjct  155   KLFDVLGLDKNGYNVSKYIYAMSHIDMPQWLERSHLADTWSKHSNWMGYVAV-SDEEETR  213

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  835
             R+GRRDIV+AWRGTV   EW  D++  L P       D K+E GF  +YT +K DT   +
Sbjct  214   RIGRRDIVVAWRGTVAPSEWYEDMQRKLEPI---GSGDAKVEHGFHGIYT-AKSDT-TRY  268

Query  836   CSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1009
                SA EQ++ EV RL+E Y  +GE +S+T+TGHSLG ALALL+AY+ AE    +     
Sbjct  269   NRSSASEQVMKEVARLVELYQARGEEVSLTITGHSLGGALALLNAYEAAEKLPGL-----  323

Query  1010  gegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1189
                             PISV SF  PRVGN+ FKE   ++G+K LR+V  +D VP +PG+
Sbjct  324   ----------------PISVISFGAPRVGNIAFKEELHQMGVKTLRVVVKQDMVPKMPGL  367

Query  1190  IANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGT-DLGCAHNLEGHLHLV  1366
             + NE  Q   + + +     W Y HVG EL L+   SP+LK G  +L   H+LE +LHLV
Sbjct  368   VLNESLQ---KFDDITGPLDWVYTHVGAELKLEVGSSPYLKRGGFNLPGFHSLETYLHLV  424

Query  1367  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             DG+      FRS   RDIALVNK  + L  +  +P  W Q  +KG+VR + GRWV P+R
Sbjct  425   DGFFSTETTFRSNARRDIALVNKGCDMLVDDLKIPQCWYQLPHKGLVRNAQGRWVKPKR  483



>ref|XP_009399031.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=483

 Score =   345 bits (885),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 198/439 (45%), Positives = 269/439 (61%), Gaps = 35/439 (8%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             ++  ++ EI G  DW  LL+P+   LRREII+YGEFAQA YD+FDF+P S++CG+C Y  
Sbjct  78    DIFSLFPEIHGHADWSPLLNPLHPWLRREIIKYGEFAQATYDAFDFNPLSEFCGSCLYGR  137

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              +  +KLG+A  GYR+S+Y+YA S++ LP + + S     WS  +NWMGYVAV +D+AE 
Sbjct  138   HRLLDKLGLARNGYRVSKYVYAMSHVKLPRWLERSLHADAWSTESNWMGYVAV-SDDAES  196

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
             RR+G RDIV+AWRGT+   EW  D++  L P       D+ +E GF  +YT+    T  N
Sbjct  197   RRIGCRDIVVAWRGTIAPTEWFKDVQGKLEPLG-DARADVMVEHGFLGVYTSKSDRTRYN  255

Query  833   FCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
                 SA EQ++ E+ RL+  Y  +GE +S+T+TGHSLG ALALL+A++ A    ++    
Sbjct  256   --KTSASEQVMEEIERLVSHYRQRGEEVSLTITGHSLGGALALLNAHEAASTIPDL----  309

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                              PISV SF GPRVGN+ F E+  E+ +KVLR+V  +D VP VPG
Sbjct  310   -----------------PISVISFGGPRVGNVAFGEKLKEMNVKVLRVVVKQDMVPKVPG  352

Query  1187  IIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1366
             I+ NE  +  + +   L+S    Y HVG+EL LD S SP+LK G D+   H LE +LHLV
Sbjct  353   ILFNEGLKRFEHVTGTLESV---YTHVGLELGLDVSSSPYLKHGLDVAGFHKLETYLHLV  409

Query  1367  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1546
             DG+    + FR    RD+ALVNK S  L+ E  +PPRW Q  NKGMVR + GRWV P R 
Sbjct  410   DGFLSSDKEFRRNARRDVALVNKTSGMLRDELHIPPRWAQAANKGMVRNAYGRWVKPARE  469

Query  1547  RIEAHPSDTGHHFRKVLRL  1603
                  P D    +R+  +L
Sbjct  470   -----PEDIPSPYREEAQL  483



>gb|KDP38020.1| hypothetical protein JCGZ_04663 [Jatropha curcas]
Length=512

 Score =   345 bits (886),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 191/419 (46%), Positives = 266/419 (63%), Gaps = 32/419 (8%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             N+   W EI GS +WE LLDP+D  LRREI++YGEFA A YD+FDFDP S+YCG+C+Y+ 
Sbjct  104   NVSAKWREIHGSCNWENLLDPLDPCLRREILKYGEFATATYDAFDFDPLSEYCGSCRYNR  163

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + FE+LG+    Y +++Y+YA S++++P +F  +  + IWS+ +NWMGYVAV+ D+ E 
Sbjct  164   HKIFEELGLNKHNYNVTKYIYAMSHVDVPEWFVRA--HSIWSKDSNWMGYVAVSNDQ-ES  220

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
             +RLGRRDIV+AWRGTV   EW  DLK  L      ++  IK++ GF+ +Y +  + T  N
Sbjct  221   KRLGRRDIVVAWRGTVAPTEWFTDLKTKLEEID-EENEKIKVQYGFYSIYKSKSEFTRYN  279

Query  833   FCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
                 SA EQ++ E+ +L+  Y+  GE +S+TVTGHSLG ALA+L+AY+ A    N+    
Sbjct  280   --KLSASEQVMQEIRKLVNCYRENGEEVSLTVTGHSLGGALAVLNAYEAANSIPNLF---  334

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                               +SV SF  PRVGNL FKE+ +ELG+K LR+V  +D VP VPG
Sbjct  335   ------------------VSVISFGAPRVGNLAFKEKLNELGVKTLRVVVKQDIVPKVPG  376

Query  1187  IIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1366
             II N+     +++ T+ +   W Y HVG +L LD   SP+LK  +D   +HNLE +LHL+
Sbjct  377   IIVNKIL---RKINTITQRLNWVYRHVGTQLKLDMFMSPYLKHVSDFSGSHNLEVYLHLL  433

Query  1367  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             DG+ G   +FR    RD+ALVNK S+ L  E  +P  W Q  +KG+V    GRWV P R
Sbjct  434   DGFLGKKLQFRWHARRDLALVNKSSDMLIEELKIPEFWYQLPHKGLVLNKYGRWVKPTR  492



>ref|XP_010940258.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Elaeis 
guineensis]
Length=505

 Score =   345 bits (886),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 192/419 (46%), Positives = 260/419 (62%), Gaps = 30/419 (7%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             ++  + +E+ GS DW  LL+P+   LRREI++YGEFAQA YD+FDF+P S+YCG+C Y+ 
Sbjct  97    DVSSLCSELHGSGDWSHLLNPLHRWLRREIVKYGEFAQATYDAFDFNPFSEYCGSCLYNR  156

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + F+ LG+A  GY +++Y+YA S+I LP + + S     WS+ +NWMGYVAV +D+ E 
Sbjct  157   RRLFDNLGLAKNGYNVTKYIYAMSHIELPRWLERSIRADTWSKDSNWMGYVAV-SDDTES  215

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
             RR+G RDIV+AWRGT+   EW  DL+  L  +   D  D+K+E GF  +YT+    T  N
Sbjct  216   RRIGCRDIVVAWRGTIAPAEWFEDLQGKLQ-SLGSDHGDVKVEHGFLSIYTSKSDATRYN  274

Query  833   FCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
                 SA EQ++ E+ RL+  Y  KGE +S+T+TGHSLG ALALL+AY+ A          
Sbjct  275   --KSSASEQVMEEIKRLVSFYREKGEQVSLTITGHSLGGALALLNAYEAAS---------  323

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                         A   +P+SV SF  PRVGN+ F E+  E+ +K LR+V  +D VP +PG
Sbjct  324   ------------AIPYLPVSVISFGAPRVGNIAFGEKLKEMEVKTLRVVVKQDLVPKMPG  371

Query  1187  IIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1366
             I+ NE     K+ E +  +  W Y HVG+EL LD   SP+LK G D+   HNLE +LHLV
Sbjct  372   ILFNEGI---KKFENVTGTLDWVYTHVGLELGLDVRSSPYLKKGLDVPGFHNLEAYLHLV  428

Query  1367  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             DGY      FR    RD+ LVNK S  L+ E  +PP W Q  NKG+V  S GRWV P+R
Sbjct  429   DGYLSSDTEFRLDAKRDVVLVNKASGMLREELRIPPCWYQSANKGLVCNSYGRWVQPQR  487



>gb|EYU19151.1| hypothetical protein MIMGU_mgv1a006227mg [Erythranthe guttata]
Length=452

 Score =   343 bits (879),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 182/423 (43%), Positives = 264/423 (62%), Gaps = 40/423 (9%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             ++ + W E  GS DW+ LLDP+   LRREI++YGEFAQA YD+FDFDP S+YCG+CKY+ 
Sbjct  40    DISDKWREFHGSSDWQNLLDPLHPSLRREIVKYGEFAQATYDAFDFDPFSEYCGSCKYNR  99

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + FEKLG+   GY +++Y++A S+I+LP + + S +   WS+ +NWMG+VAV +D+ E 
Sbjct  100   RKLFEKLGLTKNGYNVTKYVHAMSHIDLPQWLEKSHLVETWSKDSNWMGFVAV-SDDQES  158

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
             RR+GRRDIV++WRGTV   EW  +++  L P       D ++E GF  +YT+  K     
Sbjct  159   RRIGRRDIVVSWRGTVAPSEWYDNMQRKLEPI---GQGDARVEHGFLSIYTS--KSCTTR  213

Query  833   FCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAE----MKVNV  994
             +   SA EQ++AE+ +L++ Y+  GE +S+T+TGHSLG ALAL++AY+ A+    + ++V
Sbjct  214   YNKTSASEQVMAEIKKLVKFYENNGEQVSLTITGHSLGGALALINAYESAKNFPGLPISV  273

Query  995   VQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVP  1174
             V                         SFA PRVGN+ F++   ++G+K LR+ + +D VP
Sbjct  274   V-------------------------SFAAPRVGNIAFRDELYQMGVKTLRVTSKQDVVP  308

Query  1175  TVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1354
              +PG + NE  Q   + + +  +  W Y HVGVEL LD   SP+LK G +L   H LE +
Sbjct  309   RMPGFVLNESLQ---RFDDITGTLEWIYTHVGVELKLDVRSSPYLKKGLNLVGFHMLETY  365

Query  1355  LHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVV  1534
             LHLVDG+H     FR    RD+ALVNK+ + L  E  +P  W Q  NKG+++   GRWV 
Sbjct  366   LHLVDGFHSSESGFRVEARRDVALVNKECDMLVDELRIPHSWYQSANKGLIQNHHGRWVK  425

Query  1535  PER  1543
             P R
Sbjct  426   PVR  428



>ref|XP_010245170.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Nelumbo 
nucifera]
Length=534

 Score =   345 bits (885),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 197/420 (47%), Positives = 262/420 (62%), Gaps = 33/420 (8%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             ++ E W E+ G  DW+ LLDP+   LRREII+YGEF+QA YD+FDFD  S+YCG+C+Y+ 
Sbjct  97    DISEKWCELHGLTDWDNLLDPLHPWLRREIIKYGEFSQATYDAFDFDSFSEYCGSCRYNP  156

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSS-VNRIWSQHANWMGYVAVATDEAE  649
              +FFEKLG+   GY +S+Y+YA S+I++P + Q S+ V   WS+ +NWMG+VAV+  E E
Sbjct  157   KRFFEKLGLGKNGYVMSKYIYAMSHIDMPRWLQRSNLVEETWSKDSNWMGFVAVSNGE-E  215

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  829
              RR+GRRDIV+AWRGTV   EW  DL+  L P     D D+++E GF  +YT SK DT  
Sbjct  216   SRRIGRRDIVVAWRGTVAPSEWYEDLQRKLEPI---GDGDVRVEHGFLSIYT-SKCDT-T  270

Query  830   NFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
              +   SA EQ++ EV RL+  Y  +GE +S+T+TGHSLG AL LL+AY+ A     +   
Sbjct  271   RYNKSSASEQVMKEVRRLVSFYRERGEEVSLTITGHSLGGALGLLNAYEAASSLPGL---  327

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1183
                               PISV SF  PRVGN+ F+E+  ++G+K LR+V  +D VP +P
Sbjct  328   ------------------PISVISFGAPRVGNVAFREKLQQMGVKTLRVVVKQDVVPKMP  369

Query  1184  GIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1363
             G++ NE  +   + +       W Y HVG EL LD S SP+LK G DL   H+ E +LHL
Sbjct  370   GLMLNEGLE---RFDDFTGPLEWVYTHVGAELRLDVSSSPYLKRGLDLLGFHSQETYLHL  426

Query  1364  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             VDG+      FRS   RDIALVNK    L  E  +P  W Q  NKG+V  S GRWV P+R
Sbjct  427   VDGFLSSASTFRSDARRDIALVNKACGLLVDELRIPHCWYQLANKGLVLNSYGRWVKPKR  486



>ref|XP_008784887.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Phoenix dactylifera]
Length=499

 Score =   343 bits (881),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 190/419 (45%), Positives = 260/419 (62%), Gaps = 30/419 (7%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             ++  + +E+ G  DW  LL+P+   LRREI++YGEFAQA YD+FDF+P S++CG+C Y  
Sbjct  96    DVSSLCSELHGPGDWSRLLNPLHRWLRREIVKYGEFAQATYDAFDFNPFSEHCGSCLYCR  155

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + F+KLG+A  GY +S+Y+YA S+I LP + + S     WS+ +NWMGYVAV +D+ E 
Sbjct  156   RRLFDKLGLAKNGYDVSKYIYAMSHIELPRWLERSIHADTWSKDSNWMGYVAV-SDDTES  214

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
              R+G RDIV+AWRGT+   EW  DL+  L P    D  D+++E GF  +YT+    T  N
Sbjct  215   HRIGCRDIVVAWRGTIAPAEWFGDLQGKLEPLG-SDHGDVRVEHGFLSIYTSKSDATRYN  273

Query  833   FCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
                 SA EQ++ E+ RL+  Y  KGE +S+T+TGHSLG ALALL+AY+ A    ++    
Sbjct  274   --KSSASEQVMEEIKRLVSFYREKGEQVSLTITGHSLGGALALLNAYEAASAVPDL----  327

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                              P+SV SF  PRVGN+ F E+  ++ +K LR+V  +D VP +PG
Sbjct  328   -----------------PVSVISFGAPRVGNIAFGEKLKQMEVKTLRVVVKQDVVPKMPG  370

Query  1187  IIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1366
             I+ NEK    K+ E +  +  W Y HVG+EL LD   SP+LK G D+   H+LE +LHLV
Sbjct  371   ILFNEKI---KKFENVTGTLEWVYTHVGLELGLDVRSSPYLKKGLDIPGFHSLETYLHLV  427

Query  1367  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             DGY      FR    RD+ALVNK S  L+ E  +PP W Q  NKGM   S GRWV+P+R
Sbjct  428   DGYLSSDTEFRVDAKRDVALVNKASGMLREELRIPPCWHQSANKGMACNSYGRWVLPQR  486



>ref|XP_011096641.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Sesamum indicum]
Length=515

 Score =   344 bits (883),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 191/414 (46%), Positives = 261/414 (63%), Gaps = 32/414 (8%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI GS+DW+ LLDP+   LRREI++YGEFAQA YD+FDFD  S+YCG+C Y+  + F+
Sbjct  98    WREIHGSRDWDDLLDPLHPWLRREIVKYGEFAQATYDAFDFDAFSEYCGSCMYNRHKLFD  157

Query  488   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  667
             KLG+   GY +++Y+YA S+I+LP + + S     WS+ +NWMG+VAV +D+ E +R+GR
Sbjct  158   KLGLTKTGYNVTQYIYAMSHIDLPLWLEKSRFVDTWSKDSNWMGFVAV-SDDQESKRIGR  216

Query  668   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYS  847
             RDIV+AWRGTV   EW  +++  L P    D    K+E GF  +YT SK D    +   S
Sbjct  217   RDIVVAWRGTVAPSEWYDNMQRKLEPIGHGDS---KVEHGFLSIYT-SKSDF-TRYNKSS  271

Query  848   AREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegd  1021
             A EQ++ EV +L++ Y+  GE +S+T+TGHSLG AL LL+AY+ A+   N+         
Sbjct  272   ASEQVMREVKKLVDYYQKIGEQVSLTITGHSLGGALGLLNAYEAAKNFPNL---------  322

Query  1022  gesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1201
                         PISV SFA PRVGN+ F++   ++G+K LR+   +D VP +PGI+ NE
Sbjct  323   ------------PISVVSFAAPRVGNIAFRDELYQMGVKTLRVTMKQDVVPRMPGIVFNE  370

Query  1202  KFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1381
               Q   + + +  +  W Y HVGVEL LD   SP+LK G +L   H LE +LHLVDGY  
Sbjct  371   SLQ---RFDDITGTLEWVYTHVGVELKLDVRSSPYLKKGLNLVGYHMLETYLHLVDGYQS  427

Query  1382  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
                 FR+   RD+ALVNKD + L  E  +PP W Q  NKG+ R   GRWV P+R
Sbjct  428   SDSGFRADAKRDVALVNKDCDMLVDELRIPPNWYQLANKGLERNDHGRWVKPKR  481



>emb|CBI17935.3| unnamed protein product [Vitis vinifera]
Length=415

 Score =   340 bits (873),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 205/438 (47%), Positives = 236/438 (54%), Gaps = 118/438 (27%)
 Frame = +2

Query  302   EIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQF  481
             E W EI G  DW G+LDPMD  LR E+IRYGE AQACYD+FDFDP SKYCGTC++   +F
Sbjct  83    ERWREIHGEDDWTGMLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGTCRFMPRKF  142

Query  482   FEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRL  661
             F+ LGMA  GY +                                              L
Sbjct  143   FDSLGMAGHGYDVV---------------------------------------------L  157

Query  662   GRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSKKDTDC  829
             GRRDI IAWRGTVT LEWI DL + L P    + P     +K+ESGF DLYT+  KD  C
Sbjct  158   GRRDITIAWRGTVTRLEWIADLMDFLKPVSSENIPCPDRTVKVESGFLDLYTD--KDESC  215

Query  830   NFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1009
              FC +SAREQ+L EV RLIE Y  E LSIT TGHSLG ALA+LSAYD+AE  +NV+  G 
Sbjct  216   KFCKFSAREQILTEVKRLIEMYPNEELSITFTGHSLGGALAVLSAYDVAETGLNVLNNGR  275

Query  1010  gegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1189
                                V SF+GPR                                 
Sbjct  276   VLPVS--------------VLSFSGPR---------------------------------  288

Query  1190  IANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1369
                                PWSY+HVGVELALDH  SPFLK   D   AHNLE HLHL+D
Sbjct  289   -----------------GLPWSYSHVGVELALDHKNSPFLKQNADPISAHNLEAHLHLLD  331

Query  1370  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1549
             GYHG G+RF  A+GRD ALVNK S+FLK  + VPP WRQDENKGMVR+SDGRWV PER +
Sbjct  332   GYHGKGQRFVLASGRDPALVNKASDFLKDHYLVPPYWRQDENKGMVRSSDGRWVQPERPK  391

Query  1550  IEAHP---SDTGHHFRKV  1594
              E H    +D  HH  ++
Sbjct  392   HELHDHNHADMHHHLGQL  409



>ref|XP_010655697.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Vitis 
vinifera]
Length=510

 Score =   343 bits (881),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 186/410 (45%), Positives = 260/410 (63%), Gaps = 32/410 (8%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W+EI GS DW+ LLDP+   LRREI++YGEFAQA YD+FDFD  S+YCG+C+Y+  + F+
Sbjct  94    WSEIHGSCDWDNLLDPLQPWLRREIVKYGEFAQATYDAFDFDSFSEYCGSCRYNQHKLFK  153

Query  488   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  667
             +LG+   GY +S+Y+YA S+I++P + + S +   WS+ +NWMGYVAV +D+ E RR+GR
Sbjct  154   ELGLEKNGYMVSKYIYAMSHIDVPQWLERSHLLDTWSKDSNWMGYVAV-SDDQESRRIGR  212

Query  668   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYS  847
             RDIV++WRGTV   EW  D +  L P       + K+E GF  +YT+ ++ +  N    S
Sbjct  213   RDIVVSWRGTVAPSEWYEDFQRKLEPV---GSGEAKVEHGFLSIYTSKRESSRYN--KSS  267

Query  848   AREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegd  1021
             A +Q++ EV RL++ YK  GE +S+T+TGHSLG ALALL+AY+ A     +         
Sbjct  268   ASDQVMKEVTRLVQLYKQRGEQVSLTITGHSLGGALALLNAYEAATSLPGL---------  318

Query  1022  gesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1201
                         PISV SF  PRVGN+ F++   +LG+K LR+V  +D VP +PG++ NE
Sbjct  319   ------------PISVISFGAPRVGNIAFRDELHQLGVKTLRVVVKQDMVPRMPGLVFNE  366

Query  1202  KFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1381
             + Q   + + +  +  W Y HVG EL LD   SP+LK G +L   H+LE +LHL+DG+H 
Sbjct  367   RLQ---KFDDITGTLKWVYTHVGAELKLDVQSSPYLKRGFNLPGFHSLETYLHLIDGFHS  423

Query  1382  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
                 FR    RDIALVNK  + L  E  +P  W Q  NKG+VR + GRWV
Sbjct  424   KTSTFREGARRDIALVNKACDMLVDELRIPHAWYQFANKGLVRNAHGRWV  473



>ref|XP_008444745.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Cucumis melo]
Length=535

 Score =   344 bits (882),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 187/445 (42%), Positives = 277/445 (62%), Gaps = 45/445 (10%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             N+  +W ++ G+ DWEGLLDP+   LRREI++YGEFAQA YD+FDFDP S++CG+C+Y+ 
Sbjct  128   NISAVWRDLHGASDWEGLLDPLHPFLRREIVKYGEFAQATYDAFDFDPLSEFCGSCRYNR  187

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              +   +LG+A  GY++++Y+YA S ++ P++F+ S +  +WS+ +NWMGYVAV++DE E 
Sbjct  188   HKLLNELGLAQNGYKVTKYIYALSPVDGPDWFESSKIGEVWSRDSNWMGYVAVSSDE-ES  246

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
              R+GRRDI++AWRGTVT  EW  DLK  L     R +  +K++ GF  +Y +  KD D  
Sbjct  247   DRIGRRDILVAWRGTVTPTEWYIDLKTKLKKID-RSNKKVKVQRGFLTIYKS--KDEDSK  303

Query  833   FCSYSAREQLLAEVNRLIERYKGEN---LSITVTGHslgaalallsaYDI-----AEMKV  988
             F   SA EQ++ E++RLI+ +K +    +S+T+TGHSLG AL+LL+AY+      A++ V
Sbjct  304   FNKTSASEQVMEELHRLIDFFKEKGDREISLTITGHSLGGALSLLTAYEAGVTFPADVHV  363

Query  989   NVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDK  1168
             +VV                         SF  PRVGNL F+E+ +E+G+K LR+V  +D 
Sbjct  364   SVV-------------------------SFGAPRVGNLAFREKLNEMGVKTLRVVIRQDI  398

Query  1169  VPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLE  1348
             VP +PG+  N       +L  +     W Y HVG EL ++   SP+LK  +D+  +HNLE
Sbjct  399   VPKLPGLFVNSIVN---KLGAVTGKLNWVYRHVGKELRMNMYMSPYLKKDSDMSGSHNLE  455

Query  1349  GHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRW  1528
              +LHLVDG+     +FR  + RD+ALVNK S+ L  E  +P  W Q  +KG+++   GRW
Sbjct  456   IYLHLVDGFVAKKGKFRWNSRRDVALVNKGSDMLVEELRIPEFWYQLPHKGLIKNRFGRW  515

Query  1529  VVPERSRIEAHPSDTGHHFRKVLRL  1603
             V P R     +P D    F + L++
Sbjct  516   VKPGR-----NPEDIPSPFSQPLQV  535



>gb|EPS66180.1| hypothetical protein M569_08597, partial [Genlisea aurea]
Length=423

 Score =   340 bits (872),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 184/422 (44%), Positives = 260/422 (62%), Gaps = 33/422 (8%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI G+ DW+ +L+P+   LRREII+YGEF+QA YD+FDFDP S+YCG+CKY+  +   
Sbjct  32    WREIHGANDWKAILNPLHPWLRREIIKYGEFSQATYDAFDFDPFSEYCGSCKYNKKKMLA  91

Query  488   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  667
             KLG+   GY +  Y+Y  S ++LP + Q S +   WS+ +NW+G++AV +D+ E RR+GR
Sbjct  92    KLGLEKSGYTVREYIYGMSQMDLPQWMQKSKLAETWSKDSNWIGFMAV-SDDVETRRIGR  150

Query  668   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYS  847
             RDI +AWRGTV   EW  ++K+ LHP     + + ++E GF  +YT+  + T  N    S
Sbjct  151   RDIAVAWRGTVAMSEWYDNMKSELHPI---GEGEARVEHGFLSIYTSKNESTRYN--QSS  205

Query  848   AREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegd  1021
             A EQ + E+ +LIE Y  +GE +S+T+TGHSLG ALALL+AYD A     +         
Sbjct  206   ASEQAIGEIKKLIEFYAERGEEISLTITGHSLGGALALLTAYDAARNFSGI---------  256

Query  1022  gesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1201
                          ISVFSFA PRVGN+ F++    +G+K LR+   +D VP +PGI+ NE
Sbjct  257   ------------HISVFSFAAPRVGNIAFRDELYAMGVKTLRVTINQDIVPKMPGIVFNE  304

Query  1202  KFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1381
               Q   + E    +  W Y HVG EL +D   SP+LK   +L   H LE +LHL+DG+  
Sbjct  305   NLQ---KFEDFTGALEWIYTHVGAELKIDVRSSPYLKKRLNLIGFHLLETYLHLIDGFVS  361

Query  1382  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAH  1561
             +   FR  + RD+ALVNK ++    +  +PP W Q ENKG+V+ + GRWV P+R  +E  
Sbjct  362   EDSDFREDSNRDVALVNKYADMAADDLRIPPAWFQPENKGLVKNAHGRWVKPQRD-LEDI  420

Query  1562  PS  1567
             PS
Sbjct  421   PS  422



>emb|CDP21091.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   343 bits (879),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 191/422 (45%), Positives = 263/422 (62%), Gaps = 38/422 (9%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             ++ E W EI GS +W+ L+DP+   LRREII+YGEFAQA YD+FDFDP S+YCG+C+Y+ 
Sbjct  95    DISEKWQEIHGSSEWDTLIDPLHPWLRREIIKYGEFAQATYDAFDFDPFSEYCGSCRYNR  154

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + F+KLG++  GY++S Y+YA S I+LP + + S +   WS+ +NWMG+VAV+ DE E 
Sbjct  155   HKIFDKLGLSKSGYKVSAYIYAMSQIDLPRWLERSQLVDTWSKDSNWMGFVAVSDDE-ES  213

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
             +R+GRRDIV+AWRGTV   EW  D +  L P     + D K+E GF  +YT     + C+
Sbjct  214   KRIGRRDIVVAWRGTVAATEWYEDFQRKLQPI---GEGDAKVEHGFLSIYT-----SKCD  265

Query  833   FCSY---SAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVV  997
             F  Y   SA EQ++ EV  L+  YK  GE +S+T+TGHSLG ALALL+AY+ A       
Sbjct  266   FTRYNKSSASEQVMKEVRNLVHFYKSRGEEVSLTITGHSLGGALALLNAYEAA-------  318

Query  998   QegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1177
                           ++   +P+SV SF  PRVGN+ F++   ++G+K LR+   +D VP 
Sbjct  319   --------------ASFPGLPVSVISFGAPRVGNIAFRDELYQMGVKTLRVTIRQDFVPR  364

Query  1178  VPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
             +PGI+ NE  Q   + + +  +  W Y HVGVEL LD   SP+LK G +L   H LE +L
Sbjct  365   MPGIVFNESLQ---RFDDLTGTLEWIYTHVGVELKLDIRSSPYLKRGFNLMGFHMLETYL  421

Query  1358  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1537
             HLVDG+      +RS   RD ALVNK  + L  E  +PP W Q  NKG+   + GRWV P
Sbjct  422   HLVDGFLSTTSTYRSDARRDAALVNKACDMLIDELRIPPSWYQLANKGLQCNAHGRWVKP  481

Query  1538  ER  1543
             +R
Sbjct  482   KR  483



>ref|XP_004167249.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Cucumis 
sativus]
Length=534

 Score =   342 bits (878),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 183/432 (42%), Positives = 274/432 (63%), Gaps = 41/432 (9%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             +  +W ++ G+ DWEGLLDP+   LRREI++YGEFAQA YD+FDFDP S++CG+C+Y+  
Sbjct  128   ISAVWRDLHGASDWEGLLDPLHPFLRREIVKYGEFAQATYDAFDFDPLSEFCGSCRYNRQ  187

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             +   +LG+A  GY++++Y+YA S ++ P++F+ S +  +WS+ +NWMG+VAV++DE E  
Sbjct  188   KLLNELGLAQNGYKVTKYIYALSPVDGPDWFESSKIGEVWSRDSNWMGFVAVSSDE-ESD  246

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  835
             R+GRRDI+++WRGTVT  EW  DLK  L     R +  +K++ GF  +Y +  KD D  F
Sbjct  247   RIGRRDILVSWRGTVTPTEWYIDLKTKLKKID-RSNKKVKVQRGFLTIYKS--KDEDSKF  303

Query  836   CSYSAREQLLAEVNRLIERYKGEN---LSITVTGHslgaalallsaYDI-----AEMKVN  991
                SA EQ++ E++RLI+ +K +    +S+T+TGHSLG AL+LL+AY+      A++ V+
Sbjct  304   NKTSASEQVMEELHRLIDFFKQKGDREISLTITGHSLGGALSLLTAYEAGVTFPADVHVS  363

Query  992   VVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKV  1171
             VV                         SF  PRVGNL F+E+ +E+G+K+LR+V  +D V
Sbjct  364   VV-------------------------SFGAPRVGNLAFREKLNEMGVKILRVVIGQDIV  398

Query  1172  PTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1351
             P +PG+  N       +L  +     W Y HVG EL ++   SP+LK  +D+  +HNLE 
Sbjct  399   PKLPGLFVNSIVN---KLSAVTGKLNWVYRHVGKELRMNMFMSPYLKKDSDMSGSHNLEI  455

Query  1352  HLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
             +LHLVDG+     +FR  + RD+ALVNK S+ L  E  +P  W Q  +KG+++   GRWV
Sbjct  456   YLHLVDGFVTKKGKFRWNSRRDVALVNKGSDMLVEELRIPEFWYQLPHKGLIKNRFGRWV  515

Query  1532  VPERSRIEAHPS  1567
              P R+ +E  PS
Sbjct  516   KPGRN-VEDIPS  526



>ref|XP_003532708.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Glycine 
max]
Length=497

 Score =   341 bits (875),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 191/432 (44%), Positives = 267/432 (62%), Gaps = 36/432 (8%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             N+ + W EIQG  +WE +LDP+   LRREI++YGEFAQA YD+FD+D  S+YCG+C+Y+ 
Sbjct  88    NISQKWREIQGYHNWEDILDPLQPWLRREIVKYGEFAQATYDAFDYDSFSEYCGSCRYNQ  147

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + FEKLG+    Y ++RY+YA S+I LP + + S V   WS+ +NW+G+VAV+ D+ E 
Sbjct  148   NKLFEKLGLTRNSYTVTRYIYAMSHIELPRWLERSHVADTWSKDSNWIGFVAVSDDD-ET  206

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
             RR+GRRDIV+AWRGTV   EW  D +  L P       D K+E GF  +Y +  + T  N
Sbjct  207   RRIGRRDIVVAWRGTVAPCEWYEDFQRKLDPI---GHGDAKVEHGFLSIYKSKSETTRYN  263

Query  833   FCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
                 SA +Q++ EV +L+  Y   KGE +S+T+TGHSLG ALAL++AY++A   +++   
Sbjct  264   --KSSASDQVMKEVTKLVNFYKGKKGEEVSLTITGHSLGGALALINAYEVATTFLDL---  318

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1183
                               P+SV SF  PRVGN+ FK+   ++G+K+LR+V  +D VP +P
Sbjct  319   ------------------PVSVISFGAPRVGNIAFKDELHQMGVKLLRVVVKQDWVPKMP  360

Query  1184  GIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1363
             G++ NEK +   +    +    W Y HVG ELALD   SP+LK G +L   H+LE +LHL
Sbjct  361   GLLFNEKLKMFDE----ITGLEWVYTHVGAELALDVHSSPYLKGGMNLSGFHSLETYLHL  416

Query  1364  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             +DGY      FRS   RDIALVNK  + L  E  +P  W Q  NKG+V  + GRWV P+R
Sbjct  417   IDGYLSHETPFRSEARRDIALVNKSCDMLVDELRIPHCWYQLANKGLVCNAHGRWVKPKR  476

Query  1544  SR--IEAHPSDT  1573
                 I +H S+ 
Sbjct  477   DNDDIPSHASEV  488



>ref|XP_004135535.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Cucumis 
sativus]
 gb|KGN65881.1| hypothetical protein Csa_1G537320 [Cucumis sativus]
Length=534

 Score =   342 bits (877),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 183/432 (42%), Positives = 274/432 (63%), Gaps = 41/432 (9%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             +  +W ++ G+ DWEGLLDP+   LRREI++YGEFAQA YD+FDFDP S++CG+C+Y+  
Sbjct  128   ISAVWRDLHGASDWEGLLDPLHPFLRREIVKYGEFAQATYDAFDFDPLSEFCGSCRYNRQ  187

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             +   +LG+A  GY++++Y+YA S ++ P++F+ S +  +WS+ +NWMG+VAV++DE E  
Sbjct  188   KLLNELGLAQNGYKVTKYIYALSPVDGPDWFESSKIGEVWSRDSNWMGFVAVSSDE-ESD  246

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  835
             R+GRRDI+++WRGTVT  EW  DLK  L     R +  +K++ GF  +Y +  KD D  F
Sbjct  247   RIGRRDILVSWRGTVTPTEWYIDLKTKLKKID-RSNKKVKVQRGFLTIYKS--KDEDSKF  303

Query  836   CSYSAREQLLAEVNRLIERYKGEN---LSITVTGHslgaalallsaYDI-----AEMKVN  991
                SA EQ++ E++RLI+ +K +    +S+T+TGHSLG AL+LL+AY+      A++ V+
Sbjct  304   NKTSASEQVMEELHRLIDFFKQKGDREISLTITGHSLGGALSLLTAYEAGVTFPADVHVS  363

Query  992   VVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKV  1171
             VV                         SF  PRVGNL F+E+ +E+G+K+LR+V  +D V
Sbjct  364   VV-------------------------SFGAPRVGNLAFREKLNEMGVKILRVVIGQDIV  398

Query  1172  PTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1351
             P +PG+  N       +L  +     W Y HVG EL ++   SP+LK  +D+  +HNLE 
Sbjct  399   PKLPGLFVN---SIVNKLSAVTGKLNWVYRHVGKELRMNMFMSPYLKKDSDMSGSHNLEI  455

Query  1352  HLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
             +LHLVDG+     +FR  + RD+ALVNK S+ L  E  +P  W Q  +KG+++   GRWV
Sbjct  456   YLHLVDGFVTKKGKFRWNSRRDVALVNKGSDMLVEELRIPEFWYQLPHKGLIKNRFGRWV  515

Query  1532  VPERSRIEAHPS  1567
              P R+ +E  PS
Sbjct  516   KPGRN-VEDIPS  526



>ref|XP_006304825.1| hypothetical protein CARUB_v10012471mg [Capsella rubella]
 gb|EOA37723.1| hypothetical protein CARUB_v10012471mg [Capsella rubella]
Length=529

 Score =   342 bits (876),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 186/428 (43%), Positives = 268/428 (63%), Gaps = 39/428 (9%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             N+ ++W E+ GS +W  LLDP+   LRRE+ +YGEF ++ YDS DFDP S++CG+ +Y+ 
Sbjct  113   NISKMWRELHGSNNWVNLLDPLHPWLRREVTKYGEFVESVYDSLDFDPLSEFCGSSRYNR  172

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + FE+LG+   GY++++++YA S++++P +F  SSV   WS+ +NWMG+VAV+ D   +
Sbjct  173   NKLFEELGLTKHGYKVTKFIYAMSHVDVPQWFLSSSVGETWSKDSNWMGFVAVSGDRESL  232

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  823
              R+GRRDIV+AWRGTVT  EW+ DL+    P   ++      +K++SGFF +YT+  + T
Sbjct  233   -RIGRRDIVVAWRGTVTPTEWVMDLRTSKEPFDCKEQHGKNVVKVQSGFFSIYTSKSELT  291

Query  824   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaY----DIAEMK  985
               N    SA EQ + EV RL++ +K  GE +S+TVTGHSLG ALAL++AY    D+ E+ 
Sbjct  292   RYN--KESASEQTMEEVKRLVKFFKGRGEEVSLTVTGHSLGGALALMNAYEAARDVPELS  349

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
              NV                       SVFSF  PRVGNL FKER + LG+KVLR+VN +D
Sbjct  350   GNV-----------------------SVFSFGAPRVGNLAFKERLNSLGVKVLRVVNKQD  386

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              VP +PGI+ N+      +L  +   F W Y HVG +L LD   SP++K  +DLG +HNL
Sbjct  387   IVPKLPGIVFNKVLN---KLNPITSRFNWVYRHVGTQLKLDVFSSPYVKQDSDLGRSHNL  443

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDG  1522
             E +LH++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     G
Sbjct  444   EVYLHVLDGFHSKKSGFRVNARRDVASVNKSTDMLLEHLRIPECWYQVAHKGLILNKQTG  503

Query  1523  RWVVPERS  1546
             RWV P R+
Sbjct  504   RWVKPVRA  511



>ref|XP_010540608.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Tarenaya 
hassleriana]
Length=535

 Score =   342 bits (876),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 188/429 (44%), Positives = 268/429 (62%), Gaps = 31/429 (7%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             N+ ++W EI GS +WE LLDP+   LRREII+YGEF +A YDS DFDP S++CG+C+Y+ 
Sbjct  123   NISKMWREIHGSNNWENLLDPLHPWLRREIIKYGEFVEAVYDSLDFDPLSEFCGSCRYNR  182

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + FE+LG+A  GY++++Y+YA S++++P +F  S++   WS+ +NWMG V V+ D  E 
Sbjct  183   NKLFEELGLARHGYKVTKYIYAMSHVDVPQWFLRSALGETWSKDSNWMGLVGVSCDR-ES  241

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDD-PDIKIESGFFDLYTNSKKDTDC  829
             RR+GRRDIV+AWRGTVT  EW  DLK    P        ++K++SGF  +Y +  ++T  
Sbjct  242   RRIGRRDIVVAWRGTVTPTEWFLDLKTKKEPLERNGTHENVKVQSGFLSIYQSKGENTRY  301

Query  830   NFCSYSAREQLLAEVNRLIE--RYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
             N    SA EQ++ E+  +++  R +GE +S+T+TGHSLG ALALL+AY++A         
Sbjct  302   N--KQSASEQVMEEIKHMVKFFRDRGEEVSVTITGHSLGGALALLNAYEVAR--------  351

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1183
                                ISV SF  PRVGNL FKER + LG+KVLR+VN +D VP +P
Sbjct  352   ------------DIPALSNISVISFGAPRVGNLAFKERLNHLGVKVLRVVNKQDIVPKLP  399

Query  1184  GIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1363
             GI+ N+      ++  +     W Y HVG++L L+   SP+LK  +DL   HNLE +LH+
Sbjct  400   GIVFNKILN---KINPITSRLNWVYRHVGIQLKLNVFKSPYLKQDSDLAGCHNLEVYLHV  456

Query  1364  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDGRWVVPE  1540
             +DG+H    +FR    RD+A VNK ++ L  E  +P  W Q  +KG++     GRWV P 
Sbjct  457   LDGFHSKKSKFRVNARRDVASVNKSTDMLMDELRIPEFWYQVAHKGLILNKQTGRWVKPC  516

Query  1541  RSRIEAHPS  1567
             R R E  PS
Sbjct  517   R-RPEDIPS  524



>ref|XP_002531054.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF31315.1| triacylglycerol lipase, putative [Ricinus communis]
Length=521

 Score =   341 bits (874),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 187/424 (44%), Positives = 265/424 (63%), Gaps = 38/424 (9%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             N+   W EI GS++WE LLDP+   LRRE+++YGEF +A YD+FDFDP S+YCG+C Y+ 
Sbjct  109   NISSRWQEIHGSRNWENLLDPLHPWLRREVVKYGEFVEATYDAFDFDPLSEYCGSCLYNR  168

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + FE+LG+   GYR ++Y+YA S++++P +F  +     WS+ +NWMG+VAV+ D+ E 
Sbjct  169   HKIFEELGLTKHGYRATKYIYAMSHVDVPEWFARTHTT--WSKDSNWMGFVAVSNDQ-ES  225

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD-----IKIESGFFDLYTNSKK  817
             +R+GRRDI++AWRGTV   EW +DL+  L   +F +D D     +K++ GF  +Y +  +
Sbjct  226   QRIGRRDIMVAWRGTVAPTEWYNDLRTDLE--YFEEDQDHKKNHVKVQEGFLSIYKSKSE  283

Query  818   DTDCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVN  991
             +T  N    SA EQ++ E+ +L+  Y+  GE +S+T+TGHSLG ALALL+AY+ A    N
Sbjct  284   ETRYN--KLSASEQVMKELKKLVNLYRENGEEVSLTLTGHSLGGALALLNAYEAATSIPN  341

Query  992   VVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKV  1171
             V                      ISV SF  PRVGNL FKE+ +ELG+K LR+V  +D V
Sbjct  342   VF---------------------ISVISFGAPRVGNLAFKEKLNELGVKTLRVVIKQDIV  380

Query  1172  PTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1351
             P +PGII N+      +L  +     W Y HVG +L LD   SP+LK  +D+  +HNLE 
Sbjct  381   PKLPGIIVNKILN---KLSKITHKLNWVYRHVGTQLKLDMFISPYLKQESDMSGSHNLEV  437

Query  1352  HLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
             +LHL+DG+ G    +R    RD+ALVNK +N L  E  +P  W Q  +KG+V    GRWV
Sbjct  438   YLHLLDGFLGKKLNYRWNARRDLALVNKSTNMLIEELKIPEFWYQLPHKGLVLNKYGRWV  497

Query  1532  VPER  1543
              P R
Sbjct  498   KPSR  501



>ref|XP_010655698.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Vitis 
vinifera]
Length=510

 Score =   340 bits (871),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 186/410 (45%), Positives = 258/410 (63%), Gaps = 32/410 (8%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W+EI GS DW+ LLDP+   LRREI++YGEFAQA YD+FDFD  S+YCG+C+Y+  + F+
Sbjct  94    WSEIHGSCDWDNLLDPLQPWLRREIVKYGEFAQATYDAFDFDSFSEYCGSCRYNQHKLFK  153

Query  488   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  667
             +LG+   GY +S+Y+YA S+I++P + + S +   WS+ +NWMGYVAV +D+ E  R+GR
Sbjct  154   ELGLEKNGYMVSKYIYAMSHIDVPQWLERSHLLDTWSKDSNWMGYVAV-SDDQESSRIGR  212

Query  668   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYS  847
             RDIV+AWRGTV   EW  D +  L P       + K+E GF  +YT+ ++ +  N    S
Sbjct  213   RDIVVAWRGTVAPSEWYEDFQRKLEPV---GSGEAKVEHGFLSIYTSKRESSRYN--KSS  267

Query  848   AREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegd  1021
             A +Q++ EV RL++ YK  GE +S+T+TGHSLG ALALL+AY+ A     +         
Sbjct  268   ASDQVMKEVTRLVQLYKQRGEQVSLTITGHSLGGALALLNAYEAATSLPGL---------  318

Query  1022  gesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1201
                         PISV SF  PRVGN+ F++   +LG+K LR+V  +D VP +PG++ NE
Sbjct  319   ------------PISVISFGSPRVGNIAFRDELHQLGVKTLRVVVKQDIVPRMPGLVFNE  366

Query  1202  KFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1381
               Q   + + +  +  W Y HVG EL LD   SP+LK G +L   H+LE +LHL+DG+H 
Sbjct  367   SLQ---KFDDITGTLKWVYTHVGAELKLDVQSSPYLKRGFNLPGFHSLETYLHLIDGFHS  423

Query  1382  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1531
                 FR    RDIALVNK  + L  E  +P  W Q  NKG+VR + GRWV
Sbjct  424   KTSTFREDARRDIALVNKACDMLVDELRIPRAWYQFANKGLVRNAHGRWV  473



>ref|XP_007024951.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY27573.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=511

 Score =   340 bits (871),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 195/434 (45%), Positives = 262/434 (60%), Gaps = 33/434 (8%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W +I GS DW  LLDP+   LRREI++YGEFAQA YD+FDFD  S++CG+C+Y+  + FE
Sbjct  97    WRDIHGSMDWVNLLDPLHPWLRREIVKYGEFAQATYDAFDFDSFSEFCGSCRYNRNKLFE  156

Query  488   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  667
             KLG    GY++++Y+YA S+I +P + + S +   WS+ +NWMGYVAV+ DE E RR+GR
Sbjct  157   KLGHGKNGYKVTKYIYAMSHIEMPQWLERSHLMDTWSKDSNWMGYVAVSDDE-ETRRIGR  215

Query  668   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYS  847
             RDIV+AWRGTV   EW  D +  L P       D K+E GF  +YT+  + T  N    S
Sbjct  216   RDIVVAWRGTVAPAEWYEDFQRNLEPIGI---GDAKVEHGFLSIYTSKNESTRYN--KSS  270

Query  848   AREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegd  1021
             A EQ++ EV +L++ Y+  GE +S+T+TGHSLG ALALL+AY+ A     +         
Sbjct  271   ASEQVMEEVTKLVQFYQGNGEEVSLTITGHSLGGALALLNAYEAAASLPGL---------  321

Query  1022  gesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1201
                         P+SV SF  PRVGN  F++  D LG+K LR+V  +D VP +PGI+ NE
Sbjct  322   ------------PVSVISFGAPRVGNSAFRDELDGLGVKTLRVVVKQDLVPRMPGIVFNE  369

Query  1202  KFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1381
               Q   + + +  +  W Y HVG EL LD S SP+LK G      H+LE +LHLVDG+H 
Sbjct  370   SLQ---RFDDITGTLEWVYTHVGAELRLDVSSSPYLKRGFSPLGFHSLETYLHLVDGFHS  426

Query  1382  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAH  1561
                 FRS   RD++LVNK  + L  +  +P  W Q  NKG+VR   GRWV P R   E  
Sbjct  427   ADSAFRSDARRDVSLVNKACDMLVDKLRIPHCWYQLSNKGLVRNEHGRWVKPRRDP-EDI  485

Query  1562  PSDTGHHFRKVLRL  1603
             PS  G      L++
Sbjct  486   PSPIGEACDYALKI  499



>ref|XP_009399030.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=498

 Score =   338 bits (868),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 195/439 (44%), Positives = 265/439 (60%), Gaps = 35/439 (8%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             ++  ++ EI G  DW  LL+P+   LRREII+YGEFAQA YD+FDF+P S++CG+C Y  
Sbjct  93    DISSLFPEIHGYADWSPLLNPLHPWLRREIIKYGEFAQATYDAFDFNPLSEFCGSCLYGR  152

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              +  +KLG+A  GYR+S+ +YA S++ LP + + S     W   +NWMGYVAV +D+AE 
Sbjct  153   HRLLDKLGLARNGYRVSKNVYAMSHVELPRWLERSLHADAWCTESNWMGYVAV-SDDAES  211

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
             RR+G RDIV+AWRGT+   EW  D++  L P       D+K+E GF  +YT+    T  N
Sbjct  212   RRIGCRDIVVAWRGTIAPTEWFEDVQGKLEP-FGEAHADVKVEHGFLGVYTSKSDRTRYN  270

Query  833   FCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
                 SA EQ++ E+ RL+  Y  +GE +S+T+TGHSLG ALALL+AY+ A    ++    
Sbjct  271   --KTSASEQVMEEIKRLVSHYRQRGEEVSLTITGHSLGGALALLNAYESASTIPDL----  324

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                              PISV SF GPRVGN+ F E+  E+ +KVLR+V  +D VP +PG
Sbjct  325   -----------------PISVISFGGPRVGNVAFGEKLKEMNVKVLRVVVKQDMVPKMPG  367

Query  1187  IIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1366
             I+ NE     K+ E +  +  W Y HVG+EL LD   SP+LK G D+   HNLE +LHLV
Sbjct  368   ILFNEGL---KRFEHVTGTLEWVYTHVGLELGLDVRSSPYLKHGLDVAGFHNLETYLHLV  424

Query  1367  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1546
             DG+    + FR    RD+ALVNK S  L+ E  +PP W Q  NKGM   + GRWV P R 
Sbjct  425   DGFLSSDKEFRGNARRDVALVNKASGMLRDELHIPPCWVQMANKGMECNAYGRWVKPAR-  483

Query  1547  RIEAHPSDTGHHFRKVLRL  1603
                  P D    +R+  +L
Sbjct  484   ----EPEDIPSPYREEAQL  498



>ref|XP_009115161.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Brassica 
rapa]
Length=528

 Score =   339 bits (870),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 187/428 (44%), Positives = 265/428 (62%), Gaps = 39/428 (9%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             N+ + W E+ GSK+WE LLDP+   LRREI +YGEF ++ YDS DFDP S++CG+C+Y+ 
Sbjct  112   NISKAWRELHGSKNWENLLDPLHPWLRREITKYGEFVESVYDSLDFDPLSEFCGSCRYNR  171

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + FE+LG+   GY++++Y+YA S++++P +F  SS+   WS+ +NWMG+VAV+ D   +
Sbjct  172   NKLFEELGLTRHGYKVTKYIYAMSHVDVPQWFLSSSLGETWSKDSNWMGFVAVSGDRESL  231

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  823
              R+GRRDIV+AWRGTVT  EW  DL+    P   + +     +K++SGFF +Y NSK + 
Sbjct  232   -RIGRRDIVVAWRGTVTPTEWFMDLRTSKEPFDCKSEHGKNVVKVQSGFFSIY-NSKSEL  289

Query  824   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaY----DIAEMK  985
                +   SA EQ + EV RL++ +K  GE +S+TVTGHSLG ALAL++AY    D+ E+ 
Sbjct  290   -TRYNKESASEQTMEEVKRLVKFFKDRGEEVSLTVTGHSLGGALALMNAYEAARDVPELS  348

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
              NV                       SV SF  PRVGNL FKER + LG+KVLR+VN +D
Sbjct  349   GNV-----------------------SVISFGAPRVGNLAFKERMNSLGVKVLRVVNKQD  385

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              VP +PGI+ N+      +L  +     W Y HVG +L LD   SP++K  +DL   HNL
Sbjct  386   IVPKLPGIVFNKVLN---KLNPITSRLSWVYRHVGTQLKLDVFTSPYIKQDSDLAGCHNL  442

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDG  1522
             E +LH++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     G
Sbjct  443   EVYLHVLDGFHRKKSGFRVNARRDVASVNKSTDMLLDHLRIPECWYQVAHKGLILNKQTG  502

Query  1523  RWVVPERS  1546
             RWV P R+
Sbjct  503   RWVKPVRA  510



>ref|XP_007212825.1| hypothetical protein PRUPE_ppa020655mg, partial [Prunus persica]
 gb|EMJ14024.1| hypothetical protein PRUPE_ppa020655mg, partial [Prunus persica]
Length=502

 Score =   338 bits (868),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 190/420 (45%), Positives = 265/420 (63%), Gaps = 33/420 (8%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             ++ E W EI GS DWEGLLDP+   LRREI++YGEFAQA YD+FDFD  S+YCG+C+Y+ 
Sbjct  93    SISEKWREIHGSNDWEGLLDPLHPWLRREIVKYGEFAQATYDAFDFDSFSEYCGSCRYNH  152

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + F+ LG++  GY +S+Y+YA S+I++P++ + S +   WS+H+NWMG+VAV +D+ E 
Sbjct  153   NKLFDVLGLSKNGYTVSKYIYAMSHIDMPSWLERSHLADTWSKHSNWMGFVAV-SDDLET  211

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
             RR+GRRDIV+AWRGTV   EW  D +  L P       + K+E GF  +YT   + T  N
Sbjct  212   RRIGRRDIVVAWRGTVAPSEWYEDFQRKLEPI---GHGEAKVEHGFHGIYTAKCETTRYN  268

Query  833   FCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
                 SA EQ++ EV RL+E Y+  GE +S+T+TGHSLG ALALL+AY+ AE    +    
Sbjct  269   --KSSASEQVMKEVTRLMEFYRAQGEEVSLTITGHSLGGALALLNAYEAAETIPGL----  322

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                              PISV SF  PRVGN+ FK+  +++G+K LR+V  +D VP +PG
Sbjct  323   -----------------PISVVSFGAPRVGNIAFKDELNQMGVKTLRVVVKQDMVPKMPG  365

Query  1187  IIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGT-DLGCAHNLEGHLHL  1363
             ++ NE  Q   + + +  +  W Y HVG E+ L+   SP+LK G  +L   H+LE +LHL
Sbjct  366   LVLNEGLQ---KFDDITGTLDWVYTHVGAEMKLEVGSSPYLKHGGFNLPGFHSLETYLHL  422

Query  1364  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             VDG+      FRS   RD ALVNK  + L  +  +P  W Q  +KG+V  + GRWV P+R
Sbjct  423   VDGFLSTETTFRSNARRDFALVNKGCDMLVDDLRIPQCWYQLPHKGLVCNAHGRWVKPKR  482



>gb|ABR17156.1| unknown [Picea sitchensis]
Length=489

 Score =   337 bits (865),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 192/434 (44%), Positives = 270/434 (62%), Gaps = 44/434 (10%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
              +  +W +IQG   W+G LDP++  L+ EI+RYGEFAQ CYD+FD   +SKY GTCK+  
Sbjct  43    QVANLWPDIQGINSWKGFLDPINPILKAEILRYGEFAQLCYDAFDDRHYSKYYGTCKHSK  102

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
                F K G  + GY I++Y+YA +++ L +FF   S +        W+G++AV TD  EI
Sbjct  103   RSLFGKTGFGNSGYEITKYIYANTHV-LGSFFGERSRD-----EGVWIGFIAVCTDPKEI  156

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHP---THFRD-------------DPDIKIES  784
             +RLGRRDIVIAWRGT T  EWI DLK+IL     +H +              DP+++IE 
Sbjct  157   KRLGRRDIVIAWRGTSTPQEWIEDLKDILVTATLSHAKSPGRPSSTTVPSSPDPNVRIEK  216

Query  785   GFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsa  964
             GF D YT+  ++++   CS SAR+ ++ E++RL+++Y+GE+LSIT+TGHSLGAALA LSA
Sbjct  217   GFMDCYTSMNEESEK--CSRSARDIVVGEISRLLKQYEGESLSITLTGHSLGAALATLSA  274

Query  965   YDIAEMKVNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVL  1144
             YDI E     +Q                  IP++VF+FA PRVGN  F  R +E+G+KVL
Sbjct  275   YDIKETVNTSMQ----------------SAIPVTVFAFASPRVGNPTFARRMEEIGVKVL  318

Query  1145  RIVNVRDKVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTD  1324
             R+VN  D VP  PG   NE   +   L  +L   PW+Y+HVG++++LD   S FLK    
Sbjct  319   RLVNKDDVVPKFPGFFMNENMGW---LSRLLDWLPWTYSHVGIKVSLDIESSSFLKQTHS  375

Query  1325  LGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGM  1504
             L   H+LE +LHL+DG+  + + F+  +GRD +LVNK  + L     +PP W Q+ NKG+
Sbjct  376   LSDFHSLEVYLHLLDGFVAEKKPFK-PSGRDPSLVNKSCDLLVETLHIPPYWWQERNKGL  434

Query  1505  VRTSDGRWVVPERS  1546
             V+ +DG+W  P RS
Sbjct  435   VKGADGKWTCPARS  448



>ref|XP_008225538.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Prunus mume]
Length=514

 Score =   338 bits (867),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 190/420 (45%), Positives = 265/420 (63%), Gaps = 33/420 (8%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             ++ E W EI GS DW+GLLDP+   LRREI++YGEFAQA YD+FDFD  S+YCG+C+Y+ 
Sbjct  93    SISEKWREIHGSNDWDGLLDPLHPWLRREIVKYGEFAQATYDAFDFDSFSEYCGSCRYNH  152

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + F+ LG++  GY +S+Y+YA S+I++P++ + S +   WS+H+NWMG+VAV +D+ E 
Sbjct  153   NKLFDVLGLSKNGYTVSKYIYAMSHIDMPSWLERSHLADTWSKHSNWMGFVAV-SDDLET  211

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
             RR+GRRDIV+AWRGTV   EW  D +  L P       + K+E GF  +YT   + T  N
Sbjct  212   RRIGRRDIVVAWRGTVAPSEWYEDFQRKLEPI---GHGEAKVEHGFHGIYTAKCETTRYN  268

Query  833   FCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
                 SA EQ++ EV RL+E Y+  GE +S+T+TGHSLG ALALL+AY+ AE    +    
Sbjct  269   --KSSASEQVMKEVTRLLEFYRAQGEEVSLTITGHSLGGALALLNAYEAAETIPGL----  322

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                              PISV SF  PRVGN+ FK+  +++G+K LR+V  +D VP +PG
Sbjct  323   -----------------PISVVSFGAPRVGNIAFKDELNQMGVKTLRVVVKQDMVPKMPG  365

Query  1187  IIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLK-TGTDLGCAHNLEGHLHL  1363
             ++ NE  Q   + + +  +  W Y HVG EL L+   SP+LK  G +L   H+LE +LHL
Sbjct  366   LVLNEGLQ---KFDDITGTLDWVYTHVGAELKLEVGSSPYLKHGGFNLPGFHSLETYLHL  422

Query  1364  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             VDG+      FRS   RD ALVNK  + L  +  +P  W Q  +KG+V  + GRWV P+R
Sbjct  423   VDGFLSTETTFRSNARRDFALVNKGCDMLVDDLRIPQCWYQLPHKGLVCNAHGRWVKPKR  482



>ref|XP_009102705.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Brassica 
rapa]
Length=530

 Score =   338 bits (867),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 185/428 (43%), Positives = 266/428 (62%), Gaps = 39/428 (9%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             N+ ++W E+ GSK+WE +LDP+   LRREI +YGEF ++ YDS DFDP S++CG+C+Y+ 
Sbjct  114   NISKMWRELHGSKNWENILDPLHPWLRREITKYGEFVESVYDSLDFDPLSEFCGSCRYNR  173

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + FE+LG+   GY++++Y+YA S++++P +F  SS+   WS+ +NWMG+VAV+ D   +
Sbjct  174   NKLFEELGLTRHGYKVTKYIYAMSHVDVPQWFLSSSLGETWSKDSNWMGFVAVSGDRESL  233

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  823
              R+GRRDIV+AWRGTVT  EW  DL+    P     +     +K++SGFF +Y NSK + 
Sbjct  234   -RIGRRDIVVAWRGTVTPTEWFMDLRTSKEPFDCESEHGKRVVKVQSGFFSIY-NSKSEL  291

Query  824   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaY----DIAEMK  985
                +   SA EQ + EV RL++ +K  GE +S+T+TGHSLG ALAL++AY    D+ E+ 
Sbjct  292   -ARYNKESASEQTMEEVKRLVKFFKERGEEVSLTITGHSLGGALALMNAYEAARDVPELS  350

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
              NV                       SV SF  PRVGNL FKER + LG+KVLR+VN +D
Sbjct  351   GNV-----------------------SVISFGAPRVGNLAFKERLNSLGVKVLRVVNKQD  387

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              VP +PGI+ N+      +L  +     W Y HVG +L LD   SP++K  +DL  +HNL
Sbjct  388   IVPKLPGIVFNKVLN---KLNPITSKLNWVYRHVGTQLKLDVFSSPYVKRDSDLAGSHNL  444

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDG  1522
             E +LH++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     G
Sbjct  445   EVYLHVLDGFHRKKSGFRVNARRDVASVNKSTDMLLDHLRIPECWYQVAHKGLILNKQTG  504

Query  1523  RWVVPERS  1546
             RWV P R+
Sbjct  505   RWVKPVRA  512



>ref|XP_002272780.2| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Vitis 
vinifera]
Length=524

 Score =   337 bits (865),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 187/416 (45%), Positives = 262/416 (63%), Gaps = 31/416 (7%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI G  +WE LLDP+   LRREI++YGEF+QA YD+FD+D  S +CG+C+Y+  + F+
Sbjct  121   WREIHGQFNWESLLDPLHPWLRREIVKYGEFSQATYDAFDYDSFSDFCGSCRYNRHKLFD  180

Query  488   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  667
             +L +   GY++++Y+YA +NI++P++F+  +    WS+ +NWMGYVAV++D  E +R+GR
Sbjct  181   ELHLTKHGYKVTKYIYAMTNIDVPSWFERPNTGETWSKDSNWMGYVAVSSDN-ESQRIGR  239

Query  668   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYS  847
             RDIV+AWRGTV   EW  D+K  L       +  +K+ESGF  +Y +  + T  N    S
Sbjct  240   RDIVVAWRGTVAPSEWFLDMKASLEQI---GEGGVKVESGFHSIYASKSESTRYN--KLS  294

Query  848   AREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegd  1021
             A EQ++  V RL+E +K  GE +S+TVTGHSLG ALALL+AY+ A    ++         
Sbjct  295   ASEQVMEAVKRLLEFFKGRGEEVSLTVTGHSLGGALALLNAYEAASSLPDL---------  345

Query  1022  gesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1201
                          ISV SF  PRVGN+ F+++ +E+G+K+LR+V  +D VP +PGII N+
Sbjct  346   -----------DHISVISFGAPRVGNIAFRDKMNEMGVKILRVVVKQDIVPKLPGIICNK  394

Query  1202  KFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1381
                  +Q+  + +   W Y HVG EL LD S SP+LK   DL   HNLE +LHL DGY G
Sbjct  395   IL---RQIHALTRRLKWVYRHVGSELKLDMSLSPYLKREFDLLGFHNLEIYLHLTDGYVG  451

Query  1382  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1549
                +FR    RD+ALVNK S+ L  E  +P  W Q  NKG+V  S GRWV P R +
Sbjct  452   KRLKFRWNARRDLALVNKSSDMLIEELRIPECWYQVPNKGLVFNSHGRWVKPCRDQ  507



>ref|XP_001781080.1| predicted protein [Physcomitrella patens]
 gb|EDQ54106.1| predicted protein [Physcomitrella patens]
Length=401

 Score =   332 bits (851),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 192/428 (45%), Positives = 261/428 (61%), Gaps = 43/428 (10%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EIQG  +W+GLLDP+D  LRRE++RYG+FAQ CYD+F+    SKY G+ KY     FE
Sbjct  1     WREIQGLNNWDGLLDPLDEDLRRELLRYGDFAQMCYDNFEDKQWSKYAGSAKYSKQNVFE  60

Query  488   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  667
             KL   D GY+++RYLY T    LP   Q S  +  W   +NWMG+VAVA D  EI+RLGR
Sbjct  61    KLQKPDTGYQVTRYLYVTCENPLPGVIQSSLSSTRWDVQSNWMGFVAVAVDPKEIQRLGR  120

Query  668   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDI-------------KIESGFFDLYTN  808
             RDIV++WRGT+  +EW+ D +  L P     DP               K+E GF+ LYT 
Sbjct  121   RDIVVSWRGTMETIEWLVDAQIQLAPMTLAPDPQAGCEGNSKPAILKPKVEKGFWSLYTC  180

Query  809   SKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKV  988
               K +   F   SA EQ++ E++RL+  YKGE LSIT+TGHSLG ALA+L+AY++AE  +
Sbjct  181   --KRSSSQFNQKSASEQVIRELSRLVTLYKGETLSITITGHSLGGALAILTAYEVAEKGL  238

Query  989   NVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDK  1168
             N +          S + + +  IP++VFSF  PR+G+  FK+R +EL +K LR+VNV D 
Sbjct  239   NKL---------PSQNGNDSEIIPVTVFSFGSPRIGDAIFKKRFEELDLKALRVVNVHDV  289

Query  1169  VPTVPGIIANEKFQYQKQLETMLKSFPWS--YAHVGVELALDHSYSPFLKTGTDLGCAHN  1342
             VP   G I                  PWS  Y HVGVEL ++H  S ++K   D    H+
Sbjct  290   VPKAIGGIHP----------------PWSDAYRHVGVELQVNHKLSTYMKRTRDPVDWHS  333

Query  1343  LEGHLHLVDGYHGD-GRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSD  1519
             LEG+LH +DG+ G   + F+  TGRD AL+NK S+ LK+E+ +P  W Q EN G+V +S+
Sbjct  334   LEGYLHHIDGHQGSKSKEFKLMTGRDYALLNKYSDILKKEYCIPGHWWQSENMGLVLSSE  393

Query  1520  GRWVVPER  1543
             G+W+ P+R
Sbjct  394   GKWIEPDR  401



>ref|XP_006415481.1| hypothetical protein EUTSA_v10007346mg [Eutrema salsugineum]
 gb|ESQ33834.1| hypothetical protein EUTSA_v10007346mg [Eutrema salsugineum]
Length=529

 Score =   336 bits (862),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 189/430 (44%), Positives = 267/430 (62%), Gaps = 43/430 (10%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             N+ ++W E+ GSK+WE LLDP+   LRREI +YGEF ++ YDS DFDP S++CG+C+Y+ 
Sbjct  113   NISKMWRELHGSKNWENLLDPLHPWLRREITKYGEFVESVYDSLDFDPLSEFCGSCRYNR  172

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + FE+LG+   GY++++Y+YA S++++P +F  SS+   WS+ +NWMG+VAV+ D  E 
Sbjct  173   NKLFEELGLTRHGYKVTKYIYAMSHVDVPQWFLSSSLGETWSKDSNWMGFVAVSGDR-ES  231

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHP-----THFRDDPDIKIESGFFDLYTNSKK  817
              R+GRRDIV+AWRGTVT  EW  DL+    P      H ++   +K++SGFF +Y NSK 
Sbjct  232   MRIGRRDIVVAWRGTVTPTEWFMDLRTSKEPFDCEGQHGKN--VVKVQSGFFSIY-NSKS  288

Query  818   DTDCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaY----DIAE  979
             +    +   SA EQ + EV RL + +K  GE +S+TVTGHSLG ALAL++AY    D+ E
Sbjct  289   EL-TRYNKESASEQTMEEVKRLAKFFKDRGEEVSLTVTGHSLGGALALMNAYEAAKDVPE  347

Query  980   MKVNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNV  1159
             +  NV                       SV SF  PRVGNL FKER + LG+KVLR+VN 
Sbjct  348   LSGNV-----------------------SVISFGAPRVGNLAFKERLNTLGVKVLRVVNK  384

Query  1160  RDKVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAH  1339
             +D VP +PGI+ N+      +L  +     W Y HVG +L L+   SP++K  +DL  +H
Sbjct  385   QDIVPKLPGIVFNKVLN---KLNPITSRLNWVYRHVGTQLKLNVFSSPYVKRDSDLAGSH  441

Query  1340  NLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTS  1516
             NLE +LH++DG+H     FR    RD+A VNK +N L     +P  W Q  +KG++    
Sbjct  442   NLEVYLHVLDGFHRKKSGFRVNARRDVASVNKSTNMLLDHLRIPECWYQVAHKGLILNKQ  501

Query  1517  DGRWVVPERS  1546
              GRWV P R+
Sbjct  502   TGRWVKPVRA  511



>ref|XP_009792730.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Nicotiana 
sylvestris]
Length=505

 Score =   335 bits (858),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 185/419 (44%), Positives = 261/419 (62%), Gaps = 32/419 (8%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             ++ + W +I G ++WEGLLDP+   LRREI++YGEFAQA YD+ DFD  S+YCG+C Y+ 
Sbjct  93    DISDRWRDIHGVQEWEGLLDPLHPLLRREIVKYGEFAQATYDALDFDAFSEYCGSCMYNS  152

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + F+KLG++  GY++++Y+YA S+I++P + + S +   WS+ +NW+G+VAV+ DE E 
Sbjct  153   QKLFDKLGLSKSGYKVTKYIYAMSHIDMPQWLERSRLTYTWSKDSNWIGFVAVSDDE-ES  211

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
             RR+GRRDIV+AWRGTVT  EW  +++  L P    D    K+E GF  +YT+    T  N
Sbjct  212   RRIGRRDIVVAWRGTVTPSEWYENMQRKLEPIGHMDS---KVEHGFLSIYTSKSDSTRYN  268

Query  833   FCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
                 SA EQ++ E+  L++ Y  KGE +S+T+TGHSLG ALALL+AY+ A     +    
Sbjct  269   --KSSASEQVMKELKILVDFYKSKGEEVSLTITGHSLGGALALLNAYESAAKFPRI----  322

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                              PISV SFA PRVGN+ F++   ++G+K+LR+   +D VP +PG
Sbjct  323   -----------------PISVISFAAPRVGNIAFRDEIYQMGVKILRVTVKQDLVPRMPG  365

Query  1187  IIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1366
             I+ NE  Q   + +    +  W Y HVG EL LD   SP+LK G +    H LE +LHLV
Sbjct  366   IVFNESLQ---KFDDFTGTLEWIYTHVGAELKLDVRSSPYLKRGFNFIGFHMLETYLHLV  422

Query  1367  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             DG+      FRS   RD+ALVNK+ + L  E  +P  W Q  NKG+   S GRWV P+R
Sbjct  423   DGFVSTSSTFRSNAKRDVALVNKECDMLVDELRIPSCWYQLANKGLECNSYGRWVRPKR  481



>ref|XP_006448978.1| hypothetical protein CICLE_v10014927mg [Citrus clementina]
 gb|ESR62218.1| hypothetical protein CICLE_v10014927mg [Citrus clementina]
Length=520

 Score =   335 bits (858),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 188/416 (45%), Positives = 261/416 (63%), Gaps = 33/416 (8%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI G  DW+ LLDP+   LRREI++YGEFAQA YD+FDFDP S+YCG+C+++  + FE
Sbjct  102   WREIHGCTDWDSLLDPLHPCLRREILKYGEFAQATYDAFDFDPFSEYCGSCRFNSNKIFE  161

Query  488   KLGMADR-GYRISRYLYATSNINLPNFFQHS-SVNRIWSQHANWMGYVAVATDEAEIRRL  661
             KLG+  + GY++ +Y+YA S+I++P +   +  +   WS+ +NWMG+VA+ +DE E RR+
Sbjct  162   KLGLDGKHGYKVCKYIYAMSHIDMPQWLNRTVHLGDTWSRDSNWMGFVAI-SDEEETRRI  220

Query  662   GRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCS  841
             GRRDIV+AWRGTV   EW  D +  L P    DD   K+E GF  +YT+  + T   +  
Sbjct  221   GRRDIVVAWRGTVAPSEWYEDFQRKLEPIGPGDDA--KVEHGFHSIYTSKSEHT--RYSK  276

Query  842   YSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQegege  1015
              SA EQ++ EV RL++ Y  KGE +S+T+TGHSLG ALALL+AY+ A     +       
Sbjct  277   SSASEQVMKEVTRLVKLYKEKGEEVSLTITGHSLGGALALLNAYEAATTIPGL-------  329

Query  1016  gdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1195
                           PISV SF  PRVGN+ F+++  ++G+K LR+V  +D VP +PG++ 
Sbjct  330   --------------PISVISFGAPRVGNIAFRDQLHQMGVKTLRVVVKQDLVPKMPGVVF  375

Query  1196  NEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1375
             NE  Q   + + +  +  W Y HVG EL LD   SP+LK G +L   H+ E +LHLVDG+
Sbjct  376   NEGLQ---KFDEITGTLDWVYTHVGAELRLDVRSSPYLKHGFNLLGFHSQETYLHLVDGF  432

Query  1376  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
                   FR    RD+ALVNK  + L  E  +P  W Q ENKG+VR + GRWV P+R
Sbjct  433   VCQSSSFREDARRDVALVNKACDMLVDELRIPHCWYQMENKGLVRNAHGRWVKPKR  488



>ref|XP_009605461.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Nicotiana 
tomentosiformis]
Length=505

 Score =   333 bits (855),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 187/419 (45%), Positives = 264/419 (63%), Gaps = 32/419 (8%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             ++ + W +I G ++WEGLLDP+   LRREI++YGEFAQA YD+ DFD  S+YCG+C Y+ 
Sbjct  93    DISDRWRDIHGVQEWEGLLDPLHPLLRREIVKYGEFAQATYDALDFDAFSEYCGSCMYNS  152

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + F+KLG++  GY++++Y+YA S+I++P + + S +   WS+ +NW+G+VAV+ DE E 
Sbjct  153   HKLFDKLGLSKSGYKVTKYIYAMSHIDMPQWLEKSRLTYTWSKDSNWIGFVAVSDDE-ES  211

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
             RR+GRRDIV+AWRGTVT  EW  +++  L P    D    K+E GF  +YT SK D    
Sbjct  212   RRIGRRDIVVAWRGTVTPSEWYENMQRKLEPIGHVDS---KVEHGFLSIYT-SKSDL-TR  266

Query  833   FCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
             +   SA EQ++ E+  L++ Y  KGE +S+T+TGHSLG ALALL+AY+ A          
Sbjct  267   YNKSSASEQVMKELKILVDYYKSKGEEVSLTITGHSLGGALALLNAYESA----------  316

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                        +   ++PISV SFA PRVGN+ F++   ++GIK+LR+   +D VP +PG
Sbjct  317   -----------AKFPRLPISVISFAAPRVGNIAFRDEIYQMGIKILRVTVKQDLVPRMPG  365

Query  1187  IIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1366
             I+ NE  Q   + +    +  W Y HVG EL LD   SP+LK G +    H LE +LHLV
Sbjct  366   IVFNESLQ---KFDDFTGTLEWIYTHVGAELKLDVRSSPYLKRGFNFIGFHMLETYLHLV  422

Query  1367  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             DG+      FRS   RD+ALVNK+ + L  E  +P  W Q  NKG+   S GRWV P+R
Sbjct  423   DGFVSTSSTFRSNAKRDVALVNKECDMLVDELRIPTCWYQLANKGLECNSYGRWVRPKR  481



>emb|CDX77597.1| BnaA07g07350D [Brassica napus]
Length=429

 Score =   331 bits (848),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 185/431 (43%), Positives = 266/431 (62%), Gaps = 42/431 (10%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             N+ ++W E+ GSK+WE +LDP+   LRREI +YGEF ++ YDS DFDP S++CG+C+Y+ 
Sbjct  10    NISKMWRELHGSKNWENILDPLHPWLRREITKYGEFVESVYDSLDFDPLSEFCGSCRYNR  69

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + FE+LG+   GY++++Y+YA S++++P +F  SS+   WS+ +NWMG+VAV+ D   +
Sbjct  70    NKLFEELGLTRHGYKVTKYIYAMSHVDVPQWFLSSSLGETWSKDSNWMGFVAVSGDRESL  129

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  823
              R+GRRDIV+AWRGTVT  EW  DL+    P     +     +K++SGFF +Y NSK + 
Sbjct  130   -RIGRRDIVVAWRGTVTPTEWFMDLRTSKEPFDCESEHGKRVVKVQSGFFSIY-NSKSEL  187

Query  824   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaY----DIAEMK  985
                +   SA EQ + EV RL++ +K  GE +S+T+TGHSLG ALAL++AY    D+ E+ 
Sbjct  188   -ARYNKESASEQTMEEVKRLVKFFKERGEEVSLTITGHSLGGALALMNAYEAARDVPELS  246

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
              NV                       SV SF  PRVGNL FKER + LG+KVLR+VN +D
Sbjct  247   GNV-----------------------SVISFGAPRVGNLAFKERLNSLGVKVLRVVNKQD  283

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              VP +PGI+ N+      +L  +     W Y HVG +L LD   SP++K  +DL  +HNL
Sbjct  284   IVPKLPGIVFNKVLN---KLNPITSKLNWVYRHVGTQLKLDVFSSPYVKRDSDLAGSHNL  340

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKD---SNFLKREHGVPPRWRQDENKGMV-RT  1513
             E +LH++DG+H     FR    RD+A VNK    ++ L     +P  W Q  +KG++   
Sbjct  341   EVYLHVLDGFHRKKSGFRVNARRDVASVNKSTDITDMLLDHLRIPECWYQVAHKGLILNK  400

Query  1514  SDGRWVVPERS  1546
               GRWV P R+
Sbjct  401   QTGRWVKPVRA  411



>gb|KHN12425.1| Phospholipase A1-Igamma1, chloroplastic [Glycine soja]
Length=820

 Score =   342 bits (876),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 191/432 (44%), Positives = 268/432 (62%), Gaps = 36/432 (8%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             N+ + W EIQG  +WE +LDP+   LRREI++YGEFAQA YD+FD+D  S+YCG+C+Y+ 
Sbjct  6     NISQKWREIQGYHNWEDILDPLQPWLRREIVKYGEFAQATYDAFDYDSFSEYCGSCRYNQ  65

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + FEKLG+    Y ++RY+YA S+I LP + + S V   WS+ +NW+G+VAV+ D+ E 
Sbjct  66    NKLFEKLGLTRNSYTVTRYIYAMSHIELPRWLERSHVADTWSKDSNWIGFVAVSDDD-ET  124

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
             RR+GRRDIV+AWRGTV   EW  D +  L P       D K+E GF  +Y +  + T  N
Sbjct  125   RRIGRRDIVVAWRGTVAPCEWYEDFQRKLDPI---GHGDAKVEHGFLSIYKSKSETTRYN  181

Query  833   FCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
                 SA +Q++ EV +L+  Y   KGE +S+T+TGHSLG ALAL++AY++A   +++   
Sbjct  182   --KSSASDQVMKEVTKLVNFYKGKKGEEVSLTITGHSLGGALALINAYEVATTFLDL---  236

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1183
                               P+SV SF  PRVGN+ FK+   ++G+K+LR+V  +D VP +P
Sbjct  237   ------------------PVSVISFGAPRVGNIAFKDELHQMGVKLLRVVVKQDWVPKMP  278

Query  1184  GIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1363
             G++ NEK +   ++  +     W Y HVG ELALD   SP+LK G +L   H+LE +LHL
Sbjct  279   GLLFNEKLKMFDEITGL----EWVYTHVGAELALDVHSSPYLKGGMNLSGFHSLETYLHL  334

Query  1364  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             +DGY      FRS   RDIALVNK  + L  E  +P  W Q  NKG+V  + GRWV P+R
Sbjct  335   IDGYLSHETPFRSEARRDIALVNKSCDMLVDELRIPHCWYQLANKGLVCNAHGRWVKPKR  394

Query  1544  SR--IEAHPSDT  1573
                 I +H S+ 
Sbjct  395   DNDDIPSHASEV  406



>gb|KFK44851.1| hypothetical protein AALP_AA1G310600 [Arabis alpina]
Length=532

 Score =   333 bits (855),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 184/428 (43%), Positives = 263/428 (61%), Gaps = 39/428 (9%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             N+ + W E+ GSK+WE LLDP+   LRRE+ +YGEF ++ YDS DFDP S++CG+C+Y+ 
Sbjct  116   NISKTWRELHGSKNWENLLDPLHPWLRREVTKYGEFVESVYDSLDFDPLSEFCGSCRYNR  175

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + FE+LG+   GY++++Y+YA S +++P +F  S++   WS+ +NWMG+VAV+ D   +
Sbjct  176   NKLFEELGLTRHGYKVTKYIYAMSRVDVPQWFLSSALGETWSKDSNWMGFVAVSGDRESL  235

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  823
              R+GRRDIV+AWRGTVT  EW  DL+          +     +K++SGFF +Y +  + T
Sbjct  236   -RIGRRDIVVAWRGTVTPTEWFMDLRTSKETFDCEGEHGKNVVKVQSGFFSIYNSKCEQT  294

Query  824   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaY----DIAEMK  985
               N    SA EQ + EV RL + +K  GE++S+TVTGHSLG ALAL++AY    D+ E+ 
Sbjct  295   RYN--KQSASEQTMEEVKRLAKFFKDRGEDVSLTVTGHSLGGALALMNAYEAARDVPELS  352

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
              NV                       SV SF  PRVGNL FKER + LG+KVLR+VN +D
Sbjct  353   GNV-----------------------SVISFGAPRVGNLAFKERLNHLGVKVLRVVNKQD  389

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              VP +PGI+ N+      +L  +     W Y HVG +L LD   SP++K  +DLG +HNL
Sbjct  390   IVPKLPGIVFNKVLN---KLNPITSRLNWVYRHVGTQLKLDVFSSPYVKRDSDLGRSHNL  446

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDG  1522
             E +LH++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     G
Sbjct  447   EVYLHVLDGFHSKKSGFRVNARRDVASVNKSTDMLLDHLRIPEFWYQVAHKGLILNKQTG  506

Query  1523  RWVVPERS  1546
             RWV P R+
Sbjct  507   RWVKPVRA  514



>ref|XP_002893614.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69873.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=525

 Score =   333 bits (853),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 183/428 (43%), Positives = 263/428 (61%), Gaps = 39/428 (9%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             N+ ++W E+ GS +WE LLDP+   LRRE+ +YGEF ++ YDS DFDP S++CG+ +Y+ 
Sbjct  109   NISKMWRELHGSNNWENLLDPLHPWLRREVTKYGEFVESVYDSLDFDPLSEFCGSSRYNR  168

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + FE+LG+   GY++++Y+YA S++++P +F  S++   WS+ +NWMG+VAV+ D   +
Sbjct  169   NKLFEELGLTKHGYKVTKYIYAMSHVDVPQWFLSSAMGETWSKDSNWMGFVAVSGDRESL  228

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  823
             R +GRRDIV+AWRGTVT  EW  DL+    P   + +     +K++SGFF +Y +  K T
Sbjct  229   R-IGRRDIVVAWRGTVTPTEWFMDLRTSKEPFDCKGEHGKNVVKVQSGFFSIYKSKSKLT  287

Query  824   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaY----DIAEMK  985
               N    SA EQ + EV RL+  +K  GE +S+T+TGHSLG ALAL++AY    D+  + 
Sbjct  288   RYN--KESASEQTMEEVKRLVNFFKDRGEEVSLTITGHSLGGALALMNAYEAARDVPALS  345

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
              NV                       SV SF  PRVGNL FKER + LG+KVLR+VN +D
Sbjct  346   GNV-----------------------SVISFGAPRVGNLAFKERLNSLGVKVLRVVNKQD  382

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              VP +PGI+ N+      +L  +     W Y HVG +L LD   SP++K  +DLG AHNL
Sbjct  383   IVPKLPGIVFNKVLN---KLNPITSRLNWVYRHVGTQLKLDVFSSPYVKRDSDLGRAHNL  439

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDG  1522
             E +LH++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     G
Sbjct  440   EVYLHVLDGFHCKKSGFRVNARRDVASVNKSTDMLLDHLRIPEFWYQVAHKGLILNKQTG  499

Query  1523  RWVVPERS  1546
             RWV P R+
Sbjct  500   RWVKPVRA  507



>ref|XP_002314049.2| hypothetical protein POPTR_0009s06300g [Populus trichocarpa]
 gb|EEE88004.2| hypothetical protein POPTR_0009s06300g [Populus trichocarpa]
Length=526

 Score =   333 bits (853),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 199/507 (39%), Positives = 283/507 (56%), Gaps = 55/507 (11%)
 Frame = +2

Query  29    LQCTMAMGSLQPISLNHNYHTIFAEPPLMNITKPTTAKPSNSFFPLTLSSPQKPYSSLKC  208
             L C  +M  L   S N  +  +  +P   +  K     PS +   L       PY++L  
Sbjct  52    LSCARSMRRL---STNQTHQELAVKPHQASKPKQKARNPSKTLASLL----HVPYTALDF  104

Query  209   RDSLPAAIPESSNKHdeeeedgddeegRNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIR  388
              D      P  S K             +++  +W EI GS +WE LLDP    LRREI++
Sbjct  105   VDRGDHMTPTLSPK-------------QSISAVWKEIHGSSNWETLLDPFHPSLRREILK  151

Query  389   YGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYLYATSNINLPNFF  568
             YGEFAQ  YD+FDFDP S +CG+C+Y+  +FFE LG+   GY++ +Y+YA S++++P + 
Sbjct  152   YGEFAQGTYDAFDFDPLSDFCGSCRYNRRKFFETLGLTKHGYKVKKYIYALSHVDVPEWL  211

Query  569   QHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPT  748
             + S     WS+ +NWMGYVAV+  E E +R+GRRDI++AWRGTV+  EW  DL   L   
Sbjct  212   KRSYAT--WSKDSNWMGYVAVSRRE-ESQRIGRRDIMVAWRGTVSPSEWFKDLTTSLEHI  268

Query  749   HFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERY--KGENLSITV  922
                D+ ++K++ GF  +Y +  KD    +   SA EQ++ EV RL+  Y  KGE +S+TV
Sbjct  269   ---DNTNVKVQEGFLSVYKS--KDELTRYNKLSASEQVMQEVMRLVNFYRGKGEEVSLTV  323

Query  923   TGHslgaalallsaYDIAEMKVNVVQegegegdgesssasaaikipisVFSFAGPRVGNL  1102
             TGHSLG ALALL+AY+ A    ++                      +SV SF  PRVGN+
Sbjct  324   TGHSLGGALALLNAYEAATAIPDLF---------------------VSVISFGAPRVGNI  362

Query  1103  RFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELA  1282
              FKE+ +ELG+K LR+V  +D VP +PG++     +   +   +     W Y HVG +L 
Sbjct  363   AFKEKLNELGVKTLRVVVKQDIVPKLPGLLN----KMLNKFHGLTGKLNWVYRHVGTQLK  418

Query  1283  LDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREH  1462
             LD   SP+LK  +DL  +HNLE +LHL+DG+     ++R    RD+ALVNK S+ L  + 
Sbjct  419   LDAFMSPYLKPESDLSGSHNLELYLHLIDGFFSKKSKYRWNARRDLALVNKGSDMLIEDL  478

Query  1463  GVPPRWRQDENKGMVRTSDGRWVVPER  1543
              +P  W Q   KG+V    GRWV P R
Sbjct  479   KIPEFWYQFPYKGLVLNQYGRWVKPGR  505



>ref|XP_009408789.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=488

 Score =   331 bits (848),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 185/421 (44%), Positives = 258/421 (61%), Gaps = 30/421 (7%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             ++  ++ +I G  DW  LL+P+   LRREII+YGE AQA YD FDF+P S++CG+C Y  
Sbjct  80    DISSLFPDIHGRADWCRLLNPLHPWLRREIIKYGELAQATYDGFDFNPFSEFCGSCLYGR  139

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              +  EKLG++  GY +S Y+YA S+++LP + + S     WS  +NWMG+VAV+ DE E 
Sbjct  140   HRLLEKLGLSRSGYEVSTYVYAMSHVDLPAWLERSIHADAWSTESNWMGFVAVSDDE-ES  198

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
              R+G RD+V+AWRGT+   EW  +++  L P        +K+E GF  +YT+  + T  N
Sbjct  199   HRIGCRDVVVAWRGTIAPTEWFENVQGKLEPLG-DGHSAVKVEHGFLGVYTSKSERTRYN  257

Query  833   FCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
                 SA EQ++AE+ RL+  Y+  GE +S+T+TGHSLG ALALL+AY+ A    ++    
Sbjct  258   --KTSASEQVMAEIKRLVNHYRRQGEEVSLTITGHSLGGALALLNAYEAASAMPDL----  311

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                              P+SV SF  PRVGN  F +R  E+ +KVLR+V  +D VP +PG
Sbjct  312   -----------------PVSVISFGAPRVGNAAFGDRLKEMNVKVLRVVVKQDVVPKMPG  354

Query  1187  IIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1366
             I+ NE     K+LE++     W Y+HVG+EL +D   SPFLK G D+   HNLE +LHLV
Sbjct  355   ILFNEGL---KRLESVTGKLGWVYSHVGLELGIDVRSSPFLKRGIDVAGFHNLEAYLHLV  411

Query  1367  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1546
             DG+      FRS+  RD+ALVNK S  L+ E  +PP W Q  NKGM+    GRW+ P R 
Sbjct  412   DGFRSSDNGFRSSFKRDVALVNKASGMLRDELKIPPCWYQVANKGMMCNVHGRWMKPARE  471

Query  1547  R  1549
             +
Sbjct  472   Q  472



>ref|XP_007024952.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY27574.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=522

 Score =   332 bits (851),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 191/456 (42%), Positives = 269/456 (59%), Gaps = 47/456 (10%)
 Frame = +2

Query  182   QKPYSSLKCRDSLPAAIPESSNKHdeeeedgddeegRNLHEIWAEIQGSKDWEGLLDPMD  361
             Q PY++    D   A  P  S K              N+   W E+ G + W+GL++P+ 
Sbjct  93    QLPYTAADFIDRGDAMTPTKSPKE-------------NISTQWRELHGLQHWDGLVEPLH  139

Query  362   SHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYLYAT  541
               LRREI++YGEF +A YD+FDFDP S++CG+C+Y+  +FFE+LG+   GY++++Y+YA 
Sbjct  140   PWLRREIVKYGEFVEATYDAFDFDPLSEFCGSCRYNRRKFFEELGLTQHGYKVTKYIYAM  199

Query  542   SNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIH  721
             S++++P +F+ S  +  WS+ +NWMGYVAV+ D AE  R+GRRDI++AWRGTV   EW  
Sbjct  200   SHVDVPEWFERSYYS--WSKDSNWMGYVAVSGD-AESARIGRRDILVAWRGTVAPSEWYT  256

Query  722   DLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIE--RY  895
             DLK  L P       +IK++ GF  +Y++  + T  N    SA EQ++ E+ RL+   R 
Sbjct  257   DLKTSLQPL---GKTNIKVQLGFLSIYSSKGEFTRYN--KLSASEQVMEEIKRLVSFFRD  311

Query  896   KGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegdgesssasaaikipisVFS  1075
             +GE +S+T+ GHSLG ALALL+AYD A    ++                      ISV S
Sbjct  312   RGEEVSLTICGHSLGGALALLNAYDAATYFPDLF---------------------ISVIS  350

Query  1076  FAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETMLKSFPWS  1255
             F  PRVGN+ FKE+  ELG+K LR+V  +D VP +PG I N       +L T+ +   W 
Sbjct  351   FGAPRVGNVHFKEKLRELGVKTLRVVVKQDIVPKLPGFILNTILN---KLTTVTRRLKWI  407

Query  1256  YAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNK  1435
             Y HVG +L LD   SP+L+   D    HNLE +LHLVDG+     +FR    RD+ALVNK
Sbjct  408   YRHVGTQLKLDALTSPYLRRDADYTGCHNLETYLHLVDGFISKTSKFRWNARRDVALVNK  467

Query  1436  DSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
              ++ L +E  +P  W Q   KG+V    GRWV P R
Sbjct  468   TTDMLIKELKIPDSWYQKPFKGLVLNKYGRWVKPGR  503



>emb|CDY02287.1| BnaA09g26150D [Brassica napus]
Length=513

 Score =   331 bits (848),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 185/428 (43%), Positives = 260/428 (61%), Gaps = 55/428 (13%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             N+ + W E+ GSK+WE LLDP+   LRREI +YGEF ++ YDS DFDP S++CG+C+Y+ 
Sbjct  113   NISKAWRELHGSKNWENLLDPLHPWLRREITKYGEFVESVYDSLDFDPLSEFCGSCRYNR  172

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + FE+LG+   GY++++Y+YA S++++P +F  SS+   WS+ +NWMG+VAV+ D   +
Sbjct  173   NKLFEELGLTRHGYKVTKYIYAMSHVDVPQWFLSSSLGETWSKDSNWMGFVAVSGDRESL  232

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  823
              R+GRRDIV+AWRGTVT  EW  DL+    P   + +     +K++SGFF +Y NSK + 
Sbjct  233   -RIGRRDIVVAWRGTVTPTEWFMDLRTSKEPFDCKSEHGKNVVKVQSGFFSIY-NSKSEL  290

Query  824   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaY----DIAEMK  985
                +   SA EQ + EV RL++ +K  GE +S+TVTGHSLG ALAL++AY    D+ E+ 
Sbjct  291   -TRYNKESASEQTMEEVKRLVKFFKDRGEEVSLTVTGHSLGGALALMNAYEAARDVPELS  349

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
              NV                       SV SF  PRVGNL FKER + LG+KVLR+VN +D
Sbjct  350   GNV-----------------------SVISFGAPRVGNLAFKERMNSLGVKVLRVVNKQD  386

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              VP +PGI+                   W Y HVG +L LD   SP++K  +DL   HNL
Sbjct  387   IVPKLPGIV-------------------WVYRHVGTQLKLDVFTSPYIKQDSDLAGCHNL  427

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDG  1522
             E +LH++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     G
Sbjct  428   EVYLHVLDGFHRKKSGFRVNARRDVASVNKSTDMLLDHLRIPECWYQVAHKGLILNKQTG  487

Query  1523  RWVVPERS  1546
             RWV P R+
Sbjct  488   RWVKPVRA  495



>ref|XP_011025479.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Populus 
euphratica]
Length=526

 Score =   331 bits (848),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 196/514 (38%), Positives = 287/514 (56%), Gaps = 55/514 (11%)
 Frame = +2

Query  17    IGRRLQCTMAMG---SLQPISLNHNYHTIFAEPPLMNITKPTTAKPSNSFFPLTLSSPQK  187
             + +RL   + +    S++ +S N  +  +  +P   +  K     PS +   L       
Sbjct  42    VKKRLHLHLQLSCARSMRRLSTNQTHQELAVKPHQASKPKQKARNPSKTLASLL----HV  97

Query  188   PYSSLKCRDSLPAAIPESSNKHdeeeedgddeegRNLHEIWAEIQGSKDWEGLLDPMDSH  367
             PY++L   D      P  S K             +++  +W EI GS +WE LLDP+   
Sbjct  98    PYTALDFVDRGDHMTPTLSPK-------------QSISAVWKEIHGSSNWETLLDPLHPS  144

Query  368   LRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYLYATSN  547
             LRREI++YGEF Q  YD+FDFDP S +CG+C+Y+  +FFE LG+   GY++ RY+YA S+
Sbjct  145   LRREILKYGEFVQGTYDAFDFDPLSDFCGSCRYNRRKFFETLGLTKHGYKVKRYIYALSH  204

Query  548   INLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDL  727
             +++P + + S     WS+ +NWMGYVAV+  E E +R+GRRDI++AWRGTV+  EW  DL
Sbjct  205   VDVPEWLKRSYTT--WSKDSNWMGYVAVSRKE-ESQRIGRRDIMVAWRGTVSPSEWFKDL  261

Query  728   KNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERY--KG  901
                L      D+ ++K++ GF  +Y +  KD    +    + EQ++ EV RL+  Y  KG
Sbjct  262   TTSLEHI---DNTNVKVQEGFLSVYKS--KDELTRYNKLRSSEQVMQEVMRLVNFYRGKG  316

Query  902   ENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegdgesssasaaikipisVFSFA  1081
             E +S+TVTGHSLG ALALL+AY+ A    ++                      +SV SF 
Sbjct  317   EEVSLTVTGHSLGGALALLNAYEAATAIPDLF---------------------VSVISFG  355

Query  1082  GPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETMLKSFPWSYA  1261
              PRVGN+ FKE+ +ELG+K LR+V  +D VP +PG++     +   +   +     W Y 
Sbjct  356   APRVGNIAFKEKLNELGVKTLRVVVKQDIVPKLPGLLN----KMLNKFHGLTGKLNWVYR  411

Query  1262  HVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDS  1441
             HVG +L LD   SP+LK  +DL  +HNLE +LHL+DG+     ++R    RD+ALVNK S
Sbjct  412   HVGTQLKLDAFMSPYLKHESDLSGSHNLELYLHLIDGFFSKKSKYRWNARRDLALVNKGS  471

Query  1442  NFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             + L  +  +P  W Q   KG+V    GRWV P R
Sbjct  472   DMLIEDLKIPEFWYQFPYKGLVLNQHGRWVKPGR  505



>emb|CDY09593.1| BnaC05g23260D [Brassica napus]
Length=513

 Score =   329 bits (844),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 184/428 (43%), Positives = 260/428 (61%), Gaps = 55/428 (13%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             N+ + W E+ GSK+WE LLDP+   LRREI +YGEF ++ YDS DFDP S++CG+C+Y+ 
Sbjct  113   NISKAWRELHGSKNWENLLDPLHPWLRREITKYGEFVESVYDSLDFDPLSEFCGSCRYNR  172

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + FE+LG+   GY++++Y+YA S++++P +F  SS+   WS+ +NWMG+VAV+ D   +
Sbjct  173   NKLFEELGLTRHGYKVTKYIYAMSHVDVPQWFLRSSLGETWSKDSNWMGFVAVSGDRESL  232

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  823
              R+GRRDIV+AWRGTVT  EW  DL+    P   + +     +K++SGFF +Y NSK + 
Sbjct  233   -RIGRRDIVVAWRGTVTPTEWFMDLRTSKEPFDCKSEHGKNVVKVQSGFFSIY-NSKSEL  290

Query  824   DCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaY----DIAEMK  985
                +   SA EQ + EV RL++ +  +GE +S+TVTGHSLG ALAL++AY    D+ E+ 
Sbjct  291   -TRYNKESASEQTMEEVKRLVKFFTDRGEEVSLTVTGHSLGGALALMNAYEAARDVPELS  349

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
              NV                       SV SF  PRVGNL FKER + LG+KVLR+VN +D
Sbjct  350   GNV-----------------------SVISFGAPRVGNLAFKERMNSLGVKVLRVVNKQD  386

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              VP +PGI+                   W Y HVG +L LD   SP++K  +DL   HNL
Sbjct  387   IVPKLPGIV-------------------WVYRHVGTQLKLDVFSSPYIKQDSDLAGCHNL  427

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDG  1522
             E +LH++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     G
Sbjct  428   EVYLHVLDGFHRKKSGFRVNARRDVASVNKSTDMLLDHLRIPECWYQVAHKGLILNKQTG  487

Query  1523  RWVVPERS  1546
             RWV P R+
Sbjct  488   RWVKPVRA  495



>gb|KDO75376.1| hypothetical protein CISIN_1g037474mg, partial [Citrus sinensis]
Length=517

 Score =   329 bits (844),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 190/429 (44%), Positives = 263/429 (61%), Gaps = 34/429 (8%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI G  DW+ LLDP+   LRREI++YGEFAQA YD+FDFD  S+YCG+C+++  + FE
Sbjct  102   WREIHGCTDWDSLLDPLHPCLRREILKYGEFAQATYDAFDFDRFSEYCGSCRFNSNKIFE  161

Query  488   KLGMADR-GYRISRYLYATSNINLPNFFQHS-SVNRIWSQHANWMGYVAVATDEAEIRRL  661
             KLG+  + GY++ +Y+YA S+I++P +   +  +   WS+ +NWMG+VA+ +DE E  R+
Sbjct  162   KLGLDGKHGYKVCKYIYAMSHIDMPQWLNRTVHLGDTWSRDSNWMGFVAI-SDEEETHRI  220

Query  662   GRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCS  841
             GRRDIV+AWRGTV   EW  D +  L P    DD   K+E GF  +YT+  + T   +  
Sbjct  221   GRRDIVVAWRGTVAPSEWYEDFQRKLEPIGPGDDA--KVEHGFHSIYTSKSEHT--RYSK  276

Query  842   YSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQegege  1015
              SA EQ++ EV RL++ Y  KGE +S+T+TGHSLG ALALL+AY+ A     +       
Sbjct  277   SSASEQVMKEVTRLVKLYKEKGEEVSLTITGHSLGGALALLNAYEAATTIPGL-------  329

Query  1016  gdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1195
                           PISV SF  PRVGN+ F+++  ++G+K LR+V  +D VP +PG++ 
Sbjct  330   --------------PISVISFGAPRVGNIAFRDQLHQMGVKTLRVVVKQDLVPKMPGVVF  375

Query  1196  NEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1375
             NE  Q   + + +  +  W Y HVG EL LD   SP+LK G +L   H+ E +LHLVDG+
Sbjct  376   NEGLQ---KFDEITGTLDWVYTHVGAELRLDVRSSPYLKHGFNLLGFHSQETYLHLVDGF  432

Query  1376  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIE  1555
                   FR    RD+ALVNK  + L  E  +P  W Q ENKG+VR + GRWV P+R   E
Sbjct  433   VCQSSSFREDARRDVALVNKACDMLVDELRIPHCWYQMENKGLVRNAHGRWVKPKR-EAE  491

Query  1556  AHPSDTGHH  1582
               P   G H
Sbjct  492   DVPVPVGSH  500



>ref|XP_004244860.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Solanum lycopersicum]
Length=482

 Score =   328 bits (840),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 188/437 (43%), Positives = 264/437 (60%), Gaps = 37/437 (8%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             ++ + W +I G ++WEGLLDP+   LRREI++YGEFAQA YD+ D D  S+YCG+C Y+ 
Sbjct  80    DISDRWCDIHGVQEWEGLLDPLHPFLRREIVKYGEFAQATYDALDIDSFSEYCGSCMYNS  139

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + F+KLG+   GYR+++Y+YA S I++P + + S +   WS+ +NW+G+VAV+ DE E 
Sbjct  140   HKLFDKLGLNKSGYRVTKYIYAMSQIDMPQWLERSKLTYTWSKDSNWIGFVAVSDDE-ES  198

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  832
             RR+GRRDIV+AWRGTVT  EW  +++  L      D    K+E GF  +YT+    T  N
Sbjct  199   RRIGRRDIVVAWRGTVTPSEWYENMQRKLESIGHMDS---KVEHGFLSIYTSKCDSTRYN  255

Query  833   FCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
                 SA +Q++ E+  L+E Y  KGE +S+T+TGHSLG ALALL+AY+ A          
Sbjct  256   --KSSASQQVMKELKTLVEFYKTKGEQVSLTITGHSLGGALALLNAYESA----------  303

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                        +   K+PISV SFA PRVGN+ F++   ++G+K+LR+   +D VP +PG
Sbjct  304   -----------ANFPKLPISVISFAAPRVGNIAFRDELYQMGVKILRVTVKQDLVPRMPG  352

Query  1187  IIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1366
             I+ NE  Q   + + +  +  W Y H G EL LD   SP+LK G +    H LE +LHLV
Sbjct  353   IVLNESLQ---KFDDLTGTLEWIYTHAGTELKLDVRSSPYLKRGFNFIGIHMLETYLHLV  409

Query  1367  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1546
             DG+      FRS   RD+ALVNK  + L  E  +P  W Q  +KG+   S GRWV P+R 
Sbjct  410   DGFVSSTSTFRSNAKRDVALVNKACDMLVDELRIPTCWYQLAHKGLECNSYGRWVRPKR-  468

Query  1547  RIEAHPSDTGHHFRKVL  1597
                 HP D     R+ L
Sbjct  469   ----HPEDIPSPTREQL  481



>ref|XP_006468077.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Citrus 
sinensis]
Length=520

 Score =   328 bits (841),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 186/416 (45%), Positives = 259/416 (62%), Gaps = 33/416 (8%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W EI G  DW+ LLDP+   LRREI++YGEFAQA YD+FDFD  S+YCG+C+++  + FE
Sbjct  102   WREIHGCTDWDSLLDPLHPCLRREILKYGEFAQATYDAFDFDRFSEYCGSCRFNSNKIFE  161

Query  488   KLGMADR-GYRISRYLYATSNINLPNFFQHS-SVNRIWSQHANWMGYVAVATDEAEIRRL  661
             KLG+  + GY++ +Y+YA S+I++P +   +  +   WS+ +NWMG+VA+ +DE E  R+
Sbjct  162   KLGLDGKHGYKVCKYIYAMSHIDMPQWLNRTVHLGDTWSRDSNWMGFVAI-SDEEETHRI  220

Query  662   GRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCS  841
             GRRDIV+AWRGTV   EW  D +  L P    DD   K+E GF  +YT+  + T   +  
Sbjct  221   GRRDIVVAWRGTVAPSEWYEDFQRKLEPIGPGDDA--KVEHGFHSIYTSKSEHT--RYSK  276

Query  842   YSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQegege  1015
              SA EQ++ EV RL++ Y  KGE +S+T+TGHSLG ALALL+AY+ A     +       
Sbjct  277   SSASEQVMKEVTRLVKLYKEKGEEVSLTITGHSLGGALALLNAYEAATTIPGL-------  329

Query  1016  gdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1195
                           PISV SF  PRVGN+ F+++  ++G+K LR+V  +D VP +PG++ 
Sbjct  330   --------------PISVISFGAPRVGNIAFRDQLHQMGVKTLRVVVKQDLVPKMPGVVF  375

Query  1196  NEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1375
             NE  Q   + + +  +  W Y HVG EL LD   SP+LK G +L   H+ E +LHLVDG+
Sbjct  376   NEGLQ---KFDEITGTLDWVYTHVGAELRLDVRSSPYLKHGFNLLGFHSQETYLHLVDGF  432

Query  1376  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
                   FR    RD+ALVNK  + L  E  +P  W Q ENKG+VR + GRWV P+R
Sbjct  433   VCQSSSFREDARRDVALVNKACDMLVDELRIPHCWYQMENKGLVRNAHGRWVKPKR  488



>ref|XP_010460828.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Camelina 
sativa]
Length=525

 Score =   328 bits (842),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 181/428 (42%), Positives = 266/428 (62%), Gaps = 39/428 (9%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             N+ ++W E+ GS +WE LL+P+   LRRE+ +YGEF ++ YDS DFDP S++CG+ +++ 
Sbjct  109   NISKMWRELHGSNNWENLLNPLHPWLRREVTKYGEFVESVYDSLDFDPLSEFCGSSRFNR  168

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + FE+LG+   GY++++++YA S++++P +F  SS+   WS+ +NWMG+VAV+ D   +
Sbjct  169   NKLFEELGLTKHGYKVTKFIYAMSHVDVPQWFLSSSMGETWSKDSNWMGFVAVSGDRESL  228

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  823
              R+GRRDIV+AWRGTVT  EW  DL+    P   +++     +K++SGFF +Y NSK + 
Sbjct  229   -RIGRRDIVVAWRGTVTPTEWFMDLRTSKEPFDCKEEHGKNVVKVQSGFFSIY-NSKSEL  286

Query  824   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaY----DIAEMK  985
                +   SA EQ + EV RL++ +K  GE +S+TVTGHSLG ALALL+AY    D+  + 
Sbjct  287   -TRYNKESASEQTMEEVKRLVKFFKDRGEEVSLTVTGHSLGGALALLNAYEAARDVPGLS  345

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
              NV                       SVFSF  PRVGNL FKER + LG+KVLR+VN +D
Sbjct  346   GNV-----------------------SVFSFGAPRVGNLAFKERLNSLGVKVLRVVNKQD  382

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              VP +PGI+ N+      ++  +     W Y HVG +L LD   SP++K  +DL  +HNL
Sbjct  383   IVPKLPGIVFNKVLN---KINPITSRLNWVYRHVGTQLKLDVFSSPYVKRDSDLARSHNL  439

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDG  1522
             E +LH++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     G
Sbjct  440   EVYLHVLDGFHSKKSGFRVNARRDVASVNKSTDMLLDHLRIPDCWYQVAHKGLILNKQTG  499

Query  1523  RWVVPERS  1546
             RWV P R+
Sbjct  500   RWVKPVRA  507



>ref|XP_010499568.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Camelina 
sativa]
Length=529

 Score =   328 bits (840),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 179/428 (42%), Positives = 266/428 (62%), Gaps = 39/428 (9%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             N+ ++W E+ GS +WE LL+P+   LRRE+ +YGEF ++ YDS DFDP S++CG+ +++ 
Sbjct  113   NISKMWRELHGSNNWENLLNPLHPWLRREVTKYGEFVESVYDSLDFDPLSEFCGSSRFNR  172

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + FE+LG+   GY++++++YA S++++P +F  SS+   WS+ +NWMG++AV+ D   +
Sbjct  173   NKLFEELGLTKHGYKVTKFIYAMSHVDVPQWFLSSSMGETWSKDSNWMGFLAVSGDRESL  232

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  823
              R+GRRDIV+AWRGTVT  EW  DL+    P   +++     +K++SGFF +Y NSK + 
Sbjct  233   -RIGRRDIVVAWRGTVTPTEWFMDLRTSKEPFDCKEEHGKNVVKVQSGFFSIY-NSKSEL  290

Query  824   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaY----DIAEMK  985
                +   SA EQ + EV RL++ +K  GE +S+TVTGHSLG ALAL++AY    D+  + 
Sbjct  291   -TRYNKESASEQTMEEVKRLVKFFKDRGEEVSLTVTGHSLGGALALMNAYEAARDVPGLS  349

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
              NV                       SVFSF  PRVGNL FKER + LG+KVLR+VN +D
Sbjct  350   GNV-----------------------SVFSFGAPRVGNLAFKERLNSLGVKVLRVVNKQD  386

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              VP +PGI+ N+      ++  +     W Y HVG +L LD   SP++K  +DL  +HNL
Sbjct  387   IVPKLPGIVFNKVLN---KINPITSRLNWVYRHVGTQLKLDVFSSPYVKRDSDLARSHNL  443

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDG  1522
             E +LH++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     G
Sbjct  444   EVYLHVLDGFHSKKSGFRVNARRDVASVNKSTDMLLDHLRIPECWYQVAHKGLILNKQTG  503

Query  1523  RWVVPERS  1546
             RWV P R+
Sbjct  504   RWVKPVRA  511



>ref|XP_010478423.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Camelina 
sativa]
Length=525

 Score =   328 bits (840),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 180/428 (42%), Positives = 265/428 (62%), Gaps = 39/428 (9%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             N+ ++W E+ GS +WE LL+P+   LRRE+ +YGEF ++ YDS DFDP S++CG+ +++ 
Sbjct  109   NISKMWRELHGSNNWENLLNPLHPWLRREVTKYGEFVESVYDSLDFDPLSEFCGSSRFNR  168

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
              + FE+LG+   GY++++++YA S++++P +F  SS+   WS+ +NWMG+VAV+ D   +
Sbjct  169   NKLFEELGLTKHGYKVTKFIYAMSHVDVPQWFLSSSMGETWSKDSNWMGFVAVSGDRESL  228

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  823
              R+GRRDIV+AWRGTVT  EW  DL+    P   +++     +K++SGFF +Y NSK + 
Sbjct  229   -RIGRRDIVVAWRGTVTPTEWFMDLRTSKEPFDCKEEHGKNVVKVQSGFFSIY-NSKSEL  286

Query  824   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaY----DIAEMK  985
                +   SA EQ + EV RL+  +K  GE +S+TVTGHSLG ALAL++AY    D+  + 
Sbjct  287   -TRYNKESASEQTMEEVKRLVNFFKDRGEVVSLTVTGHSLGGALALMNAYEAARDVPGLS  345

Query  986   VNVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRD  1165
              NV                       SVFSF  PRVGNL FKER + LG+KVLR+VN +D
Sbjct  346   GNV-----------------------SVFSFGAPRVGNLAFKERLNSLGVKVLRVVNKQD  382

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              VP +PGI+ N+      ++  +     W Y HVG +L LD   SP++K  +DL  +HNL
Sbjct  383   IVPKLPGIVFNKVLN---KINPITSRLNWVYRHVGTQLKLDVFSSPYVKRDSDLARSHNL  439

Query  1346  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDG  1522
             E +LH++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     G
Sbjct  440   EVYLHVLDGFHSKKSGFRVNARRDVASVNKSTDMLLDHLRIPECWYQVAHKGLILNKQTG  499

Query  1523  RWVVPERS  1546
             RWV P R+
Sbjct  500   RWVKPVRA  507



>ref|NP_174326.1| DAD1-like acylhydrolase [Arabidopsis thaliana]
 gb|AAG51101.1|AC025295_9 lipase, putative [Arabidopsis thaliana]
 gb|AEE31210.1| DAD1-like acylhydrolase [Arabidopsis thaliana]
Length=529

 Score =   325 bits (833),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 179/427 (42%), Positives = 260/427 (61%), Gaps = 39/427 (9%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             + ++W E+ GS +WE LLDP+   LRRE+ +YGEF ++ YDS DFDP S++CG+ +Y+  
Sbjct  114   ISKMWRELHGSNNWENLLDPLHPWLRREVTKYGEFVESVYDSLDFDPLSEFCGSSRYNRN  173

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
             + FE+LG+   GY++++Y+YA S +++P +F  S++   WS+ +NWMG+VAV+ D   + 
Sbjct  174   KLFEELGLTRHGYKVTKYIYAMSRVDVPQWFLSSALGETWSKDSNWMGFVAVSGDRESL-  232

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR---DDPDIKIESGFFDLYTNSKKDTD  826
             R+GRRDIV+AWRGTVT  EW  DL+  + P           +K++SGF  +Y NSK +  
Sbjct  233   RIGRRDIVVAWRGTVTPTEWFMDLRTSMEPFDCEGKHGKTVVKVQSGFLSIY-NSKSEL-  290

Query  827   CNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaY----DIAEMKV  988
               +   SA EQ + EV RL+  +K  GE +S+T+TGHSLG ALAL++AY    D+  +  
Sbjct  291   TRYNKESASEQTMDEVKRLVNFFKDRGEEVSLTITGHSLGGALALMNAYEAARDVPALSG  350

Query  989   NVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDK  1168
             N+                       SV SF  PRVGNL FKE+ + LG+KVLR+VN +D 
Sbjct  351   NI-----------------------SVISFGAPRVGNLAFKEKLNSLGVKVLRVVNKQDI  387

Query  1169  VPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLE  1348
             VP +PGI+ N+      +L  +     W Y HVG +L LD   SP++K  +DLG AHNLE
Sbjct  388   VPKLPGIVFNKVLN---KLNPITSRLNWVYRHVGTQLKLDVFSSPYVKRDSDLGRAHNLE  444

Query  1349  GHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDGR  1525
              +LH++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     GR
Sbjct  445   VYLHVLDGFHRKKSGFRVNARRDVASVNKSTDMLLDHLRIPEFWYQVAHKGLILNKQTGR  504

Query  1526  WVVPERS  1546
             WV P R+
Sbjct  505   WVKPVRA  511



>gb|KCW75867.1| hypothetical protein EUGRSUZ_D00253 [Eucalyptus grandis]
Length=433

 Score =   320 bits (821),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 177/414 (43%), Positives = 251/414 (61%), Gaps = 28/414 (7%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W E+ GS DW+ LLDP+   LRREII+YGE AQA YD+FDFD  S+YCG+C+Y+  + F+
Sbjct  11    WREMHGSSDWKDLLDPLHPWLRREIIKYGELAQATYDAFDFDSSSEYCGSCRYNKHKLFD  70

Query  488   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  667
             +LG+   GY+++ Y+YA S++ +P + + S +   WS+ +NW+GY+A + DE E RR+GR
Sbjct  71    ELGLKQNGYKVTEYIYAMSHMEIPRWLERSRLADTWSKDSNWIGYIACSDDE-ETRRIGR  129

Query  668   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYS  847
             RDI++AWRGTV   EW  D +  L P    DD   ++E GF  +YT+  K T  N    S
Sbjct  130   RDILVAWRGTVAPSEWYEDFQRKLEPIGHGDDHHARVEHGFLSIYTSKSKSTRYN--KSS  187

Query  848   AREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegd  1021
             A EQ+++E+ +L++ Y  +GE +S+T+TGHSLG ALALL+A++ +    N+         
Sbjct  188   ASEQVMSEIRKLVDLYRDRGEEVSLTITGHSLGGALALLNAHEASSTIPNL---------  238

Query  1022  gesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1201
                         P+SV SF  PRVGN  F++   + G+K LR+V  +D VP +PG++ NE
Sbjct  239   ------------PVSVISFGAPRVGNGAFRDELHQKGVKTLRVVVKQDMVPKMPGLVFNE  286

Query  1202  KFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1381
                 ++  E +  +  W Y HVG EL LD   SP+LK G +    H  E +LHLVDG+  
Sbjct  287   GL--ERFDEHITGALEWVYTHVGAELKLDVQSSPYLKHGLNFLGFHMTETYLHLVDGFLS  344

Query  1382  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
                 FR    RD+ALVNK  + L  E  VP  W Q  NKG+V    G+WV P R
Sbjct  345   TRSNFRVDAKRDVALVNKACDMLVDELRVPHSWYQLANKGLVCNEYGKWVKPRR  398



>ref|XP_010052014.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Eucalyptus 
grandis]
Length=520

 Score =   322 bits (826),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 177/414 (43%), Positives = 251/414 (61%), Gaps = 28/414 (7%)
 Frame = +2

Query  308   WAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  487
             W E+ GS DW+ LLDP+   LRREII+YGE AQA YD+FDFD  S+YCG+C+Y+  + F+
Sbjct  98    WREMHGSSDWKDLLDPLHPWLRREIIKYGELAQATYDAFDFDSSSEYCGSCRYNKHKLFD  157

Query  488   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  667
             +LG+   GY+++ Y+YA S++ +P + + S +   WS+ +NW+GY+A + DE E RR+GR
Sbjct  158   ELGLKQNGYKVTEYIYAMSHMEIPRWLERSRLADTWSKDSNWIGYIACSDDE-ETRRIGR  216

Query  668   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYS  847
             RDI++AWRGTV   EW  D +  L P    DD   ++E GF  +YT+  K T  N    S
Sbjct  217   RDILVAWRGTVAPSEWYEDFQRKLEPIGHGDDHHARVEHGFLSIYTSKSKSTRYN--KSS  274

Query  848   AREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegegd  1021
             A EQ+++E+ +L++ Y  +GE +S+T+TGHSLG ALALL+A++ +    N+         
Sbjct  275   ASEQVMSEIRKLVDLYRDRGEEVSLTITGHSLGGALALLNAHEASSTIPNL---------  325

Query  1022  gesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1201
                         P+SV SF  PRVGN  F++   + G+K LR+V  +D VP +PG++ NE
Sbjct  326   ------------PVSVISFGAPRVGNGAFRDELHQKGVKTLRVVVKQDMVPKMPGLVFNE  373

Query  1202  KFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1381
                 ++  E +  +  W Y HVG EL LD   SP+LK G +    H  E +LHLVDG+  
Sbjct  374   GL--ERFDEHITGALEWVYTHVGAELKLDVQSSPYLKHGLNFLGFHMTETYLHLVDGFLS  431

Query  1382  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
                 FR    RD+ALVNK  + L  E  VP  W Q  NKG+V    G+WV P R
Sbjct  432   TRSNFRVDAKRDVALVNKACDMLVDELRVPHSWYQLANKGLVCNEYGKWVKPRR  485



>ref|XP_006364888.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Solanum 
tuberosum]
Length=491

 Score =   322 bits (824),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 185/452 (41%), Positives = 268/452 (59%), Gaps = 33/452 (7%)
 Frame = +2

Query  197   SLKCRDSLPAAIPESSNKHdeeeedgddeegRNLHEIWAEIQGSKDWEGLLDPMDSHLRR  376
             +++  D  P+     +N H+++          ++ + W +I G  +WEGLLDP+   LRR
Sbjct  52    NIQKNDPPPSTHSTLNNIHEDKANTPTMSPKEDISDRWRDIHGVHEWEGLLDPLHPLLRR  111

Query  377   EIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYLYATSNINL  556
             EI++YGEFAQA YD+ D D  S+YCG+C Y+  + F+K G+   GY++++Y+YA S I++
Sbjct  112   EIVKYGEFAQATYDALDIDSFSEYCGSCMYNSHKLFDKSGLNKSGYKVTKYIYAMSQIDM  171

Query  557   PNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNI  736
             P + + S +   WS+ +NW+G+VAV+ DE E RR+GRRDIV+AWRGTVT  EW  +++  
Sbjct  172   PQWLERSKLTYTWSKDSNWIGFVAVSDDE-ESRRIGRRDIVVAWRGTVTPSEWYENMQRK  230

Query  737   LHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERYK---GEN  907
             L      D    K+E GF  +YT+    T  N    SA EQ++ E+  L++ YK    E 
Sbjct  231   LESIGHMDS---KVEHGFLSIYTSKCDSTRYNIS--SASEQVMKELKTLVDFYKTESAEQ  285

Query  908   LSITVTGHslgaalallsaYDIAEMKVNVVQegegegdgesssasaaikipisVFSFAGP  1087
             +S+T+TGHSLG ALALL+AY+ A                     +   K+PISV SFA P
Sbjct  286   VSLTITGHSLGGALALLNAYESA---------------------ANFPKLPISVISFAAP  324

Query  1088  RVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHV  1267
             RVGN+ F++   ++G+K+LR+   +D VP +PGI+ NE  Q   + + +  +  W Y HV
Sbjct  325   RVGNIAFRDELYQMGVKILRVTVKQDLVPRMPGIVLNESLQ---KFDDLTGTLEWIYTHV  381

Query  1268  GVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNF  1447
             G EL LD   SP+LK G +    H LE +LHLVDG+      FRS   RD+ALVNK  + 
Sbjct  382   GAELKLDVRSSPYLKRGFNFIGIHMLETYLHLVDGFVSSSSTFRSNAKRDVALVNKACDM  441

Query  1448  LKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             L  E  +P  W Q  +KG+   S GRWV P+R
Sbjct  442   LVDELRIPTCWYQLAHKGLECNSYGRWVRPKR  473



>ref|XP_002298419.2| hypothetical protein POPTR_0001s27040g, partial [Populus trichocarpa]
 gb|EEE83224.2| hypothetical protein POPTR_0001s27040g, partial [Populus trichocarpa]
Length=461

 Score =   320 bits (821),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 177/420 (42%), Positives = 257/420 (61%), Gaps = 35/420 (8%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             +N+  +W EI GS +W+ LLDP+  +LRREI++YGEF +A YD+FDFDP S+YCG+C+Y+
Sbjct  66    QNISAMWQEIHGSSNWDNLLDPLHPNLRREILKYGEFVEATYDAFDFDPLSEYCGSCRYN  125

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
               + FE LG+   GY++ RY+YA S++++P + + S  + +WS+ +NWMGYVAV+  E E
Sbjct  126   RHKIFETLGLTKHGYKVKRYIYALSHVDVPQWLKRS--HAMWSKDSNWMGYVAVSRKE-E  182

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  829
               R+GRRDI++AWRGT+   EW  DL+  L      D+ ++K++ GF  +Y +  KD   
Sbjct  183   SHRIGRRDIMVAWRGTIAPSEWFSDLRTGL---ELIDNTNVKVQEGFLGIYKS--KDEST  237

Query  830   NFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
              +   SA EQ++ EV RL+  Y  KGE +S+TVTGHSLG ALALL+AY+   +  ++   
Sbjct  238   RYNKLSASEQVMQEVVRLVNFYRGKGEEVSLTVTGHSLGGALALLNAYEAKTVIPDLF--  295

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1183
                                +SV SF  PRVGN+ FKE+ +ELG+K LR+V  +D VP +P
Sbjct  296   -------------------VSVISFGAPRVGNIAFKEKLNELGVKTLRVVVKQDIVPKLP  336

Query  1184  GIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1363
             G++     +   +   +     W Y HVG +L LD   SP+LK  +DL   HNLE +LHL
Sbjct  337   GLLN----RMLNKFHGLTGKLNWVYRHVGTQLKLDAFTSPYLKHESDLSGCHNLELYLHL  392

Query  1364  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             +DG+     + R    RD+ALVNK S+ L  +  +P  W     KG++    GRWV P R
Sbjct  393   IDGFLSSTSKHRWNARRDLALVNKGSDMLIEDLRIPEFWYDFPYKGLMLNKYGRWVKPGR  452



>ref|XP_001779106.1| predicted protein [Physcomitrella patens]
 gb|EDQ56052.1| predicted protein [Physcomitrella patens]
Length=469

 Score =   320 bits (821),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 193/433 (45%), Positives = 252/433 (58%), Gaps = 48/433 (11%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
              L E W E+QG+ DW+G+L+P++ HLR E+IRYGE AQ  YDSFD+D HSK+CG+C+Y  
Sbjct  40    QLAETWREVQGADDWKGMLEPLNDHLRAELIRYGELAQVSYDSFDYDKHSKFCGSCRYSP  99

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  652
                FE++ +   GY ++ Y+YAT+N+ + +F + S     WS+ +NW+GYVAV TDE EI
Sbjct  100   DSLFEEVDLHHTGYTVTWYIYATANVRVWSFLRRSEREDAWSKKSNWIGYVAVCTDEKEI  159

Query  653   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD-----DPDIKIESGFFDLYTNSKK  817
              RLGRRDI++ WRGTVT LEW  + +  L P  F D     +   K+E+GF  LYT++  
Sbjct  160   NRLGRRDILVVWRGTVTGLEWAANAQYFLVPCAFIDGGNDNESTPKVEAGFLSLYTSA--  217

Query  818   DTDCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVN  991
             D    F   SARE  + E+ RLIE YK  G  LSIT+ GHSLG+ L LL AYD+A  K+N
Sbjct  218   DDSSRFNKISAREYAVKEIVRLIEEYKDDGHELSITICGHSLGSGLGLLFAYDVANSKLN  277

Query  992   VVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKV  1171
              +                   IPI+VFSF GPRVG+  FK+R ++LGIKVLR+VN  D V
Sbjct  278   QIS--------------QERTIPITVFSFGGPRVGDGVFKQRVEDLGIKVLRVVNKGDIV  323

Query  1172  PTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTG-------TDLG  1330
             P VPG               +L+SF  +Y H+GVE  LD   S  L          +   
Sbjct  324   PHVPGT-------------HLLESFKSAYHHLGVEFLLDDQQSLHLNQSKGRHFSLSAFA  370

Query  1331  CAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVR  1510
               HNLE +LHL+DGY     R+     RD  LVNK   FLK    VP  W Q ENKG+  
Sbjct  371   VHHNLEVYLHLIDGYG----RYDKPPTRDPVLVNKGCGFLKENKYVPECWWQVENKGLRY  426

Query  1511  TS-DGRWVVPERS  1546
                  R+  PER+
Sbjct  427   CEYQNRYFQPERA  439



>gb|EMT07991.1| Lipase [Aegilops tauschii]
Length=474

 Score =   318 bits (816),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 219/532 (41%), Positives = 275/532 (52%), Gaps = 106/532 (20%)
 Frame = +2

Query  68    SLNHNYHTIFAEPPLMNITKPTTAK-------PSNSFFPLTLSSPQKPYSSLKCRDSLPA  226
             +L+ N H++   P     T P  A+       P       T S P++P S +    S   
Sbjct  6     NLSLNAHSLLGSP--AGRTVPPAARLLLLQKPPPRIHGAYTTSRPRRPSSHVTSAVSADE  63

Query  227   AIPESSNK--------HdeeeedgddeegRNLHEIWAEIQGSKDWEGLLDPMDSHLRREI  382
             A P    K              +        L   W E+ G  DW+GLLDP+D  LR E+
Sbjct  64    APPTKEKKADSFVGDMERGTLAEESGRSDGELTSRWREMHGCNDWDGLLDPIDRTLRGEL  123

Query  383   IRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYLYATSNINLPN  562
             IRYGEF+QACYDSFD+D                           R SRY   T      +
Sbjct  124   IRYGEFSQACYDSFDYD---------------------------RYSRYA-GTCKYAQDS  155

Query  563   FFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILH  742
             FF++                            +GRR        TVT LEWI D+   L 
Sbjct  156   FFKN----------------------------VGRR--------TVTKLEWIADITAFLK  179

Query  743   PT-HFR---DDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERY--KGE  904
             P   F     DP +K+E GF +LYT+  K+ DC +C YSAREQ+LAEV +L+ERY  +GE
Sbjct  180   PIGQFGLPCPDPSVKVEEGFAELYTS--KNPDCKYCKYSAREQVLAEVRKLVERYTGQGE  237

Query  905   NLSITVTGHslgaalallsaYDIAEMKVNVVQegegegdgesssasaaikipisVFSFAG  1084
              +S+TVTGHSLGAALA+L AYDIAE + NV              ++   K P+ VFS++G
Sbjct  238   EVSVTVTGHSLGAALAVLCAYDIAETRANV--------------STGGAKAPVCVFSYSG  283

Query  1085  PRVGNLRFKERCD-ELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETMLKSFPWSYA  1261
             PRVGN  F+ER + ELG+K LRI+NV D VP VPGI                   P  Y+
Sbjct  284   PRVGNPMFRERFEGELGVKALRILNVHDSVPKVPGIFTEAVLPMPLLRIAGALGLPSVYS  343

Query  1262  HVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDS  1441
             H+GVELALDH  SPFLK   DL C HNLE HLHL+DGY G G+ F+   GRD ALVNK +
Sbjct  344   HIGVELALDHKLSPFLKDVFDLACYHNLEAHLHLLDGYQGRGKEFKLG-GRDPALVNKAA  402

Query  1442  NFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR-IEAHPSDTGHHFRKV  1594
             +FL  EH VP  WRQ+ NKGMVRT DGRW++P R R +E HP DT  H  ++
Sbjct  403   DFLMDEHMVPDGWRQELNKGMVRTEDGRWMLPHRPRNVEEHPEDTDLHLAEL  454



>ref|XP_011047360.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Populus 
euphratica]
Length=523

 Score =   320 bits (819),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 181/431 (42%), Positives = 261/431 (61%), Gaps = 36/431 (8%)
 Frame = +2

Query  290   RNLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             +N+  +W EI GS +W+ LLDP+  +LRREI++YGEFA+A YD+FDFDP S+YCG+C+Y+
Sbjct  114   QNISAMWQEIHGSSNWDNLLDPLHPNLRREILKYGEFAEATYDAFDFDPLSEYCGSCRYN  173

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
               + FE  G+   GY++ RY+YA S++++P + + S    +WS+ +NWMGYVAV+  E E
Sbjct  174   RHKIFETSGLTKHGYKVKRYIYALSHVDVPQWLKRSHA--MWSKDSNWMGYVAVSRKE-E  230

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  829
               R+GRRDI++AWRGT++  EW  DL+  L      D+ ++K++ GF  +Y +  KD   
Sbjct  231   SHRIGRRDIMVAWRGTISPSEWFSDLRTGL---ELIDNTNVKVQEGFLGIYKS--KDEST  285

Query  830   NFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
              +   SA EQ++ EV RL+  Y  KGE +S+TVTGHSLG ALALL+AY+   +  ++   
Sbjct  286   RYNKLSASEQVMQEVVRLVNFYRGKGEEVSLTVTGHSLGGALALLNAYEAKTVIPDLF--  343

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1183
                                +SV SF  PRVGN+ FKE+ +ELG++ LR+V  +D VP +P
Sbjct  344   -------------------VSVISFGAPRVGNIAFKEKLNELGVRSLRVVVKQDIVPKLP  384

Query  1184  GIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1363
             G++     +   +   +     W Y HVG +L LD   SP+LK  +DL   HNLE +LHL
Sbjct  385   GLLN----RMLNKFHGLTGKLNWVYRHVGTQLKLDAFTSPYLKHESDLSGCHNLELYLHL  440

Query  1364  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1543
             +DG+     + R    RD+ALVNK S+ L  +  +P  W     KG+V    GRWV P R
Sbjct  441   IDGFLSRTSKHRWNARRDLALVNKGSDMLIEDLRIPEFWYDFPYKGLVLNKYGRWVKPGR  500

Query  1544  SRIEAHPSDTG  1576
                E  PS  G
Sbjct  501   QS-EDIPSPLG  510



>ref|XP_011000043.1| PREDICTED: galactolipase DONGLE, chloroplastic [Populus euphratica]
Length=450

 Score =   296 bits (757),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 171/363 (47%), Positives = 231/363 (64%), Gaps = 41/363 (11%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L  +W E+ G  +WEGL++P+   LR+EIIRYGEF  ACY +FD DP+SK   TCKY   
Sbjct  74    LAHMWREVHGCNNWEGLVEPLHPFLRQEIIRYGEFVTACYQAFDLDPNSKRYLTCKYGKK  133

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
               F ++GM + GY +++Y+YAT ++N+P      S  R       W+GYVAV++D+A +R
Sbjct  134   NLFREVGMGNPGYEVTKYIYATPDVNIP-IQNEPSCGR-------WVGYVAVSSDDA-VR  184

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPT---HFRDDPDIKIESGFFDLYTNSKKDTD  826
             RLGRRDIVI +RGTVT  EWI +  + L P    H    PD+K+ESGF  LYT+++ D  
Sbjct  185   RLGRRDIVITFRGTVTNPEWIANFMSSLTPAKLDHNNPRPDVKVESGFLSLYTSNESDDK  244

Query  827   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
               F   S REQLL+EV+RL+ RYKGE LSI+++GHS+G++LALL AYDIAE+ +N +   
Sbjct  245   --FGLKSCREQLLSEVSRLLNRYKGEELSISLSGHSMGSSLALLLAYDIAELGLNRLS--  300

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                           + IP++VFSF GPRVGNL FKERC+ELG++VLRIVNV D +  +PG
Sbjct  301   ------------PNLDIPVTVFSFGGPRVGNLGFKERCEELGVRVLRIVNVNDPITKLPG  348

Query  1187  IIANEKFQYQKQLETMLKSFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
             +  NE F+           FPWS   YAHVGVE+ LD     F     +  C H+L  ++
Sbjct  349   VFFNENFRVLGG----RYEFPWSCSCYAHVGVEIVLD-----FFNM-QNPSCVHDLGSYI  398

Query  1358  HLV  1366
              L+
Sbjct  399   SLL  401



>ref|XP_002321113.2| hypothetical protein POPTR_0014s14860g [Populus trichocarpa]
 gb|EEE99428.2| hypothetical protein POPTR_0014s14860g [Populus trichocarpa]
Length=393

 Score =   293 bits (750),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 171/363 (47%), Positives = 231/363 (64%), Gaps = 41/363 (11%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L  +W E+QG  +WEGL++P+   LR+EIIRYGEF  ACY +FD DP+SK   TCKY   
Sbjct  16    LAHMWREVQGCNNWEGLVEPLHPFLRQEIIRYGEFVTACYQAFDLDPNSKRYLTCKYGKK  75

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
               F ++GM + GY +++Y+YAT ++N+P      S  R       W+GYVAV++D+A +R
Sbjct  76    NLFREVGMGNPGYEVTKYIYATPDVNIP-IQNEPSCGR-------WVGYVAVSSDDA-VR  126

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPT---HFRDDPDIKIESGFFDLYTNSKKDTD  826
             RLGRRDIVI +RGTVT  EWI +  + L P    H    PD+K+ESGF  LYT+++    
Sbjct  127   RLGRRDIVITFRGTVTNPEWIANFMSSLTPAKLDHNNPRPDVKVESGFLSLYTSNESGDK  186

Query  827   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
               F   S REQLL+EV+RL+ RYKGE LSI+++GHS+G++LALL AYDIAE+ +N +   
Sbjct  187   --FGLKSCREQLLSEVSRLLNRYKGEELSISLSGHSMGSSLALLLAYDIAELGLNRL---  241

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                           + IP++VFSF GPRVGNL FKERC+ELG++VLRIVNV D +  +PG
Sbjct  242   -----------GPNLDIPVTVFSFGGPRVGNLGFKERCEELGVRVLRIVNVNDPITKLPG  290

Query  1187  IIANEKFQYQKQLETMLKSFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
             +  NE F+           FPWS   YAHVGVE+ LD     F     +  C H+L  ++
Sbjct  291   VFLNENFRVLGG----RYEFPWSCSCYAHVGVEIVLD-----FFNM-QNPSCVHDLGSYI  340

Query  1358  HLV  1366
              L+
Sbjct  341   SLL  343



>ref|XP_008783953.1| PREDICTED: galactolipase DONGLE, chloroplastic-like [Phoenix 
dactylifera]
Length=442

 Score =   294 bits (753),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 168/363 (46%), Positives = 229/363 (63%), Gaps = 41/363 (11%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L  +W EIQGS DWE L++P++  LR+EI+RYGEF  ACY +FD DP SK    CKY   
Sbjct  64    LASVWREIQGSDDWEDLVEPLNPLLRQEIVRYGEFVAACYKAFDLDPSSKRYLNCKYGKR  123

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
                 ++GM   GY +++Y+YAT +I++P         +  +  + W+GYVAV+ DE E+R
Sbjct  124   SMLREVGMESSGYEVTKYVYATPDIDIP--------TQGGTCRSRWVGYVAVSKDE-EVR  174

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHF---RDDPDIKIESGFFDLYTNSKKDTD  826
             RLGRRDI++++RGTVT  EWI +LK  L P         PD+K+ESGF  LYT+   ++ 
Sbjct  175   RLGRRDILVSFRGTVTNTEWIANLKCSLTPARLDPHEPRPDVKVESGFLSLYTSD--ESS  232

Query  827   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
             C F S S REQLL+EV+R+I +YK E LSIT+ GHS+G++LALL  YD+AE+ +N     
Sbjct  233   CKFSSGSCREQLLSEVSRIINKYKDEELSITLAGHSMGSSLALLLGYDLAELGLN-----  287

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                         +   +PI+V+SFAGPRVGN  FKERC+ELG+KVLR+VNV D V  +PG
Sbjct  288   ---------RDGSNRDVPITVYSFAGPRVGNSGFKERCEELGVKVLRVVNVNDPVTKLPG  338

Query  1187  IIANEKFQYQKQLETMLKSFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
             +  NE      Q+       PWS   YAHVGVELALD     F K   +  C H+++ ++
Sbjct  339   VFLNE----NSQVLAGRYKLPWSCSCYAHVGVELALD-----FFKM-KNPACVHDIDAYI  388

Query  1358  HLV  1366
              L+
Sbjct  389   GLL  391



>ref|XP_009631504.1| PREDICTED: galactolipase DONGLE, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=421

 Score =   293 bits (749),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 171/363 (47%), Positives = 230/363 (63%), Gaps = 32/363 (9%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L  +W EIQGSK+WE L++P+D+ L+ EIIRYGEF  ACY++FD DP+SK    CKY   
Sbjct  40    LASMWREIQGSKNWENLVNPLDNLLQNEIIRYGEFVAACYNAFDLDPNSKRYLNCKYGKN  99

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
                 ++G+ + GY +++Y+YAT+NIN+ +  Q+       S    W+GYVAV+ +  E  
Sbjct  100   SMLNEVGLGNSGYNVTKYIYATTNINVLSIGQNC------SSSGKWIGYVAVS-NNVEST  152

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDD---PDIKIESGFFDLYTNSKKDTD  826
             RLGRRD++I +RGTVT  EWI +L + L P H   +   PD+K+E+GF  LYT+++   D
Sbjct  153   RLGRRDVLITFRGTVTNPEWIANLMSTLTPAHLDPNNLRPDVKVEAGFLSLYTSNE---D  209

Query  827   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
               F   S REQLL+E+ R+I  YKGE +SIT+ GHS+G+ALALL AYDIAE+ +N     
Sbjct  210   EKFGLGSCREQLLSEIGRVINMYKGEEMSITIAGHSMGSALALLLAYDIAELGLNTT---  266

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                     S       IP++VFSF GPRVGNL FKERC+ELGIKVLRIVNV D +  +PG
Sbjct  267   ----IVPESQVKINNSIPVTVFSFGGPRVGNLGFKERCEELGIKVLRIVNVNDPITKLPG  322

Query  1187  IIANEKFQYQKQLETMLKSFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
             +  NE F   + L       PWS   YAHVGVE+ LD     F     +  C H+L  +L
Sbjct  323   VFLNENF---RVLLGGKYEVPWSCSCYAHVGVEILLD-----FFNM-QNPTCVHDLATYL  373

Query  1358  HLV  1366
             +L+
Sbjct  374   NLL  376



>ref|XP_002272558.2| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Vitis 
vinifera]
Length=511

 Score =   295 bits (754),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 178/430 (41%), Positives = 263/430 (61%), Gaps = 49/430 (11%)
 Frame = +2

Query  293   NLHEIWAEIQ-GSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             N+   W E+  GS  WE LLDP+   LRREI++YGEFAQA YD+F+ D      G C+ +
Sbjct  114   NMSNKWHELHAGSSKWEHLLDPLHPWLRREIVKYGEFAQATYDAFNND-----SGNCQCE  168

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
               + F++L +   GY++++Y+YA S++   ++ + S   + WS+ +NW+G+VAV+TD+ E
Sbjct  169   RHKLFDELHLTKHGYKVTKYIYAMSHVGGLHYLERSQFTQTWSKDSNWIGFVAVSTDD-E  227

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLK-NILHPTHFRDDPDIKIESGFFDLYTNSKKDTD  826
              +R+GRRDIV+AWRGTV   EW+ D +  +LH      + D+ +E GF  +Y++  + T 
Sbjct  228   SQRIGRRDIVMAWRGTVAVSEWVLDFEAKLLHI----GEGDVMVEYGFHKIYSSKSESTR  283

Query  827   CNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
              N   +SA EQ++ EV  L++ Y  +GE +S T+TGHSLG ALALL+AY+ A    ++  
Sbjct  284   YN--KFSASEQVMEEVKNLVKFYGERGEEVSFTITGHSLGGALALLNAYEAAATLPDL--  339

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1180
                                PI+V SF  P+VGN+ F+++ DE+ ++ LRIV  +DKVPT+
Sbjct  340   -------------------PITVISFGAPQVGNIAFRDKIDEMKVRTLRIVVKQDKVPTL  380

Query  1181  PGIIANEKFQYQKQLETMLK---SFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1351
             P     EKF   K L+ +L    +  W Y HVG ELALD + SP+LK        HNLE 
Sbjct  381   P-----EKFMSTKILQRLLSLTGTRKWVYTHVGEELALDMTSSPYLKRKFSYKDCHNLEI  435

Query  1352  HLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV--RTSDGR  1525
             +LHL+DG+H +   F+    RDIALVNK+S  L  E G+P  W Q  NKG++   ++ GR
Sbjct  436   YLHLLDGFHREDSSFQKGARRDIALVNKNSGMLIEELGIPENWYQVPNKGLMIFNSTSGR  495

Query  1526  WVVPERSRIE  1555
             WV  +RSR++
Sbjct  496   WV--KRSRVD  503



>ref|XP_004232943.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=402

 Score =   291 bits (744),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 182/428 (43%), Positives = 250/428 (58%), Gaps = 49/428 (11%)
 Frame = +2

Query  293   NLHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  472
             ++ E W E+ G   WEGLL+P+D  LR+ II+YGE A+  YD+F  D  SKY G  +Y  
Sbjct  3     SMAEKWEELSGKNKWEGLLNPLDVDLRKYIIQYGELAEVTYDTFISDKVSKYAGASRYSM  62

Query  473   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNR-IWSQHANWMGYVAVATDEAE  649
                F  +G+    YR+++Y YATS+I LP+ F   S++R  WS+ +N+MGY+AVATDE +
Sbjct  63    ENLFSNVGLDPSKYRVTKYFYATSSIPLPDAFITKSLSREAWSKESNFMGYIAVATDEGK  122

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNIL--HPTHFRDD---PDIK--IESGFFDLYTN  808
             +  LGRRDIVIAWRGT+  LEW++DL+ +L   P  F D    P  K  +  GF+++YT+
Sbjct  123   V-SLGRRDIVIAWRGTIQTLEWVNDLQFLLIPGPKVFGDGGLLPLFKPLVHHGFYNVYTS  181

Query  809   SKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKV  988
               +    NF   SAR+Q++ EV RL+E YK E +SITVTGHSLGA+LA L+A+DIA  K+
Sbjct  182   --ESARSNFNKKSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAFDIAYNKI  239

Query  989   NVVQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELG-IKVLRIVNVRD  1165
             N                S   + P++ F FA P+VG++ F    ++L  + V+RI NV D
Sbjct  240   N--------------KTSEGKEFPVTAFVFASPKVGDINFVNAFNKLKHLHVMRIHNVLD  285

Query  1166  KVPTVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              VP  P                     P  Y  VG E+ +D + SP+L    D+   HNL
Sbjct  286   IVPKYP---------------------PLGYFDVGQEIIIDTTKSPYLNLPGDILTWHNL  324

Query  1346  EGHLHLVDGYHGDG--RRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSD  1519
             E +LH V G  G G    F+    RDIALVNK S  LK E+ VP  W   +NKGMV+  D
Sbjct  325   ECYLHGVAGTQGIGLLAGFKLEVDRDIALVNKSSGALKSEYLVPANWWTAKNKGMVQQED  384

Query  1520  GRWVVPER  1543
             G+WV+ +R
Sbjct  385   GKWVLNDR  392



>ref|XP_001779107.1| predicted protein [Physcomitrella patens]
 gb|EDQ56053.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   293 bits (751),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 185/449 (41%), Positives = 252/449 (56%), Gaps = 60/449 (13%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L E W E+QG+ DW+G+L+P++ HLR E+IRYGEFAQ  YDSFD+D HSK+CG+C+Y   
Sbjct  41    LAETWREVQGADDWKGMLEPLNDHLRAELIRYGEFAQVSYDSFDYDKHSKFCGSCRYSPD  100

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
               F+ + +   GY ++ Y+YAT+N  + +  + +     WS+ +NWMGYVAV TDE EI+
Sbjct  101   SLFKNVNLHHTGYTVTWYIYATTNERVWSLIKRTEREDAWSKRSNWMGYVAVCTDEKEIK  160

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD-----IKIESGFFDLYTNSKKD  820
             RLGRRDI++ WRGTVT  EW   L + L      D  D      K+E+G  DLYT++  D
Sbjct  161   RLGRRDILVVWRGTVTDREWASKLTSQLVECSCVDGSDHSESTPKVEAGLLDLYTSA--D  218

Query  821   TDCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNV  994
                 F   SARE  + E+ RLIE YK  G  LSIT+ GHSLG+ L +L A D+A  K+N 
Sbjct  219   AGSKFNKISAREYAVKEIVRLIEEYKDDGHELSITICGHSLGSGLGILFACDVANSKLNQ  278

Query  995   VQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVP  1174
             +                   IPI+VFSF GP VG+  FK R ++LGIKVLR+VN RD VP
Sbjct  279   IN--------------QERTIPITVFSFGGPPVGDGVFKRRVEDLGIKVLRVVNKRDAVP  324

Query  1175  TVPGIIANEKFQYQKQLETMLKSFPWSYAHVGVELALDHSYSPFL---------------  1309
             ++          +  +   +L S    + H+GV+  +D + S  L               
Sbjct  325   SL----------HTWRFVDILNS---GHQHLGVQFEVDDTNSEHLDQLKATTRQETLRYE  371

Query  1310  ---KTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRW  1480
                K  +     HNLE +LHL+DGY     R+     RD  LVNK   FLK    VP  W
Sbjct  372   IGEKHTSAFYNHHNLEVYLHLIDGYG----RYDKPPTRDPVLVNKHCGFLKNSEYVPECW  427

Query  1481  RQDENKGMVRTSDG-RWVVPERSRIEAHP  1564
              Q +NKG+  + D  R+  PER+ ++ HP
Sbjct  428   WQPKNKGLKYSKDANRYFQPERA-VKDHP  455



>emb|CAN64309.1| hypothetical protein VITISV_037470 [Vitis vinifera]
Length=511

 Score =   294 bits (753),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 177/429 (41%), Positives = 261/429 (61%), Gaps = 47/429 (11%)
 Frame = +2

Query  293   NLHEIWAEIQ-GSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  469
             N+   W E+  GS  WE LLDP+   LRREI++YGEFAQA YD+F+ D      G C+ +
Sbjct  114   NMSNKWHELHAGSSKWEHLLDPLHPWLRREIVKYGEFAQATYDAFNND-----SGNCQCE  168

Query  470   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
               + F++L +   GY++++Y+YA S++   ++ + S   + WS+ +NW+G+VAV+TD+ E
Sbjct  169   RHKLFDELHLTKHGYKVTKYIYAMSHVGGLHYLERSQFTQTWSKDSNWIGFVAVSTDD-E  227

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  829
              +R+GRRDIV+AWRGTV   EW+ D +  L       + D+ +E GF  +Y++  + T  
Sbjct  228   SQRIGRRDIVMAWRGTVAVSEWVLDFEAKLQHI---GEGDVTVEYGFHKIYSSKSESTRY  284

Query  830   NFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1003
             N   +SA EQ++ EV  L++ Y  +GE +S T+TGHSLG ALALL+AY+ A    ++   
Sbjct  285   N--KFSASEQVMEEVKNLVKFYGERGEEVSFTITGHSLGGALALLNAYEAAATLPDL---  339

Query  1004  gegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1183
                               PI+V SF  P+VGN+ F+++ DE+ ++ LRIV  +DKVPT+P
Sbjct  340   ------------------PITVISFGAPQVGNIAFRDKIDEMKVRTLRIVVKQDKVPTLP  381

Query  1184  GIIANEKFQYQKQLETMLK---SFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1354
                  EKF   K L+ +L    +  W Y HVG ELALD + SP+LK        HNLE +
Sbjct  382   -----EKFMSTKILQRLLSLTGTRKWVYTHVGEELALDMTSSPYLKRKFSYKDCHNLEIY  436

Query  1355  LHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV--RTSDGRW  1528
             LHL+DG+H +   F+    RDIALVNK+S  L  E G+P  W Q  NKG++   ++ GRW
Sbjct  437   LHLLDGFHREDSSFQKGARRDIALVNKNSGMLIEELGIPENWYQVPNKGLMIFNSTSGRW  496

Query  1529  VVPERSRIE  1555
             V  +RSR++
Sbjct  497   V--KRSRVD  503



>ref|XP_002268142.1| PREDICTED: galactolipase DONGLE, chloroplastic [Vitis vinifera]
Length=446

 Score =   291 bits (746),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 172/363 (47%), Positives = 232/363 (64%), Gaps = 41/363 (11%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L ++W EIQG  +WE L++P+DS LR EIIRYGEF  ACY +FD DP+SK    CKY   
Sbjct  69    LADVWREIQGCNNWEDLVEPLDSLLRNEIIRYGEFVTACYKAFDLDPNSKRYLNCKYGKQ  128

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
                 ++GM   GY +++Y+YAT +IN+P     +S  R       W+GYVAV++DE E +
Sbjct  129   NLLREVGMEKSGYEVTKYIYATPDINIP-IQNGASCGR-------WIGYVAVSSDE-ETK  179

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHF---RDDPDIKIESGFFDLYTNSKKDTD  826
             RLGRRD++I +RGTVT  EWI +L + L P         PD+K+E+GF  LYT+   ++D
Sbjct  180   RLGRRDVLITFRGTVTNHEWIANLMSSLTPARLDPHNPRPDVKVEAGFLSLYTS--DESD  237

Query  827   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
               F   S REQLL+EV+RL+ +YKGE LSIT+ GHS+G++LALL AYDIAE+ +N     
Sbjct  238   SKFGLESCREQLLSEVSRLLNQYKGEELSITLAGHSMGSSLALLLAYDIAELGLN-----  292

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                         ++ +IPI+VFSF GPRVGN  FKERC+ELG+KVLR+VNV D +  +PG
Sbjct  293   ---------RDHSSREIPITVFSFGGPRVGNSSFKERCEELGLKVLRVVNVNDPITKLPG  343

Query  1187  IIANEKFQYQKQLETMLKSFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
             I+ NE F+           FPWS   YAHVGVE+ LD     F K   +    H+LE ++
Sbjct  344   IVFNENFRVLGG----RYEFPWSCSCYAHVGVEVVLD-----FFKM-ENPSYVHDLESYI  393

Query  1358  HLV  1366
             +L+
Sbjct  394   NLL  396



>ref|XP_003551855.1| PREDICTED: galactolipase DONGLE, chloroplastic-like [Glycine 
max]
 gb|KHN12573.1| Galactolipase DONGLE, chloroplastic [Glycine soja]
Length=499

 Score =   292 bits (748),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 178/396 (45%), Positives = 237/396 (60%), Gaps = 54/396 (14%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L   W E+QG  +WE LL+P+   LR+EIIRYGEF  A Y +FD +P+SK    CKY   
Sbjct  83    LSNFWREVQGCNNWENLLEPLHPLLRQEIIRYGEFVTASYKAFDLNPNSKRYLNCKYGKK  142

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
                 ++GM++ GY I++Y+YAT +INLPN     + N   S  A W+GYVAV++DEA ++
Sbjct  143   SMLSEVGMSNSGYNITKYIYATPDINLPNM----TYNNSSSSSARWIGYVAVSSDEA-VK  197

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH---FRDDPDIKIESGFFDLYTNSKKDTD  826
             RLGRRDI++ +RGTVT  EWI +L + L P     +   P++K+ESGF  LYT+ +    
Sbjct  198   RLGRRDILVTFRGTVTNQEWISNLMSSLTPAMLDPYNPRPEVKVESGFLSLYTSDESSAS  257

Query  827   CNFCSYSAREQLLAEVNRLIERYKG--ENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
               F   S REQLL+EV+RL+ +YKG  ENLSI++ GHS+G+ALA+L +YDIAE+ +N   
Sbjct  258   NKFGLESCREQLLSEVSRLMNKYKGEKENLSISLAGHSMGSALAILLSYDIAELGLN---  314

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1180
                          S   ++P++VFSF GPRVGN  FK RC+ELG+KVLRI NV D +  +
Sbjct  315   -----------KKSGTHEVPVTVFSFGGPRVGNSEFKHRCEELGVKVLRIANVNDPITKL  363

Query  1181  PGIIANEKFQYQKQLETMLKSFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1351
             PG++ NE F   + L      FPWS   YAHVGVEL LD     F     +  C H+L  
Sbjct  364   PGVVFNENF---RVLLGGRYEFPWSCSCYAHVGVELLLD-----FFNV-QNPSCVHDL--  412

Query  1352  HLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKRE  1459
                  D Y G  RR            NKD   +KRE
Sbjct  413   -----DSYIGLLRR-----------PNKDEVLMKRE  432



>ref|XP_003530907.1| PREDICTED: galactolipase DONGLE, chloroplastic-like [Glycine 
max]
 gb|KHN24955.1| Galactolipase DONGLE, chloroplastic [Glycine soja]
Length=489

 Score =   291 bits (746),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 173/367 (47%), Positives = 231/367 (63%), Gaps = 42/367 (11%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L   W E+QG  +WE LL+P+   LR+EIIRYGEF  A Y +FD DP+SK    CKY   
Sbjct  85    LSNFWREVQGCNNWENLLEPLHPLLRQEIIRYGEFVTASYKAFDLDPNSKRYLNCKYGKK  144

Query  476   QFFEKLGMADRGYRISRYLYATS--NINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  649
             +   ++GM++ GY I++Y+YAT   NINLPN    SS  R       W+GYVAV++DEA 
Sbjct  145   RMLSEVGMSNSGYNITKYIYATPDININLPNITNSSSSGR-------WIGYVAVSSDEA-  196

Query  650   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH---FRDDPDIKIESGFFDLYTNSKKD  820
             ++RLGRRDI++ +RGTVT  EWI +L + L P     +   P +K+ESGF  LYT S + 
Sbjct  197   VKRLGRRDILVTFRGTVTNQEWISNLMSSLTPAMLDPYNPQPQVKVESGFLSLYT-SDES  255

Query  821   TDCNFCSYSAREQLLAEVNRLIERYKGE--NLSITVTGHslgaalallsaYDIAEMKVNV  994
             +   F   S REQLL+EV+RL+ RYKGE  NLSI++ GHS+G+ALA+L AYDIAE+ +N 
Sbjct  256   SASKFGLESCREQLLSEVSRLMNRYKGENDNLSISLAGHSMGSALAILLAYDIAELGLN-  314

Query  995   VQegegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVP  1174
                            S + ++P++VFSF GPRVGN  FK RC+ELG+KVLRI NV D + 
Sbjct  315   -------------KKSGSTEVPVTVFSFGGPRVGNSEFKHRCEELGVKVLRIANVNDPIT  361

Query  1175  TVPGIIANEKFQYQKQLETMLKSFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNL  1345
              +PG++ NE F   + L      FPWS   YAHVGVEL LD     F     +  C H+L
Sbjct  362   KLPGVVFNENF---RVLLGGRYEFPWSCSCYAHVGVELMLD-----FFNV-QNPSCVHDL  412

Query  1346  EGHLHLV  1366
             + ++ L+
Sbjct  413   DTYISLL  419



>ref|XP_006478993.1| PREDICTED: phospholipase A1-Ialpha2, chloroplastic-like [Citrus 
sinensis]
Length=431

 Score =   290 bits (741),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 170/364 (47%), Positives = 232/364 (64%), Gaps = 38/364 (10%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L   W EIQG  DWE L++P+   LR+EIIRYGE   ACY +FD DP SK    CKY   
Sbjct  43    LAHFWREIQGFNDWENLVEPLHPLLRQEIIRYGELVTACYKAFDLDPVSKRFLNCKYGKN  102

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
                 ++G+ D GY++++Y+YAT +IN+    Q+  V    S  + W+GYVAV++DE+ ++
Sbjct  103   SMMREVGLQDSGYQVTKYIYATPDININIPIQN--VASSSSSCSRWIGYVAVSSDES-VK  159

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDD---PDIKIESGFFDLYTNSKKDTD  826
             RLGRRD+V+++RGTVT  EWI +  + L P     +   PD+K+ESGF  LYT+ + D  
Sbjct  160   RLGRRDVVVSFRGTVTNPEWIANFMSSLTPARLDPNNPRPDVKVESGFLSLYTSDESD--  217

Query  827   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
               F   S REQLL+EV+RL+ +YKGE LSIT+ GHS+G++LALL AYDIAE+ +N  Q  
Sbjct  218   -KFGLGSCREQLLSEVSRLLNKYKGEELSITLAGHSMGSSLALLLAYDIAELGLNKTQ--  274

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                            +IP++VFS+ GPRVGN  FK RCDELG+KVLRIVN+ D +  +PG
Sbjct  275   --------------SQIPVTVFSYGGPRVGNSGFKARCDELGVKVLRIVNINDPITKLPG  320

Query  1187  IIANEKFQYQKQLETMLK-SFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1354
             ++ NE F   + LE   +  FPWS   YAHVGVEL LD     F     +  C H+LE +
Sbjct  321   VLLNENF---RVLELGGRFEFPWSCSCYAHVGVELVLD-----FFNV-QNPSCVHDLESY  371

Query  1355  LHLV  1366
             ++L+
Sbjct  372   INLL  375



>ref|XP_010930439.1| PREDICTED: galactolipase DONGLE, chloroplastic-like [Elaeis guineensis]
Length=449

 Score =   290 bits (741),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 180/405 (44%), Positives = 245/405 (60%), Gaps = 51/405 (13%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L  +W EIQGS DWE L++P++  LR EI+RYGEF  ACY  FD DP SK    CKY   
Sbjct  71    LASVWREIQGSDDWEDLVEPLNPLLREEIVRYGEFVAACYKVFDVDPASKRYLNCKYGKK  130

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
                 ++GMA  GY +++Y+YAT +I++P   Q  +        + W+GYVAV+ DE E R
Sbjct  131   SMLREIGMASSGYEVTKYVYATPDIDIPT--QGGTC------CSRWIGYVAVSMDE-EAR  181

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDD-----PDIKIESGFFDLYTNSKKD  820
             RLGRRDI+++ RGTVT  EWI +  + L  T  R D     PD+K+ESGF  LYT+   D
Sbjct  182   RLGRRDILVSIRGTVTTTEWIANFMSSL--TTARLDPHDPRPDVKVESGFLSLYTSD--D  237

Query  821   TDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1000
             + C F S S REQLL+EV+R+I +YK E LSIT+ GHS+G++LALL  YD+AE+ +N   
Sbjct  238   SSCKFSSGSCREQLLSEVSRIINKYKDEELSITLAGHSMGSSLALLLGYDLAELGLN---  294

Query  1001  egegegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1180
                           +  ++P++V+SFAGPRVGN  FKERC+ELG+KVLR+VNV D +  +
Sbjct  295   -----------RDGSNREVPVTVYSFAGPRVGNSGFKERCEELGVKVLRVVNVNDPITKL  343

Query  1181  PGIIANEKFQYQKQLETMLKSFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1351
             PG+  NEK    + L    +  PWS   YAHVGVELALD     F K   +  C H+L+ 
Sbjct  344   PGVFLNEK---SRVLAGRFE-LPWSCSCYAHVGVELALD-----FFKM-KNPACVHDLDA  393

Query  1352  HLHLVDGYHGDGRRFRSATGRDIA-LVNKDSNFLKREHGVPPRWR  1483
             ++ L+        +  +   +D A L+NK   FL  +     RW+
Sbjct  394   YIGLL-----KCPKMAAQVRKDGANLLNKAKKFLSLQKIDAWRWQ  433



>ref|XP_007033998.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY04924.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=448

 Score =   289 bits (740),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 166/363 (46%), Positives = 230/363 (63%), Gaps = 42/363 (12%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L   W EIQGS +WE L++P+   LR+EIIRYGEF  ACY +FD DP+S+    CKY   
Sbjct  71    LSRFWREIQGSNNWENLVEPLHPLLRKEIIRYGEFVAACYKAFDLDPNSRRYLNCKYGKK  130

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
                +++GM + GY++++Y+YAT ++N+P   Q +S  R       W+GYVAV++D+A ++
Sbjct  131   SMLKEVGMENSGYQVTKYIYATPDVNIP--IQTASCGR-------WIGYVAVSSDDA-VK  180

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHF---RDDPDIKIESGFFDLYTNSKKDTD  826
             RLGRRD++I +RGTVT  EW+ +  + L P         P++K+ESGF  LYT+   +TD
Sbjct  181   RLGRRDVLITFRGTVTNHEWVANFMSSLTPARLDPHNPRPEVKVESGFLSLYTSD--ETD  238

Query  827   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
               F   S REQLL+EV+R++ +YKGE LSITV GHS+G+ALALL AYDI E+ +N     
Sbjct  239   SKFGLESCREQLLSEVSRILNKYKGEKLSITVAGHSMGSALALLFAYDITELGLN-----  293

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                         +  +IP++VFSF GPRVGN  FK+RC+ELG+KVLRI NV D +  +PG
Sbjct  294   ---------KTDSDQEIPVTVFSFGGPRVGNSSFKQRCEELGVKVLRIANVNDPITKLPG  344

Query  1187  IIANEKFQYQKQLETMLKSFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1357
             ++ NE F+           FPWS   YAHVGVEL LD     F     +  C H+LE ++
Sbjct  345   VLFNENFRVLGG----RYEFPWSCSCYAHVGVELVLD-----FFNV-QNPSCVHDLETYI  394

Query  1358  HLV  1366
              L+
Sbjct  395   SLL  397



>ref|XP_008791829.1| PREDICTED: galactolipase DONGLE, chloroplastic [Phoenix dactylifera]
Length=384

 Score =   287 bits (735),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 167/365 (46%), Positives = 228/365 (62%), Gaps = 45/365 (12%)
 Frame = +2

Query  296   LHEIWAEIQGSKDWEGLLDPMDSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  475
             L  +W E+QG+ DWE L++P+   LR EI+RYGE   ACY +FD DP SK    CKY   
Sbjct  8     LASVWREVQGADDWEDLVEPLHPLLREEIVRYGELVAACYKAFDLDPSSKRYLNCKYGKN  67

Query  476   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  655
                 ++GMA  GY++++Y+YAT +I++P     S   R     + W+GYVAV+ DE E+R
Sbjct  68    SMLREVGMAGSGYKVTKYIYATPDISIPT---QSGTCR-----SRWIGYVAVSGDE-EVR  118

Query  656   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHF---RDDPDIKIESGFFDLYTNSKKDTD  826
              LGRRDI++++RGTVT  EWI +  + L P         PD+K+ESGF  LYT+   D+ 
Sbjct  119   SLGRRDILVSFRGTVTNTEWIANFMSSLTPARLDPHDPRPDVKVESGFLSLYTSD--DSS  176

Query  827   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1006
             C F S S REQLL+EV+R++ +YK E LSIT+ GHS+G++LALL  YD+AE+ +N     
Sbjct  177   CKFSSGSCREQLLSEVSRIVNKYKDEELSITLAGHSMGSSLALLLGYDLAELGLN-----  231

Query  1007  egegdgesssasaaikipisVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1186
                        ++  ++PI+V+SF GPRVGN  FKERCDELG+KVLR+VNV D V  +PG
Sbjct  232   ---------RDASNREVPITVYSFGGPRVGNSGFKERCDELGVKVLRVVNVNDPVTKLPG  282

Query  1187  IIANEKFQYQKQLETMLKSF--PWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1351
             +  NE       L  +   F  PWS   YAHVGVELALD     F K   +  C H+L+ 
Sbjct  283   VFLNE------NLRVLAGRFELPWSCSCYAHVGVELALD-----FFKM-KNPACVHDLDA  330

Query  1352  HLHLV  1366
             ++ L+
Sbjct  331   YIGLL  335



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5998204766208