BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25529_g1_i1 len=2187 path=[4923:0-194 104:195-242 6295:243-404
287:405-467 5514:468-477 360:478-489 10907:490-505 6516:506-521
404:522-553 436:554-634 517:635-676 10992:677-691 574:692-728
611:729-808 10777:809-818 701:819-827 710:828-868 751:869-1042
925:1043-1067 950:1068-1132 1015:1133-1167 1050:1168-1318
10231:1319-1348 1231:1349-1420 1303:1421-1427 1310:1428-1663
10710:1664-1673 1556:1674-1717 4477:1718-2186]

Length=2187
                                                                      Score     E

emb|CDP09265.1|  unnamed protein product                                675   0.0      
ref|XP_011080360.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    674   0.0      
ref|XP_002285367.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    666   0.0      Vitis vinifera
ref|XP_009801144.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    663   0.0      
ref|XP_004250927.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    657   0.0      
ref|XP_007015095.1|  Alpha/beta-Hydrolases superfamily protein          655   0.0      
ref|XP_009622048.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    652   0.0      
ref|XP_010246745.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    651   0.0      
ref|XP_007211838.1|  hypothetical protein PRUPE_ppa004631mg             649   0.0      
ref|XP_008227339.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    650   0.0      
ref|XP_002313345.2|  hypothetical protein POPTR_0009s05660g             642   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010031778.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    642   0.0      
gb|KDP22109.1|  hypothetical protein JCGZ_25940                         634   0.0      
ref|XP_011032046.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    633   0.0      
gb|EYU31376.1|  hypothetical protein MIMGU_mgv1a004679mg                629   0.0      
ref|XP_010102366.1|  Phospholipase A1-Igamma3                           630   0.0      
ref|XP_010673678.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    628   0.0      
ref|XP_010269807.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    624   0.0      
emb|CAN83233.1|  hypothetical protein VITISV_005768                     623   0.0      Vitis vinifera
gb|KCW51163.1|  hypothetical protein EUGRSUZ_J00755                     622   0.0      
ref|XP_006446147.1|  hypothetical protein CICLE_v10014848mg             621   0.0      
ref|XP_006470637.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    621   0.0      
gb|EYU46244.1|  hypothetical protein MIMGU_mgv1a004190mg                619   0.0      
ref|XP_004154680.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    612   0.0      
gb|KGN66495.1|  hypothetical protein Csa_1G614650                       615   0.0      
ref|XP_010938722.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    613   0.0      
ref|XP_004139114.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    611   0.0      
ref|XP_008450415.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    612   0.0      
ref|XP_003538937.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    612   0.0      
ref|XP_004505625.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    601   0.0      
ref|XP_003607369.1|  Lipase                                             597   0.0      
ref|XP_007131548.1|  hypothetical protein PHAVU_011G022500g             588   0.0      
ref|XP_010544180.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    587   0.0      
ref|XP_010479626.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    584   0.0      
ref|XP_002891639.1|  lipase class 3 family protein                      584   0.0      
ref|XP_010461974.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    582   0.0      
ref|XP_006307213.1|  hypothetical protein CARUB_v10008812mg             582   0.0      
ref|XP_006393053.1|  hypothetical protein EUTSA_v10011370mg             581   0.0      
gb|KFK35847.1|  hypothetical protein AALP_AA4G044700                    580   0.0      
ref|XP_010500719.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    580   0.0      
ref|XP_009147767.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    579   0.0      
emb|CDY22842.1|  BnaA06g02350D                                          577   0.0      
ref|NP_564590.1|  DAD1-like lipase 2                                    575   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY49813.1|  BnaC06g04560D                                          566   0.0      
ref|XP_006853086.1|  hypothetical protein AMTR_s00038p00106840          536   2e-179   
ref|XP_002513514.1|  triacylglycerol lipase, putative                   526   8e-177   Ricinus communis
gb|ABR16123.1|  unknown                                                 526   1e-175   Picea sitchensis
ref|XP_011042424.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    513   5e-171   
ref|XP_002302074.2|  hypothetical protein POPTR_0002s04560g             513   6e-171   Populus trichocarpa [western balsam poplar]
ref|XP_002306818.1|  hypothetical protein POPTR_0005s24000g             509   1e-169   Populus trichocarpa [western balsam poplar]
ref|XP_007050417.1|  Alpha/beta-Hydrolases superfamily protein          509   2e-169   
ref|XP_009782117.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    509   2e-169   
gb|KDP21366.1|  hypothetical protein JCGZ_21837                         508   4e-169   
ref|XP_009603052.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    508   6e-169   
ref|XP_004289898.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    509   6e-169   
ref|XP_008235325.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    504   1e-167   
ref|XP_006349747.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    503   4e-167   
ref|XP_011026041.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    503   4e-167   
ref|XP_007201554.1|  hypothetical protein PRUPE_ppa017780mg             499   4e-166   
ref|XP_002281907.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    497   1e-164   Vitis vinifera
ref|XP_009367748.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    497   1e-164   
gb|KCW49834.1|  hypothetical protein EUGRSUZ_K03311                     495   3e-164   
emb|CAN74039.1|  hypothetical protein VITISV_012945                     495   5e-164   Vitis vinifera
ref|XP_011079988.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    495   6e-164   
ref|XP_010038036.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    495   7e-164   
ref|XP_008346158.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    494   8e-164   
ref|XP_009354875.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    493   3e-163   
ref|XP_008783171.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    493   6e-163   
ref|XP_008372307.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    492   7e-163   
ref|XP_006443915.1|  hypothetical protein CICLE_v10019700mg             492   2e-162   
gb|KFK42995.1|  hypothetical protein AALP_AA1G065900                    490   5e-162   
ref|XP_009384367.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    490   6e-162   
ref|XP_006410159.1|  hypothetical protein EUTSA_v10016488mg             490   9e-162   
ref|XP_010274199.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    490   1e-161   
ref|XP_010087133.1|  Phospholipase A1-Igamma1                           488   2e-161   
ref|XP_009119028.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    489   3e-161   
ref|XP_002879267.1|  lipase class 3 family protein                      489   3e-161   
ref|NP_565701.1|  phospholipase A1-Igamma2                              488   3e-161   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010679169.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    489   4e-161   
ref|XP_010927018.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    488   5e-161   
emb|CDY29665.1|  BnaA04g17620D                                          488   6e-161   
ref|XP_009141072.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    487   1e-160   
ref|XP_010278159.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    487   1e-160   
emb|CDY10228.1|  BnaC05g04710D                                          486   2e-160   
gb|ACJ76846.1|  chloroplast lipase protein                              486   2e-160   Brassica napus [oilseed rape]
emb|CDX97819.1|  BnaC04g41200D                                          485   2e-160   
ref|XP_010522024.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    486   3e-160   
ref|XP_010469840.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    486   8e-160   
ref|XP_010558870.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    483   6e-159   
ref|XP_006293988.1|  hypothetical protein CARUB_v10022980mg             483   6e-159   
ref|XP_006853087.1|  hypothetical protein AMTR_s00038p00110060          482   7e-159   
ref|XP_010475428.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    482   8e-159   
ref|XP_010469841.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    483   1e-158   
ref|XP_010510341.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    481   2e-158   
ref|XP_010457831.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    479   2e-158   
ref|XP_010414252.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    481   3e-158   
ref|NP_849603.1|  phospholipase A1-Igamma1                              480   4e-158   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417878.1|  hypothetical protein EUTSA_v10007393mg             479   8e-158   
ref|XP_010457830.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    478   8e-158   
ref|XP_002892359.1|  lipase class 3 family protein                      478   4e-157   
ref|XP_006307284.1|  hypothetical protein CARUB_v10008898mg             477   4e-157   
ref|XP_004146954.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    477   5e-157   
ref|XP_004168244.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    476   8e-157   
ref|XP_008451275.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    476   1e-156   
ref|XP_010938535.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    476   2e-156   
ref|XP_007144693.1|  hypothetical protein PHAVU_007G177100g             475   2e-156   
ref|XP_008802654.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    475   3e-156   
ref|XP_004146952.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    473   2e-155   
ref|XP_008451272.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    471   8e-155   
ref|XP_003566295.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    472   1e-154   
ref|XP_006655277.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    467   5e-154   
ref|XP_003518894.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    469   8e-154   
emb|CDP03693.1|  unnamed protein product                                462   9e-153   
gb|KGN44761.1|  hypothetical protein Csa_7G378500                       466   1e-152   
gb|EEC79153.1|  hypothetical protein OsI_19824                          467   2e-152   Oryza sativa Indica Group [Indian rice]
ref|XP_004146990.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    464   5e-152   
ref|XP_008451639.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    463   9e-152   
ref|XP_006576919.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    461   6e-151   
ref|XP_004962195.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    463   1e-150   
ref|XP_008656338.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    462   2e-150   
ref|XP_010326538.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    457   6e-150   
ref|XP_004962194.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    462   7e-150   
ref|XP_006853094.1|  hypothetical protein AMTR_s00038p00116940          458   2e-149   
ref|XP_009414857.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    457   3e-149   
gb|KDO53917.1|  hypothetical protein CISIN_1g048560mg                   450   1e-147   
ref|XP_006420095.1|  hypothetical protein CICLE_v10006964mg             449   1e-146   
gb|KDP21364.1|  hypothetical protein JCGZ_21835                         449   2e-146   
ref|XP_007034959.1|  Alpha/beta-Hydrolases superfamily protein, p...    445   7e-145   
ref|XP_004493750.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    439   2e-142   
ref|XP_004493749.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    439   3e-142   
dbj|BAJ85518.1|  predicted protein                                      438   2e-141   
emb|CDM86669.1|  unnamed protein product                                437   6e-141   
gb|KEH23856.1|  phospholipase A1                                        435   6e-141   
ref|XP_007162494.1|  hypothetical protein PHAVU_001G156900g             430   8e-139   
dbj|BAJ99811.1|  predicted protein                                      430   9e-139   
ref|XP_002437873.1|  hypothetical protein SORBIDRAFT_10g004170          426   7e-137   Sorghum bicolor [broomcorn]
ref|XP_011042425.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    421   1e-136   
ref|XP_002456959.1|  hypothetical protein SORBIDRAFT_03g046400          424   4e-136   Sorghum bicolor [broomcorn]
emb|CDM86668.1|  unnamed protein product                                423   5e-136   
ref|XP_008648833.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    421   1e-135   
ref|XP_002455039.1|  hypothetical protein SORBIDRAFT_03g003410          421   4e-135   Sorghum bicolor [broomcorn]
tpg|DAA53109.1|  TPA: hypothetical protein ZEAMMB73_566262              420   6e-135   
ref|XP_011028727.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    416   3e-134   
ref|XP_011079989.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    414   2e-133   
gb|KEH23857.1|  phospholipase A1                                        412   2e-132   
ref|XP_008382954.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    410   6e-132   
ref|NP_850148.1|  phospholipase A1-Igamma2                              407   1e-130   Arabidopsis thaliana [mouse-ear cress]
emb|CDY54880.1|  BnaA10g27930D                                          405   4e-130   
ref|XP_010414253.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    405   8e-130   
gb|AFW75599.1|  hypothetical protein ZEAMMB73_741719                    424   5e-128   
ref|NP_563772.1|  phospholipase A1-Igamma1                              400   6e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010414254.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    400   7e-128   
ref|XP_010274200.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    399   1e-127   
ref|XP_004968489.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    402   4e-127   
ref|XP_010486704.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    397   8e-127   
ref|XP_010486640.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    396   1e-126   
ref|XP_010486634.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    396   1e-126   
ref|XP_010486696.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    395   3e-126   
ref|XP_008451277.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    390   2e-124   
gb|EEE63596.1|  hypothetical protein OsJ_18413                          393   3e-124   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001055438.1|  Os05g0390000                                       389   2e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008451276.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    388   2e-123   
gb|KCW57435.1|  hypothetical protein EUGRSUZ_H00215                     386   2e-122   
ref|XP_010069172.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    387   3e-122   
ref|XP_003518892.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    382   1e-120   
ref|XP_002441042.1|  hypothetical protein SORBIDRAFT_09g019276          381   3e-120   Sorghum bicolor [broomcorn]
ref|XP_006576920.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    377   9e-120   
emb|CBI16352.3|  unnamed protein product                                377   1e-118   
ref|XP_006489506.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    371   5e-117   
ref|XP_003518893.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    367   3e-115   
ref|XP_010685025.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    367   9e-115   
ref|XP_009362274.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    364   4e-113   
emb|CDO99150.1|  unnamed protein product                                361   4e-113   
ref|XP_009614944.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    358   2e-112   
ref|XP_008371801.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    362   2e-112   
ref|XP_008371806.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    360   9e-112   
ref|XP_006827274.1|  hypothetical protein AMTR_s00010p00263480          357   3e-111   
ref|XP_009399031.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    357   3e-111   
ref|XP_008371821.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    358   6e-111   
ref|XP_010940258.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    357   9e-111   
ref|XP_008784887.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    355   4e-110   
ref|XP_009362273.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    355   1e-109   
gb|EYU19151.1|  hypothetical protein MIMGU_mgv1a006227mg                352   2e-109   
emb|CDP21091.1|  unnamed protein product                                354   2e-109   
ref|XP_010655697.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    353   2e-109   
ref|XP_010245170.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    354   3e-109   
ref|XP_011096641.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    353   5e-109   
ref|XP_010655698.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    350   4e-108   
gb|EPS66180.1|  hypothetical protein M569_08597                         347   6e-108   
ref|XP_007024951.1|  Alpha/beta-Hydrolases superfamily protein          350   8e-108   
ref|XP_009399030.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    349   1e-107   
ref|XP_003532708.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    349   1e-107   
emb|CBI17935.3|  unnamed protein product                                346   1e-107   
gb|ABR17156.1|  unknown                                                 347   5e-107   Picea sitchensis
gb|KDP38020.1|  hypothetical protein JCGZ_04663                         347   8e-107   
ref|XP_008444745.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    347   1e-106   
ref|XP_007212825.1|  hypothetical protein PRUPE_ppa020655mg             346   1e-106   
ref|XP_009792730.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    346   1e-106   
ref|XP_008225538.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    346   2e-106   
ref|XP_004135535.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    345   8e-106   
ref|XP_004167249.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    345   8e-106   
ref|XP_009605461.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    344   8e-106   
ref|XP_006448978.1|  hypothetical protein CICLE_v10014927mg             345   9e-106   
ref|XP_009408789.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    343   1e-105   
ref|XP_002531054.1|  triacylglycerol lipase, putative                   344   1e-105   Ricinus communis
ref|XP_010540608.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    344   3e-105   
ref|XP_006304825.1|  hypothetical protein CARUB_v10012471mg             343   3e-105   
ref|XP_001781080.1|  predicted protein                                  339   3e-105   
ref|XP_002272780.2|  PREDICTED: phospholipase A1-Igamma1, chlorop...    341   2e-104   Vitis vinifera
ref|XP_009115161.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    341   3e-104   
ref|XP_004244860.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    339   3e-104   
gb|KHN12425.1|  Phospholipase A1-Igamma1, chloroplastic                 348   5e-104   
ref|XP_009102705.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    340   8e-104   
gb|KDO75376.1|  hypothetical protein CISIN_1g037474mg                   339   1e-103   
ref|XP_006468077.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    338   3e-103   
ref|XP_006415481.1|  hypothetical protein EUTSA_v10007346mg             338   4e-103   
ref|XP_007024952.1|  Alpha/beta-Hydrolases superfamily protein          336   2e-102   
emb|CDX77597.1|  BnaA07g07350D                                          332   3e-102   
gb|KFK44851.1|  hypothetical protein AALP_AA1G310600                    335   6e-102   
ref|XP_006364888.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    333   7e-102   
ref|XP_002893614.1|  lipase class 3 family protein                      335   7e-102   
ref|XP_010460828.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    335   7e-102   
ref|XP_010478423.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    333   1e-101   
ref|XP_010499568.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    334   1e-101   
emb|CDY02287.1|  BnaA09g26150D                                          333   2e-101   
ref|XP_002314049.2|  hypothetical protein POPTR_0009s06300g             333   3e-101   Populus trichocarpa [western balsam poplar]
emb|CDY09593.1|  BnaC05g23260D                                          332   5e-101   
ref|XP_001779106.1|  predicted protein                                  329   1e-100   
gb|KCW75867.1|  hypothetical protein EUGRSUZ_D00253                     328   1e-100   
ref|XP_010052014.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    330   2e-100   
ref|XP_011025479.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    331   2e-100   
ref|NP_174326.1|  DAD1-like acylhydrolase                               327   6e-99    Arabidopsis thaliana [mouse-ear cress]
gb|EMT07991.1|  Lipase                                                  324   1e-98    
ref|XP_002298419.2|  hypothetical protein POPTR_0001s27040g             323   2e-98    Populus trichocarpa [western balsam poplar]
ref|XP_011047360.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    322   2e-97    
ref|XP_008783953.1|  PREDICTED: galactolipase DONGLE, chloroplast...    305   1e-91    
ref|XP_011000043.1|  PREDICTED: galactolipase DONGLE, chloroplastic     305   1e-91    
ref|XP_002321113.2|  hypothetical protein POPTR_0014s14860g             302   3e-91    Populus trichocarpa [western balsam poplar]
ref|XP_001779107.1|  predicted protein                                  304   6e-91    
ref|XP_009631504.1|  PREDICTED: galactolipase DONGLE, chloroplast...    301   1e-90    
ref|XP_010930439.1|  PREDICTED: galactolipase DONGLE, chloroplast...    302   2e-90    
ref|XP_004232943.1|  PREDICTED: phospholipase A1-II 1                   299   5e-90    
ref|XP_006478993.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    300   8e-90    
ref|XP_007033998.1|  Alpha/beta-Hydrolases superfamily protein          300   1e-89    
ref|XP_003530907.1|  PREDICTED: galactolipase DONGLE, chloroplast...    301   2e-89    
ref|XP_003551855.1|  PREDICTED: galactolipase DONGLE, chloroplast...    301   2e-89    
ref|XP_002268142.1|  PREDICTED: galactolipase DONGLE, chloroplastic     299   2e-89    Vitis vinifera
ref|XP_006443133.1|  hypothetical protein CICLE_v10024085mg             300   2e-89    
ref|XP_008791829.1|  PREDICTED: galactolipase DONGLE, chloroplastic     296   3e-89    
ref|XP_002272558.2|  PREDICTED: phospholipase A1-Igamma1, chlorop...    300   5e-89    Vitis vinifera
emb|CAN64309.1|  hypothetical protein VITISV_037470                     300   5e-89    Vitis vinifera
ref|XP_010105205.1|  Galactolipase DONGLE                               298   9e-89    
ref|XP_010025922.1|  PREDICTED: galactolipase DONGLE, chloroplast...    297   2e-88    
ref|XP_004298041.1|  PREDICTED: galactolipase DONGLE, chloroplast...    297   2e-88    
ref|XP_002301637.2|  hypothetical protein POPTR_0002s23240g             295   2e-88    Populus trichocarpa [western balsam poplar]
ref|XP_011042808.1|  PREDICTED: galactolipase DONGLE, chloroplast...    296   7e-88    
ref|XP_009791702.1|  PREDICTED: galactolipase DONGLE, chloroplast...    294   7e-88    
ref|XP_009420257.1|  PREDICTED: galactolipase DONGLE, chloroplast...    301   2e-87    
ref|XP_002450711.1|  hypothetical protein SORBIDRAFT_05g013160          294   2e-87    Sorghum bicolor [broomcorn]
ref|XP_004979188.1|  PREDICTED: galactolipase DONGLE, chloroplast...    294   2e-87    
ref|XP_006349966.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    292   2e-87    
ref|NP_001168442.1|  uncharacterized protein LOC100382214               294   3e-87    Zea mays [maize]
ref|XP_007223991.1|  hypothetical protein PRUPE_ppa014790mg             292   5e-87    
ref|XP_010912884.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    292   6e-87    
ref|XP_008222660.1|  PREDICTED: galactolipase DONGLE, chloroplastic     293   7e-87    
emb|CDO96758.1|  unnamed protein product                                290   9e-87    
ref|XP_008794177.1|  PREDICTED: galactolipase DONGLE, chloroplast...    293   1e-86    
ref|XP_006364325.1|  PREDICTED: phospholipase A1-IIgamma-like           290   2e-86    
ref|XP_009339909.1|  PREDICTED: galactolipase DONGLE, chloroplastic     290   3e-86    
ref|XP_009403651.1|  PREDICTED: galactolipase DONGLE, chloroplast...    289   8e-86    
ref|XP_007139124.1|  hypothetical protein PHAVU_008G003400g             290   1e-85    
ref|XP_003569464.1|  PREDICTED: phospholipase A1-II 3-like              288   2e-85    
ref|XP_008380696.1|  PREDICTED: galactolipase DONGLE, chloroplastic     289   2e-85    
ref|XP_010314737.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    288   3e-85    
ref|XP_009798317.1|  PREDICTED: galactolipase DONGLE, chloroplastic     288   4e-85    
gb|ABK24664.1|  unknown                                                 287   4e-85    Picea sitchensis
ref|XP_004293927.1|  PREDICTED: phospholipase A1-IIgamma-like           287   7e-85    
ref|XP_010245971.1|  PREDICTED: LOW QUALITY PROTEIN: galactolipas...    287   1e-84    
ref|XP_004232966.1|  PREDICTED: phospholipase A1-IIgamma-like           285   1e-84    
ref|XP_004232965.1|  PREDICTED: phospholipase A1-IIgamma-like           285   1e-84    
ref|XP_006364696.1|  PREDICTED: galactolipase DONGLE, chloroplast...    294   1e-84    
ref|XP_008439757.1|  PREDICTED: phospholipase A1-IIgamma                286   2e-84    
ref|XP_009628626.1|  PREDICTED: phospholipase A1-IIgamma-like           284   2e-84    
ref|XP_009589831.1|  PREDICTED: galactolipase DONGLE, chloroplast...    286   4e-84    
ref|XP_004134929.1|  PREDICTED: phospholipase A1-IIgamma-like           285   4e-84    
ref|XP_009775805.1|  PREDICTED: phospholipase A1-IIgamma-like           283   5e-84    
ref|XP_009401159.1|  PREDICTED: galactolipase DONGLE, chloroplast...    285   5e-84    
ref|XP_004233849.2|  PREDICTED: phospholipase A1-IIgamma-like           282   1e-83    
gb|KGN49294.1|  hypothetical protein Csa_6G519470                       283   1e-83    
ref|XP_009619316.1|  PREDICTED: phospholipase A1-IIgamma-like           282   2e-83    
ref|XP_010910337.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    283   2e-83    
ref|XP_010543058.1|  PREDICTED: galactolipase DONGLE, chloroplastic     284   2e-83    
ref|XP_009353256.1|  PREDICTED: phospholipase A1-IIgamma-like           283   2e-83    
gb|KHN18833.1|  Phospholipase A1-Igamma2, chloroplastic                 281   3e-83    
ref|XP_004232962.1|  PREDICTED: phospholipase A1-IIgamma-like           281   3e-83    
gb|EAY80695.1|  hypothetical protein OsI_35877                          283   3e-83    
ref|XP_006362430.1|  PREDICTED: phospholipase A1-IIgamma-like           281   3e-83    
ref|NP_001067729.1|  Os11g0299300                                       283   3e-83    
ref|XP_009628625.1|  PREDICTED: phospholipase A1-IIgamma-like           280   6e-83    
ref|XP_004963940.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    282   8e-83    
ref|XP_006304384.1|  hypothetical protein CARUB_v10010888mg             282   9e-83    
gb|EYU32751.1|  hypothetical protein MIMGU_mgv1a019991mg                280   1e-82    
ref|XP_006417987.1|  hypothetical protein EUTSA_v10009478mg             282   1e-82    
gb|ABR18391.1|  unknown                                                 280   1e-82    
ref|XP_006359231.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    284   2e-82    
gb|EAY80693.1|  hypothetical protein OsI_35875                          281   2e-82    
gb|KDP42875.1|  hypothetical protein JCGZ_23817                         282   2e-82    
gb|ABK23399.1|  unknown                                                 280   2e-82    
emb|CDP14642.1|  unnamed protein product                                281   2e-82    
ref|XP_008439078.1|  PREDICTED: galactolipase DONGLE, chloroplast...    281   3e-82    
ref|XP_010457679.1|  PREDICTED: galactolipase DONGLE, chloroplastic     281   3e-82    
ref|XP_007213350.1|  hypothetical protein PRUPE_ppa1027164mg            278   5e-82    
ref|XP_002889566.1|  lipase class 3 family protein                      280   9e-82    
ref|XP_010475298.1|  PREDICTED: galactolipase DONGLE, chloroplast...    280   1e-81    
ref|XP_004232942.2|  PREDICTED: phospholipase A1-IIgamma-like           277   1e-81    
ref|XP_009757707.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    276   1e-81    
ref|XP_004232963.1|  PREDICTED: phospholipase A1-IIgamma-like           276   2e-81    
ref|XP_010279083.1|  PREDICTED: phospholipase A1-IIgamma-like           276   2e-81    
emb|CDY10148.1|  BnaC05g03910D                                          279   2e-81    
ref|XP_010108436.1|  Phospholipase A1-IIgamma                           277   2e-81    
ref|XP_002881190.1|  lipase class 3 family protein                      279   2e-81    
ref|XP_010686320.1|  PREDICTED: phospholipase A1-IIgamma-like           276   3e-81    
gb|ABQ95989.1|  phospholipase A1                                        276   3e-81    
ref|XP_008225210.1|  PREDICTED: phospholipase A1-IIgamma                277   3e-81    
ref|XP_009119115.1|  PREDICTED: galactolipase DONGLE, chloroplastic     278   3e-81    
ref|XP_006410299.1|  hypothetical protein EUTSA_v10017922mg             279   3e-81    
ref|XP_009405777.1|  PREDICTED: galactolipase DONGLE, chloroplast...    277   3e-81    
gb|AAX96672.1|  Lipase, putative                                        278   3e-81    
gb|KHN18919.1|  Phospholipase A1-IIgamma                                276   3e-81    
ref|NP_563748.1|  galactolipase DONGLE                                  278   4e-81    
gb|KHN08451.1|  Phospholipase A1-IIgamma                                276   4e-81    
ref|XP_009757709.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    275   4e-81    
ref|XP_002266982.2|  PREDICTED: phospholipase A1-IIgamma isoform X1     276   4e-81    
gb|AFW79273.1|  hypothetical protein ZEAMMB73_515320                    275   5e-81    
ref|XP_009787871.1|  PREDICTED: phospholipase A1-IIgamma-like           275   6e-81    
ref|XP_003547164.1|  PREDICTED: phospholipase A1-IIgamma-like           276   6e-81    
ref|XP_006362432.1|  PREDICTED: phospholipase A1-IIgamma-like           275   7e-81    
ref|XP_010326961.1|  PREDICTED: galactolipase DONGLE, chloroplastic     276   7e-81    
ref|XP_004164687.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    278   7e-81    
ref|XP_009383384.1|  PREDICTED: galactolipase DONGLE, chloroplast...    276   7e-81    
ref|XP_004489153.1|  PREDICTED: galactolipase DONGLE, chloroplast...    278   7e-81    
ref|XP_006852124.1|  hypothetical protein AMTR_s00049p00044160          273   7e-81    
ref|XP_009352805.1|  PREDICTED: phospholipase A1-IIgamma-like           276   8e-81    
ref|XP_006362433.1|  PREDICTED: phospholipase A1-II 1-like              275   8e-81    
ref|XP_004148168.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    277   9e-81    
emb|CDY34503.1|  BnaC04g12960D                                          277   9e-81    
ref|XP_006364324.1|  PREDICTED: phospholipase A1-IIgamma-like           274   1e-80    
ref|NP_001149813.1|  triacylglycerol lipase                             274   1e-80    
emb|CDM85400.1|  unnamed protein product                                275   1e-80    
ref|XP_004245812.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    278   2e-80    
ref|XP_003541709.1|  PREDICTED: phospholipase A1-IIgamma-like           274   2e-80    
ref|XP_007148062.1|  hypothetical protein PHAVU_006G177300g             274   3e-80    
ref|XP_008656977.1|  PREDICTED: galactolipase DONGLE, chloroplast...    275   3e-80    
ref|XP_009626666.1|  PREDICTED: phospholipase A1-IIgamma-like           273   4e-80    
ref|XP_003593747.1|  Lipase                                             273   4e-80    
ref|XP_008383647.1|  PREDICTED: phospholipase A1-IIgamma                274   4e-80    
ref|XP_010469684.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    276   4e-80    
gb|KFK42913.1|  hypothetical protein AALP_AA1G054600                    274   4e-80    
gb|EMT30786.1|  Lipase                                                  274   4e-80    
ref|XP_011073877.1|  PREDICTED: galactolipase DONGLE, chloroplastic     275   4e-80    
ref|XP_003621036.1|  Lipase                                             276   5e-80    
ref|XP_009789580.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    276   7e-80    
ref|XP_004980419.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    274   9e-80    
ref|XP_009387098.1|  PREDICTED: galactolipase DONGLE, chloroplast...    275   1e-79    
gb|KDP21073.1|  hypothetical protein JCGZ_21544                         272   1e-79    
ref|XP_003577614.1|  PREDICTED: galactolipase DONGLE, chloroplast...    273   1e-79    
ref|XP_006362431.1|  PREDICTED: phospholipase A1-II 1-like              271   1e-79    
ref|XP_004485882.1|  PREDICTED: phospholipase A1-IIgamma-like           272   1e-79    
ref|XP_004232957.2|  PREDICTED: phospholipase A1-II 1-like              273   1e-79    
ref|XP_007025426.1|  Alpha/beta-Hydrolases superfamily protein          272   1e-79    
ref|XP_003608599.1|  Lipase                                             275   2e-79    
ref|XP_006362445.1|  PREDICTED: phospholipase A1-IIgamma-like           271   2e-79    
ref|NP_180727.1|  triacylglycerol lipase                                273   2e-79    
ref|XP_009144055.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    273   2e-79    
ref|XP_010510171.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    273   3e-79    
gb|AFK47098.1|  unknown                                                 270   3e-79    
gb|KHN32323.1|  Phospholipase A1-Igamma1, chloroplastic                 266   4e-79    
ref|XP_007039723.1|  Alpha/beta-Hydrolases superfamily protein          274   4e-79    
ref|NP_001152663.1|  triacylglycerol lipase precursor                   271   5e-79    
ref|XP_004232964.1|  PREDICTED: phospholipase A1-IIgamma-like           270   5e-79    
ref|XP_009795642.1|  PREDICTED: phospholipase A1-IIgamma-like           270   5e-79    
ref|XP_009599019.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    274   5e-79    
emb|CDX79431.1|  BnaC03g17670D                                          272   5e-79    
ref|XP_003528480.1|  PREDICTED: phospholipase A1-IIgamma-like           270   6e-79    
ref|XP_009773996.1|  PREDICTED: phospholipase A1-II 1-like              270   7e-79    
ref|XP_006296490.1|  hypothetical protein CARUB_v10025676mg             272   8e-79    
ref|XP_010414097.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    272   1e-78    
ref|XP_010912683.1|  PREDICTED: phospholipase A1-II 1                   269   1e-78    
ref|XP_006362440.1|  PREDICTED: phospholipase A1-II 1-like              270   1e-78    
ref|XP_004253384.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    273   1e-78    
sp|Q6F358.1|PLA6_ORYSJ  RecName: Full=Phospholipase A1-II 6             269   2e-78    
ref|XP_006340582.1|  PREDICTED: phospholipase A1-IIgamma-like           269   2e-78    
ref|XP_009765842.1|  PREDICTED: phospholipase A1-II 1-like              269   2e-78    
ref|XP_009606132.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    273   2e-78    
emb|CDX84763.1|  BnaA03g14670D                                          271   2e-78    
ref|XP_010677111.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    273   2e-78    
ref|XP_010518795.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    268   4e-78    
ref|XP_009145395.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    271   4e-78    
ref|XP_011081332.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    271   5e-78    
ref|XP_004241988.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    271   7e-78    
ref|XP_010277744.1|  PREDICTED: phospholipase A1-IIgamma-like           267   7e-78    
ref|XP_006852476.1|  hypothetical protein AMTR_s00021p00129470          266   8e-78    
ref|XP_008674694.1|  PREDICTED: galactolipase DONGLE, chloroplast...    268   9e-78    
gb|KCW74072.1|  hypothetical protein EUGRSUZ_E02710                     267   1e-77    
ref|XP_003608120.1|  Lipase                                             266   1e-77    
ref|XP_004251807.1|  PREDICTED: phospholipase A1-IIdelta-like           266   1e-77    
ref|XP_002456062.1|  hypothetical protein SORBIDRAFT_03g029680          267   2e-77    
ref|XP_010279086.1|  PREDICTED: phospholipase A1-IIgamma-like           266   2e-77    
dbj|BAB89948.1|  putative DAD1                                          267   2e-77    
ref|XP_009777406.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    266   2e-77    
ref|XP_007153706.1|  hypothetical protein PHAVU_003G058000g             265   2e-77    
ref|XP_009133156.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    267   3e-77    
ref|XP_009773480.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    269   5e-77    
ref|XP_010054330.1|  PREDICTED: phospholipase A1-IIgamma-like           265   5e-77    
ref|XP_010647255.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    268   5e-77    
ref|XP_010057070.1|  PREDICTED: phospholipase A1-IIgamma-like           266   5e-77    
ref|XP_004969332.1|  PREDICTED: phospholipase A1-II 3-like              265   6e-77    
ref|XP_004231490.1|  PREDICTED: phospholipase A1-II 1                   265   7e-77    
ref|XP_006362471.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    268   7e-77    
ref|XP_010064368.1|  PREDICTED: galactolipase DONGLE, chloroplast...    265   1e-76    
ref|XP_002316835.2|  lipase class 3 family protein                      264   1e-76    
ref|XP_006414297.1|  hypothetical protein EUTSA_v10027304mg             267   2e-76    
emb|CAN77244.1|  hypothetical protein VITISV_035465                     268   3e-76    
ref|XP_006837391.1|  hypothetical protein AMTR_s00111p00133140          264   3e-76    
ref|XP_009368157.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    267   3e-76    
ref|XP_003576087.1|  PREDICTED: galactolipase DONGLE, chloroplast...    264   3e-76    
ref|XP_008812184.1|  PREDICTED: phospholipase A1-II 1                   263   3e-76    
ref|XP_010475356.1|  PREDICTED: phospholipase A1-IIalpha-like           263   3e-76    
gb|EYU19471.1|  hypothetical protein MIMGU_mgv1a004169mg                267   3e-76    
ref|XP_008373668.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    267   4e-76    
ref|XP_002522554.1|  triacylglycerol lipase, putative                   263   4e-76    
ref|XP_011031953.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    266   5e-76    
ref|XP_006440208.1|  hypothetical protein CICLE_v10019666mg             266   5e-76    
gb|ACZ57767.1|  glycerolipase A1                                        266   5e-76    
ref|XP_006449477.1|  hypothetical protein CICLE_v10015361mg             263   6e-76    
ref|XP_007153707.1|  hypothetical protein PHAVU_003G058100g             261   7e-76    
gb|KDO37674.1|  hypothetical protein CISIN_1g039426mg                   266   7e-76    
ref|XP_006467671.1|  PREDICTED: phospholipase A1-IIgamma-like           262   8e-76    
gb|KDO46424.1|  hypothetical protein CISIN_1g041669mg                   260   1e-75    
ref|XP_009393076.1|  PREDICTED: phospholipase A1-II 1                   261   1e-75    
ref|XP_011074749.1|  PREDICTED: phospholipase A1-IIgamma                262   1e-75    
emb|CDP08362.1|  unnamed protein product                                265   1e-75    
ref|XP_011101305.1|  PREDICTED: phospholipase A1-II 1-like              261   1e-75    
ref|XP_002303372.1|  hypothetical protein POPTR_0003s07940g             264   2e-75    
ref|XP_010052794.1|  PREDICTED: phospholipase A1-IIdelta                262   2e-75    
ref|XP_009343932.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    265   2e-75    
ref|XP_010501341.1|  PREDICTED: phospholipase A1-IIalpha-like           261   2e-75    
gb|EEE55822.1|  hypothetical protein OsJ_04428                          258   3e-75    
ref|XP_006477114.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    264   3e-75    
ref|XP_011045903.1|  PREDICTED: phospholipase A1-IIgamma                260   3e-75    
gb|KFK42950.1|  hypothetical protein AALP_AA1G060100                    260   3e-75    
ref|XP_009368221.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    264   3e-75    
ref|XP_009772200.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    263   4e-75    
ref|XP_009601720.1|  PREDICTED: phospholipase A1-II 1-like              260   4e-75    
ref|XP_007208875.1|  hypothetical protein PRUPE_ppa026090mg             264   4e-75    
ref|XP_009772191.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    263   4e-75    
ref|XP_011047585.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    263   5e-75    
ref|XP_006350025.1|  PREDICTED: phospholipase A1-IIdelta-like           259   5e-75    
ref|XP_006368966.1|  hypothetical protein POPTR_0001s15300g             263   5e-75    
ref|XP_008238400.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    263   6e-75    
ref|XP_003608122.1|  Lipase                                             258   7e-75    
ref|XP_006367468.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    263   7e-75    
ref|XP_009136810.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    262   9e-75    
ref|XP_008369207.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    263   1e-74    
ref|XP_010054329.1|  PREDICTED: phospholipase A1-IIgamma-like           258   1e-74    
gb|KFK22257.1|  phospholipase a1- chloroplastic-like                    261   2e-74    
gb|EAY99121.1|  hypothetical protein OsI_21080                          258   2e-74    
ref|XP_009607511.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    261   3e-74    
ref|XP_009607510.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    261   3e-74    
ref|XP_006654823.1|  PREDICTED: phospholipase A1-II 6-like              258   3e-74    
ref|NP_567515.1|  phospholipase A1-Ibeta2                               261   3e-74    
ref|XP_008369208.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    261   3e-74    
gb|KDO63393.1|  hypothetical protein CISIN_1g014927mg                   258   4e-74    
ref|XP_010529190.1|  PREDICTED: phospholipase A1-IIgamma-like           257   7e-74    
emb|CBI29538.3|  unnamed protein product                                260   7e-74    
ref|XP_009401938.1|  PREDICTED: phospholipase A1-II 5                   258   7e-74    
ref|XP_010457749.1|  PREDICTED: phospholipase A1-IIalpha                257   8e-74    
ref|XP_002458928.1|  hypothetical protein SORBIDRAFT_03g042840          256   8e-74    
ref|XP_004303191.1|  PREDICTED: phospholipase A1-IIdelta-like           258   9e-74    
ref|XP_003611369.1|  Lipase                                             260   9e-74    
ref|XP_006468997.1|  PREDICTED: phospholipase A1-IIdelta-like           256   1e-73    
gb|KEH31635.1|  glycerolipase A1                                        259   1e-73    
ref|XP_006306316.1|  hypothetical protein CARUB_v10012192mg             256   1e-73    
ref|XP_002456791.1|  hypothetical protein SORBIDRAFT_03g042850          258   1e-73    
ref|XP_006282944.1|  hypothetical protein CARUB_v10007507mg             259   1e-73    
gb|KFK28527.1|  hypothetical protein AALP_AA7G008200                    256   1e-73    
ref|XP_002305750.2|  lipase class 3 family protein                      255   1e-73    
ref|XP_008655140.1|  PREDICTED: triacylglycerol lipase isoform X1       269   1e-73    
ref|XP_003517405.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    259   1e-73    
ref|XP_004232956.1|  PREDICTED: phospholipase A1-II 1-like              256   1e-73    
emb|CDO96757.1|  unnamed protein product                                254   1e-73    
ref|XP_006417941.1|  hypothetical protein EUTSA_v10007767mg             256   1e-73    
ref|XP_003549939.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    259   2e-73    
ref|XP_009777407.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    255   2e-73    
ref|XP_006663373.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    257   3e-73    
ref|XP_010449712.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    258   3e-73    
ref|XP_010275455.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    259   3e-73    
ref|XP_004505132.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    254   3e-73    
ref|XP_004972293.1|  PREDICTED: galactolipase DONGLE, chloroplast...    254   3e-73    
gb|AFW84290.1|  hypothetical protein ZEAMMB73_664922                    256   4e-73    



>emb|CDP09265.1| unnamed protein product [Coffea canephora]
Length=502

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/428 (76%), Positives = 369/428 (86%), Gaps = 12/428 (3%)
 Frame = +1

Query  406   GRNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKY  585
              R  +++W EIQG   WEGLL+PMNSHLR+EIIRYGEFAQACYDSFDFDPHSKYCGTCKY
Sbjct  72    SRTFNQVWREIQGCYHWEGLLDPMNSHLRQEIIRYGEFAQACYDSFDFDPHSKYCGTCKY  131

Query  586   DGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEA  765
               A FF+KL MADRGY++ RYLYATSNI+LP FFQ S+++ IWSQHANWMGYVAV  DE 
Sbjct  132   QPADFFDKLDMADRGYQMRRYLYATSNIDLPKFFQKSNMSSIWSQHANWMGYVAVTVDED  191

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTD  945
             EI+RLGRRDI+I+WRGTVTYLEWIHDLK+ LHP HFRDDP IKIESGFFDLYT   K+  
Sbjct  192   EIKRLGRRDILISWRGTVTYLEWIHDLKDFLHPAHFRDDPSIKIESGFFDLYTT--KENT  249

Query  946   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
             C +CS+SAREQ+LAEVNRLI+RY+GE LSIT+TGHSLGAALALLSAYDIAEMK+N+ +  
Sbjct  250   CKYCSFSAREQVLAEVNRLIQRYEGEELSITITGHSLGAALALLSAYDIAEMKLNITK--  307

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                    +   KIP++VFSFAGPRVGNLRFKERCDELG+KVLRIVNV DKVPTVPGII N
Sbjct  308   -------TGTKKIPITVFSFAGPRVGNLRFKERCDELGVKVLRIVNVHDKVPTVPGIITN  360

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYH  1485
             EKFQYQK +E  + +FPWSYAHVGVELALDH++SPFLK  +DLGCAHNLE HLHLVDG+H
Sbjct  361   EKFQYQKYIEEVI-SFPWSYAHVGVELALDHTHSPFLKANSDLGCAHNLEAHLHLVDGFH  419

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEA  1665
             G GR FR  T RDIALVNKDS+FLKR++GVPP+WRQDENKGMVR SDGRWV+PER R+EA
Sbjct  420   GRGRPFRLVTKRDIALVNKDSDFLKRDYGVPPKWRQDENKGMVRNSDGRWVLPERPRVEA  479

Query  1666  HPPDTGHH  1689
             HP DT HH
Sbjct  480   HPADTAHH  487



>ref|XP_011080360.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Sesamum indicum]
Length=507

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/521 (66%), Positives = 399/521 (77%), Gaps = 30/521 (6%)
 Frame = +1

Query  133   MGSLQISLKHNYHTIFAESLPPPLMNITKPTTAKPSNNSFFPLNPHYSSLKCR--VSLPA  306
             M SLQ S  ++ H I       P   ++   + K + N FFP N   S    R  +++  
Sbjct  1     MASLQSSFNNSTHKI-----QTPGQLLSSWNSTKGTRNLFFP-NKRSSIFPSRRLIAVRC  54

Query  307   AAINAPPQRETGQSSNKNdeeqeedeelcveedGRNLHEIWAEIQGSKDWEGLLNPMNSH  486
             +A++    +ET +  +  D               R L EIW EIQG  DWE LL+PMNSH
Sbjct  55    SALSGLEVQETDEELSPED--------------SRPLREIWREIQGENDWEDLLDPMNSH  100

Query  487   LRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYLYATSN  666
             LRREI+RYGE AQACYDSFDFDPHSKYCGTCKY GA FFE+LGMADRGY ++R+LYATSN
Sbjct  101   LRREIVRYGEMAQACYDSFDFDPHSKYCGTCKYQGAHFFERLGMADRGYTLTRFLYATSN  160

Query  667   INLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDL  846
             INLPNFFQ S  + IWSQHANWMGYVAVATDE EIRRLGRRDI+IAWRGTVTYLEWIHDL
Sbjct  161   INLPNFFQKSKASSIWSQHANWMGYVAVATDEEEIRRLGRRDIIIAWRGTVTYLEWIHDL  220

Query  847   KNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERYKGEN  1026
             K+IL P HFRDDP IKIESGFFDLYT   K+  C +CS+SAREQ+LAE+ R+I RY+GEN
Sbjct  221   KDILQPAHFRDDPSIKIESGFFDLYTT--KENTCKYCSFSAREQVLAELRRIIHRYRGEN  278

Query  1027  LSITVTGHslgaalallsaYDIAEMKVNVVQegegessstsaatKIPVSVFSFAGPRVGN  1206
             LSIT+TGHSLGAALALLSAYDIAEMK+N++             TKIP+SVFSF+GPRVGN
Sbjct  279   LSITITGHSLGAALALLSAYDIAEMKLNIID-----DRQEEVITKIPISVFSFSGPRVGN  333

Query  1207  LRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETTLKNFPWSYAHVGVEL  1386
             L+FKERCDELGIKVLR++NV DKVPTVPGII NEKFQYQK LE  + +FPWSYAHVGVEL
Sbjct  334   LKFKERCDELGIKVLRVINVHDKVPTVPGIITNEKFQYQKYLEEVI-SFPWSYAHVGVEL  392

Query  1387  ALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKRE  1566
             ALDH++SPFLK  +DL CAHNLE HLHLVDGYHG  +RF  A+ RDIALVNK  +FLK +
Sbjct  393   ALDHTHSPFLKRNSDLRCAHNLEAHLHLVDGYHGKNKRFCLASKRDIALVNKSCDFLKSD  452

Query  1567  HGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPPDTGHH  1689
             +GVPP W QDE+KGMVRT+DGRW +PER  IEAHPPDT HH
Sbjct  453   YGVPPYWWQDEHKGMVRTADGRWTLPERPGIEAHPPDTAHH  493



>ref|XP_002285367.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Vitis vinifera]
Length=502

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/425 (75%), Positives = 365/425 (86%), Gaps = 14/425 (3%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L ++W EIQG  +WEGLL+PMN +LR+EIIRYGEFAQACYDSFDFDPHSKYCGTCKY GA
Sbjct  76    LRDVWEEIQGCNNWEGLLDPMNPNLRKEIIRYGEFAQACYDSFDFDPHSKYCGTCKYQGA  135

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
              FF+KL MADRGY+ISRYLYATSNINLPNFFQ S ++ +WS HANWMGY+AV TDE EI+
Sbjct  136   HFFQKLDMADRGYQISRYLYATSNINLPNFFQKSKMSSVWSPHANWMGYIAVTTDEKEIK  195

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  954
             RLGRRDI+IAWRGTVTYLEWIHDLK+IL P HFRDDP+IKIESGF+DLYT  KK+ +C F
Sbjct  196   RLGRRDIIIAWRGTVTYLEWIHDLKDILCPAHFRDDPNIKIESGFYDLYT--KKENNCKF  253

Query  955   CSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegege  1134
             CS+SAREQ+LAE+ RL+ERYK E +SIT+TGHSLGAALALLSAYDIAEM +NV       
Sbjct  254   CSFSAREQVLAEIKRLVERYKDEEISITITGHSLGAALALLSAYDIAEMNLNV-------  306

Query  1135  ssstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKF  1314
                    ++IP+SVFSF+GPRVGNL+FKERCDELG+KVLR++NV DKVPTVPGII NEKF
Sbjct  307   ----RNKSRIPISVFSFSGPRVGNLKFKERCDELGVKVLRVINVHDKVPTVPGIITNEKF  362

Query  1315  QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDG  1494
             QYQK +E T+ +FPWSYAHVGVELALDH++SPFLK   DLGCAHNLE HLHLVDGYHG  
Sbjct  363   QYQKYIEETI-SFPWSYAHVGVELALDHTHSPFLKPTNDLGCAHNLEAHLHLVDGYHGKD  421

Query  1495  RRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPP  1674
             R+F  AT RDIALVNK  +FL+ E+GVP  WRQDENKGMVR SDGRWV+PER R+EAHPP
Sbjct  422   RKFSLATKRDIALVNKSCDFLRSEYGVPGNWRQDENKGMVRASDGRWVLPERPRMEAHPP  481

Query  1675  DTGHH  1689
             DT HH
Sbjct  482   DTAHH  486



>ref|XP_009801144.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Nicotiana 
sylvestris]
Length=507

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/525 (66%), Positives = 402/525 (77%), Gaps = 39/525 (7%)
 Frame = +1

Query  133   MGSLQISL---KHNYHTIFAESLPPPLMNITKPTTAKPSNNSFFP--LNPHYSS-LKCRV  294
             M S Q+SL   KH  +  F E  P          T K  N SF     +P  SS L  R 
Sbjct  1     MASFQLSLTNPKHKRNHTFREVFP------LYCKTFKAKNLSFSSKITSPKLSSDLSLRP  54

Query  295   SLPAAAINAPPQRETGQSSNKNdeeqeedeelcveedGRNLHEIWAEIQGSKDWEGLLNP  474
             S P+  I AP      Q   +                 + L+E+W EIQG K+WEGLL+P
Sbjct  55    SSPS--ILAPKNTTIQQYEEEK----------------KPLYEMWREIQGLKNWEGLLDP  96

Query  475   MNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYLY  654
             MNS+LR+EIIRYGEFAQ+CYDSFD+DPHSKYCGTCKY  + FFEKL M  +GY + RYLY
Sbjct  97    MNSNLRKEIIRYGEFAQSCYDSFDYDPHSKYCGTCKYQPSHFFEKLNMVKKGYEMRRYLY  156

Query  655   ATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEW  834
             ATSNINLPNFFQ S  + +WSQHANWMGYVAVATD  EI+RLGRRDIV+AWRGTVTYLEW
Sbjct  157   ATSNINLPNFFQKSKDSMVWSQHANWMGYVAVATDPVEIKRLGRRDIVVAWRGTVTYLEW  216

Query  835   IHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERY  1014
             +HDLK+ILHP HFRDDP+IKIESGFFDLYT  +K+  C++CS+SAREQ+LAE+NRLIE+Y
Sbjct  217   LHDLKDILHPAHFRDDPNIKIESGFFDLYT--QKENSCHYCSFSAREQILAEINRLIEKY  274

Query  1015  KGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegessstsaatKIPVSVFSFAGP  1194
             +GE +SIT+TGHSLGAALALLSAYDIAEMK+N++       +  S   +IP++VFSFAGP
Sbjct  275   EGEEVSITITGHSLGAALALLSAYDIAEMKLNILH------NGKSIIKRIPITVFSFAGP  328

Query  1195  RVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETTLKNFPWSYAHV  1374
             RVGNL+FK+RC+ELGI+VLR++NV D+VPTVPGII NEKFQ+QKQLE  + +FPWSYAHV
Sbjct  329   RVGNLKFKQRCEELGIRVLRVINVHDRVPTVPGIITNEKFQFQKQLEEIV-SFPWSYAHV  387

Query  1375  GVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNF  1554
             GVELALDH +SPFLK   DLGCAHNLE HLHLVDGYHG  R F SATGRDIALVNKDS+F
Sbjct  388   GVELALDHHHSPFLKPNNDLGCAHNLEAHLHLVDGYHGKDRAFCSATGRDIALVNKDSSF  447

Query  1555  LKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPPDTGHH  1689
             LK ++GVPP W QDENKGMVRT DGRWV+PER  IEAHPPDT HH
Sbjct  448   LKEDYGVPPLWWQDENKGMVRTPDGRWVLPERPIIEAHPPDTAHH  492



>ref|XP_004250927.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Solanum lycopersicum]
Length=504

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/495 (66%), Positives = 397/495 (80%), Gaps = 11/495 (2%)
 Frame = +1

Query  205   MNITKPTTAKPSNNSFFPLNPHYSSLKCRVSLPAAAINAPPQRETGQSSNKNdeeqeede  384
             +++T P   +  N++   + P +++ K  +S P   ++     +T    +  ++    + 
Sbjct  6     LSLTNPKHKR--NHTCLEVFPLWNTFKSNLSFPNKRLSPSLSLKTSSCLSNLEDNNTIEL  63

Query  385   elcveedGRNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSK  564
             +   EE+ + LHE+W EIQG  +W+GLL+PM+ HLR+EIIRYGEFAQ+CYDSFD+DPHSK
Sbjct  64    QQYDEEEKKPLHEMWREIQGCNNWKGLLDPMDCHLRKEIIRYGEFAQSCYDSFDYDPHSK  123

Query  565   YCGTCKYDGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYV  744
             YCGTCKY  +QFF+K+ M  +GY + RYLYATSNINLPNFFQ S +  +WSQHANWMGYV
Sbjct  124   YCGTCKYQPSQFFDKINMLKKGYEMKRYLYATSNINLPNFFQKSKMRNVWSQHANWMGYV  183

Query  745   AVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYT  924
             AVATD  EI+RLGRRDIV+AWRGTVTYLEWIHDL++ILHP HFRDDP+IKIE+GFFD+YT
Sbjct  184   AVATDPEEIKRLGRRDIVVAWRGTVTYLEWIHDLQDILHPAHFRDDPNIKIETGFFDMYT  243

Query  925   NSKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMK  1104
               KK+ +C++ S+SAREQ+LAE+NRLIE+Y+GE LSIT+TGHSLGAALALLSAYDIAEMK
Sbjct  244   --KKENNCHYASFSAREQILAEINRLIEKYQGEELSITITGHSLGAALALLSAYDIAEMK  301

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
             +N++  G+  +        IP++VFSFAGPRVGNL+FKERC+ELGIKVLR+VNV DKVP 
Sbjct  302   LNILHNGKSITKI------IPITVFSFAGPRVGNLKFKERCEELGIKVLRVVNVHDKVPK  355

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
             VPGIIANEKFQ+QKQLE    +F WSYAHVG ELALDH  SPFLK  +DLG AHNLE HL
Sbjct  356   VPGIIANEKFQFQKQLEEKF-SFAWSYAHVGAELALDHHRSPFLKPNSDLGSAHNLEAHL  414

Query  1465  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1644
             HLVDGYHG  R FRSAT RD+ALVNKDS+FLK E+GVPP W QDENKGMVRTSDG+WV+P
Sbjct  415   HLVDGYHGKVRAFRSATSRDVALVNKDSSFLKEEYGVPPFWWQDENKGMVRTSDGQWVLP  474

Query  1645  ERSRIEAHPPDTGHH  1689
             ER  IEAHPPDT HH
Sbjct  475   ERPIIEAHPPDTAHH  489



>ref|XP_007015095.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY32714.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=508

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/427 (74%), Positives = 362/427 (85%), Gaps = 10/427 (2%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L +IW EIQG  DW+GLL+PMN HLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY 
Sbjct  75    RPLCQIWKEIQGCNDWDGLLDPMNPHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYQ  134

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
             GA FFEKLGMADRGY+ISRYLYATSNINLPNFFQ S+++ +WS HANWMGYVAV TDE E
Sbjct  135   GAHFFEKLGMADRGYQISRYLYATSNINLPNFFQKSNLSSVWSTHANWMGYVAVCTDEDE  194

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
             I+RLGRRDIVI+WRGTVTYLEWI+DLK+ILH  +F  DP IK+E GF+DLYT  KK+  C
Sbjct  195   IKRLGRRDIVISWRGTVTYLEWIYDLKDILHQANFTKDPSIKMELGFYDLYT--KKENAC  252

Query  949   NFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
             N+CS+SAREQ+LAE+ RL+E Y GE +SIT+TGHSLGAALAL++AYDIAE+ +N+V+   
Sbjct  253   NYCSFSAREQVLAEIKRLLEYYDGEEISITITGHSLGAALALITAYDIAELGLNLVE---  309

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1308
                     + K+P++V+SFAGPRVGNL+FKERCDELG+KVLR VNV DKVPTVPGI ANE
Sbjct  310   ----EGELSNKVPITVYSFAGPRVGNLKFKERCDELGVKVLRAVNVHDKVPTVPGIFANE  365

Query  1309  KFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1488
             K Q+QK LE  + +FPWSYAHVGVELALDH+ SPFLK+  DL CAHNLE HLHL+DGYHG
Sbjct  366   KLQFQKYLEEAV-SFPWSYAHVGVELALDHTCSPFLKSTNDLACAHNLEAHLHLLDGYHG  424

Query  1489  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAH  1668
              GRRF  A  RDIALVNKDSNFLK ++GVPP WRQDENKGMVR SDGRWV+PER R+EAH
Sbjct  425   KGRRFCLANKRDIALVNKDSNFLKSDYGVPPYWRQDENKGMVRNSDGRWVLPERPRVEAH  484

Query  1669  PPDTGHH  1689
             P D  HH
Sbjct  485   PHDISHH  491



>ref|XP_009622048.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase A1-Igamma3, chloroplastic 
[Nicotiana tomentosiformis]
Length=505

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/425 (75%), Positives = 366/425 (86%), Gaps = 10/425 (2%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L+EIW EIQG  +WEGLL+PMNS+LR+EIIRYGEFAQ+CYDSFD+DPHSKYCGTCKY  +
Sbjct  76    LYEIWREIQGCNNWEGLLDPMNSNLRKEIIRYGEFAQSCYDSFDYDPHSKYCGTCKYQPS  135

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
              FFEKL M  +GY++ RYLYATSNINLPNFFQ S    +W +HANWMGYVAVATD  EI+
Sbjct  136   HFFEKLNMVKKGYKMRRYLYATSNINLPNFFQKSKX-IVWFEHANWMGYVAVATDPDEIK  194

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  954
             RLGRRDIV+AWRGTVTYLEWIHDLK+ILHP HFRDDP+IKIESGFFDLYT ++K+  C++
Sbjct  195   RLGRRDIVVAWRGTVTYLEWIHDLKDILHPAHFRDDPNIKIESGFFDLYTQNEKN--CHY  252

Query  955   CSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegege  1134
             CS+SAREQ+LAE+NRLIE+Y+GE LSIT+TGHSLGAALALLSAYDIAEMK+N++  G+  
Sbjct  253   CSFSAREQILAEINRLIEKYEGEELSITITGHSLGAALALLSAYDIAEMKLNILHNGKSM  312

Query  1135  ssstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKF  1314
                     +IP++VFSFAGPRVGNL+FKERC+ LGI+VLR++NV DKVP VPGII NEKF
Sbjct  313   IK------RIPITVFSFAGPRVGNLKFKERCEVLGIRVLRVINVHDKVPKVPGIITNEKF  366

Query  1315  QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDG  1494
             Q+QKQLE T+ +FPWSYAHVGVE ALDH +SPFLK   DLGCAHNLE HLH VDGYHG  
Sbjct  367   QFQKQLEETI-SFPWSYAHVGVEFALDHHHSPFLKPNGDLGCAHNLEAHLHFVDGYHGKD  425

Query  1495  RRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPP  1674
             R F SATGRD+ALVNKDSNFLK ++GVPP W QDENKGMVRT DGRWV+PER  IEAHPP
Sbjct  426   RAFCSATGRDVALVNKDSNFLKEDYGVPPLWWQDENKGMVRTPDGRWVLPERPIIEAHPP  485

Query  1675  DTGHH  1689
             DT HH
Sbjct  486   DTAHH  490



>ref|XP_010246745.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Nelumbo 
nucifera]
Length=507

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/427 (74%), Positives = 364/427 (85%), Gaps = 10/427 (2%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             ++L EIW EIQG  DWEGLL+P N  LR+EIIRYGEFAQACYDSFDFDP SKYCGTCKY 
Sbjct  74    KSLREIWQEIQGCNDWEGLLDPTNPVLRKEIIRYGEFAQACYDSFDFDPRSKYCGTCKYQ  133

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
             GA FF+KL M + GY++SRY+YAT+NINLPNFFQ + ++ +WS HANWMGYVAVATDE E
Sbjct  134   GAHFFQKLYMTNLGYQVSRYVYATTNINLPNFFQKAKISSVWSPHANWMGYVAVATDEQE  193

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
             I+RLGRRDI++AWRGTVTYLEWIHDLK+ILHP  F DDP IKIESGFFDLYT  KK+  C
Sbjct  194   IKRLGRRDILVAWRGTVTYLEWIHDLKDILHPARFGDDPSIKIESGFFDLYT--KKEHKC  251

Query  949   NFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
             N+CS+SAREQ+LAE+ RL+ERYKGE LSIT+TGHSLGAALALLSAYDIAEMK+N+     
Sbjct  252   NYCSFSAREQILAEIKRLVERYKGEELSITITGHSLGAALALLSAYDIAEMKLNI-----  306

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1308
                 S     +IP++VFSFAGPRVGNL+FKERCDELG+KVLR++NV DKVPTVPG+IANE
Sbjct  307   --GDSGHIQARIPITVFSFAGPRVGNLKFKERCDELGVKVLRVINVHDKVPTVPGVIANE  364

Query  1309  KFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1488
             KFQ+QK +E  + +FPWSYAHVG+ELALDH++SPFLK   DL CAHNLE HLHLVDGYHG
Sbjct  365   KFQFQKYMEEVM-SFPWSYAHVGLELALDHTHSPFLKPTFDLFCAHNLEVHLHLVDGYHG  423

Query  1489  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAH  1668
               RRF  AT RDIALVNK  +FL+ ++GVPP WRQDENKGMVRT+DGRW++PER R+EAH
Sbjct  424   KERRFCLATKRDIALVNKSCDFLRVDYGVPPFWRQDENKGMVRTTDGRWILPERPRMEAH  483

Query  1669  PPDTGHH  1689
             PPDT HH
Sbjct  484   PPDTAHH  490



>ref|XP_007211838.1| hypothetical protein PRUPE_ppa004631mg [Prunus persica]
 gb|EMJ13037.1| hypothetical protein PRUPE_ppa004631mg [Prunus persica]
Length=499

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/428 (74%), Positives = 363/428 (85%), Gaps = 8/428 (2%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNP-MNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKY  585
             R LHEIW EIQG  +WEGLL+P +NSHLR+EIIRYGEFAQACYDSFDFDPHSKYCGTCKY
Sbjct  64    RPLHEIWKEIQGLNNWEGLLDPTLNSHLRQEIIRYGEFAQACYDSFDFDPHSKYCGTCKY  123

Query  586   DGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEA  765
              GA FFE L MADRGY+ISRYLYATSNINLPNFFQ S +  +WS+HANWMG+VAVATD  
Sbjct  124   QGAHFFENLDMADRGYQISRYLYATSNINLPNFFQKSKLGSVWSRHANWMGFVAVATDPD  183

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTD  945
             +I+RLGRRDIVIAWRGTVTYLEWI+DLK+ILHP  FR+DP IKIESGF+DLYT  KK+ +
Sbjct  184   QIKRLGRRDIVIAWRGTVTYLEWIYDLKDILHPAQFRNDPSIKIESGFYDLYT--KKEDE  241

Query  946   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
             C FCS+SAREQLLAEV RL E Y+GE +SIT+TGHSLGAALA+LSAYDIAEM +N+V   
Sbjct  242   CRFCSFSAREQLLAEVKRLRELYQGEEISITITGHSLGAALAILSAYDIAEMGLNIVH--  299

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
               +      +TKIP++V+SF+GPRVGNLRFKERCDELG+KVLR+VNV DKVP VPGII N
Sbjct  300   --DGHHELESTKIPITVYSFSGPRVGNLRFKERCDELGVKVLRVVNVHDKVPRVPGIITN  357

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYH  1485
             EKF++QK +E T+  FPWSYAHVGV L LDH+ SPFLK   D GCAHNLE HLHLVDGYH
Sbjct  358   EKFRFQKYIEDTIA-FPWSYAHVGVALELDHNQSPFLKPTNDFGCAHNLEAHLHLVDGYH  416

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEA  1665
             G G++F   T RDIALVNK  +FL+ E+GVPP WRQDENKGMVR+ DGRWV+PER R+EA
Sbjct  417   GKGQKFCLVTKRDIALVNKSCDFLRAEYGVPPHWRQDENKGMVRSKDGRWVLPERPRVEA  476

Query  1666  HPPDTGHH  1689
             HPPDT HH
Sbjct  477   HPPDTAHH  484



>ref|XP_008227339.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Prunus mume]
Length=517

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/428 (74%), Positives = 365/428 (85%), Gaps = 8/428 (2%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNP-MNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKY  585
             R LHEIW EIQG  +WEGLL+P +NSHLR+EIIRYGEFAQACYDSFDFDPHSKYCGTCKY
Sbjct  82    RPLHEIWKEIQGLNNWEGLLDPTLNSHLRQEIIRYGEFAQACYDSFDFDPHSKYCGTCKY  141

Query  586   DGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEA  765
              GA+FFE L MADRGY+ISRYLYATSNINLPNFFQ S +  +WS+HANWMG+VAVATD  
Sbjct  142   QGARFFENLDMADRGYQISRYLYATSNINLPNFFQKSKLGSVWSRHANWMGFVAVATDPY  201

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTD  945
             +I+RLGRRDIVIAWRGTVTYLEWI+DLK+ILHP  FR+DP IKIESGF+DLYT  KK+ +
Sbjct  202   QIKRLGRRDIVIAWRGTVTYLEWIYDLKDILHPAQFRNDPSIKIESGFYDLYT--KKEDE  259

Query  946   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
             C FCS+SAREQLLAEV RL E Y+GE +SIT+TGHSLGAALA+LSAYDIAEM +N+V   
Sbjct  260   CRFCSFSAREQLLAEVKRLRELYQGEEISITITGHSLGAALAILSAYDIAEMGLNIVH--  317

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
               E      +TKIP++V+SF+GPRVGNLRFKERCD+LG+KVLR+VNV DKVP VPGII N
Sbjct  318   --EGHHELESTKIPITVYSFSGPRVGNLRFKERCDKLGVKVLRVVNVHDKVPRVPGIITN  375

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYH  1485
             EKF++QK +E T+  FPWSYAHVGVEL LDH+ SPFLK   D GCAHNLE HLHLVDGYH
Sbjct  376   EKFRFQKYIEDTIA-FPWSYAHVGVELELDHNQSPFLKPTNDFGCAHNLEAHLHLVDGYH  434

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEA  1665
             G G++F   T RDIALVNK  +FL+ E+GVPP WRQDENKGMVR+ DGRWV+PER ++EA
Sbjct  435   GKGQKFCLVTKRDIALVNKSCDFLRAEYGVPPHWRQDENKGMVRSKDGRWVLPERPKVEA  494

Query  1666  HPPDTGHH  1689
             HPPDT HH
Sbjct  495   HPPDTAHH  502



>ref|XP_002313345.2| hypothetical protein POPTR_0009s05660g [Populus trichocarpa]
 gb|EEE87300.2| hypothetical protein POPTR_0009s05660g [Populus trichocarpa]
Length=508

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/507 (64%), Positives = 391/507 (77%), Gaps = 38/507 (7%)
 Frame = +1

Query  193   PPPL-------MNITKPTTAKPSNNSFFPLNPHYSSLKCRVSLPAAAINAPPQRETGQSS  351
             PPPL        N+ KP +    N    P +P+ ++LK + S  ++A+  P   ET  + 
Sbjct  15    PPPLSKGLLPRYNLNKPKSLSLLNK---PFSPNSTTLKIKGSSVSSAL-TPQLNETLVNQ  70

Query  352   NKNdeeqeedeelcveedGRNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQAC  531
                                R L EIW EIQG  DWEGLL+PMNSHLR+EIIRYGEFAQA 
Sbjct  71    EDE----------------RPLSEIWKEIQGCNDWEGLLDPMNSHLRKEIIRYGEFAQAS  114

Query  532   YDSFDFDPHSKYCGTCKYDGAQFFEKLGMADR-GYRISRYLYATSNINLPNFFQHSSVNR  708
             YDSFDFDPHSKYCG+CKY GAQFFEKL M     Y+ISRYLYATSNINLPNFFQ S ++R
Sbjct  115   YDSFDFDPHSKYCGSCKYRGAQFFEKLDMQGHVNYQISRYLYATSNINLPNFFQKSKLSR  174

Query  709   IWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD  888
             +WS HANWMGYVAV T+E EI+RLGRRDIV+AWRGTVTYLEWI+DLK+IL   +F +DP 
Sbjct  175   VWSTHANWMGYVAVTTNEEEIKRLGRRDIVVAWRGTVTYLEWIYDLKDILCVANFTNDPS  234

Query  889   IKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaal  1068
             IKIE GF+DLYT  KK+  C +C++SAREQ+LAE+ RL++ Y+GE +SIT+TGHSLGAAL
Sbjct  235   IKIELGFYDLYT--KKENSCKYCTFSAREQVLAEIKRLLDYYRGEEISITITGHSLGAAL  292

Query  1069  allsaYDIAEMKVNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKV  1248
             A LSAYDIAEM++N + +GE  +       +IP++V+SF+GPRVGNL+FKERCDELG+KV
Sbjct  293   ATLSAYDIAEMRLNYMDDGEYRT-------RIPITVYSFSGPRVGNLKFKERCDELGVKV  345

Query  1249  LRIVNVRDKVPTVPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGT  1428
             LR++NVRDKVPTVPGIIANEK Q+QK +E  + +FPWSYAHVGVELALDH++SPFLK   
Sbjct  346   LRVINVRDKVPTVPGIIANEKLQFQKYIEDNM-SFPWSYAHVGVELALDHTHSPFLKPTK  404

Query  1429  DLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKG  1608
             DLGCAHNLE HLHLVDGYHG G+RF  AT RDIALVNK  +FL+RE+GVPP WRQDENKG
Sbjct  405   DLGCAHNLEAHLHLVDGYHGKGQRFCLATKRDIALVNKSCDFLRREYGVPPYWRQDENKG  464

Query  1609  MVRTSDGRWVVPERSRIEAHPPDTGHH  1689
             MVR +DGRWV+PER R +AHP DT HH
Sbjct  465   MVRNADGRWVLPERPRADAHPADTAHH  491



>ref|XP_010031778.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Eucalyptus 
grandis]
Length=524

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/427 (73%), Positives = 361/427 (85%), Gaps = 11/427 (3%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L ++W EIQG   WEGLL+PMNSH+R+EIIRYGEFAQACYDSFDFDP+SKYCGTCKY 
Sbjct  94    RPLSQVWREIQGCNHWEGLLDPMNSHVRQEIIRYGEFAQACYDSFDFDPNSKYCGTCKYQ  153

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
             G+QFFEKLGM   GY+ISRYLYATSNINLPNFFQHS ++++WS +ANWMGY+AV TDE E
Sbjct  154   GSQFFEKLGMNHFGYQISRYLYATSNINLPNFFQHSRLSKVWSTYANWMGYIAVTTDEEE  213

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
             IRRLGRRDIVIAWRGTVTYLEWI+DLK+ILHP HF+DDP IKIE+GF+DLYT  KK+  C
Sbjct  214   IRRLGRRDIVIAWRGTVTYLEWIYDLKDILHPAHFKDDPTIKIEAGFYDLYT--KKEKSC  271

Query  949   NFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
             +FCS+SAREQ+LAEV RL++ Y+ E +SIT+TGHSLGAALA++SAYDIAEM VNVV    
Sbjct  272   HFCSFSAREQILAEVKRLLDYYRDEEISITITGHSLGAALAIISAYDIAEMGVNVVN---  328

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1308
                       K+P++V+SFAGPRVGNL+FKERCDELG+KVLR+ NV D VPTVPGIIANE
Sbjct  329   ----DGGEMKKVPITVYSFAGPRVGNLKFKERCDELGVKVLRLTNVHDMVPTVPGIIANE  384

Query  1309  KFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1488
             K Q+QK LE TL +FPWSYAHVG ELALD ++SPFLK+  D  CAHNLE  LHLVDGYHG
Sbjct  385   KMQFQKYLEETL-SFPWSYAHVGTELALDQTHSPFLKSTNDPSCAHNLEALLHLVDGYHG  443

Query  1489  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAH  1668
             +GRRF+  T RDIALVNK  +FLK E+GVPP WRQDENKGMVR+SDGRWVVPER  ++AH
Sbjct  444   EGRRFKLVTRRDIALVNKSCDFLKGEYGVPPCWRQDENKGMVRSSDGRWVVPER-LVDAH  502

Query  1669  PPDTGHH  1689
               DT HH
Sbjct  503   RSDTAHH  509



>gb|KDP22109.1| hypothetical protein JCGZ_25940 [Jatropha curcas]
Length=501

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/427 (71%), Positives = 357/427 (84%), Gaps = 13/427 (3%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L +IW EIQG  DWEGLL+PMNSHLR+EIIRYGEFAQ CYDSFDFDPHSKYCGTCKY 
Sbjct  76    RPLSQIWKEIQGCNDWEGLLDPMNSHLRKEIIRYGEFAQTCYDSFDFDPHSKYCGTCKYQ  135

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
             GA FF+KL M   GY+ISRYLYATSNINLPNFFQ S ++ +WS HANWMGYVAV+TDE E
Sbjct  136   GAHFFDKLDMQGHGYQISRYLYATSNINLPNFFQKSKLSSVWSIHANWMGYVAVSTDEEE  195

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
             I+RLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F +DP IKIE GF+DLYT  KK+  C
Sbjct  196   IQRLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFTNDPSIKIELGFYDLYT--KKENSC  253

Query  949   NFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
              +C++SAREQ+LAE+ RL++ Y+GE +SIT+TGHSLGAALA+LSAYDIAEMKVN +    
Sbjct  254   KYCTFSAREQVLAEIKRLLDYYRGEEISITITGHSLGAALAILSAYDIAEMKVNYMD---  310

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1308
                      TKIP++V+SF+GPRVGNL+FKERC+EL +KVLR++NV DKVP VPGI ANE
Sbjct  311   -------DKTKIPITVYSFSGPRVGNLKFKERCEELDVKVLRVINVHDKVPKVPGIFANE  363

Query  1309  KFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1488
             KFQ+QK +E T+ +FPWSYAHVGVELALDH++SPFL+   DLGCAHNLE HLHLVDGYHG
Sbjct  364   KFQFQKYVEETM-SFPWSYAHVGVELALDHTHSPFLRPTNDLGCAHNLEVHLHLVDGYHG  422

Query  1489  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAH  1668
              GR+F  AT RDIALVNK  +FL+ E+GVPP WRQDENKGM+R  +GRWVVP+R R+EAH
Sbjct  423   KGRKFVLATKRDIALVNKSCDFLRSEYGVPPHWRQDENKGMIRNREGRWVVPDRPRVEAH  482

Query  1669  PPDTGHH  1689
               DT HH
Sbjct  483   RADTAHH  489



>ref|XP_011032046.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Populus euphratica]
Length=508

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/504 (64%), Positives = 387/504 (77%), Gaps = 32/504 (6%)
 Frame = +1

Query  193   PPPLMNITKP--TTAKPSNNSFF--PLNPHYSSLKCRVSLPAAAINAPPQRETGQSSNKN  360
             PPPL     P    +KP + S    P +P+  +LK + S  ++A+  P   ET  +    
Sbjct  15    PPPLSKGLLPRYNPSKPKSLSLLNKPFSPNSKTLKIKGSSVSSAL-TPQLYETLVNQEDE  73

Query  361   deeqeedeelcveedGRNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDS  540
                             R L EIW EIQG  DWEGLL+PMNSHLR+EIIRYGEFAQA YDS
Sbjct  74    ----------------RPLSEIWKEIQGCNDWEGLLDPMNSHLRKEIIRYGEFAQASYDS  117

Query  541   FDFDPHSKYCGTCKYDGAQFFEKLGMADR-GYRISRYLYATSNINLPNFFQHSSVNRIWS  717
             FDFDPHSKYCG+CKY GAQFFEKL M     Y+ISRYLYATSNINLPNFFQ S ++R+WS
Sbjct  118   FDFDPHSKYCGSCKYRGAQFFEKLDMQGHVKYQISRYLYATSNINLPNFFQKSKLSRVWS  177

Query  718   QHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKI  897
              HANWMGYVAV T+E EI+RLGRRDIV+AWRGTVTYLEWI+DLK+IL   +F +DP IKI
Sbjct  178   THANWMGYVAVTTNEEEIKRLGRRDIVVAWRGTVTYLEWIYDLKDILCVANFTNDPSIKI  237

Query  898   ESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalall  1077
             E GF+DLYT  KK+  C +C++SAREQ+LAE+ RL++ Y+GE +SIT+TGHSLGAALA L
Sbjct  238   ELGFYDLYT--KKENSCKYCTFSAREQVLAEIKRLLDYYRGEEISITITGHSLGAALATL  295

Query  1078  saYDIAEMKVNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRI  1257
             SAYDIAEM++N + +GE  +       KIP++V+SF+GPRVGNL+FKERCDELG+KVLR+
Sbjct  296   SAYDIAEMRLNYMDDGEYRT-------KIPITVYSFSGPRVGNLKFKERCDELGVKVLRV  348

Query  1258  VNVRDKVPTVPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLG  1437
             +NV D VP VPG+IANEK Q+Q+ +E  + +FPWSYAHVGVELALDH++SPFLK   DLG
Sbjct  349   INVHDMVPNVPGMIANEKLQFQRYIEDNM-SFPWSYAHVGVELALDHTHSPFLKPTKDLG  407

Query  1438  CAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVR  1617
             CAHNLE HLHLVDGYHG G+RF  AT RDIALVNK  +FL+RE+GVPP WRQDENKGMVR
Sbjct  408   CAHNLEAHLHLVDGYHGKGQRFCLATKRDIALVNKSCDFLRREYGVPPYWRQDENKGMVR  467

Query  1618  TSDGRWVVPERSRIEAHPPDTGHH  1689
              +DGRW++PER R +AHP DT HH
Sbjct  468   NADGRWILPERPRADAHPADTAHH  491



>gb|EYU31376.1| hypothetical protein MIMGU_mgv1a004679mg [Erythranthe guttata]
Length=515

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/427 (73%), Positives = 354/427 (83%), Gaps = 8/427 (2%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             + L EIW EIQG  +WE LL PMN  LR+EIIRYGE AQACYDSFDFDP+SKYCGTCKY+
Sbjct  82    KQLDEIWMEIQGCNNWENLLEPMNPLLRQEIIRYGEMAQACYDSFDFDPNSKYCGTCKYE  141

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
             GA FFE++G++ RGY ++RYLYATSNINLPNFFQ S ++ +WSQHANWMGYVAVATDEAE
Sbjct  142   GANFFERVGLSGRGYTLTRYLYATSNINLPNFFQKSKISSVWSQHANWMGYVAVATDEAE  201

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
             IRRLGRRDI +AWRGTVTYLEWIHDLK+ILHP HFR DP IKIESGFFDLYT+  K++ C
Sbjct  202   IRRLGRRDITVAWRGTVTYLEWIHDLKDILHPAHFRADPSIKIESGFFDLYTS--KESSC  259

Query  949   NFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
              +CS+SAREQ+LAEV RLI RY+GE LSIT+TGHSLGAALALLSAYD+AEMK+N+     
Sbjct  260   EYCSFSAREQVLAEVRRLIHRYRGEKLSITITGHSLGAALALLSAYDMAEMKLNLT----  315

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1308
                    A +KIP++VFSFAGPRVGNL+FKERCD LGIKVLR+VN  DKVP +PGII NE
Sbjct  316   -GDHGDDAVSKIPLTVFSFAGPRVGNLKFKERCDYLGIKVLRVVNAHDKVPKMPGIITNE  374

Query  1309  KFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1488
             KF +Q+ +E  L +FPWSYAHVGVELALDH+ SPFLK   DL  AHNLE HLHL+DGYHG
Sbjct  375   KFPHQRYIEDKL-SFPWSYAHVGVELALDHTRSPFLKKTGDLRDAHNLEAHLHLLDGYHG  433

Query  1489  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAH  1668
                 FRSA GRDIALVNK   FLK E  VPP W QDE+KGMVRT DGRWV+PER R+E+H
Sbjct  434   KDGEFRSAGGRDIALVNKSCGFLKSECEVPPNWWQDEHKGMVRTGDGRWVLPERPRVESH  493

Query  1669  PPDTGHH  1689
             PPDT HH
Sbjct  494   PPDTAHH  500



>ref|XP_010102366.1| Phospholipase A1-Igamma3 [Morus notabilis]
 gb|EXB93327.1| Phospholipase A1-Igamma3 [Morus notabilis]
Length=547

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/427 (72%), Positives = 357/427 (84%), Gaps = 13/427 (3%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L EIW EIQGS DWEGL++P+NS LRREIIRYGEFAQACYDSFDFDP+SKYCGTCKY 
Sbjct  106   RPLREIWREIQGSNDWEGLVDPLNSCLRREIIRYGEFAQACYDSFDFDPNSKYCGTCKYP  165

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
             GA FFEKL MADRGY+ISRYLYATSNINLPNFFQ S ++ +WSQHANWMGYVAV+TDE E
Sbjct  166   GAHFFEKLEMADRGYKISRYLYATSNINLPNFFQRSKMSSVWSQHANWMGYVAVSTDEDE  225

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
             IRRLGRRDIVIAWRGTVTYLEWI DLK+IL    F  DP +KIESGF+DLYT  KK+  C
Sbjct  226   IRRLGRRDIVIAWRGTVTYLEWICDLKDILRSADFGPDPTVKIESGFYDLYT--KKERGC  283

Query  949   NFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
              +CS+SAREQ+LAE+ RL++ Y+GE +SITVTGHSLG+ALA+LSAYD+AE+ +NVV    
Sbjct  284   KYCSFSAREQVLAEIKRLLDYYEGEEISITVTGHSLGSALAILSAYDMAEVGLNVV----  339

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1308
                   ++  K+P++V+SFAGPRVGNL+FK RCDELGIKVLR+VNV D VPTVPGIIANE
Sbjct  340   ------ASGKKVPITVYSFAGPRVGNLKFKGRCDELGIKVLRVVNVHDVVPTVPGIIANE  393

Query  1309  KFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1488
             K Q+QK +E T+ +FPWSYAHVGVEL LD S+SPFLK   D GCAHNLE HLHLVDGYHG
Sbjct  394   KRQFQKYIEETM-SFPWSYAHVGVELRLDQSHSPFLKPTKDPGCAHNLEVHLHLVDGYHG  452

Query  1489  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAH  1668
              G+RF   T RDIALVNK+ + L+ E+GVP +WRQDENKGMVR +DGRWV+PER R+E H
Sbjct  453   KGKRFCLETKRDIALVNKNCDLLRSEYGVPSQWRQDENKGMVRNTDGRWVLPERPRLEGH  512

Query  1669  PPDTGHH  1689
             PPD   H
Sbjct  513   PPDMAEH  519



>ref|XP_010673678.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=514

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/428 (71%), Positives = 356/428 (83%), Gaps = 10/428 (2%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L EIW +IQG  DWEGLL+PMNSHLRRE++RYGEFAQ+CYDSFDFDPHS+YCG+CKY 
Sbjct  79    RLLREIWRDIQGRNDWEGLLDPMNSHLRREVLRYGEFAQSCYDSFDFDPHSRYCGSCKYP  138

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSS-VNRIWSQHANWMGYVAVATDEA  765
              A+FFEK+ M+  GY I RYLYATSNINL  FFQ SS +  IWS HANWMGYVAV +DE 
Sbjct  139   RAEFFEKMDMSHYGYDICRYLYATSNINLEKFFQKSSSIRSIWSPHANWMGYVAVTSDEE  198

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTD  945
             EI+RLGRRDI+I WRGTVTYLEWIHDLKNIL P HFRD+P I+IESGF+DLYT   K+ +
Sbjct  199   EIKRLGRRDILITWRGTVTYLEWIHDLKNILRPAHFRDNPHIQIESGFYDLYTT--KEEN  256

Query  946   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
             C +CS+SAREQ+LAEV RL+ER+KGE LSITVTGHSLG ALALL AYDIAEM +N+ ++ 
Sbjct  257   CKYCSFSAREQVLAEVKRLVERFKGEKLSITVTGHSLGGALALLCAYDIAEMSLNIGRDE  316

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
             +          K+P++VFSFA PRVGNL+FKERCDELG+K LRI+NV D++PT+PG+IAN
Sbjct  317   KNHLK------KLPITVFSFASPRVGNLKFKERCDELGVKQLRIINVHDRIPTMPGLIAN  370

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYH  1485
             EK + QK LE  + +FPWSYAHVG ELAL+H++SPFLK  TDL CAHNLE HLHL+DGYH
Sbjct  371   EKNKLQKYLEDKV-HFPWSYAHVGNELALNHTHSPFLKPATDLSCAHNLEAHLHLIDGYH  429

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEA  1665
             G GR+F   T RDIALVNKDSNFLK E+ VPPRWRQD NKGMVR S+GRWVVP+R+R+E 
Sbjct  430   GKGRKFSLVTKRDIALVNKDSNFLKNEYEVPPRWRQDYNKGMVRNSEGRWVVPDRARVEH  489

Query  1666  HPPDTGHH  1689
             HPPDT HH
Sbjct  490   HPPDTAHH  497



>ref|XP_010269807.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like, partial 
[Nelumbo nucifera]
Length=488

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/425 (72%), Positives = 359/425 (84%), Gaps = 10/425 (2%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L ++W EIQG  DWEGLL+PM+  LR+EIIRYGEFAQA YDSFDF+PHSKYCGTCK+ GA
Sbjct  59    LRDVWQEIQGCNDWEGLLDPMDPVLRKEIIRYGEFAQASYDSFDFNPHSKYCGTCKFQGA  118

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
              FFE+L MA+ GY+ISRYLYATSNI+LPNFFQ + ++++WS HANWMGYVAVATDE EI 
Sbjct  119   HFFERLHMANLGYQISRYLYATSNISLPNFFQKAKISKVWSPHANWMGYVAVATDEKEIV  178

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  954
             R GRRDIVIAWRGTVTYLEWIHDLK+IL P  F  DP IKIESGF DLYT  K+   CN+
Sbjct  179   RSGRRDIVIAWRGTVTYLEWIHDLKDILRPACFGGDPSIKIESGFLDLYTTKKQ--GCNY  236

Query  955   CSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegege  1134
             C++SA EQ+LAE+ RL+ERYKG+ LSIT+TGHSLGAALALLSAYD+AEMK++V +     
Sbjct  237   CTFSAXEQVLAEIKRLVERYKGDELSITITGHSLGAALALLSAYDVAEMKLDVRR-----  291

Query  1135  ssstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKF  1314
               +  + T+IPV+VFSF+GPRVGNL+FKE CDELGIKVLR++NV DKVPTVPG+IANEK 
Sbjct  292   --NGHSQTRIPVTVFSFSGPRVGNLKFKEMCDELGIKVLRVINVHDKVPTVPGVIANEKS  349

Query  1315  QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDG  1494
             Q+QK +E  + +FPWSYAHVGVE+ALDH+ SPFLK+  DL CAHNLE HLHLVDGYHG G
Sbjct  350   QFQKYIEKVI-SFPWSYAHVGVEIALDHTNSPFLKSTFDLSCAHNLEAHLHLVDGYHGKG  408

Query  1495  RRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPP  1674
             RRF  A  RDIALVNK S+FL+ ++GVPP W QDENKGMVR+SDGRWV+PER R+EAHPP
Sbjct  409   RRFCLANKRDIALVNKSSDFLREDYGVPPHWLQDENKGMVRSSDGRWVLPERPRMEAHPP  468

Query  1675  DTGHH  1689
             DT +H
Sbjct  469   DTAYH  473



>emb|CAN83233.1| hypothetical protein VITISV_005768 [Vitis vinifera]
Length=467

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/425 (69%), Positives = 334/425 (79%), Gaps = 49/425 (12%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L ++W EIQG  DWEGLL+PMN +LR+EIIRYGEFAQACYDSFDFDPHSKYCGTCKY GA
Sbjct  76    LRDVWEEIQGCNDWEGLLDPMNPNLRKEIIRYGEFAQACYDSFDFDPHSKYCGTCKYQGA  135

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
              FF+KL MADRGY+ISRYLYATSNINLPNFFQ S ++ +WS HANWMGY+AV TDE EI+
Sbjct  136   HFFQKLDMADRGYQISRYLYATSNINLPNFFQKSKMSSVWSPHANWMGYIAVTTDEKEIK  195

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  954
             RLGRRDI+IAWRGTVTYLEWIHDLK+IL P HFRDDP+IKIESGF+DLYT  KK+ +C F
Sbjct  196   RLGRRDIIIAWRGTVTYLEWIHDLKDILCPAHFRDDPNIKIESGFYDLYT--KKENNCKF  253

Query  955   CSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegege  1134
             CS+SAREQ+LAE+ RL+ER K                                       
Sbjct  254   CSFSAREQVLAEIKRLVERNKS--------------------------------------  275

Query  1135  ssstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKF  1314
                     +IP+SVFSF+GPRVGNL+FKERCDELG+KVLR++NV DKVPTVPGII NEKF
Sbjct  276   --------RIPISVFSFSGPRVGNLKFKERCDELGVKVLRVINVHDKVPTVPGIITNEKF  327

Query  1315  QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDG  1494
             QYQK +E T+ +FPWSYAHVGVELALDH++SPFLK   DLGCAHNLE HLHLVDGYHG  
Sbjct  328   QYQKYIEETI-SFPWSYAHVGVELALDHTHSPFLKPTNDLGCAHNLEAHLHLVDGYHGKD  386

Query  1495  RRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPP  1674
             R+F  AT RDIALVNK  +FL+ E+GVP  WRQDENKGMVR SDGRWV+PER R+EAHPP
Sbjct  387   RKFSLATKRDIALVNKSCDFLRSEYGVPGNWRQDENKGMVRASDGRWVLPERPRMEAHPP  446

Query  1675  DTGHH  1689
             DT HH
Sbjct  447   DTAHH  451



>gb|KCW51163.1| hypothetical protein EUGRSUZ_J00755 [Eucalyptus grandis]
Length=517

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/427 (72%), Positives = 355/427 (83%), Gaps = 18/427 (4%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L ++W EIQG   WEGLL+PMNSH+R+EIIRYGEFAQACYDSFDFDP+SKYCGTCKY 
Sbjct  94    RPLSQVWREIQGCNHWEGLLDPMNSHVRQEIIRYGEFAQACYDSFDFDPNSKYCGTCKYQ  153

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
             G+QFFEKLGM   GY+ISRYLYATSNINLPNFFQHS ++++WS +ANWMGY+AV TDE E
Sbjct  154   GSQFFEKLGMNHFGYQISRYLYATSNINLPNFFQHSRLSKVWSTYANWMGYIAVTTDEEE  213

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
             IRRLGRRDIVIAWRGTVTYLEWI+DLK+ILHP HF+DDP IKIE+GF+DLYT  KK+  C
Sbjct  214   IRRLGRRDIVIAWRGTVTYLEWIYDLKDILHPAHFKDDPTIKIEAGFYDLYT--KKEKSC  271

Query  949   NFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
             +FCS+SAREQ+LAEV RL++ Y+ E +SIT+TGHSLGAALA++SAYDIAEM VNVV    
Sbjct  272   HFCSFSAREQILAEVKRLLDYYRDEEISITITGHSLGAALAIISAYDIAEMGVNVVN---  328

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1308
                       K+P++V+SFAGPRVGNL+FKERCDELG+KVLR+ NV D VPTVPGIIANE
Sbjct  329   ----DGGEMKKVPITVYSFAGPRVGNLKFKERCDELGVKVLRLTNVHDMVPTVPGIIANE  384

Query  1309  KFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1488
             K Q+QK LE TL +FPWSYAHVG ELALD ++SPFLK+  D  CAHNLE  LHLVDGYHG
Sbjct  385   KMQFQKYLEETL-SFPWSYAHVGTELALDQTHSPFLKSTNDPSCAHNLEALLHLVDGYHG  443

Query  1489  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAH  1668
             +GRRF+  T RDIALVNK  +FLK E+G       DENKGMVR+SDGRWVVPER  ++AH
Sbjct  444   EGRRFKLVTRRDIALVNKSCDFLKGEYG-------DENKGMVRSSDGRWVVPER-LVDAH  495

Query  1669  PPDTGHH  1689
               DT HH
Sbjct  496   RSDTAHH  502



>ref|XP_006446147.1| hypothetical protein CICLE_v10014848mg [Citrus clementina]
 gb|ESR59387.1| hypothetical protein CICLE_v10014848mg [Citrus clementina]
Length=535

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/428 (70%), Positives = 352/428 (82%), Gaps = 8/428 (2%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             + LHE+W  IQG  DW+GLL+PMN HLR+EIIRYGEF+QACYDSFDFDPHSKYCGTCKY 
Sbjct  86    KELHEMWKAIQGCNDWQGLLDPMNCHLRKEIIRYGEFSQACYDSFDFDPHSKYCGTCKYS  145

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
              A FF+KL MAD GY+ISRYLYATSNINLP FFQ S ++ +WS +ANWMGY+AV TDE E
Sbjct  146   AASFFKKLDMADSGYQISRYLYATSNINLPKFFQKSRLSSVWSTYANWMGYIAVTTDEEE  205

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
             I+RLGRRDIV+AWRGTVTY+EWI+DLK+ILH  +F  DP IKIE GF DLYT  KK+  C
Sbjct  206   IKRLGRRDIVVAWRGTVTYIEWIYDLKDILHTANFGSDPSIKIELGFHDLYT--KKEQSC  263

Query  949   NFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
             N+C++SAREQ+LAE+ RLIE Y+GE +SIT TGHSLGAALA++SAYD+AE+ +N+V    
Sbjct  264   NYCTFSAREQVLAEIKRLIEYYEGEEISITFTGHSLGAALAIVSAYDVAELGLNIVN---  320

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1308
              +  S+S+  KIP++V+SFAGPRVGNL+FKERCDELG+KVLR+VNV DKVPTVPGI+ANE
Sbjct  321   -DGESSSSTKKIPITVYSFAGPRVGNLKFKERCDELGVKVLRVVNVHDKVPTVPGILANE  379

Query  1309  KFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1488
             KFQ+QK  E   K FPWSYAHVGVELALDH+ SPFLK   D GCAHNLE  LHL+DGY G
Sbjct  380   KFQFQKHFEEATK-FPWSYAHVGVELALDHTNSPFLKNTKDFGCAHNLEALLHLLDGYCG  438

Query  1489  DGRRF-RSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEA  1665
                +F    T RDIALVNK  +FLK E+ VPP WRQDENKGMVR +DGRWV+PER R+EA
Sbjct  439   KENQFCLETTKRDIALVNKSCDFLKSEYEVPPHWRQDENKGMVRNTDGRWVLPERPRLEA  498

Query  1666  HPPDTGHH  1689
              P DT HH
Sbjct  499   LPEDTAHH  506



>ref|XP_006470637.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Citrus 
sinensis]
 gb|KDO61218.1| hypothetical protein CISIN_1g009412mg [Citrus sinensis]
Length=535

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/428 (70%), Positives = 352/428 (82%), Gaps = 8/428 (2%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             + LHE+W  IQG  DW+GLL+PMN HLR+EIIRYGEF+QACYDSFDFDPHSKYCGTCKY 
Sbjct  86    KELHEMWKAIQGCNDWQGLLDPMNCHLRKEIIRYGEFSQACYDSFDFDPHSKYCGTCKYS  145

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
              A FF+KL MAD GY+ISRYLYATSNINLP FFQ S ++ +WS +ANWMGY+AV TDE E
Sbjct  146   AASFFKKLDMADSGYQISRYLYATSNINLPKFFQKSRLSSVWSTYANWMGYIAVTTDEEE  205

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
             I+RLGRRDIV+AWRGTVTY+EWI+DLK+ILH  +F  DP IKIE GF DLYT  KK+  C
Sbjct  206   IKRLGRRDIVVAWRGTVTYIEWIYDLKDILHTANFGSDPSIKIELGFHDLYT--KKEQSC  263

Query  949   NFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
             N+C++SAREQ+LAE+ RLIE Y+GE +SIT TGHSLGAALA++SAYD+AE+ +N+V    
Sbjct  264   NYCTFSAREQVLAEIKRLIEYYEGEEISITFTGHSLGAALAIVSAYDVAELGLNIVN---  320

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1308
              +  S+S+  KIP++V+SFAGPRVGNL+FKERCDELG+KVLR+VNV DKVPTVPGI+ANE
Sbjct  321   -DGESSSSTKKIPITVYSFAGPRVGNLKFKERCDELGVKVLRVVNVHDKVPTVPGILANE  379

Query  1309  KFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1488
             KFQ+QK  E   K FPWSYAHVGVELALDH+ SPFLK   D GCAHNLE  LHL+DGY G
Sbjct  380   KFQFQKHFEEATK-FPWSYAHVGVELALDHTNSPFLKNTKDFGCAHNLEALLHLLDGYCG  438

Query  1489  DGRRF-RSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEA  1665
                +F    T RDIALVNK  +FLK E+ VPP WRQDENKGMVR +DGRWV+PER R+EA
Sbjct  439   KENQFCLETTKRDIALVNKSCDFLKSEYEVPPHWRQDENKGMVRNTDGRWVLPERPRLEA  498

Query  1666  HPPDTGHH  1689
              P DT HH
Sbjct  499   LPEDTAHH  506



>gb|EYU46244.1| hypothetical protein MIMGU_mgv1a004190mg [Erythranthe guttata]
Length=540

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/422 (72%), Positives = 348/422 (82%), Gaps = 10/422 (2%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L +IW EI G  +W+ LL+PMNSHLRREIIRYGE AQACYDSFDFDP+SKYCGTCKY 
Sbjct  86    RPLSQIWREISGENNWQNLLDPMNSHLRREIIRYGEMAQACYDSFDFDPNSKYCGTCKYQ  145

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSS-VNRIWSQHANWMGYVAVATDEA  765
             G+ FFEKLGMA RGY ++R+LYATSNINLPNFFQ SS    +WS HANWMGYVAV+TDE 
Sbjct  146   GSHFFEKLGMAGRGYTLTRFLYATSNINLPNFFQKSSAAGSVWSPHANWMGYVAVSTDED  205

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTD  945
             E+RRLGRRD+V+AWRGTVTYLEWIHDLK+IL P HFR+DP IKIESGFFDLYT+  K+  
Sbjct  206   EVRRLGRRDVVVAWRGTVTYLEWIHDLKDILRPAHFRNDPSIKIESGFFDLYTS--KEKT  263

Query  946   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
             CN+C++SAREQ+LAE+ R+I+RY GENLSIT+TGHSLGA+LALLSAYDIAEMK+N+V   
Sbjct  264   CNYCAFSAREQVLAELRRIIQRYSGENLSITITGHSLGASLALLSAYDIAEMKLNIVD--  321

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                        KIP++VFSF+GPRVGNL+FKERC+ELGIKVLRIVNV DKVPTVPGIIAN
Sbjct  322   ----DGQEILNKIPITVFSFSGPRVGNLKFKERCEELGIKVLRIVNVHDKVPTVPGIIAN  377

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYH  1485
             EKFQYQK +E  + +FPWSYAHVGVELALDH  SPFLK  +DL CAHNLE HLHLVDGYH
Sbjct  378   EKFQYQKYIEDAI-SFPWSYAHVGVELALDHKRSPFLKKTSDLRCAHNLEAHLHLVDGYH  436

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEA  1665
             G  RRF     RDIALVNK  +FLK E GVPP W QDE+KGMVR+ DGRW+  E ++   
Sbjct  437   GKDRRFCLVEKRDIALVNKCCDFLKGEFGVPPNWWQDEHKGMVRSGDGRWIGLESNKAGR  496

Query  1666  HP  1671
              P
Sbjct  497   SP  498



>ref|XP_004154680.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Cucumis 
sativus]
Length=455

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/429 (70%), Positives = 354/429 (83%), Gaps = 14/429 (3%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L EIW +IQG  +WE LL+P+N HLR+EIIRYGEF+QACYDSFDFDPHSKYCGTCKY  +
Sbjct  26    LSEIWRDIQGMNNWEALLDPLNLHLRKEIIRYGEFSQACYDSFDFDPHSKYCGTCKYQAS  85

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
              FF KL M D GY I+RYLYATSNINLPNFF+ S    +WSQHANWMGYVAVATD  EI+
Sbjct  86    HFFNKLLMPDPGYNITRYLYATSNINLPNFFKKSKFT-LWSQHANWMGYVAVATDADEIK  144

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR-DDPDIKIESGFFDLYTNSKKDTDCN  951
             RLGRRDIVIAWRGTVTYLEWIHDLK+IL P  F  DD  +KIESGF+DLYT   K+ +CN
Sbjct  145   RLGRRDIVIAWRGTVTYLEWIHDLKDILRPAGFIPDDTSVKIESGFYDLYT--MKEENCN  202

Query  952   FCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
             +C +SAREQ+LAEV RL+E+Y    GE +SITVTGHSLGAALAL++AYDIAEMK+N+V  
Sbjct  203   YCGFSAREQILAEVKRLVEKYCKLGGEEISITVTGHSLGAALALITAYDIAEMKLNIVAR  262

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
             G   + +      +P++V+SFAGPRVGNL+FKERC+ELG+KVLR++NV DKVP VPGIIA
Sbjct  263   GGSSAVA------VPITVYSFAGPRVGNLKFKERCEELGVKVLRVINVHDKVPMVPGIIA  316

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             NEK Q+QK LE  +  FPWSYAHVG EL+LDH++SPFL +  DLGCAHNLE +LHL+DGY
Sbjct  317   NEKLQFQKYLEEAIA-FPWSYAHVGTELSLDHTHSPFLMSTNDLGCAHNLEAYLHLIDGY  375

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIE  1662
             HG GR+FR  T RDIALVNK  +FL++E+GVPP WRQDENKGMVR ++GRWVVP+R R+E
Sbjct  376   HGKGRKFRLETKRDIALVNKSCDFLRKEYGVPPCWRQDENKGMVRNNEGRWVVPDRPRLE  435

Query  1663  AHPPDTGHH  1689
              HPPDT HH
Sbjct  436   DHPPDTAHH  444



>gb|KGN66495.1| hypothetical protein Csa_1G614650 [Cucumis sativus]
Length=536

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/438 (69%), Positives = 356/438 (81%), Gaps = 22/438 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L EIW +IQG  +WE LL+P+N HLR+EIIRYGEF+QACYDSFDFDPHSKYCGTCKY  +
Sbjct  97    LSEIWRDIQGMNNWEALLDPLNLHLRKEIIRYGEFSQACYDSFDFDPHSKYCGTCKYQAS  156

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSV---------NRIWSQHANWMGYVA  747
              FF KL M D GY I+RYLYATSNINLPNFF+ S           NR+WSQHANWMGYVA
Sbjct  157   HFFNKLLMPDPGYNITRYLYATSNINLPNFFKKSKFTRDESRDFSNRVWSQHANWMGYVA  216

Query  748   VATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHF-RDDPDIKIESGFFDLYT  924
             VATD  EI+RLGRRDIVIAWRGTVTYLEWIHDLK+IL P  F  DD  +KIESGF+DLYT
Sbjct  217   VATDADEIKRLGRRDIVIAWRGTVTYLEWIHDLKDILRPAGFIPDDTSVKIESGFYDLYT  276

Query  925   NSKKDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIA  1095
                K+ +CN+C +SAREQ+LAEV RL+E+Y    GE +SITVTGHSLGAALAL++AYDIA
Sbjct  277   --MKEENCNYCGFSAREQILAEVKRLVEKYCKLGGEEISITVTGHSLGAALALITAYDIA  334

Query  1096  EMKVNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDK  1275
             EMK+N+V  G   + +      +P++V+SFAGPRVGNL+FKERC+ELG+KVLR++NV DK
Sbjct  335   EMKLNIVARGGSSAVA------VPITVYSFAGPRVGNLKFKERCEELGVKVLRVINVHDK  388

Query  1276  VPTVPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLE  1455
             VP VPGIIANEK Q+QK LE  +  FPWS AHVG ELALDH++SPFL + +DLGCAHNLE
Sbjct  389   VPMVPGIIANEKLQFQKYLEEAIA-FPWSCAHVGTELALDHTHSPFLMSTSDLGCAHNLE  447

Query  1456  GHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRW  1635
              +LHL+DGYHG GR+FR  T RDIALVNK  +FL++E+GVPP WRQDENKGMVR ++GRW
Sbjct  448   AYLHLIDGYHGKGRKFRLETKRDIALVNKSCDFLRKEYGVPPCWRQDENKGMVRNNEGRW  507

Query  1636  VVPERSRIEAHPPDTGHH  1689
             VVP+R R+E HPPDT HH
Sbjct  508   VVPDRPRLEDHPPDTAHH  525



>ref|XP_010938722.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Elaeis guineensis]
Length=499

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/523 (63%), Positives = 376/523 (72%), Gaps = 42/523 (8%)
 Frame = +1

Query  127   MAMGSLQISLKHNYHTIFAESLPPPLMNITKPTTAKPSNNSFFPLNPHYSSLKCRVSLPA  306
             MA  SL  S    +HT    S P P   I+KPT    +  S F  +   +SLKC  +   
Sbjct  1     MAFLSLS-SFYPQFHTPPLLSFPSPTPTISKPTIF--NTKSLFLNSNTTTSLKCLPTPLE  57

Query  307   AAINAPPQRETGQSSNKNdeeqeedeelcveedGRNLHEIWAEIQGSKDWEGLLNPMNSH  486
              A +   + E                        + LH +W +I GS DW GLL+PMN  
Sbjct  58    LASHCVEEEE------------------------QLLHHVWRKIHGSDDWTGLLDPMNPL  93

Query  487   LRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGM--ADRGYRISRYLYAT  660
             LR EIIRYGEFAQACYD+FDFDPHSKYCGTCKY G  FF++L M  A  GY ISRYLYAT
Sbjct  94    LRSEIIRYGEFAQACYDAFDFDPHSKYCGTCKYSGNHFFDRLHMPAAGHGYEISRYLYAT  153

Query  661   SNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIH  840
             SNINLPNFFQ   +  +WS HANWMGY+A ATD  EI RLGRRDIVIAWRGTVTYLEWIH
Sbjct  154   SNINLPNFFQKKRLRNVWSTHANWMGYIAFATDPLEIARLGRRDIVIAWRGTVTYLEWIH  213

Query  841   DLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERYKG  1020
             DLK+IL P +F DDP IK+ESGF DLYT   K+  CN+CS+SAREQ+LA++ RL+ER+ G
Sbjct  214   DLKDILTPVYFGDDPSIKVESGFLDLYT--MKEHRCNYCSFSAREQVLADIKRLVERFSG  271

Query  1021  ENLSITVTGHslgaalallsaYDIAEMKVNVVQegegessstsaatKIPVSVFSFAGPRV  1200
             E LSITVTGHSLGAALALLSAYDIAEM +N+ ++GE           IPV+VFSF+GPRV
Sbjct  272   EELSITVTGHSLGAALALLSAYDIAEMGLNIREDGEM----------IPVTVFSFSGPRV  321

Query  1201  GNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETTLKNFPWSYAHVGV  1380
             GNLRFK RC+ELG+KVLR++NV D+VP+VPGIIANEKFQYQ+ +E  +  FPWSYAHVGV
Sbjct  322   GNLRFKLRCEELGVKVLRVINVHDRVPSVPGIIANEKFQYQRVVEEVMW-FPWSYAHVGV  380

Query  1381  ELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLK  1560
             ELALDH  SPFLK   D+ C HNLE HLHLVDGY G GR F SA GRD+ALVNK  +FL+
Sbjct  381   ELALDHRESPFLKESGDVRCVHNLEAHLHLVDGYQGKGRGFESAGGRDVALVNKSCDFLR  440

Query  1561  REHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPPDTGHH  1689
              E GVPPRW QDENKGMVR  DGRWVVPER R+EAHPPDT HH
Sbjct  441   EELGVPPRWWQDENKGMVRGEDGRWVVPERPRVEAHPPDTAHH  483



>ref|XP_004139114.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Cucumis 
sativus]
Length=455

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/429 (70%), Positives = 354/429 (83%), Gaps = 14/429 (3%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L EIW +IQG  +WE LL+P+N HLR+EIIRYGEF+QACYDSFDFDPHSKYCGTCKY  +
Sbjct  26    LSEIWRDIQGMNNWEALLDPLNLHLRKEIIRYGEFSQACYDSFDFDPHSKYCGTCKYQAS  85

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
              FF KL M D GY I+RYLYATSNINLPNFF+ S    +WSQHANWMGYVAVATD  EI+
Sbjct  86    HFFNKLLMPDPGYNITRYLYATSNINLPNFFKKSKFT-LWSQHANWMGYVAVATDADEIK  144

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR-DDPDIKIESGFFDLYTNSKKDTDCN  951
             RLGRRDIVIAWRGTVTYLEWIHDLK+IL P  F  DD  +KIESGF+DLYT   K+ +CN
Sbjct  145   RLGRRDIVIAWRGTVTYLEWIHDLKDILRPAGFIPDDTSVKIESGFYDLYT--MKEENCN  202

Query  952   FCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
             +C +SAREQ+LAEV RL+E+Y    GE +SITVTGHSLGAALAL++AYDIAEMK+N+V  
Sbjct  203   YCGFSAREQILAEVKRLVEKYCKLGGEEISITVTGHSLGAALALITAYDIAEMKLNIVAR  262

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
             G   + +      +P++V+SFAGPRVGNL+FKERC+ELG+KVLR++NV DKVP VPGIIA
Sbjct  263   GGSSAVA------VPITVYSFAGPRVGNLKFKERCEELGVKVLRVINVHDKVPMVPGIIA  316

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             NEK Q+QK LE  +  FPWS AHVG ELALDH++SPFL + +DLGCAHNLE +LHL+DGY
Sbjct  317   NEKLQFQKYLEEAIA-FPWSCAHVGTELALDHTHSPFLMSTSDLGCAHNLEAYLHLIDGY  375

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIE  1662
             HG GR+FR  T RDIALVNK  +FL++E+GVPP WRQDENKGMVR ++GRWVVP+R R+E
Sbjct  376   HGKGRKFRLETKRDIALVNKSCDFLRKEYGVPPCWRQDENKGMVRNNEGRWVVPDRPRLE  435

Query  1663  AHPPDTGHH  1689
              HPPDT HH
Sbjct  436   DHPPDTAHH  444



>ref|XP_008450415.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Cucumis melo]
Length=505

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/498 (63%), Positives = 379/498 (76%), Gaps = 22/498 (4%)
 Frame = +1

Query  238   SNNSFFPLNPHYSSLKCRVSLPAAAINAP-PQRETGQSSNKNdeeqeedeelcveedGRN  414
             +NNS F  NP  S       LP +  ++  P   T +     D++  E   +    +   
Sbjct  5     NNNSLFSTNPTLSIHYFNFILPTSKCSSSLPSLTTMEDQEDEDQDDVEAITMETNNNFAP  64

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L EIW +IQG  +WEGLL+P+N HLR+EIIRYGEF+QACYDSFDFDPHSKYCGTCKY  +
Sbjct  65    LSEIWRDIQGMNNWEGLLDPLNLHLRKEIIRYGEFSQACYDSFDFDPHSKYCGTCKYQAS  124

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSV---------NRIWSQHANWMGYVA  747
              FF KL M D GY I+RYLYATSNINLPNFF+ S+          NR+WSQHANWMGYVA
Sbjct  125   HFFNKLLMPDPGYNITRYLYATSNINLPNFFKKSNFTRDESRNFSNRVWSQHANWMGYVA  184

Query  748   VATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR-DDPDIKIESGFFDLYT  924
             VATD  EI+RLGRRDIVIAWRGTVTYLEWIHDLK+IL P  F  DD  +KIESGF+DLYT
Sbjct  185   VATDADEIKRLGRRDIVIAWRGTVTYLEWIHDLKDILRPAGFIPDDTSVKIESGFYDLYT  244

Query  925   NSKKDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIA  1095
                K+ +CN+  +SAREQ+LAEV RL+E+Y    GE +SITVTGHSLGAALAL++AYDIA
Sbjct  245   --MKEENCNYSGFSAREQILAEVKRLVEKYCKLGGEEISITVTGHSLGAALALITAYDIA  302

Query  1096  EMKVNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDK  1275
             EMK+N+V  G+G S       ++P++V+SFAGPRVGNL+FKERC+ELG+K LR++N+ DK
Sbjct  303   EMKLNIVARGDGSSPV-----EVPITVYSFAGPRVGNLKFKERCEELGVKALRVINIHDK  357

Query  1276  VPTVPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLE  1455
             VP VPGIIANEK Q+QK LE  +  FPWSYAHVG ELALDH++SPFL +  DLGCAHNLE
Sbjct  358   VPMVPGIIANEKLQFQKYLEEAIA-FPWSYAHVGTELALDHTHSPFLMSTNDLGCAHNLE  416

Query  1456  GHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRW  1635
              HLHL+DGYHG GR+FR  T RDIALVNK  +FL++E+GVPP WRQDENKGMVR S+GRW
Sbjct  417   AHLHLIDGYHGKGRKFRLETKRDIALVNKSCDFLRKEYGVPPCWRQDENKGMVRNSEGRW  476

Query  1636  VVPERSRIEAHPPDTGHH  1689
             VVP+R R++ HP DT +H
Sbjct  477   VVPDRPRLDDHPSDTANH  494



>ref|XP_003538937.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Glycine 
max]
Length=505

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/518 (62%), Positives = 385/518 (74%), Gaps = 39/518 (8%)
 Frame = +1

Query  148   ISLKHNYHTIFAESLPPPLMNITKP-TTAKPSNNSFFPLNPHYSSLKCRVSLPAAAINAP  324
             + + HNY      +LP PL  ++KP TT       FFP      +LKC  S  +      
Sbjct  5     LPIYHNY-----VNLPCPL-PLSKPSTTFNTPIILFFPKTKPSLTLKCSSSASSLTPELD  58

Query  325   PQRETGQSSNKNdeeqeedeelcveedGRNLHEIWAEIQGSKDWEGLLNP-MNSHLRREI  501
              + ET  + ++                   L E W EIQG  +W+GL++P MN HLRREI
Sbjct  59    QEEETFGNFDEPP-----------------LSESWKEIQGLNNWDGLIDPTMNPHLRREI  101

Query  502   IRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYLYATSNINLPN  681
             IRYGE AQACYDSFDFDPHSKYCGTCKY  +Q FEKL M+  GY ISRYLYATSN+NLPN
Sbjct  102   IRYGELAQACYDSFDFDPHSKYCGTCKYHPSQLFEKLNMSQTGYMISRYLYATSNVNLPN  161

Query  682   FFQHSSVN-RIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNIL  858
             FFQ S ++  +WS HANWMGYVAV+TD  +I+RLGRRDIVIAWRGTVTY+EWI+DLK+IL
Sbjct  162   FFQKSRLSTSVWSPHANWMGYVAVSTDRDQIKRLGRRDIVIAWRGTVTYVEWIYDLKDIL  221

Query  859   HPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSIT  1038
              P  F DDP IK+ESGF+DLYT  KK+  C +CS+SAREQ+L+EV RL+  YK E +SIT
Sbjct  222   RPALFSDDPTIKVESGFYDLYT--KKEDSCTYCSFSAREQVLSEVKRLLHYYKNEEISIT  279

Query  1039  VTGHslgaalallsaYDIAEMKVNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFK  1218
             +TGHSLGAALA+LSAYDIAE+K+NVV++G           KIPV+VFSFAGPRVGNL+FK
Sbjct  280   ITGHSLGAALAILSAYDIAELKLNVVEDGRN---------KIPVTVFSFAGPRVGNLKFK  330

Query  1219  ERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDH  1398
             ERC+ELG+KVLR+VNV+D VPTVPGII NEKFQ+Q+ +E TL +FPWSYAH+G E+ALDH
Sbjct  331   ERCEELGVKVLRVVNVQDVVPTVPGIITNEKFQFQRYIEETL-SFPWSYAHLGTEMALDH  389

Query  1399  SYSPFLKTGT-DLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGV  1575
               SPFLK G  DLGCAHNLE HLHLVDGYHG G+RF  AT RDIALVNK  +FL+ E+GV
Sbjct  390   RESPFLKGGMNDLGCAHNLEVHLHLVDGYHGKGKRFCLATKRDIALVNKSCDFLRSEYGV  449

Query  1576  PPRWRQDENKGMVRTSDGRWVVPERSRIEAHPPDTGHH  1689
             P  WRQDENKGMVR+ DGRWV+P+R  +EAHPPD  HH
Sbjct  450   PSHWRQDENKGMVRSRDGRWVLPDRPILEAHPPDMAHH  487



>ref|XP_004505625.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Cicer 
arietinum]
Length=516

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/429 (67%), Positives = 351/429 (82%), Gaps = 13/429 (3%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             +L ++W EIQG  +WEGLL+PMN +LRREIIRYGE AQACYDSFDFDPHSKYCGTCKY  
Sbjct  80    SLSDVWKEIQGMNNWEGLLDPMNPNLRREIIRYGELAQACYDSFDFDPHSKYCGTCKYHP  139

Query  592   AQFFEKLGMADR---GYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDE  762
             A FFEK+ M +    GY I+RYLYATSNINLPNFF  S ++ +WS HANWMGYVAVAT+ 
Sbjct  140   ADFFEKVEMGENTVSGYTITRYLYATSNINLPNFFHKSKLSTVWSPHANWMGYVAVATNL  199

Query  763   AEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDT  942
              EI+RLGRRDIVIAWRGTVTY+EWI+DLK+IL   +F++DP IK+ESGF+DLYT  KK+ 
Sbjct  200   QEIKRLGRRDIVIAWRGTVTYIEWIYDLKDILRAANFKNDPTIKVESGFYDLYT--KKED  257

Query  943   DCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
              C +CS+SAREQ+L+E+ RLI+ Y+ E +SIT+TGHSLGAALA+LSAYDI E+K+NVV  
Sbjct  258   SCGYCSFSAREQVLSEIMRLIQYYQDEQISITITGHSLGAALAILSAYDITELKLNVVNN  317

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
             G  +         IPV+V+SFAGPRVGNL+FKERC+ELG+KVLR++N+ D VPTVPGI+ 
Sbjct  318   GNDKI-------NIPVTVYSFAGPRVGNLKFKERCEELGVKVLRVINIHDMVPTVPGILT  370

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             NEK ++QK +E  L +FPWSYAHVG E+ALDH  SPFLK   D+GCAHNLE  LHL+DGY
Sbjct  371   NEKLKFQKYIEDNL-SFPWSYAHVGTEIALDHRKSPFLKENGDIGCAHNLELLLHLMDGY  429

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIE  1662
             HG  ++FR  + RDIALVNK  +FL+ E+GVPP WRQDENKGMVR+ DGRW++PER R+E
Sbjct  430   HGKEKKFRLVSERDIALVNKSCDFLRSEYGVPPHWRQDENKGMVRSGDGRWILPERPRLE  489

Query  1663  AHPPDTGHH  1689
             AHPPDT HH
Sbjct  490   AHPPDTAHH  498



>ref|XP_003607369.1| Lipase [Medicago truncatula]
 gb|AES89566.1| phospholipase A1 [Medicago truncatula]
Length=534

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/425 (68%), Positives = 349/425 (82%), Gaps = 11/425 (3%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L E+W EIQG  DWEGLL+PM+  LR+EIIRYGE AQACYDSFDFD +SKYCGTCKY  A
Sbjct  100   LSEVWREIQGENDWEGLLDPMDPILRKEIIRYGELAQACYDSFDFDQNSKYCGTCKYHPA  159

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
              FFEKL M D GY ISRYLYATSNINLP FF+ S ++ +WS +ANWMGY+AV+T+E EI+
Sbjct  160   HFFEKLYMGD-GYTISRYLYATSNINLPKFFKKSKISSVWSPYANWMGYIAVSTNEEEIK  218

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  954
             RLGRRDIVIAWRGTVTY+EWI+DLK+ILH  +F++DP IK+E+GF+DLYT  KK+  C +
Sbjct  219   RLGRRDIVIAWRGTVTYIEWIYDLKDILHEANFKNDPSIKVETGFYDLYT--KKEQSCTY  276

Query  955   CSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegege  1134
             CS+SAREQ+L+E+ RL++ Y+GE +SITVTGHSLGAALA+LSAYDIAE+ VN++++G+  
Sbjct  277   CSFSAREQVLSEIKRLLQFYQGEKISITVTGHSLGAALAVLSAYDIAELGVNIIEDGDKT  336

Query  1135  ssstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKF  1314
             +        +P++V+SFAGPRVGNL FKERC+ELG+KVLRI N+ DKVPTVPGII NEKF
Sbjct  337   T-------NVPITVYSFAGPRVGNLHFKERCEELGVKVLRIHNIHDKVPTVPGIITNEKF  389

Query  1315  QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDG  1494
             Q+QK +E TL +FPWSYAHVG E+ LDH  SPFLK   DLGC HNLE  LHL+DGYHG  
Sbjct  390   QFQKYIEDTL-SFPWSYAHVGTEIKLDHRNSPFLKENGDLGCTHNLEVLLHLMDGYHGKD  448

Query  1495  RRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPP  1674
             ++F   T RDIALVNK  + L+ E GVPP WRQDENKGMV+T+DGRWVVPER  +EAHPP
Sbjct  449   KKFNMVTERDIALVNKSCDLLRSEFGVPPHWRQDENKGMVQTADGRWVVPERPLLEAHPP  508

Query  1675  DTGHH  1689
             D  HH
Sbjct  509   DIAHH  513



>ref|XP_007131548.1| hypothetical protein PHAVU_011G022500g [Phaseolus vulgaris]
 gb|ESW03542.1| hypothetical protein PHAVU_011G022500g [Phaseolus vulgaris]
Length=502

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/426 (68%), Positives = 343/426 (81%), Gaps = 13/426 (3%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNP-MNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             L ++W EIQG+ DW+GL+ P MN +LRREIIRYGE AQACYDSFDFDPHSKYCGTCKY  
Sbjct  72    LSQVWREIQGTNDWKGLIEPSMNPNLRREIIRYGELAQACYDSFDFDPHSKYCGTCKYHP  131

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
             + FF +L +   GY I+RYLYATSNINLPNFFQ S++  +WS HANWMGYVAV TD+  I
Sbjct  132   SHFFHQLNIPHAGYTITRYLYATSNINLPNFFQKSNLAAVWSPHANWMGYVAVITDKEHI  191

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
             + LGRRDI+IAWRGTVTY+EWIHDLK+IL P  F  D  IK+ESGF +LYT  KK+  C 
Sbjct  192   KHLGRRDILIAWRGTVTYVEWIHDLKDILRPAFFSRDQTIKVESGFHELYT--KKEDSCT  249

Query  952   FCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegeg  1131
             +CS+SAREQ+L+EV RL+  YK E +SIT+TGHSLGAALA+LSAYDIAE+++NVV     
Sbjct  250   YCSFSAREQVLSEVKRLLNYYKDEEISITITGHSLGAALAVLSAYDIAEVRLNVVD----  305

Query  1132  essstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEK  1311
                      ++PV+VFSFAGPRVGNL+FKERC+ELG+KVLR+VNV D VPTVPGII NEK
Sbjct  306   -----DGGERVPVTVFSFAGPRVGNLKFKERCEELGVKVLRVVNVHDVVPTVPGIITNEK  360

Query  1312  FQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGD  1491
             F++QK +E TL +FPWSYAHVG E+ALDH+ SPF+K   DL  AHNLE HLHL+DGYHG 
Sbjct  361   FRFQKYIEDTL-SFPWSYAHVGREIALDHTESPFVKGSMDLVSAHNLEVHLHLLDGYHGK  419

Query  1492  GRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHP  1671
             G+RF  A+ RDIALVNK  +FLK E+GVPP WRQDENKGMVR  DGRWV+PER R+EAHP
Sbjct  420   GKRFCLASKRDIALVNKSCDFLKSEYGVPPHWRQDENKGMVRGGDGRWVLPERPRLEAHP  479

Query  1672  PDTGHH  1689
             PD  HH
Sbjct  480   PDMTHH  485



>ref|XP_010544180.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Tarenaya 
hassleriana]
Length=525

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/424 (69%), Positives = 345/424 (81%), Gaps = 15/424 (4%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             LH +W EIQG   WEGLL+PMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY  +
Sbjct  98    LHRVWREIQGCNSWEGLLDPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHPS  157

Query  595   QFFEKLGMAD-RGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              FF +L +A  + Y I+RYLYATSNINLP FFQ S ++ +WS+HANWMGYVAV TDE E+
Sbjct  158   DFFARLDLATHKAYTITRYLYATSNINLPKFFQKSKLSSVWSKHANWMGYVAVVTDEEEV  217

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
             +RLGRRDIVIAWRGTVTYLEWI+DLK+IL+P +F +DP IKIE GF DLYT  KK+  C 
Sbjct  218   KRLGRRDIVIAWRGTVTYLEWIYDLKDILYPPNFSEDPSIKIECGFHDLYT--KKEDSCK  275

Query  952   FCSYSAREQLLAEVNRLIERYKGE--NLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
             F S+SAREQ+LAEV RL++ Y  E  ++SIT+TGHSLGAALAL+SAYDIAE+ +N + E 
Sbjct  276   FSSFSAREQVLAEVKRLLDYYGREEHDISITITGHSLGAALALVSAYDIAELNINRIPEN  335

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                        ++P+SVFSF+GPRVGNL+FKERC+ELGIKVLR+VNV DKVPTVPGI AN
Sbjct  336   SY---------QVPISVFSFSGPRVGNLKFKERCEELGIKVLRVVNVHDKVPTVPGIFAN  386

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYH  1485
             EK Q+QK +E T  +FPWSYAHVGVELALDH+ SPFLK   DLGCAH+LE  LHLVDG+H
Sbjct  387   EKSQFQKYIEET-TSFPWSYAHVGVELALDHTKSPFLKPTKDLGCAHSLEALLHLVDGFH  445

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEA  1665
             G+G RF   T RD+ALVNK  +FLK E+GVPP WRQDENKGMVR  +GRWV+ ER+R EA
Sbjct  446   GEGGRFHLETKRDVALVNKSCDFLKSEYGVPPCWRQDENKGMVRNGEGRWVLSERARPEA  505

Query  1666  HPPD  1677
             H P+
Sbjct  506   HLPE  509



>ref|XP_010479626.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Camelina 
sativa]
Length=523

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/434 (68%), Positives = 344/434 (79%), Gaps = 21/434 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L +IW E+QG  +WEGLL+PMN+HLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY  +
Sbjct  84    LRDIWREVQGCNNWEGLLHPMNNHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHPS  143

Query  595   QFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              FF  L +   +GY I+RYLYATSNINLPNFFQ S ++ IWSQHANWMGYVAVATDE E+
Sbjct  144   DFFSNLDLHLHKGYTITRYLYATSNINLPNFFQKSKLSSIWSQHANWMGYVAVATDEEEV  203

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
              RLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F DDP IKIE GF+DLYT  KK+  C 
Sbjct  204   SRLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPLIKIELGFYDLYT--KKEVSCK  261

Query  952   FCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1119
             F S+SAREQ+LAEV RL+E Y    +G  +SITVTGHSLGA+LAL+SAYDIAE+ +N + 
Sbjct  262   FSSFSAREQVLAEVKRLLEYYGTGEEGHEISITVTGHSLGASLALVSAYDIAELNLNYLP  321

Query  1120  egegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGII  1299
                          K+P++VFSF+GPRVGNLRFKERCDELG+KVLR+VN+ DKVP+VPGI 
Sbjct  322   ---------ENNNKVPITVFSFSGPRVGNLRFKERCDELGVKVLRVVNIHDKVPSVPGIF  372

Query  1300  ANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDG  1479
             ANEKF +QK +E    +FPWSYAHVGVELALDH  SPFLK   DLGCAHNLE  LHLVDG
Sbjct  373   ANEKFHFQKYVEEK-TSFPWSYAHVGVELALDHKKSPFLKQTKDLGCAHNLEALLHLVDG  431

Query  1480  YHGDGR---RFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             YHG       F SAT RDIALVNK  +FL+ E+ VPP WRQDENKGMV++SDGRWV+P+R
Sbjct  432   YHGKKEAETMFCSATNRDIALVNKSCDFLRSEYHVPPCWRQDENKGMVKSSDGRWVLPDR  491

Query  1651  SRIEAH-PPDTGHH  1689
              ++E H P D  HH
Sbjct  492   PQLEPHWPEDITHH  505



>ref|XP_002891639.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67898.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=526

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/436 (68%), Positives = 344/436 (79%), Gaps = 22/436 (5%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             +L EIW E+QG  +WEGLL+PMN+HLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY  
Sbjct  85    SLREIWREVQGCNNWEGLLDPMNNHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHP  144

Query  592   AQFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
             + FF  L +   +GY I+RYLYATSNINLPNFFQ S ++ IWSQHANWMGYVAVATDE E
Sbjct  145   SDFFSNLDLHLHKGYTITRYLYATSNINLPNFFQKSKLSSIWSQHANWMGYVAVATDEEE  204

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
             + RLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F DDP IKIE GF DLYT  KK+  C
Sbjct  205   VGRLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPSIKIELGFHDLYT--KKEDSC  262

Query  949   NFCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
              F S+SAREQ+LAEV RL+E Y    +G  +SITVTGHSLGA+LAL+SAYDIAE+ +N V
Sbjct  263   KFSSFSAREQVLAEVKRLLEYYGTGEEGHEISITVTGHSLGASLALVSAYDIAELNLNHV  322

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
                           K+P++VFSF+GPRVGNLRFKERCDELG+KVLR+VNV DKVP+VPGI
Sbjct  323   ---------PENNYKVPITVFSFSGPRVGNLRFKERCDELGVKVLRVVNVHDKVPSVPGI  373

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
              ANEKFQ+QK +E    +FPWSYAHVGVELALDH  SPFLK   DLGCAHNLE  LHLVD
Sbjct  374   FANEKFQFQKYVEEK-TSFPWSYAHVGVELALDHKKSPFLKQTKDLGCAHNLEALLHLVD  432

Query  1477  GYHGDG----RRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1644
             GYHG      +RF   T RDIALVNK  +FL+ E+ VPP WRQDENKGMV++SDGRWV+P
Sbjct  433   GYHGKDEEAQKRFCLVTKRDIALVNKSCDFLRSEYHVPPCWRQDENKGMVKSSDGRWVLP  492

Query  1645  ERSRIEAH-PPDTGHH  1689
             +R ++E H   D  HH
Sbjct  493   DRPQLEPHRQEDIAHH  508



>ref|XP_010461974.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Camelina 
sativa]
Length=524

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/434 (68%), Positives = 343/434 (79%), Gaps = 21/434 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L +IW E+QG  +WEGLL+PMN+HLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY  +
Sbjct  85    LRDIWREVQGCNNWEGLLDPMNNHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHPS  144

Query  595   QFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              FF  L +   +GY I+RYLYATSNINLPNFFQ S ++ IWSQHANWMGYVAVATDE E+
Sbjct  145   DFFSNLDLHLHKGYTITRYLYATSNINLPNFFQKSKLSSIWSQHANWMGYVAVATDEEEV  204

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
              RLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F DDP IKIE GF DLYT  KK+  C 
Sbjct  205   SRLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPLIKIELGFHDLYT--KKEVSCK  262

Query  952   FCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1119
             F S+SAREQ+LAEV RL+E Y    +G  +SITVTGHSLGA+LAL+SAYDIAE+ +N + 
Sbjct  263   FSSFSAREQVLAEVKRLLEYYCTGEEGHEISITVTGHSLGASLALVSAYDIAELNLNYLP  322

Query  1120  egegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGII  1299
                          K+P++VFSF+GPRVGNLRFKERCDELG+KVLR+VNV DKVP+VPGI 
Sbjct  323   ---------ENNNKVPITVFSFSGPRVGNLRFKERCDELGVKVLRVVNVHDKVPSVPGIF  373

Query  1300  ANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDG  1479
             ANEKF +QK +E    +FPWSYAHVGVELALDH  SPFLK   DLGCAHNLE  LHLVDG
Sbjct  374   ANEKFHFQKYVEEK-TSFPWSYAHVGVELALDHKKSPFLKQTRDLGCAHNLEALLHLVDG  432

Query  1480  YHGDGR---RFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             YHG       F SAT RDIALVNK  +FL+ E+ VPP WRQDENKGMV++SDGRWV+P+R
Sbjct  433   YHGKEEAETMFCSATNRDIALVNKSCDFLRSEYHVPPCWRQDENKGMVKSSDGRWVLPDR  492

Query  1651  SRIEAH-PPDTGHH  1689
              ++E H P D  HH
Sbjct  493   PQLEPHWPEDIAHH  506



>ref|XP_006307213.1| hypothetical protein CARUB_v10008812mg [Capsella rubella]
 gb|EOA40111.1| hypothetical protein CARUB_v10008812mg [Capsella rubella]
Length=533

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/434 (68%), Positives = 344/434 (79%), Gaps = 21/434 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L +IW E++G  +WEGLL+PMN+HLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY  +
Sbjct  94    LRDIWREVEGCNNWEGLLDPMNNHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHPS  153

Query  595   QFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              FF  L +   +GY I+RYLYATSNINLPNFFQ S ++ IWSQHANWMGYVAVATDE E+
Sbjct  154   DFFSNLDLHLHKGYTITRYLYATSNINLPNFFQKSKLSSIWSQHANWMGYVAVATDEEEV  213

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
             RRLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F DDP IKIE GF DLYT  KK+  C 
Sbjct  214   RRLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPLIKIELGFHDLYT--KKEYSCK  271

Query  952   FCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1119
             F S+SAREQ+LAEV RL+E Y    +G  +SITVTGHSLGA+LAL+SAYDIAE+K+N + 
Sbjct  272   FSSFSAREQVLAEVKRLLEYYGTGEEGNEISITVTGHSLGASLALVSAYDIAELKLNHLP  331

Query  1120  egegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGII  1299
                          K+P++VFSF+GPRVGNLRFKERCDELG+KVLR++NV DKVP VPGI 
Sbjct  332   ---------ENNYKVPITVFSFSGPRVGNLRFKERCDELGVKVLRVINVHDKVPYVPGIF  382

Query  1300  ANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDG  1479
             ANEKFQ+QK +E    +FPWSYAHVGVELALDH  SPFLK   DLGCAHNLE  LHLVDG
Sbjct  383   ANEKFQFQKYVEEK-TSFPWSYAHVGVELALDHKKSPFLKQTKDLGCAHNLEALLHLVDG  441

Query  1480  YHGDGR---RFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             YHG       F SAT RDIALVNK  +FL+ E+ VPP WRQDENKGMV++SDGRW+V +R
Sbjct  442   YHGKKEAETMFCSATKRDIALVNKSCDFLRSEYHVPPCWRQDENKGMVKSSDGRWIVQDR  501

Query  1651  SRIEAH-PPDTGHH  1689
              ++E H P D  HH
Sbjct  502   PQLEPHRPEDIAHH  515



>ref|XP_006393053.1| hypothetical protein EUTSA_v10011370mg [Eutrema salsugineum]
 gb|ESQ30339.1| hypothetical protein EUTSA_v10011370mg [Eutrema salsugineum]
Length=542

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/436 (68%), Positives = 343/436 (79%), Gaps = 22/436 (5%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             NL EIW E+QG  +WEGLL+PMN+HLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY  
Sbjct  94    NLREIWREVQGCNNWEGLLDPMNNHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHP  153

Query  592   AQFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
             + FF  L +   +GY I+RYLYATSNINLPNFFQ S ++ IWSQHANWMGYVAVAT+E E
Sbjct  154   SDFFPNLDLNLHKGYTITRYLYATSNINLPNFFQRSKLSSIWSQHANWMGYVAVATNEEE  213

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
             + RLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F DDP IKIE GF DLYT  KK+  C
Sbjct  214   VARLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPLIKIELGFHDLYT--KKEDSC  271

Query  949   NFCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
              F S+SAREQ+LAEV RL+E Y    +G  +SITVTGHSLGAALAL+SAYDIAE+ +N +
Sbjct  272   KFSSFSAREQVLAEVKRLLEYYGTGEEGHEISITVTGHSLGAALALVSAYDIAELNLNHI  331

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
                           K+P+SVFSF+GPRVGNLRFKERC+ELG+KVLR+VNV DKVP+VPGI
Sbjct  332   P---------EKNYKVPISVFSFSGPRVGNLRFKERCEELGLKVLRVVNVHDKVPSVPGI  382

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
               NEKFQ+QK +E T  +FPWSYAHVGVELALDH  SPFLK   DLGCAHNLE  LHLVD
Sbjct  383   FTNEKFQFQKYIEET-TSFPWSYAHVGVELALDHKKSPFLKQTKDLGCAHNLEALLHLVD  441

Query  1477  GYHGD----GRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1644
             GYHG      ++F   T RDIALVNK  +FL+ ++ VPP WRQDENKGMV+  DGRW++P
Sbjct  442   GYHGKEEGGEKKFCLVTKRDIALVNKSCDFLRSDYHVPPCWRQDENKGMVKNEDGRWILP  501

Query  1645  ERSRIEAH-PPDTGHH  1689
             +R R+E H P D  HH
Sbjct  502   DRPRLEPHQPEDITHH  517



>gb|KFK35847.1| hypothetical protein AALP_AA4G044700 [Arabis alpina]
Length=522

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/430 (69%), Positives = 342/430 (80%), Gaps = 21/430 (5%)
 Frame = +1

Query  424   IWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFF  603
             IW E+QG  +WEGLL+PMN+HLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY  + FF
Sbjct  90    IWREVQGCNNWEGLLDPMNNHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHPSNFF  149

Query  604   EKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRL  780
               L +   +GY I+RYLYATSNINLPNFFQ S ++ IWSQHANWMGY+AVATDE E+ RL
Sbjct  150   SNLDLNLHKGYTITRYLYATSNINLPNFFQKSKLSSIWSQHANWMGYIAVATDEEEVARL  209

Query  781   GRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCS  960
             GRRDIVI+WRGTVTYLEWI+DLK+IL   +F DDP IKIE GF DLYT  KK+  C F S
Sbjct  210   GRRDIVISWRGTVTYLEWIYDLKDILCSANFGDDPLIKIELGFHDLYT--KKEDSCKFSS  267

Query  961   YSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
             +SAREQ+LAEV RL+E Y    +   +SITVTGHSLGAALAL+SAYDIAE+K+N +    
Sbjct  268   FSAREQVLAEVKRLLEYYGTGEEAHEISITVTGHSLGAALALVSAYDIAELKLNHI----  323

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1308
                       K+P+SVFSF+GPRVGNLRFKERC+ELG+KVLR+VNV DKVP+VPGI ANE
Sbjct  324   -----AENNYKVPISVFSFSGPRVGNLRFKERCEELGVKVLRVVNVHDKVPSVPGIFANE  378

Query  1309  KFQYQKQLE-TTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYH  1485
             KFQ+QK +E TTL  FPWSYAHVGVELALDH  SPFLK   DLGCAHNLE  LHLVDGYH
Sbjct  379   KFQFQKYIEDTTL--FPWSYAHVGVELALDHKKSPFLKQTKDLGCAHNLEALLHLVDGYH  436

Query  1486  G-DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIE  1662
             G +  RF   T RDIALVNK  +FL+ ++ VPP WRQDENKGMV+  DGRWV+P+R R+E
Sbjct  437   GKEEERFSLVTKRDIALVNKSCDFLRSDYHVPPCWRQDENKGMVKNGDGRWVLPDRPRLE  496

Query  1663  AH-PPDTGHH  1689
              H P D  HH
Sbjct  497   PHLPEDMTHH  506



>ref|XP_010500719.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Camelina 
sativa]
Length=527

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/434 (68%), Positives = 342/434 (79%), Gaps = 21/434 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L +IW E+QG  +WEGLL+PMN+HLRREIIRYGEFAQ CYDSFDFDPHSKYCG+CKY  +
Sbjct  88    LRDIWREVQGCNNWEGLLDPMNNHLRREIIRYGEFAQGCYDSFDFDPHSKYCGSCKYHPS  147

Query  595   QFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              FF  L +   +GY I+ YLYATSNINLPNFFQ S ++ IWSQHANWMGYVAVATDE E+
Sbjct  148   DFFSNLDLHLHKGYTITCYLYATSNINLPNFFQKSKLSSIWSQHANWMGYVAVATDEEEV  207

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
              RLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F DDP IKIE GF+DLYT  KK+  C 
Sbjct  208   SRLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPLIKIELGFYDLYT--KKEVSCK  265

Query  952   FCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1119
             F S+SAREQ+LAEV RL+E Y    +G  +SITVTGHSLGA+LAL+SAYDIAE+ +N + 
Sbjct  266   FSSFSAREQVLAEVKRLLEYYGTGEEGHEISITVTGHSLGASLALVSAYDIAELNLNYLP  325

Query  1120  egegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGII  1299
                          K+P++VFSF+GPRVGNLRFKERCDELG+KVLR+VN+ DKVP+VPGI 
Sbjct  326   ---------ENNNKVPITVFSFSGPRVGNLRFKERCDELGLKVLRVVNIHDKVPSVPGIF  376

Query  1300  ANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDG  1479
             ANEKF +QK +E    +FPWSYAHVGVELALDH  SPFLK   DLGCAHNLE  LHLVDG
Sbjct  377   ANEKFHFQKYVEEK-TSFPWSYAHVGVELALDHKKSPFLKQTRDLGCAHNLEALLHLVDG  435

Query  1480  YHGDGR---RFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             YHG       F SAT RDIALVNK  +FL+ E+ VPP WRQDENKGMV++SDGRWV+PER
Sbjct  436   YHGKEEAETMFCSATNRDIALVNKSCDFLRSEYHVPPCWRQDENKGMVKSSDGRWVLPER  495

Query  1651  SRIEAH-PPDTGHH  1689
              ++E H P D  HH
Sbjct  496   PQLEPHWPEDIAHH  509



>ref|XP_009147767.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Brassica 
rapa]
Length=518

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/434 (68%), Positives = 343/434 (79%), Gaps = 20/434 (5%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             NL  IW E+QG  +WEGLL+PMN+HLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY  
Sbjct  81    NLGSIWREVQGCNNWEGLLDPMNNHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHP  140

Query  592   AQFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
             + FF  L +   +GY I+RYLYATSNINLPNFFQ S ++ IWSQHANWMGY+AVATDE E
Sbjct  141   SDFFSNLDLNLHKGYTITRYLYATSNINLPNFFQRSKLSSIWSQHANWMGYIAVATDEEE  200

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
             + RLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F DDP IKIE GF DLYT  KK+  C
Sbjct  201   VARLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPSIKIELGFHDLYT--KKEDSC  258

Query  949   NFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
              F S+SAREQ+L+EV RLIE Y   G  +SITVTGHSLGAALAL+SAYD+AE+ +N +  
Sbjct  259   KFSSFSAREQVLSEVKRLIEYYGQAGHEISITVTGHSLGAALALVSAYDVAELNLNHIP-  317

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
                        TK+PVSVFSF+GPRVGNLRFKERC+ELG+KVLR++NV DKVP+VPGI A
Sbjct  318   --------DNNTKVPVSVFSFSGPRVGNLRFKERCEELGVKVLRVINVHDKVPSVPGIFA  369

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             NEKFQ+QK +E    +FPWSYAHVG ELALDH  SPFLK   DLGCAHNLE  LHLVDGY
Sbjct  370   NEKFQFQKYIEEA-TSFPWSYAHVGTELALDHKKSPFLKPTKDLGCAHNLEALLHLVDGY  428

Query  1483  H----GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             H    G+ ++F   T RDIALVNK  +FLK ++ VPP WRQDENKGMV+T DGRWV+P+R
Sbjct  429   HGGEEGEEKKFCLVTKRDIALVNKSCDFLKSDYHVPPCWRQDENKGMVKTGDGRWVLPDR  488

Query  1651  SRIEAH-PPDTGHH  1689
              R+E H P D  HH
Sbjct  489   PRLEPHRPEDITHH  502



>emb|CDY22842.1| BnaA06g02350D [Brassica napus]
Length=518

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/434 (68%), Positives = 342/434 (79%), Gaps = 20/434 (5%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             NL  IW E+QG  +WEGLL+PMN+HLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY  
Sbjct  81    NLGSIWREVQGCNNWEGLLDPMNNHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHP  140

Query  592   AQFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
             + FF  L +   +GY I+RYLYATSNINLPNFFQ S ++ IWSQHANWMGY+AVATDE E
Sbjct  141   SDFFSNLDLNLHKGYTITRYLYATSNINLPNFFQRSKLSSIWSQHANWMGYIAVATDEEE  200

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
             + RLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F DDP IKIE GF DLYT  KK+  C
Sbjct  201   VARLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPSIKIELGFHDLYT--KKEDSC  258

Query  949   NFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
              F S+SAREQ+L+EV RLIE Y   G  +SITVTGHSLGAALAL+SAYDIAE+ +N +  
Sbjct  259   KFSSFSAREQVLSEVKRLIEYYGQAGHEISITVTGHSLGAALALVSAYDIAELNLNHIP-  317

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
                        TK+PVSVFSF+GPRVGNLRFKERC+ELG+KVLR++NV DKVP+VPGI A
Sbjct  318   --------ENNTKVPVSVFSFSGPRVGNLRFKERCEELGVKVLRVINVHDKVPSVPGIFA  369

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             NEKF +QK +E    +FPWSYAHVG ELALDH  SPFLK   DLGCAHNLE  LHLVDGY
Sbjct  370   NEKFLFQKYIEEA-TSFPWSYAHVGTELALDHKKSPFLKPTKDLGCAHNLEALLHLVDGY  428

Query  1483  H----GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             H    G+ ++F   T RDIALVNK  +FLK ++ VPP WRQDENKGMV+T DGRWV+P+R
Sbjct  429   HGGEEGEEKKFCLVTKRDIALVNKSCDFLKSDYHVPPCWRQDENKGMVKTGDGRWVLPDR  488

Query  1651  SRIEAH-PPDTGHH  1689
              R+E H P D  HH
Sbjct  489   PRLEPHRPEDITHH  502



>ref|NP_564590.1| DAD1-like lipase 2 [Arabidopsis thaliana]
 sp|Q9C8J6.1|PLA17_ARATH RecName: Full=Phospholipase A1-Igamma3, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG52635.1|AC024261_22 hypothetical protein; 69776-68193 [Arabidopsis thaliana]
 gb|AAL11566.1|AF424572_1 At1g51440/F5D21_19 [Arabidopsis thaliana]
 gb|AAM98287.1| At1g51440/F5D21_19 [Arabidopsis thaliana]
 dbj|BAE99030.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32668.1| phospholipase A1-Igamma3 [Arabidopsis thaliana]
Length=527

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/436 (68%), Positives = 339/436 (78%), Gaps = 22/436 (5%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             +L EIW E+QG  +WEG L+PMN+HLRREIIRYGEFAQACYDSFDFDPHSKYCG+CKY  
Sbjct  86    SLREIWREVQGCNNWEGQLDPMNNHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHP  145

Query  592   AQFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
             + FF  L +   +GY I+RYLYATSNINLPNFFQ S ++ IWSQHANWMG+VAVATDE E
Sbjct  146   SDFFLNLDLHLHKGYTITRYLYATSNINLPNFFQKSKLSSIWSQHANWMGFVAVATDEEE  205

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
             + RLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F DDP IKIE GF DLYT  KK+  C
Sbjct  206   VSRLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPSIKIELGFHDLYT--KKEDSC  263

Query  949   NFCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
              F S+SAREQ+LAEV RLIE Y    +G   SITVTGHSLGA+LAL+SAYDIAE+ +N V
Sbjct  264   KFSSFSAREQVLAEVKRLIEYYGTEEEGHKTSITVTGHSLGASLALVSAYDIAELNLNHV  323

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
                           KIP++VFSF+GPRVGNLRFKERCDELG+KVLR+VNV DKVP+VPGI
Sbjct  324   P---------ENNYKIPITVFSFSGPRVGNLRFKERCDELGVKVLRVVNVHDKVPSVPGI  374

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
               NEKFQ+QK +E    +FPWSYAHVGVELALDH  SPFLK   DLGCAHNLE  LHLVD
Sbjct  375   FTNEKFQFQKYVEEK-TSFPWSYAHVGVELALDHKKSPFLKPTKDLGCAHNLEALLHLVD  433

Query  1477  GYHGDG----RRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1644
             GYHG      +RF   T RDIALVNK  +FL+ E+ VPP WRQDENKGMV+  DG+WV+P
Sbjct  434   GYHGKDEEAEKRFCLVTKRDIALVNKSCDFLRGEYHVPPCWRQDENKGMVKNGDGQWVLP  493

Query  1645  ERSRIEAH-PPDTGHH  1689
             +R  +E H P D  HH
Sbjct  494   DRPLLEPHGPEDIAHH  509



>emb|CDY49813.1| BnaC06g04560D [Brassica napus]
Length=517

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/434 (67%), Positives = 340/434 (78%), Gaps = 20/434 (5%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             +L  IW E+QG  +WEGLL+PMN+HLR EIIRYGEFAQACYDSFDFDPHSKYCG+CKY  
Sbjct  80    SLGSIWREVQGCNNWEGLLDPMNNHLRSEIIRYGEFAQACYDSFDFDPHSKYCGSCKYHP  139

Query  592   AQFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
             +  F  L +   +GY I+RYLYATSNINLPNFFQ S ++ IWSQHANWMGY+AVATDE E
Sbjct  140   SDLFSNLDLNLHKGYTITRYLYATSNINLPNFFQRSKLSSIWSQHANWMGYIAVATDEEE  199

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
             + RLGRRDIVIAWRGTVTYLEWI+DLK+IL   +F DDP +KIE GF DLYT  KK+  C
Sbjct  200   VARLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPSVKIELGFHDLYT--KKEDSC  257

Query  949   NFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
              F S+SAREQ+L+EV RL+E Y   G  +SITVTGHSLGAALAL+SAYDIAE+ +N +  
Sbjct  258   KFSSFSAREQVLSEVKRLVEYYGQAGHEISITVTGHSLGAALALVSAYDIAELNLNHIP-  316

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
                        TK+PV+VFSF+GPRVGNLRFKERC+EL +KVLR++NV DKVP+VPGI A
Sbjct  317   --------ENNTKVPVTVFSFSGPRVGNLRFKERCEELDVKVLRVINVHDKVPSVPGIFA  368

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             NEKFQ+QK +E    +FPWSYAHVG ELALDH  SPFLK   DLGCAHNLE  LHLVDGY
Sbjct  369   NEKFQFQKYIEEA-TSFPWSYAHVGTELALDHKKSPFLKPTKDLGCAHNLEALLHLVDGY  427

Query  1483  H----GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             H    G+ ++F   T RDIALVNK  +FLK ++ VPP WRQDENKGMV+T DGRWV+P+R
Sbjct  428   HGEEEGEEKKFCLVTKRDIALVNKSCDFLKSDYHVPPCWRQDENKGMVKTGDGRWVLPDR  487

Query  1651  SRIEAH-PPDTGHH  1689
              R+E H P D  HH
Sbjct  488   PRLEPHRPEDITHH  501



>ref|XP_006853086.1| hypothetical protein AMTR_s00038p00106840 [Amborella trichopoda]
 gb|ERN14553.1| hypothetical protein AMTR_s00038p00106840 [Amborella trichopoda]
Length=559

 Score =   536 bits (1382),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 270/427 (63%), Positives = 317/427 (74%), Gaps = 17/427 (4%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L E W EIQG   W GLL+PM+  LRREIIRYGEFAQACYD+FDFDP+SKYCGTCKY G 
Sbjct  97    LSERWREIQGENHWNGLLDPMDGLLRREIIRYGEFAQACYDAFDFDPYSKYCGTCKYTGG  156

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
              FFEKLGMAD G+ +SRYLYATSNINL NFF+ S + ++WS HANWMGYVAV  D  E++
Sbjct  157   HFFEKLGMADSGHDLSRYLYATSNINLRNFFRKSKLTKVWSTHANWMGYVAVTMDPHEVQ  216

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  954
             RLGRRD+VIAWRGTVTYLEW+ DL + L    F  D  +K+ESGF DLYT  +K+  CN+
Sbjct  217   RLGRRDVVIAWRGTVTYLEWLEDLMDYLAVPGFGPDGSVKVESGFLDLYT--QKEHSCNY  274

Query  955   CSYSAREQLLAEVNRLIERYKGE--NLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
             CS+SAREQ+L+++ RL+ERYK +   LSITVTGHSLG ALALLSAYDIAE  +N++    
Sbjct  275   CSFSAREQVLSDIRRLMERYKDDEHELSITVTGHSLGGALALLSAYDIAETGLNILP---  331

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1308
                       + PV+VFSF  PRVGN RF+ERC ELG+ VLR VNV D VP VPG++ NE
Sbjct  332   -------DGRRAPVTVFSFGAPRVGNRRFRERCKELGVSVLRTVNVHDSVPKVPGVLVNE  384

Query  1309  KFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1488
                  + L   L   PWSYAHVGVELALD + SPFLK G D    HN+E HLHLVDG+ G
Sbjct  385   HVSVPRALADGL---PWSYAHVGVELALDDTKSPFLKPGLDPASRHNMELHLHLVDGHRG  441

Query  1489  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAH  1668
              G +F  A  RD+AL+NK    L+ E+GVPP WRQDENKGMVR  DGR+VVPER RI+AH
Sbjct  442   PGHKFLLADKRDVALLNKSGGLLRDEYGVPPNWRQDENKGMVRGPDGRYVVPERPRIDAH  501

Query  1669  PPDTGHH  1689
             PPDT HH
Sbjct  502   PPDTAHH  508



>ref|XP_002513514.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF48917.1| triacylglycerol lipase, putative [Ricinus communis]
Length=469

 Score =   526 bits (1355),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 284/478 (59%), Positives = 337/478 (71%), Gaps = 52/478 (11%)
 Frame = +1

Query  259   LNPHYSSLKCRVSL-PAAAINAPPQRETGQSSNKNdeeqeedeelcveedGRNLHEIWAE  435
             L+P Y+  K +  L P+   +  P      +S+ +    + DE L  +ED R L EIW +
Sbjct  23    LSPRYALTKSKAFLIPSNPFSPNPGALIKCTSSVSSLTPQLDETLVYQEDERPLTEIWKD  82

Query  436   IQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLG  615
             IQG  DWEGLL+PMNSHLR+EIIRYGEFAQACYDSFDFDPHSKYCGTCKY G+ FF+KL 
Sbjct  83    IQGCNDWEGLLDPMNSHLRKEIIRYGEFAQACYDSFDFDPHSKYCGTCKYQGSHFFDKLD  142

Query  616   MADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDI  795
             M   GY+ISRYLYATSNINLPNFFQ S ++ IWS HANWMGYVAV TDE EI RLGRRDI
Sbjct  143   MHGHGYQISRYLYATSNINLPNFFQKSKLSNIWSTHANWMGYVAVTTDEEEIIRLGRRDI  202

Query  796   VIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYSARE  975
             VIAWRGTVTYLEWI+DLK+IL   +F +DP IKIE GF+DLYT  KK+  C +C++SARE
Sbjct  203   VIAWRGTVTYLEWIYDLKDILCSANFINDPSIKIELGFYDLYT--KKEDSCKYCTFSARE  260

Query  976   QLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegessstsaa  1155
             Q+LAE+ RL++ Y+GE +SIT+TGHSLGAALA+LSAYDIAEMK+N +             
Sbjct  261   QVLAEIKRLLDYYRGEEISITLTGHSLGAALAVLSAYDIAEMKLNYMD----------DG  310

Query  1156  tKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLE  1335
             T+IP++V+SF+    G                               I+N        L+
Sbjct  311   TEIPITVYSFSALEWG-------------------------------ISN--------LK  331

Query  1336  TTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSAT  1515
                 +   +YAHVGVELALDH++SPFLK   DL CAHNLE HLHLVDGYHG GRRF  AT
Sbjct  332   NDAMSLELNYAHVGVELALDHTHSPFLKPTNDLACAHNLEVHLHLVDGYHGKGRRFFLAT  391

Query  1516  GRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPPDTGHH  1689
              RDIALVNK  +FL+ E+GVPP WRQDENKGMVR S+GRWVVPER R+EA PPDT HH
Sbjct  392   KRDIALVNKSCDFLRAEYGVPPHWRQDENKGMVRNSEGRWVVPERPRVEALPPDTAHH  449



>gb|ABR16123.1| unknown [Picea sitchensis]
Length=554

 Score =   526 bits (1356),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 265/431 (61%), Positives = 321/431 (74%), Gaps = 16/431 (4%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             RNL +IW EIQG+ +WEGLL+PM+  LR+EIIRYGEFAQACYD FDFDP SKYCG+CKY 
Sbjct  108   RNLEDIWREIQGANNWEGLLDPMDGILRKEIIRYGEFAQACYDGFDFDPFSKYCGSCKYH  167

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               + F+ +GM+D GY +++YLYATSNINL   FQ   V ++WS HANWMG++AVATDE E
Sbjct  168   RRELFQGVGMSDYGYEVTKYLYATSNINLTGLFQKPRVQKMWSTHANWMGFIAVATDEEE  227

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPT---HFRDDPDIKIESGFFDLYTNSKKD  939
             I+RLGRRDIVIAWRGTVTYLEWI DL + L P    +    PD+KIESGF  LYT   ++
Sbjct  228   IKRLGRRDIVIAWRGTVTYLEWIADLMDYLRPAELNYVHPHPDVKIESGFLSLYT--ARE  285

Query  940   TDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1119
              DC FC  SAR+Q+L+E+ RL+++YKGE LSIT+TGHSLG+ALA+LSAYDIAE+ +N   
Sbjct  286   RDCRFCKSSARDQVLSELRRLLQKYKGEQLSITITGHSLGSALAMLSAYDIAELGLN---  342

Query  1120  egegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGII  1299
                 +S S   A  IP++VFSFAGPRVGN  FK+RC+ELG+K LR+VNV D VP VPGI+
Sbjct  343   ----QSESDDRAESIPITVFSFAGPRVGNAAFKDRCEELGLKFLRVVNVHDIVPKVPGIL  398

Query  1300  ANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDG  1479
              NE F+  KQ    +   PWSY HVGV+L LDH+ SPFLK   D  C HNLE HLHL+DG
Sbjct  399   FNETFKMMKQW---IDKLPWSYCHVGVKLVLDHTQSPFLKPTNDSSCFHNLEAHLHLLDG  455

Query  1480  YHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR-  1656
             YHG G+RF   + RD ALVNK  +FLK  H VPP WRQD NKG+++ S+GRWV PER R 
Sbjct  456   YHGRGQRFCLTSRRDPALVNKSCDFLKEHHLVPPFWRQDANKGLIQNSEGRWVQPERIRI  515

Query  1657  IEAHPPDTGHH  1689
             IE    D  HH
Sbjct  516   IEESHMDPDHH  526



>ref|XP_011042424.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X1 [Populus euphratica]
Length=513

 Score =   513 bits (1322),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 260/431 (60%), Positives = 316/431 (73%), Gaps = 19/431 (4%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L ++W EIQG  DW GLL+PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  88    RRLADVWREIQGQDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFI  147

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +F E LGMA  GY ++RYLYATSNI+LPNFF+ S   ++WS  ANW+GYVAV+ DE  
Sbjct  148   RRRFLESLGMAHHGYEVTRYLYATSNIDLPNFFKKSRWPKVWSNKANWIGYVAVSDDET-  206

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
              + LGRRDI IAWRGTVT+LEWI DL + L P +       DP +K+E GF DLYT+  K
Sbjct  207   TKCLGRRDISIAWRGTVTHLEWISDLMDFLKPINANKIPCPDPTVKVEYGFLDLYTD--K  264

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D +C FC YSAREQ+L+EV RL E Y  E +SIT+TGHSLG+ALA+LSAYDIAE  ++V+
Sbjct  265   DENCRFCKYSAREQILSEVKRLTEMYADEEMSITITGHSLGSALAMLSAYDIAETGLHVM  324

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
             Q+G            +PVSVFSF+GPRVGN+RFKER + LG+KVLR+VNV+D VP  PG+
Sbjct  325   QDGRA----------LPVSVFSFSGPRVGNVRFKERIESLGVKVLRVVNVQDMVPKSPGL  374

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
               NE  Q    L    +  PW+Y+HVGVELALDH  SPFLK  +D  CAHNLE HLHL+D
Sbjct  375   FFNE--QMPPPLMKMAEGLPWAYSHVGVELALDHRNSPFLKQTSDPACAHNLEAHLHLLD  432

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG G RF  A+GRD ALVNK  +FLK  H VPP WRQDENKGM+R +DGRWV PER +
Sbjct  433   GYHGKGHRFVLASGRDPALVNKACDFLKDHHLVPPNWRQDENKGMIRNNDGRWVQPERPK  492

Query  1657  IEAHPPDTGHH  1689
             ++ HP DT  H
Sbjct  493   LDDHPLDTHDH  503



>ref|XP_002302074.2| hypothetical protein POPTR_0002s04560g [Populus trichocarpa]
 gb|EEE81347.2| hypothetical protein POPTR_0002s04560g [Populus trichocarpa]
Length=515

 Score =   513 bits (1321),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 259/431 (60%), Positives = 311/431 (72%), Gaps = 19/431 (4%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L ++W EIQG  DW GLL+PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  88    RKLADVWREIQGKDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFM  147

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +FFE LGM   GY ++RYLY TSNINLPNFF+ S   ++WS  ANW+GYVAV+ DE  
Sbjct  148   SHRFFESLGMTRHGYEVTRYLYGTSNINLPNFFKKSRWPKVWSNVANWIGYVAVSNDET-  206

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
              +RLGRRDI +AWRGTVT LEWI DL + L P +       DP +K+ESGF DLYT+  K
Sbjct  207   TKRLGRRDITVAWRGTVTRLEWIADLMDFLKPVNGNKIPCPDPTVKVESGFLDLYTD--K  264

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D +C FC YSAREQ+LAEV RL E Y  E +SIT+TGHSLG ALA+LSAYDI E  ++V+
Sbjct  265   DENCRFCKYSAREQILAEVKRLTEMYADEEMSITITGHSLGGALAMLSAYDIVETGLHVM  324

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
             Q+             +PVSVFSF+GPRVGN+RFKER + LG+KVLR+VNV+D VP  PG+
Sbjct  325   QDSRA----------LPVSVFSFSGPRVGNVRFKERIESLGVKVLRVVNVQDVVPKSPGL  374

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
               NE  Q    L    +  PW Y+HVGVELALDH  SPFLK   D  CAHNLE  LHL+D
Sbjct  375   FFNE--QVPPMLMKLTEGLPWCYSHVGVELALDHKNSPFLKQTGDPVCAHNLEALLHLLD  432

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG G+RF  A+GRD ALVNK  +FLK  + VPP WRQDENKGMVR  DGRWV P+R +
Sbjct  433   GYHGKGQRFVLASGRDPALVNKACDFLKDHYLVPPNWRQDENKGMVRNGDGRWVQPDRPK  492

Query  1657  IEAHPPDTGHH  1689
             ++ HP DT HH
Sbjct  493   LDDHPVDTHHH  503



>ref|XP_002306818.1| hypothetical protein POPTR_0005s24000g [Populus trichocarpa]
 gb|EEE93814.1| hypothetical protein POPTR_0005s24000g [Populus trichocarpa]
Length=513

 Score =   509 bits (1312),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 259/431 (60%), Positives = 315/431 (73%), Gaps = 19/431 (4%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L ++W EIQG  DW GLL+PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  88    RKLADVWREIQGQDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFI  147

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +F E LGMA  GY ++RYLYATSNI+L NFF+ S   ++WS  ANW+GYVAV+ DE  
Sbjct  148   RRRFLESLGMAHHGYEVTRYLYATSNIDLSNFFKKSRWPKVWSNKANWIGYVAVSDDET-  206

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
              + LGRRDI IAWRGTVT+LEWI DL + L P +       DP +K+E GF DLYT+  K
Sbjct  207   TKCLGRRDISIAWRGTVTHLEWISDLMDFLKPINGNKIPCPDPTVKVEYGFLDLYTD--K  264

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D +C FC YSAREQ+L+EV RL E Y  E +SIT+TGHSLG+ALA+LSAYDIAE  ++V+
Sbjct  265   DENCRFCKYSAREQILSEVKRLTEMYADEEMSITITGHSLGSALAILSAYDIAETGLHVM  324

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
             Q+G            +PVSVFSF+GPRVGN+RFKER + LG+KVLR+VNV+D VP  PG+
Sbjct  325   QDGRA----------LPVSVFSFSGPRVGNVRFKERIESLGVKVLRVVNVQDMVPKSPGL  374

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
               NE  Q    L    +  PW+Y+HVGVELALDH  SPFLK  +D  CAHNLE HLHL+D
Sbjct  375   FFNE--QVPPPLMKLAEGLPWAYSHVGVELALDHRNSPFLKQTSDPACAHNLEAHLHLLD  432

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG G RF  A+GRD ALVNK  +FLK  H VPP WRQDENKGM+R +DGRWV PER +
Sbjct  433   GYHGKGHRFVLASGRDPALVNKACDFLKDHHLVPPNWRQDENKGMIRNNDGRWVQPERPK  492

Query  1657  IEAHPPDTGHH  1689
             ++ HP DT  H
Sbjct  493   LDEHPLDTHDH  503



>ref|XP_007050417.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOX94574.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=516

 Score =   509 bits (1312),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 257/431 (60%), Positives = 312/431 (72%), Gaps = 19/431 (4%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R + ++W EI G  DW G+L+PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  91    RRVADVWKEIHGQDDWVGMLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFA  150

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
              +QFF+ LGMA  GY +SRYL+ATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE  
Sbjct  151   QSQFFDSLGMAHHGYLVSRYLFATSNINLPNFFKKSRWPKVWSKNANWIGYVAVSNDEMS  210

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
              +RLGRRDI IAWRGTVT LEWI DL + L P         D  +K+ESGF DLYT+  K
Sbjct  211   -KRLGRRDITIAWRGTVTRLEWIADLMDFLKPISSNKIPCPDSTVKVESGFLDLYTD--K  267

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D  C FC +SAREQ+L EV RL+E Y+ E +SIT+TGHSLG+ALA+LSAYDI E  +NV+
Sbjct  268   DEKCLFCKFSAREQILTEVKRLVEMYQDEEISITITGHSLGSALAILSAYDIVETGLNVL  327

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
             Q+             +PVSVFSF+GPRVGN+RFKER + LG+KVLR+VNV D VP  PG+
Sbjct  328   QDSRA----------VPVSVFSFSGPRVGNVRFKERIETLGVKVLRVVNVHDIVPKSPGL  377

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
               NE       L    +  PWSY+HVGVELALDH  SPFL+   D  CAHNLE HLHL+D
Sbjct  378   FFNE--NVSPVLMKLAEGLPWSYSHVGVELALDHKNSPFLEDTGDPTCAHNLEAHLHLLD  435

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG G RF  A+GRD ALVNK  +FLK  + VPP WRQDENKGMVR  DGRW+ PER +
Sbjct  436   GYHGKGHRFVLASGRDPALVNKACDFLKDHYLVPPYWRQDENKGMVRNKDGRWMQPERPK  495

Query  1657  IEAHPPDTGHH  1689
              + HP DT HH
Sbjct  496   FDDHPEDTLHH  506



>ref|XP_009782117.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Nicotiana 
sylvestris]
Length=521

 Score =   509 bits (1312),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 257/430 (60%), Positives = 313/430 (73%), Gaps = 20/430 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L + W EI G  DW G+L+P++  LR E+IRYGE AQACYD+FDFDP+SKYCG+CK+   
Sbjct  98    LADYWLEILGKDDWVGILDPLDPLLRNELIRYGEMAQACYDAFDFDPYSKYCGSCKFPRH  157

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             +FF+ L MA+ GY I+RYLYATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE   +
Sbjct  158   KFFDGLDMANYGYDITRYLYATSNINLPNFFKQSRWPKVWSKNANWIGYVAVSNDETS-K  216

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  942
             RLGRRDI I+WRGTVT LEWI DL + L P         DP++K+ESGF DLYT+  KD 
Sbjct  217   RLGRRDITISWRGTVTRLEWIADLMDFLRPISSDKIPCPDPNVKVESGFLDLYTD--KDE  274

Query  943   DCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
             +C +C +SAREQ+L EV RL+E+Y  E +SITVTGHSLG+ALA+LSAYDI E  VNV   
Sbjct  275   NCRYCKFSAREQILTEVKRLVEKYPTEEMSITVTGHSLGSALAILSAYDIVETGVNV---  331

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
                     +    +P+ VFSFAGPRVGN RFK+R + LG+KVLR+VNV D VP  PG++ 
Sbjct  332   -------RANTRAVPIGVFSFAGPRVGNTRFKQRLEMLGVKVLRVVNVHDIVPKSPGLVF  384

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             NE       +    +  PWSY+HVGVELALDH  SPFLK   DL CAHNLE HLHL+DGY
Sbjct  385   NE--HSPSMVMKICEGLPWSYSHVGVELALDHKNSPFLKPTNDLVCAHNLEAHLHLLDGY  442

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRI-  1659
             HG GRRF  A GRDIALVNK  +FLK  + VPP WRQDENKGM+R  DGRW+ PER R+ 
Sbjct  443   HGKGRRFVLAKGRDIALVNKACDFLKDHYCVPPNWRQDENKGMIRDKDGRWIQPERPRVL  502

Query  1660  EAHPPDTGHH  1689
             + HPPD  HH
Sbjct  503   DDHPPDIHHH  512



>gb|KDP21366.1| hypothetical protein JCGZ_21837 [Jatropha curcas]
Length=500

 Score =   508 bits (1307),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 257/431 (60%), Positives = 314/431 (73%), Gaps = 19/431 (4%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L +IW EI G  DW GLL+P++  LR E+IRYGE AQACYD+FD+DP+SKYCG+C++ 
Sbjct  74    RKLADIWREIHGQDDWVGLLDPIDPILRTELIRYGEIAQACYDAFDYDPYSKYCGSCRFM  133

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +FF+ LGM   GY +SRYLYAT+NI+LPNFF+ S   ++WS+ ANW+GYVAV+ DE  
Sbjct  134   RRRFFDSLGMGHHGYEVSRYLYATTNIDLPNFFKESRWPKVWSRKANWIGYVAVSNDET-  192

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
              +RLGRRDIVIAWRGTVT LEWI DL + L P +       DP +K+ESGF DLYT+  K
Sbjct  193   TKRLGRRDIVIAWRGTVTRLEWIADLMDFLKPINGNKIPCPDPAVKVESGFLDLYTD--K  250

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D +C FC +SAREQ+L EV RL E +  E +SIT+TGHSLG+ALA+LSAYD+ E  ++V+
Sbjct  251   DENCRFCKFSAREQVLTEVKRLTEMHSNEEVSITITGHSLGSALAILSAYDLVETGLHVM  310

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
             Q+             +PV VFSF+GPRVGN RFKER + LG+KVLR+VNV D VP  PG 
Sbjct  311   QDCRA----------LPVCVFSFSGPRVGNARFKERIESLGVKVLRVVNVHDVVPKAPGF  360

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
               NE  Q    L       PW Y+HVGVELALDH++SPFLK  +D  CAHNLE HLHL+D
Sbjct  361   FFNE--QVPPMLMKLAGGLPWCYSHVGVELALDHTHSPFLKETSDPVCAHNLEAHLHLLD  418

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG GRRF  A GRD ALVNK S+FLK  + VPP WRQDENKGMVR +DGRW+ PER R
Sbjct  419   GYHGKGRRFVLAGGRDPALVNKASDFLKDHYLVPPFWRQDENKGMVRNNDGRWIQPERPR  478

Query  1657  IEAHPPDTGHH  1689
             ++ HPPD  HH
Sbjct  479   LDDHPPDIHHH  489



>ref|XP_009603052.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=522

 Score =   508 bits (1308),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 256/430 (60%), Positives = 313/430 (73%), Gaps = 20/430 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L + W EI G  DW G+L+P++  LR E+IRYGE AQACYD+FDFDP+SKYCG+CK+   
Sbjct  99    LADRWLEIFGKDDWVGMLDPLDPLLRNELIRYGEMAQACYDAFDFDPYSKYCGSCKFPRH  158

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             +FF+ L M + GY I+RYLYATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE   +
Sbjct  159   KFFDGLDMVNYGYDITRYLYATSNINLPNFFKQSRWPKVWSKNANWIGYVAVSNDETS-K  217

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  942
             RLGRRDI IAWRGTVT LEWI DL + L P         DP++K+ESGF DLYT+  KD 
Sbjct  218   RLGRRDITIAWRGTVTRLEWIADLMDFLRPISSDKIPCPDPNVKVESGFLDLYTD--KDE  275

Query  943   DCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
             +C +C +SAREQ+L EV RL+E+Y  E +SITVTGHSLG+ALA+LSAYDI E  +N+   
Sbjct  276   NCRYCKFSAREQILTEVKRLVEKYPNEEMSITVTGHSLGSALAILSAYDIVETGLNI---  332

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
                     +    +P+ VFSFAGPRVGN RFKER ++LG+KVLR+VNV D VP  PG++ 
Sbjct  333   -------RADTRTVPIGVFSFAGPRVGNARFKERLEKLGVKVLRVVNVHDIVPKSPGLVF  385

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             NE       +    +  PWSY+HVGVELALDH  SPFLK   DL CAHNLE HLHL+DGY
Sbjct  386   NE--HSPSMVMKICEGLPWSYSHVGVELALDHKNSPFLKPTNDLVCAHNLEAHLHLLDGY  443

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRI-  1659
             HG GRRF  A GRDIALVNK  +FLK  + VPP WRQDENKGM+R  DGRW+ PER R+ 
Sbjct  444   HGKGRRFVLAKGRDIALVNKACDFLKDHYCVPPNWRQDENKGMIRDKDGRWIQPERPRVL  503

Query  1660  EAHPPDTGHH  1689
             + HPPD  HH
Sbjct  504   DDHPPDIHHH  513



>ref|XP_004289898.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=537

 Score =   509 bits (1310),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 258/431 (60%), Positives = 312/431 (72%), Gaps = 19/431 (4%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L + W E+ G  DW GLL+PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  100   RRLPDAWRELHGEDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFT  159

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
              A FF+ LGM+  GY +SRYL+ATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE  
Sbjct  160   RANFFDSLGMSHHGYHVSRYLFATSNINLPNFFKKSRWPKVWSKNANWIGYVAVSDDET-  218

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
               RLGRRDI IAWRGTVT LEWI DL + L P         DP +K ESGF DLYT+  K
Sbjct  219   TARLGRRDISIAWRGTVTRLEWIVDLMDFLKPLSNNKIPCPDPHVKAESGFLDLYTD--K  276

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D  C FC+YSAREQ+L E+ RL+E+Y+ E LSIT+TGHSLG+ALA+LSAYDIAE  +NV 
Sbjct  277   DQTCRFCTYSAREQILTEIKRLMEKYRNEELSITITGHSLGSALAILSAYDIAETGLNV-  335

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
                       +    +PVSVFSF+GPRVGN+ FKER + LG+KVLR+VNV D VP  PG+
Sbjct  336   ---------KADGRVVPVSVFSFSGPRVGNVHFKERLEALGVKVLRVVNVHDVVPKSPGL  386

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
             + NE       +    +N PWSY+HVGVEL LDH  SPFLK   D GC+HNLE HLHL+D
Sbjct  387   LINE--HVPAMMLKLTENLPWSYSHVGVELELDHKNSPFLKQTNDPGCSHNLEAHLHLLD  444

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG G RF  A+GRD ALVNK S+FLK  + VPP WRQDENKGMVR  DGRW+ PER +
Sbjct  445   GYHGKGHRFVLASGRDPALVNKASDFLKDHYLVPPFWRQDENKGMVRCKDGRWMQPERPK  504

Query  1657  IEAHPPDTGHH  1689
             ++ HP D  HH
Sbjct  505   LDDHPEDIHHH  515



>ref|XP_008235325.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic [Prunus mume]
Length=510

 Score =   504 bits (1299),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 256/431 (59%), Positives = 311/431 (72%), Gaps = 19/431 (4%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L  +W E+ G  DW GLL+PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  85    RRLSNVWRELHGQDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFV  144

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
                FF  LGMA  GYR+SRYL+ATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE  
Sbjct  145   PRSFFPSLGMAHLGYRVSRYLFATSNINLPNFFKKSRWPKVWSKNANWIGYVAVSDDET-  203

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
               RLGRRDI IAWRGTVT LEWI DL + L P         DP +K+ESGF DLYT+  K
Sbjct  204   TARLGRRDISIAWRGTVTRLEWIVDLMDFLKPVSGNKIPCPDPTVKVESGFLDLYTD--K  261

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D  C + ++SAREQ+L E+ RL+E Y GE LSIT+TGHSLG+ALA+LSAYDI E  +NV 
Sbjct  262   DVTCRYSTFSAREQILTEIKRLVEMYTGEELSITITGHSLGSALAILSAYDITETGLNVT  321

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
              +G+           +PVSV SF+GPRVGN+RFKER + LG+KVLR+VNV D VP  PG+
Sbjct  322   ADGQV----------VPVSVLSFSGPRVGNVRFKERLESLGVKVLRVVNVHDVVPKSPGL  371

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
               NE      +L    +  PWSY+HVGV+L LDH  SPFLK  +D  CAHNLE HLHL+D
Sbjct  372   FFNE--HVAPRLMKLAEGLPWSYSHVGVQLELDHKNSPFLKQTSDPVCAHNLEAHLHLLD  429

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG G RF  A+GRD ALVNK S+FLK  + VPP WRQDENKGMVR+ DGRW+ PER +
Sbjct  430   GYHGKGHRFVLASGRDPALVNKASDFLKDHYLVPPYWRQDENKGMVRSKDGRWIQPERPK  489

Query  1657  IEAHPPDTGHH  1689
             ++ HP D  HH
Sbjct  490   LDDHPEDIHHH  500



>ref|XP_006349747.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Solanum 
tuberosum]
Length=507

 Score =   503 bits (1294),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 253/415 (61%), Positives = 307/415 (74%), Gaps = 19/415 (5%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI G  DW G+L+PM+  LR E+IRYGE AQACYD+FDFDP+SKYCG+CK+   +FF+
Sbjct  92    WLEIHGQDDWVGMLDPMDPILRNELIRYGEMAQACYDAFDFDPYSKYCGSCKFPRRKFFD  151

Query  607   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  786
              LGMA+ GY I+RYLYATSNINLPNFF+ S   +IWS++ANW+GYVAV+ DE   +RLGR
Sbjct  152   GLGMAEYGYDITRYLYATSNINLPNFFKQSRWPKIWSKNANWIGYVAVSNDET-TKRLGR  210

Query  787   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNF  954
             RDI IAWRGTVT LEWI DL + L P    +    DP++K+ESGF DLYT+  KD  C +
Sbjct  211   RDITIAWRGTVTRLEWIADLMDYLRPISSDNIPCPDPNVKVESGFLDLYTD--KDEKCRY  268

Query  955   CSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegege  1134
             C +SAREQ+L EV RLIE Y  E +SITVTGHSLG+ALA+LSAYDI E  +NV       
Sbjct  269   CKFSAREQILTEVKRLIEMYPDEEMSITVTGHSLGSALAILSAYDIVETGLNV-------  321

Query  1135  ssstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKF  1314
                 +  + +P+ VFSF+GPRVGN+RFKER ++LG+KVLR+VNV D VP  PG++ NE  
Sbjct  322   ---KADTSAVPICVFSFSGPRVGNVRFKERIEKLGVKVLRVVNVHDIVPKSPGLVLNE--  376

Query  1315  QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDG  1494
                  +    +  PWSY+HVGVELALDH  SPFLK  +DL CAHNLE HLHL+DGYHG G
Sbjct  377   HSPSMVMKICEKLPWSYSHVGVELALDHKNSPFLKPTSDLVCAHNLEAHLHLLDGYHGKG  436

Query  1495  RRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRI  1659
             RRF    GRDIALVNK  +FLK  + VPP WRQDENKGM+R  DGRW+ PER R+
Sbjct  437   RRFVLEKGRDIALVNKACDFLKDHYCVPPNWRQDENKGMIRDKDGRWLQPERPRL  491



>ref|XP_011026041.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Populus 
euphratica]
Length=513

 Score =   503 bits (1295),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 254/431 (59%), Positives = 308/431 (71%), Gaps = 19/431 (4%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L ++W EIQG  DW GLL+PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  88    RKLADVWREIQGKDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFM  147

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +FFE LGM   GY ++RYLYATS I LPNFF+ S   ++WS  A+W+GYVAV+ DE  
Sbjct  148   SHRFFESLGMTRHGYEVTRYLYATSTIKLPNFFKKSRWPKVWSNSASWIGYVAVSDDET-  206

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
              +RLGRRDI +AWRGTVT LEWI DL + L P +       DP +K+ESGF DLYT+  K
Sbjct  207   TKRLGRRDITVAWRGTVTRLEWIADLMDFLKPVNDNKIPCPDPTVKVESGFLDLYTD--K  264

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D +C FC YSAREQ+LAE  RL E Y  E +SIT+TGHSLG ALA+LSAYDI E  ++V+
Sbjct  265   DENCRFCKYSAREQILAEGKRLTEMYADEEMSITITGHSLGGALAMLSAYDIVETGLHVM  324

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
             Q+             +PVSVFSF+GPRVGN+RFKER + LG+KVLR+VNV+D VP  PG+
Sbjct  325   QDSRA----------LPVSVFSFSGPRVGNVRFKERIESLGVKVLRVVNVQDVVPKSPGL  374

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
               NE  Q    L    +  PW Y+HVGVELALDH  SPFLK   D  CAHNLE  LHL+D
Sbjct  375   FLNE--QVPPMLMKLTEGLPWCYSHVGVELALDHKNSPFLKQTGDPVCAHNLEALLHLLD  432

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG G+RF  A+GRD A+VN   +FLK  + VPP WRQDENKGMVR  DGRWV P+R +
Sbjct  433   GYHGKGQRFVLASGRDPAMVNTACDFLKDHYLVPPNWRQDENKGMVRNGDGRWVQPDRPK  492

Query  1657  IEAHPPDTGHH  1689
             ++ HP DT HH
Sbjct  493   LDDHPVDTHHH  503



>ref|XP_007201554.1| hypothetical protein PRUPE_ppa017780mg, partial [Prunus persica]
 gb|EMJ02753.1| hypothetical protein PRUPE_ppa017780mg, partial [Prunus persica]
Length=468

 Score =   499 bits (1284),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 253/431 (59%), Positives = 312/431 (72%), Gaps = 19/431 (4%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L ++W E+ G  DW GLL+PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  43    RRLSDVWRELHGQDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFV  102

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
                FF  LGMA  GY +SRYL+ATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE  
Sbjct  103   RRSFFPSLGMAHHGYHVSRYLFATSNINLPNFFKKSRWPKVWSKNANWIGYVAVSDDET-  161

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSKK  936
               RLGRRDI IAWRGTVT LEWI DL + L P      P     +K+ESGF DLYT+  K
Sbjct  162   TARLGRRDISIAWRGTVTRLEWIVDLMDFLKPVSGNKIPCPDRTVKVESGFLDLYTD--K  219

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D  C + ++SAREQ+L E+ RL+E Y GE LSIT+TGHSLG+ALA+LS+YDI E  +NV 
Sbjct  220   DETCRYSTFSAREQILTEIKRLVEEYSGEELSITITGHSLGSALAILSSYDITETGLNVT  279

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
              +G+           +PVSV SF+GPRVGN+RFKER + LG+KVLR+VNV D VP  PG+
Sbjct  280   ADGQV----------VPVSVLSFSGPRVGNVRFKERLESLGVKVLRVVNVHDVVPKSPGL  329

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
               NE      +L    +  PWSY+HVGV+L LDH++SPFLK  +D  CAHNLE HLHL+D
Sbjct  330   FFNE--HVAPRLMKLAEGLPWSYSHVGVQLELDHTHSPFLKQTSDPVCAHNLEAHLHLLD  387

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG G RF  A+GRD ALVNK S+FLK  + VPP WRQDENKGMVR+ DGRW+ PER +
Sbjct  388   GYHGKGHRFVLASGRDPALVNKASDFLKDHYLVPPYWRQDENKGMVRSKDGRWIQPERPK  447

Query  1657  IEAHPPDTGHH  1689
             ++ HP D  HH
Sbjct  448   LDDHPEDIHHH  458



>ref|XP_002281907.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Vitis 
vinifera]
Length=514

 Score =   497 bits (1280),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 261/432 (60%), Positives = 307/432 (71%), Gaps = 22/432 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             + E W EI G  DW G+L+PM+  LR E+IRYGE AQACYD+FDFDP SKYCGTC++   
Sbjct  88    VSERWREIHGEDDWTGMLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGTCRFMPR  147

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             +FF+ LGMA  GY +SRYLYATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE   R
Sbjct  148   KFFDSLGMAGHGYDVSRYLYATSNINLPNFFKKSRWPKVWSKNANWIGYVAVSNDEKS-R  206

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSKKDT  942
              LGRRDI IAWRGTVT LEWI DL + L P    + P     +K+ESGF DLYT+  KD 
Sbjct  207   VLGRRDITIAWRGTVTRLEWIADLMDFLKPVSSENIPCPDRTVKVESGFLDLYTD--KDE  264

Query  943   DCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
              C FC +SAREQ+L EV RLIE Y  E LSIT TGHSLG ALA+LSAYD+AE  +NV+  
Sbjct  265   SCKFCKFSAREQILTEVKRLIEMYPNEELSITFTGHSLGGALAVLSAYDVAETGLNVLNN  324

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
             G            +PVSV SF+GPRVGN+RFKER + LG+KVLR+VNV D VP  PG+  
Sbjct  325   GRV----------LPVSVLSFSGPRVGNVRFKERLEGLGVKVLRVVNVHDVVPKSPGLFF  374

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             NE  Q    +    +  PWSY+HVGVELALDH  SPFLK   D   AHNLE HLHL+DGY
Sbjct  375   NE--QVPAMVMKLAEGLPWSYSHVGVELALDHKNSPFLKQNADPISAHNLEAHLHLLDGY  432

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIE  1662
             HG G+RF  A+GRD ALVNK S+FLK  + VPP WRQDENKGMVR+SDGRWV PER + E
Sbjct  433   HGKGQRFVLASGRDPALVNKASDFLKDHYLVPPYWRQDENKGMVRSSDGRWVQPERPKHE  492

Query  1663  AHP---PDTGHH  1689
              H     D  HH
Sbjct  493   LHDHNHADMHHH  504



>ref|XP_009367748.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Pyrus 
x bretschneideri]
Length=511

 Score =   497 bits (1279),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 253/431 (59%), Positives = 307/431 (71%), Gaps = 19/431 (4%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L ++W E+ G  DW GLL+PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  85    RRLSDVWRELHGQDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFT  144

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
                FFE LGMA  GY +SRYL+ATSNINLPNFF+ S   ++WS++ANW+GYVAV+ D+  
Sbjct  145   RHAFFESLGMAQNGYHVSRYLFATSNINLPNFFKKSRWPKVWSKNANWIGYVAVSDDDTS  204

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNSKK  936
                LGRRDI IAWRGTVT LEWI DL + L P         D  +K+ESGF DLYT+  K
Sbjct  205   A-SLGRRDISIAWRGTVTRLEWIVDLMDFLKPVSANRIPCPDQTVKVESGFLDLYTD--K  261

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D  C FC YSAREQ+L E+ RL+E+Y  E LSIT+TGHSLG+ALA+LSAYDI E  +NV+
Sbjct  262   DVTCRFCHYSAREQILTEIKRLVEKYSDEELSITITGHSLGSALAILSAYDITETGLNVM  321

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
              +G            +PVSV SF+GPRVGN+RFKER + LG+KVLR+VNV D VP  PG+
Sbjct  322   SDGRV----------VPVSVLSFSGPRVGNVRFKERLESLGVKVLRVVNVHDVVPKSPGL  371

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
               NE      ++    +  PWSY+HVGVEL LDH  SPFLK   D GCAHNLE HLHL+D
Sbjct  372   FFNE--HVAPRVMKLAEGLPWSYSHVGVELKLDHKNSPFLKPTNDPGCAHNLEAHLHLLD  429

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG G RF  A+GRD ALVNK S+FLK  + VPP WRQD NKGMVR  DGRW+  ER +
Sbjct  430   GYHGKGHRFVLASGRDPALVNKASDFLKDHYLVPPYWRQDHNKGMVRCKDGRWIQAERPK  489

Query  1657  IEAHPPDTGHH  1689
             ++ H P+  HH
Sbjct  490   LDDHHPEDIHH  500



>gb|KCW49834.1| hypothetical protein EUGRSUZ_K03311 [Eucalyptus grandis]
Length=501

 Score =   495 bits (1275),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 254/432 (59%), Positives = 307/432 (71%), Gaps = 20/432 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L ++W EI G  DW G+L+PM+  LR E+IRYGE AQACYD+FDF+P SKYCG+C+Y 
Sbjct  74    RRLSDVWREIHGEDDWVGMLDPMDPLLRSELIRYGEMAQACYDAFDFEPFSKYCGSCRYG  133

Query  589   GAQFFEKLGMADR-GYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEA  765
               +FFE+L M  R GY ++RYLYATSNINLPNFF  S   ++WS+HANW+GY+AV+ DE 
Sbjct  134   KQEFFERLDMKGRPGYDVTRYLYATSNINLPNFFMKSRWPKVWSKHANWIGYMAVSDDET  193

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNSK  933
               RRLGRRDI +AWRGTVT LEW+ DL + L P   +     DP +K ESGF  LYT+  
Sbjct  194   -TRRLGRRDIAVAWRGTVTRLEWVADLMDFLVPVSSQRVPCPDPAVKAESGFLSLYTD--  250

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNV  1113
             K+ DC F  YSAREQ+L EV RLIE+Y  E LSIT+TGHSLG+ALA+LSAYDIAE  +NV
Sbjct  251   KEDDCKFAKYSAREQILTEVKRLIEKYPDEELSITMTGHSLGSALAVLSAYDIAETGINV  310

Query  1114  VQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1293
              Q+             +PV VFSFAGPRVGN RFKER + LG+KVLR+VNV D VP  PG
Sbjct  311   RQDSRA----------VPVCVFSFAGPRVGNARFKERAEVLGVKVLRVVNVHDMVPKSPG  360

Query  1294  IIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
             ++ NE+    + +       PWSY+HVG EL LDH  SPFLK   D  CAHNLE HLHL+
Sbjct  361   LVFNERLP--RAVMKLAGGLPWSYSHVGAELELDHERSPFLKPTGDPACAHNLEAHLHLL  418

Query  1474  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1653
             DGYHG G+RF  A+GRD ALVNKD++FLK  H VPP WRQ  NKG+VR  +GRW+ PER 
Sbjct  419   DGYHGKGQRFVLASGRDPALVNKDADFLKDHHLVPPFWRQGHNKGLVRNHEGRWMQPERP  478

Query  1654  RIEAHPPDTGHH  1689
             + E HP    HH
Sbjct  479   KPEDHPAYMDHH  490



>emb|CAN74039.1| hypothetical protein VITISV_012945 [Vitis vinifera]
Length=514

 Score =   495 bits (1275),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 257/420 (61%), Positives = 303/420 (72%), Gaps = 19/420 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             + E W EI G  DW G+L+PM+  LR E+IRYGE AQACYD+FDFDP SKYCGTC++   
Sbjct  88    VSERWREIHGEDDWTGMLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGTCRFMPR  147

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             +FF+ LGMA  GY +SRYLYATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE   R
Sbjct  148   KFFDSLGMAGHGYDVSRYLYATSNINLPNFFKKSRWPKVWSKNANWIGYVAVSNDEKS-R  206

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSKKDT  942
              LGRRDI IAWRGTVT LEWI DL + L P    + P     +K+ESGF DLYT+  KD 
Sbjct  207   VLGRRDITIAWRGTVTRLEWIADLMDFLKPVSSENIPCPDRTVKVESGFLDLYTD--KDE  264

Query  943   DCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
              C FC +SAREQ+L EV RLIE Y  E LSIT TGHSLG ALA+LSAYD+AE  +NV+  
Sbjct  265   SCKFCKFSAREQILTEVKRLIEMYPDEELSITFTGHSLGGALAVLSAYDVAETGLNVLNN  324

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
             G            +PVSV SF+GPRVGN+RFKER + LG+KVLR+VNV D VP  PG+  
Sbjct  325   GRV----------LPVSVLSFSGPRVGNVRFKERLEGLGVKVLRVVNVHDVVPKSPGLFF  374

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             NE  Q    +    +  PWSY+HVGVELALDH  SPFLK   D   AHNLE HLHL+DGY
Sbjct  375   NE--QVPAMVMKLAEGLPWSYSHVGVELALDHKNSPFLKQNADPISAHNLEAHLHLLDGY  432

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIE  1662
             HG G+RF  A+GRD ALVNK S+FLK  + VPP WRQDENKGMVR+SDGRWV PER + E
Sbjct  433   HGKGQRFVLASGRDPALVNKASDFLKDHYLVPPYWRQDENKGMVRSSDGRWVQPERPKHE  492



>ref|XP_011079988.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic isoform X1 
[Sesamum indicum]
Length=509

 Score =   495 bits (1274),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 251/432 (58%), Positives = 309/432 (72%), Gaps = 21/432 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L + W+E+ G  DW GLL+PM+  LR E+IRYG  AQACYD+FDFDP+SKYCG+C++ 
Sbjct  83    RELADCWSEMLGEDDWAGLLDPMDPLLRNELIRYGVMAQACYDAFDFDPYSKYCGSCRFT  142

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +FFE+LGMA+ GY I+RYLYATSNINLPNFF++S   ++WS++ANW+GY+AV+ DE  
Sbjct  143   RREFFERLGMAEAGYDITRYLYATSNINLPNFFKNSRWPKVWSKNANWIGYIAVSNDETS  202

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
              ++LGRRDI +AWRGTVT LEW+ DL + L P         DP +++ESGF DLYT+  K
Sbjct  203   -KKLGRRDICVAWRGTVTRLEWVADLMDFLRPISSDKIPSPDPTVRVESGFLDLYTD--K  259

Query  937   DTDCNFCSYSAREQLLAEVNRLI-ERYKGENLSITVTGHslgaalallsaYDIAEMKVNV  1113
             D  C +C +SAREQ+L EVNRLI E Y  E +S+T+TGHSLG A ALLSAYDI E  +NV
Sbjct  260   DESCKYCKFSAREQILTEVNRLINEVYPKEEVSVTITGHSLGGASALLSAYDIVETGINV  319

Query  1114  VQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1293
                          +  +PV VF+FAGPRVGN RFK R + LG+KVLR+VNV D VP  PG
Sbjct  320   ----------RGDSRAVPVCVFTFAGPRVGNARFKARLELLGVKVLRVVNVHDVVPKSPG  369

Query  1294  IIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
             ++ NEK      +    +NFPWSY HVGVELALDH  SPFL+   DL CAHNLE HLHL+
Sbjct  370   LLVNEK--AHPLVIKMAENFPWSYVHVGVELALDHKNSPFLRHDGDLVCAHNLEAHLHLL  427

Query  1474  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1653
             DGYHG G RFR   GRD ALVNKD +FLK E  +PP WRQD NKGMV+  +GRWV  ER+
Sbjct  428   DGYHGRGERFR-LNGRDYALVNKDCDFLKDEFEIPPNWRQDHNKGMVKNKEGRWVQQERA  486

Query  1654  RIEAHPPDTGHH  1689
               + HP D  HH
Sbjct  487   VHDDHPADMHHH  498



>ref|XP_010038036.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Eucalyptus 
grandis]
Length=523

 Score =   495 bits (1275),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 254/432 (59%), Positives = 307/432 (71%), Gaps = 20/432 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L ++W EI G  DW G+L+PM+  LR E+IRYGE AQACYD+FDF+P SKYCG+C+Y 
Sbjct  96    RRLSDVWREIHGEDDWVGMLDPMDPLLRSELIRYGEMAQACYDAFDFEPFSKYCGSCRYG  155

Query  589   GAQFFEKLGMADR-GYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEA  765
               +FFE+L M  R GY ++RYLYATSNINLPNFF  S   ++WS+HANW+GY+AV+ DE 
Sbjct  156   KQEFFERLDMKGRPGYDVTRYLYATSNINLPNFFMKSRWPKVWSKHANWIGYMAVSDDET  215

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNSK  933
               RRLGRRDI +AWRGTVT LEW+ DL + L P   +     DP +K ESGF  LYT+  
Sbjct  216   -TRRLGRRDIAVAWRGTVTRLEWVADLMDFLVPVSSQRVPCPDPAVKAESGFLSLYTD--  272

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNV  1113
             K+ DC F  YSAREQ+L EV RLIE+Y  E LSIT+TGHSLG+ALA+LSAYDIAE  +NV
Sbjct  273   KEDDCKFAKYSAREQILTEVKRLIEKYPDEELSITMTGHSLGSALAVLSAYDIAETGINV  332

Query  1114  VQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1293
              Q+             +PV VFSFAGPRVGN RFKER + LG+KVLR+VNV D VP  PG
Sbjct  333   RQDSRA----------VPVCVFSFAGPRVGNARFKERAEVLGVKVLRVVNVHDMVPKSPG  382

Query  1294  IIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
             ++ NE+    + +       PWSY+HVG EL LDH  SPFLK   D  CAHNLE HLHL+
Sbjct  383   LVFNERLP--RAVMKLAGGLPWSYSHVGAELELDHERSPFLKPTGDPACAHNLEAHLHLL  440

Query  1474  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1653
             DGYHG G+RF  A+GRD ALVNKD++FLK  H VPP WRQ  NKG+VR  +GRW+ PER 
Sbjct  441   DGYHGKGQRFVLASGRDPALVNKDADFLKDHHLVPPFWRQGHNKGLVRNHEGRWMQPERP  500

Query  1654  RIEAHPPDTGHH  1689
             + E HP    HH
Sbjct  501   KPEDHPAYMDHH  512



>ref|XP_008346158.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Malus 
domestica]
Length=512

 Score =   494 bits (1273),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 256/433 (59%), Positives = 302/433 (70%), Gaps = 21/433 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L + W E+ G  DW GLL+PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  85    RRLSDTWRELHGQDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFT  144

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
                FFE LGMA  GY +SRY+YATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE  
Sbjct  145   RRDFFESLGMAHHGYHVSRYIYATSNINLPNFFKKSRWPKVWSKNANWIGYVAVSDDET-  203

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNSKK  936
               RLGRRDI IAWRGTVT LEWI DL + L P         DP +K+ESGF DLYT+  K
Sbjct  204   TARLGRRDISIAWRGTVTRLEWIVDLMDFLKPVSSNRIPCPDPTVKVESGFLDLYTD--K  261

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D  C FC YSAREQ+L E+ RL+E+Y  E LSIT+TGHSLG+ALA LSAYDI E  +NV 
Sbjct  262   DEACRFCQYSAREQILTEMKRLVEKYSDEELSITITGHSLGSALAXLSAYDITETGLNVT  321

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
                            +PVSV SFAGPRVGN+RFKER + LGIKVLR+VNV D VP  PG+
Sbjct  322   S----------DGRGVPVSVLSFAGPRVGNVRFKERLESLGIKVLRVVNVHDVVPKSPGL  371

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
               NE       +    +  PWSY HVGV+L LDH  SPFLK   D   AHNLE HLHL+D
Sbjct  372   FFNE--HVAPMVMKLXEGLPWSYTHVGVQLELDHKNSPFLKPTNDPVGAHNLEAHLHLLD  429

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG G RF  A+GRD ALVNK  +FLK  + VPP WRQDENKGMVR+ DGRW+ PER +
Sbjct  430   GYHGKGHRFVLASGRDPALVNKACDFLKDHYLVPPYWRQDENKGMVRSKDGRWIQPERPK  489

Query  1657  IEA--HPPDTGHH  1689
             ++   HP D  HH
Sbjct  490   LDDDHHPEDIHHH  502



>ref|XP_009354875.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Pyrus 
x bretschneideri]
Length=512

 Score =   493 bits (1270),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 255/433 (59%), Positives = 304/433 (70%), Gaps = 21/433 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L + W E+ G  DW GLL+PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  85    RRLSDTWRELHGQDDWVGLLDPMDPILRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFP  144

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
                FFE LGMA  GY +SRY++ATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE  
Sbjct  145   RRDFFESLGMAHHGYHVSRYIFATSNINLPNFFKKSRWPKVWSKNANWIGYVAVSDDET-  203

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNSKK  936
               RLGRRDI IAWRGTVT LEWI DL + L P         DP +K+ESGF DLYT+  K
Sbjct  204   TARLGRRDISIAWRGTVTRLEWIVDLMDFLKPVSSNRIPCPDPTLKVESGFLDLYTD--K  261

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D  C FC YSAREQ+L E+ RL+E+Y  E LSIT+TGHSLG+ALA+LSAYDI E  +NV 
Sbjct  262   DETCRFCQYSAREQILTEMKRLVEKYSDEELSITITGHSLGSALAILSAYDITETGLNVT  321

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
                            +PVSV SFAGPRVGN+RFKER + LG+KVLR+VNV D VP  PG+
Sbjct  322   S----------DGRGVPVSVLSFAGPRVGNVRFKERLESLGVKVLRVVNVHDVVPKSPGL  371

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
               NE      +L    +  PWSY HVGV+L LDH +SPFLK   D   AHNLE HLHL+D
Sbjct  372   FFNE--HVAPRLMKLAEGLPWSYTHVGVQLELDHKHSPFLKPTNDPVGAHNLEAHLHLLD  429

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG G RF  A+GRD ALVNK  +FLK  + VPP WRQDENKGMVR+ DGRW+ PER +
Sbjct  430   GYHGKGHRFVLASGRDPALVNKACDFLKDHYLVPPYWRQDENKGMVRSKDGRWIQPERPK  489

Query  1657  IEA--HPPDTGHH  1689
              +   HP D  HH
Sbjct  490   FDDDHHPEDIHHH  502



>ref|XP_008783171.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Phoenix 
dactylifera]
Length=520

 Score =   493 bits (1268),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 253/431 (59%), Positives = 306/431 (71%), Gaps = 21/431 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L + W EI GS DW GLL+PM+  LR E+IRYGEFAQACYD+FD+DP S+YCG+CKY+  
Sbjct  95    LADRWREIHGSDDWAGLLDPMDPLLRSELIRYGEFAQACYDAFDYDPFSRYCGSCKYNRR  154

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             +FF  LGM   GY I+RYL+ATSNINL NFF  +  ++ WSQ ANW+GY+AV+ D+A   
Sbjct  155   KFFASLGMDSSGYEITRYLFATSNINLSNFFTKTQGSKTWSQKANWIGYIAVSDDDATA-  213

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNSKKDT  942
             RLGRRDIVIAWRGTVT LEW+ DL + L P         DP++K+ESGF DLYT+  KD 
Sbjct  214   RLGRRDIVIAWRGTVTRLEWVADLMDFLRPAASEGIPCSDPEVKVESGFLDLYTD--KDP  271

Query  943   DCNFCSYSAREQLLAEVNRLIER--YKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
              C FC YSAR+Q+L EV RL+E+    GE +SITVTGHSLG+ALA+LSAYDIAE  ++V 
Sbjct  272   TCRFCKYSARQQVLTEVRRLVEQCTKAGETVSITVTGHSLGSALAMLSAYDIAETGLDV-  330

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
                           K+ ++VFSF+GPRVGN RFKER + LG+K LR+VNV D VP VPGI
Sbjct  331   ---------GVDGEKVAITVFSFSGPRVGNGRFKERFESLGVKALRVVNVHDTVPKVPGI  381

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
             + NE       +    +  PWSY+HVGVELALDH  SPFLK   D  C+HNLE HLHL+D
Sbjct  382   LVNE--HVPAFVRKFAEGLPWSYSHVGVELALDHKRSPFLKDTGDPSCSHNLEAHLHLLD  439

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG G RF  A+ RD ALVNK  +FLK    VPP WRQDENKGM+R  DGRWV PER +
Sbjct  440   GYHGSGVRFYLASKRDPALVNKACDFLKDHLMVPPFWRQDENKGMIRAHDGRWVQPERQK  499

Query  1657  IEAHPPDTGHH  1689
             ++ HP D  HH
Sbjct  500   LDDHPADMHHH  510



>ref|XP_008372307.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Malus 
domestica]
Length=512

 Score =   492 bits (1267),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 255/432 (59%), Positives = 302/432 (70%), Gaps = 20/432 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L + W E+ G  DW GLL+PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  85    RRLSDTWRELHGQDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFT  144

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
                FFE LGMA  GY +SRY+YATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE  
Sbjct  145   RRDFFESLGMAHHGYHVSRYIYATSNINLPNFFKKSRWPKVWSKNANWIGYVAVSDDET-  203

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNSKK  936
               RLGRRDI IAWRGTVT LEWI DL + L P         DP +K+ESGF DLYT+  K
Sbjct  204   TARLGRRDISIAWRGTVTRLEWIVDLMDFLKPVSSNRIPCPDPTVKVESGFLDLYTD--K  261

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D  C FC YSAREQ+L E+ RL+E+Y  E LSIT+TGHSLG+ALA LSAYDI E  +NV 
Sbjct  262   DEACRFCQYSAREQILTEMKRLVEKYSDEELSITITGHSLGSALAXLSAYDITETGLNVT  321

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
                            +PVSV SFAGPRVGN+RFKER + LGIKVLR+VNV D VP  PG+
Sbjct  322   S----------DGRGVPVSVLSFAGPRVGNVRFKERLESLGIKVLRVVNVHDVVPKSPGL  371

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
               NE       +    +  PWSY HVGV+L LDH  SPFLK   D   AHNLE HLHL+D
Sbjct  372   FFNE--HVAPMVMKLXEGLPWSYTHVGVQLELDHKNSPFLKPTNDPVGAHNLEAHLHLLD  429

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG G RF  A+GRD ALVNK  +FLK  + VPP WRQDENKGMVR+ DGRW+ PER +
Sbjct  430   GYHGKGHRFVLASGRDPALVNKACDFLKDHYLVPPYWRQDENKGMVRSKDGRWIQPERPK  489

Query  1657  I-EAHPPDTGHH  1689
             + + H P+  HH
Sbjct  490   LDDDHHPEDIHH  501



>ref|XP_006443915.1| hypothetical protein CICLE_v10019700mg [Citrus clementina]
 ref|XP_006479594.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Citrus 
sinensis]
 gb|ESR57155.1| hypothetical protein CICLE_v10019700mg [Citrus clementina]
 gb|KDO68539.1| hypothetical protein CISIN_1g009776mg [Citrus sinensis]
Length=526

 Score =   492 bits (1266),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 250/431 (58%), Positives = 309/431 (72%), Gaps = 19/431 (4%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L ++W EI G  DW G+++PM+  LR E+IRYGE AQA YD+FDFDP SKYCG+C++ 
Sbjct  99    RKLGDVWREIHGQDDWVGMIDPMDPILRSELIRYGEMAQASYDAFDFDPFSKYCGSCRFM  158

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +FF  L M+  GY +SRYLYATSNINLPNFF+ S   ++WS++ANWMGYVAV+ DE  
Sbjct  159   QREFFNSLEMSHHGYDVSRYLYATSNINLPNFFKKSRWPKMWSKNANWMGYVAVSNDET-  217

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
              +RLGRRDI IAWRGTVT LEWI DL + L P         DP +K ESGF DLYT+  K
Sbjct  218   TKRLGRRDITIAWRGTVTRLEWIADLMDFLKPFSNNKIPCPDPTVKAESGFLDLYTD--K  275

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D  C FC +SAREQ+L EV RL+E Y  E++SITVTGHSLG+ALA+LSAYDI E  +NV+
Sbjct  276   DVTCRFCKFSAREQILTEVKRLLELYYDEDVSITVTGHSLGSALAILSAYDIVETGINVL  335

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
             ++             +PV V+SF+GPRVGN+RFKER + LG+KVLR++NV D VP  PG 
Sbjct  336   RDSRA----------VPVCVYSFSGPRVGNVRFKERIEILGLKVLRVINVHDVVPKTPGF  385

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
             + NE       L    + FPWSY+HVGVELALDH  SPFL    D  CAHNLE  LHL+D
Sbjct  386   LFNE--NVSPVLMKMAEGFPWSYSHVGVELALDHKNSPFLNPAADPTCAHNLEALLHLLD  443

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG G RF  A+GRD ALVNK S+FLK  + VPP WRQ++NKG+VR+ DGRWV PER +
Sbjct  444   GYHGKGHRFVLASGRDPALVNKASDFLKDHYLVPPYWRQNQNKGLVRSKDGRWVQPERPK  503

Query  1657  IEAHPPDTGHH  1689
             ++ HPP+  +H
Sbjct  504   LDDHPPNIHNH  514



>gb|KFK42995.1| hypothetical protein AALP_AA1G065900 [Arabis alpina]
Length=507

 Score =   490 bits (1261),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 258/437 (59%), Positives = 310/437 (71%), Gaps = 25/437 (6%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             ++L + W +IQG  DW GLLNPM+  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  76    KSLRDTWRKIQGEDDWAGLLNPMDPVLRSELIRYGELAQACYDAFDFDPFSKYCGSCRFT  135

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATD-EA  765
               + F+ LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D E+
Sbjct  136   RHKLFDSLGIFDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDVES  195

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH---FR-DDPDIKIESGFFDLYTNSK  933
               RRLGRRDI IAWRGTVT LEWI DLK+ L P     FR  DP +K ESGF DLYT+  
Sbjct  196   TRRRLGRRDIAIAWRGTVTRLEWIADLKDFLKPVSGNGFRCSDPAVKAESGFLDLYTD--  253

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERYKGE-----NLSITVTGHslgaalallsaYDIAE  1098
             KDT CNF  +SAREQ+L EV RL+E+Y  E     +LSITVTGHSLG ALA+LSAYD+AE
Sbjct  254   KDTSCNFSKFSAREQVLTEVKRLVEKYGDEEDGGLDLSITVTGHSLGGALAVLSAYDVAE  313

Query  1099  MKVNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKV  1278
             M +N  + G+           IPV+VF++ GPRVGN+RFKER +ELG+KVLR+VN  D V
Sbjct  314   MGLNRTKRGKV----------IPVTVFTYGGPRVGNVRFKERMEELGVKVLRVVNEHDVV  363

Query  1279  PTVPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1458
             P  PG+  NE+  +   L       PW Y HVG EL LDH  SPFLK   DL  AHNLE 
Sbjct  364   PKSPGLFLNERAPH--ALMKLAGGLPWCYCHVGEELPLDHRNSPFLKGSVDLSTAHNLEA  421

Query  1459  HLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1638
              LHL+DGYHG G RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMVR +DGRW+
Sbjct  422   LLHLLDGYHGKGERFVLSSGRDPALVNKASDFLKEHFMVPPNWRQDANKGMVRNNDGRWI  481

Query  1639  VPERSRIEA-HPPDTGH  1686
              P+R R E  H PD  H
Sbjct  482   QPDRIRAEDHHAPDIHH  498



>ref|XP_009384367.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=516

 Score =   490 bits (1261),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 260/435 (60%), Positives = 309/435 (71%), Gaps = 24/435 (6%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L E W+EI G  DW GLL+PM+  LR E+IRYGEFAQACYDSFD+DP S+YCG+CKY+
Sbjct  86    RRLPERWSEIHGRDDWAGLLDPMDPLLRSELIRYGEFAQACYDSFDYDPFSRYCGSCKYN  145

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVN-RIWSQHANWMGYVAVATDEA  765
               +FF  LG+   GY ++RYLYATSNINLPNFF  S    +IWSQ ANWMGYVAV+ DE 
Sbjct  146   RRRFFSSLGLEGIGYEVTRYLYATSNINLPNFFTKSRAGAKIWSQRANWMGYVAVSDDET  205

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  933
               R LGRRDIV+AWRGTVT LEWI DL + L P         DP +K+ESGF +LYT+  
Sbjct  206   TAR-LGRRDIVVAWRGTVTRLEWIADLMDFLRPVTSVGIPCPDPSVKVESGFAELYTD--  262

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKV  1107
             KD  C FC YSAREQLL EV +L+E +   GE +SI+VTGHSLG+ALA+LSAYDIAEM +
Sbjct  263   KDPTCRFCKYSAREQLLTEVRKLVELHSRAGEEVSISVTGHSLGSALAMLSAYDIAEMGL  322

Query  1108  NVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1287
             NV + GE          ++  +VFSF+GPRVGN  FKER + LGIK +R+VNV D VP V
Sbjct  323   NVGEGGE----------RVATTVFSFSGPRVGNGHFKERFEGLGIKAIRVVNVHDTVPKV  372

Query  1288  PGIIANEKF-QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
             PGI+ NE+   + ++L   L   PWSY+H+GVEL LDH  SPFLK   D  C HNLE HL
Sbjct  373   PGILFNERVPAFLRRLAEAL---PWSYSHIGVELPLDHRRSPFLKETVDPSCFHNLEAHL  429

Query  1465  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1644
             HL+DGYHG G RF  A+GRD ALVNK  +FLK  H VPP WRQDENKGM R  DGRW   
Sbjct  430   HLLDGYHGKGHRFVLASGRDPALVNKACDFLKEHHMVPPFWRQDENKGMTRAHDGRWGQT  489

Query  1645  ERSRIEAHPPDTGHH  1689
             +R  ++ HP DT HH
Sbjct  490   DRREVDDHPEDTQHH  504



>ref|XP_006410159.1| hypothetical protein EUTSA_v10016488mg [Eutrema salsugineum]
 gb|ESQ51612.1| hypothetical protein EUTSA_v10016488mg [Eutrema salsugineum]
Length=539

 Score =   490 bits (1262),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 255/435 (59%), Positives = 309/435 (71%), Gaps = 22/435 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L + W +IQG  DW GL++PM+  LR E+IRYGE AQACYD+FDFDP S+YCG+ ++ 
Sbjct  109   RRLRDTWRKIQGEDDWAGLIDPMDPVLRSELIRYGEMAQACYDAFDFDPSSRYCGSSRFS  168

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
                FF+ LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DEA 
Sbjct  169   RHDFFDSLGIFDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEAT  228

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
               RLGRRDI IAWRGTVT LEWI DLK+ L P    +    DP +K+ESGF DLYT+  K
Sbjct  229   RNRLGRRDIAIAWRGTVTRLEWIADLKDYLKPVSGNNLRCPDPAVKVESGFLDLYTD--K  286

Query  937   DTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMKV  1107
             DT C F  +SAREQ+LAEV RL+E+Y   + E LSITVTGHSLG ALA+LSAYD+AEM +
Sbjct  287   DTTCRFARFSAREQILAEVKRLVEKYGDDEDEELSITVTGHSLGGALAILSAYDVAEMGL  346

Query  1108  NVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1287
             N  + G+           IPV+V ++ GPRVGNLRFKER +ELG+KV+R+VNV D VP  
Sbjct  347   NRSRSGKV----------IPVTVLTYGGPRVGNLRFKERIEELGVKVMRVVNVHDVVPKS  396

Query  1288  PGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLH  1467
             PG+  NE   +   L    +  PW Y HVG ELALDH  SPFLK+  DL  AHNLE  LH
Sbjct  397   PGLFLNESVPH--ALMKIAEGLPWCYCHVGEELALDHQNSPFLKSSVDLSNAHNLEAMLH  454

Query  1468  LVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPE  1647
             L+DGYHG G RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMVR S+GRW+  E
Sbjct  455   LLDGYHGKGERFVLSSGRDPALVNKASDFLKEHFMVPPFWRQDANKGMVRNSEGRWIQAE  514

Query  1648  RSRIEA-HPPDTGHH  1689
             R R E  H PD  H+
Sbjct  515   RLRSEDHHSPDIHHY  529



>ref|XP_010274199.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X1 [Nelumbo nucifera]
Length=537

 Score =   490 bits (1261),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 250/431 (58%), Positives = 308/431 (71%), Gaps = 19/431 (4%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R + + W EI G  DW G+L+P++  LR E+IRYGE AQACYD+FD+DP S+YCG+C++ 
Sbjct  112   RRIADFWREIHGQGDWTGMLDPIDPLLRSELIRYGEMAQACYDAFDYDPSSRYCGSCRFM  171

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +FF+ LGMA+ GY +SRYLYAT+NINLPNFF+ S   ++WS++ANW+GYVAV+ DE  
Sbjct  172   RRKFFDCLGMANFGYDVSRYLYATTNINLPNFFKKSRWPKVWSRNANWIGYVAVSNDETS  231

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
                LGRRDI IAWRGTVT LEWI DL + L P         DP +K+ESGF D+YT+  K
Sbjct  232   A-SLGRRDITIAWRGTVTRLEWIADLMDFLRPVSSDKIPCPDPSVKVESGFLDVYTD--K  288

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D  C FC YSAREQ+L+EV RL ++Y  E LSIT+TGHSLG+ALA+LSAYDIAE  VNV 
Sbjct  289   DETCRFCKYSAREQILSEVKRLTQQYPDEELSITMTGHSLGSALAMLSAYDIAETGVNVT  348

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
                            +PV+VFSF+GPRVGN+RFKER + LG+KVLR+VNV D VP VPGI
Sbjct  349   ----------GDGRAVPVTVFSFSGPRVGNVRFKERVERLGVKVLRVVNVHDTVPKVPGI  398

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
             + NE     + +    +  PW Y+HVGVEL LDH +SPFL    D  C HNLE  LHL+D
Sbjct  399   LFNE--HVPELVHRLAQWLPWCYSHVGVELTLDHKHSPFLNGTGDPSCFHNLEALLHLLD  456

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG G+RF  ++GRD ALVNK S+FLK  + VPP WRQDENKGMVR  +GRWV PER +
Sbjct  457   GYHGKGQRFVLSSGRDPALVNKASDFLKDHYLVPPYWRQDENKGMVRNQEGRWVQPERPK  516

Query  1657  IEAHPPDTGHH  1689
              E HP D  HH
Sbjct  517   HEDHPSDIHHH  527



>ref|XP_010087133.1| Phospholipase A1-Igamma1 [Morus notabilis]
 gb|EXB26573.1| Phospholipase A1-Igamma1 [Morus notabilis]
Length=505

 Score =   488 bits (1257),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 256/433 (59%), Positives = 308/433 (71%), Gaps = 21/433 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L ++W+EI G  +W GLL+PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  75    RRLADVWSEIHGQDEWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFI  134

Query  589   GAQFFEKLGMAD--RGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDE  762
               +FFE L M+   + Y +SRYLYATSNINL NFF+ S   ++WS++ANW+GYVAV++DE
Sbjct  135   RRKFFESLEMSSTHQNYDVSRYLYATSNINLANFFKKSRWPKVWSKNANWIGYVAVSSDE  194

Query  763   AEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNS  930
             A  R LGRRDI +AWRGTVT+LEWI DL + L P         D ++K ESGF DLYTN 
Sbjct  195   AS-RTLGRRDITVAWRGTVTHLEWISDLMDFLRPISANRIPCPDSNVKAESGFLDLYTN-  252

Query  931   KKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVN  1110
              KD  C FC YSAREQ+L EV RL+E Y GE LSIT+TGHSLGAALA+LSAYDIAE  +N
Sbjct  253   -KDETCRFCKYSAREQILTEVKRLMEIYSGEELSITITGHSLGAALAILSAYDIAETGLN  311

Query  1111  VVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1290
             V  +G            +PVSVFSF+GPRVGN RFKER + LG+KVLR+VN  D VP  P
Sbjct  312   VAADGRV----------VPVSVFSFSGPRVGNSRFKERLEWLGVKVLRVVNAHDVVPKSP  361

Query  1291  GIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1470
             G++ NE       L    +  PWSY+HVGV L LDH  SPFLK   DL C HNLE  LHL
Sbjct  362   GLVFNE--CAPAMLMKMAEGLPWSYSHVGVGLELDHCNSPFLKPTKDLVCTHNLEALLHL  419

Query  1471  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             +DGYHG G RF  A+GRD ALVNK S+FLK  + VPP WRQ+ENKGMVR  DGRW+ PER
Sbjct  420   LDGYHGKGHRFVLASGRDPALVNKASDFLKEHYLVPPYWRQNENKGMVRHKDGRWIQPER  479

Query  1651  SRIEAHPPDTGHH  1689
              +++ HP D   H
Sbjct  480   PKLDDHPDDIHRH  492



>ref|XP_009119028.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Brassica 
rapa]
Length=546

 Score =   489 bits (1260),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 256/435 (59%), Positives = 312/435 (72%), Gaps = 23/435 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             ++L + W +IQG  DW GL++PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  117   KSLRDTWRKIQGEDDWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFT  176

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATD-EA  765
               + F+ LG+ D GY  +RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D EA
Sbjct  177   RKKLFDSLGIFDSGYEAARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDSEA  236

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH---FR-DDPDIKIESGFFDLYTNSK  933
                RLGRRDI IAWRGTVT LEWI DLK+ L P     FR  DP +K ESGF DLYT+  
Sbjct  237   TRHRLGRRDIAIAWRGTVTQLEWIADLKDFLKPVSGNGFRCRDPAVKAESGFLDLYTD--  294

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  1104
             KDT CNF  +SAREQLL EV RL+ERY   +G++LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  295   KDTSCNFSKFSAREQLLTEVKRLVERYGDEEGDDLSITVTGHSLGGALAVLSAYDVAEMG  354

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
             +N  ++G+           +PV+VF+++ PRVGN+RFKER +ELG+KVLR+VN  D VP 
Sbjct  355   LNRTKKGKV----------VPVTVFTYSAPRVGNIRFKERMEELGVKVLRVVNKHDVVPK  404

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
              PG+  NE       L+      PW Y HVG +LALDH  SPFLK   DL  AHNLE  L
Sbjct  405   SPGLFLNE--HAPDALKQLAGGLPWCYCHVGEKLALDHQNSPFLKPSVDLSTAHNLEALL  462

Query  1465  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1644
             HL+DGYHG G+RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMVR +DGRW+ P
Sbjct  463   HLLDGYHGKGQRFVLSSGRDPALVNKASDFLKDHFMVPPYWRQDANKGMVRHTDGRWIQP  522

Query  1645  ERSRIEA-HPPDTGH  1686
             +R R E  H PD  H
Sbjct  523   DRIRAEDHHAPDIHH  537



>ref|XP_002879267.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55526.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=530

 Score =   489 bits (1258),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 254/435 (58%), Positives = 306/435 (70%), Gaps = 22/435 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L + W +IQG  DW GL++PM+  LR E+IRYGE AQACYD+FDFDP SKYCGT ++ 
Sbjct  100   RRLRDTWRKIQGEDDWAGLIDPMDPILRSELIRYGEMAQACYDAFDFDPASKYCGTSRFS  159

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
                FF+ LGM D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE  
Sbjct  160   RLDFFDSLGMIDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETS  219

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
               RLGRRDI IAWRGTVT LEWI DLK+ L P    +    DP +K+ESGF DLYT+  K
Sbjct  220   RNRLGRRDIAIAWRGTVTKLEWIADLKDYLKPVSGNNIRCPDPAVKVESGFLDLYTD--K  277

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGE---NLSITVTGHslgaalallsaYDIAEMKV  1107
             DT C F  +SAREQ+L EV RL+E Y  +   +LSITVTGHSLG ALA+LSAYDIAEM +
Sbjct  278   DTTCKFAKFSAREQILTEVKRLVEIYGDDDDSDLSITVTGHSLGGALAMLSAYDIAEMGL  337

Query  1108  NVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1287
             N  + G+           IPV+V ++ GPRVGN+RFK+R +ELG+KVLR+VNV D VP  
Sbjct  338   NRSKNGKV----------IPVTVLTYGGPRVGNVRFKDRMEELGVKVLRVVNVHDVVPKS  387

Query  1288  PGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLH  1467
             PG+  NE   +   L    +  PW Y+HVG ELALDH  SPFLK   DL  +HNLE  LH
Sbjct  388   PGLFLNESRPH--ALMKIAEGLPWCYSHVGEELALDHQNSPFLKPSVDLSTSHNLEAMLH  445

Query  1468  LVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPE  1647
             L+DGYHG G RF  ++GRD ALVNK S+FLK    +PP WRQD NKGMVR S+GRW+  E
Sbjct  446   LLDGYHGKGERFVLSSGRDHALVNKASDFLKEHLQIPPFWRQDANKGMVRNSEGRWIQAE  505

Query  1648  RSRIEA-HPPDTGHH  1689
             R R E  H PD  HH
Sbjct  506   RLRSEDHHSPDIHHH  520



>ref|NP_565701.1| phospholipase A1-Igamma2 [Arabidopsis thaliana]
 sp|Q3EBR6.2|PLA16_ARATH RecName: Full=Phospholipase A1-Igamma2, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAB63082.2| putative lipase [Arabidopsis thaliana]
 gb|AAM14092.1| putative lipase [Arabidopsis thaliana]
 gb|AAM63231.1| putative lipase [Arabidopsis thaliana]
 gb|AAN13163.1| putative lipase [Arabidopsis thaliana]
 gb|AEC08407.1| phospholipase A1-Igamma2 [Arabidopsis thaliana]
Length=529

 Score =   488 bits (1257),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 252/435 (58%), Positives = 308/435 (71%), Gaps = 22/435 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L + W +IQG  DW GL++PM+  LR E+IRYGE AQACYD+FDFDP SKYCGT ++ 
Sbjct  99    RRLRDTWRKIQGEDDWAGLMDPMDPILRSELIRYGEMAQACYDAFDFDPASKYCGTSRFT  158

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +FF+ LGM D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE  
Sbjct  159   RLEFFDSLGMIDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETS  218

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
               RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  K
Sbjct  219   RNRLGRRDIAIAWRGTVTKLEWIADLKDYLKPVTENKIRCPDPAVKVESGFLDLYTD--K  276

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGE---NLSITVTGHslgaalallsaYDIAEMKV  1107
             DT C F  +SAREQ+L EV RL+E +  +   +LSITVTGHSLG ALA+LSAYDIAEM++
Sbjct  277   DTTCKFARFSAREQILTEVKRLVEEHGDDDDSDLSITVTGHSLGGALAILSAYDIAEMRL  336

Query  1108  NVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1287
             N  ++G+           IPV+V ++ GPRVGN+RF+ER +ELG+KV+R+VNV D VP  
Sbjct  337   NRSKKGKV----------IPVTVLTYGGPRVGNVRFRERMEELGVKVMRVVNVHDVVPKS  386

Query  1288  PGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLH  1467
             PG+  NE   +   L    +  PW Y+HVG ELALDH  SPFLK   D+  AHNLE  LH
Sbjct  387   PGLFLNESRPH--ALMKIAEGLPWCYSHVGEELALDHQNSPFLKPSVDVSTAHNLEAMLH  444

Query  1468  LVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPE  1647
             L+DGYHG G RF  ++GRD ALVNK S+FLK    +PP WRQD NKGMVR S+GRW+  E
Sbjct  445   LLDGYHGKGERFVLSSGRDHALVNKASDFLKEHLQIPPFWRQDANKGMVRNSEGRWIQAE  504

Query  1648  RSRIEA-HPPDTGHH  1689
             R R E  H PD  HH
Sbjct  505   RLRFEDHHSPDIHHH  519



>ref|XP_010679169.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=549

 Score =   489 bits (1258),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 247/425 (58%), Positives = 303/425 (71%), Gaps = 19/425 (4%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI G  +W GLL+PM+S LR E+IRYGE AQACYD FDFDP SKYCG+CKY    FF+
Sbjct  130   WREIHGEDEWVGLLDPMDSLLRAELIRYGEMAQACYDGFDFDPFSKYCGSCKYPRHSFFK  189

Query  607   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  786
              L M   GY ++RYLYATSNINLPNFF++S   ++WS++ANW+GYVAV+ DE   +RLGR
Sbjct  190   GLEMEAHGYEVTRYLYATSNINLPNFFKNSRWPKVWSKNANWIGYVAVSNDEMS-KRLGR  248

Query  787   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSKKDTDCNF  954
             RDI+I+WRGTVT LEW+HDL + L P    + P     +K ESGF DLYT+  KD +C +
Sbjct  249   RDIIISWRGTVTRLEWVHDLMDFLRPVSDENIPCPDRSVKAESGFLDLYTD--KDPNCKY  306

Query  955   CSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegege  1134
             C +SAREQ+L+EV RL E +  E +SI++TGHSLG+ALA+LSAYDIAE  ++V       
Sbjct  307   CKFSAREQILSEVKRLSELFHNEEISISITGHSLGSALAILSAYDIAETGIHVGPSTRSR  366

Query  1135  ssstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKF  1314
                       P+SVFSF+GPRVGN+RFKER +ELG+KVLR+VNV D VP  PG++ NE  
Sbjct  367   ----------PISVFSFSGPRVGNVRFKERLEELGVKVLRVVNVHDMVPKAPGLVFNEHL  416

Query  1315  QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDG  1494
                       +  PWSY HVGVELALDH  SPF+K   D  CAHNLE HLHL+DGYHG G
Sbjct  417   --PSDWMKIAQGLPWSYCHVGVELALDHKNSPFIKDTNDPSCAHNLEAHLHLLDGYHGKG  474

Query  1495  RRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPP  1674
             RRF    GRDIALVNK  +FLK  + +PP WRQDEN+GMVR+ DGRW+  ER  ++ HP 
Sbjct  475   RRFHLTIGRDIALVNKACDFLKDHYQIPPFWRQDENRGMVRSKDGRWIQAERPILDDHPE  534

Query  1675  DTGHH  1689
              T HH
Sbjct  535   YTHHH  539



>ref|XP_010927018.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Elaeis 
guineensis]
Length=523

 Score =   488 bits (1256),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 254/431 (59%), Positives = 304/431 (71%), Gaps = 21/431 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L + W EI GS DW GLL+PM+  LR E+IRYGEFAQACYD FD+DP S+YCG+CKY+  
Sbjct  98    LADRWREIHGSDDWAGLLDPMDPLLRSELIRYGEFAQACYDGFDYDPFSRYCGSCKYNRR  157

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             +FF  LGM + GY I+RYLYATSN+NL NFF  +  ++ WSQ ANW+GY+AV+ D+A   
Sbjct  158   KFFGSLGMDNAGYEITRYLYATSNLNLSNFFTQTRGSKTWSQKANWIGYIAVSDDDATA-  216

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNSKKDT  942
             RLGRRDIVIAWRGTVT LEW+ DL + L P         +P++K+ESGF DLYT+  KD 
Sbjct  217   RLGRRDIVIAWRGTVTRLEWVADLMDFLRPVASEGIPCSNPEVKVESGFLDLYTD--KDP  274

Query  943   DCNFCSYSAREQLLAEVNRLIER--YKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
              C FC YSAR+Q+L EV RL+E+    GE +SITVTGHSLG+ALA+LSAYDIAE   +V 
Sbjct  275   TCRFCKYSARQQVLTEVRRLVEQCTKAGETVSITVTGHSLGSALAMLSAYDIAETGQDV-  333

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
                           K+ ++VFSF+GPRVGN RFKER + LG+K LR+VNV D VP VPGI
Sbjct  334   ---------GVDGEKVAITVFSFSGPRVGNGRFKERFEGLGVKALRVVNVHDTVPKVPGI  384

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
             + NE            +  PWSY+HVGVELALDH  SPFLK   D  C HNLE HLHL+D
Sbjct  385   LFNE--HVPAFFRKFAEGLPWSYSHVGVELALDHKRSPFLKDTGDPSCFHNLEAHLHLLD  442

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG G RF  A+ RD ALVNK  +FLK    VPP WRQDENKGM+R  DGRWV PER +
Sbjct  443   GYHGSGVRFFLASKRDPALVNKACDFLKDHLMVPPFWRQDENKGMIRAHDGRWVQPERQK  502

Query  1657  IEAHPPDTGHH  1689
             I+ HPPD  HH
Sbjct  503   IDDHPPDMHHH  513



>emb|CDY29665.1| BnaA04g17620D [Brassica napus]
Length=523

 Score =   488 bits (1255),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 255/436 (58%), Positives = 309/436 (71%), Gaps = 23/436 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L + W +IQG  DW GL +PM+  LR E+IRYGE AQACYD+FDFDP S+YCG+ ++ 
Sbjct  93    RRLRDTWRKIQGEDDWAGLTDPMDPVLRSELIRYGEMAQACYDAFDFDPSSRYCGSSRFS  152

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +FF+ LGM   GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DEA 
Sbjct  153   RHEFFDSLGMKGSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEAA  212

Query  769   IR-RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  933
              R RLGRRDI IAWRGTVT LEWI DLK+ L P +  +    DP +K+ESGF DLYT+  
Sbjct  213   TRQRLGRRDIAIAWRGTVTRLEWIADLKDYLKPVYRNNLRCPDPAVKVESGFLDLYTD--  270

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  1104
             KDT C F  +SAREQ+LAEV RL+ERY   + E LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  271   KDTSCKFSRFSAREQVLAEVKRLVERYGDDEEEELSITVTGHSLGGALAILSAYDVAEMG  330

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
             +N  + G+           IPV+V ++ GPRVGN+RFKER  ELG+KV+R+VNV D VP 
Sbjct  331   LNRSRSGKV----------IPVTVLTYGGPRVGNVRFKERLKELGVKVMRVVNVHDVVPK  380

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
              PG+  NE+  +   +    +  PW Y HVG ELALDH  SPFLK+  D   AHNLE  L
Sbjct  381   SPGLFLNERAPH--AVMKIAEGLPWCYCHVGEELALDHQNSPFLKSSVDPSNAHNLEALL  438

Query  1465  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1644
             HL+DGYHG G RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMVR S+GRW+  
Sbjct  439   HLLDGYHGKGERFVLSSGRDPALVNKASDFLKEHFMVPPFWRQDANKGMVRNSEGRWIQA  498

Query  1645  ERSRIEA-HPPDTGHH  1689
             ER R E  H PD  HH
Sbjct  499   ERLRSEDHHSPDIHHH  514



>ref|XP_009141072.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic [Brassica 
rapa]
Length=523

 Score =   487 bits (1253),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 255/436 (58%), Positives = 309/436 (71%), Gaps = 23/436 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L + W +IQG  DW GL +PM+  LR E+IRYGE AQACYD+FDFDP S+YCG+ ++ 
Sbjct  93    RRLRDTWRKIQGEDDWAGLTDPMDPVLRSELIRYGEMAQACYDAFDFDPSSRYCGSSRFS  152

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +FF+ LGM   GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DEA 
Sbjct  153   RHEFFDSLGMKGSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEAA  212

Query  769   IR-RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  933
              R RLGRRDI IAWRGTVT LEWI DLK+ L P +  +    DP +K+ESGF DLYT+  
Sbjct  213   TRHRLGRRDIAIAWRGTVTRLEWIADLKDYLKPVYRNNLRCPDPAVKVESGFLDLYTD--  270

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  1104
             KDT C F  +SAREQ+LAEV RL+ERY   + E LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  271   KDTSCKFSRFSAREQVLAEVKRLVERYGDDEEEELSITVTGHSLGGALAILSAYDVAEMG  330

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
             +N  + G+           IPV+V ++ GPRVGN+RFKER  ELG+KV+R+VNV D VP 
Sbjct  331   LNRSRSGKV----------IPVTVLTYGGPRVGNVRFKERLKELGVKVMRVVNVHDVVPK  380

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
              PG+  NE+  +   +    +  PW Y HVG ELALDH  SPFLK+  D   AHNLE  L
Sbjct  381   SPGLFLNERAPH--AVMKIAEGLPWCYCHVGEELALDHQNSPFLKSSVDPSNAHNLEALL  438

Query  1465  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1644
             HL+DGYHG G RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMVR S+GRW+  
Sbjct  439   HLLDGYHGKGERFVLSSGRDPALVNKASDFLKEHFMVPPFWRQDANKGMVRNSEGRWIQA  498

Query  1645  ERSRIEA-HPPDTGHH  1689
             ER R E  H PD  HH
Sbjct  499   ERLRSEDHHSPDIHHH  514



>ref|XP_010278159.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Nelumbo 
nucifera]
Length=525

 Score =   487 bits (1253),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 246/427 (58%), Positives = 308/427 (72%), Gaps = 19/427 (4%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             + + + W EIQG  DW GLL+PM+  LR E+IRYG+ AQACYD+FDFD  SKYCG+C++ 
Sbjct  100   KRIADCWREIQGQDDWAGLLDPMDPLLRSELIRYGDMAQACYDAFDFDSFSKYCGSCRFT  159

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +FF+ LG+   GY +SRYLY+T+NINLPNFF+ S   ++WS++ANWMGYVAV+ D+  
Sbjct  160   RRKFFDCLGLTSLGYDVSRYLYSTANINLPNFFKKSRWPKVWSRNANWMGYVAVSNDDTS  219

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
               RLGRRDI +AWRGTVT LEW+ DL + L P         DP+ K+ESGF DLYT+  K
Sbjct  220   A-RLGRRDIAVAWRGTVTRLEWVADLMDFLRPVSADKIPCPDPNAKVESGFLDLYTD--K  276

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D  C FC +SAREQ+L E+ R I++Y  E LSITVTGHSLG+ALA+LSAYDI E  +NV 
Sbjct  277   DDKCRFCKFSAREQVLTEIKRSIQQYPNEELSITVTGHSLGSALAILSAYDIEETGLNVT  336

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
              +G            IPV+VFSF+GPRVGN+RFKER + LG+KVLR+ NV D VP VPGI
Sbjct  337   ADGRI----------IPVTVFSFSGPRVGNVRFKERVEGLGVKVLRVFNVHDSVPKVPGI  386

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
             + NE     + ++  L+  PW+Y+HVGVEL LDH  SPFL   +D GC HNLE  LHL+D
Sbjct  387   VFNE--HVPEMVQKMLEWLPWNYSHVGVELCLDHKKSPFLNDTSDPGCFHNLEALLHLID  444

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG G+RF  ++ RD ALVNK S+FLK  + VPP WRQ ENKGMVR  +GRWV PER +
Sbjct  445   GYHGKGQRFVLSSRRDPALVNKASDFLKDHYLVPPYWRQHENKGMVRNQEGRWVQPERPK  504

Query  1657  IEAHPPD  1677
             +E HPPD
Sbjct  505   LEEHPPD  511



>emb|CDY10228.1| BnaC05g04710D [Brassica napus]
Length=513

 Score =   486 bits (1251),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 256/436 (59%), Positives = 312/436 (72%), Gaps = 25/436 (6%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             ++L + W +IQG  DW GL++PM+  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  84    KSLRDTWRKIQGEDDWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  143

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATD-EA  765
               + F+ LG+ D GY  +RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D EA
Sbjct  144   RKKLFDSLGIFDSGYEAARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDSEA  203

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  933
                RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K ESGF DLYT+  
Sbjct  204   TRHRLGRRDIAIAWRGTVTQLEWIADLKDFLKPVSGNGFQCRDPAVKAESGFLDLYTD--  261

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  1104
             KDT CNF  +SAREQLL EV RL+ERY   +G +LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  262   KDTSCNFSKFSAREQLLTEVKRLVERYGDEEGVDLSITVTGHSLGGALAVLSAYDVAEMG  321

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
             +N  ++G+           +PV+VF+++ PRVGN+RFKER +ELG+KVLR+VN  D VP 
Sbjct  322   LNRTKKGKV----------VPVTVFTYSAPRVGNIRFKERMEELGVKVLRVVNKHDVVPK  371

Query  1285  VPGIIANEKFQYQ-KQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1461
              PG+  NE   +  KQL   L   PW Y HVG +LALDH  SPFLK   DL  AHNLE  
Sbjct  372   SPGLFLNEHAPHALKQLAGGL---PWCYCHVGEKLALDHQNSPFLKPSVDLSTAHNLEAL  428

Query  1462  LHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVV  1641
             LHL+DGYHG G+RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMVR +DGRW+ 
Sbjct  429   LHLLDGYHGKGQRFVLSSGRDPALVNKASDFLKDHFMVPPYWRQDANKGMVRHTDGRWIQ  488

Query  1642  PERSRIEA-HPPDTGH  1686
             P+R R E  H PD  H
Sbjct  489   PDRIRAEDHHAPDIHH  504



>gb|ACJ76846.1| chloroplast lipase protein [Brassica napus]
Length=513

 Score =   486 bits (1250),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 257/436 (59%), Positives = 313/436 (72%), Gaps = 25/436 (6%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             ++L + W +IQG  DW GL++PM+  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  84    KSLRDTWRKIQGEDDWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  143

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATD-EA  765
               + F+ LG+ D GY  +RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D EA
Sbjct  144   RKKLFDSLGIFDSGYEAARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDSEA  203

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH---FR-DDPDIKIESGFFDLYTNSK  933
                RLGRRDI IAWRGTVT LEWI DLK+ L P     FR  DP +K ESGF DLYT+  
Sbjct  204   TRHRLGRRDIAIAWRGTVTQLEWIADLKDFLKPVSGNGFRCRDPAVKAESGFLDLYTD--  261

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  1104
             KDT CNF  +SAREQLL EV RL+ERY   +G +LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  262   KDTSCNFSKFSAREQLLTEVKRLVERYGDEEGGDLSITVTGHSLGGALAVLSAYDVAEMG  321

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
             +N  + G+           +PV+VF+++ PRVGN+RFKER +ELG+KVLR+VN  D VP 
Sbjct  322   LNRTKNGKV----------VPVTVFTYSAPRVGNIRFKERMEELGVKVLRVVNKHDVVPK  371

Query  1285  VPGIIANEKFQYQ-KQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1461
              PG+  NE   +  KQL   L   PW Y HVG +LALDH  SPFLK   D+  AHNLE  
Sbjct  372   SPGLFLNEHAPHALKQLAGGL---PWCYCHVGEKLALDHQNSPFLKPSVDISTAHNLEAL  428

Query  1462  LHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVV  1641
             LHL+DGYHG G+RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMVR +DGRW+ 
Sbjct  429   LHLLDGYHGKGQRFVLSSGRDPALVNKASDFLKDHFMVPPYWRQDANKGMVRHTDGRWIQ  488

Query  1642  PERSRIEA-HPPDTGH  1686
             P+R R E  H PD  H
Sbjct  489   PDRIRAEDHHAPDIHH  504



>emb|CDX97819.1| BnaC04g41200D [Brassica napus]
Length=491

 Score =   485 bits (1248),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 254/435 (58%), Positives = 306/435 (70%), Gaps = 22/435 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L + W +IQG  DW GL +PM+  LR E+IRYGE AQACYD+FDFDP S+YCG+ ++ 
Sbjct  62    RRLRDTWRKIQGEDDWAGLTDPMDPVLRSELIRYGEMAQACYDAFDFDPSSRYCGSSRFS  121

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +FF+ LGM   GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DEA 
Sbjct  122   RHEFFDSLGMKGSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEAT  181

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
               RLGRRDI IAWRGTVT LEWI DLK+ L P    +    DP +K+ESGF DLYT+  K
Sbjct  182   RHRLGRRDIAIAWRGTVTQLEWIADLKDYLKPVSGNNLRCPDPAVKVESGFLDLYTD--K  239

Query  937   DTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMKV  1107
             DT C F  +SAREQ+LAEV RL+ERY   + E LSITVTGHSLG ALA+LSAYD+AEM +
Sbjct  240   DTSCKFSRFSAREQVLAEVKRLVERYGDDEDEELSITVTGHSLGGALAILSAYDVAEMGL  299

Query  1108  NVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1287
             N  + G+           IPV+V ++ GPRVGN+RFKER  ELG+KV+R+VNV D VP  
Sbjct  300   NRSRSGKV----------IPVTVLTYGGPRVGNVRFKERLKELGVKVMRVVNVHDVVPKS  349

Query  1288  PGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLH  1467
             PG+  NE+  +   +    +  PW Y HVG ELALDH  SPFLK+  D   AHNLE  LH
Sbjct  350   PGLFLNERAPH--AVMKIAEGLPWCYCHVGEELALDHQNSPFLKSSVDPSNAHNLEALLH  407

Query  1468  LVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPE  1647
             L+DGYHG G RF  + GRD ALVNK S+FLK    VPP WRQD NKGMVR S+GRW+  E
Sbjct  408   LLDGYHGKGERFVLSNGRDPALVNKASDFLKEHFMVPPFWRQDANKGMVRNSEGRWIQAE  467

Query  1648  RSRIEA-HPPDTGHH  1689
             R R E  H PD  HH
Sbjct  468   RLRSEDHHSPDIHHH  482



>ref|XP_010522024.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Tarenaya 
hassleriana]
Length=528

 Score =   486 bits (1250),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 252/434 (58%), Positives = 307/434 (71%), Gaps = 21/434 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             + L + W ++ G  DW GLL+PM+  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  100   KRLRDTWRKVHGEDDWVGLLDPMDPVLRSELIRYGELAQACYDAFDFDPFSRYCGSCRFT  159

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +FFE LGMAD GY ++RYLYATSNINLPNFF+ S   ++WS++ANWMGYVAV+ DE  
Sbjct  160   RHKFFESLGMADCGYTVARYLYATSNINLPNFFKRSRWPKVWSKNANWMGYVAVSDDETS  219

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
               RLGRRDI +AWRGTVT LEWI DL + L P    +    DP  K ESGF DLYT+  K
Sbjct  220   RNRLGRRDIAVAWRGTVTRLEWIADLMDYLKPVTGNNLRCPDPGAKAESGFLDLYTD--K  277

Query  937   DTDCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVN  1110
             D  CNF  +SAREQ+L EV R++E +    E +SITVTGHSLG ALA+LSAYDIAEM +N
Sbjct  278   DEACNFSKFSAREQILTEVKRMVEMHGDGNEEMSITVTGHSLGGALAILSAYDIAEMGLN  337

Query  1111  VVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1290
               + G            +PV+VF++AGPRVGN+RFKER +ELG+KVLR+VNV D VP  P
Sbjct  338   RTRSGRV----------LPVTVFTYAGPRVGNVRFKERMEELGVKVLRVVNVHDVVPKSP  387

Query  1291  GIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1470
             G+  NE+  +   L    +  PW Y+HVG ELALDH  SPFLK   D   AHNLE  LHL
Sbjct  388   GLFLNERAPH--ALMKMAEGLPWCYSHVGCELALDHQNSPFLKPSVDPSNAHNLEALLHL  445

Query  1471  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             +DGYHG G+RF  A+GRD ALVNK S+FLK    +PP WRQD NKGMVR  +GRW+ PER
Sbjct  446   LDGYHGKGQRFVLASGRDPALVNKASDFLKDHFMIPPFWRQDANKGMVRNHEGRWIQPER  505

Query  1651  SRIEA-HPPDTGHH  1689
              R+E  HPPD   H
Sbjct  506   LRVEDHHPPDIHLH  519



>ref|XP_010469840.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=551

 Score =   486 bits (1250),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 253/434 (58%), Positives = 303/434 (70%), Gaps = 23/434 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L + W +IQG  DW GL+ PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+ ++   
Sbjct  122   LIDTWRKIQGEDDWAGLMEPMDPVLRSELIRYGEMAQACYDAFDFDPASKYCGSSRFSRL  181

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             +FF+ LGM+  GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE    
Sbjct  182   EFFDSLGMSGSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETSRN  241

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  942
             RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  KDT
Sbjct  242   RLGRRDIAIAWRGTVTKLEWIADLKDYLKPVSENKIRCPDPAVKVESGFLDLYTD--KDT  299

Query  943   DCNFCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVN  1110
              C F  +SAREQ+LAEV RL+E Y       +LSITVTGHSLG ALA+LSAYDIAEM +N
Sbjct  300   SCKFAKFSAREQILAEVKRLVETYDDEDDDCDLSITVTGHSLGGALAILSAYDIAEMGLN  359

Query  1111  VVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1290
               + G+           IPV+V ++ GPRVGN+RFKER +ELG+KV+R+VNV D VP  P
Sbjct  360   RSKSGKV----------IPVTVLTYGGPRVGNVRFKERMEELGVKVMRVVNVHDMVPKSP  409

Query  1291  GIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1470
             G+  NE     + L    +  PW Y HVG ELALDH  SPFLK   DL  AHNLE  LHL
Sbjct  410   GLFLNE--SAPQALMKIAEGLPWCYCHVGEELALDHQNSPFLKPSVDLSNAHNLEAMLHL  467

Query  1471  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             +DGYHG G RF  ++GRD ALVNK S+FLK    +PP WRQD NKGMVR S+GRW+  ER
Sbjct  468   LDGYHGKGERFVLSSGRDHALVNKASDFLKEHLQIPPFWRQDANKGMVRNSEGRWIQAER  527

Query  1651  SRIEA-HPPDTGHH  1689
              R E  H PD  HH
Sbjct  528   LRSEDHHSPDIHHH  541



>ref|XP_010558870.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Tarenaya 
hassleriana]
Length=533

 Score =   483 bits (1243),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 252/433 (58%), Positives = 305/433 (70%), Gaps = 25/433 (6%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             + L + W E+ G  DW GLL+PM+  LR E+IRYGE AQ CYD+FDFDP S+YCG+C++ 
Sbjct  103   KKLKDTWREVHGEDDWVGLLDPMDPVLRSELIRYGELAQTCYDAFDFDPFSRYCGSCRFA  162

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +FFE LG+AD GY ++RY+YATSNINLPNFF+ S   ++WS++ANWMGYVAV+ D+  
Sbjct  163   RHKFFESLGLADSGYTVARYIYATSNINLPNFFKRSRWPKVWSKNANWMGYVAVSDDDTS  222

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
               RLGRRDI IAWRGTVT LEWI DL + L P    +    DP +K+ESGF DLYT+  K
Sbjct  223   RNRLGRRDIAIAWRGTVTRLEWIADLMDYLKPVAGNNLRCPDPAVKVESGFLDLYTD--K  280

Query  937   DTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMKV  1107
             D  CNF  +SAREQ+L EV RL+E Y   K E LSITVTGHSLG ALA+LSAYD+AEM +
Sbjct  281   DEACNFSKFSAREQILTEVKRLVETYGDDKDEELSITVTGHSLGGALAILSAYDVAEMGL  340

Query  1108  NVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1287
             N  + G            +PV+V ++AGPRVGN+RFKER +ELG+KV+R+VNV D VP  
Sbjct  341   NRTRSGRV----------VPVTVMTYAGPRVGNVRFKERMEELGVKVMRVVNVHDVVPKS  390

Query  1288  PGIIANEKF--QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1461
             PG+  NE+      K  E  L   PW Y HVGVE+ALDH  SPFLK   D   AHNLE  
Sbjct  391   PGLFLNERAPRSLMKMAENLL---PWCYCHVGVEVALDHQNSPFLKPSVDPSNAHNLEAL  447

Query  1462  LHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVV  1641
             LHL+DGYHG G+RF  A+GRD ALVNK S+FLK    VPP WRQD NKGMV   +GRW+ 
Sbjct  448   LHLLDGYHGKGQRFVLASGRDPALVNKASDFLKDHFMVPPFWRQDANKGMVMNHEGRWIQ  507

Query  1642  PERSRIEA-HPPD  1677
              ER RIE  HPPD
Sbjct  508   SERPRIEDHHPPD  520



>ref|XP_006293988.1| hypothetical protein CARUB_v10022980mg [Capsella rubella]
 gb|EOA26886.1| hypothetical protein CARUB_v10022980mg [Capsella rubella]
Length=530

 Score =   483 bits (1242),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 250/435 (57%), Positives = 304/435 (70%), Gaps = 22/435 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L + W +IQG  DW GL++PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+ ++ 
Sbjct  100   RRLIDTWRKIQGEDDWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPASKYCGSSRFS  159

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
                FF+ LGM+  GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE  
Sbjct  160   RLDFFDSLGMSGSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETS  219

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
               RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  K
Sbjct  220   RNRLGRRDIAIAWRGTVTKLEWIADLKDYLKPVSENKIRCPDPAVKVESGFLDLYTD--K  277

Query  937   DTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMKV  1107
             DT C F  +SAREQ+LAEV RL++++      +LSITVTGHSLG ALA+LSAYDIAEM +
Sbjct  278   DTSCKFAKFSAREQILAEVKRLVDKHGDDSSSDLSITVTGHSLGGALAILSAYDIAEMGL  337

Query  1108  NVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1287
             N  + G+           IPV+V ++ GPRVGN+RFKER +ELG+KV+R+VNV D V   
Sbjct  338   NRSKTGKV----------IPVTVLTYGGPRVGNVRFKERMEELGVKVMRVVNVHDVVSKS  387

Query  1288  PGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLH  1467
             PG+  NE   +   L    +  PW Y HVG ELALDH  SPFLK   DL  AHNLE  LH
Sbjct  388   PGLFLNESAPH--ALMKIAEGLPWCYCHVGEELALDHQNSPFLKPSVDLSNAHNLEAMLH  445

Query  1468  LVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPE  1647
             L+DGYHG G RF  ++GRD ALVNK S+FLK    +PP WRQD NKGM+R S+GRW+  E
Sbjct  446   LLDGYHGKGERFVLSSGRDHALVNKASDFLKEHLQIPPFWRQDANKGMIRNSEGRWIQAE  505

Query  1648  RSRIEA-HPPDTGHH  1689
             R R E  H PD  HH
Sbjct  506   RLRSEDHHSPDIHHH  520



>ref|XP_006853087.1| hypothetical protein AMTR_s00038p00110060 [Amborella trichopoda]
 gb|ERN14554.1| hypothetical protein AMTR_s00038p00110060 [Amborella trichopoda]
Length=514

 Score =   482 bits (1240),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 246/427 (58%), Positives = 302/427 (71%), Gaps = 17/427 (4%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L E W EIQG   W+GLL PM+  LRREIIRYGEFAQACYDSF+F  +S+YCGTC Y  +
Sbjct  84    LLERWREIQGENKWKGLLEPMDPLLRREIIRYGEFAQACYDSFNFSTYSRYCGTCNYPMS  143

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
              FF  LGM D GY +SRYLYATS  NL  FF+ S   ++WSQHANW+GYV+VATD   ++
Sbjct  144   SFFRALGMDDLGYEVSRYLYATSASNLRKFFRKSLHAQVWSQHANWIGYVSVATDPKVVK  203

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  954
              LGRRDI+ AWRGTVTYLEW+ D+ +     +F  D ++K+ESGF DLY +  K+T C F
Sbjct  204   ELGRRDILFAWRGTVTYLEWVEDVMDYQVKPNFGPDANVKVESGFLDLYNS--KETACGF  261

Query  955   CSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
             CSYSAREQ+++E  RL+ERYK  G  LSIT+TGHSLG ALALLSAYDIAE  +NV+    
Sbjct  262   CSYSAREQVISETRRLMERYKDEGNELSITITGHSLGGALALLSAYDIAETGLNVLP---  318

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1308
                       ++P++VF+F  PRVGN RF +RCDELGI VLR+ N  DKVPTVPG+I NE
Sbjct  319   -------DGRRVPITVFTFGSPRVGNRRFADRCDELGIHVLRVFNKHDKVPTVPGMIINE  371

Query  1309  KFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1488
                    +   +   PWSY+HVGVEL LDH+ SP ++ G  +   HNLE +LHLV+ Y+G
Sbjct  372   DVAVPDIVADIM---PWSYSHVGVELELDHNVSPVVEAGLAIPARHNLELYLHLVNAYNG  428

Query  1489  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAH  1668
                 F+ A  RD AL+NK    LK +  +PP WRQDENKG+VR  DGRWVVPER+ I+AH
Sbjct  429   PKGGFKPAYKRDPALLNKSDTILKEKFHMPPCWRQDENKGLVRAQDGRWVVPERTSIDAH  488

Query  1669  PPDTGHH  1689
             PPDT HH
Sbjct  489   PPDTDHH  495



>ref|XP_010475428.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Camelina 
sativa]
Length=511

 Score =   482 bits (1240),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 249/432 (58%), Positives = 309/432 (72%), Gaps = 23/432 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             ++L + W +IQG  +W GL++PM+  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  81    KSLKDTWRKIQGEDNWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  140

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
                 FE LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE  
Sbjct  141   RRHLFESLGILDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEEA  200

Query  769   IR-RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNSK  933
              R RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  
Sbjct  201   TRGRLGRRDIAIAWRGTVTRLEWIADLKDYLKPVSGNGIRCSDPAVKVESGFLDLYTD--  258

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  1104
             KDT C F  +SAREQ+L EV RL+ERY   +GE+LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  259   KDTSCKFSKFSAREQVLTEVKRLVERYGDEEGEDLSITVTGHSLGGALAVLSAYDVAEMG  318

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
             +N  ++G+           IPV+VF++ GPRVGN+RFKER ++LG+KVLR+VN  D V  
Sbjct  319   LNRTRKGKL----------IPVTVFTYGGPRVGNIRFKERIEKLGVKVLRVVNQHDVVAK  368

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
              PG+  NE+  +   L       PW Y HVG +L LDH  SPFLK   DL  AHNLE  L
Sbjct  369   SPGLFLNERAPH--ALMKLAGGLPWCYCHVGEKLPLDHQNSPFLKPTVDLSTAHNLEALL  426

Query  1465  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1644
             HL+DGYHG G+RF  ++GRD ALVNK S+FLK    VPP WRQD NKGM+++SDGRW+ P
Sbjct  427   HLLDGYHGKGKRFVLSSGRDPALVNKASDFLKDHFMVPPYWRQDANKGMIKSSDGRWIQP  486

Query  1645  ERSRIEA-HPPD  1677
             +R R E  H PD
Sbjct  487   DRIRAEDHHAPD  498



>ref|XP_010469841.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=551

 Score =   483 bits (1243),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 252/434 (58%), Positives = 302/434 (70%), Gaps = 23/434 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L + W +IQG  DW GL+ PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+ ++   
Sbjct  122   LIDTWRKIQGEDDWAGLMEPMDPVLRSELIRYGEMAQACYDAFDFDPASKYCGSSRFSRL  181

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             +FF+ LGM   GY ++RYLYATSNINLPNF+  S  +++WS++ANWMGYVAV+ DE    
Sbjct  182   EFFDSLGMNGSGYEVARYLYATSNINLPNFYSKSRWSKVWSKNANWMGYVAVSDDETSRN  241

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  942
             RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  KDT
Sbjct  242   RLGRRDIAIAWRGTVTKLEWIADLKDYLKPVSENKIRCPDPAVKVESGFLDLYTD--KDT  299

Query  943   DCNFCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVN  1110
              C F  +SAREQ+LAEV RL+E Y       +LSITVTGHSLG ALA+LSAYDIAEM +N
Sbjct  300   SCKFAKFSAREQILAEVKRLVETYDDEDDDCDLSITVTGHSLGGALAILSAYDIAEMGLN  359

Query  1111  VVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1290
               + G+           IPV+V ++ GPRVGN+RFKER +ELG+KV+R+VNV D VP  P
Sbjct  360   RSKSGKV----------IPVTVLTYGGPRVGNVRFKERMEELGVKVMRVVNVHDMVPKSP  409

Query  1291  GIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1470
             G+  NE     + L    +  PW Y HVG ELALDH  SPFLK   DL  AHNLE  LHL
Sbjct  410   GLFLNE--SAPQALMKIAEGLPWCYCHVGEELALDHQNSPFLKPSVDLSNAHNLEAMLHL  467

Query  1471  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             +DGYHG G RF  ++GRD ALVNK S+FLK    +PP WRQD NKGMVR S+GRW+  ER
Sbjct  468   LDGYHGKGERFVLSSGRDHALVNKASDFLKEHLQIPPFWRQDANKGMVRNSEGRWIQAER  527

Query  1651  SRIEA-HPPDTGHH  1689
              R E  H PD  HH
Sbjct  528   LRSEDHHSPDIHHH  541



>ref|XP_010510341.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic [Camelina 
sativa]
Length=526

 Score =   481 bits (1238),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 253/434 (58%), Positives = 304/434 (70%), Gaps = 23/434 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L + W +IQG  DW GL+ PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+ ++   
Sbjct  97    LIDTWRKIQGEDDWAGLMEPMDPVLRSELIRYGEMAQACYDAFDFDPASKYCGSSRFSRL  156

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             +FF+ LGM+  GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE    
Sbjct  157   EFFDSLGMSGSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETSRN  216

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  942
             RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  KDT
Sbjct  217   RLGRRDIAIAWRGTVTKLEWIADLKDYLKPVSENKIRCPDPAVKVESGFLDLYTD--KDT  274

Query  943   DCNFCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVN  1110
              C F  +SAREQ+LAEV RL+E Y    +  +LSITVTGHSLG ALA+LSAYDIAEM +N
Sbjct  275   SCKFAKFSAREQILAEVKRLVETYDDEDEDSDLSITVTGHSLGGALAILSAYDIAEMGLN  334

Query  1111  VVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1290
               + G+           IPV+V ++ GPRVGN+RFKER +ELG+KV+R+VNV D VP  P
Sbjct  335   RSKSGKV----------IPVTVLTYGGPRVGNVRFKERMEELGVKVMRVVNVHDMVPKSP  384

Query  1291  GIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1470
             G+  NE   +   L    +  PW Y HVG ELALDH  SPFLK   DL  AHNLE  LHL
Sbjct  385   GLFLNESAPH--ALMKIAEGLPWCYCHVGEELALDHQNSPFLKPSVDLSNAHNLEATLHL  442

Query  1471  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             +DGYHG G RF  ++GRD ALVNK S+FLK    +PP WRQD NKGMVR S+GRW+  ER
Sbjct  443   LDGYHGKGERFVLSSGRDHALVNKASDFLKEHLQIPPFWRQDANKGMVRNSEGRWIQAER  502

Query  1651  SRIEA-HPPDTGHH  1689
              R E  H PD  HH
Sbjct  503   LRSEDHHSPDIHHH  516



>ref|XP_010457831.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic isoform X2 
[Camelina sativa]
Length=469

 Score =   479 bits (1233),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 249/432 (58%), Positives = 306/432 (71%), Gaps = 23/432 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             ++L + W +IQG  +W GL++PM+  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  39    KSLRDTWRKIQGEDNWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  98

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
                 FE LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV  DE  
Sbjct  99    RRHLFESLGILDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVTDDEEA  158

Query  769   IR-RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  933
              R RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  
Sbjct  159   TRGRLGRRDIAIAWRGTVTRLEWIADLKDYLKPVSGNGIRCPDPAVKVESGFLDLYTD--  216

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  1104
             KDT C F  +SAREQ+L EV RL+ERY   +GE+LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  217   KDTSCKFSKFSAREQVLTEVKRLVERYGDEEGEDLSITVTGHSLGGALAVLSAYDVAEMG  276

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
             +N  ++G+           IPV+ F++ GPRVGN+RFKER ++LG+KVLR+VN  D V  
Sbjct  277   LNRTRKGKV----------IPVTAFTYGGPRVGNIRFKERIEKLGVKVLRVVNEHDVVAK  326

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
              PG+  NE+  +   L       PW Y HVG +L LDH  SPFLK   DL  AHNLE  L
Sbjct  327   SPGLFLNERAPH--ALMKLAGGLPWCYCHVGEKLPLDHQNSPFLKPTVDLSTAHNLEALL  384

Query  1465  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1644
             HL+DGYHG G+RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMV+ SDGRW+ P
Sbjct  385   HLLDGYHGKGKRFVLSSGRDPALVNKASDFLKDHFMVPPYWRQDANKGMVKNSDGRWIQP  444

Query  1645  ERSRIEA-HPPD  1677
             +R R E  H PD
Sbjct  445   DRIRAEDHHAPD  456



>ref|XP_010414252.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=529

 Score =   481 bits (1238),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 253/434 (58%), Positives = 304/434 (70%), Gaps = 23/434 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L + W +IQG  DW GL+ PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+ ++   
Sbjct  100   LIDTWRKIQGEDDWAGLMEPMDPVLRSELIRYGEMAQACYDAFDFDPASKYCGSSRFSRL  159

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             +FF+ LGM+  GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE    
Sbjct  160   EFFDSLGMSGSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETSRN  219

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  942
             RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  KDT
Sbjct  220   RLGRRDIAIAWRGTVTKLEWIADLKDYLKPVSENKIRCPDPAVKVESGFLDLYTD--KDT  277

Query  943   DCNFCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVN  1110
              C F  +SAREQ+LAEV RL+E Y    +  +LSITVTGHSLG ALA+LSAYDIAEM +N
Sbjct  278   SCKFAKFSAREQILAEVKRLVETYDDEDEDSDLSITVTGHSLGGALAILSAYDIAEMGLN  337

Query  1111  VVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1290
               + G+           IPV+V ++ GPRVGN+RFKER +ELG+KV+R+VNV D VP  P
Sbjct  338   RSKSGKV----------IPVTVLTYGGPRVGNVRFKERMEELGVKVMRVVNVHDMVPKSP  387

Query  1291  GIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1470
             G+  NE   +   L    +  PW Y HVG ELALDH  SPFLK   DL  AHNLE  LHL
Sbjct  388   GLFLNESAPH--ALMKIAEGLPWCYCHVGEELALDHQNSPFLKPSVDLSNAHNLEAMLHL  445

Query  1471  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             +DGYHG G RF  ++GRD ALVNK S+FLK    +PP WRQD NKGMVR S+GRW+  ER
Sbjct  446   LDGYHGKGERFVLSSGRDHALVNKASDFLKEHLQIPPFWRQDANKGMVRNSEGRWIQAER  505

Query  1651  SRIEA-HPPDTGHH  1689
              R E  H PD  HH
Sbjct  506   LRSEDHHSPDIHHH  519



>ref|NP_849603.1| phospholipase A1-Igamma1 [Arabidopsis thaliana]
 sp|Q941F1.2|PLA15_ARATH RecName: Full=Phospholipase A1-Igamma1, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF63138.1|AC011001_8 Similar to lipases [Arabidopsis thaliana]
 gb|AAM20450.1| lipase, putative [Arabidopsis thaliana]
 gb|AEE28039.1| phospholipase A1-Igamma1 [Arabidopsis thaliana]
Length=515

 Score =   480 bits (1236),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 251/432 (58%), Positives = 306/432 (71%), Gaps = 23/432 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             + L + W +IQG  DW GL++PM+  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  83    KRLRDTWRKIQGEDDWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  142

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
                 F+ LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D   
Sbjct  143   RRHLFDSLGIIDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDNEA  202

Query  769   IR-RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH---FR-DDPDIKIESGFFDLYTNSK  933
              R RLGRRDI IAWRGTVT LEWI DLK+ L P     FR  DP +K ESGF DLYT+  
Sbjct  203   TRCRLGRRDIAIAWRGTVTRLEWIADLKDFLKPVSGNGFRCPDPAVKAESGFLDLYTD--  260

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  1104
             KDT CNF  +SAREQ+L EV RL+ERY   +GE LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  261   KDTSCNFSKFSAREQVLTEVKRLVERYGDEEGEELSITVTGHSLGGALAVLSAYDVAEMG  320

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
             VN  ++G+           IPV+ F++ GPRVGN+RFKER ++LG+KVLR+VN  D V  
Sbjct  321   VNRTRKGKV----------IPVTAFTYGGPRVGNIRFKERIEKLGVKVLRVVNEHDVVAK  370

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
              PG+  NE+    + L       PW Y+HVG  L LDH  SPFLK   DL  AHNLE  L
Sbjct  371   SPGLFLNER--APQALMKLAGGLPWCYSHVGEMLPLDHQKSPFLKPTVDLSTAHNLEALL  428

Query  1465  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1644
             HL+DGYHG G+RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMVR +DGRW+ P
Sbjct  429   HLLDGYHGKGQRFVLSSGRDPALVNKASDFLKDHFMVPPYWRQDANKGMVRNTDGRWIQP  488

Query  1645  ERSRI-EAHPPD  1677
             +R R  + H PD
Sbjct  489   DRIRADDQHAPD  500



>ref|XP_006417878.1| hypothetical protein EUTSA_v10007393mg [Eutrema salsugineum]
 gb|ESQ36231.1| hypothetical protein EUTSA_v10007393mg [Eutrema salsugineum]
Length=512

 Score =   479 bits (1233),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 251/432 (58%), Positives = 305/432 (71%), Gaps = 21/432 (5%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             +L + W +IQG  DW GL++PM+  LR E+IRYGE AQACYD+FDFDP S+YCG+C++  
Sbjct  86    SLRDTWRKIQGEDDWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFTR  145

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + F+ LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DEA  
Sbjct  146   HKLFDSLGIFDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEATR  205

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH---FR-DDPDIKIESGFFDLYTNSKKD  939
              RLGRRDI IAWRGTVT LEWI DLK+ L P     FR  DP++K ESGF DLYT+  KD
Sbjct  206   SRLGRRDIAIAWRGTVTRLEWIADLKDFLKPVSGNGFRCPDPEVKAESGFLDLYTD--KD  263

Query  940   TDCNFCSYSAREQLLAEVNRLIERYKGE--NLSITVTGHslgaalallsaYDIAEMKVNV  1113
             T CNF  +SAREQ+L EV R++ERY  E  +LSITVTGHSLG ALA+LSAYD+AEM +N 
Sbjct  264   TACNFSKFSAREQVLTEVKRMVERYGDEEDDLSITVTGHSLGGALAVLSAYDVAEMGMNR  323

Query  1114  VQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1293
              + G+           IPV+ F++ GPRVGN+RFKER  ELG+KVLR+VN  D V   PG
Sbjct  324   TRRGKV----------IPVTAFTYGGPRVGNIRFKERMVELGVKVLRVVNEHDVVTKSPG  373

Query  1294  IIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
             +  NE   +   L       PW Y HVG +L LDH  SPFLK   D   AHNLE  LHL+
Sbjct  374   LFLNESAPH--ALMKLAGGLPWCYCHVGEKLPLDHQNSPFLKPSVDPSTAHNLEALLHLL  431

Query  1474  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1653
             DGYHG G+RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMVR S+GRW+ P+R 
Sbjct  432   DGYHGKGQRFVLSSGRDPALVNKASDFLKDHFMVPPYWRQDANKGMVRNSEGRWIQPDRI  491

Query  1654  RIEA-HPPDTGH  1686
             R E  H PD  H
Sbjct  492   RAEDHHAPDIHH  503



>ref|XP_010457830.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic isoform X1 
[Camelina sativa]
Length=469

 Score =   478 bits (1229),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 248/432 (57%), Positives = 306/432 (71%), Gaps = 23/432 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             ++L + W +IQG  +W GL++PM+  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  39    KSLRDTWRKIQGEDNWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  98

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
                 FE LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV  DE  
Sbjct  99    RRHLFESLGILDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVTDDEEA  158

Query  769   IR-RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  933
              R R+GRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  
Sbjct  159   TRGRVGRRDIAIAWRGTVTRLEWIADLKDYLKPVSGNGIRCPDPAVKVESGFLDLYTD--  216

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  1104
             KDT C F  +SAREQ+L EV RL+ERY   +GE+LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  217   KDTSCKFSKFSAREQVLTEVKRLVERYGDEEGEDLSITVTGHSLGGALAVLSAYDVAEMG  276

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
             +N  ++G+           IPV+ F++ GPRVGN+RFKER ++LG+KVLR+VN  D V  
Sbjct  277   LNRTRKGKV----------IPVTAFTYGGPRVGNIRFKERIEKLGVKVLRVVNEHDVVAK  326

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
              PG+  NE+  +   L       PW Y HVG +L LDH  SPFLK   DL  AHNLE  L
Sbjct  327   SPGLFLNERAPH--ALMKLAGGLPWCYCHVGEKLPLDHQNSPFLKPTVDLSTAHNLEALL  384

Query  1465  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1644
             HL+DGYHG G+RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMV+ SDGRW+ P
Sbjct  385   HLLDGYHGKGKRFVLSSGRDPALVNKASDFLKDHFMVPPYWRQDANKGMVKNSDGRWIQP  444

Query  1645  ERSRIEA-HPPD  1677
             +R R E  H PD
Sbjct  445   DRIRAEDHHAPD  456



>ref|XP_002892359.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68618.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=518

 Score =   478 bits (1229),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 250/432 (58%), Positives = 307/432 (71%), Gaps = 23/432 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             + L + W +IQG  DW GL++PM+  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  86    KRLRDTWRKIQGEDDWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  145

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
                 F+ LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANW+GYVAV+ D+  
Sbjct  146   RRHLFDSLGIIDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWIGYVAVSDDDEA  205

Query  769   IR-RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH---FR-DDPDIKIESGFFDLYTNSK  933
              R RLGRRDI IAWRGTVT LEWI DLK+ L P     FR  DP +K ESGF DLYT+  
Sbjct  206   TRCRLGRRDIAIAWRGTVTRLEWIADLKDFLKPVSGNGFRCPDPAVKAESGFLDLYTD--  263

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  1104
             KDT CNF  +SAREQ+L EV RL+ERY   +GE LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  264   KDTCCNFSKFSAREQVLTEVKRLVERYGDEEGEELSITVTGHSLGGALAVLSAYDVAEMG  323

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
             +N  ++G+           IPV+ F++ GPRVGN+RFKER +ELG+KVLR+VN  D V  
Sbjct  324   LNRTRKGKV----------IPVTAFTYGGPRVGNIRFKERIEELGVKVLRVVNEHDVVAK  373

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
              PG+  NE+    + L       PW Y+HVG  L LDH  SPFLK   DL  AHNLE  L
Sbjct  374   SPGLFLNER--APQALMKLAGGLPWCYSHVGEMLPLDHQKSPFLKPTVDLSTAHNLEALL  431

Query  1465  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1644
             HL+DGYHG G+RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMVR +DGRW+ P
Sbjct  432   HLLDGYHGKGQRFVLSSGRDPALVNKASDFLKDHFMVPPYWRQDANKGMVRNTDGRWIQP  491

Query  1645  ERSRIEA-HPPD  1677
             +R R +  H PD
Sbjct  492   DRIRADDHHAPD  503



>ref|XP_006307284.1| hypothetical protein CARUB_v10008898mg [Capsella rubella]
 gb|EOA40182.1| hypothetical protein CARUB_v10008898mg [Capsella rubella]
Length=508

 Score =   477 bits (1228),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 249/432 (58%), Positives = 305/432 (71%), Gaps = 23/432 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             ++L + W +IQG  +W GLL+PM+  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  79    KSLRDTWRKIQGEDNWAGLLDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  138

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
                 FE LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE  
Sbjct  139   RRHLFESLGIIDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEEA  198

Query  769   IR-RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  933
              R RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  
Sbjct  199   SRPRLGRRDIAIAWRGTVTRLEWIADLKDFLKPVSGNGIRCPDPAVKVESGFLDLYTD--  256

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  1104
             KDT C F  +SAREQ+L EV RL+ERY   +GE+LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  257   KDTSCKFSKFSAREQILTEVKRLVERYGDEEGEDLSITVTGHSLGGALAVLSAYDVAEMG  316

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
             +N  ++G+           IPV+ F++ GPRVGN+RFKER + LG+KVLR+VN  D V  
Sbjct  317   LNRTRKGKV----------IPVTAFTYGGPRVGNIRFKERIEGLGVKVLRVVNEHDVVAK  366

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
              PG+  NE   +   L       PW Y HVG +L LDH  SPFLK   DL  AHNLE  L
Sbjct  367   SPGLFLNESAPH--ALMKLAGGLPWCYCHVGEKLPLDHQNSPFLKPTVDLSTAHNLEALL  424

Query  1465  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVP  1644
             HL+DGYHG G+RF  ++GRD ALVNK S+FLK    VPP WRQD NKGMV+ +DGRW+ P
Sbjct  425   HLLDGYHGKGQRFVLSSGRDPALVNKASDFLKDHFMVPPYWRQDANKGMVKNTDGRWIQP  484

Query  1645  ERSRIEA-HPPD  1677
             +R R E  H PD
Sbjct  485   DRIRAEDHHAPD  496



>ref|XP_004146954.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Cucumis 
sativus]
Length=508

 Score =   477 bits (1228),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 245/429 (57%), Positives = 301/429 (70%), Gaps = 20/429 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L + W EI GS DW  LL+PMN  LR E+IRYGE  QACYDSF +DP+SKYCGT +Y   
Sbjct  85    LAKKWREIHGSGDWANLLDPMNPILRSELIRYGEMTQACYDSFVYDPYSKYCGTSRYPLE  144

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
              FF+ LG+   GY+++R+LYAT N  +PN F      ++WS  ANW+GYVAV+ DE   +
Sbjct  145   SFFQSLGLESEGYQVTRFLYATGNTQMPNLFIKPRFPKLWSTRANWIGYVAVS-DEETSK  203

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  942
             RLGRRDI+IAWRGTVT LEW+ D+ NIL+P   R     DP +K+E GF DLYT+  KD 
Sbjct  204   RLGRRDILIAWRGTVTRLEWVADMTNILNPISSRKIQCPDPSVKVEFGFLDLYTD--KDE  261

Query  943   DCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
             +C FC YSAREQ+LAE+ RL+E+YK E +SIT+TGHSLG+ALA LSAYDIAE  +N    
Sbjct  262   ECEFCKYSAREQILAEMKRLLEKYKEEEVSITITGHSLGSALATLSAYDIAETGLN----  317

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
                    TSA   + +SVFSF GPRVGN+RF ER ++LG+KVLR+VN+ D VP  PG+  
Sbjct  318   ------KTSAGRDVHISVFSFGGPRVGNMRFSERMNDLGVKVLRVVNIHDIVPKSPGLFL  371

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             NEK        TT    PWSY HVGVEL LDH  SP+L+  TD GC+HNLE HLHL+DGY
Sbjct  372   NEKLPPWLLKMTTW--LPWSYVHVGVELELDHLESPYLRRSTDAGCSHNLEAHLHLLDGY  429

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIE  1662
              G G +F  A GRD ALVNK  +FL+ ++ VPP WRQDENKGM+   DGRWV  +RS I+
Sbjct  430   QGKGMKFERAVGRDPALVNKSCDFLEDKYMVPPMWRQDENKGMIYV-DGRWVFADRSDID  488

Query  1663  AHPPDTGHH  1689
              HP DT +H
Sbjct  489   GHPEDTHYH  497



>ref|XP_004168244.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Cucumis 
sativus]
 gb|KGN44760.1| hypothetical protein Csa_7G378490 [Cucumis sativus]
Length=508

 Score =   476 bits (1226),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 245/429 (57%), Positives = 301/429 (70%), Gaps = 20/429 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L + W EI GS DW  LL+PMN  LR E+IRYGE  QACYDSF +DP+SKYCGT +Y   
Sbjct  85    LAKKWREIHGSGDWANLLDPMNPILRSELIRYGEMTQACYDSFVYDPYSKYCGTSRYPLE  144

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
              FF+ LG+   GY+++R+LYAT N  +PN F      ++WS  ANW+GYVAV+ DE   +
Sbjct  145   SFFQSLGLESEGYQVTRFLYATGNTQMPNLFIKPRFPKLWSTRANWIGYVAVS-DEETSK  203

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  942
             RLGRRDI+IAWRGTVT LEW+ D+ NIL+P   R     DP +K+E GF DLYT+  KD 
Sbjct  204   RLGRRDILIAWRGTVTRLEWVADMTNILNPISSRKIQCPDPSVKVEFGFLDLYTD--KDE  261

Query  943   DCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
             +C FC YSAREQ+LAE+ RL+E+YK E +SIT+TGHSLG+ALA LSAYDIAE  +N    
Sbjct  262   ECEFCKYSAREQILAEMKRLLEKYKEEEVSITITGHSLGSALATLSAYDIAETGLN----  317

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
                    TSA   + +SVFSF GPRVGN+RF ER ++LG+KVLR+VN+ D VP  PG+  
Sbjct  318   ------KTSAGRDVHISVFSFGGPRVGNMRFSERMNDLGVKVLRVVNIHDIVPKSPGLFL  371

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             NEK        TT    PWSY HVGVEL LDH  SP+L+  TD GC+HNLE HLHL+DGY
Sbjct  372   NEKLPPWLLKMTTW--LPWSYVHVGVELELDHLESPYLRRSTDAGCSHNLEAHLHLLDGY  429

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIE  1662
              G G +F  A GRD ALVNK  +FL+ ++ VPP WRQDENKGM+   DGRWV  +RS I+
Sbjct  430   QGKGMKFELAIGRDPALVNKSCDFLEDKYMVPPMWRQDENKGMIYV-DGRWVFADRSDID  488

Query  1663  AHPPDTGHH  1689
              HP DT +H
Sbjct  489   GHPEDTHYH  497



>ref|XP_008451275.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X1 [Cucumis melo]
Length=513

 Score =   476 bits (1226),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 241/427 (56%), Positives = 301/427 (70%), Gaps = 20/427 (5%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI GS DW GLL+PMN  LR E+IRYGE +Q+CYD+FD+DP SKYCG+C++   +FFE
Sbjct  91    WREIHGSNDWTGLLDPMNDLLRSELIRYGEMSQSCYDAFDYDPFSKYCGSCRFSRGKFFE  150

Query  607   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  786
             +LGM + GY ++RYLYATSNIN+PNFF+ S   ++WS+ ANW+GYVAV+ DE   + LGR
Sbjct  151   RLGMENVGYEVTRYLYATSNINMPNFFKKSRWPKVWSKSANWIGYVAVSNDEKS-KELGR  209

Query  787   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNF  954
             RDIV+AWRGTVT LEWI DL + L P         +  +K+ESGF DLYT  K++  C +
Sbjct  210   RDIVVAWRGTVTRLEWITDLMDFLKPIAEAKIGCPNSGVKVESGFVDLYTE-KEEKGCGY  268

Query  955   CSYSAREQLLAEVNRLIERYKG--ENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
             C +SAREQ++AEV RL ER+ G  E +SIT+TGHSLG+ALA+LS +DIAE  +N +  G 
Sbjct  269   CRFSAREQVMAEVKRLTERFGGAEEEMSITITGHSLGSALAVLSGFDIAETGLNRLGNGR  328

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1308
                        +PV VFSF+GPRVGN  FKE   ELG+KVLR+VN+ D VP  PG + NE
Sbjct  329   L----------VPVCVFSFSGPRVGNFSFKEHLHELGVKVLRVVNIHDIVPKTPGFLFNE  378

Query  1309  KFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1488
                  + +    +  PWSY+HVGVEL LDH  SPFLK   D  CAHNLE  LHL+DGYHG
Sbjct  379   SI--PRAVMQFAEGLPWSYSHVGVELKLDHKVSPFLKQTNDPVCAHNLEALLHLLDGYHG  436

Query  1489  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAH  1668
              G RF  A+GRD ALVNK  +FLK  + VPP WRQDENKGM+R  DGRW+ P+R + + H
Sbjct  437   KGGRFVLASGRDPALVNKGCDFLKDHYLVPPNWRQDENKGMIRNQDGRWIQPDRLKFDDH  496

Query  1669  PPDTGHH  1689
             P D  HH
Sbjct  497   PQDIHHH  503



>ref|XP_010938535.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Elaeis 
guineensis]
Length=524

 Score =   476 bits (1225),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 248/432 (57%), Positives = 304/432 (70%), Gaps = 23/432 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L + W EI G   W GLL+PM+  LR E+IRYGEFAQACYD+FD+DP S+YCG+C+Y   
Sbjct  98    LADRWREIHGRDHWAGLLDPMDPLLRSELIRYGEFAQACYDAFDYDPFSRYCGSCRYSRR  157

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             +FF  LGM   GY ++ YLYATSNINLPNFF  +   + WSQ ANW+GY+AV +D+A   
Sbjct  158   KFFASLGMDTAGYDVTHYLYATSNINLPNFFTKTRGPKSWSQKANWIGYIAV-SDDATTA  216

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  942
              LGRRDIVIAWRGTVT LEW+ DL + L P         DP++K+ESGF DLYT+  KD 
Sbjct  217   LLGRRDIVIAWRGTVTRLEWVADLMDFLRPVASEGIPCPDPEVKVESGFVDLYTD--KDP  274

Query  943   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
              C FC YSAR+Q+L EV RL+E++   GE +SITVTGHSLG+ALA++SA+DIAE  V+V 
Sbjct  275   TCRFCKYSARQQVLTEVRRLVEQHTKMGETVSITVTGHSLGSALAMVSAFDIAETGVDV-  333

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
                           K+ V+V SF+GPRVGN RFKER +ELG+K LR+VNV D VP VPG+
Sbjct  334   ---------GVDGEKVAVTVLSFSGPRVGNGRFKERFEELGLKALRVVNVHDTVPKVPGV  384

Query  1297  IANEKF-QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
             + NE   ++ ++L   ++  PWSY+HVGVELALDH  SPF K   D  C HNLE HLHL+
Sbjct  385   LFNEHVPEFVRRL---VEGLPWSYSHVGVELALDHKRSPFFKDTGDPSCFHNLEAHLHLL  441

Query  1474  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1653
             DGYHG G RF  A+ RD ALVNK  +FLK    VPP WRQDENKGMVR  DGRWV  ER 
Sbjct  442   DGYHGSGHRFYLASKRDPALVNKACDFLKDHLMVPPFWRQDENKGMVRAHDGRWVQRERQ  501

Query  1654  RIEAHPPDTGHH  1689
             +++ HP D  HH
Sbjct  502   KMDDHPSDMHHH  513



>ref|XP_007144693.1| hypothetical protein PHAVU_007G177100g [Phaseolus vulgaris]
 gb|ESW16687.1| hypothetical protein PHAVU_007G177100g [Phaseolus vulgaris]
Length=504

 Score =   475 bits (1222),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 242/429 (56%), Positives = 299/429 (70%), Gaps = 20/429 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L E W +IQG  DW GLL PM+  LR E IRYG+ AQACYD+FDFDP SKYCG+C++   
Sbjct  81    LPEAWRQIQGESDWAGLLEPMDPLLRMETIRYGDMAQACYDAFDFDPFSKYCGSCRFTPR  140

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
              FF  L M   GY ++RYLYAT+NINLPNFF+HS  +++WS++ANW GYVAV +D A   
Sbjct  141   NFFSSLEMPLVGYTVTRYLYATANINLPNFFKHSRWSKMWSKNANWAGYVAV-SDHAMTT  199

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  942
             RLGRRDI IAWRGTVT LEW+ DL + L P         D  +K+ESGF +LYT+  K+ 
Sbjct  200   RLGRRDITIAWRGTVTCLEWVADLMDFLKPISSNGIPCPDQTVKVESGFLELYTD--KEE  257

Query  943   DCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
              C++C +SAREQ+L EV RL+E Y+ E +SIT+TGHSLG+ALA+LSAYDIAE   N ++ 
Sbjct  258   SCSYCKFSAREQVLTEVKRLLEIYRDEEVSITITGHSLGSALAILSAYDIAETGANTMR-  316

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
                          + V+V SF+GPRVGN+RFKER + LG+KVLR+VN  D VP  PG+  
Sbjct  317   ---------DGRGVGVTVMSFSGPRVGNVRFKERLERLGVKVLRVVNKHDVVPKAPGLFF  367

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             NE  Q    +    +  PWSY+HVGVELALDH  SPFL    D  CAHNLE  LHL+DGY
Sbjct  368   NE--QLPAAVMKVAEGLPWSYSHVGVELALDHKKSPFLNPNGDAVCAHNLEALLHLLDGY  425

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIE  1662
             HG G RF  A+GRD ALVNK  +FLK  H +PP WRQD NKGM+R S+GRW+ PER +++
Sbjct  426   HGKGERFVLASGRDPALVNKGCDFLKDHHMIPPNWRQDANKGMIR-SNGRWMQPERPKLQ  484

Query  1663  AHPPDTGHH  1689
              HP D  HH
Sbjct  485   VHPQDMHHH  493



>ref|XP_008802654.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Phoenix 
dactylifera]
Length=522

 Score =   475 bits (1223),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 248/431 (58%), Positives = 301/431 (70%), Gaps = 21/431 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L + W EI G  DW GLL+PM+  LR E+IRYGEFAQACYD+FD+ P S+YCG+C+Y+  
Sbjct  97    LADRWREIHGRDDWTGLLDPMDPLLRSELIRYGEFAQACYDAFDYQPFSRYCGSCRYNRR  156

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             QFF  LGM    Y ++ YLYATSNINLPNFF  +   + WSQ ANW+GY+AV +D+A   
Sbjct  157   QFFASLGMDAADYEVAHYLYATSNINLPNFFTTTRGGKTWSQKANWIGYIAV-SDDAATA  215

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  942
             RLGRRD+VIAWRGTVT LEW+ DL + L P         DP++K+ESGF DLYT+  KD 
Sbjct  216   RLGRRDVVIAWRGTVTRLEWVADLMDFLRPVASEGIPCPDPEVKVESGFIDLYTD--KDP  273

Query  943   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
              C FC YSAR+Q+L EV RL+E++   GE +SITVTGHSLG+ALA+LSAYDIAE  ++V 
Sbjct  274   SCRFCKYSARQQVLTEVRRLVEQHTKMGETVSITVTGHSLGSALAMLSAYDIAETGLDV-  332

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
                           K+ V+VFSF+GPRVGN +FKER + LG+K LR+VNV D VP VPGI
Sbjct  333   ---------GVDGEKVAVTVFSFSGPRVGNGKFKERFEGLGLKALRVVNVHDTVPKVPGI  383

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
             + NE     + L    +  PWSY+HVGVELALDH  SPFLK   D  C HNLE  LHL+D
Sbjct  384   LVNE--HVPELLRKLAEGLPWSYSHVGVELALDHKSSPFLKDTGDRSCFHNLEALLHLID  441

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG G++F  A+ RD ALVNK  +FLK    VPP WRQ+ENKGMVR  DGRWV  ER +
Sbjct  442   GYHGSGQKFYLASKRDPALVNKACDFLKDHLMVPPFWRQEENKGMVRAHDGRWVQRERQK  501

Query  1657  IEAHPPDTGHH  1689
             IE H  D  HH
Sbjct  502   IEDHALDIHHH  512



>ref|XP_004146952.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004165635.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Cucumis 
sativus]
 gb|KGN44758.1| hypothetical protein Csa_7G378470 [Cucumis sativus]
Length=505

 Score =   473 bits (1216),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 240/427 (56%), Positives = 301/427 (70%), Gaps = 20/427 (5%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI GS DW GLL+PMN  LR E+IRYGE +Q+CYD+FD+DP SKYCG+C++   +FFE
Sbjct  83    WREIHGSNDWTGLLDPMNDLLRSELIRYGEMSQSCYDAFDYDPFSKYCGSCRFSRGKFFE  142

Query  607   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  786
             +LGM + GY ++RYLYATSNIN+PNFF+ S   ++WS+ ANW+GYVAV+ DE   + LGR
Sbjct  143   RLGMENVGYEVTRYLYATSNINMPNFFKKSRWPKVWSKSANWIGYVAVSNDEKS-KELGR  201

Query  787   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNF  954
             RDIV+AWRGTVT LEWI DL + L P         +  +K+ESGF DLYT  K++  C +
Sbjct  202   RDIVVAWRGTVTRLEWITDLMDFLKPIAAAKIGCPNLGVKVESGFVDLYTE-KEEEGCGY  260

Query  955   CSYSAREQLLAEVNRLIERYKG--ENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
             C +SAREQ++AEV RL ER+ G  E +SIT+TGHSLG+ALA+LSA+D+AE  +N +  G 
Sbjct  261   CRFSAREQVMAEVKRLTERFGGAEEEMSITITGHSLGSALAVLSAFDLAETGLNRLGNGR  320

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1308
                        +PV VFSF+GPRVGN  FKER  ELG+KVLR++N+ D VP  PG + NE
Sbjct  321   V----------VPVCVFSFSGPRVGNFSFKERLHELGVKVLRVINIHDIVPKSPGFLLNE  370

Query  1309  KFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1488
                  + +    +  PWSY+HVGVEL LDH  SPFLK   D  CAHNLE  LHL+DGYH 
Sbjct  371   SI--PRAVMQYAEGLPWSYSHVGVELKLDHKVSPFLKQTNDPVCAHNLEALLHLLDGYHE  428

Query  1489  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAH  1668
                RF  A+GRD ALVNK  +FLK  + VPP WRQDENKGM+R  DGRW+ P+R + E H
Sbjct  429   KDGRFVLASGRDPALVNKGCDFLKDHYLVPPNWRQDENKGMIRNKDGRWIQPDRLKFEDH  488

Query  1669  PPDTGHH  1689
             P D  HH
Sbjct  489   PHDIHHH  495



>ref|XP_008451272.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Cucumis 
melo]
Length=508

 Score =   471 bits (1213),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 241/425 (57%), Positives = 300/425 (71%), Gaps = 20/425 (5%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI GS DW  LL+PMN  LR E+IR+GE  QACYD+F +DP+SKYCGT +Y    FF+
Sbjct  89    WREIHGSGDWANLLDPMNPILRSELIRFGEMTQACYDAFVYDPYSKYCGTSRYPSESFFQ  148

Query  607   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  786
              LG+ + GY+++R+LYAT N  +PN F      ++WS+ ANW+GYVAV+ DE   +RLGR
Sbjct  149   SLGLENEGYQVTRFLYATGNNQMPNLFIKPRFPKLWSKRANWIGYVAVSGDETS-KRLGR  207

Query  787   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNF  954
             RDI+IAWRGTVT LEW+ D+ N L+P   R     DP +K+E GF DLYT+  KD +C+F
Sbjct  208   RDILIAWRGTVTRLEWVADMTNFLNPISSRKIQCPDPSVKVEFGFLDLYTD--KDEECDF  265

Query  955   CSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegege  1134
             C YSAREQ+LAE+ RL+E+YK E +SIT+TGHSLG+ALA++SAYDIA   +N        
Sbjct  266   CKYSAREQILAEMKRLLEKYKEEEVSITITGHSLGSALAIISAYDIAATGLN--------  317

Query  1135  ssstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKF  1314
                TS    + +SVFSFAGPRVGN+RF ER +ELG+KVLRIVNV D VP  PGI  NE  
Sbjct  318   --KTSDGHNVHISVFSFAGPRVGNMRFGERLNELGVKVLRIVNVHDIVPKSPGIFFNENL  375

Query  1315  QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDG  1494
                  L    +  PWSY HVGVEL LDH  SP+L+  TD GC+HNLE HLHL+DGY G G
Sbjct  376   --PPWLLKITEWLPWSYIHVGVELELDHLESPYLRRSTDAGCSHNLEAHLHLLDGYQGKG  433

Query  1495  RRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPP  1674
              +F  A GRD ALVNK  +FL+ ++ VPP WRQDENKGM+   DGRWV  +RS I+ HP 
Sbjct  434   MKFELAIGRDPALVNKSCDFLEDKYMVPPMWRQDENKGMIYV-DGRWVFADRSDIDGHPE  492

Query  1675  DTGHH  1689
             DT +H
Sbjct  493   DTHYH  497



>ref|XP_003566295.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Brachypodium 
distachyon]
Length=537

 Score =   472 bits (1215),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 249/420 (59%), Positives = 294/420 (70%), Gaps = 24/420 (6%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI G  DW GLL+PM+  LR E+IRYGE AQACYD+FD+D  S+YCG+CKY    FF+
Sbjct  105   WREIHGCDDWAGLLDPMDPQLRSELIRYGELAQACYDAFDYDLASRYCGSCKYPRRAFFD  164

Query  607   KLGMAD--RGYRISRYLYATSNINLPNFF---QHSSVNRIWSQHANWMGYVAVATDEAEI  771
             +LGM D  RGY +SRYLYATSN   PNFF   Q  +  ++WSQ ANW+GYVAV+TDE E 
Sbjct  165   RLGMPDAARGYAVSRYLYATSNFRFPNFFPSQQSRADAKVWSQRANWIGYVAVSTDE-ES  223

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKD  939
              RLGRRD+ IAWRGT+T LEW+ DL + L P         DP++K+ESGF DLYT+  KD
Sbjct  224   ARLGRRDVAIAWRGTITRLEWVSDLMDFLRPVADEGIPCPDPEVKVESGFVDLYTD--KD  281

Query  940   TDCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNV  1113
               C FC YSAREQ+L EV +L+  Y   GE++SITVTGHSLG++LA+LSAYDIAE   N+
Sbjct  282   PSCRFCKYSAREQVLLEVRKLVTHYTALGEDVSITVTGHSLGSSLAVLSAYDIAETGANL  341

Query  1114  VQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPTVP  1290
                           TK  V VFSF+GPRVGN RFKER + ELG+K LR+VNV D VP +P
Sbjct  342   ---------GADGKTKAAVCVFSFSGPRVGNGRFKERFEGELGVKALRVVNVHDNVPRMP  392

Query  1291  GIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1470
             GI  NE      +        PW Y+HVGVELALDH  SPFLK   D GC+HNLE HLHL
Sbjct  393   GIFLNEGVPEMVRRVAEGLRMPWCYSHVGVELALDHKRSPFLKDTLDPGCSHNLEAHLHL  452

Query  1471  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             +DGYHG G RF  A+GRD ALVNK S+FLK  H VPP WRQDENKGMVR  DGRW+ P+R
Sbjct  453   LDGYHGSGERFVLASGRDPALVNKASDFLKDHHCVPPFWRQDENKGMVRALDGRWIQPDR  512



>ref|XP_006655277.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Oryza 
brachyantha]
Length=440

 Score =   467 bits (1201),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 252/419 (60%), Positives = 291/419 (69%), Gaps = 25/419 (6%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI G  DW GLL+PM+  LR E+IRYGEFAQACYD+FD+D  S+YCG+CKY    FFE
Sbjct  9     WREIHGRDDWAGLLDPMDPLLRSELIRYGEFAQACYDAFDYDQASRYCGSCKYPRRAFFE  68

Query  607   KLGM--ADRGYRISRYLYATSNINLPNFFQHSSVN-RIWSQHANWMGYVAVATDEAEIRR  777
             +LGM  A RGY +SRYLYATSN   PNFF  S    +IWSQ ANW+GYVAV+TDE E  R
Sbjct  69    RLGMPAAARGYAVSRYLYATSNFRFPNFFSQSRAGAKIWSQRANWIGYVAVSTDE-ETAR  127

Query  778   LGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTD  945
             LGRRDI IAWRGTV  LEW+ DL + L P         DP++K+ESGF DLYT+  KD  
Sbjct  128   LGRRDIAIAWRGTVPRLEWVSDLMDFLRPVADEGIPCPDPEVKVESGFVDLYTD--KDPT  185

Query  946   CNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1119
             C FC YSAREQ+L EV RL+ RY   GE++SITVTGHSLG+ALA++SAYDIAE   N+  
Sbjct  186   CRFCKYSAREQVLMEVRRLVARYTALGEDVSITVTGHSLGSALAMISAYDIAESGANL--  243

Query  1120  egegessstsaatKIPVSVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPTVPGI  1296
                             V V+SFAGPRVGN RFKER + ELG+K LR+VNV D V  +PGI
Sbjct  244   ---------HNDKSAAVCVYSFAGPRVGNARFKERFEAELGVKALRVVNVHDGVARMPGI  294

Query  1297  IANEKF-QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
             + NE      +++   L   PW YAHVGVELALDH  SPFLK   D  C HNLE HLHL+
Sbjct  295   LLNEGAPAMLRRVAEGLLRVPWCYAHVGVELALDHKRSPFLKDTLDPACHHNLEAHLHLL  354

Query  1474  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             DGYHG G RF  A+GRD ALVNK  +FLK  H VP  WRQDENKGMVR  DGRWV P+R
Sbjct  355   DGYHGRGERFVLASGRDPALVNKACDFLKDHHCVPACWRQDENKGMVRALDGRWVQPDR  413



>ref|XP_003518894.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Glycine 
max]
Length=513

 Score =   469 bits (1207),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 240/430 (56%), Positives = 300/430 (70%), Gaps = 20/430 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L E W +I G  DW GLL PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+C++   
Sbjct  88    LPEEWRQIHGESDWAGLLEPMDPLLRSEVIRYGEMAQACYDAFDFDPFSKYCGSCRFTRR  147

Query  595   QFFEKLGMADR-GYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              FF  L M    GY ++RYLYAT+NINLPNFF+HS  +++WS+HANW GYVAV +D+A  
Sbjct  148   SFFSSLEMPHHLGYAVTRYLYATANINLPNFFKHSRWSKMWSKHANWAGYVAV-SDDATT  206

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSKKD  939
             + LGRRDI IA+RGTVT LEW+ DL + L P      P     +K+ESGF DLYT+  K+
Sbjct  207   KLLGRRDITIAFRGTVTRLEWVADLMDFLKPISSNGIPCPDHTVKVESGFLDLYTD--KE  264

Query  940   TDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1119
               C +  YSAREQ+L+EV RL+E Y  E +S+T+TGHSLG+ALA+LSAYDI E  VNV++
Sbjct  265   ESCGYAKYSAREQVLSEVKRLLEIYNKEEVSVTITGHSLGSALAILSAYDIVETGVNVMR  324

Query  1120  egegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGII  1299
             +             + V+V SF+GPRVGN+RFKER + LG+KVLR+VNV D VP  PG++
Sbjct  325   DSR----------GVAVTVMSFSGPRVGNVRFKERLEGLGVKVLRVVNVHDVVPKAPGVV  374

Query  1300  ANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDG  1479
              NE       +    +  PWSY HVGVELALDH  SPFL    D   AHNLE  LHL+DG
Sbjct  375   FNEHLP--AAVMKVAEGLPWSYWHVGVELALDHKKSPFLNPNADAVSAHNLEALLHLLDG  432

Query  1480  YHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRI  1659
             YHG G RF  A+GRD ALVNK  +FLK  + +PP WRQD NKGM+R+++GRW+ PER ++
Sbjct  433   YHGKGERFVLASGRDPALVNKGCDFLKDHYLIPPNWRQDANKGMIRSNNGRWMQPERPKL  492

Query  1660  EAHPPDTGHH  1689
             E HP D  HH
Sbjct  493   EDHPEDMHHH  502



>emb|CDP03693.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   462 bits (1188),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 238/406 (59%), Positives = 293/406 (72%), Gaps = 21/406 (5%)
 Frame = +1

Query  463   LLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRIS  642
             +L+PM+  LR E+IRYGE AQACYD+FDFDP+S YCG+CK+   +FFE+L M   GY ++
Sbjct  1     MLDPMDPLLRTELIRYGEMAQACYDAFDFDPYSIYCGSCKFTRTKFFEELEMLQYGYDVT  60

Query  643   RYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVT  822
             RYLYATSNINLPNFF+ S   ++WS++ANW+GYVAV+ DE   R+LGRRDI IAWRGTVT
Sbjct  61    RYLYATSNINLPNFFKQSRWPKVWSKNANWIGYVAVSNDETS-RKLGRRDICIAWRGTVT  119

Query  823   YLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAE  990
              LEWI D+ + L P         DP +K+ESGF DLYT+  KD  C FC +SAREQ+L E
Sbjct  120   RLEWIADMMDFLRPISSDKIPCPDPTVKVESGFLDLYTD--KDESCRFCKFSAREQILTE  177

Query  991   VNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegessstsaatKI  1164
             V RLIE Y  + E LSI++TGHSLG+ALA LS YDI E  +NV ++             +
Sbjct  178   VKRLIEMYSDEEEELSISITGHSLGSALATLSGYDIVETGINVSRDSR----------GV  227

Query  1165  PVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETTL  1344
             PV V+SF+GPRVGN+RFK+R + LG+KVLR+VNV D VP  PG+  NE       +    
Sbjct  228   PVCVYSFSGPRVGNVRFKQRVEGLGLKVLRVVNVHDVVPKSPGMFFNENVP--PVVMKLA  285

Query  1345  KNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRD  1524
             +  PWSY+HVGVELALDH+ SPFLK  TD  CAHNLE HLHL+DGYHG G+RF  A+GRD
Sbjct  286   EGLPWSYSHVGVELALDHNNSPFLKPTTDPVCAHNLEAHLHLLDGYHGKGQRFVLASGRD  345

Query  1525  IALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIE  1662
             IALVNK  +FLK  H +PP WRQ ENKGMVR  +GRWV  ER R++
Sbjct  346   IALVNKACDFLKDHHCIPPNWRQVENKGMVRNREGRWVQAERPRLD  391



>gb|KGN44761.1| hypothetical protein Csa_7G378500 [Cucumis sativus]
Length=514

 Score =   466 bits (1199),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 253/516 (49%), Positives = 329/516 (64%), Gaps = 31/516 (6%)
 Frame = +1

Query  187   SLPPPLMN--ITKPTTAK---PSNNSFFPLNPHYSSLKCRVSLPAAAINAPPQRETGQSS  351
             S+  PL++  I  P + K   P N + F +N   S+  C        +   P       S
Sbjct  4     SMAIPLLSSTIVFPFSTKSQLPLNQTLFSINASSSNSHCSWKWRTQLLLHQPSLPISTRS  63

Query  352   NKNdeeqeedeelcveedGRN------LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYG  513
              KN      D++  V            L + W EI GS DW  LL+PMN  LR E+IRYG
Sbjct  64    RKNVLPALSDDDSEVSTQSSETENETELAKKWREIHGSGDWADLLDPMNPILRSELIRYG  123

Query  514   EFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQH  693
             E AQACYDSF +DP+SKYCGT +Y    FF+ LGM + GY+++R+LYAT NI +PN F  
Sbjct  124   EMAQACYDSFVYDPYSKYCGTSRYPLESFFQSLGMENEGYQVTRFLYATGNIQMPNVFIK  183

Query  694   SSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHF  873
                  +WS+HANW+GYVAV+ DE   +RLGRRDIV+AWRGTVT LEW+ DL + L P   
Sbjct  184   PRFPELWSKHANWIGYVAVSDDETS-KRLGRRDIVVAWRGTVTKLEWVEDLTDYLTPISA  242

Query  874   RD----DPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITV  1041
             ++    DP + +ESGF DLYT+  K+  C FC +SAREQ+LAE+ RL+E++ GE +SIT+
Sbjct  243   KNIRCHDPRVMVESGFLDLYTD--KEDGCEFCKFSAREQILAEMKRLLEKFDGEEMSITI  300

Query  1042  TGHslgaalallsaYDIAEMKVNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKE  1221
             TGHSLG+ALA++SAYDIAEM +N   +G              VSVFSFAGPRVGN++F+E
Sbjct  301   TGHSLGSALAMISAYDIAEMGLNKTSDGGNAH----------VSVFSFAGPRVGNVQFRE  350

Query  1222  RCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHS  1401
             R + LG+KVLR+VN+ D VP  PG   NE       +   ++  P++Y HVGV L LDH 
Sbjct  351   RLNNLGVKVLRVVNIHDVVPKSPGFFFNENL--PSWVLKMIERLPFTYVHVGVLLQLDHL  408

Query  1402  YSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPP  1581
              SP+L+  T  GC+HNLE +LHL+DGY G G +F  A GRD ALVNK  +FL+ ++ VPP
Sbjct  409   DSPYLRRSTSPGCSHNLEAYLHLLDGYQGKGMKFERAVGRDPALVNKSCDFLEDKYVVPP  468

Query  1582  RWRQDENKGMVRTSDGRWVVPERSRIEAHPPDTGHH  1689
              WRQD+NKGM+   DGRWV  +RS I+ HP DT HH
Sbjct  469   MWRQDQNKGMIYV-DGRWVFADRSDIDGHPKDTHHH  503



>gb|EEC79153.1| hypothetical protein OsI_19824 [Oryza sativa Indica Group]
Length=574

 Score =   467 bits (1202),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 253/426 (59%), Positives = 298/426 (70%), Gaps = 20/426 (5%)
 Frame = +1

Query  406   GRNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKY  585
             G  L   W EI G  DW GLL+PM+  LR E+IRYGEFAQACYD+FD+DP S+YCG+CKY
Sbjct  116   GHELAARWREIHGRDDWAGLLDPMDPLLRSELIRYGEFAQACYDAFDYDPSSRYCGSCKY  175

Query  586   DGAQFFEKLGMAD--RGYRISRYLYATSNINLPNFFQHSSVN-RIWSQHANWMGYVAVAT  756
                 FF++LGM D  RGY ++RYLYATSN   PNFF  S    +IWSQ ANW+GYVAV+T
Sbjct  176   PRRAFFDRLGMPDAARGYTVTRYLYATSNFRFPNFFSQSRAGAKIWSQRANWIGYVAVST  235

Query  757   DEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYT  924
             DE E  RLGRRDI IAWRGTVT LEW+ DL + L P      P    ++K+ESGF DLYT
Sbjct  236   DE-ETARLGRRDIAIAWRGTVTRLEWVSDLMDFLRPVADEGIPCPDREVKVESGFVDLYT  294

Query  925   NSKKDTDCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAE  1098
             +  KD  C FC YSAREQ+L EV RL+ RY   GE++S+TVTGHSLG+ALA++SAYDIAE
Sbjct  295   D--KDPTCRFCKYSAREQVLTEVRRLVTRYAALGEDVSVTVTGHSLGSALAMISAYDIAE  352

Query  1099  MKVNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDK  1275
                     G G  ++ +      V V+SFAGPRVGN RFKER + ELG+K LR+VNV D 
Sbjct  353   SGAASAAHGGGNEAAAA------VCVYSFAGPRVGNARFKERFEGELGVKALRVVNVHDG  406

Query  1276  VPTVPGIIANEKFQYQ-KQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1452
             V  +PGI+ NE      +++   +   PW YAHVGVELALDH  SPFLK   D  C HNL
Sbjct  407   VARMPGILLNEGAPAALRRVAEGILRVPWCYAHVGVELALDHKRSPFLKDTLDPACFHNL  466

Query  1453  EGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGR  1632
             E HLHL+DGYHG G RF  A+GRD ALVNK  +FLK  H VPP WRQDENKGMVR  DGR
Sbjct  467   EAHLHLLDGYHGRGERFVLASGRDPALVNKACDFLKDHHCVPPCWRQDENKGMVRAPDGR  526

Query  1633  WVVPER  1650
             WV P+R
Sbjct  527   WVQPDR  532



>ref|XP_004146990.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004168245.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Cucumis 
sativus]
Length=510

 Score =   464 bits (1194),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 252/512 (49%), Positives = 327/512 (64%), Gaps = 31/512 (6%)
 Frame = +1

Query  199   PLMN--ITKPTTAK---PSNNSFFPLNPHYSSLKCRVSLPAAAINAPPQRETGQSSNKNd  363
             PL++  I  P + K   P N + F +N   S+  C        +   P       S KN 
Sbjct  4     PLLSSTIVFPFSTKSQLPLNQTLFSINASSSNSHCSWKWRTQLLLHQPSLPISTRSRKNV  63

Query  364   eeqeedeelcveedGRN------LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQ  525
                  D++  V            L + W EI GS DW  LL+PMN  LR E+IRYGE AQ
Sbjct  64    LPALSDDDSEVSTQSSETENETELAKKWREIHGSGDWADLLDPMNPILRSELIRYGEMAQ  123

Query  526   ACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVN  705
             ACYDSF +DP+SKYCGT +Y    FF+ LGM + GY+++R+LYAT NI +PN F      
Sbjct  124   ACYDSFVYDPYSKYCGTSRYPLESFFQSLGMENEGYQVTRFLYATGNIQMPNVFIKPRFP  183

Query  706   RIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD--  879
              +WS+HANW+GYVAV+ DE   +RLGRRDIV+AWRGTVT LEW+ DL + L P   ++  
Sbjct  184   ELWSKHANWIGYVAVSDDETS-KRLGRRDIVVAWRGTVTKLEWVEDLTDYLTPISAKNIR  242

Query  880   --DPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHs  1053
               DP + +ESGF DLYT+  K+  C FC +SAREQ+LAE+ RL+E++ GE +SIT+TGHS
Sbjct  243   CHDPRVMVESGFLDLYTD--KEDGCEFCKFSAREQILAEMKRLLEKFDGEEMSITITGHS  300

Query  1054  lgaalallsaYDIAEMKVNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDE  1233
             LG+ALA++SAYDIAEM +N   +G              VSVFSFAGPRVGN++F+ER + 
Sbjct  301   LGSALAMISAYDIAEMGLNKTSDGGNAH----------VSVFSFAGPRVGNVQFRERLNN  350

Query  1234  LGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPF  1413
             LG+KVLR+VN+ D VP  PG   NE       +   ++  P++Y HVGV L LDH  SP+
Sbjct  351   LGVKVLRVVNIHDVVPKSPGFFFNENL--PSWVLKMIERLPFTYVHVGVLLQLDHLDSPY  408

Query  1414  LKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQ  1593
             L+  T  GC+HNLE +LHL+DGY G G +F  A GRD ALVNK  +FL+ ++ VPP WRQ
Sbjct  409   LRRSTSPGCSHNLEAYLHLLDGYQGKGMKFERAVGRDPALVNKSCDFLEDKYVVPPMWRQ  468

Query  1594  DENKGMVRTSDGRWVVPERSRIEAHPPDTGHH  1689
             D+NKGM+   DGRWV  +RS I+ HP DT HH
Sbjct  469   DQNKGMIYV-DGRWVFADRSDIDGHPKDTHHH  499



>ref|XP_008451639.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Cucumis 
melo]
Length=508

 Score =   463 bits (1192),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 236/429 (55%), Positives = 304/429 (71%), Gaps = 20/429 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L + W EI GS DW  LL+PMN  LR E+IRYGE AQ CYD+F +DP+SKYCGT +Y   
Sbjct  85    LAKKWREIHGSGDWADLLDPMNPILRSELIRYGEMAQLCYDAFVYDPYSKYCGTSRYPLE  144

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
              FF+ LG  + GY+++R+LYAT NI +PN F      ++WS+HANW+GYVAV+ DE   +
Sbjct  145   SFFQSLGKENEGYQVTRFLYATGNIQMPNSFIKPRFPKLWSKHANWIGYVAVSDDETS-K  203

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  942
             RLGRRDIV+AWRGTVT LEW+ DL + L P   R     +P + +ESGF DLYT+  K+ 
Sbjct  204   RLGRRDIVVAWRGTVTKLEWVEDLTDYLVPVSSRKIKCPNPGVMVESGFLDLYTD--KED  261

Query  943   DCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
             +C FC +SAREQ+LAE+ RL+E++ GE +SIT+TGHSLG+ALA++SAYDIAEM +N   +
Sbjct  262   ECEFCKFSAREQILAEMKRLMEKFNGEEVSITITGHSLGSALAMISAYDIAEMGLNKTSD  321

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
             G              VSVFSFAGPRVGN++F+ER ++LGIKVLR+VN+ D VP  PG I 
Sbjct  322   GSSAH----------VSVFSFAGPRVGNVQFRERLNKLGIKVLRVVNIHDIVPKSPGFIF  371

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             NE       +   ++  P +Y HVGV L LDH  SP+L+  TD GC+HNLE +LHL+DGY
Sbjct  372   NESL--PSWVLKMIERLPMTYVHVGVLLKLDHLDSPYLRRSTDPGCSHNLEAYLHLLDGY  429

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIE  1662
              G G +F  A GRD ALVNK  +FL+ ++ VPP+WRQDENKGMV   DGRWV  +RS I+
Sbjct  430   QGKGMKFERAIGRDPALVNKSCDFLEDKYVVPPKWRQDENKGMVYV-DGRWVFADRSDID  488

Query  1663  AHPPDTGHH  1689
             +HP DT +H
Sbjct  489   SHPEDTHYH  497



>ref|XP_006576919.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X1 [Glycine max]
Length=497

 Score =   461 bits (1186),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 239/428 (56%), Positives = 301/428 (70%), Gaps = 19/428 (4%)
 Frame = +1

Query  421   EIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQF  600
             E+W +I G  +W GLL+PM+  +R E+ RYGE AQACYD+FDFDP+SKYCG+C++   +F
Sbjct  69    EVWRKIHGEDNWAGLLDPMDPVMRGELTRYGEMAQACYDAFDFDPYSKYCGSCRFPLPEF  128

Query  601   FEKLGMADRGYRISRYLYATSNINLPNFFQHSS-VNRIWSQHANWMGYVAVATDEAEIRR  777
             F+ LGM + GY ++RYLYAT NINLPNFF+ S   +++WS+HANW G++AV+ DE   +R
Sbjct  129   FDSLGMTNVGYTMTRYLYATGNINLPNFFRKSRWPHKMWSKHANWAGFIAVSDDETS-KR  187

Query  778   LGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR---DDPDIKIESGFFDLYTNSKKDTDC  948
             LGRRDIVI+WRGTVT++EW+ DL N L P        D  +K+E+GF DLYT+  ++  C
Sbjct  188   LGRRDIVISWRGTVTHVEWVADLLNFLKPISPDIPCSDRKVKVEAGFLDLYTD--REPGC  245

Query  949   NFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
              +C YSAREQ+L EV RL+E+Y  E +S+T+ GHSLG+A+A+LSA+DI E  VNV ++G 
Sbjct  246   GYCKYSAREQVLGEVKRLMEKYADEEVSVTIAGHSLGSAMAILSAFDIVETGVNVGKDGR  305

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPTVPGIIAN  1305
                       K  VSVFSF+GPRVGN+RFKER + ELGIKVLR+ N  D VP  PG+I N
Sbjct  306   ----------KAHVSVFSFSGPRVGNVRFKERLEGELGIKVLRVHNAHDMVPQSPGLIFN  355

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYH  1485
             E    Q  L+     FPW Y HVG EL LDH  SPFL    D  CAHNLE HLHL+DGYH
Sbjct  356   ED-SPQWLLKLVEGWFPWCYLHVGEELQLDHKKSPFLNPDGDASCAHNLEAHLHLLDGYH  414

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEA  1665
             G  R F   + RD+ALVNKD +FLK EH VPPRWRQD NK MVRT DGRWV+ +R   + 
Sbjct  415   GKNRGFERTSERDLALVNKDCDFLKDEHSVPPRWRQDLNKNMVRTEDGRWVLADRPLAQD  474

Query  1666  HPPDTGHH  1689
                D  HH
Sbjct  475   PHEDIDHH  482



>ref|XP_004962195.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X2 [Setaria italica]
Length=583

 Score =   463 bits (1192),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 249/419 (59%), Positives = 291/419 (69%), Gaps = 28/419 (7%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI G  DW GLL+PM+  LR E+IRYGE AQACYD+FD+DP S+YCG+CKY    FFE
Sbjct  114   WREIHGRDDWAGLLDPMDPLLRSELIRYGELAQACYDAFDYDPSSRYCGSCKYPRRDFFE  173

Query  607   KLGM--ADRGYRISRYLYATSNINLPNFFQHSSVN-RIWSQHANWMGYVAVATDEAEIRR  777
             +LGM  A RGY +SRYLYATSN   PNFF  S    +IWSQ ANW+GYVAV+ DE E  R
Sbjct  174   RLGMPEAARGYAVSRYLYATSNFRFPNFFPQSRAGAKIWSQSANWIGYVAVSGDE-ESAR  232

Query  778   LGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTD  945
             LGRRDI IAWRGTVT LEW+ DL + L P         DP++K+ +GF DLYT+  KD  
Sbjct  233   LGRRDIAIAWRGTVTRLEWVSDLMDFLRPVADEGIPCPDPEVKVLAGFADLYTD--KDPT  290

Query  946   CNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1119
             C FC YSAREQ+L EV RL+ RY  +GE++SITVTGHSLG+ALA+LSAYDIAE   N   
Sbjct  291   CRFCKYSAREQVLMEVRRLVARYAARGEDVSITVTGHSLGSALAMLSAYDIAESGAN---  347

Query  1120  egegessstsaatKIPVSVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPTVPGI  1296
                            PV V+SFAGPRVGN  FK R + ELG++ LR+VNV D V  +PGI
Sbjct  348   -----------RAVAPVCVYSFAGPRVGNAAFKRRFESELGVRALRVVNVHDNVTRMPGI  396

Query  1297  IANEKF-QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
             + NE   +  +++   L   PW Y HVGVELALDH  SPFLK   D  C H+LE HLHL+
Sbjct  397   LLNEGAPEAVRRVAERLLRVPWCYTHVGVELALDHKRSPFLKDTMDPACYHDLEAHLHLI  456

Query  1474  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             DGYHG G RF  A+GRD ALVNK  +FLK  HGVPP WRQDENKGMVR  DGRWV P+R
Sbjct  457   DGYHGRGERFVLASGRDPALVNKACDFLKDHHGVPPCWRQDENKGMVRGRDGRWVQPDR  515



>ref|XP_008656338.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Zea 
mays]
 gb|AFW82142.1| hypothetical protein ZEAMMB73_402058 [Zea mays]
Length=576

 Score =   462 bits (1189),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 247/424 (58%), Positives = 291/424 (69%), Gaps = 28/424 (7%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
              L   W EI G  DW GLL+PM+  LR E+IRYGE AQACYD+FD+DP S+YCG+CKY  
Sbjct  114   ELRSRWREIHGCDDWAGLLDPMDPLLRSELIRYGELAQACYDAFDYDPSSRYCGSCKYSR  173

Query  592   AQFFEKLGMAD--RGYRISRYLYATSNINLPNFFQHSSVN-RIWSQHANWMGYVAVATDE  762
                FE+LGMAD  RGY +SRYL+ATSNI  PN F  S    RIWSQ A+W+GYVAV+TDE
Sbjct  174   RDLFERLGMADAARGYVVSRYLFATSNIRFPNLFPQSRAGARIWSQSASWIGYVAVSTDE  233

Query  763   AEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNS  930
              E  RLGRRDI IAWRGTVT LEW+ DL + L P      P    ++K+ +GF DLYT+ 
Sbjct  234   -ESARLGRRDIAIAWRGTVTRLEWVSDLMDFLRPVAEEGIPCPDREVKVLAGFVDLYTD-  291

Query  931   KKDTDCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMK  1104
              +D  C FC YSAREQ+L EV RL+ RY   GE++S+TVTGHSLG+ALA+LSAYDIAE  
Sbjct  292   -RDPSCRFCKYSAREQVLTEVRRLVGRYTAAGEDVSVTVTGHSLGSALAMLSAYDIAETG  350

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDE-LGIKVLRIVNVRDKVP  1281
              N+                 PV VFSF GPRVGN  FK R +E LG++ LR+VNV D V 
Sbjct  351   ANM--------------EAAPVCVFSFGGPRVGNTAFKRRFEEELGVRALRVVNVHDNVT  396

Query  1282  TVPGIIANEKF-QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1458
              +PGI+ NE   +  +++   L   PW YAHVGVEL LDH  SPFLK   D  C H+LE 
Sbjct  397   RMPGILLNEGAPEVVRRVAEGLLRVPWCYAHVGVELPLDHKRSPFLKDTLDPACYHDLEA  456

Query  1459  HLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1638
             HLHL+DGYHG G RF  A+GRD ALVNK  +FLK  HGVPP WRQDENKGMVR  DGRWV
Sbjct  457   HLHLIDGYHGRGERFVLASGRDPALVNKACDFLKDHHGVPPCWRQDENKGMVRARDGRWV  516

Query  1639  VPER  1650
              P+R
Sbjct  517   QPDR  520



>ref|XP_010326538.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase A1-Igamma2, chloroplastic-like 
[Solanum lycopersicum]
Length=474

 Score =   457 bits (1177),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 232/389 (60%), Positives = 284/389 (73%), Gaps = 19/389 (5%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI G  DW G+L+PM+  LR E+IRYGE AQACYD+FDFDP+SKYCG+CK+   +FF+
Sbjct  97    WLEIHGQDDWVGMLDPMDPLLRSELIRYGEMAQACYDAFDFDPYSKYCGSCKFPRRKFFD  156

Query  607   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  786
              LGMA+ GY I+RYLYATSNINLPNFF+ S   +IWS++ANW+GYVAV+ DE   +RLGR
Sbjct  157   GLGMAEYGYDITRYLYATSNINLPNFFKQSRWPKIWSKNANWIGYVAVSNDET-TKRLGR  215

Query  787   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNF  954
             RDI IAWRGTVT LEWI DL + L P    +    DP++K+ESGF DLYT+  KD  C +
Sbjct  216   RDITIAWRGTVTRLEWIADLMDYLRPISSDNIPCPDPNVKVESGFLDLYTD--KDESCRY  273

Query  955   CSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQegege  1134
             C +SAREQ+L EV RLIE Y  E +SITVTGHSLG+ALA+LSAYD+ E  +NV       
Sbjct  274   CKFSAREQILTEVKRLIEMYPDEEMSITVTGHSLGSALAILSAYDLVETGLNV-------  326

Query  1135  ssstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKF  1314
                 +  + +P+ VFSF+GPRVGN+RFKER ++LG+KVLR+VNV D VP  PG++ NE  
Sbjct  327   ---KADTSGVPICVFSFSGPRVGNVRFKERIEKLGVKVLRVVNVHDIVPKSPGLVLNE--  381

Query  1315  QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDG  1494
                  +    +  PWSY+HVGVELALDH  SPFLK  +DL CAHNLE HLHL+DGYHG G
Sbjct  382   HSPSMVMKICEKLPWSYSHVGVELALDHKNSPFLKPTSDLVCAHNLEAHLHLLDGYHGKG  441

Query  1495  RRFRSATGRDIALVNKDSNFLKREHGVPP  1581
             RRF    G DI LVNK  +FLK  + VPP
Sbjct  442   RRFVLEKGIDIPLVNKACDFLKEHYCVPP  470



>ref|XP_004962194.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X1 [Setaria italica]
Length=594

 Score =   462 bits (1188),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 249/419 (59%), Positives = 292/419 (70%), Gaps = 17/419 (4%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI G  DW GLL+PM+  LR E+IRYGE AQACYD+FD+DP S+YCG+CKY    FFE
Sbjct  114   WREIHGRDDWAGLLDPMDPLLRSELIRYGELAQACYDAFDYDPSSRYCGSCKYPRRDFFE  173

Query  607   KLGM--ADRGYRISRYLYATSNINLPNFFQHSSVN-RIWSQHANWMGYVAVATDEAEIRR  777
             +LGM  A RGY +SRYLYATSN   PNFF  S    +IWSQ ANW+GYVAV+ DE E  R
Sbjct  174   RLGMPEAARGYAVSRYLYATSNFRFPNFFPQSRAGAKIWSQSANWIGYVAVSGDE-ESAR  232

Query  778   LGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTD  945
             LGRRDI IAWRGTVT LEW+ DL + L P         DP++K+ +GF DLYT+  KD  
Sbjct  233   LGRRDIAIAWRGTVTRLEWVSDLMDFLRPVADEGIPCPDPEVKVLAGFADLYTD--KDPT  290

Query  946   CNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1119
             C FC YSAREQ+L EV RL+ RY  +GE++SITVTGHSLG+ALA+LSAYDIAE   +   
Sbjct  291   CRFCKYSAREQVLMEVRRLVARYAARGEDVSITVTGHSLGSALAMLSAYDIAE---SGAN  347

Query  1120  egegessstsaatKIPVSVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPTVPGI  1296
                G           PV V+SFAGPRVGN  FK R + ELG++ LR+VNV D V  +PGI
Sbjct  348   VAGGAGDGGGQRAVAPVCVYSFAGPRVGNAAFKRRFESELGVRALRVVNVHDNVTRMPGI  407

Query  1297  IANEKF-QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
             + NE   +  +++   L   PW Y HVGVELALDH  SPFLK   D  C H+LE HLHL+
Sbjct  408   LLNEGAPEAVRRVAERLLRVPWCYTHVGVELALDHKRSPFLKDTMDPACYHDLEAHLHLI  467

Query  1474  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             DGYHG G RF  A+GRD ALVNK  +FLK  HGVPP WRQDENKGMVR  DGRWV P+R
Sbjct  468   DGYHGRGERFVLASGRDPALVNKACDFLKDHHGVPPCWRQDENKGMVRGRDGRWVQPDR  526



>ref|XP_006853094.1| hypothetical protein AMTR_s00038p00116940 [Amborella trichopoda]
 gb|ERN14561.1| hypothetical protein AMTR_s00038p00116940 [Amborella trichopoda]
Length=536

 Score =   458 bits (1179),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 251/432 (58%), Positives = 295/432 (68%), Gaps = 22/432 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L E W EIQG   W GLL PM+  LR E+IRYGE AQACYD+FD+DP S+YCG+C+++  
Sbjct  113   LSERWREIQGENHWTGLLEPMDPLLRSELIRYGEHAQACYDAFDYDPFSRYCGSCRHNRR  172

Query  595   QFFEKLGMADR-GYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              FFE+L + +   Y ++RYLYATSN NL NFF+ S   R WS  ANW+GYVA A  +  I
Sbjct  173   HFFEELTLDNHCSYEVTRYLYATSNPNLRNFFRRSQWPRTWSTAANWIGYVASAGGKDGI  232

Query  772   ----RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHF-RDDPDIKIESGFFDLYTNSKK  936
                   LGRRDIV+AWRGTVT LEWI DL + L P      D  +K+ESGF DLY +  K
Sbjct  233   DTGKSELGRRDIVVAWRGTVTRLEWIADLMDCLKPVGLSHGDRLVKVESGFLDLYLS--K  290

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGE-NLSITVTGHslgaalallsaYDIAEMKVNV  1113
             D  C F  YSAREQ+L+EV RL+ERYK E  LSITVTGHSLG ALALLSAYDIAE  +N+
Sbjct  291   DPACRFSKYSAREQVLSEVRRLMERYKDEPELSITVTGHSLGGALALLSAYDIAESGLNL  350

Query  1114  VQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1293
                           T+  ++VFSFA PRVGN  F +RC+ELG+ VLR+VNV D VP VPG
Sbjct  351   ----------RLDGTRALITVFSFAAPRVGNRHFAKRCEELGVHVLRVVNVHDTVPKVPG  400

Query  1294  IIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
              + NE  Q  + L   L   PWSYAHVGVEL LDH  SPFLK   D  C HNLE HLHL+
Sbjct  401   FLINEHVQVPQALTDGL---PWSYAHVGVELTLDHRRSPFLKETGDPSCYHNLEAHLHLL  457

Query  1474  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1653
             DGYHG G+RF  A+GRD ALVNK S+FLK  H VPP WRQ+ NKGMV+   GRWV PER+
Sbjct  458   DGYHGRGQRFVLASGRDPALVNKASDFLKEHHMVPPNWRQERNKGMVKGPHGRWVQPERN  517

Query  1654  RIEAHPPDTGHH  1689
             R+E HP D   H
Sbjct  518   RVEDHPLDIKGH  529



>ref|XP_009414857.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=508

 Score =   457 bits (1175),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 237/428 (55%), Positives = 292/428 (68%), Gaps = 26/428 (6%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W  I G  DW GLL+P++  LR E+IRYGEF QACYDSFD+D  S+YCG+CKY   QFF 
Sbjct  90    WRVIHGRDDWAGLLDPIDPLLRTELIRYGEFVQACYDSFDYDKFSRYCGSCKYSRRQFFY  149

Query  607   KLGMADRGYRISRYLYATSNINLPNFFQHSSV-NRIWSQHANWMGYVAVATDEAEIRRLG  783
              LGM   GY ++RYLYATSN+ +P FF  S + +R WS+ ANW+GYV+V+ DE   R LG
Sbjct  150   SLGMESAGYDVTRYLYATSNVKVPKFFAKSVMGSRTWSERANWIGYVSVSNDETTAR-LG  208

Query  784   RRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCN  951
             RRDI+IAWRGTVT LEWIHD    + P         D  +K+E+GF DLY   +KD+ C 
Sbjct  209   RRDILIAWRGTVTRLEWIHDFMAKMQPVRSAGIPCPDTRVKVETGFVDLYI--EKDSTCR  266

Query  952   FCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
             FC YSAREQ+L EV +L+ +Y   GE +SITV GHSLG+ALA L+AYDIAEM++      
Sbjct  267   FCKYSAREQVLTEVRKLVAQYTEAGEEVSITVAGHSLGSALATLNAYDIAEMEL------  320

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                    +   ++P++VFS+ GPRVGN  FKERCD+LG+KVLR+VNV DKVPTVPG++ N
Sbjct  321   ----IKGADGKQVPMAVFSYGGPRVGNEHFKERCDKLGLKVLRVVNVHDKVPTVPGVLIN  376

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYH  1485
             E        E  L+     Y HVGVEL LDH +SPFLK   D    HNLE HLHL+DG+ 
Sbjct  377   EHMP-----EFMLRAMD-GYVHVGVELLLDHKHSPFLKDSLDPSNYHNLEAHLHLLDGFQ  430

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEA  1665
             G GR+F   TGRD ALVNK  +FL     VPP WRQDENKGM+R+ +GRW  PER +I+ 
Sbjct  431   GKGRKFAPTTGRDPALVNKSCDFLHEHLMVPPNWRQDENKGMMRSQEGRWAQPERQKIDD  490

Query  1666  HPPDTGHH  1689
             HP D  HH
Sbjct  491   HPEDIHHH  498



>gb|KDO53917.1| hypothetical protein CISIN_1g048560mg, partial [Citrus sinensis]
Length=431

 Score =   450 bits (1157),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 235/427 (55%), Positives = 294/427 (69%), Gaps = 23/427 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L +IW +I G  DW+G+L+P++  LR E+IRYGE  QAC+D+FDF+P SKYCG+CKY 
Sbjct  22    RKLADIWHDIHGVDDWDGMLDPLDPLLRSELIRYGEMVQACHDAFDFEPFSKYCGSCKYA  81

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
              ++FFE LGMA  GY+++ Y++AT NINLPN FQ S     WS  ANW+GY+AV+ DE  
Sbjct  82    PSEFFECLGMAQHGYQVNSYIHATYNINLPNIFQRSLRPDAWSHTANWIGYIAVSNDEMS  141

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
                LGRRDI IAWRGT T LEWI D    L P   +     DP +K+ESGF +LYTN  K
Sbjct  142   A-HLGRRDITIAWRGTKTKLEWIADFMYFLRPITLKKIPCPDPRVKVESGFLNLYTN--K  198

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D     C  SARE +L EV RL+ +Y+ ENLSIT+TGHSLG+ALA+LSAYDIAE  V+V+
Sbjct  199   DQSSQICKRSAREHVLEEVRRLVSQYQNENLSITITGHSLGSALAILSAYDIAETGVDVM  258

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
              +G+           +P+ VFSFAGPRVGN RFKER  +LG+KVLR+VN+ DK+P  PG+
Sbjct  259   DDGQA----------VPICVFSFAGPRVGNTRFKERLAQLGVKVLRVVNIHDKIPEAPGL  308

Query  1297  IANEKF--QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1470
               NE      +K  E +L    W Y+HVG EL LDH  SPFLK   DL C HNLE HLHL
Sbjct  309   FLNEHIPPMLRKLGEASL----WFYSHVGAELTLDHKSSPFLKETNDLACYHNLEAHLHL  364

Query  1471  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             +DGY G G+RF   +GRDIALVNK ++FLK    VPP W+Q ENKG+VR ++GRWV  ER
Sbjct  365   LDGYQGKGQRFVLTSGRDIALVNKQADFLKDHLLVPPNWQQHENKGLVRNNEGRWVQRER  424

Query  1651  SRIEAHP  1671
               +  +P
Sbjct  425   LNLGDYP  431



>ref|XP_006420095.1| hypothetical protein CICLE_v10006964mg [Citrus clementina]
 gb|ESR33335.1| hypothetical protein CICLE_v10006964mg [Citrus clementina]
Length=481

 Score =   449 bits (1155),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 234/427 (55%), Positives = 292/427 (68%), Gaps = 23/427 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L +IW +I G  DW+G+L+P++  LR E+IRYGE  QACYD+FDF+P SKYCG CKY 
Sbjct  72    RKLADIWRDIHGVDDWDGMLDPLDPLLRSELIRYGEMVQACYDAFDFEPFSKYCGCCKYA  131

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
              ++FFE LGM   GY+++ Y++AT NINLPN FQ S     WS  ANW+GY+AV+ DE  
Sbjct  132   PSEFFECLGMTQHGYQVNSYIHATYNINLPNIFQRSLRPDAWSHTANWIGYIAVSNDEMS  191

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
                LG+RDI IAWRGT T LEWI D    L P   +     DP +K+ESGF +LYTN  K
Sbjct  192   A-HLGQRDITIAWRGTKTKLEWIADFMYFLRPITLKKIPCPDPRVKVESGFLNLYTN--K  248

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D     C  SARE +L EV RL+ +Y+ ENLSIT+TGHSLG+ALA+LSAYDIAE  V+V+
Sbjct  249   DQSSQICKRSAREHVLEEVRRLVSQYQNENLSITITGHSLGSALAILSAYDIAETGVDVM  308

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
              +G+           +P+ VFSFAGPRVGN RFKER  +LG+KVLR+VN+ DK+P  PG+
Sbjct  309   DDGQA----------VPICVFSFAGPRVGNTRFKERLAQLGVKVLRVVNIHDKIPEAPGL  358

Query  1297  IANEKF--QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1470
               NE      +K  E +L    W Y+HVG EL LDH  SPFLK   DL C HNLE HLHL
Sbjct  359   FLNEHIPPMLRKLGEASL----WFYSHVGAELTLDHKSSPFLKETNDLACYHNLEAHLHL  414

Query  1471  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             +DGY G G+RF   +GRDIALVNK ++FLK    VPP W+Q ENKG+VR ++GRWV  ER
Sbjct  415   LDGYQGKGQRFVLTSGRDIALVNKQADFLKDHLLVPPNWQQHENKGLVRNNEGRWVQRER  474

Query  1651  SRIEAHP  1671
               +  +P
Sbjct  475   LNLGDYP  481



>gb|KDP21364.1| hypothetical protein JCGZ_21835 [Jatropha curcas]
Length=512

 Score =   449 bits (1156),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 232/431 (54%), Positives = 292/431 (68%), Gaps = 20/431 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             RN+ + W EI G  +W GLL+PM+  LR E+IRYGE  QA YD F FD +S+YCGTC+Y 
Sbjct  86    RNIADKWQEIHGKNNWSGLLDPMDPILRSELIRYGEMTQATYDGFFFDQYSQYCGTCRYM  145

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +FF+KLG+   GY +SRYL+ATS +  P FF+ S     WS +ANW+GYVAV+ DE  
Sbjct  146   HLEFFQKLGLDHLGYYVSRYLFATSTLKFPKFFRKSVFPTKWSSNANWIGYVAVSNDET-  204

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH----FRDDPDIKIESGFFDLYTNSKK  936
               RLGRRDIVI WRGTVT LEW+ DL +   P         +P++K ESGF DLYT+  K
Sbjct  205   TARLGRRDIVICWRGTVTGLEWLEDLMSFQKPISDYKIQSPEPNVKAESGFLDLYTD--K  262

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D  C +C +SAREQ+LAE+ +L E+Y GE LSIT+TGHSLG ALA+LSA+DIAE  +  +
Sbjct  263   DPSCRYCKFSAREQILAEIKKLTEKYPGEELSITITGHSLGGALAVLSAFDIAETALQKM  322

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
             +           + ++ V  F+FAGPRVGN+RF+ER ++LG+KVLR+ NV D VP  PG+
Sbjct  323   E----------DSKRVKVCAFTFAGPRVGNVRFRERMEKLGVKVLRVFNVHDVVPKSPGL  372

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
             + NEK          ++  PW Y HVGVELALDH+ SP+LK    L  AHNLE  LHL+D
Sbjct  373   LLNEKL--PDAALKVVEGLPWCYTHVGVELALDHTNSPYLKEHASLPNAHNLEAQLHLLD  430

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG G +F  A  RDIALVNK S+FLK E  VPP W+QDENKGMV   +GRWV PER +
Sbjct  431   GYHGKGTKFELAIERDIALVNKSSDFLKDELLVPPSWKQDENKGMV-FQNGRWVEPERPK  489

Query  1657  IEAHPPDTGHH  1689
              + H  D  HH
Sbjct  490   PDDHSSDVHHH  500



>ref|XP_007034959.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
 gb|EOY05885.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
Length=500

 Score =   445 bits (1145),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 227/422 (54%), Positives = 292/422 (69%), Gaps = 19/422 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L + W ++ G  DW G+L+P +  LR E+ RYGE AQACYD+FDFDP S YCG+CK+   
Sbjct  82    LADTWRKLHGEDDWVGMLDPFHPLLRSELTRYGEMAQACYDAFDFDPFSIYCGSCKFSPG  141

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             +FF+ LG+   GY ++ YL+AT NIN P+FF+ S  +  WSQ ANW+G+VAV+ DE    
Sbjct  142   KFFQSLGLTQHGYEVTCYLHATCNINFPSFFKRSLRSEKWSQAANWIGFVAVSNDETSA-  200

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNSKKDT  942
              LGRRDI IAWRGTVT LEW+ D    L P   R     DP +++E+GF  LYT+  ++ 
Sbjct  201   HLGRRDITIAWRGTVTRLEWLADFMYFLRPIKVRMIPCPDPRVEVETGFLHLYTD--RNR  258

Query  943   DCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
             +C F  YSAREQ+L EV RL++++KGE LSIT+TGHSLG+ALA+L+AYDIAE  V ++ +
Sbjct  259   NCPFSKYSAREQVLTEVKRLMQQHKGEKLSITITGHSLGSALAILNAYDIAETGVEIMDD  318

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
             G+            P+ VFSF+GPRVGN+RFKER D+LG+KVLR+ NV D+VP  PGI  
Sbjct  319   GQAA----------PICVFSFSGPRVGNIRFKERIDKLGVKVLRVRNVHDQVPLAPGIFF  368

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             NE+      L+   + F W Y+HVGVELAL+H  SPFLK   DL C HNLE HLHL+DGY
Sbjct  369   NERV--PSTLQKLAERFSWWYSHVGVELALNHKDSPFLKETNDLACFHNLEAHLHLIDGY  426

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIE  1662
             HG GR+F  A GRDIALVNK ++FLK  + VPP W Q ENKG+V+   G W+  ER  +E
Sbjct  427   HGKGRKFVLANGRDIALVNKATDFLKDHYLVPPNWWQRENKGLVQNHKGHWIQLERQDLE  486

Query  1663  AH  1668
              H
Sbjct  487   DH  488



>ref|XP_004493750.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X2 [Cicer arietinum]
Length=501

 Score =   439 bits (1129),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 224/431 (52%), Positives = 297/431 (69%), Gaps = 20/431 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             +  +W +I G  +W  LL+PM+  +R E+IRYGE AQACYD+FDFDP+SKYCG+CK    
Sbjct  70    IQNVWRKIHGEDNWAELLDPMDPLMRSELIRYGEMAQACYDAFDFDPYSKYCGSCKLRSQ  129

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSV-NRIWSQHANWMGYVAVATDEAEI  771
             +FF  L +   GY ++RYLYAT+N+N+P+FF+ S   ++ WS+HANWMGYVAV+ DE   
Sbjct  130   EFFPSLDLPHIGYTVTRYLYATANVNVPDFFKRSRWPDKYWSEHANWMGYVAVSNDET-T  188

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSKKD  939
             +RLGRRDIVIAWRGTVT++EW+ +L+N L P  + D P    D+++E+GF D+YT+  K 
Sbjct  189   KRLGRRDIVIAWRGTVTHVEWVANLQNFLKPI-YEDIPCPDNDVRVEAGFLDMYTD--KQ  245

Query  940   TDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1119
                 +C YSAREQ+L E+ RL+E+Y  E +S+T+TGHSLG+A+A LSA+DIAE  +N+ +
Sbjct  246   IKDGYCKYSAREQVLGELKRLLEKYSNEEVSVTLTGHSLGSAMATLSAFDIAETGLNIRE  305

Query  1120  egegessstsaatKIPVSVFSFAGPRVGNLRFKERCDE-LGIKVLRIVNVRDKVPTVPGI  1296
              GE          KI VSVFSF+GPRVGN++FK R +  LGIKVLR+ N  D VP  PG 
Sbjct  306   NGE----------KIHVSVFSFSGPRVGNVKFKGRLERHLGIKVLRVRNKHDLVPKSPGF  355

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
               NE             + PW Y HVGV+L LDH  SPFL    D  CAHNLE HLH++D
Sbjct  356   FINETSPAWLLKIAEDFDMPWCYTHVGVDLELDHKISPFLNPDGDAACAHNLEAHLHVLD  415

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG  R + + T RDIALVNK  +F+K EH VPP WRQD N+ MV+T DG+WV+ +R +
Sbjct  416   GYHGRNRGYEATTNRDIALVNKACDFVKDEHSVPPSWRQDLNRNMVKTEDGKWVLAQRPQ  475

Query  1657  IEAHPPDTGHH  1689
             ++ +  D   H
Sbjct  476   LDDNYEDIQPH  486



>ref|XP_004493749.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X1 [Cicer arietinum]
Length=506

 Score =   439 bits (1129),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 224/431 (52%), Positives = 297/431 (69%), Gaps = 20/431 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             +  +W +I G  +W  LL+PM+  +R E+IRYGE AQACYD+FDFDP+SKYCG+CK    
Sbjct  70    IQNVWRKIHGEDNWAELLDPMDPLMRSELIRYGEMAQACYDAFDFDPYSKYCGSCKLRSQ  129

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSV-NRIWSQHANWMGYVAVATDEAEI  771
             +FF  L +   GY ++RYLYAT+N+N+P+FF+ S   ++ WS+HANWMGYVAV+ DE   
Sbjct  130   EFFPSLDLPHIGYTVTRYLYATANVNVPDFFKRSRWPDKYWSEHANWMGYVAVSNDET-T  188

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSKKD  939
             +RLGRRDIVIAWRGTVT++EW+ +L+N L P  + D P    D+++E+GF D+YT+  K 
Sbjct  189   KRLGRRDIVIAWRGTVTHVEWVANLQNFLKPI-YEDIPCPDNDVRVEAGFLDMYTD--KQ  245

Query  940   TDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1119
                 +C YSAREQ+L E+ RL+E+Y  E +S+T+TGHSLG+A+A LSA+DIAE  +N+ +
Sbjct  246   IKDGYCKYSAREQVLGELKRLLEKYSNEEVSVTLTGHSLGSAMATLSAFDIAETGLNIRE  305

Query  1120  egegessstsaatKIPVSVFSFAGPRVGNLRFKERCDE-LGIKVLRIVNVRDKVPTVPGI  1296
              GE          KI VSVFSF+GPRVGN++FK R +  LGIKVLR+ N  D VP  PG 
Sbjct  306   NGE----------KIHVSVFSFSGPRVGNVKFKGRLERHLGIKVLRVRNKHDLVPKSPGF  355

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
               NE             + PW Y HVGV+L LDH  SPFL    D  CAHNLE HLH++D
Sbjct  356   FINETSPAWLLKIAEDFDMPWCYTHVGVDLELDHKISPFLNPDGDAACAHNLEAHLHVLD  415

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG  R + + T RDIALVNK  +F+K EH VPP WRQD N+ MV+T DG+WV+ +R +
Sbjct  416   GYHGRNRGYEATTNRDIALVNKACDFVKDEHSVPPSWRQDLNRNMVKTEDGKWVLAQRPQ  475

Query  1657  IEAHPPDTGHH  1689
             ++ +  D   H
Sbjct  476   LDDNYEDIQPH  486



>dbj|BAJ85518.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=535

 Score =   438 bits (1126),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 257/535 (48%), Positives = 329/535 (61%), Gaps = 41/535 (8%)
 Frame = +1

Query  139   SLQISLKHNYHTIFAESLPPPLMNITKPTTAKPSNNSFFPLNPHYSSLKCRVSLPAA---  309
             S   +L  N H++       P   +  P   KP      P   H +   CR   P++   
Sbjct  2     SCSSNLSLNAHSLLGSPAGRPAPRLLLPQ--KP------PTGSHGAYTTCRTRRPSSHVT  53

Query  310   ----AINAPPQRETGQSSNKNdeeqeedeelcveedGRNLHEIWAEIQGSKDWEGLLNPM  477
                 A  APP +E    S   D E+    E     DG  L   W E+ G  DW+GLL+P+
Sbjct  54    SAVSADKAPPTKEKKADSFVGDMERGTLAEDSGRSDG-ELTSRWREMHGCNDWDGLLDPI  112

Query  478   NSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYLYA  657
             +  LR E+IRYGEF+QACYDSFD+D  S+Y GTCKY    FF+ +G+   GY ++RYLYA
Sbjct  113   DRTLRGELIRYGEFSQACYDSFDYDRFSRYAGTCKYAQETFFKDVGLTGVGYEVARYLYA  172

Query  658   TSNINLPNFF---QHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYL  828
             TS+   P+F     + S +R+WS+   ++G++AV+TDE E  R+GRRDI +AWRGTVT L
Sbjct  173   TSHARFPSFGVQKHNPSDDRMWSETGTFIGFIAVSTDE-ETARIGRRDIAVAWRGTVTKL  231

Query  829   EWIHDLKNILHPT-HFR---DDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVN  996
             EWI D+   L P   F     DP +K+E GF +LYT+  K+TDC +C YSAREQ+LAEV 
Sbjct  232   EWIADITAFLKPVGQFGLPCPDPSVKVEEGFAELYTS--KNTDCKYCKYSAREQVLAEVR  289

Query  997   RLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegessstsaatKIPV  1170
             +L+ERY  +GE +S+TVTGHSLGAALA+L AYDIAE + NV          ++   K PV
Sbjct  290   KLVERYTGQGEEVSVTVTGHSLGAALAVLCAYDIAETRANV----------STTGAKAPV  339

Query  1171  SVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETTLK  1347
              VFS++GPRVGN RF+ER + +LG+K LRI+NV D VP VPGI                 
Sbjct  340   CVFSYSGPRVGNPRFRERFEGDLGVKALRILNVHDSVPKVPGIFTEAVLPMPLLRVAGAL  399

Query  1348  NFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDI  1527
               P  Y+H+GVELAL+H  SPFLK   DL C HNLE HLHL+DGY G G+ F+   GRD 
Sbjct  400   GLPSVYSHIGVELALNHRLSPFLKNVFDLACYHNLEAHLHLLDGYQGRGKEFKLG-GRDP  458

Query  1528  ALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR-IEAHPPDTGHH  1689
             ALVNK ++FL  EH VPP WRQ+ NKG+VRT DGRW +P R R +E HP DT  H
Sbjct  459   ALVNKAADFLVDEHMVPPVWRQEFNKGLVRTEDGRWQLPHRPRHVEGHPEDTDLH  513



>emb|CDM86669.1| unnamed protein product [Triticum aestivum]
Length=540

 Score =   437 bits (1123),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 237/442 (54%), Positives = 301/442 (68%), Gaps = 28/442 (6%)
 Frame = +1

Query  406   GRNLHEI---WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGT  576
             GR+  E+   W E+ G  DW+GLL+P++  LR E+IRYGEF+QACYDSFD+D +S+Y GT
Sbjct  91    GRSDGELTSRWREMHGCNDWDGLLDPIDRTLRGELIRYGEFSQACYDSFDYDRYSRYAGT  150

Query  577   CKYDGAQFFEKLGMADRGYRISRYLYATSNINLPNFF---QHSSVNRIWSQHANWMGYVA  747
             CKY    FF+ +G+A  GY ++RYLYATS+   P+F     + S +R+WS+   ++G++A
Sbjct  151   CKYAQESFFKDVGLAGVGYEVARYLYATSHARFPSFGVKKHNPSDDRMWSETGTFIGFIA  210

Query  748   VATDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPT-HFR---DDPDIKIESGFFD  915
             V+TDE E  R+GRRDI +AWRGTVT LEWI D+   L P   F     DP +K+E GF +
Sbjct  211   VSTDE-ETARIGRRDIAVAWRGTVTKLEWIADVTAFLKPVGQFGLPCPDPSVKVEEGFAE  269

Query  916   LYTNSKKDTDCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYD  1089
             LYT+  K+ DC +C YSAREQ+LAEV +L+ERY  +GE +S+TVTGHSLGAALA+L AYD
Sbjct  270   LYTS--KNPDCKYCKYSAREQVLAEVRKLVERYTAQGEEVSVTVTGHSLGAALAVLCAYD  327

Query  1090  IAEMKVNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNV  1266
             IAE +VNV          ++   K PV VFS++GPRVGN  F+ER + ELG+K LRI+NV
Sbjct  328   IAETRVNV----------STTGAKAPVCVFSYSGPRVGNPMFRERFEGELGVKALRILNV  377

Query  1267  RDKVPTVPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAH  1446
              D VP VPGI                   P  Y+H+GVELALDH  SPFLK   DL C H
Sbjct  378   HDSVPKVPGIFTEAVLPMPLLRVAGALGLPSVYSHIGVELALDHKLSPFLKDVFDLACYH  437

Query  1447  NLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSD  1626
             NLE HLHL+DGY G G+ F+   GRD ALVNK ++FL  EH VP  WRQ+ NKGMVRT D
Sbjct  438   NLEAHLHLLDGYQGRGKEFKLG-GRDPALVNKAADFLMDEHMVPDGWRQELNKGMVRTED  496

Query  1627  GRWVVPERSR-IEAHPPDTGHH  1689
             GRW++P R R +E HP DT  H
Sbjct  497   GRWMLPHRPRNVEEHPEDTDLH  518



>gb|KEH23856.1| phospholipase A1 [Medicago truncatula]
Length=503

 Score =   435 bits (1119),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 221/421 (52%), Positives = 298/421 (71%), Gaps = 20/421 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             + + W +I G  DW GLL+PM+  +R E+IRYGE +QACYD+FDFDP+SKYCG+CK+   
Sbjct  74    IEKAWRKIHGEDDWVGLLDPMDPIMRSELIRYGEKSQACYDAFDFDPYSKYCGSCKHPHL  133

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSS-VNRIWSQHANWMGYVAVATDEAEI  771
             +FF  L +   GY ++RYLYAT+N+N+P+FF+ S   ++ WS+HANWMGY+AV+ DEA  
Sbjct  134   EFFPSLDLPHIGYDVTRYLYATANVNVPDFFKKSRWPDKYWSEHANWMGYIAVSNDEA-T  192

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSKKD  939
             +++GRRDIVIAWRGTVT++EW+ +L+N L P  ++D P    D+++E+GF D+YT+  + 
Sbjct  193   KQIGRRDIVIAWRGTVTHVEWVANLQNYLKPL-YKDIPCPDNDVRVEAGFLDMYTD--RH  249

Query  940   TDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1119
                 +C YSAREQ+L EV RL+ ++  E +SIT+TGHSLG+A+A LSA+DIAE  +NV +
Sbjct  250   IKDGYCKYSAREQVLGEVRRLLAKFPNEEVSITLTGHSLGSAMATLSAFDIAETGLNVRE  309

Query  1120  egegessstsaatKIPVSVFSFAGPRVGNLRFKERCDE-LGIKVLRIVNVRDKVPTVPGI  1296
              GE          KI VSVFSF+GPRVGN++FK R ++ LG+K+LR+ N  D VP  PG 
Sbjct  310   NGE----------KIHVSVFSFSGPRVGNVKFKGRLEKHLGVKILRVHNKHDMVPKSPGF  359

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
             + NEK            + PW Y HVGVEL LDH  SPFL    D  CAHNLE HLH++D
Sbjct  360   LINEKSPAWLLKFAEDIDIPWCYTHVGVELELDHKISPFLNPNADAACAHNLEAHLHILD  419

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             GYHG  R + + T RDIALVNK  +F+K EH VPP WRQD N+ MV+T DGRW++  R +
Sbjct  420   GYHGSNRGYEATTDRDIALVNKSCDFVKDEHYVPPNWRQDLNRNMVKTEDGRWMLAHRPQ  479

Query  1657  I  1659
             +
Sbjct  480   V  480



>ref|XP_007162494.1| hypothetical protein PHAVU_001G156900g [Phaseolus vulgaris]
 gb|ESW34488.1| hypothetical protein PHAVU_001G156900g [Phaseolus vulgaris]
Length=501

 Score =   430 bits (1105),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 225/417 (54%), Positives = 289/417 (69%), Gaps = 20/417 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L E+W +I G  +W GLL+PM+  +R E+I YGE AQACYD+FD+DP+SKYCG+C++   
Sbjct  71    LAEVWRKIHGEDNWAGLLDPMDPVMRAELIHYGEMAQACYDAFDYDPYSKYCGSCRFSVP  130

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSV-NRIWSQHANWMGYVAVATDEAEI  771
             +FF+ L M + GY I+RYLYAT+NI LP  F+ S   ++ WS+HANW G++AV +D+A  
Sbjct  131   EFFQSLDMPNVGYTITRYLYATANIKLPKLFRKSRWPDKRWSKHANWAGFIAV-SDDATS  189

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPT--HFRDDPD-IKIESGFFDLYTNSKKDT  942
             +RLGRRDI IAWRGTVT +EW+ DL N L P   H     + +K+E+GF DLYT+  K+T
Sbjct  190   KRLGRRDITIAWRGTVTNVEWVADLTNYLRPITPHVPCSVEGVKVEAGFLDLYTD--KET  247

Query  943   DCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
             +C FC YSAREQ+L EV RL++ Y+ E +SIT TGHSLG+A+A LSA+D+ E  VNV ++
Sbjct  248   ECGFCKYSAREQVLGEVRRLMKVYENEEVSITTTGHSLGSAMATLSAFDVVENGVNVGKD  307

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPTVPGII  1299
             G           K  VSVFSF+GPRVGN+RFKER + ELGIKVLR++N  D V   PG+ 
Sbjct  308   GR----------KAHVSVFSFSGPRVGNVRFKERLEKELGIKVLRVLNKHDLVSQSPGLF  357

Query  1300  ANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDG  1479
              NE     + L   ++  PW Y HVG +L LDH  SPFL    D+ CAHNLE  LHL+DG
Sbjct  358   FNE--DSPRWLVKLVEWLPWCYLHVGEQLELDHKKSPFLNPDADVACAHNLEAQLHLLDG  415

Query  1480  YHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             YHG    F+  + RDIALVNK  +FLK EH VPP WRQD NK M +T +G WV  ER
Sbjct  416   YHGKNDAFKRTSLRDIALVNKACDFLKDEHSVPPYWRQDLNKNMTKTEEGTWVFSER  472



>dbj|BAJ99811.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=517

 Score =   430 bits (1106),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 240/435 (55%), Positives = 300/435 (69%), Gaps = 25/435 (6%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
              L   W E+ GS DW+GLL+P+++ LR E+IRYGEFAQACYDSFD+D  S+Y G+CKY  
Sbjct  76    QLTSRWRELHGSNDWQGLLDPIDTVLRGELIRYGEFAQACYDSFDYDRFSRYSGSCKYPT  135

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNF--FQHS-SVNRIWSQHANWMGYVAVATDE  762
               FFE +G+A  GY ++RYLYATS+ + PNF  ++H+   +++WS+ A ++G+VAV+TDE
Sbjct  136   RTFFEDVGLAGVGYEVTRYLYATSHPSYPNFSIWKHNPGDDKLWSESATFIGFVAVSTDE  195

Query  763   AEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNS  930
              E  R+GRRDI +AWRGTVT LEW+ DL  +L P         DP +K+E+GF DLY   
Sbjct  196   -ETARIGRRDIAVAWRGTVTRLEWVADLTAMLKPLSACGVPCPDPSVKVETGFVDLYVG-  253

Query  931   KKDTDCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMK  1104
              KD+ C F SYSAREQ+LAEV +L+ERY  +GE +S+TVTGHSLG+ALA++SA+DIAE  
Sbjct  254   -KDSACRFSSYSAREQVLAEVRKLVERYAGRGEEVSVTVTGHSLGSALAMISAFDIAESG  312

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVP  1281
              NV        S ++   K PV VFSFAGPRVGN RFK+R + ELG+K LRI NV D VP
Sbjct  313   ANV--------SPSAGGKKAPVCVFSFAGPRVGNTRFKKRFEGELGVKTLRIRNVHDMVP  364

Query  1282  TVPGIIANEKFQYQKQLETT-LKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1458
              VPG + NE       L    +   P  Y HVGVEL LDH  SPFLK   DL   HNLE 
Sbjct  365   KVPGFLFNEAIFPAVLLRVADMLRVPSVYTHVGVELTLDHIVSPFLKPTGDLASYHNLEA  424

Query  1459  HLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1638
             HLHL+DGY   G+ F    GRD ALVNK  +FL+ EH VPP WRQ+ENKGMVRT DGRW 
Sbjct  425   HLHLLDGYRAHGQPFELG-GRDPALVNKAIDFLRDEHMVPPGWRQEENKGMVRTEDGRWA  483

Query  1639  VPERSR-IEAHP-PD  1677
             + +  R +EAHP PD
Sbjct  484   LLQLPRDVEAHPVPD  498



>ref|XP_002437873.1| hypothetical protein SORBIDRAFT_10g004170 [Sorghum bicolor]
 gb|EER89240.1| hypothetical protein SORBIDRAFT_10g004170 [Sorghum bicolor]
Length=546

 Score =   426 bits (1096),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 234/441 (53%), Positives = 295/441 (67%), Gaps = 27/441 (6%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI GS  WEGLL+P+++ LR E+IRYGE AQACYDSFD+D  S YCG+C++    FF+
Sbjct  101   WREIHGSDHWEGLLDPIDAVLRGELIRYGELAQACYDSFDYDRFSPYCGSCRFPAKTFFQ  160

Query  607   KLGMADRGYRISRYLYATSN-INLPNFFQH------SSVNRIWSQHANWMGYVAVATDEA  765
              +G+   GY ++RYLYATSN + LPNF         ++ +++WS+   ++GYVAV+TDE 
Sbjct  161   DVGLGGAGYEVTRYLYATSNDLKLPNFRSRKHRSAAAAADKLWSEMGTFIGYVAVSTDE-  219

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHD-------LKNILHPTHFRDDPDIKIESGFFDLYT  924
             E  RLGRRDIV++WRGTVT LEW+ D       L  +  P     DPD+K+E GF +LYT
Sbjct  220   ETARLGRRDIVVSWRGTVTRLEWVADVTANQTRLSGMGVPC---PDPDVKVEMGFAELYT  276

Query  925   NSKKDTDCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAE  1098
                KD  C FC YSAREQ LAEV + +E Y  +GE +S+TVTGHSLG+ALA+L+A+DIAE
Sbjct  277   G--KDAACRFCRYSAREQALAEVRKQVEVYHGRGEQVSVTVTGHSLGSALAMLNAFDIAE  334

Query  1099  MKVNVV-QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRD  1272
                N   +    +        + PV VFSFAGPRVGNLRF+ER + ELG++ LR+VNV D
Sbjct  335   TGANASPEPELDDDGRRCRKAQAPVCVFSFAGPRVGNLRFRERFERELGVRALRVVNVHD  394

Query  1273  KVPTVPGIIANEKFQYQKQLETTLK-NFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHN  1449
              VP VPG+  NE    +  L           Y H+GV LALDH  SPFLK   D+ C HN
Sbjct  395   GVPKVPGVFFNEAAFPEAVLRAVDGLGAAGVYTHLGVPLALDHRASPFLKETMDISCYHN  454

Query  1450  LEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDG  1629
             LE HLHL+DG+ G G  F+   GRD ALVNK ++FL+ EH VPP W Q+ENKGMVRT DG
Sbjct  455   LEAHLHLLDGFRGSGEVFQ-LRGRDPALVNKSADFLRDEHMVPPVWYQEENKGMVRTEDG  513

Query  1630  RWVVPERSR-IEAHPPDTGHH  1689
             RWV+P R R I+ HP DT HH
Sbjct  514   RWVLPPRHRDIDEHPDDTDHH  534



>ref|XP_011042425.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X2 [Populus euphratica]
Length=435

 Score =   421 bits (1083),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 215/362 (59%), Positives = 265/362 (73%), Gaps = 19/362 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L ++W EIQG  DW GLL+PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  88    RRLADVWREIQGQDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFI  147

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +F E LGMA  GY ++RYLYATSNI+LPNFF+ S   ++WS  ANW+GYVAV+ DE  
Sbjct  148   RRRFLESLGMAHHGYEVTRYLYATSNIDLPNFFKKSRWPKVWSNKANWIGYVAVSDDET-  206

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
              + LGRRDI IAWRGTVT+LEWI DL + L P +       DP +K+E GF DLYT+  K
Sbjct  207   TKCLGRRDISIAWRGTVTHLEWISDLMDFLKPINANKIPCPDPTVKVEYGFLDLYTD--K  264

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D +C FC YSAREQ+L+EV RL E Y  E +SIT+TGHSLG+ALA+LSAYDIAE  ++V+
Sbjct  265   DENCRFCKYSAREQILSEVKRLTEMYADEEMSITITGHSLGSALAMLSAYDIAETGLHVM  324

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
             Q+G            +PVSVFSF+GPRVGN+RFKER + LG+KVLR+VNV+D VP  PG+
Sbjct  325   QDGRA----------LPVSVFSFSGPRVGNVRFKERIESLGVKVLRVVNVQDMVPKSPGL  374

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
               NE  Q    L    +  PW+Y+HVGVELALDH  SPFLK  +D  CAHNLE HLHL+D
Sbjct  375   FFNE--QMPPPLMKMAEGLPWAYSHVGVELALDHRNSPFLKQTSDPACAHNLEAHLHLLD  432

Query  1477  GY  1482
             G+
Sbjct  433   GF  434



>ref|XP_002456959.1| hypothetical protein SORBIDRAFT_03g046400 [Sorghum bicolor]
 gb|EES02079.1| hypothetical protein SORBIDRAFT_03g046400 [Sorghum bicolor]
Length=529

 Score =   424 bits (1089),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 238/441 (54%), Positives = 297/441 (67%), Gaps = 33/441 (7%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI G  DWEGLL+P+++ LR E+IRYGEFAQACYD+FD+D  S+YCG+ +Y    FF 
Sbjct  93    WREIHGRGDWEGLLDPIDTVLRGELIRYGEFAQACYDAFDYDRFSRYCGSSRYPPPTFFR  152

Query  607   KLGMADRGYRISRYLYATSNINLPNFF----QHSSVN----RIWSQHANWMGYVAVATDE  762
              +G+   GY ++R+LYATSN  LPNF     +H S +    R+WS+ A+++G+VAV+TDE
Sbjct  153   DVGLDGVGYEVTRFLYATSNARLPNFVGARRKHRSGDDPDARLWSETASFIGFVAVSTDE  212

Query  763   AEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNS  930
              E  R+GRRDI +AWRGTVT LEW+ DL     P      P      K+ESGF +LYT  
Sbjct  213   -ETARIGRRDIAVAWRGTVTRLEWVADLTAAPRPAADFGIPCPDHGAKVESGFAELYTG-  270

Query  931   KKDTDCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMK  1104
              KD  C +C YSAREQ+LAEV +L++ Y  +GE +S+TVTGHSLG+ALA LSA+D+AE  
Sbjct  271   -KDPSCRWCRYSAREQVLAEVRKLVDLYHGRGEEVSVTVTGHSLGSALATLSAFDVAETG  329

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVP  1281
              NV         S       PV VFSF+GPRVGN RFK R + ELG+KVLR+VNV D VP
Sbjct  330   ANV---------SPDGGRTAPVCVFSFSGPRVGNTRFKTRLERELGVKVLRVVNVHDMVP  380

Query  1282  TVPGII-ANEKFQYQKQLETTLKNFPWS--YAHVGVELALDHSYSPFLKTGT-DLGCAHN  1449
             TVPG++   ++  + + +   + N      Y HVGVELALDH  SP+LK  T DL C HN
Sbjct  381   TVPGVLYVLDERSFPEAVLRLMDNLGMGAVYVHVGVELALDHKVSPYLKAETLDLACFHN  440

Query  1450  LEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDG  1629
             LE HLHL+DGY G  R FR   GRD ALVNK ++FL+ EH VPP WRQD NKGMVR  DG
Sbjct  441   LEAHLHLLDGYQGRAREFR-LCGRDPALVNKAADFLRDEHMVPPVWRQDANKGMVRAEDG  499

Query  1630  RWVVPERSR-IEAHPPDTGHH  1689
             RWV+P R R +  HP DT HH
Sbjct  500   RWVLPPRHREVHDHPEDTDHH  520



>emb|CDM86668.1| unnamed protein product [Triticum aestivum]
Length=517

 Score =   423 bits (1088),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 238/435 (55%), Positives = 296/435 (68%), Gaps = 25/435 (6%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
              L   W E+ GS DW+GLL+P+++ LR E+IRYGEFAQACYDSFD+D  S+Y G+CKY  
Sbjct  76    QLTSRWRELHGSNDWQGLLDPIDTVLRGELIRYGEFAQACYDSFDYDRFSRYSGSCKYPT  135

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNF--FQHS-SVNRIWSQHANWMGYVAVATDE  762
               FF+ +G+A  GY ++RYLYATS+ + PNF  ++H+   +++WS+ A ++G+VAV+TDE
Sbjct  136   RTFFQDVGLAGVGYEVTRYLYATSHPSYPNFSIWKHNPGDDKLWSESATFIGFVAVSTDE  195

Query  763   AEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNS  930
              E  R+GRRDI +AWRGTVT LEW+ DL  +L P         DP +K+E GF DLY   
Sbjct  196   -ETARIGRRDIAVAWRGTVTRLEWVADLTAMLKPLSACGVPCPDPSVKVERGFVDLYIG-  253

Query  931   KKDTDCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMK  1104
              KD  C F SYSAREQ+LAEV +L+ERY  +GE + +TVTGHSLG+ALA+LSA+DIAE  
Sbjct  254   -KDPTCRFSSYSAREQVLAEVRKLVERYAGRGEEVGVTVTGHSLGSALAMLSAFDIAESG  312

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVP  1281
              NV        S ++   K PV VFSFAGPRVGN RFK+R + ELG+K LRI NV D VP
Sbjct  313   ANV--------SPSAGGKKAPVCVFSFAGPRVGNTRFKQRFEGELGVKALRIRNVHDMVP  364

Query  1282  TVPGIIANEKFQYQKQLETT-LKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1458
              VPG + NE       L        P  Y HVGVEL LDH  SPFLK   DL   HNLE 
Sbjct  365   KVPGFLFNEVIFPAVLLRVADALRVPSVYTHVGVELVLDHIVSPFLKPTGDLASYHNLEA  424

Query  1459  HLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1638
             HLHL+DGY   G+ F    GRD ALVNK ++FL+ EH VPP WRQ+ENKGMVRT  GRW 
Sbjct  425   HLHLLDGYRAHGQPFELG-GRDPALVNKAADFLRDEHMVPPGWRQEENKGMVRTEGGRWA  483

Query  1639  VPERSR-IEAHP-PD  1677
             + +  R +EAHP PD
Sbjct  484   LLQLPRDVEAHPVPD  498



>ref|XP_008648833.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Zea 
mays]
Length=492

 Score =   421 bits (1083),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 234/435 (54%), Positives = 292/435 (67%), Gaps = 28/435 (6%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI GS  WEG L+P+++ LR E+IRYGEFAQACYDSFD+D  S YCG+C++    FF+
Sbjct  60    WREIHGSDHWEGQLDPIDAVLRGELIRYGEFAQACYDSFDYDRFSPYCGSCRFPAKTFFQ  119

Query  607   KLGMADRGYRISRYLYATSN-INLPNFF--QHSSV--NRIWSQHANWMGYVAVATDEAEI  771
              +G+   GY++SRYLYAT N + LPNF   +HSS   +++WS+   ++GYVAV+TDE E 
Sbjct  120   DVGLGGAGYQVSRYLYATCNDLKLPNFGGRKHSSAANDKLWSELGTFIGYVAVSTDE-ET  178

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDL----KNILHPTHFRDDPDIKIESGFFDLYTNSKKD  939
              RLGRRDI ++WRGT+T LEW+ DL    K +        DPD+K+E GF +LYT   KD
Sbjct  179   ARLGRRDIAVSWRGTITRLEWVADLTANQKRLSELGVPCPDPDVKVEMGFAELYTG--KD  236

Query  940   TDCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNV  1113
               C FC YSAREQ LAEV + +E Y  +GE +S+TVTGHSLG+ALA+L+A+D+AE   N 
Sbjct  237   AACRFCRYSAREQALAEVRKQVELYHGRGEQVSVTVTGHSLGSALAMLNAFDVAETGANA  296

Query  1114  VQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPTVP  1290
                       +    K PV VFSFAGPRVGNLRF+ER   ELG++ LR+ NV D VP VP
Sbjct  297   ----------SPDGRKAPVCVFSFAGPRVGNLRFRERFQRELGVRALRVFNVHDGVPKVP  346

Query  1291  GIIANEKFQYQKQLETTLK-NFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLH  1467
             G+  N+    +  L           Y H+GV LALDH  SPFLK   D+ C HNLE HLH
Sbjct  347   GVFFNDAAFPEAVLRVVDGLGAGGVYTHLGVPLALDHKVSPFLKETMDISCYHNLEAHLH  406

Query  1468  LVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPE  1647
             L+DGY G G  F+   GRD ALVNK ++FL+ EH VPP W Q ENKGMVRT DGRWV+P 
Sbjct  407   LLDGYRGSGEGFQ-LRGRDPALVNKSADFLRDEHMVPPVWYQAENKGMVRTEDGRWVLPP  465

Query  1648  RSR-IEAHPPDTGHH  1689
             R R I+ HP DT HH
Sbjct  466   RHRDIDEHPDDTDHH  480



>ref|XP_002455039.1| hypothetical protein SORBIDRAFT_03g003410 [Sorghum bicolor]
 gb|EES00159.1| hypothetical protein SORBIDRAFT_03g003410 [Sorghum bicolor]
Length=513

 Score =   421 bits (1081),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 230/434 (53%), Positives = 290/434 (67%), Gaps = 24/434 (6%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI GS +WEGLL+P++  LR E+IRYGEFAQA YDSFD+D  S YCG+CKY    FF 
Sbjct  81    WREIHGSNNWEGLLDPIDDVLRGELIRYGEFAQATYDSFDYDRFSPYCGSCKYPARTFFH  140

Query  607   KLGMADRGYRISRYLYATSN-INLPNFF--QHSSVN-RIWSQHANWMGYVAVATDEAEIR  774
              +G+   GY +SRYLYAT N + LPNF   +H++ + ++WS+   ++GYVAV+TDE E  
Sbjct  141   DVGLGGVGYEVSRYLYATCNGLKLPNFANRKHTAADAKLWSESGTFIGYVAVSTDE-ETA  199

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  942
             RLGRRDI +AWRGT+T LEW+ DL +   P         DPD+K+E GF  LYT+  KD 
Sbjct  200   RLGRRDIAVAWRGTITRLEWVADLTSDQIPLRETGVPCPDPDVKVERGFAALYTD--KDA  257

Query  943   DCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
              C FC YSAREQ LAEV +L+E Y  +GE +S+TVTGHSLG+ LA+L A+D+AE + N  
Sbjct  258   GCRFCRYSAREQALAEVRKLVELYHGRGEQVSVTVTGHSLGSGLAMLCAFDVAETRANAS  317

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPTVPG  1293
              +      +       PV VFSFAGPRVGN+ F+ R + ELG++ LR+VNV D+VP VPG
Sbjct  318   PDDGRVRVA-------PVCVFSFAGPRVGNVGFRRRFERELGVRALRVVNVHDRVPKVPG  370

Query  1294  IIANEKFQYQKQLETTLK-NFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1470
             +  NE    +  L    +      Y H+GV L LDH  SPFLK   D+ C HNLE HLHL
Sbjct  371   VFFNEAAFPELVLRAVGRLGVGGVYTHLGVALELDHRASPFLKETLDISCYHNLEAHLHL  430

Query  1471  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             +DG+ G G  F    GRD ALVNK S+FL+ +H VPP W Q ENKGMVRT DGRWV+P R
Sbjct  431   LDGFRGSGEGF-ELRGRDPALVNKSSDFLREDHMVPPVWYQAENKGMVRTEDGRWVLPPR  489

Query  1651  SR-IEAHPPDTGHH  1689
              R ++ HP DT HH
Sbjct  490   QRELDQHPEDTDHH  503



>tpg|DAA53109.1| TPA: hypothetical protein ZEAMMB73_566262 [Zea mays]
Length=505

 Score =   420 bits (1079),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 229/432 (53%), Positives = 286/432 (66%), Gaps = 25/432 (6%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI GS +WEGLL+P++  L +E+IRYGEFAQA YDSFD+D  S YCG+CKY    FF 
Sbjct  80    WPEIHGSNNWEGLLDPIDGVLLQELIRYGEFAQATYDSFDYDRFSPYCGSCKYPAKTFFH  139

Query  607   KLGMADRGYRISRYLYATSN-INLPNFFQHSSVN-RIWSQHANWMGYVAVATDEAEIRRL  780
              +G+   GY ++RYLYAT N +  PNF   ++ N ++WS+   ++GYVAV+TDE E  RL
Sbjct  140   DVGLGGIGYEVTRYLYATCNDLKFPNFGIKTAANAKMWSESGTFIGYVAVSTDE-ETARL  198

Query  781   GRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDC  948
             GRRDI +AWRGT+T LEW+ DL     P         DPD+K+E GF  LYT+  K T C
Sbjct  199   GRRDIAVAWRGTITRLEWVADLTANQIPLRETGVPCPDPDVKVERGFVALYTD--KGTGC  256

Query  949   NFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
              FC YSAREQ+LAEV +L++ Y  +GE +S+TVTGHSLG+ALA+L A+DIAE + NV   
Sbjct  257   RFCRYSAREQVLAEVRKLVDLYHGRGEQVSVTVTGHSLGSALAMLCAFDIAETRANVSPG  316

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPTVPGII  1299
                           PV VFSFAGPRVGN+ F+ R + ELG++ LR+VNV D VP VPG+ 
Sbjct  317   DRVA----------PVCVFSFAGPRVGNVAFRRRFERELGVRALRVVNVHDSVPKVPGVF  366

Query  1300  ANEKFQYQKQLETTLK-NFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
              NE    +  L    +      Y H+GV L LDH  SPFLK   DL C HNLE HLHL+D
Sbjct  367   FNESAFPELVLRAADRLGLGGVYTHLGVLLQLDHKVSPFLKETLDLSCYHNLEAHLHLLD  426

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR  1656
             G+ G G  F    GRD ALVNK ++FL+ +H VPP W Q ENKGMVRT DGRWV+P R R
Sbjct  427   GFRGSGAGFEP-RGRDPALVNKSTDFLREDHMVPPVWYQAENKGMVRTEDGRWVLPPRQR  485

Query  1657  I-EAHPPDTGHH  1689
             + + HP DT HH
Sbjct  486   VLDDHPEDTDHH  497



>ref|XP_011028727.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Populus 
euphratica]
Length=433

 Score =   416 bits (1068),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 212/361 (59%), Positives = 257/361 (71%), Gaps = 19/361 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L ++W EIQG  DW GLL+PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  88    RKLADVWREIQGKDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFM  147

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +FFE LGM   GY ++RYLYATS I LPNFF+ S   ++WS  A+W+GYVAV+ DE  
Sbjct  148   SHRFFESLGMTRHGYEVTRYLYATSTIKLPNFFKKSRWPKVWSNSASWIGYVAVSDDET-  206

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
              +RLGRRDI +AWRGTVT LEWI DL + L P +       DP +K+ESGF DLYT+  K
Sbjct  207   TKRLGRRDITVAWRGTVTRLEWIADLMDFLKPVNDNKIPCPDPTVKVESGFLDLYTD--K  264

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D +C FC YSAREQ+LAEV RL E Y  E +SIT+TGHSLG ALA+LSAYDI E  ++V+
Sbjct  265   DENCRFCKYSAREQILAEVKRLTEMYADEEMSITITGHSLGGALAMLSAYDIVETGLHVM  324

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
             Q+             +PVSVFSF+GPRVGN+RFKER + LG+KVLR+VNV+D VP  PG+
Sbjct  325   QDSRA----------LPVSVFSFSGPRVGNVRFKERIESLGVKVLRVVNVQDVVPKSPGL  374

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
               NE  Q    L    +  PW Y+HVGVELALDH  SPFLK   D  CAHNLE  LHL+D
Sbjct  375   FLNE--QVPPMLMKLTEGLPWCYSHVGVELALDHKNSPFLKQTGDPVCAHNLEALLHLLD  432

Query  1477  G  1479
             G
Sbjct  433   G  433



>ref|XP_011079989.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic isoform X2 
[Sesamum indicum]
Length=435

 Score =   414 bits (1063),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 209/363 (58%), Positives = 262/363 (72%), Gaps = 20/363 (6%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L + W+E+ G  DW GLL+PM+  LR E+IRYG  AQACYD+FDFDP+SKYCG+C++ 
Sbjct  83    RELADCWSEMLGEDDWAGLLDPMDPLLRNELIRYGVMAQACYDAFDFDPYSKYCGSCRFT  142

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +FFE+LGMA+ GY I+RYLYATSNINLPNFF++S   ++WS++ANW+GY+AV+ DE  
Sbjct  143   RREFFERLGMAEAGYDITRYLYATSNINLPNFFKNSRWPKVWSKNANWIGYIAVSNDETS  202

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
              ++LGRRDI +AWRGTVT LEW+ DL + L P         DP +++ESGF DLYT+  K
Sbjct  203   -KKLGRRDICVAWRGTVTRLEWVADLMDFLRPISSDKIPSPDPTVRVESGFLDLYTD--K  259

Query  937   DTDCNFCSYSAREQLLAEVNRLI-ERYKGENLSITVTGHslgaalallsaYDIAEMKVNV  1113
             D  C +C +SAREQ+L EVNRLI E Y  E +S+T+TGHSLG A ALLSAYDI E  +NV
Sbjct  260   DESCKYCKFSAREQILTEVNRLINEVYPKEEVSVTITGHSLGGASALLSAYDIVETGINV  319

Query  1114  VQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1293
                          +  +PV VF+FAGPRVGN RFK R + LG+KVLR+VNV D VP  PG
Sbjct  320   ----------RGDSRAVPVCVFTFAGPRVGNARFKARLELLGVKVLRVVNVHDVVPKSPG  369

Query  1294  IIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
             ++ NEK      +    +NFPWSY HVGVELALDH  SPFL+   DL CAHNLE HLHL+
Sbjct  370   LLVNEK--AHPLVIKMAENFPWSYVHVGVELALDHKNSPFLRHDGDLVCAHNLEAHLHLL  427

Query  1474  DGY  1482
             DG+
Sbjct  428   DGW  430



>gb|KEH23857.1| phospholipase A1 [Medicago truncatula]
Length=461

 Score =   412 bits (1059),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 208/399 (52%), Positives = 280/399 (70%), Gaps = 20/399 (5%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             + + W +I G  DW GLL+PM+  +R E+IRYGE +QACYD+FDFDP+SKYCG+CK+   
Sbjct  74    IEKAWRKIHGEDDWVGLLDPMDPIMRSELIRYGEMSQACYDAFDFDPYSKYCGSCKHPHL  133

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSS-VNRIWSQHANWMGYVAVATDEAEI  771
             +FF  L +   GY ++RYLYAT+N+N+P+FF+ S   ++ WS+HANWMGY+AV+ DE   
Sbjct  134   EFFPSLDLPHIGYDVTRYLYATANVNVPDFFKKSRWPDKYWSEHANWMGYIAVSNDET-T  192

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSKKD  939
             +++GRRDIVIAWRGTVT++EW+ +L+N L P  ++D P    D+++E+GF D+YT+  + 
Sbjct  193   KQIGRRDIVIAWRGTVTHVEWVANLQNFLKPI-YQDIPCPDNDVRVEAGFLDMYTD--RH  249

Query  940   TDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1119
                 +C YSAREQ+L EV RL+ ++  E +SIT+TGHSLG+A+A LSA+DIAE ++NV +
Sbjct  250   IKDGYCKYSAREQVLGEVRRLLAKFPNEEVSITLTGHSLGSAMATLSAFDIAETRLNVRE  309

Query  1120  egegessstsaatKIPVSVFSFAGPRVGNLRFKERCDE-LGIKVLRIVNVRDKVPTVPGI  1296
                          KI VSVFSF+GPRVGN++FK R ++ LG+K+LR+ N  D VP  PG 
Sbjct  310   ----------NGEKIHVSVFSFSGPRVGNVKFKGRLEKHLGVKILRVHNKHDMVPKSPGF  359

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
             + NEK            + PW Y HVGVEL LDH  SPFL    D  CAHNLE HLH++D
Sbjct  360   LINEKSPAWLLKFAEDIDIPWCYTHVGVELELDHKISPFLNPNADAACAHNLEAHLHILD  419

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQ  1593
             GYHG  R + + T RDIALVNK  +F+K EH VPP WRQ
Sbjct  420   GYHGSNRGYEATTNRDIALVNKACDFVKDEHSVPPNWRQ  458



>ref|XP_008382954.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Malus 
domestica]
Length=435

 Score =   410 bits (1053),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 209/361 (58%), Positives = 257/361 (71%), Gaps = 19/361 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L ++W E+ G  DW GLL+PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+C++ 
Sbjct  85    RRLSDVWRELHGQDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFT  144

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
                FFE LGMA  GY +SRYL+ATSNINLPNFF+ S   ++WS++ANW+GYVAV+ D+  
Sbjct  145   RHAFFESLGMAQNGYHVSRYLFATSNINLPNFFKKSRWPKVWSKNANWIGYVAVSDDDTS  204

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
               RLGRRDI IAWRGTVT  EWI DL + L P         D  +K+ESGF DLYT+  K
Sbjct  205   A-RLGRRDISIAWRGTVTRXEWIVDLMDFLKPVSANRIPCPDQTVKVESGFLDLYTD--K  261

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D  C FC +SAREQ+L E+ RL+E+Y  E LSIT+TGHSLG+ALA+LSAYDI E  +NV+
Sbjct  262   DATCRFCQFSAREQILTEIKRLVEKYSDEELSITITGHSLGSALAILSAYDITETGLNVM  321

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
              +G            +PVSV S++GPRVGN+RFKER + LG+KVLR+VNV D VP  PG+
Sbjct  322   SDGRV----------VPVSVLSYSGPRVGNVRFKERLESLGVKVLRVVNVHDVVPKSPGL  371

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
               NE      +L    +  PWSY+HVGV+L LDH  SPFLK   D GCAHNLE HLHL+D
Sbjct  372   FFNE--HVAPRLMKLAEGLPWSYSHVGVQLELDHKNSPFLKPTNDPGCAHNLEAHLHLLD  429

Query  1477  G  1479
             G
Sbjct  430   G  430



>ref|NP_850148.1| phospholipase A1-Igamma2 [Arabidopsis thaliana]
 gb|AEC08406.1| phospholipase A1-Igamma2 [Arabidopsis thaliana]
Length=464

 Score =   407 bits (1047),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 210/365 (58%), Positives = 260/365 (71%), Gaps = 21/365 (6%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L + W +IQG  DW GL++PM+  LR E+IRYGE AQACYD+FDFDP SKYCGT ++ 
Sbjct  99    RRLRDTWRKIQGEDDWAGLMDPMDPILRSELIRYGEMAQACYDAFDFDPASKYCGTSRFT  158

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +FF+ LGM D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE  
Sbjct  159   RLEFFDSLGMIDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETS  218

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
               RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  K
Sbjct  219   RNRLGRRDIAIAWRGTVTKLEWIADLKDYLKPVTENKIRCPDPAVKVESGFLDLYTD--K  276

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGE---NLSITVTGHslgaalallsaYDIAEMKV  1107
             DT C F  +SAREQ+L EV RL+E +  +   +LSITVTGHSLG ALA+LSAYDIAEM++
Sbjct  277   DTTCKFARFSAREQILTEVKRLVEEHGDDDDSDLSITVTGHSLGGALAILSAYDIAEMRL  336

Query  1108  NVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1287
             N  ++G+           IPV+V ++ GPRVGN+RF+ER +ELG+KV+R+VNV D VP  
Sbjct  337   NRSKKGKV----------IPVTVLTYGGPRVGNVRFRERMEELGVKVMRVVNVHDVVPKS  386

Query  1288  PGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLH  1467
             PG+  NE   +   L    +  PW Y+HVG ELALDH  SPFLK   D+  AHNLE  LH
Sbjct  387   PGLFLNESRPH--ALMKIAEGLPWCYSHVGEELALDHQNSPFLKPSVDVSTAHNLEAMLH  444

Query  1468  LVDGY  1482
             L+DGY
Sbjct  445   LLDGY  449



>emb|CDY54880.1| BnaA10g27930D [Brassica napus]
Length=452

 Score =   405 bits (1042),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 212/365 (58%), Positives = 262/365 (72%), Gaps = 22/365 (6%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             ++L + W +IQG  DW GL++PM+  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  84    KSLRDTWRKIQGEDDWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  143

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATD-EA  765
               + F+ LG+ D GY  +RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D EA
Sbjct  144   RKKLFDSLGIFDSGYEAARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDSEA  203

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH---FR-DDPDIKIESGFFDLYTNSK  933
                RLGRRDI IAWRGTVT LEWI DLK+ L P     FR  DP +K ESGF DLYT+  
Sbjct  204   TRHRLGRRDIAIAWRGTVTQLEWIADLKDFLKPVSGNGFRCRDPAVKAESGFLDLYTD--  261

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  1104
             KDT CNF  +SAREQLL EV RL+ERY   +G++LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  262   KDTSCNFSKFSAREQLLTEVKRLVERYGDEEGDDLSITVTGHSLGGALAVLSAYDVAEMG  321

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
             +N  ++G+           +PV+VF+++ PRVGN+RFKER +ELG+KVLR+VN  D VP 
Sbjct  322   LNRTKKGKV----------VPVTVFTYSAPRVGNIRFKERMEELGVKVLRVVNKHDVVPK  371

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
              PG+  NE       L+      PW Y HVG +LALDH  SPFLK   DL  AHNLE  L
Sbjct  372   SPGLFLNE--HAPDALKQLAGGLPWCYCHVGEKLALDHQNSPFLKPSVDLSTAHNLEALL  429

Query  1465  HLVDG  1479
             HL+DG
Sbjct  430   HLLDG  434



>ref|XP_010414253.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=471

 Score =   405 bits (1042),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 213/366 (58%), Positives = 258/366 (70%), Gaps = 22/366 (6%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L + W +IQG  DW GL+ PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+ ++   
Sbjct  100   LIDTWRKIQGEDDWAGLMEPMDPVLRSELIRYGEMAQACYDAFDFDPASKYCGSSRFSRL  159

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             +FF+ LGM+  GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE    
Sbjct  160   EFFDSLGMSGSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETSRN  219

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  942
             RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  KDT
Sbjct  220   RLGRRDIAIAWRGTVTKLEWIADLKDYLKPVSENKIRCPDPAVKVESGFLDLYTD--KDT  277

Query  943   DCNFCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVN  1110
              C F  +SAREQ+LAEV RL+E Y    +  +LSITVTGHSLG ALA+LSAYDIAEM +N
Sbjct  278   SCKFAKFSAREQILAEVKRLVETYDDEDEDSDLSITVTGHSLGGALAILSAYDIAEMGLN  337

Query  1111  VVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1290
               + G+           IPV+V ++ GPRVGN+RFKER +ELG+KV+R+VNV D VP  P
Sbjct  338   RSKSGKV----------IPVTVLTYGGPRVGNVRFKERMEELGVKVMRVVNVHDMVPKSP  387

Query  1291  GIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1470
             G+  NE   +   L    +  PW Y HVG ELALDH  SPFLK   DL  AHNLE  LHL
Sbjct  388   GLFLNESAPH--ALMKIAEGLPWCYCHVGEELALDHQNSPFLKPSVDLSNAHNLEAMLHL  445

Query  1471  VDGYHG  1488
             +DGYHG
Sbjct  446   LDGYHG  451



>gb|AFW75599.1| hypothetical protein ZEAMMB73_741719 [Zea mays]
Length=1364

 Score =   424 bits (1091),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 234/435 (54%), Positives = 292/435 (67%), Gaps = 28/435 (6%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI GS  WEG L+P+++ LR E+IRYGEFAQACYDSFD+D  S YCG+C++    FF+
Sbjct  932   WREIHGSDHWEGQLDPIDAVLRGELIRYGEFAQACYDSFDYDRFSPYCGSCRFPAKTFFQ  991

Query  607   KLGMADRGYRISRYLYATSN-INLPNFF--QHSSV--NRIWSQHANWMGYVAVATDEAEI  771
              +G+   GY++SRYLYAT N + LPNF   +HSS   +++WS+   ++GYVAV+TDE E 
Sbjct  992   DVGLGGAGYQVSRYLYATCNDLKLPNFGGRKHSSAANDKLWSELGTFIGYVAVSTDE-ET  1050

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDL----KNILHPTHFRDDPDIKIESGFFDLYTNSKKD  939
              RLGRRDI ++WRGT+T LEW+ DL    K +        DPD+K+E GF +LYT   KD
Sbjct  1051  ARLGRRDIAVSWRGTITRLEWVADLTANQKRLSELGVPCPDPDVKVEMGFAELYTG--KD  1108

Query  940   TDCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNV  1113
               C FC YSAREQ LAEV + +E Y  +GE +S+TVTGHSLG+ALA+L+A+D+AE   N 
Sbjct  1109  AACRFCRYSAREQALAEVRKQVELYHGRGEQVSVTVTGHSLGSALAMLNAFDVAETGANA  1168

Query  1114  VQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPTVP  1290
                       +    K PV VFSFAGPRVGNLRF+ER   ELG++ LR+ NV D VP VP
Sbjct  1169  ----------SPDGRKAPVCVFSFAGPRVGNLRFRERFQRELGVRALRVFNVHDGVPKVP  1218

Query  1291  GIIANEKFQYQKQLETTLK-NFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLH  1467
             G+  N+    +  L           Y H+GV LALDH  SPFLK   D+ C HNLE HLH
Sbjct  1219  GVFFNDAAFPEAVLRVVDGLGAGGVYTHLGVPLALDHKVSPFLKETMDISCYHNLEAHLH  1278

Query  1468  LVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPE  1647
             L+DGY G G  F+   GRD ALVNK ++FL+ EH VPP W Q ENKGMVRT DGRWV+P 
Sbjct  1279  LLDGYRGSGEGFQ-LRGRDPALVNKSADFLRDEHMVPPVWYQAENKGMVRTEDGRWVLPP  1337

Query  1648  RSR-IEAHPPDTGHH  1689
             R R I+ HP DT HH
Sbjct  1338  RHRDIDEHPDDTDHH  1352



>ref|NP_563772.1| phospholipase A1-Igamma1 [Arabidopsis thaliana]
 gb|AAK97670.1| At1g06800/F4H5_10 [Arabidopsis thaliana]
 gb|AAO11634.1| At1g06800/F4H5_10 [Arabidopsis thaliana]
 gb|AEE28040.1| phospholipase A1-Igamma1 [Arabidopsis thaliana]
Length=444

 Score =   400 bits (1027),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 210/365 (58%), Positives = 257/365 (70%), Gaps = 22/365 (6%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             + L + W +IQG  DW GL++PM+  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  83    KRLRDTWRKIQGEDDWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  142

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
                 F+ LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D   
Sbjct  143   RRHLFDSLGIIDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDNEA  202

Query  769   IR-RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH---FR-DDPDIKIESGFFDLYTNSK  933
              R RLGRRDI IAWRGTVT LEWI DLK+ L P     FR  DP +K ESGF DLYT+  
Sbjct  203   TRCRLGRRDIAIAWRGTVTRLEWIADLKDFLKPVSGNGFRCPDPAVKAESGFLDLYTD--  260

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  1104
             KDT CNF  +SAREQ+L EV RL+ERY   +GE LSITVTGHSLG ALA+LSAYD+AEM 
Sbjct  261   KDTSCNFSKFSAREQVLTEVKRLVERYGDEEGEELSITVTGHSLGGALAVLSAYDVAEMG  320

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
             VN  ++G+           IPV+ F++ GPRVGN+RFKER ++LG+KVLR+VN  D V  
Sbjct  321   VNRTRKGKV----------IPVTAFTYGGPRVGNIRFKERIEKLGVKVLRVVNEHDVVAK  370

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
              PG+  NE+    + L       PW Y+HVG  L LDH  SPFLK   DL  AHNLE  L
Sbjct  371   SPGLFLNER--APQALMKLAGGLPWCYSHVGEMLPLDHQKSPFLKPTVDLSTAHNLEALL  428

Query  1465  HLVDG  1479
             HL+DG
Sbjct  429   HLLDG  433



>ref|XP_010414254.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X3 [Camelina sativa]
Length=469

 Score =   400 bits (1028),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 211/364 (58%), Positives = 256/364 (70%), Gaps = 22/364 (6%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L + W +IQG  DW GL+ PM+  LR E+IRYGE AQACYD+FDFDP SKYCG+ ++   
Sbjct  100   LIDTWRKIQGEDDWAGLMEPMDPVLRSELIRYGEMAQACYDAFDFDPASKYCGSSRFSRL  159

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             +FF+ LGM+  GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ DE    
Sbjct  160   EFFDSLGMSGSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETSRN  219

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  942
             RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  KDT
Sbjct  220   RLGRRDIAIAWRGTVTKLEWIADLKDYLKPVSENKIRCPDPAVKVESGFLDLYTD--KDT  277

Query  943   DCNFCSYSAREQLLAEVNRLIERY----KGENLSITVTGHslgaalallsaYDIAEMKVN  1110
              C F  +SAREQ+LAEV RL+E Y    +  +LSITVTGHSLG ALA+LSAYDIAEM +N
Sbjct  278   SCKFAKFSAREQILAEVKRLVETYDDEDEDSDLSITVTGHSLGGALAILSAYDIAEMGLN  337

Query  1111  VVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1290
               + G+           IPV+V ++ GPRVGN+RFKER +ELG+KV+R+VNV D VP  P
Sbjct  338   RSKSGKV----------IPVTVLTYGGPRVGNVRFKERMEELGVKVMRVVNVHDMVPKSP  387

Query  1291  GIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1470
             G+  NE   +   L    +  PW Y HVG ELALDH  SPFLK   DL  AHNLE  LHL
Sbjct  388   GLFLNESAPH--ALMKIAEGLPWCYCHVGEELALDHQNSPFLKPSVDLSNAHNLEAMLHL  445

Query  1471  VDGY  1482
             +DGY
Sbjct  446   LDGY  449



>ref|XP_010274200.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X2 [Nelumbo nucifera]
Length=458

 Score =   399 bits (1026),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 205/361 (57%), Positives = 256/361 (71%), Gaps = 19/361 (5%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R + + W EI G  DW G+L+P++  LR E+IRYGE AQACYD+FD+DP S+YCG+C++ 
Sbjct  112   RRIADFWREIHGQGDWTGMLDPIDPLLRSELIRYGEMAQACYDAFDYDPSSRYCGSCRFM  171

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +FF+ LGMA+ GY +SRYLYAT+NINLPNFF+ S   ++WS++ANW+GYVAV+ DE  
Sbjct  172   RRKFFDCLGMANFGYDVSRYLYATTNINLPNFFKKSRWPKVWSRNANWIGYVAVSNDETS  231

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
                LGRRDI IAWRGTVT LEWI DL + L P         DP +K+ESGF D+YT+  K
Sbjct  232   A-SLGRRDITIAWRGTVTRLEWIADLMDFLRPVSSDKIPCPDPSVKVESGFLDVYTD--K  288

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             D  C FC YSAREQ+L+EV RL ++Y  E LSIT+TGHSLG+ALA+LSAYDIAE  VNV 
Sbjct  289   DETCRFCKYSAREQILSEVKRLTQQYPDEELSITMTGHSLGSALAMLSAYDIAETGVNVT  348

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
                            +PV+VFSF+GPRVGN+RFKER + LG+KVLR+VNV D VP VPGI
Sbjct  349   ----------GDGRAVPVTVFSFSGPRVGNVRFKERVERLGVKVLRVVNVHDTVPKVPGI  398

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
             + NE     + +    +  PW Y+HVGVEL LDH +SPFL    D  C HNLE  LHL+D
Sbjct  399   LFNE--HVPELVHRLAQWLPWCYSHVGVELTLDHKHSPFLNGTGDPSCFHNLEALLHLLD  456

Query  1477  G  1479
             G
Sbjct  457   G  457



>ref|XP_004968489.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Setaria 
italica]
Length=570

 Score =   402 bits (1032),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 226/435 (52%), Positives = 283/435 (65%), Gaps = 28/435 (6%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI GS +WEGLL+P++  LR E+IRYGEFAQA YDSFD++  S Y G+C+Y    FFE
Sbjct  89    WREIHGSSNWEGLLDPIDPVLRAELIRYGEFAQATYDSFDYERFSPYSGSCRYPAKTFFE  148

Query  607   KLGMADRGYRISRYLYATSN-INLPNFF--QHSSV--NRIWSQHANWMGYVAVATDEAEI  771
              +G+   GY +SRYLYAT N + LPNF   +H S   +++WS+   ++GYVAV+TDE E 
Sbjct  149   DVGLVGAGYEVSRYLYATCNDLKLPNFGNPKHKSADDDKLWSESGTFIGYVAVSTDE-ET  207

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKD  939
              R+GRRDI + WRGT T LEW+ DL     P         D ++K+E GF +LYT   KD
Sbjct  208   ARIGRRDIAVVWRGTTTRLEWVADLTTNQRPLCEMGIPCPDSNVKVEMGFAELYTG--KD  265

Query  940   TDCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNV  1113
              DC FC YSAREQ LAEV +L+E Y  +GE +S+T+TGHSLG+ALA+L+A+D+AE   N 
Sbjct  266   VDCRFCRYSAREQALAEVRKLVELYHGRGEEVSVTITGHSLGSALAMLNAFDVAETGANA  325

Query  1114  VQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPTVP  1290
                G             PV VFSFAGPRVGNL F+ER + ELG++ LR+VNV D VP VP
Sbjct  326   TPSGGAA----------PVCVFSFAGPRVGNLGFRERFERELGVRALRVVNVHDWVPKVP  375

Query  1291  GIIANEKFQYQKQLETTLK-NFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLH  1467
             G I NE    +  L           Y H+GV L LDH  SPFLK   D+ C HNLE HLH
Sbjct  376   GAIFNEAAFPEAVLRAVDGLGVAGVYTHLGVALELDHRASPFLKDTIDITCYHNLEAHLH  435

Query  1468  LVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPE  1647
             L+DG+   G  F   +GRD ALVNK ++FL+ EH VPP W Q ENKG+V+T DGRWV+  
Sbjct  436   LLDGFRSRGEGF-ELSGRDPALVNKSTDFLRDEHKVPPVWYQAENKGLVKTEDGRWVLRP  494

Query  1648  RSR-IEAHPPDTGHH  1689
             R R I  HP DT H+
Sbjct  495   RHRDIAEHPEDTDHY  509



>ref|XP_010486704.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=442

 Score =   397 bits (1019),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 207/365 (57%), Positives = 258/365 (71%), Gaps = 22/365 (6%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             ++L + W +IQG  +W GL++PM+  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  81    KSLKDTWRKIQGEDNWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  140

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATD-EA  765
                 FE LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D EA
Sbjct  141   RRHLFESLGILDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEEA  200

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  933
                RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  
Sbjct  201   THGRLGRRDIAIAWRGTVTRLEWIADLKDYLKPVSGNGIRCPDPAVKVESGFLDLYTD--  258

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  1104
             KDT C F  +SAREQ+L EV RL+ERY   +GE+LSITVTGHSLG ALA+LS YD+AEM 
Sbjct  259   KDTSCKFSKFSAREQVLTEVKRLVERYGDEEGEDLSITVTGHSLGGALAVLSGYDVAEMG  318

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
             +N  ++G+           IPV+VF++ GPRVGN+RFKER ++LG+KVLR+VN  D V  
Sbjct  319   LNRTRKGKV----------IPVTVFTYGGPRVGNIRFKERIEKLGVKVLRVVNEHDVVAK  368

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
              PG+  NE+  +   L       PW Y HVG +L LDH  SPFLK   DL  AHNLE  L
Sbjct  369   SPGLFLNERAPH--ALMKLAGGLPWCYCHVGEKLPLDHQNSPFLKPTVDLSTAHNLEALL  426

Query  1465  HLVDG  1479
             HL+DG
Sbjct  427   HLLDG  431



>ref|XP_010486640.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X2 [Camelina sativa]
 ref|XP_010486663.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Camelina 
sativa]
 ref|XP_010486740.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Camelina 
sativa]
Length=442

 Score =   396 bits (1017),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 207/365 (57%), Positives = 257/365 (70%), Gaps = 22/365 (6%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             ++L   W +IQG  +W GL++PM+  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  81    KSLKNTWRKIQGEDNWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  140

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATD-EA  765
                 FE LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D EA
Sbjct  141   RRHLFESLGILDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEEA  200

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  933
                RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  
Sbjct  201   THGRLGRRDIAIAWRGTVTRLEWIADLKDYLKPVSGNGIRCPDPAVKVESGFLDLYTD--  258

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  1104
             KDT C F  +SAREQ+L EV RL+ERY   +GE+LSITVTGHSLG ALA+LS YD+AEM 
Sbjct  259   KDTSCKFSKFSAREQVLTEVKRLVERYGDEEGEDLSITVTGHSLGGALAVLSGYDVAEMG  318

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
             +N  ++G+           IPV+VF++ GPRVGN+RFKER ++LG+KVLR+VN  D V  
Sbjct  319   LNRTRKGKV----------IPVTVFTYGGPRVGNIRFKERIEKLGVKVLRVVNEHDVVAK  368

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
              PG+  NE+  +   L       PW Y HVG +L LDH  SPFLK   DL  AHNLE  L
Sbjct  369   SPGLFLNERAPH--ALMKLAGGLPWCYCHVGEKLPLDHQNSPFLKPTVDLSTAHNLEALL  426

Query  1465  HLVDG  1479
             HL+DG
Sbjct  427   HLLDG  431



>ref|XP_010486634.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=455

 Score =   396 bits (1018),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 207/367 (56%), Positives = 258/367 (70%), Gaps = 22/367 (6%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             ++L   W +IQG  +W GL++PM+  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  81    KSLKNTWRKIQGEDNWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  140

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATD-EA  765
                 FE LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D EA
Sbjct  141   RRHLFESLGILDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEEA  200

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  933
                RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  
Sbjct  201   THGRLGRRDIAIAWRGTVTRLEWIADLKDYLKPVSGNGIRCPDPAVKVESGFLDLYTD--  258

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  1104
             KDT C F  +SAREQ+L EV RL+ERY   +GE+LSITVTGHSLG ALA+LS YD+AEM 
Sbjct  259   KDTSCKFSKFSAREQVLTEVKRLVERYGDEEGEDLSITVTGHSLGGALAVLSGYDVAEMG  318

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
             +N  ++G+           IPV+VF++ GPRVGN+RFKER ++LG+KVLR+VN  D V  
Sbjct  319   LNRTRKGKV----------IPVTVFTYGGPRVGNIRFKERIEKLGVKVLRVVNEHDVVAK  368

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
              PG+  NE+  +   L       PW Y HVG +L LDH  SPFLK   DL  AHNLE  L
Sbjct  369   SPGLFLNERAPH--ALMKLAGGLPWCYCHVGEKLPLDHQNSPFLKPTVDLSTAHNLEALL  426

Query  1465  HLVDGYH  1485
             HL+DG +
Sbjct  427   HLLDGAY  433



>ref|XP_010486696.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=445

 Score =   395 bits (1016),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 207/365 (57%), Positives = 258/365 (71%), Gaps = 22/365 (6%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             ++L + W +IQG  +W GL++PM+  LR E+IRYGE AQACYD+FDFDP S+YCG+C++ 
Sbjct  81    KSLKDTWRKIQGEDNWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFT  140

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATD-EA  765
                 FE LG+ D GY ++RYLYATSNINLPNFF  S  +++WS++ANWMGYVAV+ D EA
Sbjct  141   RRHLFESLGILDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDEEA  200

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  933
                RLGRRDI IAWRGTVT LEWI DLK+ L P         DP +K+ESGF DLYT+  
Sbjct  201   THGRLGRRDIAIAWRGTVTRLEWIADLKDYLKPVSGNGIRCPDPAVKVESGFLDLYTD--  258

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMK  1104
             KDT C F  +SAREQ+L EV RL+ERY   +GE+LSITVTGHSLG ALA+LS YD+AEM 
Sbjct  259   KDTSCKFSKFSAREQVLTEVKRLVERYGDEEGEDLSITVTGHSLGGALAVLSGYDVAEMG  318

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
             +N  ++G+           IPV+VF++ GPRVGN+RFKER ++LG+KVLR+VN  D V  
Sbjct  319   LNRTRKGKV----------IPVTVFTYGGPRVGNIRFKERIEKLGVKVLRVVNEHDVVAK  368

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
              PG+  NE+  +   L       PW Y HVG +L LDH  SPFLK   DL  AHNLE  L
Sbjct  369   SPGLFLNERAPH--ALMKLAGGLPWCYCHVGEKLPLDHQNSPFLKPTVDLSTAHNLEALL  426

Query  1465  HLVDG  1479
             HL+DG
Sbjct  427   HLLDG  431



>ref|XP_008451277.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X3 [Cucumis melo]
Length=440

 Score =   390 bits (1002),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 200/360 (56%), Positives = 252/360 (70%), Gaps = 20/360 (6%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI GS DW GLL+PMN  LR E+IRYGE +Q+CYD+FD+DP SKYCG+C++   +FFE
Sbjct  91    WREIHGSNDWTGLLDPMNDLLRSELIRYGEMSQSCYDAFDYDPFSKYCGSCRFSRGKFFE  150

Query  607   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  786
             +LGM + GY ++RYLYATSNIN+PNFF+ S   ++WS+ ANW+GYVAV+ DE   + LGR
Sbjct  151   RLGMENVGYEVTRYLYATSNINMPNFFKKSRWPKVWSKSANWIGYVAVSNDEKS-KELGR  209

Query  787   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNF  954
             RDIV+AWRGTVT LEWI DL + L P         +  +K+ESGF DLYT  K++  C +
Sbjct  210   RDIVVAWRGTVTRLEWITDLMDFLKPIAEAKIGCPNSGVKVESGFVDLYTE-KEEKGCGY  268

Query  955   CSYSAREQLLAEVNRLIERYKG--ENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
             C +SAREQ++AEV RL ER+ G  E +SIT+TGHSLG+ALA+LS +DIAE  +N +  G 
Sbjct  269   CRFSAREQVMAEVKRLTERFGGAEEEMSITITGHSLGSALAVLSGFDIAETGLNRLGNGR  328

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1308
                        +PV VFSF+GPRVGN  FKE   ELG+KVLR+VN+ D VP  PG + NE
Sbjct  329   L----------VPVCVFSFSGPRVGNFSFKEHLHELGVKVLRVVNIHDIVPKTPGFLFNE  378

Query  1309  KFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1488
                  + +    +  PWSY+HVGVEL LDH  SPFLK   D  CAHNLE  LHL+DG  G
Sbjct  379   SI--PRAVMQFAEGLPWSYSHVGVELKLDHKVSPFLKQTNDPVCAHNLEALLHLLDGLEG  436



>gb|EEE63596.1| hypothetical protein OsJ_18413 [Oryza sativa Japonica Group]
Length=534

 Score =   393 bits (1010),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 225/425 (53%), Positives = 266/425 (63%), Gaps = 61/425 (14%)
 Frame = +1

Query  406   GRNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKY  585
             G  L   W EI G  DW GLL+PM+  LR E+IRYGEFAQACYD+FD+DP S+YCG+CKY
Sbjct  119   GHELAARWREIHGRDDWAGLLDPMDPLLRSELIRYGEFAQACYDAFDYDPSSRYCGSCKY  178

Query  586   DGAQFFEKLGM--ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATD  759
                 FF++LGM  A RGY                                          
Sbjct  179   PRRAFFDRLGMPAAARGY------------------------------------------  196

Query  760   EAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTN  927
               E  RLGRRDI IAWRGTVT LEW+ DL + L P      P    ++K+ESGF DLYT+
Sbjct  197   -TETARLGRRDIAIAWRGTVTRLEWVSDLMDFLRPVADEGIPCPDREVKVESGFVDLYTD  255

Query  928   SKKDTDCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEM  1101
               KD  C FC YSAREQ+L EV RL+ RY   GE++S+TVTGHSLG+ALA++SAYDIAE 
Sbjct  256   --KDPTCRFCKYSAREQVLTEVRRLVTRYAALGEDVSVTVTGHSLGSALAMISAYDIAES  313

Query  1102  KVNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKV  1278
                    G G+ ++ +      V V+SFAGPRVGN RFKER + ELG+K LR+VNV D V
Sbjct  314   GAASAAHGGGKEAAAA------VCVYSFAGPRVGNARFKERFEGELGVKALRVVNVHDGV  367

Query  1279  PTVPGIIANEKFQYQ-KQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLE  1455
               +PGI+ NE      +++   +   PW YAHVGVELALDH  SPFLK   D  C HNLE
Sbjct  368   ARMPGILLNEGAPAALRRVAEGILRVPWCYAHVGVELALDHKRSPFLKDTLDPACFHNLE  427

Query  1456  GHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRW  1635
              HLHL+DGYHG G RF  A+GRD ALVNK  +FLK  H VPP WRQDENKGMVR  DGRW
Sbjct  428   AHLHLLDGYHGRGERFVLASGRDPALVNKACDFLKDHHCVPPCWRQDENKGMVRAPDGRW  487

Query  1636  VVPER  1650
             V P+R
Sbjct  488   VQPDR  492



>ref|NP_001055438.1| Os05g0390000 [Oryza sativa Japonica Group]
 gb|AAT47444.1| putative lipase class 3 family protein, PF01764 [Oryza sativa 
Japonica Group]
 dbj|BAF17352.1| Os05g0390000 [Oryza sativa Japonica Group]
Length=478

 Score =   389 bits (999),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 213/369 (58%), Positives = 256/369 (69%), Gaps = 20/369 (5%)
 Frame = +1

Query  406   GRNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKY  585
             G  L   W EI G  DW GLL+PM+  LR E+IRYGEFAQACYD+FD+DP S+YCG+CKY
Sbjct  119   GHELAARWREIHGRDDWAGLLDPMDPLLRSELIRYGEFAQACYDAFDYDPSSRYCGSCKY  178

Query  586   DGAQFFEKLGM--ADRGYRISRYLYATSNINLPNFFQHSSVN-RIWSQHANWMGYVAVAT  756
                 FF++LGM  A RGY ++RYLYATSN   PNFF  S    +IWSQ ANW+GYVAV+T
Sbjct  179   PRRAFFDRLGMPAAARGYTVTRYLYATSNFRFPNFFSQSRAGAKIWSQRANWIGYVAVST  238

Query  757   DEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYT  924
             DE E  RLGRRDI IAWRGTVT LEW+ DL + L P      P    ++K+ESGF DLYT
Sbjct  239   DE-ETARLGRRDIAIAWRGTVTRLEWVSDLMDFLRPVADEGIPCPDREVKVESGFVDLYT  297

Query  925   NSKKDTDCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAE  1098
             +  KD  C FC YSAREQ+L EV RL+ RY   GE++S+TVTGHSLG+ALA++SAYDIAE
Sbjct  298   D--KDPTCRFCKYSAREQVLTEVRRLVTRYAALGEDVSVTVTGHSLGSALAMISAYDIAE  355

Query  1099  MKVNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDK  1275
                     G G+ ++ +      V V+SFAGPRVGN RFKER + ELG+K LR+VNV D 
Sbjct  356   SGAASAAHGGGKEAAAA------VCVYSFAGPRVGNARFKERFEGELGVKALRVVNVHDG  409

Query  1276  VPTVPGIIANEKFQYQ-KQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNL  1452
             V  +PGI+ NE      +++   +   PW YAHVGVELALDH  SPFLK   D  C HNL
Sbjct  410   VARMPGILLNEGAPAALRRVAEGILRVPWCYAHVGVELALDHKRSPFLKDTLDPACFHNL  469

Query  1453  EGHLHLVDG  1479
             E HLHL+DG
Sbjct  470   EAHLHLLDG  478



>ref|XP_008451276.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X2 [Cucumis melo]
Length=452

 Score =   388 bits (997),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 199/357 (56%), Positives = 251/357 (70%), Gaps = 20/357 (6%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI GS DW GLL+PMN  LR E+IRYGE +Q+CYD+FD+DP SKYCG+C++   +FFE
Sbjct  91    WREIHGSNDWTGLLDPMNDLLRSELIRYGEMSQSCYDAFDYDPFSKYCGSCRFSRGKFFE  150

Query  607   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  786
             +LGM + GY ++RYLYATSNIN+PNFF+ S   ++WS+ ANW+GYVAV+ DE   + LGR
Sbjct  151   RLGMENVGYEVTRYLYATSNINMPNFFKKSRWPKVWSKSANWIGYVAVSNDEKS-KELGR  209

Query  787   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDTDCNF  954
             RDIV+AWRGTVT LEWI DL + L P         +  +K+ESGF DLYT  K++  C +
Sbjct  210   RDIVVAWRGTVTRLEWITDLMDFLKPIAEAKIGCPNSGVKVESGFVDLYTE-KEEKGCGY  268

Query  955   CSYSAREQLLAEVNRLIERYKG--ENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
             C +SAREQ++AEV RL ER+ G  E +SIT+TGHSLG+ALA+LS +DIAE  +N +  G 
Sbjct  269   CRFSAREQVMAEVKRLTERFGGAEEEMSITITGHSLGSALAVLSGFDIAETGLNRLGNGR  328

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1308
                        +PV VFSF+GPRVGN  FKE   ELG+KVLR+VN+ D VP  PG + NE
Sbjct  329   L----------VPVCVFSFSGPRVGNFSFKEHLHELGVKVLRVVNIHDIVPKTPGFLFNE  378

Query  1309  KFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDG  1479
                  + +    +  PWSY+HVGVEL LDH  SPFLK   D  CAHNLE  LHL+DG
Sbjct  379   SI--PRAVMQFAEGLPWSYSHVGVELKLDHKVSPFLKQTNDPVCAHNLEALLHLLDG  433



>gb|KCW57435.1| hypothetical protein EUGRSUZ_H00215 [Eucalyptus grandis]
Length=462

 Score =   386 bits (991),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 213/425 (50%), Positives = 283/425 (67%), Gaps = 26/425 (6%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             RNL  IW EI G  +W  LL+P++  LR E+IRYGE AQA YD+FD DP SKYCG+C+Y 
Sbjct  48    RNLASIWEEIHGKSNWVSLLDPIDPLLRAELIRYGEMAQASYDAFDADPFSKYCGSCRYK  107

Query  589   GAQFFEKLGMADRGYRISRYLYATSNI-NLPNFFQHSSVNRIWSQHANWMGYVAVATDEA  765
              ++FF  L     GY ++RYLYA+ NI + P+FF+ S     WS+ ANW GYVAV+ DE 
Sbjct  108   LSEFFCSLEFPRAGYILTRYLYASCNIHHRPHFFKKSLWPEAWSESANWFGYVAVSDDEM  167

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSK  933
               + LGRRDI I WRGT+   EWI D +  + P   +  P      K+ESGF  LYT  +
Sbjct  168   S-KALGRRDIAIVWRGTMRKPEWIVDARYSMSPVRQKGIPCPDRKAKVESGFLHLYT--E  224

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNV  1113
             KD +  FC +S RE +L E+ RLI+++  E+LSITVTGHSLG+A+A+LSAYDIAE   ++
Sbjct  225   KDENSRFCKHSTREHVLQEIKRLIQKHADEDLSITVTGHSLGSAIAILSAYDIAETGTDI  284

Query  1114  VQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1293
              Q+G+           +P  VFSFAGPRVGN++FK+R +ELG+KVLR++NV D+VPTVPG
Sbjct  285   RQDGKI----------VPKCVFSFAGPRVGNVKFKKRVEELGVKVLRVLNVHDRVPTVPG  334

Query  1294  IIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
             +I NE         + L    + Y+HVG+EL L+H  SP+LK   DL C H++E  LHL+
Sbjct  335   MIFNE------NAPSVLPKI-YCYSHVGIELVLNHENSPYLKDKGDLLCYHDMEVLLHLL  387

Query  1474  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1653
             DGY   G+RF     RDIALVNK ++FLK ++ +PP+W+Q EN+G+VR  DGRW   ER 
Sbjct  388   DGYKEKGQRF-ELPRRDIALVNKATDFLKDKYLIPPKWKQLENRGLVRGQDGRWTQSERQ  446

Query  1654  RIEAH  1668
              +  H
Sbjct  447   DLGDH  451



>ref|XP_010069172.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Eucalyptus 
grandis]
Length=502

 Score =   387 bits (993),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 213/425 (50%), Positives = 283/425 (67%), Gaps = 26/425 (6%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             RNL  IW EI G  +W  LL+P++  LR E+IRYGE AQA YD+FD DP SKYCG+C+Y 
Sbjct  88    RNLASIWEEIHGKSNWVSLLDPIDPLLRAELIRYGEMAQASYDAFDADPFSKYCGSCRYK  147

Query  589   GAQFFEKLGMADRGYRISRYLYATSNI-NLPNFFQHSSVNRIWSQHANWMGYVAVATDEA  765
              ++FF  L     GY ++RYLYA+ NI + P+FF+ S     WS+ ANW GYVAV+ DE 
Sbjct  148   LSEFFCSLEFPRAGYILTRYLYASCNIHHRPHFFKKSLWPEAWSESANWFGYVAVSDDEM  207

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSK  933
               + LGRRDI I WRGT+   EWI D +  + P   +  P      K+ESGF  LYT  +
Sbjct  208   S-KALGRRDIAIVWRGTMRKPEWIVDARYSMSPVRQKGIPCPDRKAKVESGFLHLYT--E  264

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNV  1113
             KD +  FC +S RE +L E+ RLI+++  E+LSITVTGHSLG+A+A+LSAYDIAE   ++
Sbjct  265   KDENSRFCKHSTREHVLQEIKRLIQKHADEDLSITVTGHSLGSAIAILSAYDIAETGTDI  324

Query  1114  VQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1293
              Q+G+           +P  VFSFAGPRVGN++FK+R +ELG+KVLR++NV D+VPTVPG
Sbjct  325   RQDGKI----------VPKCVFSFAGPRVGNVKFKKRVEELGVKVLRVLNVHDRVPTVPG  374

Query  1294  IIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
             +I NE         + L    + Y+HVG+EL L+H  SP+LK   DL C H++E  LHL+
Sbjct  375   MIFNE------NAPSVLPKI-YCYSHVGIELVLNHENSPYLKDKGDLLCYHDMEVLLHLL  427

Query  1474  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1653
             DGY   G+RF     RDIALVNK ++FLK ++ +PP+W+Q EN+G+VR  DGRW   ER 
Sbjct  428   DGYKEKGQRF-ELPRRDIALVNKATDFLKDKYLIPPKWKQLENRGLVRGQDGRWTQSERQ  486

Query  1654  RIEAH  1668
              +  H
Sbjct  487   DLGDH  491



>ref|XP_003518892.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Glycine 
max]
Length=465

 Score =   382 bits (980),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 210/427 (49%), Positives = 279/427 (65%), Gaps = 44/427 (10%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             ++L E+W +I G K+WEGLL+PM+  LR E+IRYGE AQACYD+FD++P S++CGTC+++
Sbjct  77    KDLSEMWRQIHGEKNWEGLLDPMDPLLRSEVIRYGELAQACYDAFDYEPFSRFCGTCRFE  136

Query  589   GAQFFEKLGMADRGYRISRYLYATSNIN-LPNFFQHSSVNRIWSQHANWMGYVAVATDEA  765
               +FF  LGM   GY+++RY++ T+N + L  +  HS     WS+  NW GYVAV +D+A
Sbjct  137   EEKFFSSLGMTHHGYKVTRYIHLTANTDFLLKWLIHSKWPTAWSK-VNWGGYVAV-SDDA  194

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  933
               RRLGRRDIVIAWRGT T+LEW+ D K  L P   +     D  +K+++GF D+YT   
Sbjct  195   TSRRLGRRDIVIAWRGTATHLEWVEDFKTSLTPVSSKGIPCHDDGVKVDNGFLDMYTG--  252

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNV  1113
             KD    +C +SAR+ +L EV RL++ Y  E +SITVTGHSLG+ALA+LSAYDI E  ++ 
Sbjct  253   KDETSEYCQHSARDHVLREVKRLMDMYSEEEVSITVTGHSLGSALAILSAYDIVEKGLD-  311

Query  1114  VQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1293
                             +PVSV SF+GP VGN  FK R + LG+KVLR++N  D VP +  
Sbjct  312   --------------RGVPVSVMSFSGPAVGNKSFKNRLNRLGVKVLRVINENDWVPWLSP  357

Query  1294  IIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
              +                  P+SY HVG EL LD++ SPFLK   D  CAHNLE  LHL+
Sbjct  358   WLP-----------------PFSYCHVGEELKLDNNKSPFLK--PDNNCAHNLEVLLHLL  398

Query  1474  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1653
             DGYHG+   F  A+ RD ALVNK  +FLK  + VPP W QDENKG+ R+SDGRWV PER+
Sbjct  399   DGYHGERGEFMLASDRDHALVNKGGDFLKESYLVPPNWWQDENKGLKRSSDGRWVQPERT  458

Query  1654  -RIEAHP  1671
               ++ +P
Sbjct  459   IEVDGYP  465



>ref|XP_002441042.1| hypothetical protein SORBIDRAFT_09g019276 [Sorghum bicolor]
 gb|EES19472.1| hypothetical protein SORBIDRAFT_09g019276 [Sorghum bicolor]
Length=478

 Score =   381 bits (978),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 207/366 (57%), Positives = 250/366 (68%), Gaps = 20/366 (5%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
              L   W EI G  DW GLL+PM+  LR E+IRYGE AQACYD+FD+DP S+YCG+CKY  
Sbjct  122   ELRRRWREIHGCDDWAGLLDPMDPLLRSELIRYGELAQACYDAFDYDPSSRYCGSCKYPR  181

Query  592   AQFFEKLGMAD--RGYRISRYLYATSNINLPNFFQHSSVN-RIWSQHANWMGYVAVATDE  762
              + F +LGM D  RGY +SRYL+ATSNI  PNFF  S    RIWSQ ANW+GYVAV+TD 
Sbjct  182   RELFSRLGMPDAARGYAVSRYLFATSNIRFPNFFPQSRAGARIWSQSANWIGYVAVSTD-  240

Query  763   AEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR----DDPDIKIESGFFDLYTNS  930
             AE   LGRRDI IAWRGTVT LEW+ DL + L P        DDP++K+ +GF DLYT+ 
Sbjct  241   AETALLGRRDIAIAWRGTVTRLEWVSDLMDFLRPVAEEGIPCDDPEVKVLAGFVDLYTD-  299

Query  931   KKDTDCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMK  1104
              +D  C FC YSAR+Q+LAEV RL+ RY   GE++SITVTGHSLG+ALA+LSAYDIAE  
Sbjct  300   -RDPGCRFCKYSARQQVLAEVRRLVARYAAAGEDVSITVTGHSLGSALAMLSAYDIAETG  358

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVP  1281
              NV     G  ++       PV V+SF GPRVGN  FK R + ELG+K LR+VNV D V 
Sbjct  359   ANVGVGVGGVGTAA------PVCVYSFGGPRVGNAAFKRRFETELGVKALRVVNVHDNVT  412

Query  1282  TVPGIIANEKF-QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1458
              +PGI+ NE   +  +++   +   PW Y HVGVEL LDH  SPFLK   D  C H+LE 
Sbjct  413   RMPGILLNEGAPEVVRRVAEGMLRLPWCYTHVGVELRLDHKRSPFLKDTLDPACYHDLEA  472

Query  1459  HLHLVD  1476
             HLHL+D
Sbjct  473   HLHLID  478



>ref|XP_006576920.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X2 [Glycine max]
Length=422

 Score =   377 bits (969),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 197/358 (55%), Positives = 252/358 (70%), Gaps = 19/358 (5%)
 Frame = +1

Query  421   EIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQF  600
             E+W +I G  +W GLL+PM+  +R E+ RYGE AQACYD+FDFDP+SKYCG+C++   +F
Sbjct  69    EVWRKIHGEDNWAGLLDPMDPVMRGELTRYGEMAQACYDAFDFDPYSKYCGSCRFPLPEF  128

Query  601   FEKLGMADRGYRISRYLYATSNINLPNFFQHSS-VNRIWSQHANWMGYVAVATDEAEIRR  777
             F+ LGM + GY ++RYLYAT NINLPNFF+ S   +++WS+HANW G++AV+ DE   +R
Sbjct  129   FDSLGMTNVGYTMTRYLYATGNINLPNFFRKSRWPHKMWSKHANWAGFIAVSDDETS-KR  187

Query  778   LGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR---DDPDIKIESGFFDLYTNSKKDTDC  948
             LGRRDIVI+WRGTVT++EW+ DL N L P        D  +K+E+GF DLYT+  ++  C
Sbjct  188   LGRRDIVISWRGTVTHVEWVADLLNFLKPISPDIPCSDRKVKVEAGFLDLYTD--REPGC  245

Query  949   NFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
              +C YSAREQ+L EV RL+E+Y  E +S+T+ GHSLG+A+A+LSA+DI E  VNV +   
Sbjct  246   GYCKYSAREQVLGEVKRLMEKYADEEVSVTIAGHSLGSAMAILSAFDIVETGVNVGK---  302

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPTVPGIIAN  1305
                       K  VSVFSF+GPRVGN+RFKER + ELGIKVLR+ N  D VP  PG+I N
Sbjct  303   -------DGRKAHVSVFSFSGPRVGNVRFKERLEGELGIKVLRVHNAHDMVPQSPGLIFN  355

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDG  1479
             E    Q  L+     FPW Y HVG EL LDH  SPFL    D  CAHNLE HLHL+DG
Sbjct  356   ED-SPQWLLKLVEGWFPWCYLHVGEELQLDHKKSPFLNPDGDASCAHNLEAHLHLLDG  412



>emb|CBI16352.3| unnamed protein product [Vitis vinifera]
Length=497

 Score =   377 bits (969),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 183/233 (79%), Positives = 209/233 (90%), Gaps = 2/233 (1%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L ++W EIQG  +WEGLL+PMN +LR+EIIRYGEFAQACYDSFDFDPHSKYCGTCKY GA
Sbjct  102   LRDVWEEIQGCNNWEGLLDPMNPNLRKEIIRYGEFAQACYDSFDFDPHSKYCGTCKYQGA  161

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
              FF+KL MADRGY+ISRYLYATSNINLPNFFQ S ++ +WS HANWMGY+AV TDE EI+
Sbjct  162   HFFQKLDMADRGYQISRYLYATSNINLPNFFQKSKMSSVWSPHANWMGYIAVTTDEKEIK  221

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  954
             RLGRRDI+IAWRGTVTYLEWIHDLK+IL P HFRDDP+IKIESGF+DLYT  KK+ +C F
Sbjct  222   RLGRRDIIIAWRGTVTYLEWIHDLKDILCPAHFRDDPNIKIESGFYDLYT--KKENNCKF  279

Query  955   CSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNV  1113
             CS+SAREQ+LAE+ RL+ERYK E +SIT+TGHSLGAALALLSAYDIAEM +NV
Sbjct  280   CSFSAREQVLAEIKRLVERYKDEEISITITGHSLGAALALLSAYDIAEMNLNV  332


 Score =   197 bits (500),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = +1

Query  1330  LETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRS  1509
             +E T+ +FPWSYAHVGVELALDH++SPFLK   DLGCAHNLE HLHLVDGYHG  R+F  
Sbjct  343   IEETI-SFPWSYAHVGVELALDHTHSPFLKPTNDLGCAHNLEAHLHLVDGYHGKDRKFSL  401

Query  1510  ATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPPDTGHH  1689
             AT RDIALVNK  +FL+ E+GVP  WRQDENKGMVR SDGRWV+PER R+EAHPPDT HH
Sbjct  402   ATKRDIALVNKSCDFLRSEYGVPGNWRQDENKGMVRASDGRWVLPERPRMEAHPPDTAHH  461



>ref|XP_006489506.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Citrus 
sinensis]
Length=444

 Score =   371 bits (953),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 197/363 (54%), Positives = 246/363 (68%), Gaps = 23/363 (6%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             R L +IW +I G  DW+G+L+P++  LR E+IRYGE  QAC+D+FDF+P SKYCG+CKY 
Sbjct  87    RKLADIWHDIHGVDDWDGMLDPLDPLLRSELIRYGEMVQACHDAFDFEPFSKYCGSCKYA  146

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
              ++FFE LGMA  GY+++ Y++AT NINLPN FQ S     WS  ANW+GY+AV+ DE  
Sbjct  147   PSEFFECLGMAQHGYQVNSYIHATYNINLPNIFQRSLRPDAWSHTANWIGYIAVSNDEMS  206

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKK  936
                LGRRDI IAWRGT T L WI D    L P   +     DP +K+ESGF +LYTN  K
Sbjct  207   -AHLGRRDITIAWRGTKTKLAWIADFMYFLRPVTLKKIPCPDPRVKVESGFLNLYTN--K  263

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
                   C  SARE +L EV RL+ +Y+ ENLSIT+TGHSLG+ALA+LSAYDIAE  V+V+
Sbjct  264   SQSSQICKRSAREHVLEEVRRLVSQYQNENLSITITGHSLGSALAILSAYDIAETGVDVM  323

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
              +G+           +P+ VFSFAGPRVGN  FKER  +LG+KVLR+VN+ DK+P  PG+
Sbjct  324   DDGQA----------VPICVFSFAGPRVGNTWFKERFAQLGVKVLRVVNIHDKIPEAPGL  373

Query  1297  IANEKF--QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1470
               NE      +K  E +L    W Y+HVG EL LDH  SPFLK   DL C HNLE HLHL
Sbjct  374   FLNEHIPPMLRKLGEASL----WFYSHVGAELTLDHKSSPFLKETNDLACYHNLEAHLHL  429

Query  1471  VDG  1479
             +DG
Sbjct  430   LDG  432



>ref|XP_003518893.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Glycine 
max]
Length=466

 Score =   367 bits (943),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 206/427 (48%), Positives = 274/427 (64%), Gaps = 43/427 (10%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             ++L E+W +I G K+WEGLL PM+  LR E+IRYGE AQAC+D+FD++P S+YCGTC+++
Sbjct  77    KDLSEMWRQIHGEKNWEGLLEPMDPLLRSEVIRYGELAQACHDAFDYEPFSRYCGTCRFE  136

Query  589   GAQFFEKLGMADRGYRISRYLYATSNIN-LPNFFQHSSVNRIWSQHANWMGYVAVATDEA  765
               +FF  LGM   GY+++RY++ T+N + L  +  HS          NW GYVAV+ D+ 
Sbjct  137   EEKFFSSLGMTHHGYKVTRYIHLTANTDFLLKWLIHSKWPTAMGSKVNWGGYVAVSNDDT  196

Query  766   EIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSK  933
               R LGRRDIVIAWRGT T+LE   DL++ L P   +     D  +K+++GF D+YT   
Sbjct  197   S-RCLGRRDIVIAWRGTTTHLEGEKDLRSSLTPVSSKGIPCHDDGVKVDNGFLDMYTG--  253

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNV  1113
             KD    +C +SAR+ +L EV RL++ Y  E +SITVTGHSLG+ALA+LSAYDI E  ++ 
Sbjct  254   KDETSEYCQHSARDHVLREVKRLMDMYSEEEVSITVTGHSLGSALAILSAYDIVEKGLD-  312

Query  1114  VQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1293
                             +PVSV SF+GP VGN  F +R  +LGIKVLR++N  D VP    
Sbjct  313   --------------RGVPVSVMSFSGPAVGNKSFHKRLKKLGIKVLRVINANDWVPWF--  356

Query  1294  IIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
                            +L   P+ Y HVGVEL LD++ SPFLK   D+ CAHNLE  LHL+
Sbjct  357   ---------------SLWLPPFQYYHVGVELKLDNNKSPFLK--HDVDCAHNLEVLLHLL  399

Query  1474  DGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1653
             DGYHG+   F  A+ RD ALVNK  +FLK  + VPP W QDENKG+ R+SDGRWV PER+
Sbjct  400   DGYHGERGEFMLASDRDHALVNKGGDFLKESYLVPPNWWQDENKGLKRSSDGRWVQPERT  459

Query  1654  -RIEAHP  1671
               ++ +P
Sbjct  460   IEVDGYP  466



>ref|XP_010685025.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=496

 Score =   367 bits (943),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 197/416 (47%), Positives = 267/416 (64%), Gaps = 30/416 (7%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             ++ E W E  G  DW+  L+P++  LRRE+++YGEFAQA YD+FDFDP+S+YCG+C+Y+ 
Sbjct  88    DISEKWQEFHGFNDWDSHLDPLHPSLRRELVKYGEFAQATYDAFDFDPYSEYCGSCRYNR  147

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + FEK+G+   GY +++Y+YATS I+LP + + S V   WS H+NWMG+V V+ DE E 
Sbjct  148   NKLFEKVGLTRHGYNVTKYIYATSQIDLPQWLEKSQVAETWSTHSNWMGFVGVSDDE-ES  206

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDL-KNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
             +R+GRRDIV+AWRGTV+  EW  DL +N+    H     D K+E GF  +YT+  + +  
Sbjct  207   QRIGRRDIVVAWRGTVSVSEWYEDLQRNLERFGH----GDAKVEEGFLSIYTSKCQSSRY  262

Query  949   NFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
             N    SA EQ++ E+ RLI  YK  GE +S+T+TGHSLG ALALL+AY+ A + VNV   
Sbjct  263   N--KTSASEQVMTELARLIRFYKKRGEEVSLTITGHSLGGALALLNAYEAAAIFVNV---  317

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
                           P+SV SFA PRVGN  F++   ELG+K LR+V  +D VP +PG++ 
Sbjct  318   --------------PISVISFAAPRVGNSGFRDELHELGVKTLRVVIKQDVVPWMPGMVF  363

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             NE+ Q     E   +   W Y HVGVEL LD   SP+LK G  L   H LE +LHL+DG+
Sbjct  364   NERLQ---NFEEITRGLEWVYTHVGVELRLDARSSPYLKRGLQLQGHHMLETYLHLLDGF  420

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                   FR    RDIALVNK+ + L  E  +PPRW Q  NKG+V+ + GRWV P+R
Sbjct  421   GSSKLPFRHNARRDIALVNKECDLLINELRIPPRWYQASNKGLVQNAHGRWVKPKR  476



>ref|XP_009362274.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=519

 Score =   364 bits (934),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 198/416 (48%), Positives = 268/416 (64%), Gaps = 29/416 (7%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             N+ E W EI GS DWEGLL+P++  +RREI++YGEFAQA YD+FDFD  S+YCG+C+Y+ 
Sbjct  94    NISEKWREIHGSNDWEGLLDPLHPWIRREIVKYGEFAQATYDAFDFDFFSEYCGSCRYNK  153

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + F+ LG+   GY +S+Y+YA S+I++P + + S +   WS+H+NWMGYVAV +DE E 
Sbjct  154   NKLFDVLGLDKNGYNVSKYIYAMSHIDMPQWLERSHLADTWSKHSNWMGYVAV-SDEEET  212

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
             RR+GRRDIV+AWRGTV   EW  D++  L P       D K+E GF  +YT +K DT   
Sbjct  213   RRIGRRDIVVAWRGTVVPSEWYEDMQRKLEPI---GGGDAKVEHGFHGIYT-AKSDT-TR  267

Query  952   FCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
             +   SA EQ++ EV RL+E Y  KGE +S+T+TGHSLG ALAL++AY+ AE         
Sbjct  268   YNKSSASEQVMKEVTRLVELYQAKGEEVSLTITGHSLGGALALVNAYEAAE---------  318

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                         +P+SV SF  PRVGN+ FKE   ++G+K LR+V  +D VP +PG++ N
Sbjct  319   --------KLPGLPISVISFGAPRVGNIAFKEELHQMGVKTLRVVVKQDMVPKMPGLVLN  370

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGT-DLGCAHNLEGHLHLVDGY  1482
             E  Q    +  TL    W Y HVG EL L+  +SP+LK G  +L   H+LE +LHLVDG+
Sbjct  371   ESLQKFDDITGTLD---WVYTHVGAELKLEVGFSPYLKRGGFNLPGFHSLETYLHLVDGF  427

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                   FRS   RDIALVNK  + L  +  +P  W Q  +KG+VR + GRWV P+R
Sbjct  428   LSTETTFRSNARRDIALVNKGCDMLVDDLRIPQCWYQLPHKGLVRNAHGRWVKPKR  483



>emb|CDO99150.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   361 bits (926),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 209/419 (50%), Positives = 270/419 (64%), Gaps = 21/419 (5%)
 Frame = +1

Query  238   SNNSFFP-LNPHYSSLKCRVSLPAAAINAPPQRETGQSSNKNdeeqeedeelcveedGRN  414
             S NSFFP +    S+ K  V+      N  P R +     K  +E +E+     +E  + 
Sbjct  29    SRNSFFPGVVERGSARKSLVTTKVVPKNDSPIRVSDPERMK-AKEGDEERVALTKEPKKK  87

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L + W EIQG  DW G+L+P++  LR E+IRYG+ AQACYD+++FDP+SKYCG+CK   +
Sbjct  88    LADAWREIQGQNDWAGMLDPLDPLLRAELIRYGDMAQACYDAYEFDPYSKYCGSCKVKPS  147

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
              FFE LG     Y ++ Y+Y+T N+N P FF  S     WS  ANW+GYVAV+ +E   +
Sbjct  148   MFFENLGWKKCSYEVTSYIYSTYNVNFPKFFNVSLNPDGWSHSANWIGYVAVSNEEYS-K  206

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKDT  942
              LGRRDI+IAWRGTVT  E I DL +  +PT +      DP IK+E+GF DLY    ++ 
Sbjct  207   YLGRRDIMIAWRGTVTNAEKIADLMDFQNPTTYHTIPSRDPTIKVEAGFLDLYAG--RNV  264

Query  943   DCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
             DC +C YSAREQ+LAEV RL E Y GE LSIT+TGHSLG+ALA L+AYDIAE+ ++V+++
Sbjct  265   DCQYCKYSAREQVLAEVKRLKELYPGEELSITITGHSLGSALATLNAYDIAEIGLDVMED  324

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
             G            IPV+VFSF+GPRVGN RFKER + LG+K+LRI NV D+VP VPGI  
Sbjct  325   GRV----------IPVTVFSFSGPRVGNARFKERLEGLGVKILRIFNVHDQVPKVPGIFL  374

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDG  1479
             NE     K L+      PW Y HVG EL L+H  SPFLK  ++L   HNLE  LHL+DG
Sbjct  375   NELV--PKVLQQLGGWLPWCYFHVGEELPLNHENSPFLKDESNLVFFHNLEVLLHLLDG  431



>ref|XP_009614944.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=404

 Score =   358 bits (919),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 195/362 (54%), Positives = 246/362 (68%), Gaps = 23/362 (6%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             + E W +I G  DWEG+L+P+N  LR E+IRYGE AQACYD+F  D  SK+CG+CK D  
Sbjct  57    IAEKWKDIHGQNDWEGMLDPINPLLRAELIRYGEMAQACYDAFHLDQDSKFCGSCKIDPG  116

Query  595   QFFEKLGM-ADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              FF+ LG+ A+ GY ++ Y+Y+  +IN+P+FF+       WS  ANW+GYVAV+ DE   
Sbjct  117   LFFQSLGLSANHGYNVTSYIYSMYHINIPSFFKVPLWPDAWSHKANWIGYVAVSNDEYS-  175

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD----DPDIKIESGFFDLYTNSKKD  939
               LGRRDI IAWRGTVT LE I D  +   PT +      DP IK+E+GF ++YT+  KD
Sbjct  176   THLGRRDITIAWRGTVTDLEKIADFMDFQKPTRYHKIPSRDPTIKVEAGFLEIYTS--KD  233

Query  940   TDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1119
              +CNFC  SAREQ+LAEV RLI+RY  E +SIT+TGHSLG+ALA ++AYDIAE+ ++V +
Sbjct  234   DECNFCKVSAREQVLAEVKRLIDRYSNEEISITITGHSLGSALATINAYDIAEIGLDVRE  293

Query  1120  egegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGII  1299
             +G            IP+ VFSF+GPRVGN+RFK+R + LG+KVLR+VN  DKVP VPGI 
Sbjct  294   DGRV----------IPICVFSFSGPRVGNIRFKQRLEGLGVKVLRVVNKHDKVPAVPGIF  343

Query  1300  ANEKFQ--YQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
              NE      QK  E  L   PW Y HVG EL LDH  SPFLK   +L   HNLE HLHL+
Sbjct  344   LNENVPTFVQKVGELFL---PWCYLHVGEELVLDHKTSPFLKDIDNLTYFHNLEVHLHLL  400

Query  1474  DG  1479
             DG
Sbjct  401   DG  402



>ref|XP_008371801.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Malus 
domestica]
 ref|XP_008371802.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Malus 
domestica]
 ref|XP_008371803.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Malus 
domestica]
Length=518

 Score =   362 bits (928),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 196/415 (47%), Positives = 266/415 (64%), Gaps = 29/415 (7%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             + E W EI GS DWEGLL+P++  LRREI++YGEFAQA YD+FDFD  S+YCG+C+Y+ +
Sbjct  92    ISEKWREIHGSNDWEGLLDPLHPWLRREIVKYGEFAQATYDAFDFDSFSEYCGSCRYNKS  151

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             + F+ LG+   GY +S+Y+YA S+I++P + + S +   WS+H+NWMGYVAV+ DE E R
Sbjct  152   KLFDVLGLDKNGYNVSKYIYAMSHIDMPQWLERSHLADTWSKHSNWMGYVAVSDDE-ETR  210

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  954
             R+GRRDIV+AWRGTV   EW  D++  L P       D K+E GF  +YT +K DT   +
Sbjct  211   RIGRRDIVVAWRGTVVPSEWYEDMQRKLEPI---GGGDAKVEHGFHGIYT-AKSDT-TRY  265

Query  955   CSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
                SA EQ++ EV RL+E Y  KGE +S+T+TGHSLG ALALL+AY+ AE          
Sbjct  266   NRSSASEQVMKEVTRLVELYQAKGEEVSLTITGHSLGGALALLNAYEAAE----------  315

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1308
                        +P+SV SF  PRVGN+ FKE   ++G+  LR+V  +D VP +PG++ NE
Sbjct  316   -------KLPGLPISVISFGAPRVGNIAFKEELHQMGVNTLRVVVKQDMVPKMPGLVLNE  368

Query  1309  KFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGT-DLGCAHNLEGHLHLVDGYH  1485
                  K+ +       W Y HVG EL L+  +SP+LK G  +L   H+LE +LHLVDG+ 
Sbjct  369   SL---KKFDDITGTLDWVYTHVGAELKLEVGFSPYLKRGGFNLQGFHSLETYLHLVDGFF  425

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                  FRS   RDIALVNK  + L  +  +P  W Q  +KG+VR + GRWV P+R
Sbjct  426   STDTTFRSNARRDIALVNKGCDMLVDDLRIPQCWYQLPHKGLVRNAHGRWVKPKR  480



>ref|XP_008371806.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Malus 
domestica]
Length=519

 Score =   360 bits (924),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 198/415 (48%), Positives = 266/415 (64%), Gaps = 29/415 (7%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             + E W EI GS DWEGLL+P++  LRREI++YGEFAQA YD+FDFD  S+YCG+C+Y+  
Sbjct  95    ISEKWREIHGSNDWEGLLDPLHPWLRREIVKYGEFAQATYDAFDFDSFSEYCGSCRYNKN  154

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             + F+ LG+   GY +S+Y+YA S+I++P + + S +   WS+H+NWMGYVAV +DE E R
Sbjct  155   KLFDVLGLDKNGYNVSKYIYAMSHIDMPQWLERSHLADTWSKHSNWMGYVAV-SDEEETR  213

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  954
             R+GRRDIV+AWRGTV   EW  D++  L P       D K+E GF  +YT +K DT   +
Sbjct  214   RIGRRDIVVAWRGTVAPSEWYEDMQRKLEPI---GSGDAKVEHGFHGIYT-AKSDT-TRY  268

Query  955   CSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
                SA EQ++ EV RL+E Y  +GE +S+T+TGHSLG ALALL+AY+ AE          
Sbjct  269   NRSSASEQVMKEVARLVELYQARGEEVSLTITGHSLGGALALLNAYEAAE----------  318

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1308
                        +P+SV SF  PRVGN+ FKE   ++G+K LR+V  +D VP +PG++ NE
Sbjct  319   -------KLPGLPISVISFGAPRVGNIAFKEELHQMGVKTLRVVVKQDMVPKMPGLVLNE  371

Query  1309  KFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGT-DLGCAHNLEGHLHLVDGYH  1485
               Q    +  TL    W Y HVG EL L+   SP+LK G  +L   H+LE +LHLVDG+ 
Sbjct  372   SLQKFDDITGTLD---WVYTHVGAELKLEVGSSPYLKHGRFNLPGFHSLETYLHLVDGFF  428

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                  FRS   RDIALVNK  + L  +  +P  W Q  +KG+VR + GRWV P+R
Sbjct  429   STETTFRSNARRDIALVNKGCDMLVDDLKIPQCWYQLPHKGLVRNAHGRWVKPKR  483



>ref|XP_006827274.1| hypothetical protein AMTR_s00010p00263480 [Amborella trichopoda]
 gb|ERM94511.1| hypothetical protein AMTR_s00010p00263480 [Amborella trichopoda]
Length=450

 Score =   357 bits (915),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 193/416 (46%), Positives = 268/416 (64%), Gaps = 26/416 (6%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             +++HE W EI GS  W+GLLNP++  L+REII+YGE AQA YD+FDFD  S YCG+C+Y 
Sbjct  43    QDIHERWQEIHGSNHWQGLLNPLHPWLQREIIKYGELAQATYDAFDFDCFSHYCGSCRYS  102

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
              ++ F+KLG+   GY++++YLYA S+++LP+    S     WS+ +NWMGYVAV +D+ E
Sbjct  103   PSRLFQKLGLTRCGYKVTKYLYAMSHVDLPHLLNRSLTGNKWSRDSNWMGYVAV-SDDNE  161

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
              +R+GRRD+++AWRGTVT LEW+ +++  L     + D D+K+E GF  ++ +  + T  
Sbjct  162   SQRIGRRDVIVAWRGTVTPLEWVENIQERLESIE-QHDVDVKVEHGFLSIFRSKSEATRY  220

Query  949   NFCSYSAREQLLAEVNRLIE--RYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
             N    SA EQ + E+ R++   R +GE +S+T+TGHSLG ALALL+AY+ A  +++    
Sbjct  221   N--KSSACEQAMREIERVVSFHRERGEGVSLTITGHSLGGALALLNAYEAAISQLD----  274

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
                          IP++VFSFA PRVGN  F++R   LG K LR+V  +D VP +PGI+ 
Sbjct  275   -------------IPIAVFSFAAPRVGNTAFRDRLKHLGAKTLRVVIKQDVVPKMPGIVF  321

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             NE     K+ E    +  W Y H+G EL+LD S SPFLK   +    H+LE +LHLVDGY
Sbjct  322   NEGM---KKFEEITGSLQWMYTHLGEELSLDVSSSPFLKHAWNPIGFHSLETYLHLVDGY  378

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                   F  A  RDIALVNK  N +  E  +PP W Q  NKG+V+ S GRWV PER
Sbjct  379   SSQNEPFSHAAKRDIALVNKACNMVVDELRIPPCWHQLANKGLVQNSYGRWVHPER  434



>ref|XP_009399031.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=483

 Score =   357 bits (917),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 194/415 (47%), Positives = 264/415 (64%), Gaps = 26/415 (6%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             ++  ++ EI G  DW  LLNP++  LRREII+YGEFAQA YD+FDF+P S++CG+C Y  
Sbjct  78    DIFSLFPEIHGHADWSPLLNPLHPWLRREIIKYGEFAQATYDAFDFNPLSEFCGSCLYGR  137

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              +  +KLG+A  GYR+S+Y+YA S++ LP + + S     WS  +NWMGYVAV +D+AE 
Sbjct  138   HRLLDKLGLARNGYRVSKYVYAMSHVKLPRWLERSLHADAWSTESNWMGYVAV-SDDAES  196

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
             RR+G RDIV+AWRGT+   EW  D++  L P       D+ +E GF  +YT+    T  N
Sbjct  197   RRIGCRDIVVAWRGTIAPTEWFKDVQGKLEPLG-DARADVMVEHGFLGVYTSKSDRTRYN  255

Query  952   FCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
                 SA EQ++ E+ RL+  Y  +GE +S+T+TGHSLG ALALL+A++ A    +     
Sbjct  256   --KTSASEQVMEEIERLVSHYRQRGEEVSLTITGHSLGGALALLNAHEAASTIPD-----  308

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                         +P+SV SF GPRVGN+ F E+  E+ +KVLR+V  +D VP VPGI+ N
Sbjct  309   ------------LPISVISFGGPRVGNVAFGEKLKEMNVKVLRVVVKQDMVPKVPGILFN  356

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYH  1485
             E  +  + +  TL++    Y HVG+EL LD S SP+LK G D+   H LE +LHLVDG+ 
Sbjct  357   EGLKRFEHVTGTLESV---YTHVGLELGLDVSSSPYLKHGLDVAGFHKLETYLHLVDGFL  413

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                + FR    RD+ALVNK S  L+ E  +PPRW Q  NKGMVR + GRWV P R
Sbjct  414   SSDKEFRRNARRDVALVNKTSGMLRDELHIPPRWAQAANKGMVRNAYGRWVKPAR  468



>ref|XP_008371821.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Malus 
domestica]
Length=516

 Score =   358 bits (919),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 198/415 (48%), Positives = 265/415 (64%), Gaps = 29/415 (7%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             + E W EI GS DWEGLL+P++  LRREI++YGEFAQA YD+FDFD  S+YCG+C+Y+  
Sbjct  90    MSEKWREIHGSNDWEGLLDPLHPWLRREIVKYGEFAQATYDAFDFDSFSEYCGSCRYNKN  149

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             + F+ LG+   GY +S+Y+YA S+I++P + + S +   WS+H+NWMGYVAV+ DE E R
Sbjct  150   KLFDVLGLDKNGYNVSKYIYAMSHIDMPQWLERSHLADTWSKHSNWMGYVAVSDDE-ETR  208

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  954
             R+GRRDIV+AWRGTV   EW  D++  L P       D K+E GF  +YT +K DT   +
Sbjct  209   RIGRRDIVVAWRGTVVPSEWYEDMQRKLEPI---GSGDAKVEHGFHGIYT-AKSDT-TRY  263

Query  955   CSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
                SA EQ++ EV RL+E Y  KGE +S+T+TGHSLG ALALL+AY+ AE    ++    
Sbjct  264   NKSSASEQVMKEVTRLVELYQAKGEEVSLTITGHSLGGALALLNAYEAAEKLPGIM----  319

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1308
                          +SV SF  PRVGN+ FKE   ++G+K LR+V  +D VP +PG++ NE
Sbjct  320   -------------ISVISFGAPRVGNIAFKEELHQMGVKTLRVVVKQDMVPKMPGLVLNE  366

Query  1309  KFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLK-TGTDLGCAHNLEGHLHLVDGYH  1485
               Q    +  TL    W YAHVG EL L+   SP+LK  G +L   H+LE +LHLVDG+ 
Sbjct  367   SLQKFDDITGTLD---WVYAHVGAELKLEIGSSPYLKHGGFNLPGFHSLETYLHLVDGFL  423

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                  FRS   RDI LVNK  + L  +  +P  W Q  +KG+VR   GRWV P+R
Sbjct  424   STETTFRSNARRDITLVNKGCDMLVDDLRIPQCWYQLPHKGLVRNVHGRWVKPKR  478



>ref|XP_010940258.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Elaeis 
guineensis]
Length=505

 Score =   357 bits (916),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 194/415 (47%), Positives = 259/415 (62%), Gaps = 26/415 (6%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             ++  + +E+ GS DW  LLNP++  LRREI++YGEFAQA YD+FDF+P S+YCG+C Y+ 
Sbjct  97    DVSSLCSELHGSGDWSHLLNPLHRWLRREIVKYGEFAQATYDAFDFNPFSEYCGSCLYNR  156

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + F+ LG+A  GY +++Y+YA S+I LP + + S     WS+ +NWMGYVAV +D+ E 
Sbjct  157   RRLFDNLGLAKNGYNVTKYIYAMSHIELPRWLERSIRADTWSKDSNWMGYVAV-SDDTES  215

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
             RR+G RDIV+AWRGT+   EW  DL+  L  +   D  D+K+E GF  +YT+    T  N
Sbjct  216   RRIGCRDIVVAWRGTIAPAEWFEDLQGKLQ-SLGSDHGDVKVEHGFLSIYTSKSDATRYN  274

Query  952   FCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
                 SA EQ++ E+ RL+  Y  KGE +S+T+TGHSLG ALALL+AY+ A          
Sbjct  275   --KSSASEQVMEEIKRLVSFYREKGEQVSLTITGHSLGGALALLNAYEAAS---------  323

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                     A   +PVSV SF  PRVGN+ F E+  E+ +K LR+V  +D VP +PGI+ N
Sbjct  324   --------AIPYLPVSVISFGAPRVGNIAFGEKLKEMEVKTLRVVVKQDLVPKMPGILFN  375

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYH  1485
             E     K+ E       W Y HVG+EL LD   SP+LK G D+   HNLE +LHLVDGY 
Sbjct  376   EGI---KKFENVTGTLDWVYTHVGLELGLDVRSSPYLKKGLDVPGFHNLEAYLHLVDGYL  432

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                  FR    RD+ LVNK S  L+ E  +PP W Q  NKG+V  S GRWV P+R
Sbjct  433   SSDTEFRLDAKRDVVLVNKASGMLREELRIPPCWYQSANKGLVCNSYGRWVQPQR  487



>ref|XP_008784887.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Phoenix dactylifera]
Length=499

 Score =   355 bits (911),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 200/454 (44%), Positives = 269/454 (59%), Gaps = 43/454 (9%)
 Frame = +1

Query  295   SLPAAAINAPPQRETGQSSNKNdeeqeedeelcveedGRNLHEIWAEIQGSKDWEGLLNP  474
             SL + A+  P  R T   S K                  ++  + +E+ G  DW  LLNP
Sbjct  74    SLESLAVALPADRRTPTESPKE-----------------DVSSLCSELHGPGDWSRLLNP  116

Query  475   MNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYLY  654
             ++  LRREI++YGEFAQA YD+FDF+P S++CG+C Y   + F+KLG+A  GY +S+Y+Y
Sbjct  117   LHRWLRREIVKYGEFAQATYDAFDFNPFSEHCGSCLYCRRRLFDKLGLAKNGYDVSKYIY  176

Query  655   ATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLEW  834
             A S+I LP + + S     WS+ +NWMGYVAV +D+ E  R+G RDIV+AWRGT+   EW
Sbjct  177   AMSHIELPRWLERSIHADTWSKDSNWMGYVAV-SDDTESHRIGCRDIVVAWRGTIAPAEW  235

Query  835   IHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNRLIERY  1014
               DL+  L P    D  D+++E GF  +YT+    T  N    SA EQ++ E+ RL+  Y
Sbjct  236   FGDLQGKLEPLG-SDHGDVRVEHGFLSIYTSKSDATRYN--KSSASEQVMEEIKRLVSFY  292

Query  1015  --KGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegessstsaatKIPVSVFSFA  1188
               KGE +S+T+TGHSLG ALALL+AY+ A    +                 +PVSV SF 
Sbjct  293   REKGEQVSLTITGHSLGGALALLNAYEAASAVPD-----------------LPVSVISFG  335

Query  1189  GPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETTLKNFPWSYA  1368
              PRVGN+ F E+  ++ +K LR+V  +D VP +PGI+ NEK    K+ E       W Y 
Sbjct  336   APRVGNIAFGEKLKQMEVKTLRVVVKQDVVPKMPGILFNEKI---KKFENVTGTLEWVYT  392

Query  1369  HVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDS  1548
             HVG+EL LD   SP+LK G D+   H+LE +LHLVDGY      FR    RD+ALVNK S
Sbjct  393   HVGLELGLDVRSSPYLKKGLDIPGFHSLETYLHLVDGYLSSDTEFRVDAKRDVALVNKAS  452

Query  1549  NFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
               L+ E  +PP W Q  NKGM   S GRWV+P+R
Sbjct  453   GMLREELRIPPCWHQSANKGMACNSYGRWVLPQR  486



>ref|XP_009362273.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=519

 Score =   355 bits (910),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 194/415 (47%), Positives = 264/415 (64%), Gaps = 29/415 (7%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             + E W +I GS DWEGLL+P++  LRREI++YGEFAQA YD+FDF   S+YCG+C+Y+  
Sbjct  95    ISEKWRKIHGSNDWEGLLDPLHPWLRREIVKYGEFAQATYDAFDFVSFSEYCGSCRYNKN  154

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             + F+ LG+   GY +S+Y+YA S+I++P + + S +   WS+H+NWMGYVAV +DE E R
Sbjct  155   KLFDVLGLDKNGYNVSKYIYAMSHIDMPQWLERSHLADTWSKHSNWMGYVAV-SDEEETR  213

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  954
             R+GRRDIV+AWRGTV   EW  D++  L P       D K+E GF  +YT +K DT   +
Sbjct  214   RIGRRDIVVAWRGTVAPSEWYEDMQRKLEPI---GSGDAKVEHGFHGIYT-AKSDT-TRY  268

Query  955   CSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
                SA EQ++ EV RL+E Y  +GE +S+T+TGHSLG ALALL+AY+ AE          
Sbjct  269   NRSSASEQVMKEVARLVELYQARGEEVSLTITGHSLGGALALLNAYEAAE----------  318

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1308
                        +P+SV SF  PRVGN+ FKE   ++G+K LR+V  +D VP +PG++ NE
Sbjct  319   -------KLPGLPISVISFGAPRVGNIAFKEELHQMGVKTLRVVVKQDMVPKMPGLVLNE  371

Query  1309  KFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGT-DLGCAHNLEGHLHLVDGYH  1485
               Q   + +       W Y HVG EL L+   SP+LK G  +L   H+LE +LHLVDG+ 
Sbjct  372   SLQ---KFDDITGPLDWVYTHVGAELKLEVGSSPYLKRGGFNLPGFHSLETYLHLVDGFF  428

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                  FRS   RDIALVNK  + L  +  +P  W Q  +KG+VR + GRWV P+R
Sbjct  429   STETTFRSNARRDIALVNKGCDMLVDDLKIPQCWYQLPHKGLVRNAQGRWVKPKR  483



>gb|EYU19151.1| hypothetical protein MIMGU_mgv1a006227mg [Erythranthe guttata]
Length=452

 Score =   352 bits (903),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 184/415 (44%), Positives = 265/415 (64%), Gaps = 28/415 (7%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             ++ + W E  GS DW+ LL+P++  LRREI++YGEFAQA YD+FDFDP S+YCG+CKY+ 
Sbjct  40    DISDKWREFHGSSDWQNLLDPLHPSLRREIVKYGEFAQATYDAFDFDPFSEYCGSCKYNR  99

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + FEKLG+   GY +++Y++A S+I+LP + + S +   WS+ +NWMG+VAV +D+ E 
Sbjct  100   RKLFEKLGLTKNGYNVTKYVHAMSHIDLPQWLEKSHLVETWSKDSNWMGFVAV-SDDQES  158

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
             RR+GRRDIV++WRGTV   EW  +++  L P       D ++E GF  +YT+  K     
Sbjct  159   RRIGRRDIVVSWRGTVAPSEWYDNMQRKLEPI---GQGDARVEHGFLSIYTS--KSCTTR  213

Query  952   FCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
             +   SA EQ++AE+ +L++ Y+  GE +S+T+TGHSLG ALAL++AY+ A+         
Sbjct  214   YNKTSASEQVMAEIKKLVKFYENNGEQVSLTITGHSLGGALALINAYESAK---------  264

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                         +P+SV SFA PRVGN+ F++   ++G+K LR+ + +D VP +PG + N
Sbjct  265   --------NFPGLPISVVSFAAPRVGNIAFRDELYQMGVKTLRVTSKQDVVPRMPGFVLN  316

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYH  1485
             E  Q    +  TL+   W Y HVGVEL LD   SP+LK G +L   H LE +LHLVDG+H
Sbjct  317   ESLQRFDDITGTLE---WIYTHVGVELKLDVRSSPYLKKGLNLVGFHMLETYLHLVDGFH  373

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                  FR    RD+ALVNK+ + L  E  +P  W Q  NKG+++   GRWV P R
Sbjct  374   SSESGFRVEARRDVALVNKECDMLVDELRIPHSWYQSANKGLIQNHHGRWVKPVR  428



>emb|CDP21091.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   354 bits (908),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 194/418 (46%), Positives = 264/418 (63%), Gaps = 34/418 (8%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             ++ E W EI GS +W+ L++P++  LRREII+YGEFAQA YD+FDFDP S+YCG+C+Y+ 
Sbjct  95    DISEKWQEIHGSSEWDTLIDPLHPWLRREIIKYGEFAQATYDAFDFDPFSEYCGSCRYNR  154

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + F+KLG++  GY++S Y+YA S I+LP + + S +   WS+ +NWMG+VAV+ DE E 
Sbjct  155   HKIFDKLGLSKSGYKVSAYIYAMSQIDLPRWLERSQLVDTWSKDSNWMGFVAVSDDE-ES  213

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
             +R+GRRDIV+AWRGTV   EW  D +  L P     + D K+E GF  +YT     + C+
Sbjct  214   KRIGRRDIVVAWRGTVAATEWYEDFQRKLQPI---GEGDAKVEHGFLSIYT-----SKCD  265

Query  952   FCSY---SAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
             F  Y   SA EQ++ EV  L+  YK  GE +S+T+TGHSLG ALALL+AY+ A       
Sbjct  266   FTRYNKSSASEQVMKEVRNLVHFYKSRGEEVSLTITGHSLGGALALLNAYEAA-------  318

Query  1117  QegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGI  1296
                       ++   +PVSV SF  PRVGN+ F++   ++G+K LR+   +D VP +PGI
Sbjct  319   ----------ASFPGLPVSVISFGAPRVGNIAFRDELYQMGVKTLRVTIRQDFVPRMPGI  368

Query  1297  IANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVD  1476
             + NE  Q    L  TL+   W Y HVGVEL LD   SP+LK G +L   H LE +LHLVD
Sbjct  369   VFNESLQRFDDLTGTLE---WIYTHVGVELKLDIRSSPYLKRGFNLMGFHMLETYLHLVD  425

Query  1477  GYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             G+      +RS   RD ALVNK  + L  E  +PP W Q  NKG+   + GRWV P+R
Sbjct  426   GFLSTTSTYRSDARRDAALVNKACDMLIDELRIPPSWYQLANKGLQCNAHGRWVKPKR  483



>ref|XP_010655697.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Vitis 
vinifera]
Length=510

 Score =   353 bits (907),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 187/406 (46%), Positives = 262/406 (65%), Gaps = 28/406 (7%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W+EI GS DW+ LL+P+   LRREI++YGEFAQA YD+FDFD  S+YCG+C+Y+  + F+
Sbjct  94    WSEIHGSCDWDNLLDPLQPWLRREIVKYGEFAQATYDAFDFDSFSEYCGSCRYNQHKLFK  153

Query  607   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  786
             +LG+   GY +S+Y+YA S+I++P + + S +   WS+ +NWMGYVAV +D+ E RR+GR
Sbjct  154   ELGLEKNGYMVSKYIYAMSHIDVPQWLERSHLLDTWSKDSNWMGYVAV-SDDQESRRIGR  212

Query  787   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYS  966
             RDIV++WRGTV   EW  D +  L P       + K+E GF  +YT+ ++ +  N    S
Sbjct  213   RDIVVSWRGTVAPSEWYEDFQRKLEPV---GSGEAKVEHGFLSIYTSKRESSRYN--KSS  267

Query  967   AREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQegegess  1140
             A +Q++ EV RL++ YK  GE +S+T+TGHSLG ALALL+AY+ A               
Sbjct  268   ASDQVMKEVTRLVQLYKQRGEQVSLTITGHSLGGALALLNAYEAA---------------  312

Query  1141  stsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQY  1320
               ++   +P+SV SF  PRVGN+ F++   +LG+K LR+V  +D VP +PG++ NE+ Q 
Sbjct  313   --TSLPGLPISVISFGAPRVGNIAFRDELHQLGVKTLRVVVKQDMVPRMPGLVFNERLQK  370

Query  1321  QKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRR  1500
                +  TLK   W Y HVG EL LD   SP+LK G +L   H+LE +LHL+DG+H     
Sbjct  371   FDDITGTLK---WVYTHVGAELKLDVQSSPYLKRGFNLPGFHSLETYLHLIDGFHSKTST  427

Query  1501  FRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1638
             FR    RDIALVNK  + L  E  +P  W Q  NKG+VR + GRWV
Sbjct  428   FREGARRDIALVNKACDMLVDELRIPHAWYQFANKGLVRNAHGRWV  473



>ref|XP_010245170.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Nelumbo 
nucifera]
Length=534

 Score =   354 bits (908),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 196/416 (47%), Positives = 264/416 (63%), Gaps = 29/416 (7%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             ++ E W E+ G  DW+ LL+P++  LRREII+YGEF+QA YD+FDFD  S+YCG+C+Y+ 
Sbjct  97    DISEKWCELHGLTDWDNLLDPLHPWLRREIIKYGEFSQATYDAFDFDSFSEYCGSCRYNP  156

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSS-VNRIWSQHANWMGYVAVATDEAE  768
              +FFEKLG+   GY +S+Y+YA S+I++P + Q S+ V   WS+ +NWMG+VAV+  E E
Sbjct  157   KRFFEKLGLGKNGYVMSKYIYAMSHIDMPRWLQRSNLVEETWSKDSNWMGFVAVSNGE-E  215

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
              RR+GRRDIV+AWRGTV   EW  DL+  L P     D D+++E GF  +YT SK DT  
Sbjct  216   SRRIGRRDIVVAWRGTVAPSEWYEDLQRKLEPI---GDGDVRVEHGFLSIYT-SKCDT-T  270

Query  949   NFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
              +   SA EQ++ EV RL+  Y  +GE +S+T+TGHSLG AL LL+AY+ A         
Sbjct  271   RYNKSSASEQVMKEVRRLVSFYRERGEEVSLTITGHSLGGALGLLNAYEAAS--------  322

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
                      +   +P+SV SF  PRVGN+ F+E+  ++G+K LR+V  +D VP +PG++ 
Sbjct  323   ---------SLPGLPISVISFGAPRVGNVAFREKLQQMGVKTLRVVVKQDVVPKMPGLML  373

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             NE  +        L+   W Y HVG EL LD S SP+LK G DL   H+ E +LHLVDG+
Sbjct  374   NEGLERFDDFTGPLE---WVYTHVGAELRLDVSSSPYLKRGLDLLGFHSQETYLHLVDGF  430

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                   FRS   RDIALVNK    L  E  +P  W Q  NKG+V  S GRWV P+R
Sbjct  431   LSSASTFRSDARRDIALVNKACGLLVDELRIPHCWYQLANKGLVLNSYGRWVKPKR  486



>ref|XP_011096641.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Sesamum indicum]
Length=515

 Score =   353 bits (905),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 190/410 (46%), Positives = 261/410 (64%), Gaps = 28/410 (7%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI GS+DW+ LL+P++  LRREI++YGEFAQA YD+FDFD  S+YCG+C Y+  + F+
Sbjct  98    WREIHGSRDWDDLLDPLHPWLRREIVKYGEFAQATYDAFDFDAFSEYCGSCMYNRHKLFD  157

Query  607   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  786
             KLG+   GY +++Y+YA S+I+LP + + S     WS+ +NWMG+VAV +D+ E +R+GR
Sbjct  158   KLGLTKTGYNVTQYIYAMSHIDLPLWLEKSRFVDTWSKDSNWMGFVAV-SDDQESKRIGR  216

Query  787   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYS  966
             RDIV+AWRGTV   EW  +++  L P    D    K+E GF  +YT+    T  N    S
Sbjct  217   RDIVVAWRGTVAPSEWYDNMQRKLEPIGHGDS---KVEHGFLSIYTSKSDFTRYN--KSS  271

Query  967   AREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQegegess  1140
             A EQ++ EV +L++ Y+  GE +S+T+TGHSLG AL LL+AY+ A+   N          
Sbjct  272   ASEQVMREVKKLVDYYQKIGEQVSLTITGHSLGGALGLLNAYEAAKNFPN----------  321

Query  1141  stsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQY  1320
                    +P+SV SFA PRVGN+ F++   ++G+K LR+   +D VP +PGI+ NE  Q 
Sbjct  322   -------LPISVVSFAAPRVGNIAFRDELYQMGVKTLRVTMKQDVVPRMPGIVFNESLQR  374

Query  1321  QKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRR  1500
                +  TL+   W Y HVGVEL LD   SP+LK G +L   H LE +LHLVDGY      
Sbjct  375   FDDITGTLE---WVYTHVGVELKLDVRSSPYLKKGLNLVGYHMLETYLHLVDGYQSSDSG  431

Query  1501  FRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             FR+   RD+ALVNKD + L  E  +PP W Q  NKG+ R   GRWV P+R
Sbjct  432   FRADAKRDVALVNKDCDMLVDELRIPPNWYQLANKGLERNDHGRWVKPKR  481



>ref|XP_010655698.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Vitis 
vinifera]
Length=510

 Score =   350 bits (899),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 187/406 (46%), Positives = 260/406 (64%), Gaps = 28/406 (7%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W+EI GS DW+ LL+P+   LRREI++YGEFAQA YD+FDFD  S+YCG+C+Y+  + F+
Sbjct  94    WSEIHGSCDWDNLLDPLQPWLRREIVKYGEFAQATYDAFDFDSFSEYCGSCRYNQHKLFK  153

Query  607   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  786
             +LG+   GY +S+Y+YA S+I++P + + S +   WS+ +NWMGYVAV +D+ E  R+GR
Sbjct  154   ELGLEKNGYMVSKYIYAMSHIDVPQWLERSHLLDTWSKDSNWMGYVAV-SDDQESSRIGR  212

Query  787   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYS  966
             RDIV+AWRGTV   EW  D +  L P       + K+E GF  +YT+ ++ +  N    S
Sbjct  213   RDIVVAWRGTVAPSEWYEDFQRKLEPV---GSGEAKVEHGFLSIYTSKRESSRYN--KSS  267

Query  967   AREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQegegess  1140
             A +Q++ EV RL++ YK  GE +S+T+TGHSLG ALALL+AY+ A               
Sbjct  268   ASDQVMKEVTRLVQLYKQRGEQVSLTITGHSLGGALALLNAYEAA---------------  312

Query  1141  stsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQY  1320
               ++   +P+SV SF  PRVGN+ F++   +LG+K LR+V  +D VP +PG++ NE  Q 
Sbjct  313   --TSLPGLPISVISFGSPRVGNIAFRDELHQLGVKTLRVVVKQDIVPRMPGLVFNESLQK  370

Query  1321  QKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRR  1500
                +  TLK   W Y HVG EL LD   SP+LK G +L   H+LE +LHL+DG+H     
Sbjct  371   FDDITGTLK---WVYTHVGAELKLDVQSSPYLKRGFNLPGFHSLETYLHLIDGFHSKTST  427

Query  1501  FRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1638
             FR    RDIALVNK  + L  E  +P  W Q  NKG+VR + GRWV
Sbjct  428   FREDARRDIALVNKACDMLVDELRIPRAWYQFANKGLVRNAHGRWV  473



>gb|EPS66180.1| hypothetical protein M569_08597, partial [Genlisea aurea]
Length=423

 Score =   347 bits (890),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 182/410 (44%), Positives = 257/410 (63%), Gaps = 28/410 (7%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI G+ DW+ +LNP++  LRREII+YGEF+QA YD+FDFDP S+YCG+CKY+  +   
Sbjct  32    WREIHGANDWKAILNPLHPWLRREIIKYGEFSQATYDAFDFDPFSEYCGSCKYNKKKMLA  91

Query  607   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  786
             KLG+   GY +  Y+Y  S ++LP + Q S +   WS+ +NW+G++AV +D+ E RR+GR
Sbjct  92    KLGLEKSGYTVREYIYGMSQMDLPQWMQKSKLAETWSKDSNWIGFMAV-SDDVETRRIGR  150

Query  787   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYS  966
             RDI +AWRGTV   EW  ++K+ LHP     + + ++E GF  +YT+  + T  N    S
Sbjct  151   RDIAVAWRGTVAMSEWYDNMKSELHPI---GEGEARVEHGFLSIYTSKNESTRYN--QSS  205

Query  967   AREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegess  1140
             A EQ + E+ +LIE Y  +GE +S+T+TGHSLG ALALL+AYD A               
Sbjct  206   ASEQAIGEIKKLIEFYAERGEEISLTITGHSLGGALALLTAYDAAR--------------  251

Query  1141  stsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQY  1320
                  + I +SVFSFA PRVGN+ F++    +G+K LR+   +D VP +PGI+ NE  Q 
Sbjct  252   ---NFSGIHISVFSFAAPRVGNIAFRDELYAMGVKTLRVTINQDIVPKMPGIVFNENLQ-  307

Query  1321  QKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRR  1500
               + E       W Y HVG EL +D   SP+LK   +L   H LE +LHL+DG+  +   
Sbjct  308   --KFEDFTGALEWIYTHVGAELKIDVRSSPYLKKRLNLIGFHLLETYLHLIDGFVSEDSD  365

Query  1501  FRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             FR  + RD+ALVNK ++    +  +PP W Q ENKG+V+ + GRWV P+R
Sbjct  366   FREDSNRDVALVNKYADMAADDLRIPPAWFQPENKGLVKNAHGRWVKPQR  415



>ref|XP_007024951.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY27573.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=511

 Score =   350 bits (897),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 192/410 (47%), Positives = 258/410 (63%), Gaps = 28/410 (7%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W +I GS DW  LL+P++  LRREI++YGEFAQA YD+FDFD  S++CG+C+Y+  + FE
Sbjct  97    WRDIHGSMDWVNLLDPLHPWLRREIVKYGEFAQATYDAFDFDSFSEFCGSCRYNRNKLFE  156

Query  607   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  786
             KLG    GY++++Y+YA S+I +P + + S +   WS+ +NWMGYVAV+ DE E RR+GR
Sbjct  157   KLGHGKNGYKVTKYIYAMSHIEMPQWLERSHLMDTWSKDSNWMGYVAVSDDE-ETRRIGR  215

Query  787   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYS  966
             RDIV+AWRGTV   EW  D +  L P       D K+E GF  +YT+  + T  N    S
Sbjct  216   RDIVVAWRGTVAPAEWYEDFQRNLEPIGI---GDAKVEHGFLSIYTSKNESTRYN--KSS  270

Query  967   AREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQegegess  1140
             A EQ++ EV +L++ Y+  GE +S+T+TGHSLG ALALL+AY+ A               
Sbjct  271   ASEQVMEEVTKLVQFYQGNGEEVSLTITGHSLGGALALLNAYEAA---------------  315

Query  1141  stsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQY  1320
               ++   +PVSV SF  PRVGN  F++  D LG+K LR+V  +D VP +PGI+ NE  Q 
Sbjct  316   --ASLPGLPVSVISFGAPRVGNSAFRDELDGLGVKTLRVVVKQDLVPRMPGIVFNESLQR  373

Query  1321  QKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRR  1500
                +  TL+   W Y HVG EL LD S SP+LK G      H+LE +LHLVDG+H     
Sbjct  374   FDDITGTLE---WVYTHVGAELRLDVSSSPYLKRGFSPLGFHSLETYLHLVDGFHSADSA  430

Query  1501  FRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             FRS   RD++LVNK  + L  +  +P  W Q  NKG+VR   GRWV P R
Sbjct  431   FRSDARRDVSLVNKACDMLVDKLRIPHCWYQLSNKGLVRNEHGRWVKPRR  480



>ref|XP_009399030.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=498

 Score =   349 bits (895),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 191/415 (46%), Positives = 256/415 (62%), Gaps = 26/415 (6%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             ++  ++ EI G  DW  LLNP++  LRREII+YGEFAQA YD+FDF+P S++CG+C Y  
Sbjct  93    DISSLFPEIHGYADWSPLLNPLHPWLRREIIKYGEFAQATYDAFDFNPLSEFCGSCLYGR  152

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              +  +KLG+A  GYR+S+ +YA S++ LP + + S     W   +NWMGYVAV +D+AE 
Sbjct  153   HRLLDKLGLARNGYRVSKNVYAMSHVELPRWLERSLHADAWCTESNWMGYVAV-SDDAES  211

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
             RR+G RDIV+AWRGT+   EW  D++  L P       D+K+E GF  +YT+    T  N
Sbjct  212   RRIGCRDIVVAWRGTIAPTEWFEDVQGKLEP-FGEAHADVKVEHGFLGVYTSKSDRTRYN  270

Query  952   FCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
                 SA EQ++ E+ RL+  Y  +GE +S+T+TGHSLG ALALL+AY+ A          
Sbjct  271   --KTSASEQVMEEIKRLVSHYRQRGEEVSLTITGHSLGGALALLNAYESAS---------  319

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                         +P+SV SF GPRVGN+ F E+  E+ +KVLR+V  +D VP +PGI+ N
Sbjct  320   --------TIPDLPISVISFGGPRVGNVAFGEKLKEMNVKVLRVVVKQDMVPKMPGILFN  371

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYH  1485
             E     K+ E       W Y HVG+EL LD   SP+LK G D+   HNLE +LHLVDG+ 
Sbjct  372   EGL---KRFEHVTGTLEWVYTHVGLELGLDVRSSPYLKHGLDVAGFHNLETYLHLVDGFL  428

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                + FR    RD+ALVNK S  L+ E  +PP W Q  NKGM   + GRWV P R
Sbjct  429   SSDKEFRGNARRDVALVNKASGMLRDELHIPPCWVQMANKGMECNAYGRWVKPAR  483



>ref|XP_003532708.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Glycine 
max]
Length=497

 Score =   349 bits (895),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 188/416 (45%), Positives = 262/416 (63%), Gaps = 30/416 (7%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             N+ + W EIQG  +WE +L+P+   LRREI++YGEFAQA YD+FD+D  S+YCG+C+Y+ 
Sbjct  88    NISQKWREIQGYHNWEDILDPLQPWLRREIVKYGEFAQATYDAFDYDSFSEYCGSCRYNQ  147

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + FEKLG+    Y ++RY+YA S+I LP + + S V   WS+ +NW+G+VAV+ D+ E 
Sbjct  148   NKLFEKLGLTRNSYTVTRYIYAMSHIELPRWLERSHVADTWSKDSNWIGFVAVSDDD-ET  206

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
             RR+GRRDIV+AWRGTV   EW  D +  L P       D K+E GF  +Y +  + T  N
Sbjct  207   RRIGRRDIVVAWRGTVAPCEWYEDFQRKLDPI---GHGDAKVEHGFLSIYKSKSETTRYN  263

Query  952   FCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
                 SA +Q++ EV +L+  Y   KGE +S+T+TGHSLG ALAL++AY++A   ++    
Sbjct  264   --KSSASDQVMKEVTKLVNFYKGKKGEEVSLTITGHSLGGALALINAYEVATTFLD----  317

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
                          +PVSV SF  PRVGN+ FK+   ++G+K+LR+V  +D VP +PG++ 
Sbjct  318   -------------LPVSVISFGAPRVGNIAFKDELHQMGVKLLRVVVKQDWVPKMPGLLF  364

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             NEK +   +    +    W Y HVG ELALD   SP+LK G +L   H+LE +LHL+DGY
Sbjct  365   NEKLKMFDE----ITGLEWVYTHVGAELALDVHSSPYLKGGMNLSGFHSLETYLHLIDGY  420

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                   FRS   RDIALVNK  + L  E  +P  W Q  NKG+V  + GRWV P+R
Sbjct  421   LSHETPFRSEARRDIALVNKSCDMLVDELRIPHCWYQLANKGLVCNAHGRWVKPKR  476



>emb|CBI17935.3| unnamed protein product [Vitis vinifera]
Length=415

 Score =   346 bits (887),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 206/430 (48%), Positives = 237/430 (55%), Gaps = 114/430 (27%)
 Frame = +1

Query  421   EIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQF  600
             E W EI G  DW G+L+PM+  LR E+IRYGE AQACYD+FDFDP SKYCGTC++   +F
Sbjct  83    ERWREIHGEDDWTGMLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGTCRFMPRKF  142

Query  601   FEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRL  780
             F+ LGMA  GY +                                              L
Sbjct  143   FDSLGMAGHGYDVV---------------------------------------------L  157

Query  781   GRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDP----DIKIESGFFDLYTNSKKDTDC  948
             GRRDI IAWRGTVT LEWI DL + L P    + P     +K+ESGF DLYT+  KD  C
Sbjct  158   GRRDITIAWRGTVTRLEWIADLMDFLKPVSSENIPCPDRTVKVESGFLDLYTD--KDESC  215

Query  949   NFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQege  1128
              FC +SAREQ+L EV RLIE Y  E LSIT TGHSLG ALA+LSAYD+AE  +NV+  G 
Sbjct  216   KFCKFSAREQILTEVKRLIEMYPNEELSITFTGHSLGGALAVLSAYDVAETGLNVLNNGR  275

Query  1129  gessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANE  1308
                        +PVSV SF+GPR                                     
Sbjct  276   V----------LPVSVLSFSGPR-------------------------------------  288

Query  1309  KFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHG  1488
                            PWSY+HVGVELALDH  SPFLK   D   AHNLE HLHL+DGYHG
Sbjct  289   -------------GLPWSYSHVGVELALDHKNSPFLKQNADPISAHNLEAHLHLLDGYHG  335

Query  1489  DGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAH  1668
              G+RF  A+GRD ALVNK S+FLK  + VPP WRQDENKGMVR+SDGRWV PER + E H
Sbjct  336   KGQRFVLASGRDPALVNKASDFLKDHYLVPPYWRQDENKGMVRSSDGRWVQPERPKHELH  395

Query  1669  P---PDTGHH  1689
                  D  HH
Sbjct  396   DHNHADMHHH  405



>gb|ABR17156.1| unknown [Picea sitchensis]
Length=489

 Score =   347 bits (889),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 193/426 (45%), Positives = 269/426 (63%), Gaps = 40/426 (9%)
 Frame = +1

Query  424   IWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFF  603
             +W +IQG   W+G L+P+N  L+ EI+RYGEFAQ CYD+FD   +SKY GTCK+     F
Sbjct  47    LWPDIQGINSWKGFLDPINPILKAEILRYGEFAQLCYDAFDDRHYSKYYGTCKHSKRSLF  106

Query  604   EKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLG  783
              K G  + GY I++Y+YA +++ L +FF   S +        W+G++AV TD  EI+RLG
Sbjct  107   GKTGFGNSGYEITKYIYANTHV-LGSFFGERSRD-----EGVWIGFIAVCTDPKEIKRLG  160

Query  784   RRDIVIAWRGTVTYLEWIHDLKNILHP---THFRD-------------DPDIKIESGFFD  915
             RRDIVIAWRGT T  EWI DLK+IL     +H +              DP+++IE GF D
Sbjct  161   RRDIVIAWRGTSTPQEWIEDLKDILVTATLSHAKSPGRPSSTTVPSSPDPNVRIEKGFMD  220

Query  916   LYTNSKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIA  1095
              YT+  ++++   CS SAR+ ++ E++RL+++Y+GE+LSIT+TGHSLGAALA LSAYDI 
Sbjct  221   CYTSMNEESEK--CSRSARDIVVGEISRLLKQYEGESLSITLTGHSLGAALATLSAYDIK  278

Query  1096  EMKVNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDK  1275
             E     +Q              IPV+VF+FA PRVGN  F  R +E+G+KVLR+VN  D 
Sbjct  279   ETVNTSMQSA------------IPVTVFAFASPRVGNPTFARRMEEIGVKVLRLVNKDDV  326

Query  1276  VPTVPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLE  1455
             VP  PG   NE   +  +L   L   PW+Y+HVG++++LD   S FLK    L   H+LE
Sbjct  327   VPKFPGFFMNENMGWLSRL---LDWLPWTYSHVGIKVSLDIESSSFLKQTHSLSDFHSLE  383

Query  1456  GHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRW  1635
              +LHL+DG+  + + F+  +GRD +LVNK  + L     +PP W Q+ NKG+V+ +DG+W
Sbjct  384   VYLHLLDGFVAEKKPFK-PSGRDPSLVNKSCDLLVETLHIPPYWWQERNKGLVKGADGKW  442

Query  1636  VVPERS  1653
               P RS
Sbjct  443   TCPARS  448



>gb|KDP38020.1| hypothetical protein JCGZ_04663 [Jatropha curcas]
Length=512

 Score =   347 bits (890),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 190/415 (46%), Positives = 265/415 (64%), Gaps = 28/415 (7%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             N+   W EI GS +WE LL+P++  LRREI++YGEFA A YD+FDFDP S+YCG+C+Y+ 
Sbjct  104   NVSAKWREIHGSCNWENLLDPLDPCLRREILKYGEFATATYDAFDFDPLSEYCGSCRYNR  163

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + FE+LG+    Y +++Y+YA S++++P +F  +  + IWS+ +NWMGYVAV+ D+ E 
Sbjct  164   HKIFEELGLNKHNYNVTKYIYAMSHVDVPEWFVRA--HSIWSKDSNWMGYVAVSNDQ-ES  220

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
             +RLGRRDIV+AWRGTV   EW  DLK  L      ++  IK++ GF+ +Y +  + T  N
Sbjct  221   KRLGRRDIVVAWRGTVAPTEWFTDLKTKLEEID-EENEKIKVQYGFYSIYKSKSEFTRYN  279

Query  952   FCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
                 SA EQ++ E+ +L+  Y+  GE +S+TVTGHSLG ALA+L+AY+ A    N+    
Sbjct  280   --KLSASEQVMQEIRKLVNCYRENGEEVSLTVTGHSLGGALAVLNAYEAANSIPNLF---  334

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                           VSV SF  PRVGNL FKE+ +ELG+K LR+V  +D VP VPGII N
Sbjct  335   --------------VSVISFGAPRVGNLAFKEKLNELGVKTLRVVVKQDIVPKVPGIIVN  380

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYH  1485
             +     +++ T  +   W Y HVG +L LD   SP+LK  +D   +HNLE +LHL+DG+ 
Sbjct  381   KIL---RKINTITQRLNWVYRHVGTQLKLDMFMSPYLKHVSDFSGSHNLEVYLHLLDGFL  437

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             G   +FR    RD+ALVNK S+ L  E  +P  W Q  +KG+V    GRWV P R
Sbjct  438   GKKLQFRWHARRDLALVNKSSDMLIEELKIPEFWYQLPHKGLVLNKYGRWVKPTR  492



>ref|XP_008444745.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Cucumis melo]
Length=535

 Score =   347 bits (891),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 181/417 (43%), Positives = 268/417 (64%), Gaps = 26/417 (6%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             N+  +W ++ G+ DWEGLL+P++  LRREI++YGEFAQA YD+FDFDP S++CG+C+Y+ 
Sbjct  128   NISAVWRDLHGASDWEGLLDPLHPFLRREIVKYGEFAQATYDAFDFDPLSEFCGSCRYNR  187

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              +   +LG+A  GY++++Y+YA S ++ P++F+ S +  +WS+ +NWMGYVAV++DE E 
Sbjct  188   HKLLNELGLAQNGYKVTKYIYALSPVDGPDWFESSKIGEVWSRDSNWMGYVAVSSDE-ES  246

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
              R+GRRDI++AWRGTVT  EW  DLK  L     R +  +K++ GF  +Y +  KD D  
Sbjct  247   DRIGRRDILVAWRGTVTPTEWYIDLKTKLKKID-RSNKKVKVQRGFLTIYKS--KDEDSK  303

Query  952   FCSYSAREQLLAEVNRLIERYKGEN---LSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
             F   SA EQ++ E++RLI+ +K +    +S+T+TGHSLG AL+LL+AY+           
Sbjct  304   FNKTSASEQVMEELHRLIDFFKEKGDREISLTITGHSLGGALSLLTAYEAG---------  354

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
                     +    + VSV SF  PRVGNL F+E+ +E+G+K LR+V  +D VP +PG+  
Sbjct  355   -------VTFPADVHVSVVSFGAPRVGNLAFREKLNEMGVKTLRVVIRQDIVPKLPGLFV  407

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             N       +L        W Y HVG EL ++   SP+LK  +D+  +HNLE +LHLVDG+
Sbjct  408   NSIVN---KLGAVTGKLNWVYRHVGKELRMNMYMSPYLKKDSDMSGSHNLEIYLHLVDGF  464

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1653
                  +FR  + RD+ALVNK S+ L  E  +P  W Q  +KG+++   GRWV P R+
Sbjct  465   VAKKGKFRWNSRRDVALVNKGSDMLVEELRIPEFWYQLPHKGLIKNRFGRWVKPGRN  521



>ref|XP_007212825.1| hypothetical protein PRUPE_ppa020655mg, partial [Prunus persica]
 gb|EMJ14024.1| hypothetical protein PRUPE_ppa020655mg, partial [Prunus persica]
Length=502

 Score =   346 bits (888),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 190/416 (46%), Positives = 265/416 (64%), Gaps = 29/416 (7%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             ++ E W EI GS DWEGLL+P++  LRREI++YGEFAQA YD+FDFD  S+YCG+C+Y+ 
Sbjct  93    SISEKWREIHGSNDWEGLLDPLHPWLRREIVKYGEFAQATYDAFDFDSFSEYCGSCRYNH  152

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + F+ LG++  GY +S+Y+YA S+I++P++ + S +   WS+H+NWMG+VAV +D+ E 
Sbjct  153   NKLFDVLGLSKNGYTVSKYIYAMSHIDMPSWLERSHLADTWSKHSNWMGFVAV-SDDLET  211

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
             RR+GRRDIV+AWRGTV   EW  D +  L P       + K+E GF  +YT   + T  N
Sbjct  212   RRIGRRDIVVAWRGTVAPSEWYEDFQRKLEPI---GHGEAKVEHGFHGIYTAKCETTRYN  268

Query  952   FCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
                 SA EQ++ EV RL+E Y+  GE +S+T+TGHSLG ALALL+AY+ AE         
Sbjct  269   --KSSASEQVMKEVTRLMEFYRAQGEEVSLTITGHSLGGALALLNAYEAAE---------  317

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                         +P+SV SF  PRVGN+ FK+  +++G+K LR+V  +D VP +PG++ N
Sbjct  318   --------TIPGLPISVVSFGAPRVGNIAFKDELNQMGVKTLRVVVKQDMVPKMPGLVLN  369

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLK-TGTDLGCAHNLEGHLHLVDGY  1482
             E  Q    +  TL    W Y HVG E+ L+   SP+LK  G +L   H+LE +LHLVDG+
Sbjct  370   EGLQKFDDITGTLD---WVYTHVGAEMKLEVGSSPYLKHGGFNLPGFHSLETYLHLVDGF  426

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                   FRS   RD ALVNK  + L  +  +P  W Q  +KG+V  + GRWV P+R
Sbjct  427   LSTETTFRSNARRDFALVNKGCDMLVDDLRIPQCWYQLPHKGLVCNAHGRWVKPKR  482



>ref|XP_009792730.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Nicotiana 
sylvestris]
Length=505

 Score =   346 bits (888),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 186/415 (45%), Positives = 264/415 (64%), Gaps = 28/415 (7%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             ++ + W +I G ++WEGLL+P++  LRREI++YGEFAQA YD+ DFD  S+YCG+C Y+ 
Sbjct  93    DISDRWRDIHGVQEWEGLLDPLHPLLRREIVKYGEFAQATYDALDFDAFSEYCGSCMYNS  152

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + F+KLG++  GY++++Y+YA S+I++P + + S +   WS+ +NW+G+VAV+ DE E 
Sbjct  153   QKLFDKLGLSKSGYKVTKYIYAMSHIDMPQWLERSRLTYTWSKDSNWIGFVAVSDDE-ES  211

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
             RR+GRRDIV+AWRGTVT  EW  +++  L P    D    K+E GF  +YT+    T  N
Sbjct  212   RRIGRRDIVVAWRGTVTPSEWYENMQRKLEPIGHMDS---KVEHGFLSIYTSKSDSTRYN  268

Query  952   FCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
                 SA EQ++ E+  L++ Y  KGE +S+T+TGHSLG ALALL+AY+ A          
Sbjct  269   --KSSASEQVMKELKILVDFYKSKGEEVSLTITGHSLGGALALLNAYESA----------  316

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                    +   +IP+SV SFA PRVGN+ F++   ++G+K+LR+   +D VP +PGI+ N
Sbjct  317   -------AKFPRIPISVISFAAPRVGNIAFRDEIYQMGVKILRVTVKQDLVPRMPGIVFN  369

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYH  1485
             E  Q       TL+   W Y HVG EL LD   SP+LK G +    H LE +LHLVDG+ 
Sbjct  370   ESLQKFDDFTGTLE---WIYTHVGAELKLDVRSSPYLKRGFNFIGFHMLETYLHLVDGFV  426

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                  FRS   RD+ALVNK+ + L  E  +P  W Q  NKG+   S GRWV P+R
Sbjct  427   STSSTFRSNAKRDVALVNKECDMLVDELRIPSCWYQLANKGLECNSYGRWVRPKR  481



>ref|XP_008225538.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Prunus mume]
Length=514

 Score =   346 bits (888),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 190/416 (46%), Positives = 265/416 (64%), Gaps = 29/416 (7%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             ++ E W EI GS DW+GLL+P++  LRREI++YGEFAQA YD+FDFD  S+YCG+C+Y+ 
Sbjct  93    SISEKWREIHGSNDWDGLLDPLHPWLRREIVKYGEFAQATYDAFDFDSFSEYCGSCRYNH  152

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + F+ LG++  GY +S+Y+YA S+I++P++ + S +   WS+H+NWMG+VAV +D+ E 
Sbjct  153   NKLFDVLGLSKNGYTVSKYIYAMSHIDMPSWLERSHLADTWSKHSNWMGFVAV-SDDLET  211

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
             RR+GRRDIV+AWRGTV   EW  D +  L P       + K+E GF  +YT   + T  N
Sbjct  212   RRIGRRDIVVAWRGTVAPSEWYEDFQRKLEPI---GHGEAKVEHGFHGIYTAKCETTRYN  268

Query  952   FCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
                 SA EQ++ EV RL+E Y+  GE +S+T+TGHSLG ALALL+AY+ AE         
Sbjct  269   --KSSASEQVMKEVTRLLEFYRAQGEEVSLTITGHSLGGALALLNAYEAAE---------  317

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                         +P+SV SF  PRVGN+ FK+  +++G+K LR+V  +D VP +PG++ N
Sbjct  318   --------TIPGLPISVVSFGAPRVGNIAFKDELNQMGVKTLRVVVKQDMVPKMPGLVLN  369

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLK-TGTDLGCAHNLEGHLHLVDGY  1482
             E  Q    +  TL    W Y HVG EL L+   SP+LK  G +L   H+LE +LHLVDG+
Sbjct  370   EGLQKFDDITGTLD---WVYTHVGAELKLEVGSSPYLKHGGFNLPGFHSLETYLHLVDGF  426

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                   FRS   RD ALVNK  + L  +  +P  W Q  +KG+V  + GRWV P+R
Sbjct  427   LSTETTFRSNARRDFALVNKGCDMLVDDLRIPQCWYQLPHKGLVCNAHGRWVKPKR  482



>ref|XP_004135535.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Cucumis 
sativus]
 gb|KGN65881.1| hypothetical protein Csa_1G537320 [Cucumis sativus]
Length=534

 Score =   345 bits (885),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 178/416 (43%), Positives = 268/416 (64%), Gaps = 26/416 (6%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             +  +W ++ G+ DWEGLL+P++  LRREI++YGEFAQA YD+FDFDP S++CG+C+Y+  
Sbjct  128   ISAVWRDLHGASDWEGLLDPLHPFLRREIVKYGEFAQATYDAFDFDPLSEFCGSCRYNRQ  187

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             +   +LG+A  GY++++Y+YA S ++ P++F+ S +  +WS+ +NWMG+VAV++DE E  
Sbjct  188   KLLNELGLAQNGYKVTKYIYALSPVDGPDWFESSKIGEVWSRDSNWMGFVAVSSDE-ESD  246

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  954
             R+GRRDI+++WRGTVT  EW  DLK  L     R +  +K++ GF  +Y +  KD D  F
Sbjct  247   RIGRRDILVSWRGTVTPTEWYIDLKTKLKKID-RSNKKVKVQRGFLTIYKS--KDEDSKF  303

Query  955   CSYSAREQLLAEVNRLIERYKGEN---LSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
                SA EQ++ E++RLI+ +K +    +S+T+TGHSLG AL+LL+AY+            
Sbjct  304   NKTSASEQVMEELHRLIDFFKQKGDREISLTITGHSLGGALSLLTAYEAG----------  353

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                    +    + VSV SF  PRVGNL F+E+ +E+G+K+LR+V  +D VP +PG+  N
Sbjct  354   ------VTFPADVHVSVVSFGAPRVGNLAFREKLNEMGVKILRVVIGQDIVPKLPGLFVN  407

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYH  1485
                    +L        W Y HVG EL ++   SP+LK  +D+  +HNLE +LHLVDG+ 
Sbjct  408   ---SIVNKLSAVTGKLNWVYRHVGKELRMNMFMSPYLKKDSDMSGSHNLEIYLHLVDGFV  464

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1653
                 +FR  + RD+ALVNK S+ L  E  +P  W Q  +KG+++   GRWV P R+
Sbjct  465   TKKGKFRWNSRRDVALVNKGSDMLVEELRIPEFWYQLPHKGLIKNRFGRWVKPGRN  520



>ref|XP_004167249.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Cucumis 
sativus]
Length=534

 Score =   345 bits (885),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 178/416 (43%), Positives = 268/416 (64%), Gaps = 26/416 (6%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             +  +W ++ G+ DWEGLL+P++  LRREI++YGEFAQA YD+FDFDP S++CG+C+Y+  
Sbjct  128   ISAVWRDLHGASDWEGLLDPLHPFLRREIVKYGEFAQATYDAFDFDPLSEFCGSCRYNRQ  187

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             +   +LG+A  GY++++Y+YA S ++ P++F+ S +  +WS+ +NWMG+VAV++DE E  
Sbjct  188   KLLNELGLAQNGYKVTKYIYALSPVDGPDWFESSKIGEVWSRDSNWMGFVAVSSDE-ESD  246

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNF  954
             R+GRRDI+++WRGTVT  EW  DLK  L     R +  +K++ GF  +Y +  KD D  F
Sbjct  247   RIGRRDILVSWRGTVTPTEWYIDLKTKLKKID-RSNKKVKVQRGFLTIYKS--KDEDSKF  303

Query  955   CSYSAREQLLAEVNRLIERYKGEN---LSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
                SA EQ++ E++RLI+ +K +    +S+T+TGHSLG AL+LL+AY+            
Sbjct  304   NKTSASEQVMEELHRLIDFFKQKGDREISLTITGHSLGGALSLLTAYEAG----------  353

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                    +    + VSV SF  PRVGNL F+E+ +E+G+K+LR+V  +D VP +PG+  N
Sbjct  354   ------VTFPADVHVSVVSFGAPRVGNLAFREKLNEMGVKILRVVIGQDIVPKLPGLFVN  407

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYH  1485
                    +L        W Y HVG EL ++   SP+LK  +D+  +HNLE +LHLVDG+ 
Sbjct  408   ---SIVNKLSAVTGKLNWVYRHVGKELRMNMFMSPYLKKDSDMSGSHNLEIYLHLVDGFV  464

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERS  1653
                 +FR  + RD+ALVNK S+ L  E  +P  W Q  +KG+++   GRWV P R+
Sbjct  465   TKKGKFRWNSRRDVALVNKGSDMLVEELRIPEFWYQLPHKGLIKNRFGRWVKPGRN  520



>ref|XP_009605461.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Nicotiana 
tomentosiformis]
Length=505

 Score =   344 bits (883),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 203/481 (42%), Positives = 286/481 (59%), Gaps = 38/481 (8%)
 Frame = +1

Query  214   TKPTTAKPSNNSFFPLNPHYSSLKCRVSLPAAAINAPPQRETGQSSNKNdeeqeedeelc  393
             T+  T+K SN     L    S+L   +  P   IN P        SN N    E+     
Sbjct  37    TQIKTSKKSNR----LGETLSNL-LNIQKPYQKINNP-----STYSNWNTLNIEDKANTP  86

Query  394   veedGRNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCG  573
                   ++ + W +I G ++WEGLL+P++  LRREI++YGEFAQA YD+ DFD  S+YCG
Sbjct  87    TMSPKEDISDRWRDIHGVQEWEGLLDPLHPLLRREIVKYGEFAQATYDALDFDAFSEYCG  146

Query  574   TCKYDGAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVA  753
             +C Y+  + F+KLG++  GY++++Y+YA S+I++P + + S +   WS+ +NW+G+VAV+
Sbjct  147   SCMYNSHKLFDKLGLSKSGYKVTKYIYAMSHIDMPQWLEKSRLTYTWSKDSNWIGFVAVS  206

Query  754   TDEAEIRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSK  933
              DE E RR+GRRDIV+AWRGTVT  EW  +++  L P    D    K+E GF  +YT SK
Sbjct  207   DDE-ESRRIGRRDIVVAWRGTVTPSEWYENMQRKLEPIGHVDS---KVEHGFLSIYT-SK  261

Query  934   KDTDCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKV  1107
              D    +   SA EQ++ E+  L++ Y  KGE +S+T+TGHSLG ALALL+AY+ A    
Sbjct  262   SDL-TRYNKSSASEQVMKELKILVDYYKSKGEEVSLTITGHSLGGALALLNAYESA----  316

Query  1108  NVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1287
                          +   ++P+SV SFA PRVGN+ F++   ++GIK+LR+   +D VP +
Sbjct  317   -------------AKFPRLPISVISFAAPRVGNIAFRDEIYQMGIKILRVTVKQDLVPRM  363

Query  1288  PGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLH  1467
             PGI+ NE  Q       TL+   W Y HVG EL LD   SP+LK G +    H LE +LH
Sbjct  364   PGIVFNESLQKFDDFTGTLE---WIYTHVGAELKLDVRSSPYLKRGFNFIGFHMLETYLH  420

Query  1468  LVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPE  1647
             LVDG+      FRS   RD+ALVNK+ + L  E  +P  W Q  NKG+   S GRWV P+
Sbjct  421   LVDGFVSTSSTFRSNAKRDVALVNKECDMLVDELRIPTCWYQLANKGLECNSYGRWVRPK  480

Query  1648  R  1650
             R
Sbjct  481   R  481



>ref|XP_006448978.1| hypothetical protein CICLE_v10014927mg [Citrus clementina]
 gb|ESR62218.1| hypothetical protein CICLE_v10014927mg [Citrus clementina]
Length=520

 Score =   345 bits (884),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 188/412 (46%), Positives = 263/412 (64%), Gaps = 29/412 (7%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI G  DW+ LL+P++  LRREI++YGEFAQA YD+FDFDP S+YCG+C+++  + FE
Sbjct  102   WREIHGCTDWDSLLDPLHPCLRREILKYGEFAQATYDAFDFDPFSEYCGSCRFNSNKIFE  161

Query  607   KLGMADR-GYRISRYLYATSNINLPNFFQHSS-VNRIWSQHANWMGYVAVATDEAEIRRL  780
             KLG+  + GY++ +Y+YA S+I++P +   +  +   WS+ +NWMG+VA+ +DE E RR+
Sbjct  162   KLGLDGKHGYKVCKYIYAMSHIDMPQWLNRTVHLGDTWSRDSNWMGFVAI-SDEEETRRI  220

Query  781   GRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCS  960
             GRRDIV+AWRGTV   EW  D +  L P    DD   K+E GF  +YT+  + T   +  
Sbjct  221   GRRDIVVAWRGTVAPSEWYEDFQRKLEPIGPGDDA--KVEHGFHSIYTSKSEHT--RYSK  276

Query  961   YSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQegege  1134
              SA EQ++ EV RL++ YK  GE +S+T+TGHSLG ALALL+AY+ A             
Sbjct  277   SSASEQVMKEVTRLVKLYKEKGEEVSLTITGHSLGGALALLNAYEAA-------------  323

Query  1135  ssstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKF  1314
                 +    +P+SV SF  PRVGN+ F+++  ++G+K LR+V  +D VP +PG++ NE  
Sbjct  324   ----TTIPGLPISVISFGAPRVGNIAFRDQLHQMGVKTLRVVVKQDLVPKMPGVVFNEGL  379

Query  1315  QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDG  1494
             Q   ++  TL    W Y HVG EL LD   SP+LK G +L   H+ E +LHLVDG+    
Sbjct  380   QKFDEITGTLD---WVYTHVGAELRLDVRSSPYLKHGFNLLGFHSQETYLHLVDGFVCQS  436

Query  1495  RRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
               FR    RD+ALVNK  + L  E  +P  W Q ENKG+VR + GRWV P+R
Sbjct  437   SSFREDARRDVALVNKACDMLVDELRIPHCWYQMENKGLVRNAHGRWVKPKR  488



>ref|XP_009408789.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=488

 Score =   343 bits (880),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 188/423 (44%), Positives = 260/423 (61%), Gaps = 26/423 (6%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             ++  ++ +I G  DW  LLNP++  LRREII+YGE AQA YD FDF+P S++CG+C Y  
Sbjct  80    DISSLFPDIHGRADWCRLLNPLHPWLRREIIKYGELAQATYDGFDFNPFSEFCGSCLYGR  139

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              +  EKLG++  GY +S Y+YA S+++LP + + S     WS  +NWMG+VAV+ DE E 
Sbjct  140   HRLLEKLGLSRSGYEVSTYVYAMSHVDLPAWLERSIHADAWSTESNWMGFVAVSDDE-ES  198

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
              R+G RD+V+AWRGT+   EW  +++  L P        +K+E GF  +YT+  + T  N
Sbjct  199   HRIGCRDVVVAWRGTIAPTEWFENVQGKLEPLG-DGHSAVKVEHGFLGVYTSKSERTRYN  257

Query  952   FCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
                 SA EQ++AE+ RL+  Y+  GE +S+T+TGHSLG ALALL+AY+ A    +     
Sbjct  258   --KTSASEQVMAEIKRLVNHYRRQGEEVSLTITGHSLGGALALLNAYEAASAMPD-----  310

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                         +PVSV SF  PRVGN  F +R  E+ +KVLR+V  +D VP +PGI+ N
Sbjct  311   ------------LPVSVISFGAPRVGNAAFGDRLKEMNVKVLRVVVKQDVVPKMPGILFN  358

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYH  1485
             E     K+LE+      W Y+HVG+EL +D   SPFLK G D+   HNLE +LHLVDG+ 
Sbjct  359   EGL---KRLESVTGKLGWVYSHVGLELGIDVRSSPFLKRGIDVAGFHNLEAYLHLVDGFR  415

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEA  1665
                  FRS+  RD+ALVNK S  L+ E  +PP W Q  NKGM+    GRW+ P R + + 
Sbjct  416   SSDNGFRSSFKRDVALVNKASGMLRDELKIPPCWYQVANKGMMCNVHGRWMKPAREQEDI  475

Query  1666  HPP  1674
               P
Sbjct  476   PSP  478



>ref|XP_002531054.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF31315.1| triacylglycerol lipase, putative [Ricinus communis]
Length=521

 Score =   344 bits (883),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 185/420 (44%), Positives = 265/420 (63%), Gaps = 34/420 (8%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             N+   W EI GS++WE LL+P++  LRRE+++YGEF +A YD+FDFDP S+YCG+C Y+ 
Sbjct  109   NISSRWQEIHGSRNWENLLDPLHPWLRREVVKYGEFVEATYDAFDFDPLSEYCGSCLYNR  168

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + FE+LG+   GYR ++Y+YA S++++P +F  +     WS+ +NWMG+VAV+ D+ E 
Sbjct  169   HKIFEELGLTKHGYRATKYIYAMSHVDVPEWFARTHTT--WSKDSNWMGFVAVSNDQ-ES  225

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD-----IKIESGFFDLYTNSKK  936
             +R+GRRDI++AWRGTV   EW +DL+  L   +F +D D     +K++ GF  +Y +  +
Sbjct  226   QRIGRRDIMVAWRGTVAPTEWYNDLRTDLE--YFEEDQDHKKNHVKVQEGFLSIYKSKSE  283

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVN  1110
             +T  N    SA EQ++ E+ +L+  Y+  GE +S+T+TGHSLG ALALL+AY+ A    N
Sbjct  284   ETRYN--KLSASEQVMKELKKLVNLYRENGEEVSLTLTGHSLGGALALLNAYEAATSIPN  341

Query  1111  VVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1290
             V                  +SV SF  PRVGNL FKE+ +ELG+K LR+V  +D VP +P
Sbjct  342   VF-----------------ISVISFGAPRVGNLAFKEKLNELGVKTLRVVIKQDIVPKLP  384

Query  1291  GIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1470
             GII N+      +L        W Y HVG +L LD   SP+LK  +D+  +HNLE +LHL
Sbjct  385   GIIVNKILN---KLSKITHKLNWVYRHVGTQLKLDMFISPYLKQESDMSGSHNLEVYLHL  441

Query  1471  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
             +DG+ G    +R    RD+ALVNK +N L  E  +P  W Q  +KG+V    GRWV P R
Sbjct  442   LDGFLGKKLNYRWNARRDLALVNKSTNMLIEELKIPEFWYQLPHKGLVLNKYGRWVKPSR  501



>ref|XP_010540608.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Tarenaya 
hassleriana]
Length=535

 Score =   344 bits (882),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 185/421 (44%), Positives = 267/421 (63%), Gaps = 34/421 (8%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             N+ ++W EI GS +WE LL+P++  LRREII+YGEF +A YDS DFDP S++CG+C+Y+ 
Sbjct  123   NISKMWREIHGSNNWENLLDPLHPWLRREIIKYGEFVEAVYDSLDFDPLSEFCGSCRYNR  182

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + FE+LG+A  GY++++Y+YA S++++P +F  S++   WS+ +NWMG V V+ D  E 
Sbjct  183   NKLFEELGLARHGYKVTKYIYAMSHVDVPQWFLRSALGETWSKDSNWMGLVGVSCDR-ES  241

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDD-PDIKIESGFFDLYTNSKKDTDC  948
             RR+GRRDIV+AWRGTVT  EW  DLK    P        ++K++SGF  +Y +  ++T  
Sbjct  242   RRIGRRDIVVAWRGTVTPTEWFLDLKTKKEPLERNGTHENVKVQSGFLSIYQSKGENTRY  301

Query  949   NFCSYSAREQLLAEVNRLIE--RYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
             N    SA EQ++ E+  +++  R +GE +S+T+TGHSLG ALALL+AY++A         
Sbjct  302   N--KQSASEQVMEEIKHMVKFFRDRGEEVSVTITGHSLGGALALLNAYEVAR--------  351

Query  1123  gegessstsaatKIP----VSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1290
                          IP    +SV SF  PRVGNL FKER + LG+KVLR+VN +D VP +P
Sbjct  352   ------------DIPALSNISVISFGAPRVGNLAFKERLNHLGVKVLRVVNKQDIVPKLP  399

Query  1291  GIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1470
             GI+ N+       + + L    W Y HVG++L L+   SP+LK  +DL   HNLE +LH+
Sbjct  400   GIVFNKILNKINPITSRLN---WVYRHVGIQLKLNVFKSPYLKQDSDLAGCHNLEVYLHV  456

Query  1471  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDGRWVVPE  1647
             +DG+H    +FR    RD+A VNK ++ L  E  +P  W Q  +KG++     GRWV P 
Sbjct  457   LDGFHSKKSKFRVNARRDVASVNKSTDMLMDELRIPEFWYQVAHKGLILNKQTGRWVKPC  516

Query  1648  R  1650
             R
Sbjct  517   R  517



>ref|XP_006304825.1| hypothetical protein CARUB_v10012471mg [Capsella rubella]
 gb|EOA37723.1| hypothetical protein CARUB_v10012471mg [Capsella rubella]
Length=529

 Score =   343 bits (881),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 185/424 (44%), Positives = 268/424 (63%), Gaps = 35/424 (8%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             N+ ++W E+ GS +W  LL+P++  LRRE+ +YGEF ++ YDS DFDP S++CG+ +Y+ 
Sbjct  113   NISKMWRELHGSNNWVNLLDPLHPWLRREVTKYGEFVESVYDSLDFDPLSEFCGSSRYNR  172

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + FE+LG+   GY++++++YA S++++P +F  SSV   WS+ +NWMG+VAV+ D   +
Sbjct  173   NKLFEELGLTKHGYKVTKFIYAMSHVDVPQWFLSSSVGETWSKDSNWMGFVAVSGDRESL  232

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  942
              R+GRRDIV+AWRGTVT  EW+ DL+    P   ++      +K++SGFF +YT+  + T
Sbjct  233   -RIGRRDIVVAWRGTVTPTEWVMDLRTSKEPFDCKEQHGKNVVKVQSGFFSIYTSKSELT  291

Query  943   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaY----DIAEMK  1104
               N    SA EQ + EV RL++ +K  GE +S+TVTGHSLG ALAL++AY    D+ E+ 
Sbjct  292   RYN--KESASEQTMEEVKRLVKFFKGRGEEVSLTVTGHSLGGALALMNAYEAARDVPELS  349

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
              N                   VSVFSF  PRVGNL FKER + LG+KVLR+VN +D VP 
Sbjct  350   GN-------------------VSVFSFGAPRVGNLAFKERLNSLGVKVLRVVNKQDIVPK  390

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
             +PGI+ N+      +L      F W Y HVG +L LD   SP++K  +DLG +HNLE +L
Sbjct  391   LPGIVFNKVLN---KLNPITSRFNWVYRHVGTQLKLDVFSSPYVKQDSDLGRSHNLEVYL  447

Query  1465  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDGRWVV  1641
             H++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     GRWV 
Sbjct  448   HVLDGFHSKKSGFRVNARRDVASVNKSTDMLLEHLRIPECWYQVAHKGLILNKQTGRWVK  507

Query  1642  PERS  1653
             P R+
Sbjct  508   PVRA  511



>ref|XP_001781080.1| predicted protein [Physcomitrella patens]
 gb|EDQ54106.1| predicted protein [Physcomitrella patens]
Length=401

 Score =   339 bits (870),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 192/424 (45%), Positives = 260/424 (61%), Gaps = 39/424 (9%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EIQG  +W+GLL+P++  LRRE++RYG+FAQ CYD+F+    SKY G+ KY     FE
Sbjct  1     WREIQGLNNWDGLLDPLDEDLRRELLRYGDFAQMCYDNFEDKQWSKYAGSAKYSKQNVFE  60

Query  607   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  786
             KL   D GY+++RYLY T    LP   Q S  +  W   +NWMG+VAVA D  EI+RLGR
Sbjct  61    KLQKPDTGYQVTRYLYVTCENPLPGVIQSSLSSTRWDVQSNWMGFVAVAVDPKEIQRLGR  120

Query  787   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDI-------------KIESGFFDLYTN  927
             RDIV++WRGT+  +EW+ D +  L P     DP               K+E GF+ LYT 
Sbjct  121   RDIVVSWRGTMETIEWLVDAQIQLAPMTLAPDPQAGCEGNSKPAILKPKVEKGFWSLYTC  180

Query  928   SKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKV  1107
               K +   F   SA EQ++ E++RL+  YKGE LSIT+TGHSLG ALA+L+AY++AE  +
Sbjct  181   --KRSSSQFNQKSASEQVIRELSRLVTLYKGETLSITITGHSLGGALAILTAYEVAEKGL  238

Query  1108  NVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTV  1287
             N +    G  S       IPV+VFSF  PR+G+  FK+R +EL +K LR+VNV D VP  
Sbjct  239   NKLPSQNGNDSEI-----IPVTVFSFGSPRIGDAIFKKRFEELDLKALRVVNVHDVVPKA  293

Query  1288  PGIIANEKFQYQKQLETTLKNFPWS--YAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1461
              G I                + PWS  Y HVGVEL ++H  S ++K   D    H+LEG+
Sbjct  294   IGGI----------------HPPWSDAYRHVGVELQVNHKLSTYMKRTRDPVDWHSLEGY  337

Query  1462  LHLVDGYHGD-GRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1638
             LH +DG+ G   + F+  TGRD AL+NK S+ LK+E+ +P  W Q EN G+V +S+G+W+
Sbjct  338   LHHIDGHQGSKSKEFKLMTGRDYALLNKYSDILKKEYCIPGHWWQSENMGLVLSSEGKWI  397

Query  1639  VPER  1650
              P+R
Sbjct  398   EPDR  401



>ref|XP_002272780.2| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Vitis 
vinifera]
Length=524

 Score =   341 bits (875),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 186/418 (44%), Positives = 264/418 (63%), Gaps = 27/418 (6%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI G  +WE LL+P++  LRREI++YGEF+QA YD+FD+D  S +CG+C+Y+  + F+
Sbjct  121   WREIHGQFNWESLLDPLHPWLRREIVKYGEFSQATYDAFDYDSFSDFCGSCRYNRHKLFD  180

Query  607   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  786
             +L +   GY++++Y+YA +NI++P++F+  +    WS+ +NWMGYVAV++D  E +R+GR
Sbjct  181   ELHLTKHGYKVTKYIYAMTNIDVPSWFERPNTGETWSKDSNWMGYVAVSSDN-ESQRIGR  239

Query  787   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYS  966
             RDIV+AWRGTV   EW  D+K  L       +  +K+ESGF  +Y +  + T  N    S
Sbjct  240   RDIVVAWRGTVAPSEWFLDMKASLEQI---GEGGVKVESGFHSIYASKSESTRYN--KLS  294

Query  967   AREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQegegess  1140
             A EQ++  V RL+E +K  GE +S+TVTGHSLG ALALL+AY+ A    ++         
Sbjct  295   ASEQVMEAVKRLLEFFKGRGEEVSLTVTGHSLGGALALLNAYEAASSLPDLDH-------  347

Query  1141  stsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQY  1320
                      +SV SF  PRVGN+ F+++ +E+G+K+LR+V  +D VP +PGII N+    
Sbjct  348   ---------ISVISFGAPRVGNIAFRDKMNEMGVKILRVVVKQDIVPKLPGIICNKIL--  396

Query  1321  QKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRR  1500
              +Q+    +   W Y HVG EL LD S SP+LK   DL   HNLE +LHL DGY G   +
Sbjct  397   -RQIHALTRRLKWVYRHVGSELKLDMSLSPYLKREFDLLGFHNLEIYLHLTDGYVGKRLK  455

Query  1501  FRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPP  1674
             FR    RD+ALVNK S+ L  E  +P  W Q  NKG+V  S GRWV P R + +   P
Sbjct  456   FRWNARRDLALVNKSSDMLIEELRIPECWYQVPNKGLVFNSHGRWVKPCRDQQDIPSP  513



>ref|XP_009115161.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Brassica 
rapa]
Length=528

 Score =   341 bits (874),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 186/424 (44%), Positives = 265/424 (63%), Gaps = 35/424 (8%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             N+ + W E+ GSK+WE LL+P++  LRREI +YGEF ++ YDS DFDP S++CG+C+Y+ 
Sbjct  112   NISKAWRELHGSKNWENLLDPLHPWLRREITKYGEFVESVYDSLDFDPLSEFCGSCRYNR  171

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + FE+LG+   GY++++Y+YA S++++P +F  SS+   WS+ +NWMG+VAV+ D   +
Sbjct  172   NKLFEELGLTRHGYKVTKYIYAMSHVDVPQWFLSSSLGETWSKDSNWMGFVAVSGDRESL  231

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  942
              R+GRRDIV+AWRGTVT  EW  DL+    P   + +     +K++SGFF +Y NSK + 
Sbjct  232   -RIGRRDIVVAWRGTVTPTEWFMDLRTSKEPFDCKSEHGKNVVKVQSGFFSIY-NSKSEL  289

Query  943   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaY----DIAEMK  1104
                +   SA EQ + EV RL++ +K  GE +S+TVTGHSLG ALAL++AY    D+ E+ 
Sbjct  290   -TRYNKESASEQTMEEVKRLVKFFKDRGEEVSLTVTGHSLGGALALMNAYEAARDVPELS  348

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
              N                   VSV SF  PRVGNL FKER + LG+KVLR+VN +D VP 
Sbjct  349   GN-------------------VSVISFGAPRVGNLAFKERMNSLGVKVLRVVNKQDIVPK  389

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
             +PGI+ N+      +L        W Y HVG +L LD   SP++K  +DL   HNLE +L
Sbjct  390   LPGIVFNKVLN---KLNPITSRLSWVYRHVGTQLKLDVFTSPYIKQDSDLAGCHNLEVYL  446

Query  1465  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDGRWVV  1641
             H++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     GRWV 
Sbjct  447   HVLDGFHRKKSGFRVNARRDVASVNKSTDMLLDHLRIPECWYQVAHKGLILNKQTGRWVK  506

Query  1642  PERS  1653
             P R+
Sbjct  507   PVRA  510



>ref|XP_004244860.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Solanum lycopersicum]
Length=482

 Score =   339 bits (870),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 187/424 (44%), Positives = 262/424 (62%), Gaps = 33/424 (8%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             ++ + W +I G ++WEGLL+P++  LRREI++YGEFAQA YD+ D D  S+YCG+C Y+ 
Sbjct  80    DISDRWCDIHGVQEWEGLLDPLHPFLRREIVKYGEFAQATYDALDIDSFSEYCGSCMYNS  139

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + F+KLG+   GYR+++Y+YA S I++P + + S +   WS+ +NW+G+VAV+ DE E 
Sbjct  140   HKLFDKLGLNKSGYRVTKYIYAMSQIDMPQWLERSKLTYTWSKDSNWIGFVAVSDDE-ES  198

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
             RR+GRRDIV+AWRGTVT  EW  +++  L      D    K+E GF  +YT+    T  N
Sbjct  199   RRIGRRDIVVAWRGTVTPSEWYENMQRKLESIGHMDS---KVEHGFLSIYTSKCDSTRYN  255

Query  952   FCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
                 SA +Q++ E+  L+E Y  KGE +S+T+TGHSLG ALALL+AY+ A          
Sbjct  256   --KSSASQQVMKELKTLVEFYKTKGEQVSLTITGHSLGGALALLNAYESA----------  303

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                    +   K+P+SV SFA PRVGN+ F++   ++G+K+LR+   +D VP +PGI+ N
Sbjct  304   -------ANFPKLPISVISFAAPRVGNIAFRDELYQMGVKILRVTVKQDLVPRMPGIVLN  356

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYH  1485
             E  Q    L  TL+   W Y H G EL LD   SP+LK G +    H LE +LHLVDG+ 
Sbjct  357   ESLQKFDDLTGTLE---WIYTHAGTELKLDVRSSPYLKRGFNFIGIHMLETYLHLVDGFV  413

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEA  1665
                  FRS   RD+ALVNK  + L  E  +P  W Q  +KG+   S GRWV P+R     
Sbjct  414   SSTSTFRSNAKRDVALVNKACDMLVDELRIPTCWYQLAHKGLECNSYGRWVRPKR-----  468

Query  1666  HPPD  1677
             HP D
Sbjct  469   HPED  472



>gb|KHN12425.1| Phospholipase A1-Igamma1, chloroplastic [Glycine soja]
Length=820

 Score =   348 bits (894),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 188/416 (45%), Positives = 262/416 (63%), Gaps = 30/416 (7%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             N+ + W EIQG  +WE +L+P+   LRREI++YGEFAQA YD+FD+D  S+YCG+C+Y+ 
Sbjct  6     NISQKWREIQGYHNWEDILDPLQPWLRREIVKYGEFAQATYDAFDYDSFSEYCGSCRYNQ  65

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + FEKLG+    Y ++RY+YA S+I LP + + S V   WS+ +NW+G+VAV+ D+ E 
Sbjct  66    NKLFEKLGLTRNSYTVTRYIYAMSHIELPRWLERSHVADTWSKDSNWIGFVAVSDDD-ET  124

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
             RR+GRRDIV+AWRGTV   EW  D +  L P       D K+E GF  +Y +  + T  N
Sbjct  125   RRIGRRDIVVAWRGTVAPCEWYEDFQRKLDPI---GHGDAKVEHGFLSIYKSKSETTRYN  181

Query  952   FCSYSAREQLLAEVNRLIERY---KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
                 SA +Q++ EV +L+  Y   KGE +S+T+TGHSLG ALAL++AY++A   ++    
Sbjct  182   --KSSASDQVMKEVTKLVNFYKGKKGEEVSLTITGHSLGGALALINAYEVATTFLD----  235

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
                          +PVSV SF  PRVGN+ FK+   ++G+K+LR+V  +D VP +PG++ 
Sbjct  236   -------------LPVSVISFGAPRVGNIAFKDELHQMGVKLLRVVVKQDWVPKMPGLLF  282

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             NEK +   +    +    W Y HVG ELALD   SP+LK G +L   H+LE +LHL+DGY
Sbjct  283   NEKLKMFDE----ITGLEWVYTHVGAELALDVHSSPYLKGGMNLSGFHSLETYLHLIDGY  338

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                   FRS   RDIALVNK  + L  E  +P  W Q  NKG+V  + GRWV P+R
Sbjct  339   LSHETPFRSEARRDIALVNKSCDMLVDELRIPHCWYQLANKGLVCNAHGRWVKPKR  394



>ref|XP_009102705.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Brassica 
rapa]
Length=530

 Score =   340 bits (871),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 184/424 (43%), Positives = 266/424 (63%), Gaps = 35/424 (8%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             N+ ++W E+ GSK+WE +L+P++  LRREI +YGEF ++ YDS DFDP S++CG+C+Y+ 
Sbjct  114   NISKMWRELHGSKNWENILDPLHPWLRREITKYGEFVESVYDSLDFDPLSEFCGSCRYNR  173

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + FE+LG+   GY++++Y+YA S++++P +F  SS+   WS+ +NWMG+VAV+ D   +
Sbjct  174   NKLFEELGLTRHGYKVTKYIYAMSHVDVPQWFLSSSLGETWSKDSNWMGFVAVSGDRESL  233

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  942
              R+GRRDIV+AWRGTVT  EW  DL+    P     +     +K++SGFF +Y NSK + 
Sbjct  234   -RIGRRDIVVAWRGTVTPTEWFMDLRTSKEPFDCESEHGKRVVKVQSGFFSIY-NSKSEL  291

Query  943   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaY----DIAEMK  1104
                +   SA EQ + EV RL++ +K  GE +S+T+TGHSLG ALAL++AY    D+ E+ 
Sbjct  292   -ARYNKESASEQTMEEVKRLVKFFKERGEEVSLTITGHSLGGALALMNAYEAARDVPELS  350

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
              N                   VSV SF  PRVGNL FKER + LG+KVLR+VN +D VP 
Sbjct  351   GN-------------------VSVISFGAPRVGNLAFKERLNSLGVKVLRVVNKQDIVPK  391

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
             +PGI+ N+      +L        W Y HVG +L LD   SP++K  +DL  +HNLE +L
Sbjct  392   LPGIVFNKVLN---KLNPITSKLNWVYRHVGTQLKLDVFSSPYVKRDSDLAGSHNLEVYL  448

Query  1465  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDGRWVV  1641
             H++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     GRWV 
Sbjct  449   HVLDGFHRKKSGFRVNARRDVASVNKSTDMLLDHLRIPECWYQVAHKGLILNKQTGRWVK  508

Query  1642  PERS  1653
             P R+
Sbjct  509   PVRA  512



>gb|KDO75376.1| hypothetical protein CISIN_1g037474mg, partial [Citrus sinensis]
Length=517

 Score =   339 bits (869),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 190/425 (45%), Positives = 265/425 (62%), Gaps = 30/425 (7%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI G  DW+ LL+P++  LRREI++YGEFAQA YD+FDFD  S+YCG+C+++  + FE
Sbjct  102   WREIHGCTDWDSLLDPLHPCLRREILKYGEFAQATYDAFDFDRFSEYCGSCRFNSNKIFE  161

Query  607   KLGMADR-GYRISRYLYATSNINLPNFFQHS-SVNRIWSQHANWMGYVAVATDEAEIRRL  780
             KLG+  + GY++ +Y+YA S+I++P +   +  +   WS+ +NWMG+VA+ +DE E  R+
Sbjct  162   KLGLDGKHGYKVCKYIYAMSHIDMPQWLNRTVHLGDTWSRDSNWMGFVAI-SDEEETHRI  220

Query  781   GRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCS  960
             GRRDIV+AWRGTV   EW  D +  L P    DD   K+E GF  +YT+  + T   +  
Sbjct  221   GRRDIVVAWRGTVAPSEWYEDFQRKLEPIGPGDDA--KVEHGFHSIYTSKSEHT--RYSK  276

Query  961   YSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQegege  1134
              SA EQ++ EV RL++ YK  GE +S+T+TGHSLG ALALL+AY+ A             
Sbjct  277   SSASEQVMKEVTRLVKLYKEKGEEVSLTITGHSLGGALALLNAYEAA-------------  323

Query  1135  ssstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKF  1314
                 +    +P+SV SF  PRVGN+ F+++  ++G+K LR+V  +D VP +PG++ NE  
Sbjct  324   ----TTIPGLPISVISFGAPRVGNIAFRDQLHQMGVKTLRVVVKQDLVPKMPGVVFNEGL  379

Query  1315  QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDG  1494
             Q   ++  TL    W Y HVG EL LD   SP+LK G +L   H+ E +LHLVDG+    
Sbjct  380   QKFDEITGTLD---WVYTHVGAELRLDVRSSPYLKHGFNLLGFHSQETYLHLVDGFVCQS  436

Query  1495  RRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSRIEAHPP  1674
               FR    RD+ALVNK  + L  E  +P  W Q ENKG+VR + GRWV P+R   E  P 
Sbjct  437   SSFREDARRDVALVNKACDMLVDELRIPHCWYQMENKGLVRNAHGRWVKPKRE-AEDVPV  495

Query  1675  DTGHH  1689
               G H
Sbjct  496   PVGSH  500



>ref|XP_006468077.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Citrus 
sinensis]
Length=520

 Score =   338 bits (867),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 186/412 (45%), Positives = 261/412 (63%), Gaps = 29/412 (7%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W EI G  DW+ LL+P++  LRREI++YGEFAQA YD+FDFD  S+YCG+C+++  + FE
Sbjct  102   WREIHGCTDWDSLLDPLHPCLRREILKYGEFAQATYDAFDFDRFSEYCGSCRFNSNKIFE  161

Query  607   KLGMADR-GYRISRYLYATSNINLPNFFQHSS-VNRIWSQHANWMGYVAVATDEAEIRRL  780
             KLG+  + GY++ +Y+YA S+I++P +   +  +   WS+ +NWMG+VA+ +DE E  R+
Sbjct  162   KLGLDGKHGYKVCKYIYAMSHIDMPQWLNRTVHLGDTWSRDSNWMGFVAI-SDEEETHRI  220

Query  781   GRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCS  960
             GRRDIV+AWRGTV   EW  D +  L P    DD   K+E GF  +YT+  + T   +  
Sbjct  221   GRRDIVVAWRGTVAPSEWYEDFQRKLEPIGPGDDA--KVEHGFHSIYTSKSEHT--RYSK  276

Query  961   YSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQegege  1134
              SA EQ++ EV RL++ YK  GE +S+T+TGHSLG ALALL+AY+ A             
Sbjct  277   SSASEQVMKEVTRLVKLYKEKGEEVSLTITGHSLGGALALLNAYEAA-------------  323

Query  1135  ssstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKF  1314
                 +    +P+SV SF  PRVGN+ F+++  ++G+K LR+V  +D VP +PG++ NE  
Sbjct  324   ----TTIPGLPISVISFGAPRVGNIAFRDQLHQMGVKTLRVVVKQDLVPKMPGVVFNEGL  379

Query  1315  QYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDG  1494
             Q   ++  TL    W Y HVG EL LD   SP+LK G +L   H+ E +LHLVDG+    
Sbjct  380   QKFDEITGTLD---WVYTHVGAELRLDVRSSPYLKHGFNLLGFHSQETYLHLVDGFVCQS  436

Query  1495  RRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
               FR    RD+ALVNK  + L  E  +P  W Q ENKG+VR + GRWV P+R
Sbjct  437   SSFREDARRDVALVNKACDMLVDELRIPHCWYQMENKGLVRNAHGRWVKPKR  488



>ref|XP_006415481.1| hypothetical protein EUTSA_v10007346mg [Eutrema salsugineum]
 gb|ESQ33834.1| hypothetical protein EUTSA_v10007346mg [Eutrema salsugineum]
Length=529

 Score =   338 bits (866),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 188/426 (44%), Positives = 267/426 (63%), Gaps = 39/426 (9%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             N+ ++W E+ GSK+WE LL+P++  LRREI +YGEF ++ YDS DFDP S++CG+C+Y+ 
Sbjct  113   NISKMWRELHGSKNWENLLDPLHPWLRREITKYGEFVESVYDSLDFDPLSEFCGSCRYNR  172

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + FE+LG+   GY++++Y+YA S++++P +F  SS+   WS+ +NWMG+VAV+ D  E 
Sbjct  173   NKLFEELGLTRHGYKVTKYIYAMSHVDVPQWFLSSSLGETWSKDSNWMGFVAVSGDR-ES  231

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHP-----THFRDDPDIKIESGFFDLYTNSKK  936
              R+GRRDIV+AWRGTVT  EW  DL+    P      H ++   +K++SGFF +Y NSK 
Sbjct  232   MRIGRRDIVVAWRGTVTPTEWFMDLRTSKEPFDCEGQHGKN--VVKVQSGFFSIY-NSKS  288

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaY----DIAE  1098
             +    +   SA EQ + EV RL + +K  GE +S+TVTGHSLG ALAL++AY    D+ E
Sbjct  289   EL-TRYNKESASEQTMEEVKRLAKFFKDRGEEVSLTVTGHSLGGALALMNAYEAAKDVPE  347

Query  1099  MKVNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKV  1278
             +  N                   VSV SF  PRVGNL FKER + LG+KVLR+VN +D V
Sbjct  348   LSGN-------------------VSVISFGAPRVGNLAFKERLNTLGVKVLRVVNKQDIV  388

Query  1279  PTVPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEG  1458
             P +PGI+ N+      +L        W Y HVG +L L+   SP++K  +DL  +HNLE 
Sbjct  389   PKLPGIVFNKVLN---KLNPITSRLNWVYRHVGTQLKLNVFSSPYVKRDSDLAGSHNLEV  445

Query  1459  HLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDGRW  1635
             +LH++DG+H     FR    RD+A VNK +N L     +P  W Q  +KG++     GRW
Sbjct  446   YLHVLDGFHRKKSGFRVNARRDVASVNKSTNMLLDHLRIPECWYQVAHKGLILNKQTGRW  505

Query  1636  VVPERS  1653
             V P R+
Sbjct  506   VKPVRA  511



>ref|XP_007024952.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY27574.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=522

 Score =   336 bits (861),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 182/415 (44%), Positives = 258/415 (62%), Gaps = 30/415 (7%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             N+   W E+ G + W+GL+ P++  LRREI++YGEF +A YD+FDFDP S++CG+C+Y+ 
Sbjct  117   NISTQWRELHGLQHWDGLVEPLHPWLRREIVKYGEFVEATYDAFDFDPLSEFCGSCRYNR  176

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              +FFE+LG+   GY++++Y+YA S++++P +F+ S  +  WS+ +NWMGYVAV+ D AE 
Sbjct  177   RKFFEELGLTQHGYKVTKYIYAMSHVDVPEWFERSYYS--WSKDSNWMGYVAVSGD-AES  233

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
              R+GRRDI++AWRGTV   EW  DLK  L P       +IK++ GF  +Y++  + T  N
Sbjct  234   ARIGRRDILVAWRGTVAPSEWYTDLKTSLQPL---GKTNIKVQLGFLSIYSSKGEFTRYN  290

Query  952   FCSYSAREQLLAEVNRLIE--RYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
                 SA EQ++ E+ RL+   R +GE +S+T+ GHSLG ALALL+AYD A    ++    
Sbjct  291   --KLSASEQVMEEIKRLVSFFRDRGEEVSLTICGHSLGGALALLNAYDAATYFPDLF---  345

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                           +SV SF  PRVGN+ FKE+  ELG+K LR+V  +D VP +PG I N
Sbjct  346   --------------ISVISFGAPRVGNVHFKEKLRELGVKTLRVVVKQDIVPKLPGFILN  391

Query  1306  EKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYH  1485
                    +L T  +   W Y HVG +L LD   SP+L+   D    HNLE +LHLVDG+ 
Sbjct  392   TILN---KLTTVTRRLKWIYRHVGTQLKLDALTSPYLRRDADYTGCHNLETYLHLVDGFI  448

Query  1486  GDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                 +FR    RD+ALVNK ++ L +E  +P  W Q   KG+V    GRWV P R
Sbjct  449   SKTSKFRWNARRDVALVNKTTDMLIKELKIPDSWYQKPFKGLVLNKYGRWVKPGR  503



>emb|CDX77597.1| BnaA07g07350D [Brassica napus]
Length=429

 Score =   332 bits (852),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 184/427 (43%), Positives = 266/427 (62%), Gaps = 38/427 (9%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             N+ ++W E+ GSK+WE +L+P++  LRREI +YGEF ++ YDS DFDP S++CG+C+Y+ 
Sbjct  10    NISKMWRELHGSKNWENILDPLHPWLRREITKYGEFVESVYDSLDFDPLSEFCGSCRYNR  69

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + FE+LG+   GY++++Y+YA S++++P +F  SS+   WS+ +NWMG+VAV+ D   +
Sbjct  70    NKLFEELGLTRHGYKVTKYIYAMSHVDVPQWFLSSSLGETWSKDSNWMGFVAVSGDRESL  129

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  942
              R+GRRDIV+AWRGTVT  EW  DL+    P     +     +K++SGFF +Y NSK + 
Sbjct  130   -RIGRRDIVVAWRGTVTPTEWFMDLRTSKEPFDCESEHGKRVVKVQSGFFSIY-NSKSEL  187

Query  943   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaY----DIAEMK  1104
                +   SA EQ + EV RL++ +K  GE +S+T+TGHSLG ALAL++AY    D+ E+ 
Sbjct  188   -ARYNKESASEQTMEEVKRLVKFFKERGEEVSLTITGHSLGGALALMNAYEAARDVPELS  246

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
              N                   VSV SF  PRVGNL FKER + LG+KVLR+VN +D VP 
Sbjct  247   GN-------------------VSVISFGAPRVGNLAFKERLNSLGVKVLRVVNKQDIVPK  287

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
             +PGI+ N+      +L        W Y HVG +L LD   SP++K  +DL  +HNLE +L
Sbjct  288   LPGIVFNKVLN---KLNPITSKLNWVYRHVGTQLKLDVFSSPYVKRDSDLAGSHNLEVYL  344

Query  1465  HLVDGYHGDGRRFRSATGRDIALVNKD---SNFLKREHGVPPRWRQDENKGMV-RTSDGR  1632
             H++DG+H     FR    RD+A VNK    ++ L     +P  W Q  +KG++     GR
Sbjct  345   HVLDGFHRKKSGFRVNARRDVASVNKSTDITDMLLDHLRIPECWYQVAHKGLILNKQTGR  404

Query  1633  WVVPERS  1653
             WV P R+
Sbjct  405   WVKPVRA  411



>gb|KFK44851.1| hypothetical protein AALP_AA1G310600 [Arabis alpina]
Length=532

 Score =   335 bits (859),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 183/424 (43%), Positives = 263/424 (62%), Gaps = 35/424 (8%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             N+ + W E+ GSK+WE LL+P++  LRRE+ +YGEF ++ YDS DFDP S++CG+C+Y+ 
Sbjct  116   NISKTWRELHGSKNWENLLDPLHPWLRREVTKYGEFVESVYDSLDFDPLSEFCGSCRYNR  175

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + FE+LG+   GY++++Y+YA S +++P +F  S++   WS+ +NWMG+VAV+ D   +
Sbjct  176   NKLFEELGLTRHGYKVTKYIYAMSRVDVPQWFLSSALGETWSKDSNWMGFVAVSGDRESL  235

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  942
              R+GRRDIV+AWRGTVT  EW  DL+          +     +K++SGFF +Y +  + T
Sbjct  236   -RIGRRDIVVAWRGTVTPTEWFMDLRTSKETFDCEGEHGKNVVKVQSGFFSIYNSKCEQT  294

Query  943   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaY----DIAEMK  1104
               N    SA EQ + EV RL + +K  GE++S+TVTGHSLG ALAL++AY    D+ E+ 
Sbjct  295   RYN--KQSASEQTMEEVKRLAKFFKDRGEDVSLTVTGHSLGGALALMNAYEAARDVPELS  352

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
              N                   VSV SF  PRVGNL FKER + LG+KVLR+VN +D VP 
Sbjct  353   GN-------------------VSVISFGAPRVGNLAFKERLNHLGVKVLRVVNKQDIVPK  393

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
             +PGI+ N+      +L        W Y HVG +L LD   SP++K  +DLG +HNLE +L
Sbjct  394   LPGIVFNKVLN---KLNPITSRLNWVYRHVGTQLKLDVFSSPYVKRDSDLGRSHNLEVYL  450

Query  1465  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDGRWVV  1641
             H++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     GRWV 
Sbjct  451   HVLDGFHSKKSGFRVNARRDVASVNKSTDMLLDHLRIPEFWYQVAHKGLILNKQTGRWVK  510

Query  1642  PERS  1653
             P R+
Sbjct  511   PVRA  514



>ref|XP_006364888.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Solanum 
tuberosum]
Length=491

 Score =   333 bits (855),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 182/416 (44%), Positives = 257/416 (62%), Gaps = 29/416 (7%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             ++ + W +I G  +WEGLL+P++  LRREI++YGEFAQA YD+ D D  S+YCG+C Y+ 
Sbjct  84    DISDRWRDIHGVHEWEGLLDPLHPLLRREIVKYGEFAQATYDALDIDSFSEYCGSCMYNS  143

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + F+K G+   GY++++Y+YA S I++P + + S +   WS+ +NW+G+VAV+ DE E 
Sbjct  144   HKLFDKSGLNKSGYKVTKYIYAMSQIDMPQWLERSKLTYTWSKDSNWIGFVAVSDDE-ES  202

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCN  951
             RR+GRRDIV+AWRGTVT  EW  +++  L      D    K+E GF  +YT+    T  N
Sbjct  203   RRIGRRDIVVAWRGTVTPSEWYENMQRKLESIGHMDS---KVEHGFLSIYTSKCDSTRYN  259

Query  952   FCSYSAREQLLAEVNRLIERYK---GENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
                 SA EQ++ E+  L++ YK    E +S+T+TGHSLG ALALL+AY+ A         
Sbjct  260   IS--SASEQVMKELKTLVDFYKTESAEQVSLTITGHSLGGALALLNAYESA---------  308

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
                     +   K+P+SV SFA PRVGN+ F++   ++G+K+LR+   +D VP +PGI+ 
Sbjct  309   --------ANFPKLPISVISFAAPRVGNIAFRDELYQMGVKILRVTVKQDLVPRMPGIVL  360

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             NE  Q    L  TL+   W Y HVG EL LD   SP+LK G +    H LE +LHLVDG+
Sbjct  361   NESLQKFDDLTGTLE---WIYTHVGAELKLDVRSSPYLKRGFNFIGIHMLETYLHLVDGF  417

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                   FRS   RD+ALVNK  + L  E  +P  W Q  +KG+   S GRWV P+R
Sbjct  418   VSSSSTFRSNAKRDVALVNKACDMLVDELRIPTCWYQLAHKGLECNSYGRWVRPKR  473



>ref|XP_002893614.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69873.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=525

 Score =   335 bits (858),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 182/425 (43%), Positives = 263/425 (62%), Gaps = 37/425 (9%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             N+ ++W E+ GS +WE LL+P++  LRRE+ +YGEF ++ YDS DFDP S++CG+ +Y+ 
Sbjct  109   NISKMWRELHGSNNWENLLDPLHPWLRREVTKYGEFVESVYDSLDFDPLSEFCGSSRYNR  168

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + FE+LG+   GY++++Y+YA S++++P +F  S++   WS+ +NWMG+VAV+ D   +
Sbjct  169   NKLFEELGLTKHGYKVTKYIYAMSHVDVPQWFLSSAMGETWSKDSNWMGFVAVSGDRESL  228

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  942
              R+GRRDIV+AWRGTVT  EW  DL+    P   + +     +K++SGFF +Y +  K T
Sbjct  229   -RIGRRDIVVAWRGTVTPTEWFMDLRTSKEPFDCKGEHGKNVVKVQSGFFSIYKSKSKLT  287

Query  943   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
               N    SA EQ + EV RL+  +K  GE +S+T+TGHSLG ALAL++AY+ A       
Sbjct  288   RYN--KESASEQTMEEVKRLVNFFKDRGEEVSLTITGHSLGGALALMNAYEAAR------  339

Query  1117  QegegessstsaatKIP-----VSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVP  1281
                            +P     VSV SF  PRVGNL FKER + LG+KVLR+VN +D VP
Sbjct  340   --------------DVPALSGNVSVISFGAPRVGNLAFKERLNSLGVKVLRVVNKQDIVP  385

Query  1282  TVPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1461
              +PGI+ N+      +L        W Y HVG +L LD   SP++K  +DLG AHNLE +
Sbjct  386   KLPGIVFNKVLN---KLNPITSRLNWVYRHVGTQLKLDVFSSPYVKRDSDLGRAHNLEVY  442

Query  1462  LHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDGRWV  1638
             LH++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     GRWV
Sbjct  443   LHVLDGFHCKKSGFRVNARRDVASVNKSTDMLLDHLRIPEFWYQVAHKGLILNKQTGRWV  502

Query  1639  VPERS  1653
              P R+
Sbjct  503   KPVRA  507



>ref|XP_010460828.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Camelina 
sativa]
Length=525

 Score =   335 bits (858),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 183/425 (43%), Positives = 267/425 (63%), Gaps = 37/425 (9%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             N+ ++W E+ GS +WE LLNP++  LRRE+ +YGEF ++ YDS DFDP S++CG+ +++ 
Sbjct  109   NISKMWRELHGSNNWENLLNPLHPWLRREVTKYGEFVESVYDSLDFDPLSEFCGSSRFNR  168

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + FE+LG+   GY++++++YA S++++P +F  SS+   WS+ +NWMG+VAV+ D   +
Sbjct  169   NKLFEELGLTKHGYKVTKFIYAMSHVDVPQWFLSSSMGETWSKDSNWMGFVAVSGDRESL  228

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  942
              R+GRRDIV+AWRGTVT  EW  DL+    P   +++     +K++SGFF +Y NSK + 
Sbjct  229   -RIGRRDIVVAWRGTVTPTEWFMDLRTSKEPFDCKEEHGKNVVKVQSGFFSIY-NSKSEL  286

Query  943   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
                +   SA EQ + EV RL++ +K  GE +S+TVTGHSLG ALALL+AY+ A       
Sbjct  287   -TRYNKESASEQTMEEVKRLVKFFKDRGEEVSLTVTGHSLGGALALLNAYEAAR------  339

Query  1117  QegegessstsaatKIP-----VSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVP  1281
                            +P     VSVFSF  PRVGNL FKER + LG+KVLR+VN +D VP
Sbjct  340   --------------DVPGLSGNVSVFSFGAPRVGNLAFKERLNSLGVKVLRVVNKQDIVP  385

Query  1282  TVPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1461
              +PGI+ N+       + + L    W Y HVG +L LD   SP++K  +DL  +HNLE +
Sbjct  386   KLPGIVFNKVLNKINPITSRLN---WVYRHVGTQLKLDVFSSPYVKRDSDLARSHNLEVY  442

Query  1462  LHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDGRWV  1638
             LH++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     GRWV
Sbjct  443   LHVLDGFHSKKSGFRVNARRDVASVNKSTDMLLDHLRIPDCWYQVAHKGLILNKQTGRWV  502

Query  1639  VPERS  1653
              P R+
Sbjct  503   KPVRA  507



>ref|XP_010478423.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Camelina 
sativa]
Length=525

 Score =   333 bits (855),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 182/425 (43%), Positives = 266/425 (63%), Gaps = 37/425 (9%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             N+ ++W E+ GS +WE LLNP++  LRRE+ +YGEF ++ YDS DFDP S++CG+ +++ 
Sbjct  109   NISKMWRELHGSNNWENLLNPLHPWLRREVTKYGEFVESVYDSLDFDPLSEFCGSSRFNR  168

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + FE+LG+   GY++++++YA S++++P +F  SS+   WS+ +NWMG+VAV+ D   +
Sbjct  169   NKLFEELGLTKHGYKVTKFIYAMSHVDVPQWFLSSSMGETWSKDSNWMGFVAVSGDRESL  228

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  942
              R+GRRDIV+AWRGTVT  EW  DL+    P   +++     +K++SGFF +Y NSK + 
Sbjct  229   -RIGRRDIVVAWRGTVTPTEWFMDLRTSKEPFDCKEEHGKNVVKVQSGFFSIY-NSKSEL  286

Query  943   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
                +   SA EQ + EV RL+  +K  GE +S+TVTGHSLG ALAL++AY+ A       
Sbjct  287   -TRYNKESASEQTMEEVKRLVNFFKDRGEVVSLTVTGHSLGGALALMNAYEAAR------  339

Query  1117  QegegessstsaatKIP-----VSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVP  1281
                            +P     VSVFSF  PRVGNL FKER + LG+KVLR+VN +D VP
Sbjct  340   --------------DVPGLSGNVSVFSFGAPRVGNLAFKERLNSLGVKVLRVVNKQDIVP  385

Query  1282  TVPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1461
              +PGI+ N+       + + L    W Y HVG +L LD   SP++K  +DL  +HNLE +
Sbjct  386   KLPGIVFNKVLNKINPITSRLN---WVYRHVGTQLKLDVFSSPYVKRDSDLARSHNLEVY  442

Query  1462  LHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDGRWV  1638
             LH++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     GRWV
Sbjct  443   LHVLDGFHSKKSGFRVNARRDVASVNKSTDMLLDHLRIPECWYQVAHKGLILNKQTGRWV  502

Query  1639  VPERS  1653
              P R+
Sbjct  503   KPVRA  507



>ref|XP_010499568.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Camelina 
sativa]
Length=529

 Score =   334 bits (856),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 182/432 (42%), Positives = 269/432 (62%), Gaps = 37/432 (9%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             N+ ++W E+ GS +WE LLNP++  LRRE+ +YGEF ++ YDS DFDP S++CG+ +++ 
Sbjct  113   NISKMWRELHGSNNWENLLNPLHPWLRREVTKYGEFVESVYDSLDFDPLSEFCGSSRFNR  172

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + FE+LG+   GY++++++YA S++++P +F  SS+   WS+ +NWMG++AV+ D   +
Sbjct  173   NKLFEELGLTKHGYKVTKFIYAMSHVDVPQWFLSSSMGETWSKDSNWMGFLAVSGDRESL  232

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  942
              R+GRRDIV+AWRGTVT  EW  DL+    P   +++     +K++SGFF +Y NSK + 
Sbjct  233   -RIGRRDIVVAWRGTVTPTEWFMDLRTSKEPFDCKEEHGKNVVKVQSGFFSIY-NSKSEL  290

Query  943   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVV  1116
                +   SA EQ + EV RL++ +K  GE +S+TVTGHSLG ALAL++AY+ A       
Sbjct  291   -TRYNKESASEQTMEEVKRLVKFFKDRGEEVSLTVTGHSLGGALALMNAYEAAR------  343

Query  1117  QegegessstsaatKIP-----VSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVP  1281
                            +P     VSVFSF  PRVGNL FKER + LG+KVLR+VN +D VP
Sbjct  344   --------------DVPGLSGNVSVFSFGAPRVGNLAFKERLNSLGVKVLRVVNKQDIVP  389

Query  1282  TVPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGH  1461
              +PGI+ N+       + + L    W Y HVG +L LD   SP++K  +DL  +HNLE +
Sbjct  390   KLPGIVFNKVLNKINPITSRLN---WVYRHVGTQLKLDVFSSPYVKRDSDLARSHNLEVY  446

Query  1462  LHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDGRWV  1638
             LH++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     GRWV
Sbjct  447   LHVLDGFHSKKSGFRVNARRDVASVNKSTDMLLDHLRIPECWYQVAHKGLILNKQTGRWV  506

Query  1639  VPERSRIEAHPP  1674
              P R+  +   P
Sbjct  507   KPVRASEDIPSP  518



>emb|CDY02287.1| BnaA09g26150D [Brassica napus]
Length=513

 Score =   333 bits (854),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 184/424 (43%), Positives = 261/424 (62%), Gaps = 51/424 (12%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             N+ + W E+ GSK+WE LL+P++  LRREI +YGEF ++ YDS DFDP S++CG+C+Y+ 
Sbjct  113   NISKAWRELHGSKNWENLLDPLHPWLRREITKYGEFVESVYDSLDFDPLSEFCGSCRYNR  172

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + FE+LG+   GY++++Y+YA S++++P +F  SS+   WS+ +NWMG+VAV+ D   +
Sbjct  173   NKLFEELGLTRHGYKVTKYIYAMSHVDVPQWFLSSSLGETWSKDSNWMGFVAVSGDRESL  232

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  942
              R+GRRDIV+AWRGTVT  EW  DL+    P   + +     +K++SGFF +Y NSK + 
Sbjct  233   -RIGRRDIVVAWRGTVTPTEWFMDLRTSKEPFDCKSEHGKNVVKVQSGFFSIY-NSKSEL  290

Query  943   DCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaY----DIAEMK  1104
                +   SA EQ + EV RL++ +K  GE +S+TVTGHSLG ALAL++AY    D+ E+ 
Sbjct  291   -TRYNKESASEQTMEEVKRLVKFFKDRGEEVSLTVTGHSLGGALALMNAYEAARDVPELS  349

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
              N                   VSV SF  PRVGNL FKER + LG+KVLR+VN +D VP 
Sbjct  350   GN-------------------VSVISFGAPRVGNLAFKERMNSLGVKVLRVVNKQDIVPK  390

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
             +PGI+                   W Y HVG +L LD   SP++K  +DL   HNLE +L
Sbjct  391   LPGIV-------------------WVYRHVGTQLKLDVFTSPYIKQDSDLAGCHNLEVYL  431

Query  1465  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDGRWVV  1641
             H++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     GRWV 
Sbjct  432   HVLDGFHRKKSGFRVNARRDVASVNKSTDMLLDHLRIPECWYQVAHKGLILNKQTGRWVK  491

Query  1642  PERS  1653
             P R+
Sbjct  492   PVRA  495



>ref|XP_002314049.2| hypothetical protein POPTR_0009s06300g [Populus trichocarpa]
 gb|EEE88004.2| hypothetical protein POPTR_0009s06300g [Populus trichocarpa]
Length=526

 Score =   333 bits (853),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 184/416 (44%), Positives = 259/416 (62%), Gaps = 31/416 (7%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             +++  +W EI GS +WE LL+P +  LRREI++YGEFAQ  YD+FDFDP S +CG+C+Y+
Sbjct  119   QSISAVWKEIHGSSNWETLLDPFHPSLRREILKYGEFAQGTYDAFDFDPLSDFCGSCRYN  178

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +FFE LG+   GY++ +Y+YA S++++P + + S     WS+ +NWMGYVAV+  E E
Sbjct  179   RRKFFETLGLTKHGYKVKKYIYALSHVDVPEWLKRSYAT--WSKDSNWMGYVAVSRRE-E  235

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
              +R+GRRDI++AWRGTV+  EW  DL   L      D+ ++K++ GF  +Y +  KD   
Sbjct  236   SQRIGRRDIMVAWRGTVSPSEWFKDLTTSLEHI---DNTNVKVQEGFLSVYKS--KDELT  290

Query  949   NFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
              +   SA EQ++ EV RL+  Y  KGE +S+TVTGHSLG ALALL+AY+ A    ++   
Sbjct  291   RYNKLSASEQVMQEVMRLVNFYRGKGEEVSLTVTGHSLGGALALLNAYEAATAIPDLF--  348

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
                            VSV SF  PRVGN+ FKE+ +ELG+K LR+V  +D VP +PG++ 
Sbjct  349   ---------------VSVISFGAPRVGNIAFKEKLNELGVKTLRVVVKQDIVPKLPGLL-  392

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             N+       L   L    W Y HVG +L LD   SP+LK  +DL  +HNLE +LHL+DG+
Sbjct  393   NKMLNKFHGLTGKLN---WVYRHVGTQLKLDAFMSPYLKPESDLSGSHNLELYLHLIDGF  449

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                  ++R    RD+ALVNK S+ L  +  +P  W Q   KG+V    GRWV P R
Sbjct  450   FSKKSKYRWNARRDLALVNKGSDMLIEDLKIPEFWYQFPYKGLVLNQYGRWVKPGR  505



>emb|CDY09593.1| BnaC05g23260D [Brassica napus]
Length=513

 Score =   332 bits (851),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 183/424 (43%), Positives = 261/424 (62%), Gaps = 51/424 (12%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             N+ + W E+ GSK+WE LL+P++  LRREI +YGEF ++ YDS DFDP S++CG+C+Y+ 
Sbjct  113   NISKAWRELHGSKNWENLLDPLHPWLRREITKYGEFVESVYDSLDFDPLSEFCGSCRYNR  172

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
              + FE+LG+   GY++++Y+YA S++++P +F  SS+   WS+ +NWMG+VAV+ D   +
Sbjct  173   NKLFEELGLTRHGYKVTKYIYAMSHVDVPQWFLRSSLGETWSKDSNWMGFVAVSGDRESL  232

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD---IKIESGFFDLYTNSKKDT  942
              R+GRRDIV+AWRGTVT  EW  DL+    P   + +     +K++SGFF +Y NSK + 
Sbjct  233   -RIGRRDIVVAWRGTVTPTEWFMDLRTSKEPFDCKSEHGKNVVKVQSGFFSIY-NSKSEL  290

Query  943   DCNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaY----DIAEMK  1104
                +   SA EQ + EV RL++ +  +GE +S+TVTGHSLG ALAL++AY    D+ E+ 
Sbjct  291   -TRYNKESASEQTMEEVKRLVKFFTDRGEEVSLTVTGHSLGGALALMNAYEAARDVPELS  349

Query  1105  VNVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
              N                   VSV SF  PRVGNL FKER + LG+KVLR+VN +D VP 
Sbjct  350   GN-------------------VSVISFGAPRVGNLAFKERMNSLGVKVLRVVNKQDIVPK  390

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
             +PGI+                   W Y HVG +L LD   SP++K  +DL   HNLE +L
Sbjct  391   LPGIV-------------------WVYRHVGTQLKLDVFSSPYIKQDSDLAGCHNLEVYL  431

Query  1465  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDGRWVV  1641
             H++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     GRWV 
Sbjct  432   HVLDGFHRKKSGFRVNARRDVASVNKSTDMLLDHLRIPECWYQVAHKGLILNKQTGRWVK  491

Query  1642  PERS  1653
             P R+
Sbjct  492   PVRA  495



>ref|XP_001779106.1| predicted protein [Physcomitrella patens]
 gb|EDQ56052.1| predicted protein [Physcomitrella patens]
Length=469

 Score =   329 bits (844),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 192/429 (45%), Positives = 251/429 (59%), Gaps = 44/429 (10%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
              L E W E+QG+ DW+G+L P+N HLR E+IRYGE AQ  YDSFD+D HSK+CG+C+Y  
Sbjct  40    QLAETWREVQGADDWKGMLEPLNDHLRAELIRYGELAQVSYDSFDYDKHSKFCGSCRYSP  99

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
                FE++ +   GY ++ Y+YAT+N+ + +F + S     WS+ +NW+GYVAV TDE EI
Sbjct  100   DSLFEEVDLHHTGYTVTWYIYATANVRVWSFLRRSEREDAWSKKSNWIGYVAVCTDEKEI  159

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRD-----DPDIKIESGFFDLYTNSKK  936
              RLGRRDI++ WRGTVT LEW  + +  L P  F D     +   K+E+GF  LYT++  
Sbjct  160   NRLGRRDILVVWRGTVTGLEWAANAQYFLVPCAFIDGGNDNESTPKVEAGFLSLYTSA--  217

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVN  1110
             D    F   SARE  + E+ RLIE YK  G  LSIT+ GHSLG+ L LL AYD+A  K+N
Sbjct  218   DDSSRFNKISAREYAVKEIVRLIEEYKDDGHELSITICGHSLGSGLGLLFAYDVANSKLN  277

Query  1111  VVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1290
              + +             IP++VFSF GPRVG+  FK+R ++LGIKVLR+VN  D VP VP
Sbjct  278   QISQERT----------IPITVFSFGGPRVGDGVFKQRVEDLGIKVLRVVNKGDIVPHVP  327

Query  1291  GIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTG-------TDLGCAHN  1449
             G                L++F  +Y H+GVE  LD   S  L          +     HN
Sbjct  328   GT-------------HLLESFKSAYHHLGVEFLLDDQQSLHLNQSKGRHFSLSAFAVHHN  374

Query  1450  LEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTS-D  1626
             LE +LHL+DGY     R+     RD  LVNK   FLK    VP  W Q ENKG+      
Sbjct  375   LEVYLHLIDGYG----RYDKPPTRDPVLVNKGCGFLKENKYVPECWWQVENKGLRYCEYQ  430

Query  1627  GRWVVPERS  1653
              R+  PER+
Sbjct  431   NRYFQPERA  439



>gb|KCW75867.1| hypothetical protein EUGRSUZ_D00253 [Eucalyptus grandis]
Length=433

 Score =   328 bits (841),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 177/411 (43%), Positives = 253/411 (62%), Gaps = 26/411 (6%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W E+ GS DW+ LL+P++  LRREII+YGE AQA YD+FDFD  S+YCG+C+Y+  + F+
Sbjct  11    WREMHGSSDWKDLLDPLHPWLRREIIKYGELAQATYDAFDFDSSSEYCGSCRYNKHKLFD  70

Query  607   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  786
             +LG+   GY+++ Y+YA S++ +P + + S +   WS+ +NW+GY+A + DE E RR+GR
Sbjct  71    ELGLKQNGYKVTEYIYAMSHMEIPRWLERSRLADTWSKDSNWIGYIACSDDE-ETRRIGR  129

Query  787   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYS  966
             RDI++AWRGTV   EW  D +  L P    DD   ++E GF  +YT+  K T  N    S
Sbjct  130   RDILVAWRGTVAPSEWYEDFQRKLEPIGHGDDHHARVEHGFLSIYTSKSKSTRYN--KSS  187

Query  967   AREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegess  1140
             A EQ+++E+ +L++ Y  +GE +S+T+TGHSLG ALALL+A++ +    N          
Sbjct  188   ASEQVMSEIRKLVDLYRDRGEEVSLTITGHSLGGALALLNAHEASSTIPN----------  237

Query  1141  stsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQ-  1317
                    +PVSV SF  PRVGN  F++   + G+K LR+V  +D VP +PG++ NE  + 
Sbjct  238   -------LPVSVISFGAPRVGNGAFRDELHQKGVKTLRVVVKQDMVPKMPGLVFNEGLER  290

Query  1318  YQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGR  1497
             + + +   L+   W Y HVG EL LD   SP+LK G +    H  E +LHLVDG+     
Sbjct  291   FDEHITGALE---WVYTHVGAELKLDVQSSPYLKHGLNFLGFHMTETYLHLVDGFLSTRS  347

Query  1498  RFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
              FR    RD+ALVNK  + L  E  VP  W Q  NKG+V    G+WV P R
Sbjct  348   NFRVDAKRDVALVNKACDMLVDELRVPHSWYQLANKGLVCNEYGKWVKPRR  398



>ref|XP_010052014.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Eucalyptus 
grandis]
Length=520

 Score =   330 bits (847),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 177/411 (43%), Positives = 253/411 (62%), Gaps = 26/411 (6%)
 Frame = +1

Query  427   WAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFE  606
             W E+ GS DW+ LL+P++  LRREII+YGE AQA YD+FDFD  S+YCG+C+Y+  + F+
Sbjct  98    WREMHGSSDWKDLLDPLHPWLRREIIKYGELAQATYDAFDFDSSSEYCGSCRYNKHKLFD  157

Query  607   KLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGR  786
             +LG+   GY+++ Y+YA S++ +P + + S +   WS+ +NW+GY+A + DE E RR+GR
Sbjct  158   ELGLKQNGYKVTEYIYAMSHMEIPRWLERSRLADTWSKDSNWIGYIACSDDE-ETRRIGR  216

Query  787   RDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDCNFCSYS  966
             RDI++AWRGTV   EW  D +  L P    DD   ++E GF  +YT+  K T  N    S
Sbjct  217   RDILVAWRGTVAPSEWYEDFQRKLEPIGHGDDHHARVEHGFLSIYTSKSKSTRYN--KSS  274

Query  967   AREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegess  1140
             A EQ+++E+ +L++ Y  +GE +S+T+TGHSLG ALALL+A++ +    N          
Sbjct  275   ASEQVMSEIRKLVDLYRDRGEEVSLTITGHSLGGALALLNAHEASSTIPN----------  324

Query  1141  stsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIANEKFQ-  1317
                    +PVSV SF  PRVGN  F++   + G+K LR+V  +D VP +PG++ NE  + 
Sbjct  325   -------LPVSVISFGAPRVGNGAFRDELHQKGVKTLRVVVKQDMVPKMPGLVFNEGLER  377

Query  1318  YQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGR  1497
             + + +   L+   W Y HVG EL LD   SP+LK G +    H  E +LHLVDG+     
Sbjct  378   FDEHITGALE---WVYTHVGAELKLDVQSSPYLKHGLNFLGFHMTETYLHLVDGFLSTRS  434

Query  1498  RFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
              FR    RD+ALVNK  + L  E  VP  W Q  NKG+V    G+WV P R
Sbjct  435   NFRVDAKRDVALVNKACDMLVDELRVPHSWYQLANKGLVCNEYGKWVKPRR  485



>ref|XP_011025479.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Populus 
euphratica]
Length=526

 Score =   331 bits (848),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 182/416 (44%), Positives = 258/416 (62%), Gaps = 31/416 (7%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             +++  +W EI GS +WE LL+P++  LRREI++YGEF Q  YD+FDFDP S +CG+C+Y+
Sbjct  119   QSISAVWKEIHGSSNWETLLDPLHPSLRREILKYGEFVQGTYDAFDFDPLSDFCGSCRYN  178

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               +FFE LG+   GY++ RY+YA S++++P + + S     WS+ +NWMGYVAV+  E E
Sbjct  179   RRKFFETLGLTKHGYKVKRYIYALSHVDVPEWLKRSYTT--WSKDSNWMGYVAVSRKE-E  235

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
              +R+GRRDI++AWRGTV+  EW  DL   L      D+ ++K++ GF  +Y +  KD   
Sbjct  236   SQRIGRRDIMVAWRGTVSPSEWFKDLTTSLEHI---DNTNVKVQEGFLSVYKS--KDELT  290

Query  949   NFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
              +    + EQ++ EV RL+  Y  KGE +S+TVTGHSLG ALALL+AY+ A    ++   
Sbjct  291   RYNKLRSSEQVMQEVMRLVNFYRGKGEEVSLTVTGHSLGGALALLNAYEAATAIPDLF--  348

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
                            VSV SF  PRVGN+ FKE+ +ELG+K LR+V  +D VP +PG++ 
Sbjct  349   ---------------VSVISFGAPRVGNIAFKEKLNELGVKTLRVVVKQDIVPKLPGLL-  392

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
             N+       L   L    W Y HVG +L LD   SP+LK  +DL  +HNLE +LHL+DG+
Sbjct  393   NKMLNKFHGLTGKLN---WVYRHVGTQLKLDAFMSPYLKHESDLSGSHNLELYLHLIDGF  449

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                  ++R    RD+ALVNK S+ L  +  +P  W Q   KG+V    GRWV P R
Sbjct  450   FSKKSKYRWNARRDLALVNKGSDMLIEDLKIPEFWYQFPYKGLVLNQHGRWVKPGR  505



>ref|NP_174326.1| DAD1-like acylhydrolase [Arabidopsis thaliana]
 gb|AAG51101.1|AC025295_9 lipase, putative [Arabidopsis thaliana]
 gb|AEE31210.1| DAD1-like acylhydrolase [Arabidopsis thaliana]
Length=529

 Score =   327 bits (838),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 178/424 (42%), Positives = 260/424 (61%), Gaps = 37/424 (9%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             + ++W E+ GS +WE LL+P++  LRRE+ +YGEF ++ YDS DFDP S++CG+ +Y+  
Sbjct  114   ISKMWRELHGSNNWENLLDPLHPWLRREVTKYGEFVESVYDSLDFDPLSEFCGSSRYNRN  173

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
             + FE+LG+   GY++++Y+YA S +++P +F  S++   WS+ +NWMG+VAV+ D   + 
Sbjct  174   KLFEELGLTRHGYKVTKYIYAMSRVDVPQWFLSSALGETWSKDSNWMGFVAVSGDRESL-  232

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFR---DDPDIKIESGFFDLYTNSKKDTD  945
             R+GRRDIV+AWRGTVT  EW  DL+  + P           +K++SGF  +Y NSK +  
Sbjct  233   RIGRRDIVVAWRGTVTPTEWFMDLRTSMEPFDCEGKHGKTVVKVQSGFLSIY-NSKSEL-  290

Query  946   CNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1119
               +   SA EQ + EV RL+  +K  GE +S+T+TGHSLG ALAL++AY+ A        
Sbjct  291   TRYNKESASEQTMDEVKRLVNFFKDRGEEVSLTITGHSLGGALALMNAYEAAR-------  343

Query  1120  egegessstsaatKIP-----VSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPT  1284
                           +P     +SV SF  PRVGNL FKE+ + LG+KVLR+VN +D VP 
Sbjct  344   -------------DVPALSGNISVISFGAPRVGNLAFKEKLNSLGVKVLRVVNKQDIVPK  390

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
             +PGI+ N+      +L        W Y HVG +L LD   SP++K  +DLG AHNLE +L
Sbjct  391   LPGIVFNKVLN---KLNPITSRLNWVYRHVGTQLKLDVFSSPYVKRDSDLGRAHNLEVYL  447

Query  1465  HLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV-RTSDGRWVV  1641
             H++DG+H     FR    RD+A VNK ++ L     +P  W Q  +KG++     GRWV 
Sbjct  448   HVLDGFHRKKSGFRVNARRDVASVNKSTDMLLDHLRIPEFWYQVAHKGLILNKQTGRWVK  507

Query  1642  PERS  1653
             P R+
Sbjct  508   PVRA  511



>gb|EMT07991.1| Lipase [Aegilops tauschii]
Length=474

 Score =   324 bits (831),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 213/474 (45%), Positives = 263/474 (55%), Gaps = 86/474 (18%)
 Frame = +1

Query  292   VSLPAAAINAPPQRETGQSSNKNdeeqeedeelcveedGRNLHEIWAEIQGSKDWEGLLN  471
             V+   +A  APP +E    S   D E+    E     DG  L   W E+ G  DW+GLL+
Sbjct  55    VTSAVSADEAPPTKEKKADSFVGDMERGTLAEESGRSDG-ELTSRWREMHGCNDWDGLLD  113

Query  472   PMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGAQFFEKLGMADRGYRISRYL  651
             P++  LR E+IRYGEF+QACYDSFD+D                           R SRY 
Sbjct  114   PIDRTLRGELIRYGEFSQACYDSFDYD---------------------------RYSRYA  146

Query  652   YATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIRRLGRRDIVIAWRGTVTYLE  831
               T      +FF++                            +GRR        TVT LE
Sbjct  147   -GTCKYAQDSFFKN----------------------------VGRR--------TVTKLE  169

Query  832   WIHDLKNILHPT-HFR---DDPDIKIESGFFDLYTNSKKDTDCNFCSYSAREQLLAEVNR  999
             WI D+   L P   F     DP +K+E GF +LYT+  K+ DC +C YSAREQ+LAEV +
Sbjct  170   WIADITAFLKPIGQFGLPCPDPSVKVEEGFAELYTS--KNPDCKYCKYSAREQVLAEVRK  227

Query  1000  LIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQegegessstsaatKIPVS  1173
             L+ERY  +GE +S+TVTGHSLGAALA+L AYDIAE + NV          ++   K PV 
Sbjct  228   LVERYTGQGEEVSVTVTGHSLGAALAVLCAYDIAETRANV----------STGGAKAPVC  277

Query  1174  VFSFAGPRVGNLRFKERCD-ELGIKVLRIVNVRDKVPTVPGIIANEKFQYQKQLETTLKN  1350
             VFS++GPRVGN  F+ER + ELG+K LRI+NV D VP VPGI                  
Sbjct  278   VFSYSGPRVGNPMFRERFEGELGVKALRILNVHDSVPKVPGIFTEAVLPMPLLRIAGALG  337

Query  1351  FPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIA  1530
              P  Y+H+GVELALDH  SPFLK   DL C HNLE HLHL+DGY G G+ F+   GRD A
Sbjct  338   LPSVYSHIGVELALDHKLSPFLKDVFDLACYHNLEAHLHLLDGYQGRGKEFKLG-GRDPA  396

Query  1531  LVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPERSR-IEAHPPDTGHH  1689
             LVNK ++FL  EH VP  WRQ+ NKGMVRT DGRW++P R R +E HP DT  H
Sbjct  397   LVNKAADFLMDEHMVPDGWRQELNKGMVRTEDGRWMLPHRPRNVEEHPEDTDLH  450



>ref|XP_002298419.2| hypothetical protein POPTR_0001s27040g, partial [Populus trichocarpa]
 gb|EEE83224.2| hypothetical protein POPTR_0001s27040g, partial [Populus trichocarpa]
Length=461

 Score =   323 bits (829),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 177/416 (43%), Positives = 257/416 (62%), Gaps = 31/416 (7%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             +N+  +W EI GS +W+ LL+P++ +LRREI++YGEF +A YD+FDFDP S+YCG+C+Y+
Sbjct  66    QNISAMWQEIHGSSNWDNLLDPLHPNLRREILKYGEFVEATYDAFDFDPLSEYCGSCRYN  125

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               + FE LG+   GY++ RY+YA S++++P + + S  + +WS+ +NWMGYVAV+  E E
Sbjct  126   RHKIFETLGLTKHGYKVKRYIYALSHVDVPQWLKRS--HAMWSKDSNWMGYVAVSRKE-E  182

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
               R+GRRDI++AWRGT+   EW  DL+  L      D+ ++K++ GF  +Y +  KD   
Sbjct  183   SHRIGRRDIMVAWRGTIAPSEWFSDLRTGL---ELIDNTNVKVQEGFLGIYKS--KDEST  237

Query  949   NFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
              +   SA EQ++ EV RL+  Y  KGE +S+TVTGHSLG ALALL+AY+   +  ++   
Sbjct  238   RYNKLSASEQVMQEVVRLVNFYRGKGEEVSLTVTGHSLGGALALLNAYEAKTVIPDLF--  295

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
                            VSV SF  PRVGN+ FKE+ +ELG+K LR+V  +D VP +PG++ 
Sbjct  296   ---------------VSVISFGAPRVGNIAFKEKLNELGVKTLRVVVKQDIVPKLPGLLN  340

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
                 +   +         W Y HVG +L LD   SP+LK  +DL   HNLE +LHL+DG+
Sbjct  341   ----RMLNKFHGLTGKLNWVYRHVGTQLKLDAFTSPYLKHESDLSGCHNLELYLHLIDGF  396

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                  + R    RD+ALVNK S+ L  +  +P  W     KG++    GRWV P R
Sbjct  397   LSSTSKHRWNARRDLALVNKGSDMLIEDLRIPEFWYDFPYKGLMLNKYGRWVKPGR  452



>ref|XP_011047360.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Populus 
euphratica]
Length=523

 Score =   322 bits (826),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 177/416 (43%), Positives = 257/416 (62%), Gaps = 31/416 (7%)
 Frame = +1

Query  409   RNLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             +N+  +W EI GS +W+ LL+P++ +LRREI++YGEFA+A YD+FDFDP S+YCG+C+Y+
Sbjct  114   QNISAMWQEIHGSSNWDNLLDPLHPNLRREILKYGEFAEATYDAFDFDPLSEYCGSCRYN  173

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               + FE  G+   GY++ RY+YA S++++P + + S    +WS+ +NWMGYVAV+  E E
Sbjct  174   RHKIFETSGLTKHGYKVKRYIYALSHVDVPQWLKRSHA--MWSKDSNWMGYVAVSRKE-E  230

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPDIKIESGFFDLYTNSKKDTDC  948
               R+GRRDI++AWRGT++  EW  DL+  L      D+ ++K++ GF  +Y +  KD   
Sbjct  231   SHRIGRRDIMVAWRGTISPSEWFSDLRTGL---ELIDNTNVKVQEGFLGIYKS--KDEST  285

Query  949   NFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQe  1122
              +   SA EQ++ EV RL+  Y  KGE +S+TVTGHSLG ALALL+AY+   +  ++   
Sbjct  286   RYNKLSASEQVMQEVVRLVNFYRGKGEEVSLTVTGHSLGGALALLNAYEAKTVIPDLF--  343

Query  1123  gegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIA  1302
                            VSV SF  PRVGN+ FKE+ +ELG++ LR+V  +D VP +PG++ 
Sbjct  344   ---------------VSVISFGAPRVGNIAFKEKLNELGVRSLRVVVKQDIVPKLPGLLN  388

Query  1303  NEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLVDGY  1482
                 +   +         W Y HVG +L LD   SP+LK  +DL   HNLE +LHL+DG+
Sbjct  389   ----RMLNKFHGLTGKLNWVYRHVGTQLKLDAFTSPYLKHESDLSGCHNLELYLHLIDGF  444

Query  1483  HGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWVVPER  1650
                  + R    RD+ALVNK S+ L  +  +P  W     KG+V    GRWV P R
Sbjct  445   LSRTSKHRWNARRDLALVNKGSDMLIEDLRIPEFWYDFPYKGLVLNKYGRWVKPGR  500



>ref|XP_008783953.1| PREDICTED: galactolipase DONGLE, chloroplastic-like [Phoenix 
dactylifera]
Length=442

 Score =   305 bits (781),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 169/359 (47%), Positives = 228/359 (64%), Gaps = 37/359 (10%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L  +W EIQGS DWE L+ P+N  LR+EI+RYGEF  ACY +FD DP SK    CKY   
Sbjct  64    LASVWREIQGSDDWEDLVEPLNPLLRQEIVRYGEFVAACYKAFDLDPSSKRYLNCKYGKR  123

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
                 ++GM   GY +++Y+YAT +I++P   Q  +        + W+GYVAV+ DE E+R
Sbjct  124   SMLREVGMESSGYEVTKYVYATPDIDIPT--QGGTC------RSRWVGYVAVSKDE-EVR  174

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHF---RDDPDIKIESGFFDLYTNSKKDTD  945
             RLGRRDI++++RGTVT  EWI +LK  L P         PD+K+ESGF  LYT+   ++ 
Sbjct  175   RLGRRDILVSFRGTVTNTEWIANLKCSLTPARLDPHEPRPDVKVESGFLSLYTSD--ESS  232

Query  946   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
             C F S S REQLL+EV+R+I +YK E LSIT+ GHS+G++LALL  YD+AE+ +N     
Sbjct  233   CKFSSGSCREQLLSEVSRIINKYKDEELSITLAGHSMGSSLALLLGYDLAELGLN-----  287

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                     +   +P++V+SFAGPRVGN  FKERC+ELG+KVLR+VNV D V  +PG+  N
Sbjct  288   -----RDGSNRDVPITVYSFAGPRVGNSGFKERCEELGVKVLRVVNVNDPVTKLPGVFLN  342

Query  1306  EKFQYQKQLETTLKNFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
             E      Q+       PWS   YAHVGVELALD     F K   +  C H+++ ++ L+
Sbjct  343   E----NSQVLAGRYKLPWSCSCYAHVGVELALD-----FFKM-KNPACVHDIDAYIGLL  391



>ref|XP_011000043.1| PREDICTED: galactolipase DONGLE, chloroplastic [Populus euphratica]
Length=450

 Score =   305 bits (781),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 172/359 (48%), Positives = 231/359 (64%), Gaps = 37/359 (10%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L  +W E+ G  +WEGL+ P++  LR+EIIRYGEF  ACY +FD DP+SK   TCKY   
Sbjct  74    LAHMWREVHGCNNWEGLVEPLHPFLRQEIIRYGEFVTACYQAFDLDPNSKRYLTCKYGKK  133

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
               F ++GM + GY +++Y+YAT ++N+P      S  R       W+GYVAV++D+A +R
Sbjct  134   NLFREVGMGNPGYEVTKYIYATPDVNIP-IQNEPSCGR-------WVGYVAVSSDDA-VR  184

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPT---HFRDDPDIKIESGFFDLYTNSKKDTD  945
             RLGRRDIVI +RGTVT  EWI +  + L P    H    PD+K+ESGF  LYT+++ D  
Sbjct  185   RLGRRDIVITFRGTVTNPEWIANFMSSLTPAKLDHNNPRPDVKVESGFLSLYTSNESDDK  244

Query  946   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
               F   S REQLL+EV+RL+ RYKGE LSI+++GHS+G++LALL AYDIAE+ +N +   
Sbjct  245   --FGLKSCREQLLSEVSRLLNRYKGEELSISLSGHSMGSSLALLLAYDIAELGLNRLS--  300

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                         IPV+VFSF GPRVGNL FKERC+ELG++VLRIVNV D +  +PG+  N
Sbjct  301   --------PNLDIPVTVFSFGGPRVGNLGFKERCEELGVRVLRIVNVNDPITKLPGVFFN  352

Query  1306  EKFQYQKQLETTLKNFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
             E F    ++      FPWS   YAHVGVE+ LD     F     +  C H+L  ++ L+
Sbjct  353   ENF----RVLGGRYEFPWSCSCYAHVGVEIVLD-----FFNM-QNPSCVHDLGSYISLL  401



>ref|XP_002321113.2| hypothetical protein POPTR_0014s14860g [Populus trichocarpa]
 gb|EEE99428.2| hypothetical protein POPTR_0014s14860g [Populus trichocarpa]
Length=393

 Score =   302 bits (773),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 172/359 (48%), Positives = 231/359 (64%), Gaps = 37/359 (10%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L  +W E+QG  +WEGL+ P++  LR+EIIRYGEF  ACY +FD DP+SK   TCKY   
Sbjct  16    LAHMWREVQGCNNWEGLVEPLHPFLRQEIIRYGEFVTACYQAFDLDPNSKRYLTCKYGKK  75

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
               F ++GM + GY +++Y+YAT ++N+P      S  R       W+GYVAV++D+A +R
Sbjct  76    NLFREVGMGNPGYEVTKYIYATPDVNIP-IQNEPSCGR-------WVGYVAVSSDDA-VR  126

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPT---HFRDDPDIKIESGFFDLYTNSKKDTD  945
             RLGRRDIVI +RGTVT  EWI +  + L P    H    PD+K+ESGF  LYT+++    
Sbjct  127   RLGRRDIVITFRGTVTNPEWIANFMSSLTPAKLDHNNPRPDVKVESGFLSLYTSNESGD-  185

Query  946   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
               F   S REQLL+EV+RL+ RYKGE LSI+++GHS+G++LALL AYDIAE+ +N +   
Sbjct  186   -KFGLKSCREQLLSEVSRLLNRYKGEELSISLSGHSMGSSLALLLAYDIAELGLNRL---  241

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                         IPV+VFSF GPRVGNL FKERC+ELG++VLRIVNV D +  +PG+  N
Sbjct  242   -------GPNLDIPVTVFSFGGPRVGNLGFKERCEELGVRVLRIVNVNDPITKLPGVFLN  294

Query  1306  EKFQYQKQLETTLKNFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
             E F    ++      FPWS   YAHVGVE+ LD     F     +  C H+L  ++ L+
Sbjct  295   ENF----RVLGGRYEFPWSCSCYAHVGVEIVLD-----FFNM-QNPSCVHDLGSYISLL  343



>ref|XP_001779107.1| predicted protein [Physcomitrella patens]
 gb|EDQ56053.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   304 bits (779),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 184/446 (41%), Positives = 252/446 (57%), Gaps = 56/446 (13%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
              L E W E+QG+ DW+G+L P+N HLR E+IRYGEFAQ  YDSFD+D HSK+CG+C+Y  
Sbjct  40    QLAETWREVQGADDWKGMLEPLNDHLRAELIRYGEFAQVSYDSFDYDKHSKFCGSCRYSP  99

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEI  771
                F+ + +   GY ++ Y+YAT+N  + +  + +     WS+ +NWMGYVAV TDE EI
Sbjct  100   DSLFKNVNLHHTGYTVTWYIYATTNERVWSLIKRTEREDAWSKRSNWMGYVAVCTDEKEI  159

Query  772   RRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDDPD-----IKIESGFFDLYTNSKK  936
             +RLGRRDI++ WRGTVT  EW   L + L      D  D      K+E+G  DLYT++  
Sbjct  160   KRLGRRDILVVWRGTVTDREWASKLTSQLVECSCVDGSDHSESTPKVEAGLLDLYTSA--  217

Query  937   DTDCNFCSYSAREQLLAEVNRLIERYK--GENLSITVTGHslgaalallsaYDIAEMKVN  1110
             D    F   SARE  + E+ RLIE YK  G  LSIT+ GHSLG+ L +L A D+A  K+N
Sbjct  218   DAGSKFNKISAREYAVKEIVRLIEEYKDDGHELSITICGHSLGSGLGILFACDVANSKLN  277

Query  1111  VVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVP  1290
              + +             IP++VFSF GP VG+  FK R ++LGIKVLR+VN RD VP++ 
Sbjct  278   QINQERT----------IPITVFSFGGPPVGDGVFKRRVEDLGIKVLRVVNKRDAVPSL-  326

Query  1291  GIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFL------------------  1416
                    +++   L +        + H+GV+  +D + S  L                  
Sbjct  327   -----HTWRFVDILNS-------GHQHLGVQFEVDDTNSEHLDQLKATTRQETLRYEIGE  374

Query  1417  KTGTDLGCAHNLEGHLHLVDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQD  1596
             K  +     HNLE +LHL+DGY     R+     RD  LVNK   FLK    VP  W Q 
Sbjct  375   KHTSAFYNHHNLEVYLHLIDGYG----RYDKPPTRDPVLVNKHCGFLKNSEYVPECWWQP  430

Query  1597  ENKGMVRTSDG-RWVVPERSRIEAHP  1671
             +NKG+  + D  R+  PER+ ++ HP
Sbjct  431   KNKGLKYSKDANRYFQPERA-VKDHP  455



>ref|XP_009631504.1| PREDICTED: galactolipase DONGLE, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=421

 Score =   301 bits (772),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 172/359 (48%), Positives = 230/359 (64%), Gaps = 28/359 (8%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L  +W EIQGSK+WE L+NP+++ L+ EIIRYGEF  ACY++FD DP+SK    CKY   
Sbjct  40    LASMWREIQGSKNWENLVNPLDNLLQNEIIRYGEFVAACYNAFDLDPNSKRYLNCKYGKN  99

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
                 ++G+ + GY +++Y+YAT+NIN+ +  Q+       S    W+GYVAV+ +  E  
Sbjct  100   SMLNEVGLGNSGYNVTKYIYATTNINVLSIGQNC------SSSGKWIGYVAVS-NNVEST  152

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDD---PDIKIESGFFDLYTNSKKDTD  945
             RLGRRD++I +RGTVT  EWI +L + L P H   +   PD+K+E+GF  LYT+++   D
Sbjct  153   RLGRRDVLITFRGTVTNPEWIANLMSTLTPAHLDPNNLRPDVKVEAGFLSLYTSNE---D  209

Query  946   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
               F   S REQLL+E+ R+I  YKGE +SIT+ GHS+G+ALALL AYDIAE+ +N     
Sbjct  210   EKFGLGSCREQLLSEIGRVINMYKGEEMSITIAGHSMGSALALLLAYDIAELGLNTT---  266

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                 S       IPV+VFSF GPRVGNL FKERC+ELGIKVLRIVNV D +  +PG+  N
Sbjct  267   IVPESQVKINNSIPVTVFSFGGPRVGNLGFKERCEELGIKVLRIVNVNDPITKLPGVFLN  326

Query  1306  EKFQYQKQLETTLKNFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
             E F   + L       PWS   YAHVGVE+ LD     F     +  C H+L  +L+L+
Sbjct  327   ENF---RVLLGGKYEVPWSCSCYAHVGVEILLD-----FFNM-QNPTCVHDLATYLNLL  376



>ref|XP_010930439.1| PREDICTED: galactolipase DONGLE, chloroplastic-like [Elaeis guineensis]
Length=449

 Score =   302 bits (773),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 181/401 (45%), Positives = 243/401 (61%), Gaps = 47/401 (12%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L  +W EIQGS DWE L+ P+N  LR EI+RYGEF  ACY  FD DP SK    CKY   
Sbjct  71    LASVWREIQGSDDWEDLVEPLNPLLREEIVRYGEFVAACYKVFDVDPASKRYLNCKYGKK  130

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
                 ++GMA  GY +++Y+YAT +I++P   Q  +        + W+GYVAV+ DE E R
Sbjct  131   SMLREIGMASSGYEVTKYVYATPDIDIPT--QGGTC------CSRWIGYVAVSMDE-EAR  181

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDD-----PDIKIESGFFDLYTNSKKD  939
             RLGRRDI+++ RGTVT  EWI +  + L  T  R D     PD+K+ESGF  LYT+   D
Sbjct  182   RLGRRDILVSIRGTVTTTEWIANFMSSL--TTARLDPHDPRPDVKVESGFLSLYTSD--D  237

Query  940   TDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1119
             + C F S S REQLL+EV+R+I +YK E LSIT+ GHS+G++LALL  YD+AE+ +N   
Sbjct  238   SSCKFSSGSCREQLLSEVSRIINKYKDEELSITLAGHSMGSSLALLLGYDLAELGLN---  294

Query  1120  egegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGII  1299
                       +  ++PV+V+SFAGPRVGN  FKERC+ELG+KVLR+VNV D +  +PG+ 
Sbjct  295   -------RDGSNREVPVTVYSFAGPRVGNSGFKERCEELGVKVLRVVNVNDPITKLPGVF  347

Query  1300  ANEKFQYQKQLETTLKNFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1470
              NEK     ++       PWS   YAHVGVELALD     F K   +  C H+L+ ++ L
Sbjct  348   LNEK----SRVLAGRFELPWSCSCYAHVGVELALD-----FFKM-KNPACVHDLDAYIGL  397

Query  1471  VDGYHGDGRRFRSATGRDIA-LVNKDSNFLKREHGVPPRWR  1590
             +        +  +   +D A L+NK   FL  +     RW+
Sbjct  398   L-----KCPKMAAQVRKDGANLLNKAKKFLSLQKIDAWRWQ  433



>ref|XP_004232943.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=402

 Score =   299 bits (766),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 184/424 (43%), Positives = 251/424 (59%), Gaps = 45/424 (11%)
 Frame = +1

Query  412   NLHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDG  591
             ++ E W E+ G   WEGLLNP++  LR+ II+YGE A+  YD+F  D  SKY G  +Y  
Sbjct  3     SMAEKWEELSGKNKWEGLLNPLDVDLRKYIIQYGELAEVTYDTFISDKVSKYAGASRYSM  62

Query  592   AQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNR-IWSQHANWMGYVAVATDEAE  768
                F  +G+    YR+++Y YATS+I LP+ F   S++R  WS+ +N+MGY+AVATDE +
Sbjct  63    ENLFSNVGLDPSKYRVTKYFYATSSIPLPDAFITKSLSREAWSKESNFMGYIAVATDEGK  122

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNIL--HPTHFRDD---PDIK--IESGFFDLYTN  927
             +  LGRRDIVIAWRGT+  LEW++DL+ +L   P  F D    P  K  +  GF+++YT+
Sbjct  123   V-SLGRRDIVIAWRGTIQTLEWVNDLQFLLIPGPKVFGDGGLLPLFKPLVHHGFYNVYTS  181

Query  928   SKKDTDCNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKV  1107
               +    NF   SAR+Q++ EV RL+E YK E +SITVTGHSLGA+LA L+A+DIA  K+
Sbjct  182   --ESARSNFNKKSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAFDIAYNKI  239

Query  1108  NVVQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELG-IKVLRIVNVRDKVPT  1284
             N           TS   + PV+ F FA P+VG++ F    ++L  + V+RI NV D VP 
Sbjct  240   N----------KTSEGKEFPVTAFVFASPKVGDINFVNAFNKLKHLHVMRIHNVLDIVPK  289

Query  1285  VPGIIANEKFQYQKQLETTLKNFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
              P                     P  Y  VG E+ +D + SP+L    D+   HNLE +L
Sbjct  290   YP---------------------PLGYFDVGQEIIIDTTKSPYLNLPGDILTWHNLECYL  328

Query  1465  HLVDGYHGDG--RRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMVRTSDGRWV  1638
             H V G  G G    F+    RDIALVNK S  LK E+ VP  W   +NKGMV+  DG+WV
Sbjct  329   HGVAGTQGIGLLAGFKLEVDRDIALVNKSSGALKSEYLVPANWWTAKNKGMVQQEDGKWV  388

Query  1639  VPER  1650
             + +R
Sbjct  389   LNDR  392



>ref|XP_006478993.1| PREDICTED: phospholipase A1-Ialpha2, chloroplastic-like [Citrus 
sinensis]
Length=431

 Score =   300 bits (767),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 171/360 (48%), Positives = 233/360 (65%), Gaps = 34/360 (9%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L   W EIQG  DWE L+ P++  LR+EIIRYGE   ACY +FD DP SK    CKY   
Sbjct  43    LAHFWREIQGFNDWENLVEPLHPLLRQEIIRYGELVTACYKAFDLDPVSKRFLNCKYGKN  102

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
                 ++G+ D GY++++Y+YAT +IN+    Q+  V    S  + W+GYVAV++DE+ ++
Sbjct  103   SMMREVGLQDSGYQVTKYIYATPDININIPIQN--VASSSSSCSRWIGYVAVSSDES-VK  159

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDD---PDIKIESGFFDLYTNSKKDTD  945
             RLGRRD+V+++RGTVT  EWI +  + L P     +   PD+K+ESGF  LYT+ + D  
Sbjct  160   RLGRRDVVVSFRGTVTNPEWIANFMSSLTPARLDPNNPRPDVKVESGFLSLYTSDESD--  217

Query  946   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
               F   S REQLL+EV+RL+ +YKGE LSIT+ GHS+G++LALL AYDIAE+ +N  Q  
Sbjct  218   -KFGLGSCREQLLSEVSRLLNKYKGEELSITLAGHSMGSSLALLLAYDIAELGLNKTQ--  274

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                       ++IPV+VFS+ GPRVGN  FK RCDELG+KVLRIVN+ D +  +PG++ N
Sbjct  275   ----------SQIPVTVFSYGGPRVGNSGFKARCDELGVKVLRIVNINDPITKLPGVLLN  324

Query  1306  EKFQYQKQLETTLK-NFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
             E F   + LE   +  FPWS   YAHVGVEL LD     F     +  C H+LE +++L+
Sbjct  325   ENF---RVLELGGRFEFPWSCSCYAHVGVELVLD-----FFNV-QNPSCVHDLESYINLL  375



>ref|XP_007033998.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY04924.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=448

 Score =   300 bits (767),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 168/359 (47%), Positives = 232/359 (65%), Gaps = 38/359 (11%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L   W EIQGS +WE L+ P++  LR+EIIRYGEF  ACY +FD DP+S+    CKY   
Sbjct  71    LSRFWREIQGSNNWENLVEPLHPLLRKEIIRYGEFVAACYKAFDLDPNSRRYLNCKYGKK  130

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
                +++GM + GY++++Y+YAT ++N+P   Q +S  R       W+GYVAV++D+A ++
Sbjct  131   SMLKEVGMENSGYQVTKYIYATPDVNIP--IQTASCGR-------WIGYVAVSSDDA-VK  180

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHF---RDDPDIKIESGFFDLYTNSKKDTD  945
             RLGRRD++I +RGTVT  EW+ +  + L P         P++K+ESGF  LYT+   +TD
Sbjct  181   RLGRRDVLITFRGTVTNHEWVANFMSSLTPARLDPHNPRPEVKVESGFLSLYTSD--ETD  238

Query  946   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
               F   S REQLL+EV+R++ +YKGE LSITV GHS+G+ALALL AYDI E+ +N     
Sbjct  239   SKFGLESCREQLLSEVSRILNKYKGEKLSITVAGHSMGSALALLFAYDITELGLN-----  293

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                   T +  +IPV+VFSF GPRVGN  FK+RC+ELG+KVLRI NV D +  +PG++ N
Sbjct  294   -----KTDSDQEIPVTVFSFGGPRVGNSSFKQRCEELGVKVLRIANVNDPITKLPGVLFN  348

Query  1306  EKFQYQKQLETTLKNFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
             E F    ++      FPWS   YAHVGVEL LD     F     +  C H+LE ++ L+
Sbjct  349   ENF----RVLGGRYEFPWSCSCYAHVGVELVLD-----FFNV-QNPSCVHDLETYISLL  397



>ref|XP_003530907.1| PREDICTED: galactolipase DONGLE, chloroplastic-like [Glycine 
max]
 gb|KHN24955.1| Galactolipase DONGLE, chloroplastic [Glycine soja]
Length=489

 Score =   301 bits (770),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 175/363 (48%), Positives = 232/363 (64%), Gaps = 38/363 (10%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L   W E+QG  +WE LL P++  LR+EIIRYGEF  A Y +FD DP+SK    CKY   
Sbjct  85    LSNFWREVQGCNNWENLLEPLHPLLRQEIIRYGEFVTASYKAFDLDPNSKRYLNCKYGKK  144

Query  595   QFFEKLGMADRGYRISRYLYATS--NINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
             +   ++GM++ GY I++Y+YAT   NINLPN    SS  R       W+GYVAV++DEA 
Sbjct  145   RMLSEVGMSNSGYNITKYIYATPDININLPNITNSSSSGR-------WIGYVAVSSDEA-  196

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH---FRDDPDIKIESGFFDLYTNSKKD  939
             ++RLGRRDI++ +RGTVT  EWI +L + L P     +   P +K+ESGF  LYT S + 
Sbjct  197   VKRLGRRDILVTFRGTVTNQEWISNLMSSLTPAMLDPYNPQPQVKVESGFLSLYT-SDES  255

Query  940   TDCNFCSYSAREQLLAEVNRLIERYKGE--NLSITVTGHslgaalallsaYDIAEMKVNV  1113
             +   F   S REQLL+EV+RL+ RYKGE  NLSI++ GHS+G+ALA+L AYDIAE+ +N 
Sbjct  256   SASKFGLESCREQLLSEVSRLMNRYKGENDNLSISLAGHSMGSALAILLAYDIAELGLN-  314

Query  1114  VQegegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPG  1293
                        S +T++PV+VFSF GPRVGN  FK RC+ELG+KVLRI NV D +  +PG
Sbjct  315   ---------KKSGSTEVPVTVFSFGGPRVGNSEFKHRCEELGVKVLRIANVNDPITKLPG  365

Query  1294  IIANEKFQYQKQLETTLKNFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHL  1464
             ++ NE F   + L      FPWS   YAHVGVEL LD     F     +  C H+L+ ++
Sbjct  366   VVFNENF---RVLLGGRYEFPWSCSCYAHVGVELMLD-----FFNV-QNPSCVHDLDTYI  416

Query  1465  HLV  1473
              L+
Sbjct  417   SLL  419



>ref|XP_003551855.1| PREDICTED: galactolipase DONGLE, chloroplastic-like [Glycine 
max]
 gb|KHN12573.1| Galactolipase DONGLE, chloroplastic [Glycine soja]
Length=499

 Score =   301 bits (770),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 179/392 (46%), Positives = 237/392 (60%), Gaps = 50/392 (13%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L   W E+QG  +WE LL P++  LR+EIIRYGEF  A Y +FD +P+SK    CKY   
Sbjct  83    LSNFWREVQGCNNWENLLEPLHPLLRQEIIRYGEFVTASYKAFDLNPNSKRYLNCKYGKK  142

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
                 ++GM++ GY I++Y+YAT +INLPN     + N   S  A W+GYVAV++DEA ++
Sbjct  143   SMLSEVGMSNSGYNITKYIYATPDINLPNM----TYNNSSSSSARWIGYVAVSSDEA-VK  197

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTH---FRDDPDIKIESGFFDLYTNSKKDTD  945
             RLGRRDI++ +RGTVT  EWI +L + L P     +   P++K+ESGF  LYT+ +    
Sbjct  198   RLGRRDILVTFRGTVTNQEWISNLMSSLTPAMLDPYNPRPEVKVESGFLSLYTSDESSAS  257

Query  946   CNFCSYSAREQLLAEVNRLIERYKG--ENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1119
               F   S REQLL+EV+RL+ +YKG  ENLSI++ GHS+G+ALA+L +YDIAE+ +N   
Sbjct  258   NKFGLESCREQLLSEVSRLMNKYKGEKENLSISLAGHSMGSALAILLSYDIAELGLN---  314

Query  1120  egegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGII  1299
                      S   ++PV+VFSF GPRVGN  FK RC+ELG+KVLRI NV D +  +PG++
Sbjct  315   -------KKSGTHEVPVTVFSFGGPRVGNSEFKHRCEELGVKVLRIANVNDPITKLPGVV  367

Query  1300  ANEKFQYQKQLETTLKNFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1470
              NE F   + L      FPWS   YAHVGVEL LD     F     +  C H+L      
Sbjct  368   FNENF---RVLLGGRYEFPWSCSCYAHVGVELLLD-----FFNV-QNPSCVHDL------  412

Query  1471  VDGYHGDGRRFRSATGRDIALVNKDSNFLKRE  1566
              D Y G  RR            NKD   +KRE
Sbjct  413   -DSYIGLLRR-----------PNKDEVLMKRE  432



>ref|XP_002268142.1| PREDICTED: galactolipase DONGLE, chloroplastic [Vitis vinifera]
Length=446

 Score =   299 bits (766),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 170/359 (47%), Positives = 232/359 (65%), Gaps = 37/359 (10%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L ++W EIQG  +WE L+ P++S LR EIIRYGEF  ACY +FD DP+SK    CKY   
Sbjct  69    LADVWREIQGCNNWEDLVEPLDSLLRNEIIRYGEFVTACYKAFDLDPNSKRYLNCKYGKQ  128

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
                 ++GM   GY +++Y+YAT +IN+P     +S  R       W+GYVAV++DE E +
Sbjct  129   NLLREVGMEKSGYEVTKYIYATPDINIP-IQNGASCGR-------WIGYVAVSSDE-ETK  179

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHF---RDDPDIKIESGFFDLYTNSKKDTD  945
             RLGRRD++I +RGTVT  EWI +L + L P         PD+K+E+GF  LYT+   ++D
Sbjct  180   RLGRRDVLITFRGTVTNHEWIANLMSSLTPARLDPHNPRPDVKVEAGFLSLYTS--DESD  237

Query  946   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
               F   S REQLL+EV+RL+ +YKGE LSIT+ GHS+G++LALL AYDIAE+ +N     
Sbjct  238   SKFGLESCREQLLSEVSRLLNQYKGEELSITLAGHSMGSSLALLLAYDIAELGLN-----  292

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                     ++ +IP++VFSF GPRVGN  FKERC+ELG+KVLR+VNV D +  +PGI+ N
Sbjct  293   -----RDHSSREIPITVFSFGGPRVGNSSFKERCEELGLKVLRVVNVNDPITKLPGIVFN  347

Query  1306  EKFQYQKQLETTLKNFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
             E F    ++      FPWS   YAHVGVE+ LD     F K   +    H+LE +++L+
Sbjct  348   ENF----RVLGGRYEFPWSCSCYAHVGVEVVLD-----FFKM-ENPSYVHDLESYINLL  396



>ref|XP_006443133.1| hypothetical protein CICLE_v10024085mg, partial [Citrus clementina]
 gb|ESR56373.1| hypothetical protein CICLE_v10024085mg, partial [Citrus clementina]
Length=476

 Score =   300 bits (768),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 171/360 (48%), Positives = 233/360 (65%), Gaps = 34/360 (9%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L   W EIQG  DWE L+ P++  LR+EIIRYGE   ACY +FD DP SK    CKY   
Sbjct  88    LAHFWREIQGFNDWENLVEPLHPLLRQEIIRYGELVTACYKAFDLDPVSKRFLNCKYGKN  147

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
                 ++G+ D GY++++Y+YAT +IN+    Q+  V    S  + W+GYVAV++DE+ ++
Sbjct  148   SMMREVGLQDSGYQVTKYIYATPDININIPIQN--VASSSSSCSRWIGYVAVSSDES-VK  204

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHFRDD---PDIKIESGFFDLYTNSKKDTD  945
             RLGRRD+V+++RGTVT  EWI +  + L P     +   PD+K+ESGF  LYT+ + D  
Sbjct  205   RLGRRDVVVSFRGTVTNPEWIANFMSSLTPARLDPNNPRPDVKVESGFLSLYTSDESD--  262

Query  946   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
               F   S REQLL+EV+RL+ +YKGE LSIT+ GHS+G++LALL AYDIAE+ +N  Q  
Sbjct  263   -KFGLGSCREQLLSEVSRLLNKYKGEELSITLAGHSMGSSLALLLAYDIAELGLNKTQ--  319

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                       ++IPV+VFS+ GPRVGN  FK RCDELG+KVLRIVN+ D +  +PG++ N
Sbjct  320   ----------SQIPVTVFSYGGPRVGNSGFKARCDELGVKVLRIVNINDPITKLPGVLLN  369

Query  1306  EKFQYQKQLETTLK-NFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
             E F   + LE   +  FPWS   YAHVGVEL LD     F     +  C H+LE +++L+
Sbjct  370   ENF---RVLELGGRFEFPWSCSCYAHVGVELVLD-----FFNV-QNPSCVHDLESYINLL  420



>ref|XP_008791829.1| PREDICTED: galactolipase DONGLE, chloroplastic [Phoenix dactylifera]
Length=384

 Score =   296 bits (759),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 164/359 (46%), Positives = 227/359 (63%), Gaps = 37/359 (10%)
 Frame = +1

Query  415   LHEIWAEIQGSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYDGA  594
             L  +W E+QG+ DWE L+ P++  LR EI+RYGE   ACY +FD DP SK    CKY   
Sbjct  8     LASVWREVQGADDWEDLVEPLHPLLREEIVRYGELVAACYKAFDLDPSSKRYLNCKYGKN  67

Query  595   QFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAEIR  774
                 ++GMA  GY++++Y+YAT +I++P     S   R     + W+GYVAV+ DE E+R
Sbjct  68    SMLREVGMAGSGYKVTKYIYATPDISIPT---QSGTCR-----SRWIGYVAVSGDE-EVR  118

Query  775   RLGRRDIVIAWRGTVTYLEWIHDLKNILHPTHF---RDDPDIKIESGFFDLYTNSKKDTD  945
              LGRRDI++++RGTVT  EWI +  + L P         PD+K+ESGF  LYT+   D+ 
Sbjct  119   SLGRRDILVSFRGTVTNTEWIANFMSSLTPARLDPHDPRPDVKVESGFLSLYTSD--DSS  176

Query  946   CNFCSYSAREQLLAEVNRLIERYKGENLSITVTGHslgaalallsaYDIAEMKVNVVQeg  1125
             C F S S REQLL+EV+R++ +YK E LSIT+ GHS+G++LALL  YD+AE+ +N     
Sbjct  177   CKFSSGSCREQLLSEVSRIVNKYKDEELSITLAGHSMGSSLALLLGYDLAELGLN-----  231

Query  1126  egessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGIIAN  1305
                    ++  ++P++V+SF GPRVGN  FKERCDELG+KVLR+VNV D V  +PG+  N
Sbjct  232   -----RDASNREVPITVYSFGGPRVGNSGFKERCDELGVKVLRVVNVNDPVTKLPGVFLN  286

Query  1306  EKFQYQKQLETTLKNFPWS---YAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHLV  1473
             E      ++       PWS   YAHVGVELALD     F K   +  C H+L+ ++ L+
Sbjct  287   ENL----RVLAGRFELPWSCSCYAHVGVELALD-----FFKM-KNPACVHDLDAYIGLL  335



>ref|XP_002272558.2| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Vitis 
vinifera]
Length=511

 Score =   300 bits (768),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 176/426 (41%), Positives = 262/426 (62%), Gaps = 45/426 (11%)
 Frame = +1

Query  412   NLHEIWAEIQ-GSKDWEGLLNPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGTCKYD  588
             N+   W E+  GS  WE LL+P++  LRREI++YGEFAQA YD+F+ D      G C+ +
Sbjct  114   NMSNKWHELHAGSSKWEHLLDPLHPWLRREIVKYGEFAQATYDAFNND-----SGNCQCE  168

Query  589   GAQFFEKLGMADRGYRISRYLYATSNINLPNFFQHSSVNRIWSQHANWMGYVAVATDEAE  768
               + F++L +   GY++++Y+YA S++   ++ + S   + WS+ +NW+G+VAV+TD+ E
Sbjct  169   RHKLFDELHLTKHGYKVTKYIYAMSHVGGLHYLERSQFTQTWSKDSNWIGFVAVSTDD-E  227

Query  769   IRRLGRRDIVIAWRGTVTYLEWIHDLK-NILHPTHFRDDPDIKIESGFFDLYTNSKKDTD  945
              +R+GRRDIV+AWRGTV   EW+ D +  +LH      + D+ +E GF  +Y++  + T 
Sbjct  228   SQRIGRRDIVMAWRGTVAVSEWVLDFEAKLLHI----GEGDVMVEYGFHKIYSSKSESTR  283

Query  946   CNFCSYSAREQLLAEVNRLIERY--KGENLSITVTGHslgaalallsaYDIAEMKVNVVQ  1119
              N   +SA EQ++ EV  L++ Y  +GE +S T+TGHSLG ALALL+AY+ A        
Sbjct  284   YN--KFSASEQVMEEVKNLVKFYGERGEEVSFTITGHSLGGALALLNAYEAA--------  333

Query  1120  egegessstsaatKIPVSVFSFAGPRVGNLRFKERCDELGIKVLRIVNVRDKVPTVPGII  1299
                      +    +P++V SF  P+VGN+ F+++ DE+ ++ LRIV  +DKVPT+P   
Sbjct  334   ---------ATLPDLPITVISFGAPQVGNIAFRDKIDEMKVRTLRIVVKQDKVPTLP---  381

Query  1300  ANEKFQYQKQLETTLK---NFPWSYAHVGVELALDHSYSPFLKTGTDLGCAHNLEGHLHL  1470
               EKF   K L+  L       W Y HVG ELALD + SP+LK        HNLE +LHL
Sbjct  382   --EKFMSTKILQRLLSLTGTRKWVYTHVGEELALDMTSSPYLKRKFSYKDCHNLEIYLHL  439

Query  1471  VDGYHGDGRRFRSATGRDIALVNKDSNFLKREHGVPPRWRQDENKGMV--RTSDGRWVVP  1644
             +DG+H +   F+    RDIALVNK+S  L  E G+P  W Q  NKG++   ++ GRWV  
Sbjct  440   LDGFHREDSSFQKGARRDIALVNKNSGMLIEELGIPENWYQVPNKGLMIFNSTSGRWV--  497

Query  1645  ERSRIE  1662
             +RSR++
Sbjct  498   KRSRVD  503



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6668028586648