BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25518_g3_i3 len=2342 path=[1:0-966 968:967-987 @989@!:988-2216
2218:2217-2341]

Length=2342
                                                                      Score     E

emb|CDP00585.1|  unnamed protein product                                855   0.0      
ref|XP_009771929.1|  PREDICTED: mediator of RNA polymerase II tra...    832   0.0      
ref|XP_011077190.1|  PREDICTED: mediator of RNA polymerase II tra...    819   0.0      
ref|XP_006354095.1|  PREDICTED: mediator of RNA polymerase II tra...    818   0.0      
ref|XP_004252687.1|  PREDICTED: mediator of RNA polymerase II tra...    805   0.0      
ref|XP_011070829.1|  PREDICTED: mediator of RNA polymerase II tra...    803   0.0      
ref|XP_002278845.1|  PREDICTED: mediator of RNA polymerase II tra...    802   0.0      Vitis vinifera
ref|XP_007046291.1|  Phytochrome and flowering time regulatory pr...    797   0.0      
gb|KDO70069.1|  hypothetical protein CISIN_1g003284mg                   789   0.0      
gb|KHG24986.1|  Mediator of RNA polymerase II transcription subun...    788   0.0      
emb|CBI27055.3|  unnamed protein product                                786   0.0      
ref|XP_006437725.1|  hypothetical protein CICLE_v10030710mg             786   0.0      
ref|XP_007046292.1|  Phytochrome and flowering time regulatory pr...    785   0.0      
gb|KDO70068.1|  hypothetical protein CISIN_1g003284mg                   783   0.0      
ref|XP_006484420.1|  PREDICTED: mediator of RNA polymerase II tra...    780   0.0      
ref|XP_009356323.1|  PREDICTED: mediator of RNA polymerase II tra...    775   0.0      
ref|XP_009356316.1|  PREDICTED: mediator of RNA polymerase II tra...    768   0.0      
ref|XP_010265228.1|  PREDICTED: mediator of RNA polymerase II tra...    760   0.0      
ref|XP_008243186.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...    751   0.0      
gb|KDO70070.1|  hypothetical protein CISIN_1g003284mg                   729   0.0      
ref|XP_004135110.1|  PREDICTED: mediator of RNA polymerase II tra...    729   0.0      
ref|XP_004297135.1|  PREDICTED: mediator of RNA polymerase II tra...    728   0.0      
ref|XP_008339697.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...    709   0.0      
ref|XP_006574879.1|  PREDICTED: mediator of RNA polymerase II tra...    706   0.0      
gb|KEH27965.1|  phytochrome and flowering time regulatory protein       700   0.0      
ref|XP_007153353.1|  hypothetical protein PHAVU_003G028300g             697   0.0      
ref|XP_004513303.1|  PREDICTED: mediator of RNA polymerase II tra...    692   0.0      
ref|XP_006573255.1|  PREDICTED: mediator of RNA polymerase II tra...    691   0.0      
ref|XP_010672164.1|  PREDICTED: mediator of RNA polymerase II tra...    690   0.0      
ref|XP_010052625.1|  PREDICTED: mediator of RNA polymerase II tra...    687   0.0      
ref|XP_010672163.1|  PREDICTED: mediator of RNA polymerase II tra...    685   0.0      
ref|XP_010923559.1|  PREDICTED: mediator of RNA polymerase II tra...    682   0.0      
ref|XP_008791235.1|  PREDICTED: mediator of RNA polymerase II tra...    680   0.0      
ref|XP_009595471.1|  PREDICTED: mediator of RNA polymerase II tra...    679   0.0      
ref|XP_009595475.1|  PREDICTED: mediator of RNA polymerase II tra...    677   0.0      
ref|XP_010923554.1|  PREDICTED: mediator of RNA polymerase II tra...    674   0.0      
ref|XP_009595469.1|  PREDICTED: mediator of RNA polymerase II tra...    674   0.0      
ref|XP_009595472.1|  PREDICTED: mediator of RNA polymerase II tra...    674   0.0      
ref|XP_009595473.1|  PREDICTED: mediator of RNA polymerase II tra...    671   0.0      
ref|XP_009595470.1|  PREDICTED: mediator of RNA polymerase II tra...    672   0.0      
ref|XP_009782374.1|  PREDICTED: mediator of RNA polymerase II tra...    664   0.0      
ref|XP_008791236.1|  PREDICTED: mediator of RNA polymerase II tra...    641   0.0      
ref|XP_009414709.1|  PREDICTED: mediator of RNA polymerase II tra...    639   0.0      
ref|XP_009604841.1|  PREDICTED: mediator of RNA polymerase II tra...    612   0.0      
gb|KDO70071.1|  hypothetical protein CISIN_1g003284mg                   608   0.0      
gb|KDP29373.1|  hypothetical protein JCGZ_18294                         607   0.0      
ref|XP_009782378.1|  PREDICTED: mediator of RNA polymerase II tra...    605   0.0      
ref|XP_009595474.1|  PREDICTED: mediator of RNA polymerase II tra...    607   0.0      
gb|KCW76700.1|  hypothetical protein EUGRSUZ_D01061                     609   0.0      
gb|ABM81545.1|  phytochrome and flowering time protein 1                602   0.0      
ref|XP_009782377.1|  PREDICTED: mediator of RNA polymerase II tra...    600   0.0      
gb|KDO70072.1|  hypothetical protein CISIN_1g003284mg                   588   0.0      
gb|KHN25577.1|  Mediator of RNA polymerase II transcription subun...    599   0.0      
ref|XP_008670123.1|  PREDICTED: mediator of RNA polymerase II tra...    590   0.0      
tpg|DAA39874.1|  TPA: hypothetical protein ZEAMMB73_491348              588   0.0      
ref|XP_010923566.1|  PREDICTED: mediator of RNA polymerase II tra...    568   0.0      
tpg|DAA39875.1|  TPA: hypothetical protein ZEAMMB73_491348              570   0.0      
ref|XP_008670124.1|  PREDICTED: mediator of RNA polymerase II tra...    556   0.0      
ref|XP_006573257.1|  PREDICTED: mediator of RNA polymerase II tra...    528   5e-173   
ref|XP_010923574.1|  PREDICTED: mediator of RNA polymerase II tra...    524   8e-172   
ref|XP_010089730.1|  hypothetical protein L484_013924                   519   7e-166   
gb|EEE69415.1|  hypothetical protein OsJ_28785                          511   5e-165   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011021763.1|  PREDICTED: mediator of RNA polymerase II tra...    511   7e-165   
ref|XP_002311445.2|  hypothetical protein POPTR_0008s11650g             506   1e-162   Populus trichocarpa [western balsam poplar]
ref|XP_002529152.1|  conserved hypothetical protein                     492   1e-161   Ricinus communis
ref|XP_010105771.1|  hypothetical protein L484_009967                   486   1e-158   
gb|EYU29950.1|  hypothetical protein MIMGU_mgv1a001668mg                485   3e-156   
gb|EYU29949.1|  hypothetical protein MIMGU_mgv1a001668mg                485   8e-156   
ref|XP_004166861.1|  PREDICTED: mediator of RNA polymerase II tra...    468   9e-152   
gb|KGN52054.1|  hypothetical protein Csa_5G608420                       468   1e-150   
ref|XP_002315956.1|  PHYTOCHROME AND FLOWERING TIME 1 family protein    472   1e-150   Populus trichocarpa [western balsam poplar]
gb|EPS74095.1|  hypothetical protein M569_00660                         461   8e-150   
ref|XP_008446563.1|  PREDICTED: mediator of RNA polymerase II tra...    471   1e-149   
gb|AGM20684.1|  PFT                                                     460   6e-145   
ref|XP_010672165.1|  PREDICTED: mediator of RNA polymerase II tra...    452   3e-144   
ref|XP_009336605.1|  PREDICTED: mediator of RNA polymerase II tra...    442   1e-140   
ref|XP_010477906.1|  PREDICTED: mediator of RNA polymerase II tra...    442   7e-139   
ref|XP_006306776.1|  hypothetical protein CARUB_v10008315mg             441   2e-138   
ref|XP_010532164.1|  PREDICTED: mediator of RNA polymerase II tra...    440   4e-138   
ref|XP_010462903.1|  PREDICTED: mediator of RNA polymerase II tra...    438   9e-138   
ref|XP_002890684.1|  hypothetical protein ARALYDRAFT_472815             439   1e-137   
gb|KFK44547.1|  phytochrome and flowering time regulatory protein 1     431   1e-134   
ref|XP_006415883.1|  hypothetical protein EUTSA_v10006778mg             425   2e-134   
ref|NP_173925.3|  mediator of RNA polymerase II transcription sub...    430   5e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109891.1|  PREDICTED: mediator of RNA polymerase II tra...    429   7e-134   
ref|XP_009109890.1|  PREDICTED: mediator of RNA polymerase II tra...    429   9e-134   
ref|XP_009336606.1|  PREDICTED: mediator of RNA polymerase II tra...    423   1e-133   
ref|XP_010551298.1|  PREDICTED: mediator of RNA polymerase II tra...    426   2e-133   
ref|XP_009336607.1|  PREDICTED: mediator of RNA polymerase II tra...    422   4e-133   
emb|CDY24392.1|  BnaCnng04590D                                          424   2e-132   
ref|XP_004513304.1|  PREDICTED: mediator of RNA polymerase II tra...    422   6e-132   
dbj|BAJ34376.1|  unnamed protein product                                425   6e-132   
ref|XP_006415884.1|  hypothetical protein EUTSA_v10006778mg             425   7e-132   
emb|CDY42096.1|  BnaA09g28640D                                          422   7e-132   
ref|XP_009115336.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...    423   4e-131   
ref|XP_010551292.1|  PREDICTED: mediator of RNA polymerase II tra...    421   5e-131   
emb|CDY36100.1|  BnaA08g19480D                                          421   5e-131   
emb|CDX84998.1|  BnaC05g20570D                                          416   2e-129   
ref|XP_010551299.1|  PREDICTED: mediator of RNA polymerase II tra...    403   9e-125   
ref|XP_008353070.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...    390   2e-123   
ref|XP_010551294.1|  PREDICTED: mediator of RNA polymerase II tra...    399   7e-123   
ref|XP_006843755.1|  hypothetical protein AMTR_s00007p00235560          394   1e-121   
ref|XP_004956526.1|  PREDICTED: mediator of RNA polymerase II tra...    395   2e-121   
ref|XP_010499097.1|  PREDICTED: mediator of RNA polymerase II tra...    393   3e-120   
ref|XP_010238042.1|  PREDICTED: mediator of RNA polymerase II tra...    368   1e-110   
dbj|BAD36509.1|  putative SMA-9 class B                                 365   1e-109   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009336608.1|  PREDICTED: mediator of RNA polymerase II tra...    359   2e-109   
gb|EEC84311.1|  hypothetical protein OsI_30806                          363   1e-107   Oryza sativa Indica Group [Indian rice]
ref|XP_006661102.1|  PREDICTED: mediator of RNA polymerase II tra...    343   8e-101   
ref|XP_004300904.1|  PREDICTED: mediator of RNA polymerase II tra...    306   7e-91    
ref|XP_004959349.1|  PREDICTED: mediator of RNA polymerase II tra...    295   2e-86    
gb|AAF65166.2|AF166494_1  putative phloem transcription factor M1       286   2e-85    Apium graveolens
ref|XP_008340292.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...    294   3e-85    
gb|KEH39855.1|  mediator of RNA polymerase II transcription subun...    291   3e-84    
ref|XP_006574880.1|  PREDICTED: mediator of RNA polymerase II tra...    276   3e-82    
ref|XP_006573263.1|  PREDICTED: mediator of RNA polymerase II tra...    273   9e-82    
ref|XP_006573262.1|  PREDICTED: mediator of RNA polymerase II tra...    273   1e-81    
ref|XP_006573258.1|  PREDICTED: mediator of RNA polymerase II tra...    273   1e-81    
gb|EMT10095.1|  hypothetical protein F775_05844                         274   1e-81    
ref|XP_010477908.1|  PREDICTED: mediator of RNA polymerase II tra...    284   2e-80    
ref|XP_010663571.1|  PREDICTED: mediator of RNA polymerase II tra...    251   1e-73    
gb|AAG50810.1|AC079281_12  hypothetical protein                         259   6e-73    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001077596.1|  mediator of RNA polymerase II transcription ...    259   3e-71    Arabidopsis thaliana [mouse-ear cress]
gb|EPS63132.1|  hypothetical protein M569_11655                         233   5e-68    
gb|EMT10094.1|  hypothetical protein F775_05843                         243   3e-67    
gb|KHN27175.1|  Mediator of RNA polymerase II transcription subun...    231   3e-66    
ref|XP_011070854.1|  PREDICTED: mediator of RNA polymerase II tra...    232   3e-66    
ref|XP_002969081.1|  hypothetical protein SELMODRAFT_440592             244   1e-64    
ref|XP_002973982.1|  hypothetical protein SELMODRAFT_442372             229   1e-60    
gb|EMS65916.1|  hypothetical protein TRIUR3_16672                       219   3e-57    
ref|XP_003614497.1|  PHYTOCHROME AND FLOWERING TIME                     203   7e-55    
gb|AFK48085.1|  unknown                                                 201   6e-54    
gb|KEH27968.1|  hypothetical protein MTR_5g054690                       192   2e-51    
ref|XP_010501597.1|  PREDICTED: mediator of RNA polymerase II tra...    185   4e-51    
gb|KEH27966.1|  hypothetical protein MTR_5g054690                       192   4e-51    
gb|KEH27967.1|  hypothetical protein MTR_5g054690                       192   5e-51    
ref|XP_002964016.1|  hypothetical protein SELMODRAFT_405603             196   3e-50    
gb|ABR17109.1|  unknown                                                 186   2e-48    Picea sitchensis
ref|XP_001778121.1|  predicted protein                                  193   4e-48    
ref|XP_004173267.1|  PREDICTED: mediator of RNA polymerase II tra...    180   4e-48    
ref|XP_008670907.1|  PREDICTED: uncharacterized protein LOC103648...    190   6e-47    
ref|XP_008670906.1|  PREDICTED: uncharacterized protein LOC103648...    190   6e-47    
gb|KDP29374.1|  hypothetical protein JCGZ_18295                         176   1e-46    
ref|XP_009616759.1|  PREDICTED: mediator of RNA polymerase II tra...    174   6e-46    
ref|XP_008390014.1|  PREDICTED: mediator of RNA polymerase II tra...    165   7e-41    
ref|XP_004238955.2|  PREDICTED: mediator of RNA polymerase II tra...    157   1e-38    
ref|XP_001778157.1|  predicted protein                                  149   7e-36    
gb|AAX47175.1|  PHYTOCHROME AND FLOWERING TIME 1                        136   3e-32    Pisum sativum [garden pea]
ref|XP_003623987.1|  PHYTOCHROME AND FLOWERING TIME                     133   8e-32    
emb|CBI15421.3|  unnamed protein product                                129   5e-31    
ref|XP_002967906.1|  hypothetical protein SELMODRAFT_408814             130   1e-30    
ref|XP_006606654.1|  PREDICTED: mediator of RNA polymerase II tra...    134   2e-29    
ref|NP_001062824.2|  Os09g0306700                                       123   2e-28    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010320776.1|  PREDICTED: mediator of RNA polymerase II tra...    122   9e-27    
gb|KEH27075.1|  mediator complex subunit 25 von willebrand factor...    124   6e-26    
gb|KEH27076.1|  mediator complex subunit 25 von willebrand factor...    119   2e-24    
ref|XP_008361736.1|  PREDICTED: mediator of RNA polymerase II tra...  97.8    5e-19    
ref|XP_007152798.1|  hypothetical protein PHAVU_004G1605000g            100   1e-18    
ref|XP_007152799.1|  hypothetical protein PHAVU_004G160600g           94.0    7e-17    
ref|XP_004071275.1|  PREDICTED: uncharacterized protein LOC101164559  84.3    2e-13    
ref|XP_010087336.1|  hypothetical protein L484_012669                 82.0    3e-13    
ref|NP_001096266.1|  mediator of RNA polymerase II transcription ...  84.0    3e-13    Xenopus tropicalis [western clawed frog]
ref|NP_001085778.1|  mediator of RNA polymerase II transcription ...  82.0    1e-12    Xenopus laevis [clawed frog]
ref|XP_003964989.1|  PREDICTED: uncharacterized protein LOC101068687  81.3    2e-12    
ref|XP_006274932.1|  PREDICTED: mediator of RNA polymerase II tra...  81.3    2e-12    
ref|XP_006274931.1|  PREDICTED: mediator of RNA polymerase II tra...  81.3    2e-12    
ref|XP_010766997.1|  PREDICTED: mediator of RNA polymerase II tra...  80.9    2e-12    
ref|XP_010766989.1|  PREDICTED: mediator of RNA polymerase II tra...  80.9    2e-12    
ref|XP_008843323.1|  PREDICTED: mediator of RNA polymerase II tra...  80.9    3e-12    
ref|XP_010767004.1|  PREDICTED: mediator of RNA polymerase II tra...  80.9    3e-12    
ref|XP_006681386.1|  hypothetical protein BATDEDRAFT_27121            80.9    3e-12    
ref|XP_008173946.1|  PREDICTED: mediator of RNA polymerase II tra...  80.1    3e-12    
ref|XP_008296616.1|  PREDICTED: mediator of RNA polymerase II tra...  79.7    6e-12    
ref|XP_008296615.1|  PREDICTED: mediator of RNA polymerase II tra...  79.7    6e-12    
ref|XP_005810191.1|  PREDICTED: mediator of RNA polymerase II tra...  79.7    6e-12    
ref|XP_008296614.1|  PREDICTED: mediator of RNA polymerase II tra...  79.7    6e-12    
ref|XP_008296617.1|  PREDICTED: mediator of RNA polymerase II tra...  79.3    7e-12    
ref|XP_004811689.1|  PREDICTED: mediator of RNA polymerase II tra...  79.7    7e-12    
ref|XP_004552537.1|  PREDICTED: mediator of RNA polymerase II tra...  79.3    7e-12    
ref|XP_004552539.1|  PREDICTED: mediator of RNA polymerase II tra...  79.3    7e-12    
ref|XP_006362546.1|  PREDICTED: mediator of RNA polymerase II tra...  73.6    8e-12    
ref|XP_008843319.1|  PREDICTED: mediator of RNA polymerase II tra...  79.3    8e-12    
ref|XP_008296620.1|  PREDICTED: mediator of RNA polymerase II tra...  79.3    8e-12    
ref|XP_008296619.1|  PREDICTED: mediator of RNA polymerase II tra...  79.3    8e-12    
ref|XP_008296618.1|  PREDICTED: mediator of RNA polymerase II tra...  79.3    8e-12    
ref|XP_005726321.1|  PREDICTED: mediator of RNA polymerase II tra...  79.3    8e-12    
ref|XP_005726323.1|  PREDICTED: mediator of RNA polymerase II tra...  79.3    8e-12    
ref|XP_005726325.1|  PREDICTED: mediator of RNA polymerase II tra...  79.0    8e-12    
ref|XP_007562204.1|  PREDICTED: mediator of RNA polymerase II tra...  79.0    9e-12    
ref|XP_008414619.1|  PREDICTED: mediator of RNA polymerase II tra...  79.0    9e-12    
ref|XP_004552540.1|  PREDICTED: mediator of RNA polymerase II tra...  79.0    9e-12    
ref|XP_004552541.1|  PREDICTED: mediator of RNA polymerase II tra...  79.0    9e-12    
ref|XP_007562206.1|  PREDICTED: mediator of RNA polymerase II tra...  79.0    9e-12    
ref|XP_007562205.1|  PREDICTED: mediator of RNA polymerase II tra...  79.0    9e-12    
ref|XP_008296622.1|  PREDICTED: mediator of RNA polymerase II tra...  79.0    9e-12    
ref|XP_008843322.1|  PREDICTED: mediator of RNA polymerase II tra...  79.0    1e-11    
ref|XP_008414620.1|  PREDICTED: mediator of RNA polymerase II tra...  79.0    1e-11    
ref|XP_007562207.1|  PREDICTED: mediator of RNA polymerase II tra...  79.0    1e-11    
ref|XP_008347052.1|  PREDICTED: mediator of RNA polymerase II tra...  75.5    1e-11    
ref|XP_010872425.1|  PREDICTED: mediator of RNA polymerase II tra...  79.0    1e-11    
ref|XP_005921844.1|  PREDICTED: mediator of RNA polymerase II tra...  79.0    1e-11    
ref|XP_010872422.1|  PREDICTED: mediator of RNA polymerase II tra...  79.0    1e-11    
ref|XP_005469051.1|  PREDICTED: mediator of RNA polymerase II tra...  79.0    1e-11    
ref|XP_010872424.1|  PREDICTED: mediator of RNA polymerase II tra...  79.0    1e-11    
ref|XP_005726324.1|  PREDICTED: mediator of RNA polymerase II tra...  78.6    1e-11    
ref|XP_010743886.1|  PREDICTED: mediator of RNA polymerase II tra...  78.6    1e-11    
ref|XP_005469053.1|  PREDICTED: mediator of RNA polymerase II tra...  78.6    1e-11    
ref|XP_006803141.1|  PREDICTED: mediator of RNA polymerase II tra...  78.2    2e-11    
gb|ACB88867.1|  mediator complex subunit MED25 variant MED25_i8       75.1    2e-11    Homo sapiens [man]
ref|XP_005469054.1|  PREDICTED: mediator of RNA polymerase II tra...  77.8    2e-11    
ref|XP_005469055.1|  PREDICTED: mediator of RNA polymerase II tra...  77.8    2e-11    
ref|XP_005163996.1|  PREDICTED: mediator of RNA polymerase II tra...  77.8    2e-11    
ref|XP_004337130.1|  hypothetical protein ACA1_215990                 77.8    3e-11    
ref|XP_005163994.1|  PREDICTED: mediator of RNA polymerase II tra...  77.4    3e-11    
ref|XP_001627984.1|  predicted protein                                77.4    3e-11    Nematostella vectensis
ref|XP_005163997.1|  PREDICTED: mediator of RNA polymerase II tra...  77.4    3e-11    
emb|CDQ96874.1|  unnamed protein product                              74.3    4e-11    
ref|XP_009297717.1|  PREDICTED: mediator of RNA polymerase II tra...  76.6    5e-11    
ref|NP_999931.1|  mediator of RNA polymerase II transcription sub...  76.6    5e-11    Danio rerio [leopard danio]
ref|XP_008111806.1|  PREDICTED: mediator of RNA polymerase II tra...  76.6    5e-11    
ref|XP_005921846.1|  PREDICTED: mediator of RNA polymerase II tra...  76.3    6e-11    
ref|XP_005412881.1|  PREDICTED: mediator of RNA polymerase II tra...  76.6    6e-11    
ref|XP_007429826.1|  PREDICTED: mediator of RNA polymerase II tra...  76.3    6e-11    
ref|XP_008843324.1|  PREDICTED: mediator of RNA polymerase II tra...  76.3    6e-11    
ref|XP_007429822.1|  PREDICTED: mediator of RNA polymerase II tra...  76.3    7e-11    
ref|XP_007429824.1|  PREDICTED: mediator of RNA polymerase II tra...  76.3    7e-11    
ref|XP_008111805.1|  PREDICTED: mediator of RNA polymerase II tra...  76.3    7e-11    
ref|XP_008111803.1|  PREDICTED: mediator of RNA polymerase II tra...  76.3    7e-11    
ref|XP_007429825.1|  PREDICTED: mediator of RNA polymerase II tra...  76.3    7e-11    
ref|XP_008843325.1|  PREDICTED: mediator of RNA polymerase II tra...  76.3    8e-11    
ref|XP_003510925.2|  PREDICTED: mediator of RNA polymerase II tra...  75.9    9e-11    
ref|XP_008327856.1|  PREDICTED: mediator of RNA polymerase II tra...  75.9    1e-10    
gb|EPB90050.1|  hypothetical protein HMPREF1544_03162                 75.9    1e-10    
ref|XP_007649653.1|  PREDICTED: mediator of RNA polymerase II tra...  75.9    1e-10    
ref|XP_003230191.2|  PREDICTED: mediator of RNA polymerase II tra...  74.7    1e-10    
ref|XP_008327857.1|  PREDICTED: mediator of RNA polymerase II tra...  75.5    1e-10    
gb|ERE70128.1|  mediator of RNA polymerase II transcription subun...  75.5    1e-10    
gb|ERE70130.1|  mediator of RNA polymerase II transcription subun...  75.5    1e-10    
gb|ERE70129.1|  mediator of RNA polymerase II transcription subun...  75.1    1e-10    
ref|XP_005820011.1|  hypothetical protein GUITHDRAFT_120768           74.3    1e-10    
ref|XP_005084810.1|  PREDICTED: mediator of RNA polymerase II tra...  75.1    1e-10    
gb|ETE70944.1|  Mediator of RNA polymerase II transcription subun...  75.1    1e-10    
gb|EGW13426.1|  Mediator of RNA polymerase II transcription subun...  75.1    2e-10    
ref|XP_003465545.1|  PREDICTED: mediator of RNA polymerase II tra...  75.1    2e-10    
ref|XP_005412880.1|  PREDICTED: mediator of RNA polymerase II tra...  75.1    2e-10    
ref|XP_008843321.1|  PREDICTED: mediator of RNA polymerase II tra...  75.1    2e-10    
ref|XP_004619909.1|  PREDICTED: mediator of RNA polymerase II tra...  74.7    2e-10    
ref|XP_006575862.1|  PREDICTED: uncharacterized serine-rich prote...  73.9    2e-10    
ref|XP_007463452.1|  PREDICTED: mediator of RNA polymerase II tra...  74.3    3e-10    
ref|XP_004767837.1|  PREDICTED: mediator of RNA polymerase II tra...  74.3    3e-10    
ref|XP_006229073.1|  PREDICTED: mediator of RNA polymerase II tra...  74.3    3e-10    
ref|XP_006541326.1|  PREDICTED: mediator of RNA polymerase II tra...  74.3    3e-10    
ref|XP_004811697.1|  PREDICTED: mediator of RNA polymerase II tra...  74.3    3e-10    
ref|XP_006229074.1|  PREDICTED: mediator of RNA polymerase II tra...  74.3    3e-10    
gb|KFO26200.1|  Mediator of RNA polymerase II transcription subun...  74.3    3e-10    
ref|XP_006541327.1|  PREDICTED: mediator of RNA polymerase II tra...  73.9    3e-10    
ref|XP_007536304.1|  PREDICTED: mediator of RNA polymerase II tra...  73.9    3e-10    
gb|ERE70127.1|  mediator of RNA polymerase II transcription subun...  73.9    3e-10    
ref|XP_004811698.1|  PREDICTED: mediator of RNA polymerase II tra...  73.9    3e-10    
ref|NP_001163897.1|  mediator of RNA polymerase II transcription ...  73.9    4e-10    Rattus norvegicus [brown rat]
ref|XP_007112512.1|  PREDICTED: mediator of RNA polymerase II tra...  73.9    4e-10    
ref|XP_005366897.1|  PREDICTED: mediator of RNA polymerase II tra...  73.9    4e-10    
gb|EDM07444.1|  mediator of RNA polymerase II transcription, subu...  73.9    4e-10    Rattus norvegicus [brown rat]
ref|XP_006600953.1|  PREDICTED: mediator of RNA polymerase II tra...  70.9    4e-10    
ref|XP_006986283.1|  PREDICTED: mediator of RNA polymerase II tra...  73.9    4e-10    
ref|XP_006600955.1|  PREDICTED: mediator of RNA polymerase II tra...  70.9    4e-10    
ref|NP_083641.1|  mediator of RNA polymerase II transcription sub...  73.6    4e-10    Mus musculus [mouse]
ref|XP_005366898.1|  PREDICTED: mediator of RNA polymerase II tra...  73.6    4e-10    
ref|XP_004866929.1|  PREDICTED: mediator of RNA polymerase II tra...  73.6    4e-10    
ref|XP_004646480.1|  PREDICTED: mediator of RNA polymerase II tra...  73.6    4e-10    
ref|XP_007184998.1|  PREDICTED: mediator of RNA polymerase II tra...  73.6    4e-10    
ref|XP_004286208.1|  PREDICTED: mediator of RNA polymerase II tra...  73.6    4e-10    
ref|XP_008152558.1|  PREDICTED: mediator of RNA polymerase II tra...  73.6    4e-10    
ref|XP_006986284.1|  PREDICTED: mediator of RNA polymerase II tra...  73.6    5e-10    
ref|XP_006766032.1|  PREDICTED: mediator of RNA polymerase II tra...  73.6    5e-10    
ref|XP_006080133.1|  PREDICTED: mediator of RNA polymerase II tra...  73.6    5e-10    
ref|XP_005879602.1|  PREDICTED: mediator of RNA polymerase II tra...  73.6    5e-10    
gb|EPQ16001.1|  Mediator of RNA polymerase II transcription subun...  73.6    5e-10    
ref|XP_003801517.1|  PREDICTED: mediator of RNA polymerase II tra...  73.6    5e-10    
gb|ELK18520.1|  Mediator of RNA polymerase II transcription subun...  73.2    5e-10    
ref|XP_008589132.1|  PREDICTED: mediator of RNA polymerase II tra...  73.2    5e-10    
ref|XP_006986285.1|  PREDICTED: mediator of RNA polymerase II tra...  73.2    5e-10    
ref|XP_009860133.1|  PREDICTED: mediator of RNA polymerase II tra...  73.6    5e-10    
ref|XP_005366899.1|  PREDICTED: mediator of RNA polymerase II tra...  73.2    6e-10    
tpg|DAA19611.1|  TPA: mediator of RNA polymerase II transcription...  73.2    6e-10    
ref|XP_006905076.1|  PREDICTED: mediator of RNA polymerase II tra...  73.2    6e-10    
ref|NP_001075914.1|  mediator of RNA polymerase II transcription ...  73.2    6e-10    
gb|ACB88865.1|  mediator complex subunit MED25 variant MED25_i6       72.0    6e-10    
gb|EDL22768.1|  mediator of RNA polymerase II transcription, subu...  73.2    6e-10    
ref|XP_003997543.2|  PREDICTED: mediator of RNA polymerase II tra...  73.2    6e-10    
ref|XP_006229072.1|  PREDICTED: mediator of RNA polymerase II tra...  73.2    6e-10    
ref|XP_006898713.1|  PREDICTED: mediator of RNA polymerase II tra...  73.2    6e-10    
ref|XP_004889054.1|  PREDICTED: mediator of RNA polymerase II tra...  73.2    6e-10    
gb|EHB05670.1|  Mediator of RNA polymerase II transcription subun...  73.2    6e-10    
gb|EHH30280.1|  hypothetical protein EGK_10907                        73.2    7e-10    
ref|XP_008251306.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...  73.2    7e-10    
ref|XP_004440357.1|  PREDICTED: mediator of RNA polymerase II tra...  73.2    7e-10    
ref|XP_541489.4|  PREDICTED: mediator of RNA polymerase II transc...  73.2    7e-10    
ref|XP_006229070.1|  PREDICTED: mediator of RNA polymerase II tra...  73.2    7e-10    
ref|XP_002917873.1|  PREDICTED: mediator of RNA polymerase II tra...  72.8    7e-10    
ref|XP_004015862.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...  72.8    7e-10    
ref|XP_006229069.1|  PREDICTED: mediator of RNA polymerase II tra...  73.2    8e-10    
ref|XP_006541324.1|  PREDICTED: mediator of RNA polymerase II tra...  72.8    8e-10    
ref|XP_006751291.1|  PREDICTED: mediator of RNA polymerase II tra...  72.8    8e-10    
ref|XP_007995794.1|  PREDICTED: mediator of RNA polymerase II tra...  72.8    8e-10    
ref|XP_004409961.1|  PREDICTED: mediator of RNA polymerase II tra...  72.8    8e-10    
ref|XP_006229071.1|  PREDICTED: mediator of RNA polymerase II tra...  72.8    8e-10    
ref|XP_002762429.2|  PREDICTED: mediator of RNA polymerase II tra...  72.8    9e-10    
ref|XP_008986671.1|  PREDICTED: mediator of RNA polymerase II tra...  72.8    9e-10    
ref|XP_003127384.2|  PREDICTED: mediator of RNA polymerase II tra...  72.8    9e-10    
ref|XP_004811696.1|  PREDICTED: mediator of RNA polymerase II tra...  72.8    9e-10    
ref|XP_005590022.1|  PREDICTED: mediator of RNA polymerase II tra...  72.8    9e-10    
ref|XP_010367814.1|  PREDICTED: mediator of RNA polymerase II tra...  72.8    9e-10    
ref|XP_001115505.1|  PREDICTED: mediator of RNA polymerase II tra...  72.8    9e-10    
ref|XP_005590023.1|  PREDICTED: mediator of RNA polymerase II tra...  72.8    9e-10    
ref|XP_008965234.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...  72.8    9e-10    
gb|ACB88864.1|  mediator complex subunit MED25 variant MED25_i5       71.6    9e-10    
ref|XP_008986672.1|  PREDICTED: mediator of RNA polymerase II tra...  72.4    9e-10    
emb|CDH49928.1|  hypothetical protein RO3G_05308                      72.8    1e-09    
ref|XP_007910786.1|  PREDICTED: mediator of RNA polymerase II tra...  72.4    1e-09    
ref|XP_006541325.1|  PREDICTED: mediator of RNA polymerase II tra...  72.8    1e-09    
ref|XP_009231193.1|  PREDICTED: mediator of RNA polymerase II tra...  72.4    1e-09    
ref|XP_010639180.1|  PREDICTED: mediator of RNA polymerase II tra...  72.8    1e-09    
ref|XP_004061238.1|  PREDICTED: mediator of RNA polymerase II tra...  72.4    1e-09    
gb|EAW52544.1|  mediator of RNA polymerase II transcription, subu...  72.4    1e-09    
ref|NP_112235.2|  mediator of RNA polymerase II transcription sub...  72.4    1e-09    
ref|XP_008986673.1|  PREDICTED: mediator of RNA polymerase II tra...  72.4    1e-09    
ref|XP_010991470.1|  PREDICTED: mediator of RNA polymerase II tra...  72.4    1e-09    
ref|XP_002801398.1|  PREDICTED: mediator of RNA polymerase II tra...  72.4    1e-09    
ref|XP_006986281.1|  PREDICTED: mediator of RNA polymerase II tra...  72.4    1e-09    
gb|EAW52550.1|  mediator of RNA polymerase II transcription, subu...  72.0    1e-09    
ref|XP_009434378.1|  PREDICTED: mediator of RNA polymerase II tra...  72.0    1e-09    
ref|XP_006878106.1|  PREDICTED: mediator of RNA polymerase II tra...  71.6    1e-09    
ref|XP_004597024.1|  PREDICTED: mediator of RNA polymerase II tra...  72.0    1e-09    
ref|XP_006986282.1|  PREDICTED: mediator of RNA polymerase II tra...  72.0    1e-09    
ref|XP_006107348.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...  72.0    1e-09    
ref|XP_001115473.2|  PREDICTED: mediator of RNA polymerase II tra...  72.0    1e-09    
ref|XP_007112511.1|  PREDICTED: mediator of RNA polymerase II tra...  72.0    2e-09    
gb|AAS45401.1|  ARC/mediator transcriptional coactivator subunit      72.0    2e-09    
gb|EAW52548.1|  mediator of RNA polymerase II transcription, subu...  71.6    2e-09    
emb|CAE84581.1|  activator interaction domain 1 protein               71.6    2e-09    
ref|XP_006080132.1|  PREDICTED: mediator of RNA polymerase II tra...  71.6    2e-09    
ref|XP_008589131.1|  PREDICTED: mediator of RNA polymerase II tra...  71.6    2e-09    
ref|XP_004710505.1|  PREDICTED: mediator of RNA polymerase II tra...  71.2    2e-09    
ref|XP_006941036.1|  PREDICTED: mediator of RNA polymerase II tra...  71.6    2e-09    
gb|EAW52547.1|  mediator of RNA polymerase II transcription, subu...  71.2    2e-09    
gb|EAW52549.1|  mediator of RNA polymerase II transcription, subu...  71.2    3e-09    
gb|KFM78624.1|  hypothetical protein X975_26427                       71.2    3e-09    
ref|XP_004866928.1|  PREDICTED: mediator of RNA polymerase II tra...  71.2    3e-09    
gb|AAM20739.1|AF261072_2  p78                                         70.9    3e-09    
ref|XP_005616347.1|  PREDICTED: mediator of RNA polymerase II tra...  71.2    3e-09    
ref|XP_004672275.1|  PREDICTED: mediator of RNA polymerase II tra...  70.5    4e-09    
ref|XP_006575035.1|  PREDICTED: mediator of RNA polymerase II tra...  70.1    4e-09    
gb|EAW52545.1|  mediator of RNA polymerase II transcription, subu...  70.5    4e-09    
emb|CAB66680.1|  hypothetical protein                                 70.5    4e-09    
ref|XP_004381685.1|  PREDICTED: mediator of RNA polymerase II tra...  70.5    4e-09    
ref|XP_005955527.1|  PREDICTED: mediator of RNA polymerase II tra...  70.1    5e-09    
gb|ELK28571.1|  Mediator of RNA polymerase II transcription subun...  70.1    5e-09    
ref|XP_004485057.1|  PREDICTED: LOW QUALITY PROTEIN: mediator com...  69.7    7e-09    
dbj|BAG61008.1|  unnamed protein product                              69.7    7e-09    
dbj|BAG51583.1|  unnamed protein product                              69.7    7e-09    
gb|EHH59794.1|  hypothetical protein EGM_09988                        69.7    7e-09    
gb|EKC37256.1|  Mediator of RNA polymerase II transcription subun...  69.3    1e-08    
ref|XP_007153718.1|  hypothetical protein PHAVU_003G059200g           67.8    1e-08    
gb|ACB88866.1|  mediator complex subunit MED25 variant MED25_i7       66.6    1e-08    
ref|XP_006853197.1|  hypothetical protein AMTR_s00038p00208830        63.5    1e-08    
emb|CDS06033.1|  hypothetical protein LRAMOSA08561                    68.9    2e-08    
ref|XP_005336760.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...  68.2    2e-08    
ref|XP_002414075.1|  med25 protein, putative                          66.6    3e-08    
gb|KFH69538.1|  hypothetical protein MVEG_04349                       68.2    3e-08    
ref|XP_004361161.1|  hypothetical protein DFA_05442                   67.8    3e-08    
ref|XP_005645244.1|  hypothetical protein COCSUDRAFT_67190            67.4    5e-08    
ref|XP_008546945.1|  PREDICTED: mediator of RNA polymerase II tra...  67.0    6e-08    
ref|XP_006600956.1|  PREDICTED: mediator of RNA polymerase II tra...  63.5    8e-08    
ref|XP_010585241.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...  66.2    8e-08    
emb|CEG68371.1|  hypothetical protein RMATCC62417_04645               65.9    1e-07    
ref|XP_010105770.1|  hypothetical protein L484_009966                 61.6    1e-07    
gb|ACB88868.1|  mediator complex subunit MED25 variant MED25_i9       63.2    1e-07    
ref|XP_010089728.1|  hypothetical protein L484_013922                 62.8    2e-07    
gb|ENN76372.1|  hypothetical protein YQE_07094                        64.7    3e-07    
gb|EAW52551.1|  mediator of RNA polymerase II transcription, subu...  62.0    3e-07    
gb|ERL88002.1|  hypothetical protein D910_05391                       64.3    4e-07    
gb|KDR14682.1|  hypothetical protein L798_11454                       63.9    4e-07    
ref|XP_003742924.1|  PREDICTED: uncharacterized protein LOC100900590  64.3    4e-07    
gb|KEH27077.1|  hypothetical protein MTR_6g085130                     63.9    4e-07    
ref|XP_007153720.1|  hypothetical protein PHAVU_003G059300g           63.2    6e-07    
ref|XP_637454.1|  hypothetical protein DDB_G0286967                   63.5    7e-07    
gb|KHN35285.1|  hypothetical protein glysoja_046672                   62.0    9e-07    
ref|XP_006584406.1|  PREDICTED: uncharacterized protein LOC102670031  60.5    2e-06    
ref|XP_006015106.1|  PREDICTED: mediator of RNA polymerase II tra...  62.0    2e-06    
ref|XP_006575863.1|  PREDICTED: uncharacterized protein LOC102660682  61.6    2e-06    
ref|XP_005991044.1|  PREDICTED: mediator of RNA polymerase II tra...  61.6    2e-06    
gb|EXX62018.1|  hypothetical protein RirG_165530                      61.2    3e-06    
ref|XP_002426584.1|  transcription factor, putative                   61.2    4e-06    
gb|EZA49336.1|  Mediator of RNA polymerase II transcription subunit   60.1    7e-06    
ref|XP_975178.1|  PREDICTED: mediator of RNA polymerase II transc...  59.7    9e-06    
gb|EFA81952.1|  putative mediator complex subunit 25                  59.7    1e-05    
ref|XP_008192689.1|  PREDICTED: mediator of RNA polymerase II tra...  59.3    1e-05    
ref|XP_008192688.1|  PREDICTED: mediator of RNA polymerase II tra...  58.9    1e-05    
emb|CEJ03135.1|  Putative Lipoamide Acyltransferase                   57.8    3e-05    
gb|EFX72490.1|  hypothetical protein DAPPUDRAFT_227538                57.8    3e-05    
ref|XP_006817960.1|  PREDICTED: mediator of RNA polymerase II tra...  56.2    3e-05    
gb|ACB88869.1|  mediator complex subunit MED25 variant MED25_i10      55.8    3e-05    
ref|XP_011057324.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...  57.8    4e-05    
gb|EFN84184.1|  Mediator of RNA polymerase II transcription subun...  57.4    5e-05    
ref|XP_008206394.1|  PREDICTED: mediator of RNA polymerase II tra...  57.4    5e-05    
ref|XP_008206393.1|  PREDICTED: mediator of RNA polymerase II tra...  57.4    5e-05    
gb|EFN70189.1|  Mediator of RNA polymerase II transcription subun...  56.2    8e-05    
ref|XP_008053995.1|  PREDICTED: mediator of RNA polymerase II tra...  56.2    1e-04    
ref|XP_003704097.1|  PREDICTED: uncharacterized protein LOC100878374  56.2    1e-04    
ref|XP_010848018.1|  PREDICTED: mediator of RNA polymerase II tra...  55.8    1e-04    
ref|XP_007941211.1|  PREDICTED: mediator of RNA polymerase II tra...  55.1    1e-04    
ref|XP_005596798.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...  55.5    2e-04    
ref|XP_001180359.2|  PREDICTED: mediator of RNA polymerase II tra...  54.3    2e-04    
gb|EFZ15269.1|  hypothetical protein SINV_11494                       55.5    2e-04    
ref|XP_008682782.1|  PREDICTED: mediator of RNA polymerase II tra...  55.1    2e-04    
gb|EPY89101.1|  mediator of RNA polymerase II transcription subun...  54.7    3e-04    
ref|XP_008482105.1|  PREDICTED: mediator of RNA polymerase II tra...  54.3    3e-04    
ref|XP_008529413.1|  PREDICTED: mediator of RNA polymerase II tra...  54.7    3e-04    
emb|CDQ89718.1|  unnamed protein product                              54.7    3e-04    
ref|XP_006160274.1|  PREDICTED: mediator of RNA polymerase II tra...  54.3    5e-04    
ref|XP_009051485.1|  hypothetical protein LOTGIDRAFT_228259           53.9    5e-04    
ref|XP_008682781.1|  PREDICTED: mediator of RNA polymerase II tra...  53.5    7e-04    
ref|XP_001868059.1|  conserved hypothetical protein                   53.5    8e-04    
gb|EDM07443.1|  mediator of RNA polymerase II transcription, subu...  50.1    0.001    



>emb|CDP00585.1| unnamed protein product [Coffea canephora]
Length=835

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/688 (73%), Positives = 571/688 (83%), Gaps = 9/688 (1%)
 Frame = +2

Query  185   EKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGS  364
             E+ LI+AVEGTAA+GP W +++SDYLEK+IR FC  ++  QK S ANV   LV FNSHG 
Sbjct  11    ERHLIVAVEGTAAVGPFWHTVLSDYLEKVIRSFCANDSTGQKLSAANVNLSLVTFNSHGP  70

Query  365   YSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
             YSACLVQRSGWTRDID+F  WLS+I FGGGGFNDAAIAEGLAEALMM+SS NGNQ++Q +
Sbjct  71    YSACLVQRSGWTRDIDVFFEWLSAIPFGGGGFNDAAIAEGLAEALMMISSKNGNQTQQNL  130

Query  545   EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
             +  KHCILVAASNPYPLPTPVYRP+  N EQSEN     D RLSDAETVAKSFAQC++SL
Sbjct  131   DSHKHCILVAASNPYPLPTPVYRPR-QNVEQSENTEIQSDGRLSDAETVAKSFAQCNISL  189

Query  725   SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSL  904
             SV+CPK + KLK IY A KRNPR  D P+DN KNP++LVLISENF+EAR A  R+GM ++
Sbjct  190   SVICPKQLPKLKAIYNAGKRNPRAPDPPVDNGKNPHFLVLISENFIEARVALGRSGMTNI  249

Query  905   PSTQNPVKMDVSSVPPISGPLPSGLASIPSAN-GPVMNRQPIPTGNIHPATVKIEPTTVT  1081
              STQ+PVK+D +SV  +SGP PS   S+ SAN G V+NRQP   G I PA VKIEPTTVT
Sbjct  250   -STQSPVKVDAASVASVSGP-PS--TSVQSANAGAVVNRQPGSVGTIPPAVVKIEPTTVT  305

Query  1082  SMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSVRP  1261
             SM GPTF HVPSVPRA+SQP+ NLQTSSPIS SQ+MV+ NEN+QE KP +V  M QS+RP
Sbjct  306   SMSGPTFPHVPSVPRASSQPIPNLQTSSPISASQDMVSTNENIQEMKP-IVSSMTQSLRP  364

Query  1262  VGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPMLSNmissgmassvsaaqsvisss  1441
             VGAA ANVRILNDVAQARQA  GGTS+GL SMGGTP+LSNMISSGM SS+ AAQ++ISS 
Sbjct  365   VGAAPANVRILNDVAQARQAFGGGTSMGLQSMGGTPILSNMISSGMTSSIPAAQTLISSG  424

Query  1442  qsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSSVSVGQTV  1621
             QSGVTS++ S P+AG  Q  Q+ AP SF  TTS++S +SNL MSQ ++     VS+GQTV
Sbjct  425   QSGVTSVSGSAPVAGNAQGAQNPAPASFPTTTSNVSGSSNLSMSQPLSNHQGGVSMGQTV  484

Query  1622  PGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgmqpIGV  1801
             P M+Q N+ GTQM+Q+    +QNMM G+G ASGIPSGTGTM+PTPGM+QQ Q GMQP+GV
Sbjct  485   PSMSQGNLTGTQMVQSGMTMNQNMMGGIG-ASGIPSGTGTMIPTPGMSQQVQPGMQPLGV  543

Query  1802  NNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETL  1981
             NNN+ ANMPL QQ +++   +   KYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETL
Sbjct  544   NNNAGANMPLPQQTSNTLPSAQS-KYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETL  602

Query  1982  AANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQT  2161
             AANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQT
Sbjct  603   AANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQT  662

Query  2162  LLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             LLLSVSDKACRLIGMLFPGDMVVFKPQI
Sbjct  663   LLLSVSDKACRLIGMLFPGDMVVFKPQI  690



>ref|XP_009771929.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Nicotiana sylvestris]
Length=828

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/688 (74%), Positives = 583/688 (85%), Gaps = 11/688 (2%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             +A+KQLI+AVEGTAA+GP W +IVSDYL+KIIR F GAE+ SQKPS ANVE  LVMFN+H
Sbjct  2     VADKQLIVAVEGTAALGPFWHTIVSDYLDKIIRSFFGAESTSQKPSAANVEVSLVMFNAH  61

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQ  538
             GSYSACLVQRSGWTRD+D+F  WLS+I F GGGF+DAA+AEGL EALMM SSPNGNQS+Q
Sbjct  62    GSYSACLVQRSGWTRDMDIFFQWLSAIPFSGGGFSDAAVAEGLGEALMMFSSPNGNQSQQ  121

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSEN-ETQTDDRRLSDAETVAKSFAQCS  715
              +EG+KHC+L++ASNPYPLPTPVYRPQ+   EQ+EN ETQTD  RLSDAETVAK+F QCS
Sbjct  122   NMEGKKHCLLISASNPYPLPTPVYRPQMQKLEQNENTETQTDS-RLSDAETVAKAFPQCS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK + KL+ +Y A KRNPR AD PID  KNP +LVLISENF+EARAAF+R+GM
Sbjct  181   VSLSVICPKQLSKLRAVYNAGKRNPRAADPPIDTAKNPNFLVLISENFIEARAAFSRSGM  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              +L S Q P+KMDV S+            S  +ANG VM+RQPI  GNI PATVKIEPTT
Sbjct  241   TNLTSNQTPIKMDVPSI---PPVSVPPSISNSAANGSVMSRQPISAGNIPPATVKIEPTT  297

Query  1076  VTSMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
             VTSM GP F+H+PSV R A QPV +LQTSSP+SVSQEM ++NEN+QE KP +V GM QS+
Sbjct  298   VTSMNGPAFSHIPSV-RPALQPVPSLQTSSPLSVSQEMASHNENVQEMKP-IVSGMTQSL  355

Query  1256  RPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPMLSNmissgmassvsaaqsvis  1435
             RPV AAAANVRILNDVAQARQA+AG TSIGL SMGGTPMLS+MISSGMASSV +AQ+V S
Sbjct  356   RPVAAAAANVRILNDVAQARQAIAGATSIGLQSMGGTPMLSSMISSGMASSVPSAQTVFS  415

Query  1436  ssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSSVSV-G  1612
             S QSGVT+++ S+PL+G GQ  Q+SAP SFT+T  SMS   N+ +SQ ++     +S+ G
Sbjct  416   SGQSGVTTVSGSVPLSGSGQNTQNSAPASFTSTAPSMSGNPNISISQPLSNNQGGISMAG  475

Query  1613  QTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgmqp  1792
             QTVPGM Q N+PGTQMM + TG +QNM++G+ GA+G+PSGTGTM+PTPG++QQGQ GMQP
Sbjct  476   QTVPGMCQGNLPGTQMMPSGTGMNQNMLTGL-GATGMPSGTGTMMPTPGISQQGQPGMQP  534

Query  1793  IGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASAS  1972
             +G  N++ ANMPLSQQQT + L SAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRSASAS
Sbjct  535   VG--NSTGANMPLSQQQTPAALPSAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRSASAS  592

Query  1973  ETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLP  2152
             E+LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFL QLQEKKLCAVIQLP
Sbjct  593   ESLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLSQLQEKKLCAVIQLP  652

Query  2153  SQTLLLSVSDKACRLIGMLFPGDMVVFK  2236
             SQTLLLSVSDKACRLIGMLFPGDMVVFK
Sbjct  653   SQTLLLSVSDKACRLIGMLFPGDMVVFK  680



>ref|XP_011077190.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Sesamum indicum]
Length=806

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/693 (71%), Positives = 564/693 (81%), Gaps = 10/693 (1%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             M  KQLI+AVEGTAA+GP W +IVSDYL+KIIRCFCG E+  QKPS + VE  LVMFN+H
Sbjct  1     MVPKQLIVAVEGTAAVGPFWQTIVSDYLDKIIRCFCGNESTGQKPSTSQVELSLVMFNAH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQ  538
             GSY ACLVQRSGWTRD+D+F  WLS+I F GGGFNDAAIAEGLAEALMM SSPNG+Q  Q
Sbjct  61    GSYCACLVQRSGWTRDMDIFFQWLSAIPFAGGGFNDAAIAEGLAEALMMFSSPNGSQ-IQ  119

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
              ++GQ+HCILVAASNPYPLPTPVYRPQ  N EQS+N     D RLSDAE +AKSFAQ  +
Sbjct  120   NMDGQRHCILVAASNPYPLPTPVYRPQPQNLEQSDNIESQPDNRLSDAEALAKSFAQFGI  179

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLS++CPK + KL+ IY A KRN R AD P+DN KNP++LVLISENFME  AA +R GM 
Sbjct  180   SLSIICPKKLPKLRAIYNAGKRNARAADPPVDNVKNPHFLVLISENFMEGLAALSRPGMA  239

Query  899   SLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTG-NIHPATVKIEPTT  1075
             +LPS QNP+KMDV+  PPISGP P+  AS   ANG V+ RQPIP G NI PATVK+EP T
Sbjct  240   NLPSNQNPIKMDVTPAPPISGPPPASGAS---ANGSVLGRQPIPVGKNIPPATVKVEPIT  296

Query  1076  VTSMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
             VTS  GP F  + SV RA SQPV +LQTSSPIS SQEMV++NEN+ + KP V   M  S+
Sbjct  297   VTSGTGPAFPPISSVSRATSQPVPSLQTSSPISTSQEMVSSNENVHDMKPQVTS-MTPSL  355

Query  1256  RPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPMLSNmissgmassvsaaqsvis  1435
             RPVGA A NVRILNDVAQARQALAGGTSIGL SMGGTPMLSNMISSGMASSV  AQ+VIS
Sbjct  356   RPVGAPA-NVRILNDVAQARQALAGGTSIGLPSMGGTPMLSNMISSGMASSVPPAQTVIS  414

Query  1436  ssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSSVSVGQ  1615
             S  SGV S+  S+P+   GQV Q+S+  SFT+T  +++ TS+L MSQS++ L  S S+GQ
Sbjct  415   SGSSGVASIAGSLPIPASGQVAQNSSSASFTSTAPTVTGTSSLGMSQSLSNLQVSGSLGQ  474

Query  1616  TVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgmqpI  1795
             ++PGM+Q N+P TQM+QT    +QNMMSG G  +G+PSG+G M+PTPGM+QQ   GMQP+
Sbjct  475   SLPGMSQGNLPVTQMVQTGMSMNQNMMSGTG-TTGMPSGSGNMMPTPGMSQQIPPGMQPV  533

Query  1796  GVN-NNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASAS  1972
             GVN NNS  NMPL+QQ +S+   +   KYVKVWEGNLSGQRQGQPVFITRLEGYR+ASAS
Sbjct  534   GVNSNNSVTNMPLNQQTSSTIQPAQS-KYVKVWEGNLSGQRQGQPVFITRLEGYRNASAS  592

Query  1973  ETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLP  2152
             ETLAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQEKKLCAVIQLP
Sbjct  593   ETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMDQHGFLGQLQEKKLCAVIQLP  652

Query  2153  SQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             SQTLLLSVSDKA RLIGMLFPGDMVVFKPQI N
Sbjct  653   SQTLLLSVSDKAYRLIGMLFPGDMVVFKPQIPN  685



>ref|XP_006354095.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Solanum tuberosum]
Length=819

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/683 (73%), Positives = 575/683 (84%), Gaps = 8/683 (1%)
 Frame = +2

Query  191   QLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGSYS  370
             +LI+AVEGTAA+GP+W +IVSDYL+KIIRCF G ++ SQK S A+VE  LVMFN+HGSYS
Sbjct  4     KLIVAVEGTAALGPYWKTIVSDYLDKIIRCFFGVDSTSQKSSAADVEVSLVMFNTHGSYS  63

Query  371   ACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTVEG  550
             ACLVQRSGWTRD+D FL WLS+I F GGGFNDAA+AEGLAEAL+M S  NGNQS+Q +EG
Sbjct  64    ACLVQRSGWTRDMDTFLQWLSAIPFLGGGFNDAAVAEGLAEALVMFSGLNGNQSQQNMEG  123

Query  551   QKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLSV  730
             +KHCIL++ SNPYPLPTPVYRPQ+   EQ+EN     D RLSDAETVAK+F QCS+SLSV
Sbjct  124   KKHCILISGSNPYPLPTPVYRPQMQKLEQNENIEAQTDSRLSDAETVAKAFPQCSISLSV  183

Query  731   VCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSLPS  910
             +CPK + KL+ IY A K NPR AD PID  KNP +LVLISENF+EARAAF+R+GM +L S
Sbjct  184   LCPKKLPKLRAIYDAGKHNPRAADPPIDTAKNPNFLVLISENFIEARAAFSRSGMTNLAS  243

Query  911   TQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTVTSMP  1090
               +PVKMDVSSV P+SG   +   S  +AN  VM+R PI  GNI PATVKIEP TVTSM 
Sbjct  244   NHSPVKMDVSSVLPVSG---TQSISNSAANVSVMSRPPISAGNIPPATVKIEPNTVTSMT  300

Query  1091  GPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSVRPVGA  1270
             GP F+H+PSV R A QPV +LQ SSP+SVSQEM ++ EN+QE KP +V GM QS+RPV A
Sbjct  301   GPAFSHIPSV-RPALQPVPSLQASSPLSVSQEMASHTENVQEMKP-IVSGMTQSLRPVAA  358

Query  1271  AAANVRILNDVAQARQALAGGTSIGLSSMGGTPMLSNmissgmassvsaaqsvisssqsg  1450
             AAANV+ILN VAQA Q L GGTSIGL SMGGTPMLS+MISSGMASSV A+Q+V+SS QSG
Sbjct  359   AAANVKILNGVAQAHQVLGGGTSIGLQSMGGTPMLSSMISSGMASSVPASQAVLSSGQSG  418

Query  1451  vtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSSVSV-GQTVPG  1627
             VT+MT ++PLAG  Q  Q+SAP+SFT+T  SMS  SN+ +SQ +N     VS+ GQTVPG
Sbjct  419   VTTMTGAVPLAGSAQNTQNSAPSSFTSTAPSMSGNSNISISQPLNNNQRGVSMTGQTVPG  478

Query  1628  MNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgmqpIGVNN  1807
             M+Q N+PGTQMM + TG +QNM++G+ GA+G+PSGTGTM+PTPGM+QQGQ GMQP+GVN+
Sbjct  479   MSQGNLPGTQMMPSGTGMNQNMLTGL-GATGLPSGTGTMMPTPGMSQQGQPGMQPVGVNS  537

Query  1808  NSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAA  1987
              S ANMPLSQQQTS+ L SAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASE+LAA
Sbjct  538   TS-ANMPLSQQQTSAALPSAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASESLAA  596

Query  1988  NWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLL  2167
             NWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFL QLQEKKLCAVIQLPSQTLL
Sbjct  597   NWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLSQLQEKKLCAVIQLPSQTLL  656

Query  2168  LSVSDKACRLIGMLFPGDMVVFK  2236
             LSVSDKACRLIGMLFPGDMVVFK
Sbjct  657   LSVSDKACRLIGMLFPGDMVVFK  679



>ref|XP_004252687.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Solanum lycopersicum]
Length=805

 Score =   805 bits (2079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/688 (70%), Positives = 553/688 (80%), Gaps = 39/688 (6%)
 Frame = +2

Query  191   QLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGSYS  370
             +LI+AVEGTA +GP+W  IVSDYL+KIIRCF G ++ SQK S A+VE  +VMFN+HG YS
Sbjct  4     KLIVAVEGTAVLGPYWKIIVSDYLDKIIRCFFGVDSTSQKSSAADVEVSMVMFNTHGPYS  63

Query  371   ACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTVEG  550
             ACLVQRSGWT+D+D FL WLS+I F GGGFNDAA+AEGLAEAL+M S PNGNQ++Q +EG
Sbjct  64    ACLVQRSGWTKDMDTFLQWLSAIPFSGGGFNDAAVAEGLAEALVMFSVPNGNQTQQKMEG  123

Query  551   QKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLSV  730
             +KHCIL++ SNPYPLPTPVYRPQ+   EQ+EN     D RL+DAETVAK+F QCS+SLSV
Sbjct  124   KKHCILISGSNPYPLPTPVYRPQMQKLEQNENIEAQTDSRLADAETVAKTFPQCSISLSV  183

Query  731   VCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSLPS  910
             +CPK + KL+ IY A K NPR AD PID  KNP +LVLISENF+EARAAF+R+G+ +L S
Sbjct  184   ICPKKLPKLRAIYDAGKHNPRAADPPIDTAKNPNFLVLISENFIEARAAFSRSGLTNLAS  243

Query  911   TQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTVTSMP  1090
               +PVKMDVSSV P+SG   +   S  +AN  V++R PI  GNI PATVKIEP TVT M 
Sbjct  244   NHSPVKMDVSSVLPVSG---TQSISNSAANVSVISRPPISAGNIPPATVKIEPNTVTPMT  300

Query  1091  GPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSVRPVGA  1270
             GP F+H+PSV R A QPV +LQ SSP+SVSQEMV++ EN+QE KP +V GM QS+RPV A
Sbjct  301   GPGFSHIPSV-RPALQPVPSLQASSPLSVSQEMVSHTENVQEMKP-IVSGMTQSLRPVAA  358

Query  1271  AAANVRILNDVAQARQALAGGTSIGLSSMGGTPMLSNmissgmassvsaaqsvisssqsg  1450
             AAANV+ILN VAQA Q L GGTSIGL SMGGTPMLS+MISSGMASSV A+Q+V+SS QSG
Sbjct  359   AAANVKILNGVAQAHQVLGGGTSIGLQSMGGTPMLSSMISSGMASSVPASQAVLSSGQSG  418

Query  1451  vtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSSVS------VG  1612
             VT+MT ++PLAG  Q  Q                          N+ PSS +       G
Sbjct  419   VTTMTGAVPLAGSAQNTQ--------------------------NSAPSSFTSTAPSMSG  452

Query  1613  QTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgmqp  1792
             QTVP M+Q N+PGTQMM + TG +QNM++G+ GA+G+PSGTGTM+PTPGM+QQGQ GMQP
Sbjct  453   QTVPAMSQGNIPGTQMMPSGTGMNQNMLTGL-GATGLPSGTGTMMPTPGMSQQGQPGMQP  511

Query  1793  IGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASAS  1972
             +GVN+ S ANMPLSQQQTS  L SAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRSASAS
Sbjct  512   VGVNSTS-ANMPLSQQQTSGALPSAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRSASAS  570

Query  1973  ETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLP  2152
             E+LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFL QLQEKKLCAVIQLP
Sbjct  571   ESLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLSQLQEKKLCAVIQLP  630

Query  2153  SQTLLLSVSDKACRLIGMLFPGDMVVFK  2236
             SQTLLLSVSDKACRLIGMLFPGDMVVFK
Sbjct  631   SQTLLLSVSDKACRLIGMLFPGDMVVFK  658



>ref|XP_011070829.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Sesamum indicum]
Length=788

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/693 (70%), Positives = 558/693 (81%), Gaps = 10/693 (1%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             M+ KQL++AVEGTAA+GP W +IVSDYL+KIIRCF G E   QK S   VE  LVMFN+H
Sbjct  1     MSPKQLVVAVEGTAAIGPFWQTIVSDYLDKIIRCFFGNEPTGQKSSMTPVELSLVMFNAH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQ  538
             GSYSACLVQRSGWTRD+D+F  WL +I F GGGFNDAAIAEGLAEALMM SS +GNQ+ Q
Sbjct  61    GSYSACLVQRSGWTRDMDIFFQWLQAIPFAGGGFNDAAIAEGLAEALMMFSSTSGNQN-Q  119

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
              VEGQ+HCILVAASNPYPLPTPVYRPQ  N E+S++     D  LSDAET+AKSFAQ ++
Sbjct  120   IVEGQRHCILVAASNPYPLPTPVYRPQPQNPEKSDSMETQPDNCLSDAETLAKSFAQFAI  179

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSV+CPK + KL+ IY A KRNPR A+ P+DN KNP++LVLISENF+EAR++ +R+GM 
Sbjct  180   SLSVICPKQLPKLRGIYNAGKRNPRAAEPPVDNVKNPHFLVLISENFVEARSSLSRSGMT  239

Query  899   SLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
             SLPS QNPVK DV+ V PISG      AS PSAN  V+ RQ I  GNI PATVK+EP T+
Sbjct  240   SLPSNQNPVKTDVAPVLPISG---LPSASAPSANASVLVRQQISVGNIAPATVKVEPITL  296

Query  1079  TSMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSVR  1258
             TSM  P F  + SVPRAASQ V +LQTSSPIS SQ+M+ NN N+ + KP V + M  S+R
Sbjct  297   TSMTAPAFPQIASVPRAASQAVPSLQTSSPISTSQDMIPNNANVPDVKPSVTN-MAPSLR  355

Query  1259  PVGAAAANVRILNDVAQARQALAGGTS-IGLSSMGGTPMLSNmissgmassvsaaqsvis  1435
             PVGA A NVRILNDVAQARQALAGGTS IGL S+GGTPMLSNMISSG+ +S+  AQ+VIS
Sbjct  356   PVGAPA-NVRILNDVAQARQALAGGTSTIGLPSIGGTPMLSNMISSGITTSIPPAQTVIS  414

Query  1436  ssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSSVSVGQ  1615
             S  SGVTS+  S+P++  GQVV +S P S  +T S++S  ++L MSQ  +TL  SVS+ Q
Sbjct  415   SGPSGVTSIAGSLPVSATGQVVHNSTPASLISTASNVSGNASLTMSQPSSTLQGSVSLSQ  474

Query  1616  TVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgmqpI  1795
             T+PGM+Q N P TQ++QT    +QNMMSG  GASG+PSGTGTM+PT G +QQGQ GMQP+
Sbjct  475   TLPGMSQGNHPVTQIVQTGMNMNQNMMSG-SGASGMPSGTGTMIPTLGTSQQGQPGMQPV  533

Query  1796  GVN-NNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASAS  1972
             G+N NNS  NMPL+QQ +S+   +   KY+KVWEGNLSGQRQGQPVFITRLEGYRSASAS
Sbjct  534   GLNSNNSGTNMPLNQQTSSTVQSAQS-KYIKVWEGNLSGQRQGQPVFITRLEGYRSASAS  592

Query  1973  ETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLP  2152
             ETLAANWP  MQIVRLISQDHMNNK YVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLP
Sbjct  593   ETLAANWPPIMQIVRLISQDHMNNKHYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLP  652

Query  2153  SQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             SQTLLLSVSDKA RLIGMLFPGDMVVFKPQI N
Sbjct  653   SQTLLLSVSDKAHRLIGMLFPGDMVVFKPQIPN  685



>ref|XP_002278845.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 [Vitis vinifera]
Length=827

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/701 (70%), Positives = 576/701 (82%), Gaps = 17/701 (2%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEKQL++AVEGTAAMGP+W ++VSDYL+KIIR FCG E   QKPS +N E  LVMFN+H
Sbjct  1     MAEKQLVVAVEGTAAMGPYWQAVVSDYLDKIIRYFCGNELAGQKPSSSNFELSLVMFNAH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSK  535
             GSY +CLVQRSGWTRD+DLFL WLS++ F GGGFNDAAIAEGLAEALMM S + NG+Q++
Sbjct  61    GSYCSCLVQRSGWTRDVDLFLQWLSALPFAGGGFNDAAIAEGLAEALMMFSVAANGSQTQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q V+GQ+HCILVAA+NPYPLPTPVY+PQ+ N EQ+E+     + RLSDAE VAKSFAQCS
Sbjct  121   QNVDGQRHCILVAANNPYPLPTPVYQPQMQNMEQNESIESQTESRLSDAEAVAKSFAQCS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK + KLK+IY A KRNPR AD P+DN KNP++LVLIS++FMEARAA +R G+
Sbjct  181   VSLSVICPKQLPKLKSIYNAGKRNPRVADPPVDNVKNPHFLVLISDSFMEARAALSRPGL  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              ++ + Q+PVKMD++SVP +S   P   ASIPS NG +MNR  I  G +  ATVK+EP+T
Sbjct  241   SNMTANQSPVKMDIASVPQVSAAPP---ASIPSVNG-IMNRPTIAVGAVPTATVKVEPST  296

Query  1076  VTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             VTS+  GP F H+PSVPRAASQ V +LQTSSP S SQEM++N +N+Q+ KP +V G+ Q+
Sbjct  297   VTSITSGPGFPHIPSVPRAASQGVPSLQTSSPSSTSQEMISNGDNVQDLKP-IVSGISQT  355

Query  1253  VRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---LSNmissgmass  1408
             +RPV  AAANV ILN+++QARQ     AL+GGTSIGL SMGGT M   +SNMISSGMASS
Sbjct  356   LRPVVPAAANVSILNNLSQARQVMHSAALSGGTSIGLQSMGGTSMAMHMSNMISSGMASS  415

Query  1409  vsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNT  1588
             V A Q+V SS QS V+S+T S  LAG  QV Q+SA  SFT+ TS+MS  SNL +SQ ++ 
Sbjct  416   VPATQTVFSSGQSAVSSITGSGTLAGTAQVAQNSALGSFTSATSNMSVNSNLGISQPLSN  475

Query  1589  LPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtq  1768
             L   VS+GQTVPGM+Q N+PG QM+Q+  G +QNMMSG+G  SGI SGTGTM+PTPGM+Q
Sbjct  476   LQGGVSMGQTVPGMSQGNLPGGQMVQSGIGMNQNMMSGLG-PSGISSGTGTMIPTPGMSQ  534

Query  1769  qgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLE  1948
             Q Q GM  +GVNNN+AANMPL QQ + +   +   KYVKVWEGNLSGQRQGQPVFITRLE
Sbjct  535   QVQPGMPSLGVNNNAAANMPLPQQTSGAMQTAQS-KYVKVWEGNLSGQRQGQPVFITRLE  593

Query  1949  GYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  2128
             GYRSASASE+LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK
Sbjct  594   GYRSASASESLAANWPATMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  653

Query  2129  LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN
Sbjct  654   LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  694



>ref|XP_007046291.1| Phytochrome and flowering time regulatory protein isoform 1 [Theobroma 
cacao]
 gb|EOY02123.1| Phytochrome and flowering time regulatory protein isoform 1 [Theobroma 
cacao]
Length=871

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/695 (69%), Positives = 564/695 (81%), Gaps = 17/695 (2%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAE+QLI+AVEGTAAMGP+W ++VSDYL+KIIRCF  +E   QK S +NVE  LV FN+H
Sbjct  1     MAERQLIVAVEGTAAMGPYWQTVVSDYLDKIIRCFSSSELTGQKTSTSNVELALVTFNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSK  535
             GSY ACLVQRSGWT+D+D+FL WLS+I F GGGFNDAAIAEGL+EALMM   +PNGNQ++
Sbjct  61    GSYCACLVQRSGWTKDVDIFLQWLSAIPFSGGGFNDAAIAEGLSEALMMFPIAPNGNQTQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q V+GQ+HCILVAASNPYPLPTPVYRPQI N EQ+EN     + RLSDAETVAKSFAQCS
Sbjct  121   QNVDGQRHCILVAASNPYPLPTPVYRPQIQNLEQTENIEAQTESRLSDAETVAKSFAQCS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK + KLKTIY+A KRNPR  D P+DN +NP +LVLISENFME RAA +R G+
Sbjct  181   VSLSVICPKQLSKLKTIYSAGKRNPRAPDPPVDNVRNPPFLVLISENFMEGRAALSRPGV  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
             PSL S Q+PVKMD++SV   +GP P+   S+PS NG +M+RQP+  GN+  AT+K+EPTT
Sbjct  241   PSLASNQSPVKMDMASVTSGTGPPPT---SVPSVNGSMMSRQPVSVGNVPTATIKVEPTT  297

Query  1076  VTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             +TSM  GP F H+P+VPRA S  +  +QTSSP + SQE++ + +N+QE KP  V GM Q 
Sbjct  298   ITSMGTGPAFPHIPAVPRAPSPAIPTMQTSSPSTTSQEVMNSGDNVQELKP-SVSGMTQP  356

Query  1253  VRPVGAAAANVRILNDVAQAR----QALAGGTSIGLSSMGGTPM---LSNmissgmassv  1411
             +RPV   AANV ILN+++QAR     AL GGTSIGL SMG TP+   +SNMISSGMASSV
Sbjct  357   LRPV-PPAANVNILNNLSQARVMNSAALTGGTSIGLPSMGQTPVAMHMSNMISSGMASSV  415

Query  1412  saaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTL  1591
               AQ+V SS QS +TS+T S  L G  QV  +S  +SF + TS++++ SN+ MSQ M  +
Sbjct  416   PPAQTVFSSGQSCMTSLTGSGALTGTVQVPPNSGLSSFASATSNVTANSNIGMSQPMGNV  475

Query  1592  PSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqq  1771
              S VS+GQ+VPGM+Q N  G QM+Q+  G SQN MSG+ G S + SGTGTM P PGM+QQ
Sbjct  476   QSGVSMGQSVPGMSQGNHSGAQMVQSGVGMSQN-MSGL-GPSTVSSGTGTMFPIPGMSQQ  533

Query  1772  gqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEG  1951
              Q GMQ +GV+N+SAA+MPL  QQTSS LQSAQSKYVKVWEGNLSGQRQGQPVFITRLEG
Sbjct  534   VQSGMQTLGVSNSSAASMPL-SQQTSSALQSAQSKYVKVWEGNLSGQRQGQPVFITRLEG  592

Query  1952  YRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKL  2131
             YRSASASETLAA+WP+TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKL
Sbjct  593   YRSASASETLAAHWPQTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKL  652

Query  2132  CAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFK  2236
             CAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFK
Sbjct  653   CAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFK  687



>gb|KDO70069.1| hypothetical protein CISIN_1g003284mg [Citrus sinensis]
Length=834

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/697 (70%), Positives = 562/697 (81%), Gaps = 19/697 (3%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             M+EKQLI+AVEGTAAMGP+W SIVSDYLEKIIRCFC  E   QK S +NVE  LV FN+H
Sbjct  1     MSEKQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQKTSASNVELSLVTFNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSK  535
             GSY ACLVQRSGWT+D+D+FLHWLS+I F GGGFNDAAIAEGL+EALMM S +PNG+Q++
Sbjct  61    GSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSVAPNGSQNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q V+GQ+HCILVAASNP+PLPTPVYRPQ+ N +Q+EN     + RLSDAETVAKSF QCS
Sbjct  121   QNVDGQRHCILVAASNPHPLPTPVYRPQMQNLDQNENNEAQAESRLSDAETVAKSFVQCS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK + KL  IY AAKRNPR AD P+DN KNP++LVLISENFMEARAA +R G+
Sbjct  181   VSLSVICPKQLPKLTAIYNAAKRNPRAADPPVDNSKNPHFLVLISENFMEARAALSRPGV  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              +L   QNPVKMD++ V  ++GP P+   SIPS NG  +NR PI  GN+  ATVK+EP+T
Sbjct  241   ANLAPNQNPVKMDIAPVTSVTGPAPT---SIPSVNG--INRPPISVGNVPTATVKVEPST  295

Query  1076  VTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             VTSM  GPTF H+PSVPR ASQ V +LQTSSP S SQEM+ + +++ E KP+ V GM Q 
Sbjct  296   VTSMVNGPTFPHIPSVPRPASQGVPSLQTSSPSSTSQEMITSGDSVPEVKPL-VSGMSQP  354

Query  1253  VRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---LSNmissgmass  1408
             +RP+  AAANV ILN+++QARQ     AL GGTSIGL SMG TPM   +SNMISSGMASS
Sbjct  355   LRPMAPAAANVNILNNLSQARQVMNNAALTGGTSIGLQSMGQTPMAMHMSNMISSGMASS  414

Query  1409  vsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNT  1588
             V  +Q V SS+QSG+TS+  S  L G  QV Q+S   SFT+  S++S  SN  +SQ M T
Sbjct  415   VPTSQPVFSSAQSGITSIGGSGTLTGTSQVPQNSGLNSFTSAPSNLSGNSNPSISQPMGT  474

Query  1589  LPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtq  1768
             L    S+GQ+V GM+Q N  G QM+Q     +QNMMSG+ G SG+ SGTGTM+PTPGM+Q
Sbjct  475   LQGGASMGQSV-GMSQGNHSGGQMVQNGISMNQNMMSGL-GPSGVSSGTGTMIPTPGMSQ  532

Query  1769  qgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLE  1948
             Q Q GMQP+ VNNN+A NM L  QQTSS L S+QSKYVKVWEG+LSGQRQGQPVFIT+LE
Sbjct  533   QAQSGMQPLSVNNNTAVNMQL-SQQTSSALHSSQSKYVKVWEGSLSGQRQGQPVFITKLE  591

Query  1949  GYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  2128
             GYRSASASETLAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK
Sbjct  592   GYRSASASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  651

Query  2129  LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  2239
             LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP
Sbjct  652   LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  688



>gb|KHG24986.1| Mediator of RNA polymerase II transcription subunit 25 [Gossypium 
arboreum]
Length=828

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/701 (67%), Positives = 560/701 (80%), Gaps = 17/701 (2%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEKQLI+AVEGTAAMGP+W  I+SDYLEKIIRCFC  E   QK + +NVE  LV FN+H
Sbjct  1     MAEKQLIVAVEGTAAMGPYWQIILSDYLEKIIRCFCSNEFAGQKNTTSNVELSLVAFNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSK  535
             GSY ACLVQRSGWT+D+D+FL WLS+I F GGGFNDAAIAEGL+EALMM   + NGNQ+ 
Sbjct  61    GSYCACLVQRSGWTKDVDIFLQWLSAIPFSGGGFNDAAIAEGLSEALMMFPIAANGNQTH  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q  +GQ+HCILVAASNPYPLPTPVYRPQ  N EQSEN     + RLSDAETVAKSF QCS
Sbjct  121   QIADGQRHCILVAASNPYPLPTPVYRPQTQNLEQSENMESQTESRLSDAETVAKSFPQCS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK + KLK IY+A KRNPR +D P+DN +NP +LVLISENFME  AA +R+G+
Sbjct  181   VSLSVICPKQLSKLKAIYSAGKRNPRASDPPVDNVRNPQFLVLISENFMEGCAALSRSGV  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
             PSL   Q+PVKMD++SV  ++G  P+   S+PS NG +M+RQP+  GN+  ATVK+EP T
Sbjct  241   PSLAPNQSPVKMDMASVTSVAGTSPT---SVPSVNGSIMSRQPVSVGNVPTATVKVEPAT  297

Query  1076  VTSMP-GPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             +TSM  GP F H+PSVPRA  Q V  LQTSSP++ ++E++ +++N+QE KP  V GM Q 
Sbjct  298   ITSMANGPAFPHIPSVPRAPFQAVPTLQTSSPLTTTEEVMRSSDNVQEIKP-SVGGMTQP  356

Query  1253  VRPVGAAAANVRILNDVAQAR----QALAGGTSIGLSSMGGTPM---LSNmissgmassv  1411
             +RPV  AAANV ILN+++QAR     AL+GGTSIGL SMG TP+   +SNMISSGM SSV
Sbjct  357   LRPVPPAAANVNILNNLSQARVMNSAALSGGTSIGLQSMGQTPVAMHMSNMISSGMTSSV  416

Query  1412  saaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTL  1591
               AQ+V SS QS +TS+  S  + G  QV  +S   SF + TS+++  SN+ +SQ M  +
Sbjct  417   PLAQTVFSSGQSAMTSLPGSGAVTGTTQVPPNSNLNSFASATSNVAGNSNIGISQPMCNV  476

Query  1592  PSSVSVGQTVPG-MNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtq  1768
               +VS+GQ+VPG M+  N  G Q++QT    SQ+ MSG+ G S + SGTGT++PTPG++Q
Sbjct  477   QGAVSMGQSVPGSMSHGNHSGAQLVQTGVAMSQS-MSGL-GPSTVSSGTGTLIPTPGLSQ  534

Query  1769  qgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLE  1948
             Q Q GMQ IGVNNNSAA+MPL  QQTSS LQSAQSKYVKVWEGNLSGQRQGQPVFITRLE
Sbjct  535   QVQSGMQTIGVNNNSAASMPL-SQQTSSALQSAQSKYVKVWEGNLSGQRQGQPVFITRLE  593

Query  1949  GYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  2128
             GYRSASASETLA++WP+TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK
Sbjct  594   GYRSASASETLASDWPQTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  653

Query  2129  LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             LCAVIQLPSQTL+LSVSDKA RLIGMLFPGDMVVFKPQI++
Sbjct  654   LCAVIQLPSQTLMLSVSDKAYRLIGMLFPGDMVVFKPQISS  694



>emb|CBI27055.3| unnamed protein product [Vitis vinifera]
Length=815

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/702 (69%), Positives = 572/702 (81%), Gaps = 31/702 (4%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEKQL++AVEGTAAMGP+W ++VSDYL+KIIR FCG E   QKPS +N E  LVMFN+H
Sbjct  1     MAEKQLVVAVEGTAAMGPYWQAVVSDYLDKIIRYFCGNELAGQKPSSSNFELSLVMFNAH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSK  535
             GSY +CLVQRSGWTRD+DLFL WLS++ F GGGFNDAAIAEGLAEALMM S + NG+Q++
Sbjct  61    GSYCSCLVQRSGWTRDVDLFLQWLSALPFAGGGFNDAAIAEGLAEALMMFSVAANGSQTQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q V+GQ+HCILVAA+NPYPLPTPVY+PQ+ N EQ+E+     + RLSDAE VAKSFAQCS
Sbjct  121   QNVDGQRHCILVAANNPYPLPTPVYQPQMQNMEQNESIESQTESRLSDAEAVAKSFAQCS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK + KLK+IY A KRNPR AD P+DN KNP++LVLIS++FMEARAA +R G+
Sbjct  181   VSLSVICPKQLPKLKSIYNAGKRNPRVADPPVDNVKNPHFLVLISDSFMEARAALSRPGL  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              ++ + Q+PVKMD++SVP +S   P   ASIPS NG +MNR  I  G +  ATVK+EP+T
Sbjct  241   SNMTANQSPVKMDIASVPQVSAAPP---ASIPSVNG-IMNRPTIAVGAVPTATVKVEPST  296

Query  1076  VTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             VTS+  GP F H+PSVPRAASQ V +LQTSSP S SQEM++N +N+Q+ KP +V G+ Q+
Sbjct  297   VTSITSGPGFPHIPSVPRAASQGVPSLQTSSPSSTSQEMISNGDNVQDLKP-IVSGISQT  355

Query  1253  VRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---LSNmissgmass  1408
             +RPV  AAANV ILN+++QARQ     AL+GGTSIGL SMGGT M   +SNMISSGMASS
Sbjct  356   LRPVVPAAANVSILNNLSQARQVMHSAALSGGTSIGLQSMGGTSMAMHMSNMISSGMASS  415

Query  1409  vsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNT  1588
             V A Q+V SS QS V+S+T S  LAG  QV Q+SA  SFT+ TS+M             +
Sbjct  416   VPATQTVFSSGQSAVSSITGSGTLAGTAQVAQNSALGSFTSATSNM-------------S  462

Query  1589  LPSSVSVGQ-TVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmt  1765
             + S++ + Q  +PGM+Q N+PG QM+Q+  G +QNMMSG+ G SGI SGTGTM+PTPGM+
Sbjct  463   VNSNLGISQPLIPGMSQGNLPGGQMVQSGIGMNQNMMSGL-GPSGISSGTGTMIPTPGMS  521

Query  1766  qqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRL  1945
             QQ Q GM  +GVNNN+AANMPL  QQTS  +Q+AQSKYVKVWEGNLSGQRQGQPVFITRL
Sbjct  522   QQVQPGMPSLGVNNNAAANMPL-PQQTSGAMQTAQSKYVKVWEGNLSGQRQGQPVFITRL  580

Query  1946  EGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEK  2125
             EGYRSASASE+LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEK
Sbjct  581   EGYRSASASESLAANWPATMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEK  640

Query  2126  KLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             KLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN
Sbjct  641   KLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  682



>ref|XP_006437725.1| hypothetical protein CICLE_v10030710mg [Citrus clementina]
 ref|XP_006484419.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X1 [Citrus sinensis]
 gb|ESR50965.1| hypothetical protein CICLE_v10030710mg [Citrus clementina]
Length=830

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/697 (70%), Positives = 561/697 (80%), Gaps = 19/697 (3%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             M+EKQLI+AVEGTAAMGP+W SIVSDYLEKIIRCFC  E   QK S +NVE  LV FN+H
Sbjct  1     MSEKQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQKTSASNVELSLVTFNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSK  535
             GSY ACLVQRSGWT+D+D+FLHWLS+I F GGGFNDAAIAEGL+EALMM S +PNG+Q++
Sbjct  61    GSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSVAPNGSQNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q V+GQ+HCILVAASNP+PLPTPVYRPQ+ N +Q+EN     + RLSDAETVAKSF QCS
Sbjct  121   QNVDGQRHCILVAASNPHPLPTPVYRPQMQNLDQNENNEAQAESRLSDAETVAKSFVQCS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK + KL  IY AAKRNPR AD P+DN KNP++LVLISENFMEARAA +R G+
Sbjct  181   VSLSVICPKQLPKLTAIYNAAKRNPRAADPPVDNSKNPHFLVLISENFMEARAALSRPGV  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              +L   QNPVKMD++ V  ++GP P+   SIPS NG  +NR PI  GN+  ATVK+EP+T
Sbjct  241   ANLAPNQNPVKMDIAPVTSVTGPAPT---SIPSVNG--INRPPISVGNVPTATVKVEPST  295

Query  1076  VTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             VTSM  GPTF H+PSV R ASQ V +LQTSSP S SQEM+ + +++ E KP+ V GM Q 
Sbjct  296   VTSMVNGPTFPHIPSVSRPASQGVPSLQTSSPSSTSQEMITSGDSVPEVKPL-VSGMSQP  354

Query  1253  VRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---LSNmissgmass  1408
             +RP+  AAANV ILN+++QARQ     AL GGTSIGL SMG TPM   +SNMISSGMASS
Sbjct  355   LRPMAPAAANVNILNNLSQARQVMNNAALTGGTSIGLQSMGQTPMAMHMSNMISSGMASS  414

Query  1409  vsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNT  1588
             V  +Q V SS+QSG+TS+  S  L G  QV Q+S   SFT+  S++S  SN  +SQ M T
Sbjct  415   VPTSQPVFSSAQSGITSIGGSGTLTGTSQVPQNSGLNSFTSAPSNLSGNSNPSISQPMGT  474

Query  1589  LPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtq  1768
             L    S+GQ+V GM+Q N  G QM+Q     +QNMMSG+ G SG+ SGTGTM+PTPGM+Q
Sbjct  475   LQGGASMGQSV-GMSQGNHSGGQMVQNGISMNQNMMSGL-GPSGVSSGTGTMIPTPGMSQ  532

Query  1769  qgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLE  1948
             Q Q GMQP+ VNNN+A NM L  QQTSS L S+QSKYVKVWEG+LSGQRQGQPVFIT+LE
Sbjct  533   QAQSGMQPLSVNNNTAVNMQL-SQQTSSALHSSQSKYVKVWEGSLSGQRQGQPVFITKLE  591

Query  1949  GYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  2128
             GYRSASASETLAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK
Sbjct  592   GYRSASASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  651

Query  2129  LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  2239
             LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP
Sbjct  652   LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  688



>ref|XP_007046292.1| Phytochrome and flowering time regulatory protein isoform 2 [Theobroma 
cacao]
 gb|EOY02124.1| Phytochrome and flowering time regulatory protein isoform 2 [Theobroma 
cacao]
Length=860

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/695 (68%), Positives = 556/695 (80%), Gaps = 28/695 (4%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAE+QLI+AVEGTAAMGP+W ++VSDYL+KIIRCF  +E   QK S +NVE  LV FN+H
Sbjct  1     MAERQLIVAVEGTAAMGPYWQTVVSDYLDKIIRCFSSSELTGQKTSTSNVELALVTFNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSK  535
             GSY ACLVQRSGWT+D+D+FL WLS+I F GGGFNDAAIAEGL+EALMM   +PNGNQ++
Sbjct  61    GSYCACLVQRSGWTKDVDIFLQWLSAIPFSGGGFNDAAIAEGLSEALMMFPIAPNGNQTQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q V+GQ+HCILVAASNPYPLPTPVYRPQI N EQ+EN     + RLSDAETVAKSFAQCS
Sbjct  121   QNVDGQRHCILVAASNPYPLPTPVYRPQIQNLEQTENIEAQTESRLSDAETVAKSFAQCS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK + KLKTIY+A KRNPR  D P+DN +NP +LVLISENFME RAA +R G+
Sbjct  181   VSLSVICPKQLSKLKTIYSAGKRNPRAPDPPVDNVRNPPFLVLISENFMEGRAALSRPGV  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
             PSL S Q+PVKMD              +AS+ S NG +M+RQP+  GN+  AT+K+EPTT
Sbjct  241   PSLASNQSPVKMD--------------MASVTSVNGSMMSRQPVSVGNVPTATIKVEPTT  286

Query  1076  VTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             +TSM  GP F H+P+VPRA S  +  +QTSSP + SQE++ + +N+QE KP  V GM Q 
Sbjct  287   ITSMGTGPAFPHIPAVPRAPSPAIPTMQTSSPSTTSQEVMNSGDNVQELKP-SVSGMTQP  345

Query  1253  VRPVGAAAANVRILNDVAQAR----QALAGGTSIGLSSMGGTPM---LSNmissgmassv  1411
             +RPV   AANV ILN+++QAR     AL GGTSIGL SMG TP+   +SNMISSGMASSV
Sbjct  346   LRPV-PPAANVNILNNLSQARVMNSAALTGGTSIGLPSMGQTPVAMHMSNMISSGMASSV  404

Query  1412  saaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTL  1591
               AQ+V SS QS +TS+T S  L G  QV  +S  +SF + TS++++ SN+ MSQ M  +
Sbjct  405   PPAQTVFSSGQSCMTSLTGSGALTGTVQVPPNSGLSSFASATSNVTANSNIGMSQPMGNV  464

Query  1592  PSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqq  1771
              S VS+GQ+VPGM+Q N  G QM+Q+  G SQN MSG+ G S + SGTGTM P PGM+QQ
Sbjct  465   QSGVSMGQSVPGMSQGNHSGAQMVQSGVGMSQN-MSGL-GPSTVSSGTGTMFPIPGMSQQ  522

Query  1772  gqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEG  1951
              Q GMQ +GV+N+SAA+MPL  QQTSS LQSAQSKYVKVWEGNLSGQRQGQPVFITRLEG
Sbjct  523   VQSGMQTLGVSNSSAASMPL-SQQTSSALQSAQSKYVKVWEGNLSGQRQGQPVFITRLEG  581

Query  1952  YRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKL  2131
             YRSASASETLAA+WP+TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKL
Sbjct  582   YRSASASETLAAHWPQTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKL  641

Query  2132  CAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFK  2236
             CAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFK
Sbjct  642   CAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFK  676



>gb|KDO70068.1| hypothetical protein CISIN_1g003284mg [Citrus sinensis]
Length=833

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/697 (70%), Positives = 561/697 (80%), Gaps = 20/697 (3%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             M+EKQLI+AVEGTAAMGP+W SIVSDYLEKIIRCFC  E   Q  S +NVE  LV FN+H
Sbjct  1     MSEKQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQT-SASNVELSLVTFNTH  59

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSK  535
             GSY ACLVQRSGWT+D+D+FLHWLS+I F GGGFNDAAIAEGL+EALMM S +PNG+Q++
Sbjct  60    GSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSVAPNGSQNQ  119

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q V+GQ+HCILVAASNP+PLPTPVYRPQ+ N +Q+EN     + RLSDAETVAKSF QCS
Sbjct  120   QNVDGQRHCILVAASNPHPLPTPVYRPQMQNLDQNENNEAQAESRLSDAETVAKSFVQCS  179

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK + KL  IY AAKRNPR AD P+DN KNP++LVLISENFMEARAA +R G+
Sbjct  180   VSLSVICPKQLPKLTAIYNAAKRNPRAADPPVDNSKNPHFLVLISENFMEARAALSRPGV  239

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              +L   QNPVKMD++ V  ++GP P+   SIPS NG  +NR PI  GN+  ATVK+EP+T
Sbjct  240   ANLAPNQNPVKMDIAPVTSVTGPAPT---SIPSVNG--INRPPISVGNVPTATVKVEPST  294

Query  1076  VTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             VTSM  GPTF H+PSVPR ASQ V +LQTSSP S SQEM+ + +++ E KP+ V GM Q 
Sbjct  295   VTSMVNGPTFPHIPSVPRPASQGVPSLQTSSPSSTSQEMITSGDSVPEVKPL-VSGMSQP  353

Query  1253  VRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---LSNmissgmass  1408
             +RP+  AAANV ILN+++QARQ     AL GGTSIGL SMG TPM   +SNMISSGMASS
Sbjct  354   LRPMAPAAANVNILNNLSQARQVMNNAALTGGTSIGLQSMGQTPMAMHMSNMISSGMASS  413

Query  1409  vsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNT  1588
             V  +Q V SS+QSG+TS+  S  L G  QV Q+S   SFT+  S++S  SN  +SQ M T
Sbjct  414   VPTSQPVFSSAQSGITSIGGSGTLTGTSQVPQNSGLNSFTSAPSNLSGNSNPSISQPMGT  473

Query  1589  LPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtq  1768
             L    S+GQ+V GM+Q N  G QM+Q     +QNMMSG+ G SG+ SGTGTM+PTPGM+Q
Sbjct  474   LQGGASMGQSV-GMSQGNHSGGQMVQNGISMNQNMMSGL-GPSGVSSGTGTMIPTPGMSQ  531

Query  1769  qgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLE  1948
             Q Q GMQP+ VNNN+A NM L  QQTSS L S+QSKYVKVWEG+LSGQRQGQPVFIT+LE
Sbjct  532   QAQSGMQPLSVNNNTAVNMQL-SQQTSSALHSSQSKYVKVWEGSLSGQRQGQPVFITKLE  590

Query  1949  GYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  2128
             GYRSASASETLAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK
Sbjct  591   GYRSASASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  650

Query  2129  LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  2239
             LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP
Sbjct  651   LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  687



>ref|XP_006484420.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X2 [Citrus sinensis]
Length=829

 Score =   780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/697 (70%), Positives = 560/697 (80%), Gaps = 20/697 (3%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             M+EKQLI+AVEGTAAMGP+W SIVSDYLEKIIRCFC  E   Q  S +NVE  LV FN+H
Sbjct  1     MSEKQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQT-SASNVELSLVTFNTH  59

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSK  535
             GSY ACLVQRSGWT+D+D+FLHWLS+I F GGGFNDAAIAEGL+EALMM S +PNG+Q++
Sbjct  60    GSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSVAPNGSQNQ  119

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q V+GQ+HCILVAASNP+PLPTPVYRPQ+ N +Q+EN     + RLSDAETVAKSF QCS
Sbjct  120   QNVDGQRHCILVAASNPHPLPTPVYRPQMQNLDQNENNEAQAESRLSDAETVAKSFVQCS  179

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK + KL  IY AAKRNPR AD P+DN KNP++LVLISENFMEARAA +R G+
Sbjct  180   VSLSVICPKQLPKLTAIYNAAKRNPRAADPPVDNSKNPHFLVLISENFMEARAALSRPGV  239

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              +L   QNPVKMD++ V  ++GP P+   SIPS NG  +NR PI  GN+  ATVK+EP+T
Sbjct  240   ANLAPNQNPVKMDIAPVTSVTGPAPT---SIPSVNG--INRPPISVGNVPTATVKVEPST  294

Query  1076  VTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             VTSM  GPTF H+PSV R ASQ V +LQTSSP S SQEM+ + +++ E KP+ V GM Q 
Sbjct  295   VTSMVNGPTFPHIPSVSRPASQGVPSLQTSSPSSTSQEMITSGDSVPEVKPL-VSGMSQP  353

Query  1253  VRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---LSNmissgmass  1408
             +RP+  AAANV ILN+++QARQ     AL GGTSIGL SMG TPM   +SNMISSGMASS
Sbjct  354   LRPMAPAAANVNILNNLSQARQVMNNAALTGGTSIGLQSMGQTPMAMHMSNMISSGMASS  413

Query  1409  vsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNT  1588
             V  +Q V SS+QSG+TS+  S  L G  QV Q+S   SFT+  S++S  SN  +SQ M T
Sbjct  414   VPTSQPVFSSAQSGITSIGGSGTLTGTSQVPQNSGLNSFTSAPSNLSGNSNPSISQPMGT  473

Query  1589  LPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtq  1768
             L    S+GQ+V GM+Q N  G QM+Q     +QNMMSG+ G SG+ SGTGTM+PTPGM+Q
Sbjct  474   LQGGASMGQSV-GMSQGNHSGGQMVQNGISMNQNMMSGL-GPSGVSSGTGTMIPTPGMSQ  531

Query  1769  qgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLE  1948
             Q Q GMQP+ VNNN+A NM L  QQTSS L S+QSKYVKVWEG+LSGQRQGQPVFIT+LE
Sbjct  532   QAQSGMQPLSVNNNTAVNMQL-SQQTSSALHSSQSKYVKVWEGSLSGQRQGQPVFITKLE  590

Query  1949  GYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  2128
             GYRSASASETLAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK
Sbjct  591   GYRSASASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  650

Query  2129  LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  2239
             LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP
Sbjct  651   LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  687



>ref|XP_009356323.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X2 [Pyrus x bretschneideri]
 ref|XP_009356332.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X2 [Pyrus x bretschneideri]
 ref|XP_009356340.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X2 [Pyrus x bretschneideri]
Length=839

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/692 (65%), Positives = 533/692 (77%), Gaps = 27/692 (4%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEKQLI+AV GT AMGP+W ++VSDYL+KIIR FCG E   QK S + VE  LV FN+H
Sbjct  1     MAEKQLIVAVGGTPAMGPYWATVVSDYLDKIIRSFCGNEQSGQKLSTSTVELSLVTFNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSS-PNGNQSK  535
             GSY  CLVQRSGWTRD+DLFLHWLS+I F GGGF+DAAIAEGL+EALMM  +  NG+Q++
Sbjct  61    GSYCGCLVQRSGWTRDVDLFLHWLSAIPFSGGGFSDAAIAEGLSEALMMFPTVQNGSQNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q V+ QKHC+L+AASNP+PLPTPVYRPQI N EQ+EN     + RL DAE VAKSF Q S
Sbjct  121   QNVDFQKHCVLIAASNPHPLPTPVYRPQIQNLEQNENIDAQTENRLYDAEAVAKSFPQSS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK + KL+ IY A KRNPR AD PIDN KNP+++VLISENFMEARA  +R G+
Sbjct  181   VSLSVICPKQLPKLRAIYNAGKRNPRAADPPIDNAKNPHFIVLISENFMEARATLSRPGI  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              +LPS Q+PVKMD++ V  ++GP P+   S+PS NGPVMNRQPI  GN+ PATVK+EP+T
Sbjct  241   TTLPSNQSPVKMDIAPVASVTGPPPT---SMPSVNGPVMNRQPISVGNVPPATVKVEPST  297

Query  1076  VTSMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
             V+SM GP+FAH+PSV R  SQ V +LQTSSP S SQEM  NN+N+ + KP VV G+    
Sbjct  298   VSSM-GPSFAHIPSV-RPPSQGVPSLQTSSPSSASQEMATNNDNVPDLKP-VVSGVTHPS  354

Query  1256  RPVGAAAANVRILNDVAQAR----QALAGGTSIGLSSMGGTPMLSNmissgmassvsaaq  1423
             RPVG+      ILN+++QAR     AL GGTS+GL +MG  PM  ++ +   +   S+  
Sbjct  355   RPVGS------ILNNISQARVMNAAALTGGTSMGLPTMGQNPMAMHVSNMISSGMASSVG  408

Query  1424  svisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSSV  1603
             +  +   S  +   +        QV Q+    SFT+ TS++S  +NL MSQ M+ L   V
Sbjct  409   AAQNVFSSSGSGTLT--------QVAQNPGLNSFTSGTSNVSGNNNLGMSQPMSNLQGGV  460

Query  1604  SVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqg  1783
             S+GQ VPGM+Q N+ G QM+Q+  G + NMMS + G++G  SGTGTM+PTPGM QQ Q G
Sbjct  461   SMGQAVPGMSQGNLSGQQMVQSGIGMNPNMMSAL-GSTGASSGTGTMIPTPGMAQQVQSG  519

Query  1784  mqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSA  1963
             MQ +G NNNSA+N+P   QQTSS L SAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRSA
Sbjct  520   MQSLGANNNSASNVPF-SQQTSSALASAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRSA  578

Query  1964  SASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVI  2143
             SASETLAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVI
Sbjct  579   SASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVI  638

Query  2144  QLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  2239
             QLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP
Sbjct  639   QLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  670



>ref|XP_009356316.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X1 [Pyrus x bretschneideri]
Length=846

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/699 (65%), Positives = 533/699 (76%), Gaps = 34/699 (5%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEKQLI+AV GT AMGP+W ++VSDYL+KIIR FCG E   QK S + VE  LV FN+H
Sbjct  1     MAEKQLIVAVGGTPAMGPYWATVVSDYLDKIIRSFCGNEQSGQKLSTSTVELSLVTFNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSS-PNGNQSK  535
             GSY  CLVQRSGWTRD+DLFLHWLS+I F GGGF+DAAIAEGL+EALMM  +  NG+Q++
Sbjct  61    GSYCGCLVQRSGWTRDVDLFLHWLSAIPFSGGGFSDAAIAEGLSEALMMFPTVQNGSQNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q V+ QKHC+L+AASNP+PLPTPVYRPQI N EQ+EN     + RL DAE VAKSF Q S
Sbjct  121   QNVDFQKHCVLIAASNPHPLPTPVYRPQIQNLEQNENIDAQTENRLYDAEAVAKSFPQSS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK + KL+ IY A KRNPR AD PIDN KNP+++VLISENFMEARA  +R G+
Sbjct  181   VSLSVICPKQLPKLRAIYNAGKRNPRAADPPIDNAKNPHFIVLISENFMEARATLSRPGI  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              +LPS Q+PVKMD++ V  ++GP P+   S+PS NGPVMNRQPI  GN+ PATVK+EP+T
Sbjct  241   TTLPSNQSPVKMDIAPVASVTGPPPT---SMPSVNGPVMNRQPISVGNVPPATVKVEPST  297

Query  1076  VTSMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
             V+SM GP+FAH+PSV R  SQ V +LQTSSP S SQEM  NN+N+ + KP VV G+    
Sbjct  298   VSSM-GPSFAHIPSV-RPPSQGVPSLQTSSPSSASQEMATNNDNVPDLKP-VVSGVTHPS  354

Query  1256  RPVGAAAANVRILNDVAQAR----QALAGGTSIGLSSMGGTPMLSNmissgmassvsaaq  1423
             RPVG+      ILN+++QAR     AL GGTS+GL +MG  PM  ++ +   +   S+  
Sbjct  355   RPVGS------ILNNISQARVMNAAALTGGTSMGLPTMGQNPMAMHVSNMISSGMASSVG  408

Query  1424  svisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSSV  1603
             +  +   S  +   +        QV Q+    SFT+ TS++S  +NL MSQ M+ L   V
Sbjct  409   AAQNVFSSSGSGTLT--------QVAQNPGLNSFTSGTSNVSGNNNLGMSQPMSNLQGGV  460

Query  1604  SVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqg  1783
             S+GQ VPGM+Q N+ G QM+Q+  G + NMMS + G++G  SGTGTM+PTPGM QQ Q G
Sbjct  461   SMGQAVPGMSQGNLSGQQMVQSGIGMNPNMMSAL-GSTGASSGTGTMIPTPGMAQQVQSG  519

Query  1784  mqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSA  1963
             MQ +G NNNSA+N+P   QQTSS L SAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRSA
Sbjct  520   MQSLGANNNSASNVPF-SQQTSSALASAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRSA  578

Query  1964  SASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVI  2143
             SASETLAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVI
Sbjct  579   SASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVI  638

Query  2144  QLPSQTLLLSVSDKACRLIGMLFPG-------DMVVFKP  2239
             QLPSQTLLLSVSDKACRLIGMLFPG       DMVVFKP
Sbjct  639   QLPSQTLLLSVSDKACRLIGMLFPGLNLPSVQDMVVFKP  677



>ref|XP_010265228.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 [Nelumbo nucifera]
Length=809

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/697 (63%), Positives = 534/697 (77%), Gaps = 22/697 (3%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEKQLI+A+EGTAAMGP W ++VSDYLEKIIRCFCG E   QK  GAN E  LV+FN+H
Sbjct  1     MAEKQLIVAIEGTAAMGPFWNTVVSDYLEKIIRCFCGKELSGQKLPGANFELSLVVFNAH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSK  535
             GS SACLVQRSGWT+++D FL WLS+I F GGGF +AAI EGL+EALMM   +PNG+Q++
Sbjct  61    GSCSACLVQRSGWTKNMDTFLQWLSAIPFTGGGFCEAAIGEGLSEALMMFCVAPNGSQTQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q V+GQKHCILVAASNPYPLPTPVYRP   N E++E+     +  LSDAETVAKSFAQC 
Sbjct  121   QNVDGQKHCILVAASNPYPLPTPVYRPPNQNLEKNESMEGQTESCLSDAETVAKSFAQCF  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+ PK + KLK IY A KRNPR AD  +DN KNP +L+L+SENFMEARAA +R G+
Sbjct  181   VSLSVISPKQLPKLKAIYNAGKRNPRAADPSVDNLKNPQFLILLSENFMEARAALSRPGI  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              SL S Q PVKMD +SVPP+SGP     ASIPS NGP+M RQ IP GNI  ATVK+EPTT
Sbjct  241   TSLTSNQGPVKMDTTSVPPVSGP----SASIPSVNGPLMTRQQIPVGNIPTATVKVEPTT  296

Query  1076  VTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             V+SM  GP F+++P V   A+Q V +LQTSSPI+ SQEM+AN +N+QE KP +V+ + Q 
Sbjct  297   VSSMVTGPGFSNIPPVSHGATQAVPSLQTSSPIASSQEMIANADNVQEFKP-IVNPVSQP  355

Query  1253  VRPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPMLSNmissgmassvsaaqsvi  1432
             +RP G AAANV ILN+++Q R     G+SIGL ++G TPM  +M +   +   S+     
Sbjct  356   LRPPG-AAANVNILNNLSQVR-----GSSIGLQTVGATPMAMHMSNMISSGMASSVLPAA  409

Query  1433  sssqsgvtsmtssM----PLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSS  1600
              +  S   S  +S+     L G  QV Q++A  S T+  S++S  SNL +SQ +  +  +
Sbjct  410   QTVFSSGQSSITSLTGSGSLMGTAQVTQNTAIGSLTSAASNISGNSNLGISQPLANIQGA  469

Query  1601  VSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqq  1780
             VS+GQ VP + Q N+ GTQ+ Q+  G +QN+M+G+ G SGI SG GTM+PTPGM+QQ Q 
Sbjct  470   VSMGQPVPTVGQGNLSGTQIGQSGIGMNQNIMTGL-GPSGISSGAGTMIPTPGMSQQVQG  528

Query  1781  gmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRS  1960
             G Q +GVNN SAAN+    QQT+  LQ +QS+YVK+WEG LSGQRQGQPVFITRLEGYR+
Sbjct  529   GTQSLGVNNGSAANV----QQTAGTLQPSQSRYVKLWEGALSGQRQGQPVFITRLEGYRN  584

Query  1961  ASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAV  2140
              +ASETLA++WP TMQIVRLISQDHMNNKQYVGKADFLVFRA+NQHGFLGQLQ+KKLCAV
Sbjct  585   VTASETLASDWPPTMQIVRLISQDHMNNKQYVGKADFLVFRALNQHGFLGQLQDKKLCAV  644

Query  2141  IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI N
Sbjct  645   IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIPN  681



>ref|XP_008243186.1| PREDICTED: LOW QUALITY PROTEIN: mediator of RNA polymerase II 
transcription subunit 25 [Prunus mume]
Length=868

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/695 (65%), Positives = 533/695 (77%), Gaps = 27/695 (4%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEKQLI+AVEGTAAMGP+W++++SDYL+KIIRCFCG E   QKPS + VE  LV F +H
Sbjct  1     MAEKQLIVAVEGTAAMGPYWSTVISDYLDKIIRCFCGNELNGQKPSTSTVELSLVTFYTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSS-PNGNQSK  535
             GSY  CLVQRSGWTRD+DLFL WLS+I F GGGF+DAAIAEGL+EALMM  +  NGNQ++
Sbjct  61    GSYCGCLVQRSGWTRDLDLFLQWLSAIPFSGGGFSDAAIAEGLSEALMMFPTVQNGNQNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q V+ QKHCIL+AASNP+PLPTPVYRPQ+ N EQ+E+     + RL DAE VAKSF QCS
Sbjct  121   QNVDCQKHCILIAASNPHPLPTPVYRPQLQNLEQNESIDAQTENRLYDAEAVAKSFPQCS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK + KL+ IY A KRNPR AD PIDN KNP +LVLISENFMEARA  +R G 
Sbjct  181   VSLSVICPKQLPKLRAIYNAGKRNPRVADPPIDNAKNPQFLVLISENFMEARATLSRPGS  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              +LPS  +PVKMD++ V  ++GP P+   S+PS NG VMNRQP+  GN+ PATVK+EP+T
Sbjct  241   TNLPSNPSPVKMDIAPVASVTGPPPT---SMPSVNGSVMNRQPVAVGNVPPATVKVEPST  297

Query  1076  VTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             V+SM  GP F H+PSV R  SQ V +LQTSSP S SQEM  NNEN+ + KP VV G+   
Sbjct  298   VSSMVAGPAFPHIPSV-RPPSQGVPSLQTSSPSSASQEMTTNNENVPDLKP-VVSGVTHP  355

Query  1253  VRPVGAAAANVRILNDVAQAR----QALAGGTSIGLSSMGGTPMLSNmissgmassvsaa  1420
              RPVG+      ILN+++QAR     AL GGTSIGL +MG  PM  ++ +   +   S+ 
Sbjct  356   SRPVGS------ILNNISQARVMNSAALTGGTSIGLQTMGQNPMAMHVSNMISSGMASSV  409

Query  1421  qsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSS  1600
              +  +   S  +   +        QV Q+S  +SFT+  S++S  +NL +SQ M+ L   
Sbjct  410   GAAQNVFSSSGSGTLT--------QVAQNSGLSSFTSANSNVSGNNNLGISQPMSNLQGG  461

Query  1601  VSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqq  1780
             VS+GQ+VPGM+Q N+ G QM+Q+A G + NMMS +G +    SGTGTM+PTPG  QQ Q 
Sbjct  462   VSMGQSVPGMSQGNLSGPQMVQSAIGMNPNMMSALGSSGSS-SGTGTMIPTPGRPQQVQA  520

Query  1781  gmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRS  1960
             G+Q +  NN+SA N+PL  QQTSS LQSAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRS
Sbjct  521   GIQSLXANNSSAPNVPL-SQQTSSALQSAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRS  579

Query  1961  ASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAV  2140
             ASASETLAANWP TMQIVRLISQDHMNNKQYVG+ADFLVFRAMNQHGFLGQLQEKKLCAV
Sbjct  580   ASASETLAANWPPTMQIVRLISQDHMNNKQYVGRADFLVFRAMNQHGFLGQLQEKKLCAV  639

Query  2141  IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQ+
Sbjct  640   IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQV  674



>gb|KDO70070.1| hypothetical protein CISIN_1g003284mg [Citrus sinensis]
Length=818

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/665 (69%), Positives = 531/665 (80%), Gaps = 19/665 (3%)
 Frame = +2

Query  275   RCFCGAEAGSQKPSGANVEFGLVMFNSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGG  454
             RCFC  E   QK S +NVE  LV FN+HGSY ACLVQRSGWT+D+D+FLHWLS+I F GG
Sbjct  17    RCFCVNELAGQKTSASNVELSLVTFNTHGSYCACLVQRSGWTKDVDIFLHWLSTIPFAGG  76

Query  455   GFNDAAIAEGLAEALMMLS-SPNGNQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNS  631
             GFNDAAIAEGL+EALMM S +PNG+Q++Q V+GQ+HCILVAASNP+PLPTPVYRPQ+ N 
Sbjct  77    GFNDAAIAEGLSEALMMFSVAPNGSQNQQNVDGQRHCILVAASNPHPLPTPVYRPQMQNL  136

Query  632   EQSENETQTDDRRLSDAETVAKSFAQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPI  811
             +Q+EN     + RLSDAETVAKSF QCSVSLSV+CPK + KL  IY AAKRNPR AD P+
Sbjct  137   DQNENNEAQAESRLSDAETVAKSFVQCSVSLSVICPKQLPKLTAIYNAAKRNPRAADPPV  196

Query  812   DNPKNPYYLVLISENFMEARAAFNRTGMPSLPSTQNPVKMDVSSVPPISGPLPSGLASIP  991
             DN KNP++LVLISENFMEARAA +R G+ +L   QNPVKMD++ V  ++GP P+   SIP
Sbjct  197   DNSKNPHFLVLISENFMEARAALSRPGVANLAPNQNPVKMDIAPVTSVTGPAPT---SIP  253

Query  992   SANGPVMNRQPIPTGNIHPATVKIEPTTVTSM-PGPTFAHVPSVPRAASQPVQNLQTSSP  1168
             S NG  +NR PI  GN+  ATVK+EP+TVTSM  GPTF H+PSVPR ASQ V +LQTSSP
Sbjct  254   SVNG--INRPPISVGNVPTATVKVEPSTVTSMVNGPTFPHIPSVPRPASQGVPSLQTSSP  311

Query  1169  ISVSQEMVANNENLQETKPMVVHGMGQSVRPVGAAAANVRILNDVAQARQ-----ALAGG  1333
              S SQEM+ + +++ E KP+ V GM Q +RP+  AAANV ILN+++QARQ     AL GG
Sbjct  312   SSTSQEMITSGDSVPEVKPL-VSGMSQPLRPMAPAAANVNILNNLSQARQVMNNAALTGG  370

Query  1334  TSIGLSSMGGTPM---LSNmissgmassvsaaqsvisssqsgvtsmtssMPLAGPGQVVQ  1504
             TSIGL SMG TPM   +SNMISSGMASSV  +Q V SS+QSG+TS+  S  L G  QV Q
Sbjct  371   TSIGLQSMGQTPMAMHMSNMISSGMASSVPTSQPVFSSAQSGITSIGGSGTLTGTSQVPQ  430

Query  1505  ssaptsftattssmsstsnlvmsqsmNTLPSSVSVGQTVPGMNQANMPGTQMMQTATGRS  1684
             +S   SFT+  S++S  SN  +SQ M TL    S+GQ+V GM+Q N  G QM+Q     +
Sbjct  431   NSGLNSFTSAPSNLSGNSNPSISQPMGTLQGGASMGQSV-GMSQGNHSGGQMVQNGISMN  489

Query  1685  QNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqs  1864
             QNMMSG+ G SG+ SGTGTM+PTPGM+QQ Q GMQP+ VNNN+A NM L  QQTSS L S
Sbjct  490   QNMMSGL-GPSGVSSGTGTMIPTPGMSQQAQSGMQPLSVNNNTAVNMQL-SQQTSSALHS  547

Query  1865  aqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNN  2044
             +QSKYVKVWEG+LSGQRQGQPVFIT+LEGYRSASASETLAANWP TMQIVRLISQDHMNN
Sbjct  548   SQSKYVKVWEGSLSGQRQGQPVFITKLEGYRSASASETLAANWPPTMQIVRLISQDHMNN  607

Query  2045  KQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDM  2224
             KQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDM
Sbjct  608   KQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDM  667

Query  2225  VVFKP  2239
             VVFKP
Sbjct  668   VVFKP  672



>ref|XP_004135110.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Cucumis sativus]
Length=858

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/696 (65%), Positives = 536/696 (77%), Gaps = 24/696 (3%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MA+KQLI+ VEGTAAMGP W ++VSDY+EKI+R FCG E   QKP  +NVEF LV F++H
Sbjct  1     MADKQLIVVVEGTAAMGPFWQTVVSDYIEKIVRSFCGNELTGQKPPTSNVEFSLVTFHTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSK  535
             GSY  CLVQR+GWTRD+D+F+ WLS+I F GGGF+DAAIAEGLAEALMM  + PNG Q++
Sbjct  61    GSYCGCLVQRTGWTRDVDIFIQWLSAIPFSGGGFSDAAIAEGLAEALMMFPTQPNGGQNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             QT++ QKHCILVAASNPYPLPTPVYRP + N EQ +N      +  S AETVAKSF QC 
Sbjct  121   QTMDMQKHCILVAASNPYPLPTPVYRPAVQNLEQHDNVEPGSSQ--SYAETVAKSFPQCF  178

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             +SLSV+CPK + KLK IY A KRNPR AD PIDN K+P YLVLISENF+EARAA +R G+
Sbjct  179   ISLSVICPKQLPKLKAIYTAGKRNPRAADPPIDNVKSPSYLVLISENFVEARAALSRPGI  238

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              SLP+ Q+PVKMD+SSV            + PS NGP++NRQP+   N   ATVK+EP T
Sbjct  239   TSLPANQSPVKMDISSV---VPVTGPPPTTTPSVNGPIINRQPVSVPNGPTATVKVEPNT  295

Query  1076  VTSMP-GPTF-AHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQ  1249
             VTSM  G  +  H+PSV RAASQ V +LQTSSP+S SQEM+ NNEN Q+ KP+V  G+ Q
Sbjct  296   VTSMTNGSGYPPHMPSVVRAASQGVPSLQTSSPLS-SQEMITNNENTQDLKPLVT-GVPQ  353

Query  1250  SVRPVGAAAANVRILNDVAQAR----QALAGGTSIGLSSMGGTPM---LSNmissgmass  1408
              VR +G   ANV ILN+++QAR     AL GGTSIGL SMG TP+   +SNMISSGM SS
Sbjct  354   PVRSLG--PANVSILNNISQARVMSTAALNGGTSIGLPSMGQTPIAMHVSNMISSGMGSS  411

Query  1409  vsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNT  1588
             V AAQ+V SS QSG+TS+  S  L+   QV  +S  +S T+  +++S   N+  SQ++  
Sbjct  412   VPAAQNVFSSGQSGMTSINGSSTLS---QVAPNSGISSLTSGNNNISGNPNIATSQAVGN  468

Query  1589  LPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtq  1768
             L  SVSV Q+VPG++Q N+ GTQ++Q+  G SQN+MS +    G+ SG GTM+PTPGM Q
Sbjct  469   LQGSVSVSQSVPGISQGNLAGTQVVQSGIGVSQNVMSNL-TQPGVSSGNGTMIPTPGMPQ  527

Query  1769  qgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLE  1948
             Q Q GM  +G+ NN+AANMPL Q    +  Q AQSKYVK WEGNLSGQRQGQPVFITR+E
Sbjct  528   QVQNGMHSLGM-NNAAANMPLPQHSAGALQQQAQSKYVKFWEGNLSGQRQGQPVFITRME  586

Query  1949  GYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  2128
             GYRSASAS+ LAANWP+TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK
Sbjct  587   GYRSASASDKLAANWPQTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  646

Query  2129  LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFK  2236
             LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFK
Sbjct  647   LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFK  682



>ref|XP_004297135.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Fragaria vesca subsp. vesca]
Length=855

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/695 (64%), Positives = 524/695 (75%), Gaps = 31/695 (4%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEKQLI+ VEGTAAMGP+W ++VSDY+EK+IR   G E   QKPS + VE  LV FN+H
Sbjct  1     MAEKQLIVVVEGTAAMGPYWPAVVSDYVEKVIRSLSGNELSGQKPSSSTVEMSLVTFNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSS-PNGNQSK  535
             GSYS CLVQR+GWTRDI+LFL WLS+I   GGGF+DAAIAEGL+EALMM  +  NG Q++
Sbjct  61    GSYSGCLVQRTGWTRDIELFLQWLSAIPLAGGGFSDAAIAEGLSEALMMFPTIQNGGQNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q V+ QKHCILVAASNP+PLPTPVYRPQ+ N EQSEN     + RL DAE VAKSF QCS
Sbjct  121   QNVDFQKHCILVAASNPHPLPTPVYRPQMQNVEQSENFDAQTESRLYDAEAVAKSFPQCS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK + KL+ IY A KRNPR  D PIDN KNP++LVLISENF+EARA  +R G 
Sbjct  181   VSLSVICPKQLPKLRAIYNAGKRNPRAEDPPIDNVKNPHFLVLISENFIEARATLSRPGS  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              +LPS  +PVKMD++ V  ++GP P+   S+PS NG VMNR     GN+ PATVK+EP+T
Sbjct  241   TTLPSIPSPVKMDIAPVASVTGPPPT---SMPSVNGSVMNRPSFSVGNVPPATVKVEPST  297

Query  1076  VTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             V+SM  GP FAHVPSV R  SQ V  LQTSSP   S EM  NNE++ + KP +V G+   
Sbjct  298   VSSMVAGPAFAHVPSV-RPPSQGVPTLQTSSP--SSGEMNTNNESVPDLKP-IVSGVTHQ  353

Query  1253  VRPVGAAAANVRILNDVAQAR----QALAGGTSIGLSSMGGTPMLSNmissgmassvsaa  1420
             +RPVG+      ILN+++QAR     AL+GGTSIGL +MG  PM  ++ +   +   S+ 
Sbjct  354   LRPVGS------ILNNISQARVMNSAALSGGTSIGLQNMGQNPMAMHVSNMISSGMASSV  407

Query  1421  qsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSS  1600
              +  +   S      + +P        QSS   +FT+ TS++S  SNL MSQ M+ L   
Sbjct  408   AAAQNVFSSSAPHTLTQVP--------QSSGLNTFTSATSNVSGNSNLGMSQPMSNLQGG  459

Query  1601  VSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqq  1780
             VS+GQ+VPGMNQ N+ G QM+Q   G + NMMSG G A    SGTGTM+PTPG++QQ Q 
Sbjct  460   VSIGQSVPGMNQ-NLSGPQMVQNGIGMNPNMMSGHGSAGSS-SGTGTMIPTPGISQQAQS  517

Query  1781  gmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRS  1960
             G+Q +G NN+S +N PL  QQTSS LQSAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRS
Sbjct  518   GIQSLGANNSSISN-PL-SQQTSSALQSAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRS  575

Query  1961  ASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAV  2140
             ASASETLAANWP TMQIVRLISQDHMNNKQYVG+ADFLVFRAMNQHGFLGQLQEKKLCAV
Sbjct  576   ASASETLAANWPPTMQIVRLISQDHMNNKQYVGRADFLVFRAMNQHGFLGQLQEKKLCAV  635

Query  2141  IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQ+
Sbjct  636   IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQV  670



>ref|XP_008339697.1| PREDICTED: LOW QUALITY PROTEIN: mediator of RNA polymerase II 
transcription subunit 25-like [Malus domestica]
Length=850

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/697 (62%), Positives = 509/697 (73%), Gaps = 32/697 (5%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEKQLI+AVEGTAAMGP W ++VSDYL+KIIR FCG E   QK S + VE  LV FN+H
Sbjct  1     MAEKQLIVAVEGTAAMGPCWATVVSDYLDKIIRSFCGNEPSGQKLSTSTVELSLVTFNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSS-PNGNQSK  535
             GSY  CLVQRSGWTRD++LFLH LS+I F GGGF+ AAIAEGL+EALMM  +  NG+Q++
Sbjct  61    GSYCGCLVQRSGWTRDVBLFLHRLSAIPFSGGGFSXAAIAEGLSEALMMFPTVQNGSQNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q V+ QKHC+L+AAS P+PLPTPVYRPQI N EQ          RL D   VAKSF    
Sbjct  121   QNVDCQKHCVLIAASKPHPLPTPVYRPQIQNLEQXXXXXXXXXBRLXDXXXVAKSFXXXX  180

Query  716   VS-----LSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAF  880
                    +  +  +      T+    KRNPR AD PIDN KNP +LVLISENFMEARA  
Sbjct  181   XXFIPXLMXSITXRSWCDXDTLPMQGKRNPRAADPPIDNAKNPXFLVLISENFMEARATL  240

Query  881   NRTGMPSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVK  1060
             +R G+ +L S Q+PVKMD++ V  ++GP P+   S+PS NGPVMNRQPI  GN+ PATVK
Sbjct  241   SRPGITTLXSNQSPVKMDIAPVASVTGPPPT---SMPSVNGPVMNRQPISVGNVPPATVK  297

Query  1061  IEPTTVTSMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHG  1240
             +EP+TV+SM GP+FAH+PSV R  SQ V +LQTSSP S SQEM  NN+N+ + KP VV G
Sbjct  298   VEPSTVSSM-GPSFAHIPSV-RPPSQGVPSLQTSSPSSASQEMATNNDNVPDLKP-VVSG  354

Query  1241  MGQSVRPVGAAAANVRILNDVAQAR----QALAGGTSIGLSSMGGTPMLSNmissgmass  1408
             +    RPVG+      ILN+++QAR     AL GGTS+GL +MG  PM  ++ +   +  
Sbjct  355   VTHPSRPVGS------ILNNISQARVMNAAALTGGTSMGLPTMGQNPMAMHVSNMISSGM  408

Query  1409  vsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNT  1588
              S+  +  +   S  +   +        QV Q+    SFT+ TS++S  +NL MSQ M+ 
Sbjct  409   ASSVGAAQNVFTSSGSGTLT--------QVAQNPGLNSFTSGTSNVSGNNNLGMSQPMSN  460

Query  1589  LPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtq  1768
             L   VS+GQ VPGM+Q N+ G QM+Q+  G + NMMS + G++G  SGTGTM+PTPGM Q
Sbjct  461   LQGGVSMGQAVPGMSQGNLSGPQMVQSGIGMNPNMMSAL-GSTGASSGTGTMIPTPGMAQ  519

Query  1769  qgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLE  1948
             Q Q GMQ +G NNNSA+N+P   QQTSS L SAQSKYVKVWEGNLSGQRQGQPVFITRLE
Sbjct  520   QVQSGMQSLGANNNSASNVPF-SQQTSSALASAQSKYVKVWEGNLSGQRQGQPVFITRLE  578

Query  1949  GYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  2128
             GYRSASASETLAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK
Sbjct  579   GYRSASASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  638

Query  2129  LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  2239
             LCAVIQLPSQTLLLSVSDKA RLIGMLFPGDMVVFKP
Sbjct  639   LCAVIQLPSQTLLLSVSDKAXRLIGMLFPGDMVVFKP  675



>ref|XP_006574879.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Glycine max]
Length=877

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/699 (64%), Positives = 533/699 (76%), Gaps = 24/699 (3%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEKQLI+AVE TAAMGP+W +I+ DYL+K+IRCF G ++  QK S +NVEF LV +N+H
Sbjct  1     MAEKQLIVAVESTAAMGPYWNTILMDYLDKMIRCFGGNDSTGQKFSASNVEFALVTYNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSK  535
             G YS+CLVQRSGWTRD D+F  WLSSI F GGGFNDAAIAEGL+EALMML +S +G  ++
Sbjct  61    GCYSSCLVQRSGWTRDPDVFFSWLSSIPFNGGGFNDAAIAEGLSEALMMLWNSQSGAPNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q+V+  KHCILVAASNPYPL TPVY P+  N EQSE         L DAE VAK+F Q S
Sbjct  121   QSVDMHKHCILVAASNPYPLQTPVYVPRPQNLEQSETIDSDSGSHLYDAEAVAKAFPQFS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             +SLSV+CPK + K+K+IY A KRN R AD P++  K P++L+LISE F EAR A +R+G+
Sbjct  181   ISLSVICPKQLPKIKSIYNAGKRNNRAADPPLE-AKTPHFLILISEGFREARGALSRSGI  239

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              SLPS Q+PVK+D  SV P++G  P+   S+P  NG + NRQP+P GN+ PATVK+EP  
Sbjct  240   TSLPSNQSPVKVDAVSVTPVTGAPPT---SMP-VNGSIPNRQPVPAGNVAPATVKVEPVP  295

Query  1076  VTSM-PGPTFAHVPSVPRAAS--QPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMG  1246
             VTSM  GP F H  SVPRA S  Q V +LQTSSP SVSQ+++ NNE  Q+TKP V     
Sbjct  296   VTSMVSGPAFPHNSSVPRATSTSQGVPSLQTSSPSSVSQDIITNNETAQDTKPTVSM---  352

Query  1247  QSVRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---LSNmissgma  1402
               +RPV    ANV ILN+++QARQ     AL+GGTS+GL SMG TP+   +SNMISSGM 
Sbjct  353   LPLRPVNPVQANVNILNNLSQARQVMNSAALSGGTSMGLPSMGQTPVAMHMSNMISSGMT  412

Query  1403  ssvsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsm  1582
             SSV AAQ+V SS QSG+TSMTSS PL  P QV Q+S   S T+ TS++SS+SN+ +SQ +
Sbjct  413   SSVPAAQNVFSSGQSGITSMTSSGPLTVPAQVGQNSGLGSLTSNTSNLSSSSNIGISQPL  472

Query  1583  NTLPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgm  1762
               L   VS+GQ V GM+Q N+ G QM+Q     +QN+MSG+G  S + SGTGTM+PTPGM
Sbjct  473   GNLQGVVSIGQQVSGMSQGNLSGAQMVQGGVSMNQNVMSGLG-QSVVSSGTGTMIPTPGM  531

Query  1763  tqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITR  1942
             +Q  Q  MQP+   NN+AANMPLSQQ +     +   KYVKVWEG+LSGQRQGQPVFIT+
Sbjct  532   SQPVQSVMQPL--VNNAAANMPLSQQTSGGMQSAQS-KYVKVWEGSLSGQRQGQPVFITK  588

Query  1943  LEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQE  2122
             LEGYR++SASETLAANWP  MQIVRLISQDHMNNKQYVGKADFLVFRAMN HGFLGQLQE
Sbjct  589   LEGYRNSSASETLAANWPPVMQIVRLISQDHMNNKQYVGKADFLVFRAMNPHGFLGQLQE  648

Query  2123  KKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  2239
             KKLCAVIQLPSQTLLLSVSDKA RLIGMLFPGDMVVFKP
Sbjct  649   KKLCAVIQLPSQTLLLSVSDKAFRLIGMLFPGDMVVFKP  687



>gb|KEH27965.1| phytochrome and flowering time regulatory protein [Medicago truncatula]
Length=820

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/695 (60%), Positives = 514/695 (74%), Gaps = 23/695 (3%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEKQLI+AVE TAAMGP+W +++ DYLEKI+RC  G E+  QKPSG+NVEF LV +N+H
Sbjct  1     MAEKQLIVAVETTAAMGPYWDTLLMDYLEKIVRCLGGNESTGQKPSGSNVEFSLVTYNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSK  535
             G YS  LVQR+GWTRD D+FL WL SI F GGGFNDAAIAEGLAEALMM   S +G  ++
Sbjct  61    GCYSGILVQRTGWTRDPDVFLQWLESIPFSGGGFNDAAIAEGLAEALMMFPPSQSGGLNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q V+   HCILVAASNPYPL TPVY PQ+ + E++E+       +L DAE VAK+F Q +
Sbjct  121   QNVDTNMHCILVAASNPYPLQTPVYVPQLQSLEKTESIDSNQVNQLYDAEAVAKAFPQFN  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             +SLSVVCPK + K+K IY A KRN R AD P+D  K  ++L+LISE F EAR+A +R G 
Sbjct  181   ISLSVVCPKQLPKIKAIYNAGKRNNRAADPPVD-AKTTHFLILISEGFREARSALSRPGT  239

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              ++PS Q+PVK+D  S  P++G  PS   S+PS NG + NRQPIP GN+ PATVK+E   
Sbjct  240   -NMPSNQSPVKVDAVSATPVTGAPPS---SLPSVNGSIPNRQPIPAGNVTPATVKVEQVP  295

Query  1076  VTSMPGPTFAHVPSVPRAASQ--PVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQ  1249
             VTS  GP F+H PSVPRA      V +LQTSSP SVSQ+++ +NEN  +TKP+V   M Q
Sbjct  296   VTS--GPAFSHNPSVPRATGTGLGVPSLQTSSPSSVSQDIMTSNENAMDTKPIV--SMLQ  351

Query  1250  SVRPVGAAAANVRILNDVAQARQ--ALAGGTSIGLSSMGGTPMLSNmissgmassvsaaq  1423
              +RPV  A ANV ILN+++QARQ  AL+GGTS+GL SMG TP+  +M +   + + S+  
Sbjct  352   PIRPVNPAQANVNILNNLSQARQVMALSGGTSMGLQSMGQTPVAMHMSNMISSGTTSSGP  411

Query  1424  svisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSSV  1603
             +  +   SG + +TSS  L    QV Q+S  +S T+ TS+ S  + +    +   L   V
Sbjct  412   TGQNVFSSGPSVITSSGSLTASAQVGQNSGLSSLTSATSNSSPNTGISQPIA--NLQGGV  469

Query  1604  SVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqg  1783
             S+GQ VP MN  N+ G QM+Q     +QN+++G+ G SG+ SGTG M+PTPG+ QQ Q G
Sbjct  470   SMGQQVPTMNPGNLSGAQMVQGGVNMNQNVINGL-GQSGVSSGTGAMIPTPGIPQQVQSG  528

Query  1784  mqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSA  1963
             MQP+ VNN +AANM L     + Q  S+QSKY+KVWEG+LSGQRQGQPVFIT+LEGYRS+
Sbjct  529   MQPL-VNNAAAANMTL-----TQQTASSQSKYIKVWEGSLSGQRQGQPVFITKLEGYRSS  582

Query  1964  SASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVI  2143
             SASETLAANWP  MQIVRLISQDHMNNKQYVGKADFLVFRAMN HGFLGQLQEKKLCAVI
Sbjct  583   SASETLAANWPPVMQIVRLISQDHMNNKQYVGKADFLVFRAMNPHGFLGQLQEKKLCAVI  642

Query  2144  QLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIT  2248
             QLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQ++
Sbjct  643   QLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQLS  677



>ref|XP_007153353.1| hypothetical protein PHAVU_003G028300g [Phaseolus vulgaris]
 gb|ESW25347.1| hypothetical protein PHAVU_003G028300g [Phaseolus vulgaris]
Length=863

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/700 (63%), Positives = 532/700 (76%), Gaps = 23/700 (3%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAE QLI+ VE TAAMGP+W +I+ DYL+K+IR F G ++  QK S  NVEF LV +N+H
Sbjct  1     MAEFQLIVVVESTAAMGPYWETILVDYLDKMIRSFGGNDSTGQKSSTPNVEFALVTYNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSK  535
             G YS CLVQR+GWTRD D+F  WLSSI F GGGFNDAAIAEGL+EALMM  +S +G  ++
Sbjct  61    GCYSGCLVQRTGWTRDPDVFFLWLSSIPFNGGGFNDAAIAEGLSEALMMFPNSQSGGPNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q+V+  KHCIL+AASNPYPL TPVY P+  N EQSE        RL DAE VAK+F Q S
Sbjct  121   QSVDVHKHCILIAASNPYPLQTPVYVPRPQNLEQSETIDSDSGNRLYDAEAVAKAFPQFS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             +SLSV+CPK + K+K IY A KR+ R AD P++  K P++L+LISE+F EAR+A +R+G+
Sbjct  181   ISLSVICPKQLPKIKAIYNAGKRSNRAADPPLE-AKTPHFLILISESFREARSALSRSGI  239

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHP-ATVKIEPT  1072
              SLPS Q+PVK+D  SV P++G  P+   S+PS NG + NRQP+P GN+ P ATVK+E  
Sbjct  240   TSLPSNQSPVKVDAVSVTPVTGAPPT---SMPSVNGSIANRQPVPAGNVAPPATVKVEQV  296

Query  1073  TVTSM-PGPTFAHVPSVPRAAS--QPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGM  1243
              VTSM  GP F H  SVPRA S  Q V +LQTSSP SVSQ+++ NNEN Q+TKP V   M
Sbjct  297   PVTSMVSGPPFPHNSSVPRATSTSQVVPSLQTSSPSSVSQDIITNNENAQDTKPTV--SM  354

Query  1244  GQSVRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---LSNmissgm  1399
              QS+RPV    ANV ILN+++QARQ     AL+GGTS+GL SMG TP+   +SNMISSGM
Sbjct  355   LQSLRPVNPTQANVSILNNLSQARQVMNSAALSGGTSMGLPSMGQTPVAMHMSNMISSGM  414

Query  1400  assvsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqs  1579
              SSV AAQ+V  S QSG+TS+TSS PL+ P QV Q+    S T+ TS++SS+SN+ +SQ 
Sbjct  415   TSSVPAAQNVFPSGQSGITSITSSGPLSVPAQVGQNPGLGSLTSNTSNLSSSSNIGISQP  474

Query  1580  mNTLPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpg  1759
             +  L  +VS+GQ   GM+Q N+ G QM+Q     +QN MS +G +S + SG GTM+PTPG
Sbjct  475   LGNLQGAVSMGQQASGMSQGNLSGPQMVQGGVPMNQNAMSALG-SSVVSSGNGTMIPTPG  533

Query  1760  mtqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFIT  1939
             M+QQ Q GMQ +G  NN+AANMPLSQQ +     +   KYVKVWEG+LSGQRQGQPVFIT
Sbjct  534   MSQQVQSGMQALG--NNAAANMPLSQQTSGGMQSAQS-KYVKVWEGSLSGQRQGQPVFIT  590

Query  1940  RLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQ  2119
             +LEGYR++SASE+LA+NWP  MQIVRLISQDHMNNKQYVGKADFLVFRAMN HGFLGQLQ
Sbjct  591   KLEGYRNSSASESLASNWPSVMQIVRLISQDHMNNKQYVGKADFLVFRAMNPHGFLGQLQ  650

Query  2120  EKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  2239
             EKKLCAVIQLPSQTLLLSVSDKA RLIGMLFPGDMVVFKP
Sbjct  651   EKKLCAVIQLPSQTLLLSVSDKAFRLIGMLFPGDMVVFKP  690



>ref|XP_004513303.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X1 [Cicer arietinum]
Length=818

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/699 (59%), Positives = 502/699 (72%), Gaps = 26/699 (4%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEKQLI+ VE TAAMGP+W ++  DY+EKI+RC CG E+  QKPS +NVEF LV +N+H
Sbjct  1     MAEKQLIVVVESTAAMGPYWDTLQMDYIEKIVRCLCGNESSGQKPSVSNVEFALVTYNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSK  535
             G YS  LVQR+GWT+D D+FL WLSS+ F GGGFND AIAEGLAEALMM   S +G  ++
Sbjct  61    GCYSGILVQRTGWTKDPDVFLQWLSSVPFSGGGFNDVAIAEGLAEALMMFPHSQSGGPNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q+ +   HCILVAASNPYPL TPVY PQ+ + EQSE+      ++L DAE VAK F Q S
Sbjct  121   QSADMHMHCILVAASNPYPLQTPVYVPQLQSLEQSESVDSEPGKQLYDAEAVAKVFPQFS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             +SLS++CPK + K+K +Y A KRN R AD P+D  K  ++L+LISE F EAR A +R+G+
Sbjct  181   ISLSIICPKQLPKVKAVYNAGKRNNRAADPPVD-AKTSHFLILISEGFREARGALSRSGI  239

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              +LPS Q+PVK+D  SV P++G  P+   S+PS NG + NRQPIP GN+ PATVK+E   
Sbjct  240   TNLPSNQSPVKVDTVSVTPVTGGPPT---SLPSVNGTIANRQPIPAGNVTPATVKVEQVP  296

Query  1076  VTSM-PGPTFAHVPSVPRAASQPVQN--LQTSSPISVSQEMVANNENLQETKPMVVHGMG  1246
             VTSM  GP F H  S  RA S    N  LQ SSP SVSQ+++ +NEN Q+TKP+V   M 
Sbjct  297   VTSMITGPAFPHNSSAARATSTGQGNPSLQASSPSSVSQDIMTSNENAQDTKPIV--SML  354

Query  1247  QSVRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---LSNmissgma  1402
             Q +RPV  A  N  ILN+++QARQ     AL+GGTS+GL SMG TP+   +SNMISS   
Sbjct  355   QPLRPVNPAQVNGNILNNLSQARQVMNSAALSGGTSMGLPSMGQTPVAMHMSNMISSATT  414

Query  1403  ssvsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsm  1582
             SS    Q+V SS    +TS+TSS  L  P QV Q++   S T+ TS++SS+SN  +SQS+
Sbjct  415   SSGPTGQNVFSSGPPVITSITSSGSLTAPAQVAQNTGLASLTSATSNLSSSSNTGISQSL  474

Query  1583  NTLPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgm  1762
               L  +VS+GQ   GMN  N+ G QM+Q     +QN+M+G+G    + S     +     
Sbjct  475   ANLQGAVSMGQQASGMNPGNLSGAQMVQGGVNMNQNVMNGLG--QSVVSSGNGAMIPTPG  532

Query  1763  tqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITR  1942
               Q  Q      VNN ++AN+PL      SQ  SAQSKY++VWEG+LSGQRQGQPVFIT+
Sbjct  533   MPQQVQSGMQPLVNNAASANLPL------SQQTSAQSKYIRVWEGSLSGQRQGQPVFITK  586

Query  1943  LEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQE  2122
             LEGYRS+SASETLAANWP  MQIVRLISQDHMNNKQYVGKADFLVFRAMN HGFLGQLQE
Sbjct  587   LEGYRSSSASETLAANWPPVMQIVRLISQDHMNNKQYVGKADFLVFRAMNPHGFLGQLQE  646

Query  2123  KKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  2239
             KKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP
Sbjct  647   KKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  685



>ref|XP_006573255.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X1 [Glycine max]
 ref|XP_006573256.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X2 [Glycine max]
Length=832

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/699 (64%), Positives = 529/699 (76%), Gaps = 24/699 (3%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEKQLI+AVE TAAMGP+W +I+ DYL+K+IRCF G ++  QK S + VEF LV +N+H
Sbjct  1     MAEKQLIVAVESTAAMGPYWDTILMDYLDKMIRCFGGNDSTGQKSSASIVEFALVTYNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSK  535
             G YS+CLVQRSGWTRD D+F  WLSSI F GGGFNDAAIAEGL+EALMML  S +G  ++
Sbjct  61    GCYSSCLVQRSGWTRDPDVFFLWLSSIPFNGGGFNDAAIAEGLSEALMMLWISQSGAPNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q+V+  KHCILVAASNPYPL TPVY P+  N EQSE         L DAE VAK+F Q S
Sbjct  121   QSVDMHKHCILVAASNPYPLQTPVYVPRPQNLEQSETIDLDSGSHLYDAEAVAKAFPQFS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             +SLSV+CPK + K+KTIY A KRN R AD P++  K P++L+LISE F EA  A +R+G+
Sbjct  181   ISLSVICPKQLPKIKTIYNAGKRNNRAADSPLE-AKTPHFLILISEGFREAWGALSRSGI  239

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              SLPS Q+PVK+D  SV P++   P+   S+P  NG + NRQP+P GN+ PATVK+EP  
Sbjct  240   TSLPSNQSPVKVDAVSVTPVTEAPPT---SMP-VNGSIPNRQPVPAGNVAPATVKVEPVL  295

Query  1076  VTSM-PGPTFAHVPSVPRAAS--QPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMG  1246
             V SM  GP F H  SVPRA S  Q V +LQTSS  SVSQ+++ NNEN Q+TKP V     
Sbjct  296   VASMVSGPAFPHNSSVPRATSTSQGVPSLQTSSLSSVSQDIITNNENAQDTKPTVSM---  352

Query  1247  QSVRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---LSNmissgma  1402
               +RPV  A ANV ILN+++ ARQ     AL+GGTS+GL SM  TP+   +SNMISSGM 
Sbjct  353   LPLRPVNPAQANVNILNNLSIARQVMNSAALSGGTSMGLPSMSQTPVAMHMSNMISSGMT  412

Query  1403  ssvsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsm  1582
             SSV AAQ+V SS QSG+TSMTSS PL GP QV Q+S   S T+ TS++SS+SN+ +SQ +
Sbjct  413   SSVPAAQNVFSSGQSGITSMTSSGPLTGPAQVGQNSGLGSLTSNTSNLSSSSNIGISQPL  472

Query  1583  NTLPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgm  1762
               L  +VS+GQ V GM+Q N+ G QM+Q     +QN+MSG+G  S + SGTGTM+PTPGM
Sbjct  473   GNLQGAVSMGQQVSGMSQGNLSGAQMVQGGVNMNQNVMSGLG-QSVVSSGTGTMIPTPGM  531

Query  1763  tqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITR  1942
             +Q  Q GMQP+   NN+A NMPLSQQ +     +   KYVKVWEG+LSGQRQGQPVFIT+
Sbjct  532   SQPVQSGMQPL--VNNAATNMPLSQQTSGGMQSAQS-KYVKVWEGSLSGQRQGQPVFITK  588

Query  1943  LEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQE  2122
             LEGYR++SASETLAANWP  MQIVRLISQDHMNNKQYVGKADFLVFRAMN HGFLGQLQE
Sbjct  589   LEGYRNSSASETLAANWPPVMQIVRLISQDHMNNKQYVGKADFLVFRAMNPHGFLGQLQE  648

Query  2123  KKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  2239
             KKLCAVIQLPSQTLLLSVSDKA RLIGMLFPGDMVVFKP
Sbjct  649   KKLCAVIQLPSQTLLLSVSDKAFRLIGMLFPGDMVVFKP  687



>ref|XP_010672164.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=843

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/700 (62%), Positives = 527/700 (75%), Gaps = 36/700 (5%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPS----GANVEFGLVM  346
             MAEKQLI+ VEGTAAMGP+W++IVSDYLEKIIR FC  +   QKPS    G+  E  LV+
Sbjct  1     MAEKQLILVVEGTAAMGPYWSTIVSDYLEKIIRSFCANDVTVQKPSSTASGSTFELALVV  60

Query  347   FNSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSP-NG  523
             FN+HG YSA LVQRSGWTRDI+ F  WLSS+ F GGG+ND A  EGL+EALMM + P NG
Sbjct  61    FNTHGPYSASLVQRSGWTRDIENFFTWLSSLTFSGGGWNDVATGEGLSEALMMFAIPQNG  120

Query  524   NQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSF  703
               +KQ ++G++HCILV+ASNPYPLPTPVYRP I N EQ EN     +  L DAETV+K F
Sbjct  121   FCAKQNLDGKRHCILVSASNPYPLPTPVYRPAIENLEQGENGEAQSENLLYDAETVSKWF  180

Query  704   AQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFN  883
               CSVSLSV+CPK + KLK IY A KRNPR AD  +D  K P++ V IS+NF EA AA +
Sbjct  181   GLCSVSLSVICPKPLPKLKAIYNAGKRNPRSADPAVD-VKQPHFFVQISDNFTEALAALS  239

Query  884   RTGMPSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKI  1063
             R+G   L  +QNP    V+++PP SG       S+ + NG +MNR PI TG+   ATVKI
Sbjct  240   RSG---LVQSQNP----VTTLPPGSGT----STSMSTVNGSIMNRPPISTGSAPQATVKI  288

Query  1064  EPTTVTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHG  1240
             EP+TVTSM  GP   H+P++PRAA+Q V +LQ SSP +VSQE+   NEN+ E KPMV   
Sbjct  289   EPSTVTSMTSGPAIPHMPAIPRAAAQNVPSLQASSPPAVSQELTTINENVPELKPMV--S  346

Query  1241  MGQSVRPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPM---LSNmissgmassv  1411
             M QS+RPVGA      ILN+++QAR AL GGTS+GL SMGG  +   ++NMIS+GMASSV
Sbjct  347   MSQSLRPVGA------ILNNISQARVALTGGTSLGLPSMGGNSIGMHMTNMISNGMASSV  400

Query  1412  saaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTL  1591
               +Q+V+SS Q G+ ++++S  +AG  Q +Q+S   S+   TS++S  SN  +SQ +  L
Sbjct  401   PPSQTVLSSGQPGIAAVSASGSIAGASQPIQNSTLNSYGTATSNVSGNSNHGISQPLTNL  460

Query  1592  PSSVS--VGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmt  1765
               +VS  +GQ+V G++Q N+P   M Q  T  + NM+  + GA+G  SGTG M+PTPGM+
Sbjct  461   QGNVSNTMGQSVSGISQGNLPA--MTQNGTTMNPNMIPNL-GATGAQSGTGPMMPTPGMS  517

Query  1766  qqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRL  1945
             QQ Q GMQ +GV +NSAANMP+  QQ ++ LQS+QSKYVKVWEGNLSGQRQGQPVFITRL
Sbjct  518   QQVQSGMQSVGV-SNSAANMPI-SQQATTSLQSSQSKYVKVWEGNLSGQRQGQPVFITRL  575

Query  1946  EGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEK  2125
             EGYR+ASASETLAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFL QLQEK
Sbjct  576   EGYRNASASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLAQLQEK  635

Query  2126  KLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             KLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI
Sbjct  636   KLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  675



>ref|XP_010052625.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 [Eucalyptus grandis]
 gb|KCW76701.1| hypothetical protein EUGRSUZ_D01061 [Eucalyptus grandis]
Length=860

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/701 (60%), Positives = 506/701 (72%), Gaps = 28/701 (4%)
 Frame = +2

Query  185   EKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGS  364
             E+ LI+AV+GTAAMGP+W +IVSDYLEKI+R F G E  +Q+   +N +  LVMFNSHGS
Sbjct  27    ERSLIVAVDGTAAMGPYWKTIVSDYLEKIVRAFVGNEVPAQR---SNCDLSLVMFNSHGS  83

Query  365   YSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSP-NGNQSKQT  541
              SAC+VQRS WT+D+  FL WLS++ F GGGFNDAAIAEGL+EALMM   P NGN   Q+
Sbjct  84    LSACMVQRSAWTKDVSCFLEWLSAMSFSGGGFNDAAIAEGLSEALMMFPLPLNGNLPPQS  143

Query  542   VEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVS  721
             ++G++HC+LVAA+NPYPL TPVYRP      + E+      + L DAE VAK F QC VS
Sbjct  144   LDGKRHCVLVAATNPYPLSTPVYRPTFQ--LEDEHVETYSGKPLCDAEGVAKFFPQCCVS  201

Query  722   LSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPS  901
             LSV+CPK + KL+ IY A KRNPR AD P+DN KN ++LVLI+ENF+EAR A +R G  S
Sbjct  202   LSVICPKQLPKLRAIYNAGKRNPRAADPPVDNGKNTHFLVLIAENFLEARTALSRPGTAS  261

Query  902   LPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTVT  1081
             LPS Q+PVKMD +  PP++       AS+P  +  +++RQ +  GN  PA VK+EPTTVT
Sbjct  262   LPSNQSPVKMDTTP-PPVNSVTAQPPASVPPVS--LLSRQAVSAGNGPPAIVKVEPTTVT  318

Query  1082  SM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSVR  1258
             SM  GP F+H+PSV R  +Q V  LQTSSP SVSQ+MV NNE++Q+ KP+V  G+ Q++R
Sbjct  319   SMAAGPNFSHIPSVQRPTTQGVSALQTSSPSSVSQDMVTNNESVQDLKPVVSAGIPQTLR  378

Query  1259  PVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---LSNmissgmassvs  1414
             PV    AN  ILN+++Q RQ      L GGTSIGL SMG  PM   +SNMISSGM S+V 
Sbjct  379   PV--VPANSNILNNLSQVRQVVNSATLTGGTSIGLQSMGQNPMAMHMSNMISSGMQSTVP  436

Query  1415  aaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLP  1594
             AAQ+  SS QSG+TS+T    L+G     Q+    SF + TS+++  SN+ MSQ    L 
Sbjct  437   AAQTGYSSGQSGITSVTGPGTLSGTIPSAQNPGLGSFASATSNITGNSNIGMSQPTGNLQ  496

Query  1595  SSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqg  1774
                 +GQT PGM+Q ++ G+QM+Q   G + NMMS +G  +  PS     +         
Sbjct  497   VGPGMGQTAPGMSQGSLSGSQMVQNGVGMNPNMMSSLGPTA--PSSGSGTMMPTPGMPSQ  554

Query  1775  qqgmqpIGVNNNS----AANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITR  1942
              Q      +N NS     A+MP   QQ+SS LQSAQSKYVKVWEGNLSGQRQGQPV ITR
Sbjct  555   GQSGMS-SINGNSNPGPGASMP-LSQQSSSALQSAQSKYVKVWEGNLSGQRQGQPVLITR  612

Query  1943  LEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQE  2122
             LEGYRSASASETLAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQE
Sbjct  613   LEGYRSASASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQE  672

Query  2123  KKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             KKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI
Sbjct  673   KKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  713



>ref|XP_010672163.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=845

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/702 (62%), Positives = 527/702 (75%), Gaps = 38/702 (5%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQ--KPS----GANVEFGL  340
             MAEKQLI+ VEGTAAMGP+W++IVSDYLEKIIR FC  +   Q  KPS    G+  E  L
Sbjct  1     MAEKQLILVVEGTAAMGPYWSTIVSDYLEKIIRSFCANDVTVQIQKPSSTASGSTFELAL  60

Query  341   VMFNSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSP-  517
             V+FN+HG YSA LVQRSGWTRDI+ F  WLSS+ F GGG+ND A  EGL+EALMM + P 
Sbjct  61    VVFNTHGPYSASLVQRSGWTRDIENFFTWLSSLTFSGGGWNDVATGEGLSEALMMFAIPQ  120

Query  518   NGNQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAK  697
             NG  +KQ ++G++HCILV+ASNPYPLPTPVYRP I N EQ EN     +  L DAETV+K
Sbjct  121   NGFCAKQNLDGKRHCILVSASNPYPLPTPVYRPAIENLEQGENGEAQSENLLYDAETVSK  180

Query  698   SFAQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAA  877
              F  CSVSLSV+CPK + KLK IY A KRNPR AD  +D  K P++ V IS+NF EA AA
Sbjct  181   WFGLCSVSLSVICPKPLPKLKAIYNAGKRNPRSADPAVD-VKQPHFFVQISDNFTEALAA  239

Query  878   FNRTGMPSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATV  1057
              +R+G   L  +QNP    V+++PP SG       S+ + NG +MNR PI TG+   ATV
Sbjct  240   LSRSG---LVQSQNP----VTTLPPGSGT----STSMSTVNGSIMNRPPISTGSAPQATV  288

Query  1058  KIEPTTVTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVV  1234
             KIEP+TVTSM  GP   H+P++PRAA+Q V +LQ SSP +VSQE+   NEN+ E KPMV 
Sbjct  289   KIEPSTVTSMTSGPAIPHMPAIPRAAAQNVPSLQASSPPAVSQELTTINENVPELKPMV-  347

Query  1235  HGMGQSVRPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPM---LSNmissgmas  1405
               M QS+RPVGA      ILN+++QAR AL GGTS+GL SMGG  +   ++NMIS+GMAS
Sbjct  348   -SMSQSLRPVGA------ILNNISQARVALTGGTSLGLPSMGGNSIGMHMTNMISNGMAS  400

Query  1406  svsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmN  1585
             SV  +Q+V+SS Q G+ ++++S  +AG  Q +Q+S   S+   TS++S  SN  +SQ + 
Sbjct  401   SVPPSQTVLSSGQPGIAAVSASGSIAGASQPIQNSTLNSYGTATSNVSGNSNHGISQPLT  460

Query  1586  TLPSSVS--VGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpg  1759
              L  +VS  +GQ+V G++Q N+P   M Q  T  + NM+  + GA+G  SGTG M+PTPG
Sbjct  461   NLQGNVSNTMGQSVSGISQGNLPA--MTQNGTTMNPNMIPNL-GATGAQSGTGPMMPTPG  517

Query  1760  mtqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFIT  1939
             M+QQ Q GMQ +GV +NSAANMP+  QQ ++ LQS+QSKYVKVWEGNLSGQRQGQPVFIT
Sbjct  518   MSQQVQSGMQSVGV-SNSAANMPI-SQQATTSLQSSQSKYVKVWEGNLSGQRQGQPVFIT  575

Query  1940  RLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQ  2119
             RLEGYR+ASASETLAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFL QLQ
Sbjct  576   RLEGYRNASASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLAQLQ  635

Query  2120  EKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             EKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI
Sbjct  636   EKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  677



>ref|XP_010923559.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Elaeis guineensis]
Length=816

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/702 (58%), Positives = 508/702 (72%), Gaps = 32/702 (5%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEKQLI+AVEGTAA+GP+W +I+SDYL+KIIRCF G E   QK SGA+ EF LV+FN+H
Sbjct  1     MAEKQLIVAVEGTAALGPYWQTILSDYLDKIIRCFYGNELTGQKLSGAHPEFALVVFNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSK  535
             G +S+ +V  SGWT+D+D+F  WLS I F GGGF++AAIAEGLAEALMM   +PN +QS 
Sbjct  61    GPHSSFIVHHSGWTKDLDVFFQWLSGIPFSGGGFSEAAIAEGLAEALMMFPFTPNVSQSH  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q +E QKHCILVAASNPYPLPTPVYRP + + E  EN     +  L+DAETVAKSF QC 
Sbjct  121   QNLEAQKHCILVAASNPYPLPTPVYRPAM-SLEHPENAEAQTEAGLADAETVAKSFGQCC  179

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+ PK + KL++IY A KRNPR  D  +D+ KNP +LVL+SENFMEARAA +R  +
Sbjct  180   VSLSVISPKQLPKLRSIYNAGKRNPRAVDPAVDHVKNPQFLVLLSENFMEARAALSRPLL  239

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              SL S Q  VK+D +S  PI GP  +     P+ NG ++NR P+  GN+  ATVK+EPTT
Sbjct  240   GSLSSNQGVVKLDGASAAPIPGPSTNN----PTVNGSMINRPPVTVGNVPTATVKMEPTT  295

Query  1076  VTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             V SM  GP F H+PS+   A+Q V NLQ S+P   SQEM ANN+ +QE KP+ V+ + QS
Sbjct  296   VPSMVSGPAFPHMPSISTVATQGVANLQNSAPSPTSQEMGANNDGVQEIKPL-VNPISQS  354

Query  1253  VRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---LSNmissgmass  1408
             +RPVG   ANV ILN+++Q RQ     ++AG +SIGL +MG TPM   +SNMISSGMASS
Sbjct  355   LRPVGPTPANVSILNNLSQHRQMMTSASIAGASSIGLQTMGATPMAMHMSNMISSGMASS  414

Query  1409  vsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNT  1588
               +  + ++ S           PL    QV Q+SA  SF + TS+MS  SN+ +S ++  
Sbjct  415   AMSGITSVAGSG----------PLMATAQVAQNSALGSFASATSNMSGNSNIGISPALAN  464

Query  1589  LPSSVSVGQTVPGMNQANMPGT-QMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmt  1765
             L  ++ +G +VPG+ Q ++  + Q+ Q   G +QN+M+ +G  S     +G     P   
Sbjct  465   LQGNIGMGTSVPGVGQGSLASSAQIGQGGIGMNQNIMNNLGPTS---ISSGPGTMIPTPG  521

Query  1766  qqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRL  1945
                Q G+  +GV+NNS  +MP+   Q +S +Q A SKYVK+WEG LSGQRQGQPVFI +L
Sbjct  522   MSQQAGLHSLGVSNNSTMSMPV--SQHASNVQQAPSKYVKIWEGALSGQRQGQPVFICKL  579

Query  1946  EGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEK  2125
             EGYRSASASETLAA+WP TMQIVRLI+Q+HMNNKQYVGKADFLVFR +NQHGFLGQLQEK
Sbjct  580   EGYRSASASETLAADWPLTMQIVRLIAQEHMNNKQYVGKADFLVFRTLNQHGFLGQLQEK  639

Query  2126  KLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             KLCAVIQLPSQTLLLSVSDKA RLIGMLFPGDMVVFKPQ+++
Sbjct  640   KLCAVIQLPSQTLLLSVSDKAGRLIGMLFPGDMVVFKPQVSS  681



>ref|XP_008791235.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Phoenix dactylifera]
Length=809

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/700 (57%), Positives = 505/700 (72%), Gaps = 31/700 (4%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEKQLI+AVEGTAA+GP+W+ I+SDYL+KIIRCF G E   QK SGA+ EF LV+FN+H
Sbjct  1     MAEKQLIVAVEGTAALGPYWSIILSDYLDKIIRCFYGNELTGQKLSGAHPEFALVVFNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSK  535
             G +S+ +VQ SGWT+D+D+F  WLS I F GGGF++AAIAEGLAEALMM   +PN +QS 
Sbjct  61    GPHSSFIVQHSGWTKDLDVFFQWLSGIPFSGGGFSEAAIAEGLAEALMMFPFTPNVSQSH  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q +E QKHCILVAASNPYPLPTPVYRP I + E  EN     +  L+DAETVAKSF QC 
Sbjct  121   QNLEAQKHCILVAASNPYPLPTPVYRPAIQSLEHPENAEAQTEAGLADAETVAKSFGQCC  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+ PK + KL++IY A KRNPR AD  +D+ KNP +LVL+SE+FMEARAA +R  +
Sbjct  181   VSLSVISPKHLPKLRSIYNAGKRNPRAADPAVDHVKNPQFLVLLSESFMEARAALSRPLI  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
               L S Q  VK+D +S  PI GP  +     P+ NG ++NR P+  GNI  ATVK+EPTT
Sbjct  241   GGLTSNQGVVKLDGASATPIPGPSTNN----PAVNGSMINRPPVTVGNIPTATVKMEPTT  296

Query  1076  VTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             V+SM  GP F H+ S+   A+Q V NLQ S+P   SQEM AN++ +QE KP+ ++ + QS
Sbjct  297   VSSMVSGPAFPHMQSISNVATQGVGNLQNSAPSPTSQEMGANSDGVQEIKPL-INPISQS  355

Query  1253  VRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---LSNmissgmass  1408
             +RPVG   ANV ILN+++Q RQ     ++AG +SIGL +MG TPM   +SNMIS+GM SS
Sbjct  356   LRPVGPTPANVSILNNLSQHRQMMTSASIAGASSIGLQTMGATPMAMHMSNMISTGMVSS  415

Query  1409  vsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNT  1588
               +  + ++ S           PL    QV Q+SA  SF + TS+MS  SN+ +S ++  
Sbjct  416   AMSGITSVAGSG----------PLMATAQVAQNSALGSFASATSNMSGNSNIGISPALAN  465

Query  1589  LPSSVSVGQTVPGMNQANMP-GTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmt  1765
             L  ++ +G +VPG+ Q N+   TQ+ Q     +QN M+ + G +GI S  G     P   
Sbjct  466   LQGNIGMGTSVPGVGQGNLASSTQIGQGGISMNQNTMNNL-GPTGISS--GPGTMIPTPG  522

Query  1766  qqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRL  1945
                Q G+  +GV NNS  NMP+   Q  S +Q AQSKYVK+WEG+LSGQRQGQPVFI +L
Sbjct  523   MSQQAGLHSLGVTNNSTMNMPV--SQHPSNVQQAQSKYVKIWEGSLSGQRQGQPVFICKL  580

Query  1946  EGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEK  2125
             EGYR+ASASETLAA+WP+TMQIVRLI+Q+HM+NKQY GK D+LVFR +NQHGFLGQLQEK
Sbjct  581   EGYRNASASETLAADWPQTMQIVRLIAQEHMSNKQYGGKVDYLVFRTLNQHGFLGQLQEK  640

Query  2126  KLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             KLCAVIQLPSQTLLLSVSDKA RLIG+LFPGDMVVFKPQ+
Sbjct  641   KLCAVIQLPSQTLLLSVSDKAGRLIGVLFPGDMVVFKPQV  680



>ref|XP_009595471.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X3 [Nicotiana tomentosiformis]
Length=841

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/693 (59%), Positives = 511/693 (74%), Gaps = 32/693 (5%)
 Frame = +2

Query  167   GQSPMAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVM  346
             G++ M EKQLI+AVEGTAA+GP W +I+SDYL+K+IR F   E   +KPS  N +  +V+
Sbjct  63    GKAHMMEKQLIVAVEGTAAVGPFWQTIISDYLDKMIRSFTKLEPIEKKPSAGNWQLAMVV  122

Query  347   FNSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGN  526
             F  HGS+ ACLV+RSGWTRDID+F  WLS+I F GGGFNDAA+AE LAEAL M SS NG+
Sbjct  123   FAVHGSHGACLVRRSGWTRDIDMFFQWLSAIPFSGGGFNDAAVAESLAEALTMFSSLNGS  182

Query  527   QSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFA  706
             Q++Q V+ Q+HCIL+AASNPYPLPTPVY P + N EQS N       RLSDAETVAK F 
Sbjct  183   QTQQNVDWQRHCILIAASNPYPLPTPVYHPHMQNVEQSGNIEAHTANRLSDAETVAKEFP  242

Query  707   QCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNR  886
             QCSVSLSV+CPK + KL+ IY A KR+P+ AD PID  KNP +LVLISENF+EA AAFNR
Sbjct  243   QCSVSLSVLCPKQLPKLRAIYNAGKRDPQAADPPIDTSKNPNFLVLISENFIEACAAFNR  302

Query  887   TGMPSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIE  1066
             TGM S    Q+ V+MD+SSV P+S P     A+  +  G VM++QPI  GNI  AT+ +E
Sbjct  303   TGMESSALNQSLVEMDMSSVAPVSAP-----AATFNPAGSVMSQQPISAGNIPAATINME  357

Query  1067  PTTVTSMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMG  1246
             PTTVTS+ GP   H+P+  R  SQ V +LQ++SPISVS+E+V NNE + ETKP ++ GM 
Sbjct  358   PTTVTSVTGPALPHIPTA-RPTSQLVASLQSASPISVSEEVVPNNEIVNETKP-ILSGMT  415

Query  1247  QSVRPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPMLSNmissgmassvsaaqs  1426
             Q +     AAAN RILNDVAQA QAL GGTSIGL SMG TP+LSNM+S G++SS+ AA +
Sbjct  416   QPLHSFSGAAANARILNDVAQA-QALVGGTSIGLQSMGETPILSNMMSGGISSSIPAAPT  474

Query  1427  visssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSSVS  1606
             V+SS Q  VTSM+  +PLAG GQ+ Q+S   S  +   SMS               S++ 
Sbjct  475   VLSSGQLAVTSMSGLVPLAGTGQIAQNSVSASSVSIAPSMSGN-------------SNLC  521

Query  1607  VGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgm  1786
             V Q +     +N+ G      + G  QN++SG G  +G+P G GT++ TP MTQQG  GM
Sbjct  522   VSQLL-----SNIQGG----VSAGMHQNVLSGTG--AGMPFGQGTLMSTPRMTQQGHPGM  570

Query  1787  qpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSAS  1966
             QP+  NN++ ANMPLSQQQTS+ L SAQS YVKVWEG+LSGQRQG+PV ITRL+G+R AS
Sbjct  571   QPLSRNNSTEANMPLSQQQTSATLSSAQSNYVKVWEGDLSGQRQGEPVLITRLQGFRIAS  630

Query  1967  ASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQ  2146
             AS+ LAANWP+TMQI RLI+Q+H+NN++ +GKA+ +VF AM+QH FLGQLQEKK CAVIQ
Sbjct  631   ASKLLAANWPQTMQIDRLITQEHLNNERLIGKAEIVVFWAMDQHVFLGQLQEKKFCAVIQ  690

Query  2147  LPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             L SQT++LSVSDK CRLIGMLFP +MVVFKPQI
Sbjct  691   LSSQTMILSVSDKTCRLIGMLFPENMVVFKPQI  723



>ref|XP_009595475.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X7 [Nicotiana tomentosiformis]
Length=839

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/693 (59%), Positives = 509/693 (73%), Gaps = 34/693 (5%)
 Frame = +2

Query  167   GQSPMAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVM  346
             G++ M EKQLI+AVEGTAA+GP W +I+SDYL+K+IR F   E   +KPS  N +  +V+
Sbjct  63    GKAHMMEKQLIVAVEGTAAVGPFWQTIISDYLDKMIRSFTKLEPIEKKPSAGNWQLAMVV  122

Query  347   FNSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGN  526
             F  HGS+ ACLV+RSGWTRDID+F  WLS+I F GGGFNDAA+AE LAEAL M SS NG+
Sbjct  123   FAVHGSHGACLVRRSGWTRDIDMFFQWLSAIPFSGGGFNDAAVAESLAEALTMFSSLNGS  182

Query  527   QSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFA  706
             Q++Q V+ Q+HCIL+AASNPYPLPTPVY P + N EQS N       RLSDAETVAK F 
Sbjct  183   QTQQNVDWQRHCILIAASNPYPLPTPVYHPHMQNVEQSGNIEAHTANRLSDAETVAKEFP  242

Query  707   QCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNR  886
             QCSVSLSV+CPK + KL+ IY A KR+P+ AD PID  KNP +LVLISENF+EA AAFNR
Sbjct  243   QCSVSLSVLCPKQLPKLRAIYNAGKRDPQAADPPIDTSKNPNFLVLISENFIEACAAFNR  302

Query  887   TGMPSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIE  1066
             TGM S    Q+ V+MD+SSV P+S P         + N  VM++QPI  GNI  AT+ +E
Sbjct  303   TGMESSALNQSLVEMDMSSVAPVSAP-------AATFNPAVMSQQPISAGNIPAATINME  355

Query  1067  PTTVTSMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMG  1246
             PTTVTS+ GP   H+P+  R  SQ V +LQ++SPISVS+E+V NNE + ETKP ++ GM 
Sbjct  356   PTTVTSVTGPALPHIPTA-RPTSQLVASLQSASPISVSEEVVPNNEIVNETKP-ILSGMT  413

Query  1247  QSVRPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPMLSNmissgmassvsaaqs  1426
             Q +     AAAN RILNDVAQA QAL GGTSIGL SMG TP+LSNM+S G++SS+ AA +
Sbjct  414   QPLHSFSGAAANARILNDVAQA-QALVGGTSIGLQSMGETPILSNMMSGGISSSIPAAPT  472

Query  1427  visssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSSVS  1606
             V+SS Q  VTSM+  +PLAG GQ+ Q+S   S  +   SMS               S++ 
Sbjct  473   VLSSGQLAVTSMSGLVPLAGTGQIAQNSVSASSVSIAPSMSGN-------------SNLC  519

Query  1607  VGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgm  1786
             V Q +     +N+ G      + G  QN++SG G  +G+P G GT++ TP MTQQG  GM
Sbjct  520   VSQLL-----SNIQGG----VSAGMHQNVLSGTG--AGMPFGQGTLMSTPRMTQQGHPGM  568

Query  1787  qpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSAS  1966
             QP+  NN++ ANMPLSQQQTS+ L SAQS YVKVWEG+LSGQRQG+PV ITRL+G+R AS
Sbjct  569   QPLSRNNSTEANMPLSQQQTSATLSSAQSNYVKVWEGDLSGQRQGEPVLITRLQGFRIAS  628

Query  1967  ASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQ  2146
             AS+ LAANWP+TMQI RLI+Q+H+NN++ +GKA+ +VF AM+QH FLGQLQEKK CAVIQ
Sbjct  629   ASKLLAANWPQTMQIDRLITQEHLNNERLIGKAEIVVFWAMDQHVFLGQLQEKKFCAVIQ  688

Query  2147  LPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             L SQT++LSVSDK CRLIGMLFP +MVVFKPQI
Sbjct  689   LSSQTMILSVSDKTCRLIGMLFPENMVVFKPQI  721



>ref|XP_010923554.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Elaeis guineensis]
Length=827

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/713 (57%), Positives = 508/713 (71%), Gaps = 43/713 (6%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQ-----------KPSGAN  325
             MAEKQLI+AVEGTAA+GP+W +I+SDYL+KIIRCF G E   Q           K SGA+
Sbjct  1     MAEKQLIVAVEGTAALGPYWQTILSDYLDKIIRCFYGNELTGQVDILLPRLVFKKLSGAH  60

Query  326   VEFGLVMFNSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMM  505
              EF LV+FN+HG +S+ +V  SGWT+D+D+F  WLS I F GGGF++AAIAEGLAEALMM
Sbjct  61    PEFALVVFNTHGPHSSFIVHHSGWTKDLDVFFQWLSGIPFSGGGFSEAAIAEGLAEALMM  120

Query  506   LS-SPNGNQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDA  682
                +PN +QS Q +E QKHCILVAASNPYPLPTPVYRP + + E  EN     +  L+DA
Sbjct  121   FPFTPNVSQSHQNLEAQKHCILVAASNPYPLPTPVYRPAM-SLEHPENAEAQTEAGLADA  179

Query  683   ETVAKSFAQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFM  862
             ETVAKSF QC VSLSV+ PK + KL++IY A KRNPR  D  +D+ KNP +LVL+SENFM
Sbjct  180   ETVAKSFGQCCVSLSVISPKQLPKLRSIYNAGKRNPRAVDPAVDHVKNPQFLVLLSENFM  239

Query  863   EARAAFNRTGMPSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNI  1042
             EARAA +R  + SL S Q  VK+D +S  PI GP  +     P+ NG ++NR P+  GN+
Sbjct  240   EARAALSRPLLGSLSSNQGVVKLDGASAAPIPGPSTNN----PTVNGSMINRPPVTVGNV  295

Query  1043  HPATVKIEPTTVTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQET  1219
               ATVK+EPTTV SM  GP F H+PS+   A+Q V NLQ S+P   SQEM ANN+ +QE 
Sbjct  296   PTATVKMEPTTVPSMVSGPAFPHMPSISTVATQGVANLQNSAPSPTSQEMGANNDGVQEI  355

Query  1220  KPMVVHGMGQSVRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---L  1375
             KP+ V+ + QS+RPVG   ANV ILN+++Q RQ     ++AG +SIGL +MG TPM   +
Sbjct  356   KPL-VNPISQSLRPVGPTPANVSILNNLSQHRQMMTSASIAGASSIGLQTMGATPMAMHM  414

Query  1376  SNmissgmassvsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsst  1555
             SNMISSGMASS  +  + ++ S           PL    QV Q+SA  SF + TS+MS  
Sbjct  415   SNMISSGMASSAMSGITSVAGSG----------PLMATAQVAQNSALGSFASATSNMSGN  464

Query  1556  snlvmsqsmNTLPSSVSVGQTVPGMNQANMPGT-QMMQTATGRSQNMMSGMGGASGIPSg  1732
             SN+ +S ++  L  ++ +G +VPG+ Q ++  + Q+ Q   G +QN+M+ +G  S     
Sbjct  465   SNIGISPALANLQGNIGMGTSVPGVGQGSLASSAQIGQGGIGMNQNIMNNLGPTS---IS  521

Query  1733  tgtmvptpgmtqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQ  1912
             +G     P      Q G+  +GV+NNS  +MP+   Q +S +Q A SKYVK+WEG LSGQ
Sbjct  522   SGPGTMIPTPGMSQQAGLHSLGVSNNSTMSMPV--SQHASNVQQAPSKYVKIWEGALSGQ  579

Query  1913  RQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMN  2092
             RQGQPVFI +LEGYRSASASETLAA+WP TMQIVRLI+Q+HMNNKQYVGKADFLVFR +N
Sbjct  580   RQGQPVFICKLEGYRSASASETLAADWPLTMQIVRLIAQEHMNNKQYVGKADFLVFRTLN  639

Query  2093  QHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             QHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKA RLIGMLFPGDMVVFKPQ+++
Sbjct  640   QHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKAGRLIGMLFPGDMVVFKPQVSS  692



>ref|XP_009595469.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Nicotiana tomentosiformis]
Length=843

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/695 (59%), Positives = 511/695 (74%), Gaps = 34/695 (5%)
 Frame = +2

Query  167   GQSPMAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVM  346
             G++ M EKQLI+AVEGTAA+GP W +I+SDYL+K+IR F   E   +KPS  N +  +V+
Sbjct  63    GKAHMMEKQLIVAVEGTAAVGPFWQTIISDYLDKMIRSFTKLEPIEKKPSAGNWQLAMVV  122

Query  347   FNSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGN  526
             F  HGS+ ACLV+RSGWTRDID+F  WLS+I F GGGFNDAA+AE LAEAL M SS NG+
Sbjct  123   FAVHGSHGACLVRRSGWTRDIDMFFQWLSAIPFSGGGFNDAAVAESLAEALTMFSSLNGS  182

Query  527   QSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFA  706
             Q++Q V+ Q+HCIL+AASNPYPLPTPVY P + N EQS N       RLSDAETVAK F 
Sbjct  183   QTQQNVDWQRHCILIAASNPYPLPTPVYHPHMQNVEQSGNIEAHTANRLSDAETVAKEFP  242

Query  707   QCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNR  886
             QCSVSLSV+CPK + KL+ IY A KR+P+ AD PID  KNP +LVLISENF+EA AAFNR
Sbjct  243   QCSVSLSVLCPKQLPKLRAIYNAGKRDPQAADPPIDTSKNPNFLVLISENFIEACAAFNR  302

Query  887   TGMPSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIE  1066
             TGM S    Q+ V+MD+SSV P+S P     A+  +  G VM++QPI  GNI  AT+ +E
Sbjct  303   TGMESSALNQSLVEMDMSSVAPVSAP-----AATFNPAGSVMSQQPISAGNIPAATINME  357

Query  1067  PTTVTSMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMG  1246
             PTTVTS+ GP   H+P+  R  SQ V +LQ++SPISVS+E+V NNE + ETKP ++ GM 
Sbjct  358   PTTVTSVTGPALPHIPTA-RPTSQLVASLQSASPISVSEEVVPNNEIVNETKP-ILSGMT  415

Query  1247  QSVRPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPMLSNmissgmassvsaaqs  1426
             Q +     AAAN RILNDVAQA QAL GGTSIGL SMG TP+LSNM+S G++SS+ AA +
Sbjct  416   QPLHSFSGAAANARILNDVAQA-QALVGGTSIGLQSMGETPILSNMMSGGISSSIPAAPT  474

Query  1427  visssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSSVS  1606
             V+SS Q  VTSM+  +PLAG GQ+ Q+S   S  +   SMS               S++ 
Sbjct  475   VLSSGQLAVTSMSGLVPLAGTGQIAQNSVSASSVSIAPSMSGN-------------SNLC  521

Query  1607  VGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgm  1786
             V Q +     +N+ G      + G  QN++SG G  +G+P G GT++ TP MTQQG  GM
Sbjct  522   VSQLL-----SNIQGG----VSAGMHQNVLSGTG--AGMPFGQGTLMSTPRMTQQGHPGM  570

Query  1787  qpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSAS  1966
             QP+  NN++ ANMPLSQQQTS+ L SAQS YVKVWEG+LSGQRQG+PV ITRL+G+R AS
Sbjct  571   QPLSRNNSTEANMPLSQQQTSATLSSAQSNYVKVWEGDLSGQRQGEPVLITRLQGFRIAS  630

Query  1967  ASETLAANWPETMQIVRLISQDHMNN--KQYVGKADFLVFRAMNQHGFLGQLQEKKLCAV  2140
             AS+ LAANWP+TMQI RLI+Q+H+NN  ++ +GKA+ +VF AM+QH FLGQLQEKK CAV
Sbjct  631   ASKLLAANWPQTMQIDRLITQEHLNNDVRRLIGKAEIVVFWAMDQHVFLGQLQEKKFCAV  690

Query  2141  IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             IQL SQT++LSVSDK CRLIGMLFP +MVVFKPQI
Sbjct  691   IQLSSQTMILSVSDKTCRLIGMLFPENMVVFKPQI  725



>ref|XP_009595472.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X4 [Nicotiana tomentosiformis]
Length=832

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/695 (59%), Positives = 511/695 (74%), Gaps = 34/695 (5%)
 Frame = +2

Query  167   GQSPMAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVM  346
             G++ M EKQLI+AVEGTAA+GP W +I+SDYL+K+IR F   E   +KPS  N +  +V+
Sbjct  52    GKAHMMEKQLIVAVEGTAAVGPFWQTIISDYLDKMIRSFTKLEPIEKKPSAGNWQLAMVV  111

Query  347   FNSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGN  526
             F  HGS+ ACLV+RSGWTRDID+F  WLS+I F GGGFNDAA+AE LAEAL M SS NG+
Sbjct  112   FAVHGSHGACLVRRSGWTRDIDMFFQWLSAIPFSGGGFNDAAVAESLAEALTMFSSLNGS  171

Query  527   QSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFA  706
             Q++Q V+ Q+HCIL+AASNPYPLPTPVY P + N EQS N       RLSDAETVAK F 
Sbjct  172   QTQQNVDWQRHCILIAASNPYPLPTPVYHPHMQNVEQSGNIEAHTANRLSDAETVAKEFP  231

Query  707   QCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNR  886
             QCSVSLSV+CPK + KL+ IY A KR+P+ AD PID  KNP +LVLISENF+EA AAFNR
Sbjct  232   QCSVSLSVLCPKQLPKLRAIYNAGKRDPQAADPPIDTSKNPNFLVLISENFIEACAAFNR  291

Query  887   TGMPSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIE  1066
             TGM S    Q+ V+MD+SSV P+S P     A+  +  G VM++QPI  GNI  AT+ +E
Sbjct  292   TGMESSALNQSLVEMDMSSVAPVSAP-----AATFNPAGSVMSQQPISAGNIPAATINME  346

Query  1067  PTTVTSMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMG  1246
             PTTVTS+ GP   H+P+  R  SQ V +LQ++SPISVS+E+V NNE + ETKP ++ GM 
Sbjct  347   PTTVTSVTGPALPHIPTA-RPTSQLVASLQSASPISVSEEVVPNNEIVNETKP-ILSGMT  404

Query  1247  QSVRPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPMLSNmissgmassvsaaqs  1426
             Q +     AAAN RILNDVAQA QAL GGTSIGL SMG TP+LSNM+S G++SS+ AA +
Sbjct  405   QPLHSFSGAAANARILNDVAQA-QALVGGTSIGLQSMGETPILSNMMSGGISSSIPAAPT  463

Query  1427  visssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSSVS  1606
             V+SS Q  VTSM+  +PLAG GQ+ Q+S   S  +   SMS               S++ 
Sbjct  464   VLSSGQLAVTSMSGLVPLAGTGQIAQNSVSASSVSIAPSMSGN-------------SNLC  510

Query  1607  VGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgm  1786
             V Q +     +N+ G      + G  QN++SG G  +G+P G GT++ TP MTQQG  GM
Sbjct  511   VSQLL-----SNIQGG----VSAGMHQNVLSGTG--AGMPFGQGTLMSTPRMTQQGHPGM  559

Query  1787  qpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSAS  1966
             QP+  NN++ ANMPLSQQQTS+ L SAQS YVKVWEG+LSGQRQG+PV ITRL+G+R AS
Sbjct  560   QPLSRNNSTEANMPLSQQQTSATLSSAQSNYVKVWEGDLSGQRQGEPVLITRLQGFRIAS  619

Query  1967  ASETLAANWPETMQIVRLISQDHMNN--KQYVGKADFLVFRAMNQHGFLGQLQEKKLCAV  2140
             AS+ LAANWP+TMQI RLI+Q+H+NN  ++ +GKA+ +VF AM+QH FLGQLQEKK CAV
Sbjct  620   ASKLLAANWPQTMQIDRLITQEHLNNDVRRLIGKAEIVVFWAMDQHVFLGQLQEKKFCAV  679

Query  2141  IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             IQL SQT++LSVSDK CRLIGMLFP +MVVFKPQI
Sbjct  680   IQLSSQTMILSVSDKTCRLIGMLFPENMVVFKPQI  714



>ref|XP_009595473.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X5 [Nicotiana tomentosiformis]
Length=777

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/691 (59%), Positives = 508/691 (74%), Gaps = 34/691 (5%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             M EKQLI+AVEGTAA+GP W +I+SDYL+K+IR F   E   +KPS  N +  +V+F  H
Sbjct  1     MMEKQLIVAVEGTAAVGPFWQTIISDYLDKMIRSFTKLEPIEKKPSAGNWQLAMVVFAVH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQ  538
             GS+ ACLV+RSGWTRDID+F  WLS+I F GGGFNDAA+AE LAEAL M SS NG+Q++Q
Sbjct  61    GSHGACLVRRSGWTRDIDMFFQWLSAIPFSGGGFNDAAVAESLAEALTMFSSLNGSQTQQ  120

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
              V+ Q+HCIL+AASNPYPLPTPVY P + N EQS N       RLSDAETVAK F QCSV
Sbjct  121   NVDWQRHCILIAASNPYPLPTPVYHPHMQNVEQSGNIEAHTANRLSDAETVAKEFPQCSV  180

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSV+CPK + KL+ IY A KR+P+ AD PID  KNP +LVLISENF+EA AAFNRTGM 
Sbjct  181   SLSVLCPKQLPKLRAIYNAGKRDPQAADPPIDTSKNPNFLVLISENFIEACAAFNRTGME  240

Query  899   SLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
             S    Q+ V+MD+SSV P+S P     A+  +  G VM++QPI  GNI  AT+ +EPTTV
Sbjct  241   SSALNQSLVEMDMSSVAPVSAP-----AATFNPAGSVMSQQPISAGNIPAATINMEPTTV  295

Query  1079  TSMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSVR  1258
             TS+ GP   H+P+  R  SQ V +LQ++SPISVS+E+V NNE + ETKP ++ GM Q + 
Sbjct  296   TSVTGPALPHIPTA-RPTSQLVASLQSASPISVSEEVVPNNEIVNETKP-ILSGMTQPLH  353

Query  1259  PVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPMLSNmissgmassvsaaqsviss  1438
                 AAAN RILNDVAQA QAL GGTSIGL SMG TP+LSNM+S G++SS+ AA +V+SS
Sbjct  354   SFSGAAANARILNDVAQA-QALVGGTSIGLQSMGETPILSNMMSGGISSSIPAAPTVLSS  412

Query  1439  sqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSSVSVGQT  1618
              Q  VTSM+  +PLAG GQ+ Q+S   S  +   SMS               S++ V Q 
Sbjct  413   GQLAVTSMSGLVPLAGTGQIAQNSVSASSVSIAPSMSGN-------------SNLCVSQL  459

Query  1619  VPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgmqpIG  1798
             +     +N+ G      + G  QN++SG G  +G+P G GT++ TP MTQQG  GMQP+ 
Sbjct  460   L-----SNIQGG----VSAGMHQNVLSGTG--AGMPFGQGTLMSTPRMTQQGHPGMQPLS  508

Query  1799  VNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASET  1978
              NN++ ANMPLSQQQTS+ L SAQS YVKVWEG+LSGQRQG+PV ITRL+G+R ASAS+ 
Sbjct  509   RNNSTEANMPLSQQQTSATLSSAQSNYVKVWEGDLSGQRQGEPVLITRLQGFRIASASKL  568

Query  1979  LAANWPETMQIVRLISQDHMNN--KQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLP  2152
             LAANWP+TMQI RLI+Q+H+NN  ++ +GKA+ +VF AM+QH FLGQLQEKK CAVIQL 
Sbjct  569   LAANWPQTMQIDRLITQEHLNNDVRRLIGKAEIVVFWAMDQHVFLGQLQEKKFCAVIQLS  628

Query  2153  SQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             SQT++LSVSDK CRLIGMLFP +MVVFKPQI
Sbjct  629   SQTMILSVSDKTCRLIGMLFPENMVVFKPQI  659



>ref|XP_009595470.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Nicotiana tomentosiformis]
Length=841

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/695 (59%), Positives = 509/695 (73%), Gaps = 36/695 (5%)
 Frame = +2

Query  167   GQSPMAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVM  346
             G++ M EKQLI+AVEGTAA+GP W +I+SDYL+K+IR F   E   +KPS  N +  +V+
Sbjct  63    GKAHMMEKQLIVAVEGTAAVGPFWQTIISDYLDKMIRSFTKLEPIEKKPSAGNWQLAMVV  122

Query  347   FNSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGN  526
             F  HGS+ ACLV+RSGWTRDID+F  WLS+I F GGGFNDAA+AE LAEAL M SS NG+
Sbjct  123   FAVHGSHGACLVRRSGWTRDIDMFFQWLSAIPFSGGGFNDAAVAESLAEALTMFSSLNGS  182

Query  527   QSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFA  706
             Q++Q V+ Q+HCIL+AASNPYPLPTPVY P + N EQS N       RLSDAETVAK F 
Sbjct  183   QTQQNVDWQRHCILIAASNPYPLPTPVYHPHMQNVEQSGNIEAHTANRLSDAETVAKEFP  242

Query  707   QCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNR  886
             QCSVSLSV+CPK + KL+ IY A KR+P+ AD PID  KNP +LVLISENF+EA AAFNR
Sbjct  243   QCSVSLSVLCPKQLPKLRAIYNAGKRDPQAADPPIDTSKNPNFLVLISENFIEACAAFNR  302

Query  887   TGMPSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIE  1066
             TGM S    Q+ V+MD+SSV P+S P         + N  VM++QPI  GNI  AT+ +E
Sbjct  303   TGMESSALNQSLVEMDMSSVAPVSAP-------AATFNPAVMSQQPISAGNIPAATINME  355

Query  1067  PTTVTSMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMG  1246
             PTTVTS+ GP   H+P+  R  SQ V +LQ++SPISVS+E+V NNE + ETKP ++ GM 
Sbjct  356   PTTVTSVTGPALPHIPTA-RPTSQLVASLQSASPISVSEEVVPNNEIVNETKP-ILSGMT  413

Query  1247  QSVRPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPMLSNmissgmassvsaaqs  1426
             Q +     AAAN RILNDVAQA QAL GGTSIGL SMG TP+LSNM+S G++SS+ AA +
Sbjct  414   QPLHSFSGAAANARILNDVAQA-QALVGGTSIGLQSMGETPILSNMMSGGISSSIPAAPT  472

Query  1427  visssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSSVS  1606
             V+SS Q  VTSM+  +PLAG GQ+ Q+S   S  +   SMS               S++ 
Sbjct  473   VLSSGQLAVTSMSGLVPLAGTGQIAQNSVSASSVSIAPSMSGN-------------SNLC  519

Query  1607  VGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgm  1786
             V Q +     +N+ G      + G  QN++SG G  +G+P G GT++ TP MTQQG  GM
Sbjct  520   VSQLL-----SNIQGG----VSAGMHQNVLSGTG--AGMPFGQGTLMSTPRMTQQGHPGM  568

Query  1787  qpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSAS  1966
             QP+  NN++ ANMPLSQQQTS+ L SAQS YVKVWEG+LSGQRQG+PV ITRL+G+R AS
Sbjct  569   QPLSRNNSTEANMPLSQQQTSATLSSAQSNYVKVWEGDLSGQRQGEPVLITRLQGFRIAS  628

Query  1967  ASETLAANWPETMQIVRLISQDHMNN--KQYVGKADFLVFRAMNQHGFLGQLQEKKLCAV  2140
             AS+ LAANWP+TMQI RLI+Q+H+NN  ++ +GKA+ +VF AM+QH FLGQLQEKK CAV
Sbjct  629   ASKLLAANWPQTMQIDRLITQEHLNNDVRRLIGKAEIVVFWAMDQHVFLGQLQEKKFCAV  688

Query  2141  IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             IQL SQT++LSVSDK CRLIGMLFP +MVVFKPQI
Sbjct  689   IQLSSQTMILSVSDKTCRLIGMLFPENMVVFKPQI  723



>ref|XP_009782374.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Nicotiana sylvestris]
 ref|XP_009782375.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Nicotiana sylvestris]
 ref|XP_009782376.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Nicotiana sylvestris]
Length=784

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/699 (58%), Positives = 502/699 (72%), Gaps = 48/699 (7%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             M EKQLI+AVEGTAA+GP W +I+SDYL+K+IR F   E   +KPS  N +  +V+F  H
Sbjct  1     MMEKQLIVAVEGTAAVGPFWQTIISDYLDKMIRSFTKLEPIEKKPSAGNWQLAMVVFTVH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQ  538
             GS+ ACLV+RSGWT DID+F  WLS+I F GGGFNDAA+AE LAEAL M SS NG+Q++Q
Sbjct  61    GSHGACLVRRSGWTTDIDMFFQWLSAIPFSGGGFNDAAVAESLAEALTMFSSLNGSQTQQ  120

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
              V+GQ+HCIL+AASNPYPLPTPVY P + N EQS N       RLSDAETVAK F QCSV
Sbjct  121   NVDGQRHCILIAASNPYPLPTPVYHPHMQNVEQSGNIEAHTANRLSDAETVAKEFPQCSV  180

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSV+CPK + KL+ IY A KR+P+ AD PID  KNP +LVLISENF+EA AAFNRTGM 
Sbjct  181   SLSVICPKQLPKLRAIYNAGKRDPQAADPPIDTSKNPNFLVLISENFIEACAAFNRTGME  240

Query  899   SLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
                  Q  V+MD+SSV P+S P         + +  VM++QPI  G+I  ATV +EPTTV
Sbjct  241   ISALNQILVEMDMSSVAPVSAP-------AATFDPAVMSQQPISAGSIPSATVNMEPTTV  293

Query  1079  TSMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSVR  1258
             TS+ GP   H+P+  R  SQ V +LQ++SPISVS+E+V NNE + ETKP ++ GM Q +R
Sbjct  294   TSVTGPALPHIPTA-RPTSQLVASLQSASPISVSEEVVPNNEIVNETKP-ILSGMTQPLR  351

Query  1259  PVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPMLSNmissgmassvsaaqsviss  1438
                 AAAN RILNDVAQA QAL GGTSIGL SMGGTP+LSNMI  G++SS+ AA +V+SS
Sbjct  352   SFSGAAANARILNDVAQA-QALVGGTSIGLQSMGGTPILSNMIPGGISSSIPAAPTVLSS  410

Query  1439  sqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSSVSVGQT  1618
              Q  VTSM+  +PLAG GQ+ Q+S                             S S    
Sbjct  411   GQLAVTSMSGLVPLAGTGQIAQNS----------------------------VSASSVSI  442

Query  1619  VPGMN-QANMPGTQMMQTATG-----RSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqq  1780
              P M+  +N+  +Q++    G       QN++SG G  +G+P GTGT++ TP MTQ G  
Sbjct  443   APSMSGNSNLCVSQLLSNIQGGVSAVMHQNVLSGTG--AGMPFGTGTLMSTPRMTQPGHP  500

Query  1781  gmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRS  1960
             GMQP+G NN++ AN+PLSQ+QTS+ L SAQS YVKVWEG+LSGQRQG+PV ITRL+G+R 
Sbjct  501   GMQPLGRNNSTEANIPLSQRQTSATLSSAQSNYVKVWEGDLSGQRQGEPVLITRLQGFRI  560

Query  1961  ASASETLAANWPETMQIVRLISQDHMNN--KQYVGKADFLVFRAMNQHGFLGQLQEKKLC  2134
             ASAS++LAA+WP+TMQIVRLI+Q+H+NN  ++ +GKA+ +VF AM+QH FL QLQEKK C
Sbjct  561   ASASKSLAADWPQTMQIVRLITQEHLNNDVRRLIGKAEIVVFWAMDQHVFLSQLQEKKFC  620

Query  2135  AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             AVIQLPSQ ++LSVSDK CRLIGMLFP + VVFKPQ  N
Sbjct  621   AVIQLPSQAMILSVSDKTCRLIGMLFPENTVVFKPQKLN  659



>ref|XP_008791236.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Phoenix dactylifera]
Length=787

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/700 (56%), Positives = 488/700 (70%), Gaps = 53/700 (8%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEKQLI+AVEGTAA+GP+W+ I+SDYL+KIIRCF G E   QK SGA+ EF LV+FN+H
Sbjct  1     MAEKQLIVAVEGTAALGPYWSIILSDYLDKIIRCFYGNELTGQKLSGAHPEFALVVFNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSK  535
             G +S+ +VQ SGWT+D+D+F  WLS I F GGGF++AAIAEGLAEALMM   +PN +QS 
Sbjct  61    GPHSSFIVQHSGWTKDLDVFFQWLSGIPFSGGGFSEAAIAEGLAEALMMFPFTPNVSQSH  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q +E QKHCILVAASNPYPLPTPVYRP I + E  EN     +  L+DAETVAKSF Q  
Sbjct  121   QNLEAQKHCILVAASNPYPLPTPVYRPAIQSLEHPENAEAQTEAGLADAETVAKSFGQ--  178

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
                                  KRNPR AD  +D+ KNP +LVL+SE+FMEARAA +R  +
Sbjct  179   --------------------GKRNPRAADPAVDHVKNPQFLVLLSESFMEARAALSRPLI  218

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
               L S Q  VK+D +S  PI GP  +     P+ NG ++NR P+  GNI  ATVK+EPTT
Sbjct  219   GGLTSNQGVVKLDGASATPIPGPSTNN----PAVNGSMINRPPVTVGNIPTATVKMEPTT  274

Query  1076  VTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             V+SM  GP F H+ S+   A+Q V NLQ S+P   SQEM AN++ +QE KP+ ++ + QS
Sbjct  275   VSSMVSGPAFPHMQSISNVATQGVGNLQNSAPSPTSQEMGANSDGVQEIKPL-INPISQS  333

Query  1253  VRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---LSNmissgmass  1408
             +RPVG   ANV ILN+++Q RQ     ++AG +SIGL +MG TPM   +SNMIS+GM SS
Sbjct  334   LRPVGPTPANVSILNNLSQHRQMMTSASIAGASSIGLQTMGATPMAMHMSNMISTGMVSS  393

Query  1409  vsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNT  1588
               +  + ++ S           PL    QV Q+SA  SF + TS+MS  SN+ +S ++  
Sbjct  394   AMSGITSVAGSG----------PLMATAQVAQNSALGSFASATSNMSGNSNIGISPALAN  443

Query  1589  LPSSVSVGQTVPGMNQANMP-GTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmt  1765
             L  ++ +G +VPG+ Q N+   TQ+ Q     +QN M+ + G +GI S  G     P   
Sbjct  444   LQGNIGMGTSVPGVGQGNLASSTQIGQGGISMNQNTMNNL-GPTGISS--GPGTMIPTPG  500

Query  1766  qqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRL  1945
                Q G+  +GV NNS  NMP+   Q  S +Q AQSKYVK+WEG+LSGQRQGQPVFI +L
Sbjct  501   MSQQAGLHSLGVTNNSTMNMPV--SQHPSNVQQAQSKYVKIWEGSLSGQRQGQPVFICKL  558

Query  1946  EGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEK  2125
             EGYR+ASASETLAA+WP+TMQIVRLI+Q+HM+NKQY GK D+LVFR +NQHGFLGQLQEK
Sbjct  559   EGYRNASASETLAADWPQTMQIVRLIAQEHMSNKQYGGKVDYLVFRTLNQHGFLGQLQEK  618

Query  2126  KLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             KLCAVIQLPSQTLLLSVSDKA RLIG+LFPGDMVVFKPQ+
Sbjct  619   KLCAVIQLPSQTLLLSVSDKAGRLIGVLFPGDMVVFKPQV  658



>ref|XP_009414709.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 [Musa acuminata subsp. malaccensis]
Length=813

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/711 (56%), Positives = 497/711 (70%), Gaps = 44/711 (6%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAE+QLI+AVEGTAA+GP+W +I+SDYL+KIIR + G E   QK +GAN E  LV+FN+H
Sbjct  1     MAERQLIVAVEGTAALGPYWQTILSDYLDKIIRYYYGNEMTGQKLNGANPELALVVFNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSP-NGNQSK  535
             G YSA +V RSGWT+D+D+FL WLS++ F GGGF +AAIAEGL+EALMM S+  N   + 
Sbjct  61    GPYSAFVVDRSGWTKDLDVFLQWLSAMRFTGGGFTEAAIAEGLSEALMMFSAASNVTDNH  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSEN-ETQTDDRRLSDAETVAKSFAQC  712
             Q  E QKHCILVAASNP+PLPTPVYRP +  SE  E  E QT++  L+DA+TVAKSF QC
Sbjct  121   QNHETQKHCILVAASNPHPLPTPVYRPPVPASEHKETGEVQTEN-GLADAQTVAKSFGQC  179

Query  713   SVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTG  892
              VSLSV+ PK +  L+ IY A KRNPR  D  +D+ +NP YLVL+SENF EA AA +R  
Sbjct  180   FVSLSVISPKQLPNLREIYNAGKRNPRALDPSVDHVRNPQYLVLLSENFKEACAALSRPS  239

Query  893   MPSLP-----STQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATV  1057
             MP+L      S Q  VK+D +S  PISGP P+   S PS NG +MNRQPI  G+I  ATV
Sbjct  240   MPNLTHNQGISNQGIVKLDGASAAPISGP-PA--TSNPSVNGSMMNRQPITVGSIPTATV  296

Query  1058  KIEPTTVTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVV  1234
             K+EPTTV+ M  GP F+H+PSV   ASQ + +LQ SS  S SQEM A+ +  QE KP+ V
Sbjct  297   KVEPTTVSPMVSGPAFSHLPSVANVASQGISSLQNSS-PSSSQEMNASIDTTQEIKPL-V  354

Query  1235  HGMGQSVRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPMLSNmissgm  1399
             + + QS RP   A ANV ILN+++Q RQ     ++AGG+SIGL +MGGTPM         
Sbjct  355   NPISQSSRPAVPAPANVSILNNLSQHRQVMTSASIAGGSSIGLPTMGGTPM---------  405

Query  1400  assvsaaqsvisssqsgvtsmtssMPLAGP----GQVVQssaptsftattssmsstsnlv  1567
               +V  +  + S   S   S  SS+P++G      QV Q++   S  + TS++S  SN+ 
Sbjct  406   --AVHMSNMISSGMSSSALSGISSVPVSGALMTTSQVAQNTTLGSLASATSNLSGNSNIG  463

Query  1568  msqsmNTLPSSVSVGQTVPGMNQANM-PGTQMMQTATGRSQNMMSGM--GGASGIPSgtg  1738
             +S ++N L  ++ VGQ+V  + Q  +  G Q+ Q     +QNMM+ +   G S  P    
Sbjct  464   ISSTLNNLQGNIPVGQSVSNVGQGTLGSGAQIGQGGMTINQNMMNNLVPSGVSSGPG---  520

Query  1739  tmvptpgmtqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQ  1918
                  P      Q G+  +GV NNSA NM L   Q +  +Q +QSKY+K+WEG+LSGQRQ
Sbjct  521   --TMIPTPGMTQQSGVHSLGVANNSAINMSL--TQHAPGIQQSQSKYLKIWEGSLSGQRQ  576

Query  1919  GQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQH  2098
             GQPVFI +LEGYRS SAS++LAA+WP TMQIVRLI+Q+HMNNKQYVGKADFLVFR +NQH
Sbjct  577   GQPVFICKLEGYRSQSASDSLAADWPMTMQIVRLIAQEHMNNKQYVGKADFLVFRTLNQH  636

Query  2099  GFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             GFLGQLQEKKLCAVIQLPSQTLLLSVSDKA RLIGMLFPGDMVVFKPQ+++
Sbjct  637   GFLGQLQEKKLCAVIQLPSQTLLLSVSDKAGRLIGMLFPGDMVVFKPQVSS  687



>ref|XP_009604841.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Nicotiana tomentosiformis]
Length=534

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/546 (71%), Positives = 449/546 (82%), Gaps = 13/546 (2%)
 Frame = +2

Query  344   MFNSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNG  523
             MFN+HGSYSACLVQRSGWTRD+D+F  WLS+I F GGGF+DAA+AEGL EALMM SSPNG
Sbjct  1     MFNAHGSYSACLVQRSGWTRDMDIFFQWLSAIPFSGGGFSDAAVAEGLGEALMMFSSPNG  60

Query  524   NQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSEN-ETQTDDRRLSDAETVAKS  700
             NQS+Q +EG+KHC+L++ASNPYPLPTPVYRPQ+   EQ+EN ETQTD  RLSDAETVAK+
Sbjct  61    NQSQQNMEGKKHCLLISASNPYPLPTPVYRPQMQKLEQNENTETQTDS-RLSDAETVAKA  119

Query  701   FAQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAF  880
             F QCSVSLSV+CPK + KL+ +Y A KRNPR AD PID  KNP +LVLISENF+EARAAF
Sbjct  120   FPQCSVSLSVICPKQLSKLRAVYNAGKRNPRAADPPIDTAKNPNFLVLISENFIEARAAF  179

Query  881   NRTGMPSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVK  1060
             +R GM +L S Q+PVKMDVSS+PP+S P PS   S  +ANG VM+RQPI  GNI PATVK
Sbjct  180   SRPGMTNLTSNQSPVKMDVSSIPPVSVP-PS--ISNSAANGSVMSRQPISAGNIPPATVK  236

Query  1061  IEPTTVTSMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHG  1240
             IEPTTVTSM GP F+H+PSV R A QPV +LQTSSP+SVSQEM ++NEN+QE KP VV G
Sbjct  237   IEPTTVTSMNGPAFSHIPSV-RPALQPVPSLQTSSPLSVSQEMASHNENVQEMKP-VVSG  294

Query  1241  MGQSVRPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPMLSNmissgmassvsaa  1420
             M QS+RPV AAAANVRILNDVAQARQA+AG TSIGL SMGGTPMLS+MISSGMASSV +A
Sbjct  295   MTQSLRPVAAAAANVRILNDVAQARQAIAGATSIGLQSMGGTPMLSSMISSGMASSVPSA  354

Query  1421  qsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSS  1600
             Q+V SS QSGVT+++ S+PLAG GQ  Q    ++ T+ TSS  S S         TL   
Sbjct  355   QTVFSSGQSGVTTVSGSVPLAGSGQNTQ---NSAPTSFTSSAPSMSGNPNISISQTLSGV  411

Query  1601  VSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqq  1780
                GQTVPGM Q N+PGTQMM + TG +QNM++G+ GA+G+PSGTGTM+PTPG++QQGQ 
Sbjct  412   SMAGQTVPGMCQGNLPGTQMMPSGTGMNQNMLTGL-GATGMPSGTGTMMPTPGISQQGQP  470

Query  1781  gmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRS  1960
             GMQP+G  N++ ANMPLSQQQT + L SAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRS
Sbjct  471   GMQPVG--NSTGANMPLSQQQTPAALPSAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRS  528

Query  1961  ASASET  1978
             ASASE+
Sbjct  529   ASASES  534



>gb|KDO70071.1| hypothetical protein CISIN_1g003284mg [Citrus sinensis]
Length=601

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/610 (66%), Positives = 476/610 (78%), Gaps = 19/610 (3%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             M+EKQLI+AVEGTAAMGP+W SIVSDYLEKIIRCFC  E   QK S +NVE  LV FN+H
Sbjct  1     MSEKQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQKTSASNVELSLVTFNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSK  535
             GSY ACLVQRSGWT+D+D+FLHWLS+I F GGGFNDAAIAEGL+EALMM S +PNG+Q++
Sbjct  61    GSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSVAPNGSQNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q V+GQ+HCILVAASNP+PLPTPVYRPQ+ N +Q+EN     + RLSDAETVAKSF QCS
Sbjct  121   QNVDGQRHCILVAASNPHPLPTPVYRPQMQNLDQNENNEAQAESRLSDAETVAKSFVQCS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK + KL  IY AAKRNPR AD P+DN KNP++LVLISENFMEARAA +R G+
Sbjct  181   VSLSVICPKQLPKLTAIYNAAKRNPRAADPPVDNSKNPHFLVLISENFMEARAALSRPGV  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              +L   QNPVKMD++ V  ++GP P+   SIPS NG  +NR PI  GN+  ATVK+EP+T
Sbjct  241   ANLAPNQNPVKMDIAPVTSVTGPAPT---SIPSVNG--INRPPISVGNVPTATVKVEPST  295

Query  1076  VTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             VTSM  GPTF H+PSVPR ASQ V +LQTSSP S SQEM+ + +++ E KP+ V GM Q 
Sbjct  296   VTSMVNGPTFPHIPSVPRPASQGVPSLQTSSPSSTSQEMITSGDSVPEVKPL-VSGMSQP  354

Query  1253  VRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---LSNmissgmass  1408
             +RP+  AAANV ILN+++QARQ     AL GGTSIGL SMG TPM   +SNMISSGMASS
Sbjct  355   LRPMAPAAANVNILNNLSQARQVMNNAALTGGTSIGLQSMGQTPMAMHMSNMISSGMASS  414

Query  1409  vsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNT  1588
             V  +Q V SS+QSG+TS+  S  L G  QV Q+S   SFT+  S++S  SN  +SQ M T
Sbjct  415   VPTSQPVFSSAQSGITSIGGSGTLTGTSQVPQNSGLNSFTSAPSNLSGNSNPSISQPMGT  474

Query  1589  LPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtq  1768
             L    S+GQ+V GM+Q N  G QM+Q     +QNMMSG+ G SG+ SGTGTM+PTPGM+Q
Sbjct  475   LQGGASMGQSV-GMSQGNHSGGQMVQNGISMNQNMMSGL-GPSGVSSGTGTMIPTPGMSQ  532

Query  1769  qgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLE  1948
             Q Q GMQP+ VNNN+A NM L  QQTSS L S+QSKYVKVWEG+LSGQRQGQPVFIT+LE
Sbjct  533   QAQSGMQPLSVNNNTAVNMQL-SQQTSSALHSSQSKYVKVWEGSLSGQRQGQPVFITKLE  591

Query  1949  GYRSASASET  1978
             GYRSASASET
Sbjct  592   GYRSASASET  601



>gb|KDP29373.1| hypothetical protein JCGZ_18294 [Jatropha curcas]
Length=610

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/610 (65%), Positives = 468/610 (77%), Gaps = 17/610 (3%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             M EKQLI+AVEG+AAMGP W SI+SDYLEKIIR F G++   QKP+ + VE  LV F +H
Sbjct  1     MTEKQLIVAVEGSAAMGPFWQSILSDYLEKIIRSFVGSDLTGQKPATSTVELSLVTFYAH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSK  535
             GSYSACLVQRSGWTRDID+FL WLS I F GGGFNDAAIAEGL+EALMM   +PN +Q++
Sbjct  61    GSYSACLVQRSGWTRDIDIFLQWLSCIPFAGGGFNDAAIAEGLSEALMMFPFAPNASQAQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q  + Q+HC+LVAASNP+ LPTPVYRPQI N EQSEN     + RLSDAETVAKSF QCS
Sbjct  121   QNTDAQRHCVLVAASNPHSLPTPVYRPQIQNLEQSENIDLQTESRLSDAETVAKSFPQCS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK +LKL+ IY A KRN R AD  +DN KNP++LVLISENFMEAR A  R G+
Sbjct  181   VSLSVICPKQLLKLRAIYNAGKRNTRVADPTVDNVKNPHFLVLISENFMEARTALTRPGV  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              +L + Q+PVKMDVSSVP ++GP P    SI S NG +MNR PI  GN+  ATVKIEPTT
Sbjct  241   SNLSANQSPVKMDVSSVPSVAGPPP---PSISSVNGSIMNRPPISVGNVPTATVKIEPTT  297

Query  1076  VTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             VTSM PGP F+H+PS  R A+Q V +LQTSSP + SQEM+ N EN+ E KP  V GM QS
Sbjct  298   VTSMAPGPVFSHIPSA-RPATQAVPSLQTSSPPTTSQEMMTNGENVPELKP-TVSGMPQS  355

Query  1253  VRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---LSNmissgmass  1408
             VRPV   AANV ILN+++QARQ     AL GG+SI L SM  TP+   +SNMISSGMA+S
Sbjct  356   VRPVPPGAANVSILNNLSQARQVMNSAALTGGSSIALPSMNQTPVAMHMSNMISSGMATS  415

Query  1409  vsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNT  1588
             V AAQ+V SS Q G+TSMT S  L G  Q+  +S   SF ++TS++S  SNL +SQ M  
Sbjct  416   VPAAQTVFSSGQPGITSMTGSGTLTGTSQIAPNSGLGSFASSTSNISGNSNLGISQPMAN  475

Query  1589  LPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtq  1768
             L   VS+GQ+V GM+Q N+ G QM+Q+  G +QN+M+G+ G SG+ SGT TM+PTPGM Q
Sbjct  476   LQGGVSMGQSVSGMSQGNLSGGQMVQSVIGMNQNVMNGL-GPSGVSSGTSTMIPTPGMPQ  534

Query  1769  qgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLE  1948
             Q Q GMQ +GVNNNSAANMPL  QQT+S LQSAQSKYVKVWEGNLSGQRQGQPVFITRLE
Sbjct  535   QAQTGMQSLGVNNNSAANMPL-SQQTTSALQSAQSKYVKVWEGNLSGQRQGQPVFITRLE  593

Query  1949  GYRSASASET  1978
             GYR+ASASE+
Sbjct  594   GYRNASASES  603



>ref|XP_009782378.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X3 [Nicotiana sylvestris]
Length=647

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/672 (56%), Positives = 474/672 (71%), Gaps = 48/672 (7%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             M EKQLI+AVEGTAA+GP W +I+SDYL+K+IR F   E   +KPS  N +  +V+F  H
Sbjct  1     MMEKQLIVAVEGTAAVGPFWQTIISDYLDKMIRSFTKLEPIEKKPSAGNWQLAMVVFTVH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQ  538
             GS+ ACLV+RSGWT DID+F  WLS+I F GGGFNDAA+AE LAEAL M SS NG+Q++Q
Sbjct  61    GSHGACLVRRSGWTTDIDMFFQWLSAIPFSGGGFNDAAVAESLAEALTMFSSLNGSQTQQ  120

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
              V+GQ+HCIL+AASNPYPLPTPVY P + N EQS N       RLSDAETVAK F QCSV
Sbjct  121   NVDGQRHCILIAASNPYPLPTPVYHPHMQNVEQSGNIEAHTANRLSDAETVAKEFPQCSV  180

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSV+CPK + KL+ IY A KR+P+ AD PID  KNP +LVLISENF+EA AAFNRTGM 
Sbjct  181   SLSVICPKQLPKLRAIYNAGKRDPQAADPPIDTSKNPNFLVLISENFIEACAAFNRTGME  240

Query  899   SLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
                  Q  V+MD+SSV P+S P         + +  VM++QPI  G+I  ATV +EPTTV
Sbjct  241   ISALNQILVEMDMSSVAPVSAP-------AATFDPAVMSQQPISAGSIPSATVNMEPTTV  293

Query  1079  TSMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSVR  1258
             TS+ GP   H+P+  R  SQ V +LQ++SPISVS+E+V NNE + ETKP ++ GM Q +R
Sbjct  294   TSVTGPALPHIPTA-RPTSQLVASLQSASPISVSEEVVPNNEIVNETKP-ILSGMTQPLR  351

Query  1259  PVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPMLSNmissgmassvsaaqsviss  1438
                 AAAN RILNDVAQA QAL GGTSIGL SMGGTP+LSNMI  G++SS+ AA +V+SS
Sbjct  352   SFSGAAANARILNDVAQA-QALVGGTSIGLQSMGGTPILSNMIPGGISSSIPAAPTVLSS  410

Query  1439  sqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSSVSVGQT  1618
              Q  VTSM+  +PLAG GQ+ Q+S                             S S    
Sbjct  411   GQLAVTSMSGLVPLAGTGQIAQNS----------------------------VSASSVSI  442

Query  1619  VPGMN-QANMPGTQMMQTATG-----RSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqq  1780
              P M+  +N+  +Q++    G       QN++SG G  +G+P GTGT++ TP MTQ G  
Sbjct  443   APSMSGNSNLCVSQLLSNIQGGVSAVMHQNVLSGTG--AGMPFGTGTLMSTPRMTQPGHP  500

Query  1781  gmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRS  1960
             GMQP+G NN++ AN+PLSQ+QTS+ L SAQS YVKVWEG+LSGQRQG+PV ITRL+G+R 
Sbjct  501   GMQPLGRNNSTEANIPLSQRQTSATLSSAQSNYVKVWEGDLSGQRQGEPVLITRLQGFRI  560

Query  1961  ASASETLAANWPETMQIVRLISQDHMNN--KQYVGKADFLVFRAMNQHGFLGQLQEKKLC  2134
             ASAS++LAA+WP+TMQIVRLI+Q+H+NN  ++ +GKA+ +VF AM+QH FL QLQEKK  
Sbjct  561   ASASKSLAADWPQTMQIVRLITQEHLNNDVRRLIGKAEIVVFWAMDQHVFLSQLQEKKFV  620

Query  2135  AVIQLPSQTLLL  2170
             +V++     L L
Sbjct  621   SVLESKDCFLFL  632



>ref|XP_009595474.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X6 [Nicotiana tomentosiformis]
Length=724

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/638 (60%), Positives = 470/638 (74%), Gaps = 34/638 (5%)
 Frame = +2

Query  338   LVMFNSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSP  517
             +V+F  HGS+ ACLV+RSGWTRDID+F  WLS+I F GGGFNDAA+AE LAEAL M SS 
Sbjct  1     MVVFAVHGSHGACLVRRSGWTRDIDMFFQWLSAIPFSGGGFNDAAVAESLAEALTMFSSL  60

Query  518   NGNQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAK  697
             NG+Q++Q V+ Q+HCIL+AASNPYPLPTPVY P + N EQS N       RLSDAETVAK
Sbjct  61    NGSQTQQNVDWQRHCILIAASNPYPLPTPVYHPHMQNVEQSGNIEAHTANRLSDAETVAK  120

Query  698   SFAQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAA  877
              F QCSVSLSV+CPK + KL+ IY A KR+P+ AD PID  KNP +LVLISENF+EA AA
Sbjct  121   EFPQCSVSLSVLCPKQLPKLRAIYNAGKRDPQAADPPIDTSKNPNFLVLISENFIEACAA  180

Query  878   FNRTGMPSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATV  1057
             FNRTGM S    Q+ V+MD+SSV P+S P     A+  +  G VM++QPI  GNI  AT+
Sbjct  181   FNRTGMESSALNQSLVEMDMSSVAPVSAP-----AATFNPAGSVMSQQPISAGNIPAATI  235

Query  1058  KIEPTTVTSMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVH  1237
              +EPTTVTS+ GP   H+P+  R  SQ V +LQ++SPISVS+E+V NNE + ETKP ++ 
Sbjct  236   NMEPTTVTSVTGPALPHIPTA-RPTSQLVASLQSASPISVSEEVVPNNEIVNETKP-ILS  293

Query  1238  GMGQSVRPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPMLSNmissgmassvsa  1417
             GM Q +     AAAN RILNDVAQA QAL GGTSIGL SMG TP+LSNM+S G++SS+ A
Sbjct  294   GMTQPLHSFSGAAANARILNDVAQA-QALVGGTSIGLQSMGETPILSNMMSGGISSSIPA  352

Query  1418  aqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPS  1597
             A +V+SS Q  VTSM+  +PLAG GQ+ Q+S   S  +   SMS               S
Sbjct  353   APTVLSSGQLAVTSMSGLVPLAGTGQIAQNSVSASSVSIAPSMSGN-------------S  399

Query  1598  SVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgq  1777
             ++ V Q +     +N+ G      + G  QN++SG G  +G+P G GT++ TP MTQQG 
Sbjct  400   NLCVSQLL-----SNIQGG----VSAGMHQNVLSGTG--AGMPFGQGTLMSTPRMTQQGH  448

Query  1778  qgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYR  1957
              GMQP+  NN++ ANMPLSQQQTS+ L SAQS YVKVWEG+LSGQRQG+PV ITRL+G+R
Sbjct  449   PGMQPLSRNNSTEANMPLSQQQTSATLSSAQSNYVKVWEGDLSGQRQGEPVLITRLQGFR  508

Query  1958  SASASETLAANWPETMQIVRLISQDHMNN--KQYVGKADFLVFRAMNQHGFLGQLQEKKL  2131
              ASAS+ LAANWP+TMQI RLI+Q+H+NN  ++ +GKA+ +VF AM+QH FLGQLQEKK 
Sbjct  509   IASASKLLAANWPQTMQIDRLITQEHLNNDVRRLIGKAEIVVFWAMDQHVFLGQLQEKKF  568

Query  2132  CAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             CAVIQL SQT++LSVSDK CRLIGMLFP +MVVFKPQI
Sbjct  569   CAVIQLSSQTMILSVSDKTCRLIGMLFPENMVVFKPQI  606



>gb|KCW76700.1| hypothetical protein EUGRSUZ_D01061 [Eucalyptus grandis]
Length=863

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/697 (56%), Positives = 479/697 (69%), Gaps = 34/697 (5%)
 Frame = +2

Query  185   EKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGS  364
             E+ LI+AV+GTAAMGP+W +IVSDYLEKI+R F G E  +Q+   +N +  LVMFNSHGS
Sbjct  27    ERSLIVAVDGTAAMGPYWKTIVSDYLEKIVRAFVGNEVPAQR---SNCDLSLVMFNSHGS  83

Query  365   YSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSP-NGNQSKQT  541
              SAC+VQRS WT+D+  FL WLS++ F GGGFNDAAIAEGL+EALMM   P NGN   Q+
Sbjct  84    LSACMVQRSAWTKDVSCFLEWLSAMSFSGGGFNDAAIAEGLSEALMMFPLPLNGNLPPQS  143

Query  542   VEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVS  721
             ++G++HC+LVAA+NPYPL TPVYRP      + E+      + L DAE VAK F QC VS
Sbjct  144   LDGKRHCVLVAATNPYPLSTPVYRPTFQ--LEDEHVETYSGKPLCDAEGVAKFFPQCCVS  201

Query  722   LSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPS  901
             LSV+CPK + KL+ IY A KRNPR AD P+DN KN ++LVLI+ENF+EAR A +R G  S
Sbjct  202   LSVICPKQLPKLRAIYNAGKRNPRAADPPVDNGKNTHFLVLIAENFLEARTALSRPGTAS  261

Query  902   LPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTVT  1081
             LPS Q+PVKMD +  PP++       AS+P  +  +++RQ +  GN  PA VK+EPTTVT
Sbjct  262   LPSNQSPVKMDTTP-PPVNSVTAQPPASVPPVS--LLSRQAVSAGNGPPAIVKVEPTTVT  318

Query  1082  SM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSVR  1258
             SM  GP F+H+PSV R  +Q V  LQTSSP SVSQ+MV NNE++Q+ KP+V  G+ Q++R
Sbjct  319   SMAAGPNFSHIPSVQRPTTQGVSALQTSSPSSVSQDMVTNNESVQDLKPVVSAGIPQTLR  378

Query  1259  PVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---LSNmissgmassvs  1414
             PV    AN  ILN+++Q RQ      L GGTSIGL SMG  PM   +SNMISSGM S+V 
Sbjct  379   PV--VPANSNILNNLSQVRQVVNSATLTGGTSIGLQSMGQNPMAMHMSNMISSGMQSTVP  436

Query  1415  aaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLP  1594
             AAQ+  SS QSG+TS+T    L+G     Q+    SF + TS+++  SN+ MSQ    L 
Sbjct  437   AAQTGYSSGQSGITSVTGPGTLSGTIPSAQNPGLGSFASATSNITGNSNIGMSQPTGNLQ  496

Query  1595  SSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqg  1774
                 +GQT PGM+Q ++ G+QM+Q   G + NMMS +G  +  PS     +         
Sbjct  497   VGPGMGQTAPGMSQGSLSGSQMVQNGVGMNPNMMSSLGPTA--PSSGSGTMMPTPGMPSQ  554

Query  1775  qqgmqpIGVNNNS----AANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITR  1942
              Q      +N NS     A+MP   QQ+SS LQSAQSKYVKVWEGNLSGQRQGQPV ITR
Sbjct  555   GQSGMS-SINGNSNPGPGASMP-LSQQSSSALQSAQSKYVKVWEGNLSGQRQGQPVLITR  612

Query  1943  LEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQE  2122
             LEGYRSASASETLAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQE
Sbjct  613   LEGYRSASASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQE  672

Query  2123  KKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVF  2233
             KKL         +  ++VSD A   +    P D   F
Sbjct  673   KKLVMC------SHSITVSDAAALCVRQGMPLDWNAF  703



>gb|ABM81545.1| phytochrome and flowering time protein 1 [Triticum aestivum]
Length=759

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/695 (53%), Positives = 471/695 (68%), Gaps = 39/695 (6%)
 Frame = +2

Query  182   AEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHG  361
             +E+QL++ VEGTAA+GP+W +I ++Y+EKI+R FC  E   QK +G   E  LV+F++HG
Sbjct  7     SERQLVVVVEGTAALGPYWPAIAAEYVEKIVRSFCSTELSGQKLAGVPPELALVVFHTHG  66

Query  362   SYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSKQ  538
              YSA +VQRSGWT+D+D FL WLS I F GGGF++AAI EGLAEALM+L  S + +Q+ Q
Sbjct  67    PYSAFIVQRSGWTKDMDAFLSWLSGISFSGGGFSEAAICEGLAEALMILQGSSSSSQNHQ  126

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
               E QKHC+LVAASNPYPLPTPVYRP + +S+  ++   T +  L+DAE VA SFAQCSV
Sbjct  127   NRELQKHCLLVAASNPYPLPTPVYRPSVQSSDHKKSNEATKESCLADAEAVAVSFAQCSV  186

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSVV PK +  LK IY A KRNP+ +D  +D+ KNP++LVL+SE+FMEAR A +     
Sbjct  187   SLSVVSPKQLPTLKAIYNAGKRNPQASDPSVDHAKNPHFLVLLSESFMEARTALSHPLPG  246

Query  899   SLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
             +L       KMD +    + GP PS  +  PS NG +M RQP        A VK+EPTT+
Sbjct  247   NLVPNHTITKMDTTPAATVPGP-PSNAS--PSVNGTMMGRQPT-------ANVKVEPTTI  296

Query  1079  TSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
               M   P F+H+  +   ASQ V  +QTSSP  +SQE    NE LQE KP+ V+ + Q V
Sbjct  297   PPMVSAPAFSHMTPISNVASQGVSAMQTSSPSIISQETNVANEILQEHKPL-VNPIQQQV  355

Query  1256  RPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPM---LSNmissgmassvsaaqs  1426
             RP G   ANV ILN+++Q R +L   TS+G  +MG TP+   +SNMISSGM S+ +   S
Sbjct  356   RPGG--PANVSILNNLSQHRHSLTAATSMG-PNMGATPIQVHMSNMISSGMTSTPAVISS  412

Query  1427  visssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSSVS  1606
             +  + Q          P+ G  Q+ Q++A  SF + TS++S  SN+ +S S+  + S+++
Sbjct  413   ISGTVQ----------PI-GAQQLAQNTALGSFGSNTSTVSCNSNIAVSSSLANIQSNMA  461

Query  1607  VGQTVPGMNQAN-MPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqg  1783
             +GQ+VP M Q   M G Q  Q   G +QNM++ +G      +   T    P      Q G
Sbjct  462   MGQSVPSMAQGGLMAGPQSGQGGIGTNQNMINNLGTT----AINSTPTMMPTPGMVQQTG  517

Query  1784  mqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSA  1963
             +  +  NN+SA NMPL             SKYVK+WEG LSGQRQGQPVFI +LEGYRS 
Sbjct  518   VNALSANNSSAMNMPL----AQHPNGQQPSKYVKIWEGTLSGQRQGQPVFICKLEGYRSG  573

Query  1964  SASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVI  2143
             +AS TLA++WPETMQIVRLI+Q+HMNNKQYVGKADFLVFR +NQHGFLGQLQEKKLCAVI
Sbjct  574   TASGTLASDWPETMQIVRLIAQEHMNNKQYVGKADFLVFRTLNQHGFLGQLQEKKLCAVI  633

Query  2144  QLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIT  2248
             QLPSQTLLLSVSDKA RLIGMLFPGDMVVFKPQ++
Sbjct  634   QLPSQTLLLSVSDKAGRLIGMLFPGDMVVFKPQVS  668



>ref|XP_009782377.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Nicotiana sylvestris]
Length=731

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/646 (58%), Positives = 464/646 (72%), Gaps = 48/646 (7%)
 Frame = +2

Query  338   LVMFNSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSP  517
             +V+F  HGS+ ACLV+RSGWT DID+F  WLS+I F GGGFNDAA+AE LAEAL M SS 
Sbjct  1     MVVFTVHGSHGACLVRRSGWTTDIDMFFQWLSAIPFSGGGFNDAAVAESLAEALTMFSSL  60

Query  518   NGNQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAK  697
             NG+Q++Q V+GQ+HCIL+AASNPYPLPTPVY P + N EQS N       RLSDAETVAK
Sbjct  61    NGSQTQQNVDGQRHCILIAASNPYPLPTPVYHPHMQNVEQSGNIEAHTANRLSDAETVAK  120

Query  698   SFAQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAA  877
              F QCSVSLSV+CPK + KL+ IY A KR+P+ AD PID  KNP +LVLISENF+EA AA
Sbjct  121   EFPQCSVSLSVICPKQLPKLRAIYNAGKRDPQAADPPIDTSKNPNFLVLISENFIEACAA  180

Query  878   FNRTGMPSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATV  1057
             FNRTGM      Q  V+MD+SSV P+S P         + +  VM++QPI  G+I  ATV
Sbjct  181   FNRTGMEISALNQILVEMDMSSVAPVSAP-------AATFDPAVMSQQPISAGSIPSATV  233

Query  1058  KIEPTTVTSMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVH  1237
              +EPTTVTS+ GP   H+P+  R  SQ V +LQ++SPISVS+E+V NNE + ETKP ++ 
Sbjct  234   NMEPTTVTSVTGPALPHIPTA-RPTSQLVASLQSASPISVSEEVVPNNEIVNETKP-ILS  291

Query  1238  GMGQSVRPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPMLSNmissgmassvsa  1417
             GM Q +R    AAAN RILNDVAQA QAL GGTSIGL SMGGTP+LSNMI  G++SS+ A
Sbjct  292   GMTQPLRSFSGAAANARILNDVAQA-QALVGGTSIGLQSMGGTPILSNMIPGGISSSIPA  350

Query  1418  aqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPS  1597
             A +V+SS Q  VTSM+  +PLAG GQ+ Q+S                             
Sbjct  351   APTVLSSGQLAVTSMSGLVPLAGTGQIAQNS----------------------------V  382

Query  1598  SVSVGQTVPGMN-QANMPGTQMMQTATG-----RSQNMMSGMGGASGIPSgtgtmvptpg  1759
             S S     P M+  +N+  +Q++    G       QN++SG G  +G+P GTGT++ TP 
Sbjct  383   SASSVSIAPSMSGNSNLCVSQLLSNIQGGVSAVMHQNVLSGTG--AGMPFGTGTLMSTPR  440

Query  1760  mtqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFIT  1939
             MTQ G  GMQP+G NN++ AN+PLSQ+QTS+ L SAQS YVKVWEG+LSGQRQG+PV IT
Sbjct  441   MTQPGHPGMQPLGRNNSTEANIPLSQRQTSATLSSAQSNYVKVWEGDLSGQRQGEPVLIT  500

Query  1940  RLEGYRSASASETLAANWPETMQIVRLISQDHMNN--KQYVGKADFLVFRAMNQHGFLGQ  2113
             RL+G+R ASAS++LAA+WP+TMQIVRLI+Q+H+NN  ++ +GKA+ +VF AM+QH FL Q
Sbjct  501   RLQGFRIASASKSLAADWPQTMQIVRLITQEHLNNDVRRLIGKAEIVVFWAMDQHVFLSQ  560

Query  2114  LQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             LQEKK CAVIQLPSQ ++LSVSDK CRLIGMLFP + VVFKPQ  N
Sbjct  561   LQEKKFCAVIQLPSQAMILSVSDKTCRLIGMLFPENTVVFKPQKLN  606



>gb|KDO70072.1| hypothetical protein CISIN_1g003284mg [Citrus sinensis]
Length=619

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/600 (65%), Positives = 466/600 (78%), Gaps = 19/600 (3%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             M+EKQLI+AVEGTAAMGP+W SIVSDYLEKIIRCFC  E   QK S +NVE  LV FN+H
Sbjct  1     MSEKQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQKTSASNVELSLVTFNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSK  535
             GSY ACLVQRSGWT+D+D+FLHWLS+I F GGGFNDAAIAEGL+EALMM S +PNG+Q++
Sbjct  61    GSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSVAPNGSQNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q V+GQ+HCILVAASNP+PLPTPVYRPQ+ N +Q+EN     + RLSDAETVAKSF QCS
Sbjct  121   QNVDGQRHCILVAASNPHPLPTPVYRPQMQNLDQNENNEAQAESRLSDAETVAKSFVQCS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK + KL  IY AAKRNPR AD P+DN KNP++LVLISENFMEARAA +R G+
Sbjct  181   VSLSVICPKQLPKLTAIYNAAKRNPRAADPPVDNSKNPHFLVLISENFMEARAALSRPGV  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              +L   QNPVKMD++ V  ++GP P+   SIPS NG  +NR PI  GN+  ATVK+EP+T
Sbjct  241   ANLAPNQNPVKMDIAPVTSVTGPAPT---SIPSVNG--INRPPISVGNVPTATVKVEPST  295

Query  1076  VTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             VTSM  GPTF H+PSVPR ASQ V +LQTSSP S SQEM+ + +++ E KP+ V GM Q 
Sbjct  296   VTSMVNGPTFPHIPSVPRPASQGVPSLQTSSPSSTSQEMITSGDSVPEVKPL-VSGMSQP  354

Query  1253  VRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---LSNmissgmass  1408
             +RP+  AAANV ILN+++QARQ     AL GGTSIGL SMG TPM   +SNMISSGMASS
Sbjct  355   LRPMAPAAANVNILNNLSQARQVMNNAALTGGTSIGLQSMGQTPMAMHMSNMISSGMASS  414

Query  1409  vsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNT  1588
             V  +Q V SS+QSG+TS+  S  L G  QV Q+S   SFT+  S++S  SN  +SQ M T
Sbjct  415   VPTSQPVFSSAQSGITSIGGSGTLTGTSQVPQNSGLNSFTSAPSNLSGNSNPSISQPMGT  474

Query  1589  LPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtq  1768
             L    S+GQ+V GM+Q N  G QM+Q     +QNMMSG+ G SG+ SGTGTM+PTPGM+Q
Sbjct  475   LQGGASMGQSV-GMSQGNHSGGQMVQNGISMNQNMMSGL-GPSGVSSGTGTMIPTPGMSQ  532

Query  1769  qgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLE  1948
             Q Q GMQP+ VNNN+A NM L  QQTSS L S+QSKYVKVWEG+LSGQRQGQPVFIT+LE
Sbjct  533   QAQSGMQPLSVNNNTAVNMQL-SQQTSSALHSSQSKYVKVWEGSLSGQRQGQPVFITKLE  591



>gb|KHN25577.1| Mediator of RNA polymerase II transcription subunit 25 [Glycine 
soja]
Length=963

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/636 (64%), Positives = 478/636 (75%), Gaps = 24/636 (4%)
 Frame = +2

Query  368   SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSKQTV  544
             S CLVQRSGWTRD D+F  WLSSI F GGGFNDAAIAEGL+EALMML  S +G  ++Q+V
Sbjct  195   SCCLVQRSGWTRDPDVFFLWLSSIPFNGGGFNDAAIAEGLSEALMMLWISQSGAPNQQSV  254

Query  545   EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
             +  KHCILVAASNPYPL TPVY P+  N EQSE         L DAE VAK+F Q S+SL
Sbjct  255   DMHKHCILVAASNPYPLQTPVYVPRPQNLEQSETIDLDSGSHLYDAEAVAKAFPQFSISL  314

Query  725   SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSL  904
             SV+CPK + K+KTIY A KRN R AD P++  K P++L+LISE F EA  A +R+G+ SL
Sbjct  315   SVICPKQLPKIKTIYNAGKRNNRAADSPLE-AKTPHFLILISEGFREAWGALSRSGITSL  373

Query  905   PSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTVTS  1084
             PS Q+PVK+D  SV P++   P+   S+P  NG + NRQP+P GN+ PATVK+EP  V S
Sbjct  374   PSNQSPVKVDAVSVTPVTEAPPT---SMP-VNGSIPNRQPVPAGNVAPATVKVEPVLVAS  429

Query  1085  M-PGPTFAHVPSVPRAAS--QPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
             M  GP F H  SVPRA S  Q V +LQTSS  SVSQ+++ NNEN Q+TKP V       +
Sbjct  430   MVSGPAFPHNSSVPRATSTSQGVPSLQTSSLSSVSQDIITNNENAQDTKPTVSM---LPL  486

Query  1256  RPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---LSNmissgmassv  1411
             RPV  A ANV ILN+++ ARQ     AL+GGTS+GL SM  TP+   +SNMISSGM SSV
Sbjct  487   RPVNPAQANVNILNNLSIARQVMNSAALSGGTSMGLPSMSQTPVAMHMSNMISSGMTSSV  546

Query  1412  saaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTL  1591
              AAQ+V SS QSG+TSMTSS PL GP QV Q+S   S T+ TS++SS+SN+ +SQ +  L
Sbjct  547   PAAQNVFSSGQSGITSMTSSGPLTGPAQVGQNSGLGSLTSNTSNLSSSSNIGISQPLGNL  606

Query  1592  PSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqq  1771
               +VS+GQ V GM+Q N+ G QM+Q     +QN+MSG+G  S + SGTGTM+PTPGM+Q 
Sbjct  607   QGAVSMGQQVSGMSQGNLSGAQMVQGGVNMNQNVMSGLG-QSVVSSGTGTMIPTPGMSQP  665

Query  1772  gqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEG  1951
              Q GMQP+   NN+A NMPLSQQ +     +   KYVKVWEG+LSGQRQGQPVFIT+LEG
Sbjct  666   VQSGMQPL--VNNAATNMPLSQQTSGGMQSAQS-KYVKVWEGSLSGQRQGQPVFITKLEG  722

Query  1952  YRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKL  2131
             YR++SASETLAANWP  MQIVRLISQDHMNNKQYVGKADFLVFRAMN HGFLGQLQEKKL
Sbjct  723   YRNSSASETLAANWPPVMQIVRLISQDHMNNKQYVGKADFLVFRAMNPHGFLGQLQEKKL  782

Query  2132  CAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  2239
             CAVIQLPSQTLLLSVSDKA RLIGMLFPGDMVVFKP
Sbjct  783   CAVIQLPSQTLLLSVSDKAFRLIGMLFPGDMVVFKP  818



>ref|XP_008670123.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Zea mays]
Length=885

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/706 (52%), Positives = 470/706 (67%), Gaps = 54/706 (8%)
 Frame = +2

Query  182   AEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHG  361
             A++QL++AVEGTAA+GP+W++IV++Y+EKI+R FC +E   QK  G   E  LV+F++HG
Sbjct  4     ADRQLVVAVEGTAALGPYWSTIVAEYVEKIVRSFCASELPGQKLVGTPPELALVVFHTHG  63

Query  362   SYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSKQ  538
              YSA  VQRSGWT+D+D FL WLS I F GGGF++A+  EGLAEAL +L  +PN  Q  Q
Sbjct  64    PYSAFDVQRSGWTKDVDAFLSWLSGILFSGGGFSEASTCEGLAEALKILQGNPNTTQGHQ  123

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
               E QKHCILVAASNPYPLPTPVY     +++  EN   + +  ++DAETVAKSFAQCSV
Sbjct  124   NHEAQKHCILVAASNPYPLPTPVYCLPTQSTDHKENIETSKEPSIADAETVAKSFAQCSV  183

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSV+ PK +  LK IY A KRN R AD  +D+ KNP++LVL+SENFMEAR A +R    
Sbjct  184   SLSVISPKQLPTLKAIYNAGKRNLRAADPSVDHAKNPHFLVLLSENFMEARTALSRPLHG  243

Query  899   SLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
             +L   Q   KMD +    + GP  +G +S+ +  G    RQPI  G I   +VK+EPTT+
Sbjct  244   NLAPNQTITKMDTAPAVTMPGPTSNGNSSVNAMAG----RQPI-VGGISTTSVKVEPTTM  298

Query  1079  TSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
               +   P F+HV  +   ASQ +  LQTSSP  +SQE    N+N+QE KP +++ + Q +
Sbjct  299   PPIVSAPAFSHVTPISNVASQGISALQTSSPSLISQEANMGNDNVQEHKP-IINPVQQPI  357

Query  1256  RPVGAAAANVRILNDVAQAR----QALAGG-TSIGLSSMGGTPM---LSNmissgmassv  1411
             RP G  +    +LN+++Q R     +L GG TS+GL +MG TP+   +SNMISSGM S+ 
Sbjct  358   RPGGHGS----LLNNLSQVRLMNSTSLGGGATSMGLPNMGATPIQVHMSNMISSGMTSTP  413

Query  1412  saaqsvisssqsgvtsmtssMPLAGPG------QVVQssaptsftattssmsstsnlvms  1573
             S   S                 ++GPG      Q+VQS+A  SF + T +++  S + +S
Sbjct  414   SVISS-----------------MSGPGQPISTQQMVQSTALGSFGSNTPTVTGNSTIAVS  456

Query  1574  qsmNTLPSSVSVGQTVPGMNQANM-PGTQMMQTATGRSQNMMSGMG--GASGIPSgtgtm  1744
              S+    SS+ +GQ+V  + Q  +  G+Q+ Q     +QN+MS +G    S  P+     
Sbjct  457   SSLTNNQSSMGMGQSVQSVAQGGLVSGSQLGQGGIVANQNVMSTLGPTAISSTPA-----  511

Query  1745  vptpgmtqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQ  1924
                P      Q G+  +GVNNNSA NMP+   Q  +  Q    KYVK+WEG LSGQRQGQ
Sbjct  512   -MMPTPGMVPQTGVNSLGVNNNSAMNMPI--TQQHANAQQPPPKYVKIWEGTLSGQRQGQ  568

Query  1925  PVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGF  2104
             PV I +LEGYRS +ASETLAA+WPETMQIVRLI+Q+HMNNKQYVGKADFLVFR +N HGF
Sbjct  569   PVIICKLEGYRSGTASETLAADWPETMQIVRLIAQEHMNNKQYVGKADFLVFRTLNHHGF  628

Query  2105  LGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQ  2242
             L QLQEKKLCAVIQLPSQTLLLS++DKA RLIGMLFPGDMVVFKPQ
Sbjct  629   LVQLQEKKLCAVIQLPSQTLLLSMADKAGRLIGMLFPGDMVVFKPQ  674



>tpg|DAA39874.1| TPA: hypothetical protein ZEAMMB73_491348 [Zea mays]
Length=880

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/706 (51%), Positives = 467/706 (66%), Gaps = 59/706 (8%)
 Frame = +2

Query  182   AEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHG  361
             A++QL++AVEGTAA+GP+W++IV++Y+EKI+R FC +E   QK  G   E  LV+F++HG
Sbjct  4     ADRQLVVAVEGTAALGPYWSTIVAEYVEKIVRSFCASELPGQKLVGTPPELALVVFHTHG  63

Query  362   SYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSKQ  538
              YSA  VQRSGWT+D+D FL WLS I F GGGF++A+  EGLAEAL +L  +PN  Q  Q
Sbjct  64    PYSAFDVQRSGWTKDVDAFLSWLSGILFSGGGFSEASTCEGLAEALKILQGNPNTTQGHQ  123

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
               E QKHCILVAASNPYPLPTPVY     +++  EN   + +  ++DAETVAKSFAQCSV
Sbjct  124   NHEAQKHCILVAASNPYPLPTPVYCLPTQSTDHKENIETSKEPSIADAETVAKSFAQCSV  183

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSV+ PK +  LK IY A KRN R AD  +D+ KNP++LVL+SENFMEAR A +R    
Sbjct  184   SLSVISPKQLPTLKAIYNAGKRNLRAADPSVDHAKNPHFLVLLSENFMEARTALSRPLHG  243

Query  899   SLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
             +L   Q   KMD +    + G         P++NG    RQPI  G I   +VK+EPTT+
Sbjct  244   NLAPNQTITKMDTAPAVTMPG---------PTSNGNSSGRQPI-VGGISTTSVKVEPTTM  293

Query  1079  TSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
               +   P F+HV  +   ASQ +  LQTSSP  +SQE    N+N+QE KP +++ + Q +
Sbjct  294   PPIVSAPAFSHVTPISNVASQGISALQTSSPSLISQEANMGNDNVQEHKP-IINPVQQPI  352

Query  1256  RPVGAAAANVRILNDVAQAR----QALAGG-TSIGLSSMGGTPM---LSNmissgmassv  1411
             RP G  +    +LN+++Q R     +L GG TS+GL +MG TP+   +SNMISSGM S+ 
Sbjct  353   RPGGHGS----LLNNLSQVRLMNSTSLGGGATSMGLPNMGATPIQVHMSNMISSGMTSTP  408

Query  1412  saaqsvisssqsgvtsmtssMPLAGPG------QVVQssaptsftattssmsstsnlvms  1573
             S   S                 ++GPG      Q+VQS+A  SF + T +++  S + +S
Sbjct  409   SVISS-----------------MSGPGQPISTQQMVQSTALGSFGSNTPTVTGNSTIAVS  451

Query  1574  qsmNTLPSSVSVGQTVPGMNQANM-PGTQMMQTATGRSQNMMSGMG--GASGIPSgtgtm  1744
              S+    SS+ +GQ+V  + Q  +  G+Q+ Q     +QN+MS +G    S  P+     
Sbjct  452   SSLTNNQSSMGMGQSVQSVAQGGLVSGSQLGQGGIVANQNVMSTLGPTAISSTPA-----  506

Query  1745  vptpgmtqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQ  1924
                P      Q G+  +GVNNNSA NMP+   Q  +  Q    KYVK+WEG LSGQRQGQ
Sbjct  507   -MMPTPGMVPQTGVNSLGVNNNSAMNMPI--TQQHANAQQPPPKYVKIWEGTLSGQRQGQ  563

Query  1925  PVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGF  2104
             PV I +LEGYRS +ASETLAA+WPETMQIVRLI+Q+HMNNKQYVGKADFLVFR +N HGF
Sbjct  564   PVIICKLEGYRSGTASETLAADWPETMQIVRLIAQEHMNNKQYVGKADFLVFRTLNHHGF  623

Query  2105  LGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQ  2242
             L QLQEKKLCAVIQLPSQTLLLS++DKA RLIGMLFPGDMVVFKPQ
Sbjct  624   LVQLQEKKLCAVIQLPSQTLLLSMADKAGRLIGMLFPGDMVVFKPQ  669



>ref|XP_010923566.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X3 [Elaeis guineensis]
Length=762

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/701 (53%), Positives = 462/701 (66%), Gaps = 84/701 (12%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEKQLI+AVEGTAA+GP+W +I+SDYL+KIIR F G                       
Sbjct  1     MAEKQLIVAVEGTAALGPYWQTILSDYLDKIIRSFLGH----------------------  38

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQ  538
                    +Q           L WLSSI        D  +        M   +PN +QS Q
Sbjct  39    -------IQS----------LRWLSSI------LMDLTV--------MFPFTPNVSQSHQ  67

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
              +E QKHCILVAASNPYPLPTPVYRP + + E  EN     +  L+DAETVAKSF QC V
Sbjct  68    NLEAQKHCILVAASNPYPLPTPVYRPAM-SLEHPENAEAQTEAGLADAETVAKSFGQCCV  126

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSV+ PK + KL++IY A KRNPR  D  +D+ KNP +LVL+SENFMEARAA +R  + 
Sbjct  127   SLSVISPKQLPKLRSIYNAGKRNPRAVDPAVDHVKNPQFLVLLSENFMEARAALSRPLLG  186

Query  899   SLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
             SL S Q  VK+D +S  PI GP  +     P+ NG ++NR P+  GN+  ATVK+EPTTV
Sbjct  187   SLSSNQGVVKLDGASAAPIPGPSTNN----PTVNGSMINRPPVTVGNVPTATVKMEPTTV  242

Query  1079  TSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
              SM  GP F H+PS+   A+Q V NLQ S+P   SQEM ANN+ +QE KP+ V+ + QS+
Sbjct  243   PSMVSGPAFPHMPSISTVATQGVANLQNSAPSPTSQEMGANNDGVQEIKPL-VNPISQSL  301

Query  1256  RPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---LSNmissgmassv  1411
             RPVG   ANV ILN+++Q RQ     ++AG +SIGL +MG TPM   +SNMISSGMASS 
Sbjct  302   RPVGPTPANVSILNNLSQHRQMMTSASIAGASSIGLQTMGATPMAMHMSNMISSGMASSA  361

Query  1412  saaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTL  1591
              +  + ++ S           PL    QV Q+SA  SF + TS+MS  SN+ +S ++  L
Sbjct  362   MSGITSVAGSG----------PLMATAQVAQNSALGSFASATSNMSGNSNIGISPALANL  411

Query  1592  PSSVSVGQTVPGMNQANMPGT-QMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtq  1768
               ++ +G +VPG+ Q ++  + Q+ Q   G +QN+M+ +G  S     +G     P    
Sbjct  412   QGNIGMGTSVPGVGQGSLASSAQIGQGGIGMNQNIMNNLGPTS---ISSGPGTMIPTPGM  468

Query  1769  qgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLE  1948
               Q G+  +GV+NNS  +MP+   Q +S +Q A SKYVK+WEG LSGQRQGQPVFI +LE
Sbjct  469   SQQAGLHSLGVSNNSTMSMPV--SQHASNVQQAPSKYVKIWEGALSGQRQGQPVFICKLE  526

Query  1949  GYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  2128
             GYRSASASETLAA+WP TMQIVRLI+Q+HMNNKQYVGKADFLVFR +NQHGFLGQLQEKK
Sbjct  527   GYRSASASETLAADWPLTMQIVRLIAQEHMNNKQYVGKADFLVFRTLNQHGFLGQLQEKK  586

Query  2129  LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             LCAVIQLPSQTLLLSVSDKA RLIGMLFPGDMVVFKPQ+++
Sbjct  587   LCAVIQLPSQTLLLSVSDKAGRLIGMLFPGDMVVFKPQVSS  627



>tpg|DAA39875.1| TPA: hypothetical protein ZEAMMB73_491348 [Zea mays]
Length=915

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/741 (49%), Positives = 467/741 (63%), Gaps = 94/741 (13%)
 Frame = +2

Query  182   AEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHG  361
             A++QL++AVEGTAA+GP+W++IV++Y+EKI+R FC +E   QK  G   E  LV+F++HG
Sbjct  4     ADRQLVVAVEGTAALGPYWSTIVAEYVEKIVRSFCASELPGQKLVGTPPELALVVFHTHG  63

Query  362   SYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSKQ  538
              YSA  VQRSGWT+D+D FL WLS I F GGGF++A+  EGLAEAL +L  +PN  Q  Q
Sbjct  64    PYSAFDVQRSGWTKDVDAFLSWLSGILFSGGGFSEASTCEGLAEALKILQGNPNTTQGHQ  123

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
               E QKHCILVAASNPYPLPTPVY     +++  EN   + +  ++DAETVAKSFAQCSV
Sbjct  124   NHEAQKHCILVAASNPYPLPTPVYCLPTQSTDHKENIETSKEPSIADAETVAKSFAQCSV  183

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSV+ PK +  LK IY A KRN R AD  +D+ KNP++LVL+SENFMEAR A +R    
Sbjct  184   SLSVISPKQLPTLKAIYNAGKRNLRAADPSVDHAKNPHFLVLLSENFMEARTALSRPLHG  243

Query  899   SLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
             +L   Q   KMD +    + G         P++NG    RQPI  G I   +VK+EPTT+
Sbjct  244   NLAPNQTITKMDTAPAVTMPG---------PTSNGNSSGRQPI-VGGISTTSVKVEPTTM  293

Query  1079  TSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
               +   P F+HV  +   ASQ +  LQTSSP  +SQE    N+N+QE KP +++ + Q +
Sbjct  294   PPIVSAPAFSHVTPISNVASQGISALQTSSPSLISQEANMGNDNVQEHKP-IINPVQQPI  352

Query  1256  RPVGAAAANVRILNDVAQAR----QALAGG-TSIGLSSMGGTPM---LSNmissgmassv  1411
             RP G  +    +LN+++Q R     +L GG TS+GL +MG TP+   +SNMISSGM S+ 
Sbjct  353   RPGGHGS----LLNNLSQVRLMNSTSLGGGATSMGLPNMGATPIQVHMSNMISSGMTSTP  408

Query  1412  saaqsvisssqsgvtsmtssMPLAGPG------QVVQssaptsftattssmsstsnlvms  1573
             S   S                 ++GPG      Q+VQS+A  SF + T +++  S + +S
Sbjct  409   SVISS-----------------MSGPGQPISTQQMVQSTALGSFGSNTPTVTGNSTIAVS  451

Query  1574  qsmNTLPSSVSVGQTVPGMNQANM-PGTQMMQTATGRSQNMMSGMG--GASGIPSgtgtm  1744
              S+    SS+ +GQ+V  + Q  +  G+Q+ Q     +QN+MS +G    S  P+     
Sbjct  452   SSLTNNQSSMGMGQSVQSVAQGGLVSGSQLGQGGIVANQNVMSTLGPTAISSTPA-----  506

Query  1745  vptpgmtqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQ  1924
                P      Q G+  +GVNNNSA NMP+   Q  +  Q    KYVK+WEG LSGQRQGQ
Sbjct  507   -MMPTPGMVPQTGVNSLGVNNNSAMNMPI--TQQHANAQQPPPKYVKIWEGTLSGQRQGQ  563

Query  1925  PVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGF  2104
             PV I +LEGYRS +ASETLAA+WPETMQIVRLI+Q+HMNNKQYVGKADFLVFR +N HGF
Sbjct  564   PVIICKLEGYRSGTASETLAADWPETMQIVRLIAQEHMNNKQYVGKADFLVFRTLNHHGF  623

Query  2105  LGQLQEKKL-----------------------------------CAVIQLPSQTLLLSVS  2179
             L QLQEKKL                                   CAVIQLPSQTLLLS++
Sbjct  624   LVQLQEKKLSNFVILLRFIYCRFIHLVFCQLLYTVLISNWSWFQCAVIQLPSQTLLLSMA  683

Query  2180  DKACRLIGMLFPGDMVVFKPQ  2242
             DKA RLIGMLFPGDMVVFKPQ
Sbjct  684   DKAGRLIGMLFPGDMVVFKPQ  704



>ref|XP_008670124.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Zea mays]
Length=861

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/706 (50%), Positives = 455/706 (64%), Gaps = 78/706 (11%)
 Frame = +2

Query  182   AEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHG  361
             A++QL++AVEGTAA+GP+W++IV++Y+EKI+R FC +E   QK                 
Sbjct  4     ADRQLVVAVEGTAALGPYWSTIVAEYVEKIVRSFCASELPGQK-----------------  46

Query  362   SYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSKQ  538
                     RSGWT+D+D FL WLS I F GGGF++A+  EGLAEAL +L  +PN  Q  Q
Sbjct  47    -------LRSGWTKDVDAFLSWLSGILFSGGGFSEASTCEGLAEALKILQGNPNTTQGHQ  99

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
               E QKHCILVAASNPYPLPTPVY     +++  EN   + +  ++DAETVAKSFAQCSV
Sbjct  100   NHEAQKHCILVAASNPYPLPTPVYCLPTQSTDHKENIETSKEPSIADAETVAKSFAQCSV  159

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSV+ PK +  LK IY A KRN R AD  +D+ KNP++LVL+SENFMEAR A +R    
Sbjct  160   SLSVISPKQLPTLKAIYNAGKRNLRAADPSVDHAKNPHFLVLLSENFMEARTALSRPLHG  219

Query  899   SLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
             +L   Q   KMD +    + GP  +G +S+ +  G    RQPI  G I   +VK+EPTT+
Sbjct  220   NLAPNQTITKMDTAPAVTMPGPTSNGNSSVNAMAG----RQPI-VGGISTTSVKVEPTTM  274

Query  1079  TSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
               +   P F+HV  +   ASQ +  LQTSSP  +SQE    N+N+QE KP +++ + Q +
Sbjct  275   PPIVSAPAFSHVTPISNVASQGISALQTSSPSLISQEANMGNDNVQEHKP-IINPVQQPI  333

Query  1256  RPVGAAAANVRILNDVAQAR----QALAGG-TSIGLSSMGGTPM---LSNmissgmassv  1411
             RP G  +    +LN+++Q R     +L GG TS+GL +MG TP+   +SNMISSGM S+ 
Sbjct  334   RPGGHGS----LLNNLSQVRLMNSTSLGGGATSMGLPNMGATPIQVHMSNMISSGMTSTP  389

Query  1412  saaqsvisssqsgvtsmtssMPLAGPG------QVVQssaptsftattssmsstsnlvms  1573
             S   S                 ++GPG      Q+VQS+A  SF + T +++  S + +S
Sbjct  390   SVISS-----------------MSGPGQPISTQQMVQSTALGSFGSNTPTVTGNSTIAVS  432

Query  1574  qsmNTLPSSVSVGQTVPGMNQANM-PGTQMMQTATGRSQNMMSGMG--GASGIPSgtgtm  1744
              S+    SS+ +GQ+V  + Q  +  G+Q+ Q     +QN+MS +G    S  P+     
Sbjct  433   SSLTNNQSSMGMGQSVQSVAQGGLVSGSQLGQGGIVANQNVMSTLGPTAISSTPA-----  487

Query  1745  vptpgmtqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQ  1924
                P      Q G+  +GVNNNSA NMP+   Q  +  Q    KYVK+WEG LSGQRQGQ
Sbjct  488   -MMPTPGMVPQTGVNSLGVNNNSAMNMPI--TQQHANAQQPPPKYVKIWEGTLSGQRQGQ  544

Query  1925  PVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGF  2104
             PV I +LEGYRS +ASETLAA+WPETMQIVRLI+Q+HMNNKQYVGKADFLVFR +N HGF
Sbjct  545   PVIICKLEGYRSGTASETLAADWPETMQIVRLIAQEHMNNKQYVGKADFLVFRTLNHHGF  604

Query  2105  LGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQ  2242
             L QLQEKKLCAVIQLPSQTLLLS++DKA RLIGMLFPGDMVVFKPQ
Sbjct  605   LVQLQEKKLCAVIQLPSQTLLLSMADKAGRLIGMLFPGDMVVFKPQ  650



>ref|XP_006573257.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X3 [Glycine max]
Length=725

 Score =   528 bits (1359),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 367/592 (62%), Positives = 440/592 (74%), Gaps = 23/592 (4%)
 Frame = +2

Query  497   LMMLSSPNGNQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLS  676
             +M+  S +G  ++Q+V+  KHCILVAASNPYPL TPVY P+  N EQSE         L 
Sbjct  1     MMLWISQSGAPNQQSVDMHKHCILVAASNPYPLQTPVYVPRPQNLEQSETIDLDSGSHLY  60

Query  677   DAETVAKSFAQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISEN  856
             DAE VAK+F Q S+SLSV+CPK + K+KTIY A KRN R AD P++  K P++L+LISE 
Sbjct  61    DAEAVAKAFPQFSISLSVICPKQLPKIKTIYNAGKRNNRAADSPLE-AKTPHFLILISEG  119

Query  857   FMEARAAFNRTGMPSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTG  1036
             F EA  A +R+G+ SLPS Q+PVK+D  SV P++   P+   S+P  NG + NRQP+P G
Sbjct  120   FREAWGALSRSGITSLPSNQSPVKVDAVSVTPVTEAPPT---SMP-VNGSIPNRQPVPAG  175

Query  1037  NIHPATVKIEPTTVTSM-PGPTFAHVPSVPRAAS--QPVQNLQTSSPISVSQEMVANNEN  1207
             N+ PATVK+EP  V SM  GP F H  SVPRA S  Q V +LQTSS  SVSQ+++ NNEN
Sbjct  176   NVAPATVKVEPVLVASMVSGPAFPHNSSVPRATSTSQGVPSLQTSSLSSVSQDIITNNEN  235

Query  1208  LQETKPMVVHGMGQSVRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM  1372
              Q+TKP V       +RPV  A ANV ILN+++ ARQ     AL+GGTS+GL SM  TP+
Sbjct  236   AQDTKPTVSM---LPLRPVNPAQANVNILNNLSIARQVMNSAALSGGTSMGLPSMSQTPV  292

Query  1373  ---LSNmissgmassvsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattss  1543
                +SNMISSGM SSV AAQ+V SS QSG+TSMTSS PL GP QV Q+S   S T+ TS+
Sbjct  293   AMHMSNMISSGMTSSVPAAQNVFSSGQSGITSMTSSGPLTGPAQVGQNSGLGSLTSNTSN  352

Query  1544  msstsnlvmsqsmNTLPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGI  1723
             +SS+SN+ +SQ +  L  +VS+GQ V GM+Q N+ G QM+Q     +QN+MSG+G  S +
Sbjct  353   LSSSSNIGISQPLGNLQGAVSMGQQVSGMSQGNLSGAQMVQGGVNMNQNVMSGLG-QSVV  411

Query  1724  PSgtgtmvptpgmtqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNL  1903
              SGTGTM+PTPGM+Q  Q GMQP+   NN+A NMPLSQQ +     +   KYVKVWEG+L
Sbjct  412   SSGTGTMIPTPGMSQPVQSGMQPL--VNNAATNMPLSQQTSGGMQSAQS-KYVKVWEGSL  468

Query  1904  SGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFR  2083
             SGQRQGQPVFIT+LEGYR++SASETLAANWP  MQIVRLISQDHMNNKQYVGKADFLVFR
Sbjct  469   SGQRQGQPVFITKLEGYRNSSASETLAANWPPVMQIVRLISQDHMNNKQYVGKADFLVFR  528

Query  2084  AMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  2239
             AMN HGFLGQLQEKKLCAVIQLPSQTLLLSVSDKA RLIGMLFPGDMVVFKP
Sbjct  529   AMNPHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKAFRLIGMLFPGDMVVFKP  580



>ref|XP_010923574.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X4 [Elaeis guineensis]
Length=713

 Score =   524 bits (1350),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 333/595 (56%), Positives = 419/595 (70%), Gaps = 31/595 (5%)
 Frame = +2

Query  497   LMMLSSPNGNQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLS  676
             +M   +PN +QS Q +E QKHCILVAASNPYPLPTPVYRP + + E  EN     +  L+
Sbjct  5     VMFPFTPNVSQSHQNLEAQKHCILVAASNPYPLPTPVYRPAM-SLEHPENAEAQTEAGLA  63

Query  677   DAETVAKSFAQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISEN  856
             DAETVAKSF QC VSLSV+ PK + KL++IY A KRNPR  D  +D+ KNP +LVL+SEN
Sbjct  64    DAETVAKSFGQCCVSLSVISPKQLPKLRSIYNAGKRNPRAVDPAVDHVKNPQFLVLLSEN  123

Query  857   FMEARAAFNRTGMPSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTG  1036
             FMEARAA +R  + SL S Q  VK+D +S  PI GP  +     P+ NG ++NR P+  G
Sbjct  124   FMEARAALSRPLLGSLSSNQGVVKLDGASAAPIPGPSTNN----PTVNGSMINRPPVTVG  179

Query  1037  NIHPATVKIEPTTVTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQ  1213
             N+  ATVK+EPTTV SM  GP F H+PS+   A+Q V NLQ S+P   SQEM ANN+ +Q
Sbjct  180   NVPTATVKMEPTTVPSMVSGPAFPHMPSISTVATQGVANLQNSAPSPTSQEMGANNDGVQ  239

Query  1214  ETKPMVVHGMGQSVRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM--  1372
             E KP+ V+ + QS+RPVG   ANV ILN+++Q RQ     ++AG +SIGL +MG TPM  
Sbjct  240   EIKPL-VNPISQSLRPVGPTPANVSILNNLSQHRQMMTSASIAGASSIGLQTMGATPMAM  298

Query  1373  -LSNmissgmassvsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssms  1549
              +SNMISSGMASS  +  + ++ S           PL    QV Q+SA  SF + TS+MS
Sbjct  299   HMSNMISSGMASSAMSGITSVAGSG----------PLMATAQVAQNSALGSFASATSNMS  348

Query  1550  stsnlvmsqsmNTLPSSVSVGQTVPGMNQANMPGT-QMMQTATGRSQNMMSGMGGASGIP  1726
               SN+ +S ++  L  ++ +G +VPG+ Q ++  + Q+ Q   G +QN+M+ +G  S   
Sbjct  349   GNSNIGISPALANLQGNIGMGTSVPGVGQGSLASSAQIGQGGIGMNQNIMNNLGPTS---  405

Query  1727  SgtgtmvptpgmtqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLS  1906
               +G     P      Q G+  +GV+NNS  +MP+   Q +S +Q A SKYVK+WEG LS
Sbjct  406   ISSGPGTMIPTPGMSQQAGLHSLGVSNNSTMSMPV--SQHASNVQQAPSKYVKIWEGALS  463

Query  1907  GQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRA  2086
             GQRQGQPVFI +LEGYRSASASETLAA+WP TMQIVRLI+Q+HMNNKQYVGKADFLVFR 
Sbjct  464   GQRQGQPVFICKLEGYRSASASETLAADWPLTMQIVRLIAQEHMNNKQYVGKADFLVFRT  523

Query  2087  MNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             +NQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKA RLIGMLFPGDMVVFKPQ+++
Sbjct  524   LNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKAGRLIGMLFPGDMVVFKPQVSS  578



>ref|XP_010089730.1| hypothetical protein L484_013924 [Morus notabilis]
 gb|EXB38291.1| hypothetical protein L484_013924 [Morus notabilis]
Length=1038

 Score =   519 bits (1337),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 339/600 (57%), Positives = 418/600 (70%), Gaps = 52/600 (9%)
 Frame = +2

Query  494   ALMMLSSPNGNQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRL  673
             A M  S  NGNQS+  ++ Q+HCIL++ASNP+PL TPV+RPQ+ N EQSEN     + RL
Sbjct  192   AKMFTSVQNGNQSQPNMDCQRHCILISASNPHPLSTPVFRPQVQNLEQSENIDGQTENRL  251

Query  674   SDAETVAKSFAQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISE  853
             SD ET+AKSFAQC VSLSV+ PK + KL+ IY   KRNPR  D PIDN KNPY+LVL+SE
Sbjct  252   SDTETIAKSFAQCLVSLSVISPKQLPKLRAIYNVGKRNPRANDPPIDNAKNPYFLVLLSE  311

Query  854   NFMEARAAFNRTGMPSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPT  1033
             NF+EARAA     +PSLPS Q+PVKMD++SVP ++GP P+   S+PS NG VMNRQPI  
Sbjct  312   NFLEARAALR---VPSLPSNQSPVKMDMASVPSVTGPPPT---SMPSVNGSVMNRQPISV  365

Query  1034  GNIHPATVKIEPTTV----------------TSMPGPTFAHVPSVPRAASQPVQNLQTSS  1165
             GN+ PATVK+    +                T     +       PR+   PV +  T  
Sbjct  366   GNMPPATVKVNGFDLINKSSGAKYCKFHGFWTHFSTHSLCCSCCFPRS---PVADFFT--  420

Query  1166  PISVSQEMVANNENLQETKPMVVHGMGQSVRPVGAAAANVRILNDVAQARQAL------A  1327
              I  SQ+M++NNEN  + KP +V  + Q +RPVG A ANV ILN++    Q +       
Sbjct  421   -IFCSQDMISNNENGPDLKP-IVSSISQPLRPVGPAPANVNILNNLLAKHQVINSAALPM  478

Query  1328  GGTSIGLSSMGGTPMLSNmissgmassvsaaqsvisssqsgvtsmtssMPLAGP-GQVVQ  1504
             G T IG   M  + M+SN ++S   +         + +          +P +GP  QV Q
Sbjct  479   GQTPIG---MHMSNMISNGMASSTPAQNILPSGQPAITS---------LPGSGPLTQVTQ  526

Query  1505  ssaptsftattssmsstsnlvmsqsmNTLPSSVSVGQTVPGMNQANMPGTQMMQTATGRS  1684
             +   ++F+A TS++S  SN+ +SQ MN L   VS+GQ+VP M+Q N+ G QM+QT  G +
Sbjct  527   TPGLSTFSAATSNVSGNSNIGVSQPMNNLQGGVSMGQSVPTMSQGNISGAQMVQTGMGMN  586

Query  1685  QNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqs  1864
             QNM+SG+G  S + SGTGTM+PTPGM+QQ Q GMQP+GVNNNSAA++P+SQQ +++   S
Sbjct  587   QNMISGLG-QSVVSSGTGTMMPTPGMSQQVQSGMQPLGVNNNSAASIPMSQQASTAPQAS  645

Query  1865  aqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNN  2044
                KYVKVWEGNLSGQRQGQPVFITRLEGYR+A+ASETLAANWP TMQIVRLISQDHMNN
Sbjct  646   ---KYVKVWEGNLSGQRQGQPVFITRLEGYRNATASETLAANWPATMQIVRLISQDHMNN  702

Query  2045  KQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDM  2224
             KQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPG +
Sbjct  703   KQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGSL  762



>gb|EEE69415.1| hypothetical protein OsJ_28785 [Oryza sativa Japonica Group]
Length=839

 Score =   511 bits (1315),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 320/673 (48%), Positives = 422/673 (63%), Gaps = 69/673 (10%)
 Frame = +2

Query  182   AEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHG  361
             AE+QL++AVEGTAA+GP+W   V+DY+EKI+R FC  E   QK +G   E  LV+F++HG
Sbjct  6     AERQLVVAVEGTAALGPYWPVTVADYVEKIVRSFCAHEMAGQKLAGTPPELALVVFHTHG  65

Query  362   SYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSKQ  538
              YSA  VQRSGWT+D+++FL WLS I F GGGF++AAI+EGLAEALM+L  S + +Q+ Q
Sbjct  66    PYSAFCVQRSGWTKDMNVFLSWLSGISFSGGGFSEAAISEGLAEALMILQGSSSNSQNHQ  125

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             + E QKHCILVAASNPYPLPTPVYRP + +S+  EN     +  L+DAETVAKSFAQCSV
Sbjct  126   SHEVQKHCILVAASNPYPLPTPVYRPLVQSSDHKENNDGAKESCLADAETVAKSFAQCSV  185

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSVV PK +  LK IY AAKRNPR AD  +D+ KNP++LVL+S+NF+EAR A +R  +P
Sbjct  186   SLSVVSPKQLPTLKAIYNAAKRNPRAADPSVDHAKNPHFLVLLSDNFLEARTALSRP-LP  244

Query  899   SLPSTQNPV-KMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
                 T +P+ KMD ++    S P+P+   + PS NGP++ RQP    N   A +K EPTT
Sbjct  245   GNLVTNHPITKMDTAAT---SVPVPTSNGN-PSVNGPMLTRQP----NGVVANIKTEPTT  296

Query  1076  VTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             +  M   P F+HV  V    SQ + ++Q+ SP  +SQE    N+++QE KP+ ++ + QS
Sbjct  297   LPPMVSAPAFSHVTPVANGVSQGLSSVQSPSPSLISQETNLANDSVQEHKPL-INPIQQS  355

Query  1253  VRPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPMLSNmissgmassvsaaqsvi  1432
             +RP G   ANV ILN+++Q R       S+     GG P                     
Sbjct  356   IRPGG--PANVSILNNLSQHR-------SVATIISGGMP---------------------  385

Query  1433  sssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSSVSVG  1612
                          +P++G GQ + S      TA  S+   T N  ++ S +      ++G
Sbjct  386   ------------GIPMSGTGQSIGSQQVVQNTAFGSNTPITGNSNIAVSSSLGGIQSNIG  433

Query  1613  QTVPGMNQ-ANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgmq  1789
              + P + Q  +M  TQ+ Q     +QNM+S +    G  + +      P      Q G+ 
Sbjct  434   ISGPPVTQGGSMGSTQLGQGGINTNQNMISSL----GTTTVSSAPAMMPTPGMAQQAGVN  489

Query  1790  pIGVNNNSAANMPLsqqqtssqlqsaqs---------KYVKVWEGNLSGQRQGQPVFITR  1942
              +GV N+SA NMP+ Q   + Q Q  Q          KYVK+WEG LSGQRQGQPVFI +
Sbjct  490   SLGVTNSSAMNMPIVQHPNAQQQQQQQQQQQQQQPPPKYVKIWEGTLSGQRQGQPVFICK  549

Query  1943  LEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQE  2122
             LEGYRS +ASETLAA+WPETMQIVRLI+Q+HMNNKQYVGKADFLVFR +NQHGFLGQLQE
Sbjct  550   LEGYRSGTASETLAADWPETMQIVRLIAQEHMNNKQYVGKADFLVFRTLNQHGFLGQLQE  609

Query  2123  KKLCAVIQLPSQT  2161
             KKL   + + S +
Sbjct  610   KKLWTSVSVRSDS  622



>ref|XP_011021763.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Populus euphratica]
Length=857

 Score =   511 bits (1316),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 261/403 (65%), Positives = 313/403 (78%), Gaps = 11/403 (3%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MA+KQLI+AVEGTAAMGP W+ IVSDYLEKIIRC+CG E   QKP  ++ E  LV FNSH
Sbjct  1     MADKQLIVAVEGTAAMGPFWSIIVSDYLEKIIRCYCGNETSGQKPPTSSAELALVTFNSH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSK  535
             GSYSACLVQRSGWTRD+D+FLHWLS+I F GGGFNDAAIAEGL+EALMM   +PNGNQ++
Sbjct  61    GSYSACLVQRSGWTRDVDIFLHWLSAIPFAGGGFNDAAIAEGLSEALMMFPIAPNGNQTQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
               ++GQ++CIL+AASNP+PLPTPVYRPQI N EQ+EN    ++ RLSDAETVAKSF QCS
Sbjct  121   PNIDGQRNCILIAASNPHPLPTPVYRPQIQNLEQTENIDAQNESRLSDAETVAKSFPQCS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK + KLK+IY A KRN R AD P+DN KNP++LVLISENFMEARAA +R G 
Sbjct  181   VSLSVICPKQLPKLKSIYNAGKRNSRAADPPVDNIKNPHFLVLISENFMEARAALSRPGA  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              SLPS Q P K+D++SV  ++GPLP   ASIPS NG + NR PI  GN+  ATVK+EP+T
Sbjct  241   TSLPSNQTPAKVDIASVTSVTGPLP---ASIPSVNGSITNRPPISVGNLPTATVKVEPST  297

Query  1076  VTSMP-GPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             +TSM  G  F H+PSVPR +SQ V ++QTSSP + +Q+M  N EN Q+ KP  V    QS
Sbjct  298   ITSMANGSAFPHIPSVPRPSSQVVPSMQTSSPSTTTQDMATNGENAQDLKPN-VSVTTQS  356

Query  1253  VRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGT  1366
              R    AAANV ILN+++QARQ     AL+GGTSIGL S+  T
Sbjct  357   ARSAPPAAANVNILNNLSQARQVMNSAALSGGTSIGLPSINQT  399


 Score =   285 bits (729),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 177/201 (88%), Gaps = 2/201 (1%)
 Frame = +2

Query  1649  GTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgmqpIGVNNNSAANMP  1828
             G QM+Q+  G + N MSG+G ASG+ SG+ TM+PTPGM+ Q Q GMQP+G NNNSAAN+P
Sbjct  503   GAQMVQSGMGANPNTMSGLG-ASGVSSGSNTMIPTPGMSPQVQSGMQPLGANNNSAANLP  561

Query  1829  LsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQ  2008
             LSQQ       +   KY+KVWEG+LSGQRQGQPVFITRLEGYRSASASETLAANWP TMQ
Sbjct  562   LSQQTAGGLQPTQT-KYLKVWEGSLSGQRQGQPVFITRLEGYRSASASETLAANWPPTMQ  620

Query  2009  IVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKA  2188
             IVRLISQDHMNNKQYVGKADFLVFRA+NQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKA
Sbjct  621   IVRLISQDHMNNKQYVGKADFLVFRAVNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKA  680

Query  2189  CRLIGMLFPGDMVVFKPQITN  2251
             CRLIGMLFPGDMVVFKPQI++
Sbjct  681   CRLIGMLFPGDMVVFKPQISS  701



>ref|XP_002311445.2| hypothetical protein POPTR_0008s11650g [Populus trichocarpa]
 gb|EEE88812.2| hypothetical protein POPTR_0008s11650g [Populus trichocarpa]
Length=896

 Score =   506 bits (1304),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 260/403 (65%), Positives = 311/403 (77%), Gaps = 11/403 (3%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MA+KQLI+AVEGTAAMGP W+ IVSDYLEKIIRC+CG E   QKP  ++ E  LV FNSH
Sbjct  1     MADKQLIVAVEGTAAMGPFWSIIVSDYLEKIIRCYCGNETSGQKPPTSSAELSLVTFNSH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSK  535
             GSYSACLVQRSGWTRD+D+FLHWLS+I F GGGFNDAAIAEGL+EALMM   +PNGNQ++
Sbjct  61    GSYSACLVQRSGWTRDVDIFLHWLSAIPFAGGGFNDAAIAEGLSEALMMFPITPNGNQTQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
                +GQ++CIL+AASNP+PLPTPVYRPQI N EQ+EN    ++ RLSDAETVAKSF QCS
Sbjct  121   PNTDGQRNCILIAASNPHPLPTPVYRPQIQNLEQTENIDAQNESRLSDAETVAKSFPQCS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK + KL+ IY A KRN R AD P+DN KNP++LVLISENFMEARAA +R G 
Sbjct  181   VSLSVICPKQLPKLRLIYNAGKRNSRAADPPVDNIKNPHFLVLISENFMEARAALSRPGA  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              SLPS Q PVK+D++SV  ++GPLP   ASIPS NG + NR PI  GN+  ATVK+EP+T
Sbjct  241   TSLPSNQTPVKVDIASVTSVTGPLP---ASIPSVNGSITNRPPISVGNLPTATVKVEPST  297

Query  1076  VTSMP-GPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             +TSM  G  F H+ SVPR +SQ V ++QTSSP + +Q+M  N EN Q+ KP  V    QS
Sbjct  298   ITSMANGSAFPHITSVPRPSSQGVPSMQTSSPSTTTQDMATNGENAQDLKPN-VSVTTQS  356

Query  1253  VRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGT  1366
              R    AAANV ILN+++QARQ     AL+GGTSIGL S+  T
Sbjct  357   ARSAPPAAANVNILNNLSQARQVMNSAALSGGTSIGLPSINQT  399


 Score =   290 bits (743),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 177/200 (89%), Gaps = 2/200 (1%)
 Frame = +2

Query  1649  GTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgmqpIGVNNNSAANMP  1828
             G QM+Q+  G + N MSG+G ASG+ SG+ TM+PTPGM+QQ Q GMQP+G NNNSAAN+P
Sbjct  503   GAQMVQSGMGANPNTMSGLG-ASGVSSGSNTMIPTPGMSQQVQSGMQPLGANNNSAANLP  561

Query  1829  LsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQ  2008
             LSQQ       +   KYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWP TMQ
Sbjct  562   LSQQTAGGLQPAQS-KYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPPTMQ  620

Query  2009  IVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKA  2188
             IVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKA
Sbjct  621   IVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKA  680

Query  2189  CRLIGMLFPGDMVVFKPQIT  2248
             CRLIGMLFPGDMVVFKPQI+
Sbjct  681   CRLIGMLFPGDMVVFKPQIS  700



>ref|XP_002529152.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33265.1| conserved hypothetical protein [Ricinus communis]
Length=561

 Score =   492 bits (1267),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 343/541 (63%), Positives = 416/541 (77%), Gaps = 20/541 (4%)
 Frame = +2

Query  389   SGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSS--PNGNQSKQTVEGQKHC  562
             SGWTRD+D+FL WL++I F GGGF+DAAIAEGL+EALMM+    PNG+Q++Q ++GQ+HC
Sbjct  30    SGWTRDVDIFLQWLAAIPFAGGGFSDAAIAEGLSEALMMMFPFVPNGSQAQQNIDGQRHC  89

Query  563   ILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLSVVCPK  742
             IL+AASNP+PLPTPVYR QI N EQ+EN     + RLSDAET+AKSF QCSVSLSV+CPK
Sbjct  90    ILIAASNPHPLPTPVYRQQIQNLEQNENIDPQTESRLSDAETIAKSFPQCSVSLSVICPK  149

Query  743   LVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSLPSTQNP  922
              + KL+ IY A KRN R AD  +DN KNP++LVLISENFMEARAA +R G+ +LPS Q+P
Sbjct  150   QLPKLRAIYNAGKRNSRAADPTVDNVKNPHFLVLISENFMEARAALSRPGVANLPSNQSP  209

Query  923   VKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTVTSM-PGPT  1099
             VKMDV+SV  ++GP      SIPS NG +M+R  I  GN+  ATVK+EPTTVTSM PGP 
Sbjct  210   VKMDVASVTSVAGPTS---PSIPSVNGSIMSRPSI--GNVPTATVKVEPTTVTSMAPGPA  264

Query  1100  FAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSVRPVGAAAA  1279
             F H+PS  R ASQ V +LQTSSP + +QE++ ++EN+ E KP  V GM  SVRPV   AA
Sbjct  265   FPHIPST-RPASQSVPSLQTSSPPTSTQEIITSSENVSEIKP-TVSGMPHSVRPVPPGAA  322

Query  1280  NVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM---LSNmissgmassvsaaqsvis  1435
             NV ILN+++QARQ     AL GGTSIGL S+  TP+   +SNMISSGMASSV AAQ+V S
Sbjct  323   NVSILNNLSQARQVMNSAALTGGTSIGLPSINQTPVAMHMSNMISSGMASSVPAAQTVFS  382

Query  1436  ssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSSVSVGQ  1615
             S Q+G+TS+T S  L G  Q+  +S   SFT+TT+++S  SNL MSQ M  L + VS+GQ
Sbjct  383   SGQTGITSITGSGTLTGTTQIAPNSGLGSFTSTTTNVSGNSNLGMSQPMGNLQAGVSMGQ  442

Query  1616  TVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgmqpI  1795
             +VPGM+Q N+ G QM+Q+  G SQNMMSG+ G S + SG  TM+PTPGM Q  Q G+Q +
Sbjct  443   SVPGMSQGNLSGAQMVQSGIGMSQNMMSGL-GPSVVSSGASTMIPTPGMGQPAQTGIQSL  501

Query  1796  GVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASE  1975
             GVNNNSAANMPL  QQT+S LQSAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRS SASE
Sbjct  502   GVNNNSAANMPL-SQQTASALQSAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRSGSASE  560

Query  1976  T  1978
             T
Sbjct  561   T  561



>ref|XP_010105771.1| hypothetical protein L484_009967 [Morus notabilis]
 gb|EXC06056.1| hypothetical protein L484_009967 [Morus notabilis]
Length=607

 Score =   486 bits (1252),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 340/649 (52%), Positives = 422/649 (65%), Gaps = 86/649 (13%)
 Frame = +2

Query  338   LVMFNSH----GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMM  505
             ++ FN H        +CLVQRSGWTRDID +L WLS+I F GGGFNDAAIAEGL+EALMM
Sbjct  19    VLRFNRHWYIMCKLLSCLVQRSGWTRDIDNYLQWLSAIPFSGGGFNDAAIAEGLSEALMM  78

Query  506   LSS-PNGNQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDA  682
               S  NGNQS+  ++ Q+HCIL++ASNP+PL TPV+RPQ+ N EQSEN     + RLSDA
Sbjct  79    FPSMQNGNQSQPNMDCQRHCILISASNPHPLSTPVFRPQVQNLEQSENIDGQTENRLSDA  138

Query  683   ETVAKSFAQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFM  862
             ET+AKSFAQC VSLSV+ PK + KL+ IY A K NPR  D PIDN KNPY+LVL+SENF+
Sbjct  139   ETIAKSFAQCLVSLSVISPKQLPKLRAIYNAGKCNPRANDPPIDNAKNPYFLVLLSENFL  198

Query  863   EARAAFNRTGMPSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNI  1042
             EARAAF    +PSLPS Q+PVKMD++SVP ++GP P+   S+PS NG VMNRQPI  GN+
Sbjct  199   EARAAFR---VPSLPSNQSPVKMDMASVPSVTGPPPT---SMPSVNGSVMNRQPISVGNM  252

Query  1043  HPATVKIEPTTV----------------TSMPGPTFAHVPSVPRAASQPVQNLQTSSPIS  1174
              PATVK+    +                T     +       PR+   PV +  T   I 
Sbjct  253   PPATVKVNGFDLINKSSGAKYCKFHGFWTHFSTHSVCCSCCFPRS---PVADFFT---IF  306

Query  1175  VSQEMVANNENLQETKPMVVHGMGQSVRPVGAAAANVRILNDVAQARQALAGGTSIGLSS  1354
              SQ+M++NNEN  + KP +V  + Q +RPVG A ANV ILN+++  RQ +    S  L  
Sbjct  307   CSQDMISNNENGPDLKP-IVSSLSQPLRPVGPAPANVNILNNLSAKRQVI---NSAAL-P  361

Query  1355  MGGTPMLSNmissgmassvsaaqsvisssqsgvtsmtssMPLAGP-GQVVQssaptsfta  1531
             MG TP+   M  S M SS  A+ +   ++        +S+P +GP  QV Q+   ++F+A
Sbjct  362   MGQTPI--GMHMSNMISSGMASSTPAQNTLPSGQPAITSLPGSGPLTQVTQTPGLSTFSA  419

Query  1532  ttssmsstsnlvmsqsmNTLPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGG  1711
              TS++S  SN+ +SQ MN L   VS+GQ+VP M+Q N+ G QM+QT  G +QNM+SG+ G
Sbjct  420   ATSNVSGNSNIGVSQPMNNLQGGVSMGQSVPTMSQGNISGAQMVQTGMGMNQNMISGL-G  478

Query  1712  ASGIPSgtgtmvptpgmtqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVW  1891
              S + SGTGTM+PTPGM+QQ Q GMQP+GVNNNSAA++P+      +      SKYVKVW
Sbjct  479   QSVVSSGTGTMMPTPGMSQQVQSGMQPLGVNNNSAASIPM---SQQASTAPQASKYVKVW  535

Query  1892  EGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADF  2071
                               EGYR+A+ASET                       QYVGKADF
Sbjct  536   ------------------EGYRNATASET-----------------------QYVGKADF  554

Query  2072  LVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPG  2218
             LVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKA RLIGMLFPG
Sbjct  555   LVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKAYRLIGMLFPG  603



>gb|EYU29950.1| hypothetical protein MIMGU_mgv1a001668mg [Erythranthe guttata]
Length=757

 Score =   485 bits (1249),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 251/410 (61%), Positives = 300/410 (73%), Gaps = 13/410 (3%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             M  KQLI+AVEGTAA+GP W +IVSDYL+KIIR FCG E   QKP+  + E  LVMFN+H
Sbjct  1     MVPKQLIVAVEGTAAIGPFWQTIVSDYLDKIIRSFCGNEPTGQKPATTHFELSLVMFNAH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQ  538
             GSYSACLVQRSGWT+D+D+F  WLS+I F GGGFNDAAIAEGL+EALMM SSP GNQ+ Q
Sbjct  61    GSYSACLVQRSGWTKDMDIFFQWLSAIPFAGGGFNDAAIAEGLSEALMMFSSPKGNQN-Q  119

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
              VEGQ+HCIL+AASNPYPLPTPV+RPQI N E+++      D RLSDAET+AKSFAQC+V
Sbjct  120   NVEGQRHCILIAASNPYPLPTPVFRPQIQNPEKNDGVESQPDNRLSDAETLAKSFAQCAV  179

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSV+CPK + KL+ I+ A KRNPR  D P+DN KNP++LVLISENFMEAR+  +R+G+ 
Sbjct  180   SLSVICPKQLPKLRGIFNAGKRNPRAPDPPVDNNKNPHFLVLISENFMEARSCLSRSGIT  239

Query  899   SLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
             SLP  Q PVKMDV+              SIP+ NG ++ RQP+P  NI PA VK+EP T+
Sbjct  240   SLPPNQIPVKMDVTPA--PPPISGPPPVSIPAVNGSLLARQPVPAANIPPAIVKLEPPTI  297

Query  1079  T-SMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
               SM GPTF H+ S+PRA  Q V  +QTSSPIS  QE++  NEN+ E KP+V       +
Sbjct  298   APSMTGPTFPHISSIPRAVPQTVPTMQTSSPISTPQEVIPINENIPEVKPLVASS-APPI  356

Query  1256  RPVGAAAANVRILNDV-------AQARQALAGGTSIGLSSM-GGTPMLSN  1381
             RP G AAANVRILND+       A A     GG SIG+ SM GGT MLSN
Sbjct  357   RPAGGAAANVRILNDMAQARQALAAAAAGGGGGASIGIPSMGGGTTMLSN  406


 Score =   239 bits (610),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  1874  KYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQY  2053
             KYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWP TMQIVRLISQDHMNNKQY
Sbjct  532   KYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPSTMQIVRLISQDHMNNKQY  591

Query  2054  VGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPG  2218
             VGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKA RLIGMLFPG
Sbjct  592   VGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKAHRLIGMLFPG  646



>gb|EYU29949.1| hypothetical protein MIMGU_mgv1a001668mg [Erythranthe guttata]
Length=777

 Score =   485 bits (1248),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 251/410 (61%), Positives = 300/410 (73%), Gaps = 13/410 (3%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             M  KQLI+AVEGTAA+GP W +IVSDYL+KIIR FCG E   QKP+  + E  LVMFN+H
Sbjct  1     MVPKQLIVAVEGTAAIGPFWQTIVSDYLDKIIRSFCGNEPTGQKPATTHFELSLVMFNAH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQ  538
             GSYSACLVQRSGWT+D+D+F  WLS+I F GGGFNDAAIAEGL+EALMM SSP GNQ+ Q
Sbjct  61    GSYSACLVQRSGWTKDMDIFFQWLSAIPFAGGGFNDAAIAEGLSEALMMFSSPKGNQN-Q  119

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
              VEGQ+HCIL+AASNPYPLPTPV+RPQI N E+++      D RLSDAET+AKSFAQC+V
Sbjct  120   NVEGQRHCILIAASNPYPLPTPVFRPQIQNPEKNDGVESQPDNRLSDAETLAKSFAQCAV  179

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSV+CPK + KL+ I+ A KRNPR  D P+DN KNP++LVLISENFMEAR+  +R+G+ 
Sbjct  180   SLSVICPKQLPKLRGIFNAGKRNPRAPDPPVDNNKNPHFLVLISENFMEARSCLSRSGIT  239

Query  899   SLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
             SLP  Q PVKMDV+              SIP+ NG ++ RQP+P  NI PA VK+EP T+
Sbjct  240   SLPPNQIPVKMDVTPA--PPPISGPPPVSIPAVNGSLLARQPVPAANIPPAIVKLEPPTI  297

Query  1079  T-SMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
               SM GPTF H+ S+PRA  Q V  +QTSSPIS  QE++  NEN+ E KP+V       +
Sbjct  298   APSMTGPTFPHISSIPRAVPQTVPTMQTSSPISTPQEVIPINENIPEVKPLVASS-APPI  356

Query  1256  RPVGAAAANVRILNDV-------AQARQALAGGTSIGLSSM-GGTPMLSN  1381
             RP G AAANVRILND+       A A     GG SIG+ SM GGT MLSN
Sbjct  357   RPAGGAAANVRILNDMAQARQALAAAAAGGGGGASIGIPSMGGGTTMLSN  406


 Score =   252 bits (643),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  1874  KYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQY  2053
             KYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWP TMQIVRLISQDHMNNKQY
Sbjct  532   KYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPSTMQIVRLISQDHMNNKQY  591

Query  2054  VGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVF  2233
             VGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKA RLIGMLFPGDMVVF
Sbjct  592   VGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKAHRLIGMLFPGDMVVF  651

Query  2234  K  2236
             K
Sbjct  652   K  652



>ref|XP_004166861.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like, partial [Cucumis sativus]
Length=595

 Score =   468 bits (1205),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 253/405 (62%), Positives = 304/405 (75%), Gaps = 16/405 (4%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MA+KQLI+ VEGTAAMGP W ++VSDY+EKI+R FCG E   QKP  +NVEF LV F++H
Sbjct  1     MADKQLIVVVEGTAAMGPFWQTVVSDYIEKIVRSFCGNELTGQKPPTSNVEFSLVTFHTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSK  535
             GSY  CLVQR+GWTRD+D+F+ WLS+I F GGGF+DAAIAEGLAEALMM  + PNG Q++
Sbjct  61    GSYCGCLVQRTGWTRDVDIFIQWLSAIPFSGGGFSDAAIAEGLAEALMMFPTQPNGGQNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             QT++ QKHCILVAASNPYPLPTPVYRP + N EQ +N      +  S AETVAKSF QC 
Sbjct  121   QTMDMQKHCILVAASNPYPLPTPVYRPAVQNLEQHDNVEPGSSQ--SYAETVAKSFPQCF  178

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             +SLSV+CPK + KLK IY A KRNPR AD PIDN K+P YLVLISENF+EARAA +R G+
Sbjct  179   ISLSVICPKQLPKLKAIYTAGKRNPRAADPPIDNVKSPSYLVLISENFVEARAALSRPGI  238

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              SLP+ Q+PVKMD+SSV            + PS NGP++NRQP+   N   ATVK+EP T
Sbjct  239   TSLPANQSPVKMDISSV---VPVTGPPPTTTPSVNGPIINRQPVSVPNGPTATVKVEPNT  295

Query  1076  VTSMP-GPTF-AHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQ  1249
             VTSM  G  +  H+PSV RAASQ V +LQTSSP+S SQEM+ NNEN Q+ KP+V  G+ Q
Sbjct  296   VTSMTNGSGYPPHMPSVVRAASQGVPSLQTSSPLS-SQEMITNNENTQDLKPLVT-GVPQ  353

Query  1250  SVRPVGAAAANVRILNDVAQAR----QALAGGTSIGLSSMGGTPM  1372
              VR +G   ANV ILN+++QAR     AL GGTSIGL SMG TP+
Sbjct  354   PVRSLG--PANVSILNNISQARVMSTAALNGGTSIGLPSMGQTPI  396


 Score =   107 bits (268),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 99/129 (77%), Gaps = 2/129 (2%)
 Frame = +2

Query  1589  LPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtq  1768
             L  SVSV Q+VPG++Q N+ GTQ++Q+  G SQN+MS +    G+ SG GTM+PTPGM Q
Sbjct  469   LQGSVSVSQSVPGISQGNLAGTQVVQSGIGVSQNVMSNLT-QPGVSSGNGTMIPTPGMPQ  527

Query  1769  qgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLE  1948
             Q Q GM  +G+NN +AANMPL Q    +  Q AQSKYVK WEGNLSGQRQGQPVFITR+E
Sbjct  528   QVQNGMHSLGMNN-AAANMPLPQHSAGALQQQAQSKYVKFWEGNLSGQRQGQPVFITRME  586

Query  1949  GYRSASASE  1975
             GYRSASAS+
Sbjct  587   GYRSASASD  595



>gb|KGN52054.1| hypothetical protein Csa_5G608420 [Cucumis sativus]
Length=680

 Score =   468 bits (1205),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 253/405 (62%), Positives = 304/405 (75%), Gaps = 16/405 (4%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MA+KQLI+ VEGTAAMGP W ++VSDY+EKI+R FCG E   QKP  +NVEF LV F++H
Sbjct  1     MADKQLIVVVEGTAAMGPFWQTVVSDYIEKIVRSFCGNELTGQKPPTSNVEFSLVTFHTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSK  535
             GSY  CLVQR+GWTRD+D+F+ WLS+I F GGGF+DAAIAEGLAEALMM  + PNG Q++
Sbjct  61    GSYCGCLVQRTGWTRDVDIFIQWLSAIPFSGGGFSDAAIAEGLAEALMMFPTQPNGGQNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             QT++ QKHCILVAASNPYPLPTPVYRP + N EQ +N      +  S AETVAKSF QC 
Sbjct  121   QTMDMQKHCILVAASNPYPLPTPVYRPAVQNLEQHDNVEPGSSQ--SYAETVAKSFPQCF  178

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             +SLSV+CPK + KLK IY A KRNPR AD PIDN K+P YLVLISENF+EARAA +R G+
Sbjct  179   ISLSVICPKQLPKLKAIYTAGKRNPRAADPPIDNVKSPSYLVLISENFVEARAALSRPGI  238

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              SLP+ Q+PVKMD+SSV            + PS NGP++NRQP+   N   ATVK+EP T
Sbjct  239   TSLPANQSPVKMDISSV---VPVTGPPPTTTPSVNGPIINRQPVSVPNGPTATVKVEPNT  295

Query  1076  VTSMP-GPTF-AHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQ  1249
             VTSM  G  +  H+PSV RAASQ V +LQTSSP+S SQEM+ NNEN Q+ KP+V  G+ Q
Sbjct  296   VTSMTNGSGYPPHMPSVVRAASQGVPSLQTSSPLS-SQEMITNNENTQDLKPLVT-GVPQ  353

Query  1250  SVRPVGAAAANVRILNDVAQAR----QALAGGTSIGLSSMGGTPM  1372
              VR +G   ANV ILN+++QAR     AL GGTSIGL SMG TP+
Sbjct  354   PVRSLG--PANVSILNNISQARVMSTAALNGGTSIGLPSMGQTPI  396


 Score =   276 bits (706),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 179/210 (85%), Gaps = 2/210 (1%)
 Frame = +2

Query  1589  LPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtq  1768
             L  SVSV Q+VPG++Q N+ GTQ++Q+  G SQN+MS +    G+ SG GTM+PTPGM Q
Sbjct  469   LQGSVSVSQSVPGISQGNLAGTQVVQSGIGVSQNVMSNLT-QPGVSSGNGTMIPTPGMPQ  527

Query  1769  qgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLE  1948
             Q Q GM  +G+NN +AANMPL Q    +  Q AQSKYVK WEGNLSGQRQGQPVFITR+E
Sbjct  528   QVQNGMHSLGMNN-AAANMPLPQHSAGALQQQAQSKYVKFWEGNLSGQRQGQPVFITRME  586

Query  1949  GYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  2128
             GYRSASAS+ LAANWP+TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK
Sbjct  587   GYRSASASDKLAANWPQTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  646

Query  2129  LCAVIQLPSQTLLLSVSDKACRLIGMLFPG  2218
             LCAVIQLPSQTLLLSVSDKACRLIGMLFPG
Sbjct  647   LCAVIQLPSQTLLLSVSDKACRLIGMLFPG  676



>ref|XP_002315956.1| PHYTOCHROME AND FLOWERING TIME 1 family protein [Populus trichocarpa]
 gb|EEF02127.1| PHYTOCHROME AND FLOWERING TIME 1 family protein [Populus trichocarpa]
Length=796

 Score =   472 bits (1214),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 247/403 (61%), Positives = 302/403 (75%), Gaps = 20/403 (5%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEKQLI+AVEGTAAMGP W+ IVSDYLEKIIR          K   + VE  +V FNSH
Sbjct  1     MAEKQLIVAVEGTAAMGPFWSIIVSDYLEKIIRY---------KVPTSIVELSIVTFNSH  51

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSK  535
             GSYSACLVQRSGWTRD+D+FL WLS+I F GGGFNDAAIAEGL+EALMM    PNG+Q++
Sbjct  52    GSYSACLVQRSGWTRDVDIFLQWLSAIPFAGGGFNDAAIAEGLSEALMMFPIDPNGSQTQ  111

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
               ++ Q++CIL+AASNP+PLPTPVYRPQI N EQ EN    ++ RLSDAETVAKSF QCS
Sbjct  112   SNIDEQRNCILIAASNPHPLPTPVYRPQIQNLEQIENIDAQNESRLSDAETVAKSFPQCS  171

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLS++CPK + KL++IY A KRN R AD P+D+ KNP++LVLISENFMEARAA +  G+
Sbjct  172   VSLSIICPKQLPKLRSIYNAGKRNSRAADPPVDSVKNPHFLVLISENFMEARAALSLPGV  231

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              SL S Q PVK+D++SV  ++GP P+   SIPS NG + NR  I  GN+  ATVK+EP+T
Sbjct  232   TSLTSNQTPVKVDIASVTSVTGPAPT---SIPSVNGSITNRPTISVGNVPTATVKVEPST  288

Query  1076  VTSMP-GPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             +TSM  GPTF H PSVPR ASQ V  LQTSSP + +Q+M  + +++Q+ KP  V  M QS
Sbjct  289   ITSMANGPTFPHNPSVPRPASQGVPILQTSSPSTTTQDMATSGDDVQDLKPN-VSVMTQS  347

Query  1253  VRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGT  1366
              RP   AAANV ILN+++QARQ      L+GGTS+GL S+  T
Sbjct  348   ARPGPPAAANVSILNNISQARQVMNSAGLSGGTSLGLPSINQT  390


 Score =   300 bits (768),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 171/220 (78%), Positives = 187/220 (85%), Gaps = 2/220 (1%)
 Frame = +2

Query  1589  LPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtq  1768
             L + VS+GQ+ PGM+Q N+ G QM+Q+  G + N MSG+G  SG+ SG  TM+PTPGM+Q
Sbjct  469   LQAGVSIGQSAPGMSQGNISGAQMVQSGMGANPNTMSGLG-PSGVSSGLNTMIPTPGMSQ  527

Query  1769  qgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLE  1948
             Q Q GMQP+G NNNSA N+ +SQQ           KYVKVWEGNLSGQRQGQPVFITRLE
Sbjct  528   QVQSGMQPLGANNNSADNLSMSQQTAGGLQPPQS-KYVKVWEGNLSGQRQGQPVFITRLE  586

Query  1949  GYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  2128
             GYRSASASETLAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK
Sbjct  587   GYRSASASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  646

Query  2129  LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIT  2248
             LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI+
Sbjct  647   LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIS  686



>gb|EPS74095.1| hypothetical protein M569_00660, partial [Genlisea aurea]
Length=527

 Score =   461 bits (1186),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 247/407 (61%), Positives = 300/407 (74%), Gaps = 21/407 (5%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             M  KQLIIAVEGTA++GP W +I+SDYL+KIIR  CG+E   QKP   +VE  LVMFN+H
Sbjct  1     MVTKQLIIAVEGTASLGPFWKTILSDYLDKIIRFLCGSEPVGQKPPNTHVELSLVMFNAH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQ  538
             G YSA LVQRSGWT+D+DL+  WLS+I F GGGFNDAAI EGL+E LMM SSPNGNQ  Q
Sbjct  61    GPYSAFLVQRSGWTKDMDLYFQWLSAIPFSGGGFNDAAITEGLSEVLMMFSSPNGNQ-NQ  119

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
               E Q+HCILV+ASNPYPLPTPVYRPQ+ N E++EN     +  LSDAET+AKSF QC +
Sbjct  120   NAEVQRHCILVSASNPYPLPTPVYRPQM-NQEKTENVESQAENHLSDAETLAKSFPQCGI  178

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSV+CPK + KL+ IY A K+NPR  D P++N KNP +LVLISENFMEA     ++G+ 
Sbjct  179   SLSVICPKQLPKLRGIYNAGKQNPRAGDPPVENAKNPSFLVLISENFMEAV----QSGIA  234

Query  899   SLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
             +LPS QNPVK D  SVPPISG  P+  ++IP A GP++ R P+ +GN+ PATVK+EPTT+
Sbjct  235   ALPSYQNPVKTDAPSVPPISGAPPT--SAIP-AKGPILVRPPVSSGNVLPATVKVEPTTI  291

Query  1079  TSMPG-PTFAHVPS-VPRAASQPVQNLQTSSPI-SVSQEM--VANNENLQETKPMVVHG-  1240
              SMPG  TF H+ +  P +ASQ V +L+ S P+ S SQEM    N+E+  E KP+V    
Sbjct  292   PSMPGSSTFPHLSTAAPLSASQAVASLRISPPLSSTSQEMATTTNHESAPELKPLVSSSN  351

Query  1241  MGQSVRPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPMLSN  1381
             +   +RPVG AAANVRILNDVAQ RQALA G SI     GG PMLSN
Sbjct  352   VAPPLRPVGGAAANVRILNDVAQ-RQALAAGASI-----GGAPMLSN  392



>ref|XP_008446563.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 [Cucumis melo]
Length=843

 Score =   471 bits (1212),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 251/405 (62%), Positives = 305/405 (75%), Gaps = 16/405 (4%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MA+KQLI+ VEGTAAMGP W ++VSDY+EKI+R FCG E   QKP  +NVEF LV F++H
Sbjct  1     MADKQLIVVVEGTAAMGPFWQTVVSDYIEKIVRSFCGNELTGQKPPTSNVEFSLVTFHTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSK  535
             GSY  CLVQR+GWTRD+D+F+ WLS+I F GGGF+DAAIAEGLAEALMM  + PNG Q++
Sbjct  61    GSYCGCLVQRTGWTRDVDIFMQWLSAIPFSGGGFSDAAIAEGLAEALMMFPTQPNGGQNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             QT++ QKHCIL+AASNPYPLPTPVYRP + N EQ +N      +  S AETVAKSF+QC 
Sbjct  121   QTMDMQKHCILIAASNPYPLPTPVYRPAVQNLEQHDNVEPGSSQ--SYAETVAKSFSQCF  178

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             +SLSV+CPK + KL+ IY A KRNPR AD PIDN K P YLVLISENF+EARAA +R G+
Sbjct  179   ISLSVICPKQLPKLRAIYTAGKRNPRAADPPIDNVKTPSYLVLISENFVEARAALSRPGI  238

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              SLP+ Q+PVKMD+S V            + PS NGP++NRQP+   N  PATVK+EP T
Sbjct  239   TSLPANQSPVKMDISPV---VPVTGPPPTTTPSVNGPIINRQPVSVTNGPPATVKVEPNT  295

Query  1076  VTSMP-GPTF-AHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQ  1249
             VTSM  G  +  H+PSV RAASQ V +LQTSSP+S SQEM+ NNEN Q+ KP+ V+G+ Q
Sbjct  296   VTSMTNGSGYPPHMPSVVRAASQGVPSLQTSSPLS-SQEMITNNENTQDLKPL-VNGVPQ  353

Query  1250  SVRPVGAAAANVRILNDVAQAR----QALAGGTSIGLSSMGGTPM  1372
              VR +G   ANV ILN+++QAR     AL GGTSIGL SMG TP+
Sbjct  354   PVRSLG--PANVSILNNISQARVMSTAALNGGTSIGLPSMGQTPI  396


 Score =   286 bits (733),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 183/216 (85%), Gaps = 3/216 (1%)
 Frame = +2

Query  1589  LPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtq  1768
             L  SVSV Q+VPG++Q N+ GTQ++Q+  G SQN+MS +    G+ SG GTM+PTPGM Q
Sbjct  469   LQGSVSVSQSVPGISQGNLAGTQVVQSGIGVSQNVMSNLT-QPGVSSGNGTMIPTPGMPQ  527

Query  1769  qgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLE  1948
             Q Q GM  +GVNN +AANMPL Q    +  Q+   KYVK WEGNLSGQRQGQPVFITR+E
Sbjct  528   QVQNGMHSLGVNN-AAANMPLPQHSAGALQQAQS-KYVKFWEGNLSGQRQGQPVFITRME  585

Query  1949  GYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  2128
             GYRSASAS+ LAANWP+TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK
Sbjct  586   GYRSASASDKLAANWPQTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  645

Query  2129  LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFK  2236
             LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFK
Sbjct  646   LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFK  681



>gb|AGM20684.1| PFT [Populus tomentosa]
Length=889

 Score =   460 bits (1183),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 248/430 (58%), Positives = 304/430 (71%), Gaps = 35/430 (8%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAE---------------AGSQKP  313
             MAEKQ I+AVEGTAAMGP W+ IVSDYLEKIIRC+CG E                  QK 
Sbjct  1     MAEKQFIVAVEGTAAMGPFWSIIVSDYLEKIIRCYCGNELLGQILLTIVLCLSSVQIQKV  60

Query  314   SGANVEFGLVMFNSHGSYS-------ACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA  472
               + VE  +V FNSHGSYS       ACLVQRSGWTRD+D+FL WLS+I F GGGFNDAA
Sbjct  61    PTSIVELSIVTFNSHGSYSEYPLLCEACLVQRSGWTRDVDIFLQWLSAIPFAGGGFNDAA  120

Query  473   IAEGLAEALMMLS-SPNGNQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENE  649
             I EGL+EALMM    PNG+Q++  ++ Q++CIL AASNP+PLPTPVYRPQI NSEQ EN 
Sbjct  121   IGEGLSEALMMFPIDPNGSQTQSNIDEQRNCILFAASNPHPLPTPVYRPQIQNSEQIENI  180

Query  650   TQTDDRRLSDAETVAKSFAQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNP  829
                ++ RLSDAE VAKSF QCSVSLS++CPK + KL++IY A KRN R AD P+D+ KNP
Sbjct  181   DAQNESRLSDAERVAKSFPQCSVSLSIICPKQLPKLRSIYNAGKRNSRAADPPVDSVKNP  240

Query  830   YYLVLISENFMEARAAFNRTGMPSLPSTQNPVKMDVSSVPPISGP----LPSGLASIP-S  994
             ++LVLISENF+EARAA +  G+ SL S Q PVK+D++SV  ++GP    +PS L S   S
Sbjct  241   HFLVLISENFLEARAALSLPGVTSLTSNQTPVKVDIASVTSVTGPAPTSIPSDLLSFKTS  300

Query  995   ANGPVMNRQPIPTGNIHPATVKIEPTTVTSMP-GPTFAHVPSVPRAASQPVQNLQTSSPI  1171
              NG + NR  I  GN+  ATVK+EP+T+TSM  GPTF H PSVPR ASQ V  LQTSSP 
Sbjct  301   VNGSITNRPTISVGNVPTATVKVEPSTITSMANGPTFPHNPSVPRPASQGVPILQTSSPS  360

Query  1172  SVSQEMVANNENLQETKPMVVHGMGQSVRPVGAAAANVRILNDVAQARQ-----ALAGGT  1336
             + +Q+M  + +++Q+ KP  V  M QS RP   AAANV ILN+++ ARQ      L+GGT
Sbjct  361   TTTQDMATSGDDVQDLKPN-VSVMTQSARPGPPAAANVSILNNISPARQVMNSAGLSGGT  419

Query  1337  SIGLSSMGGT  1366
             S+GL S+  T
Sbjct  420   SLGLPSINQT  429


 Score =   186 bits (473),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +2

Query  1970  SETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQL  2149
             ++ LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFL QLQEKKLCAVIQL
Sbjct  687   TDRLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLRQLQEKKLCAVIQL  746

Query  2150  PSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             PSQTLLLS SDKACRLIGMLFPGDMVVFKPQI
Sbjct  747   PSQTLLLSASDKACRLIGMLFPGDMVVFKPQI  778


 Score =   102 bits (254),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 95/131 (73%), Gaps = 2/131 (2%)
 Frame = +2

Query  1589  LPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtq  1768
             L + VS+G++ PGM+Q N+ G QM+Q+  G + N MSG+G  SG+ SG  TM+PTPGM+Q
Sbjct  508   LQAGVSIGRSAPGMSQGNISGAQMVQSGMGANPNTMSGLG-PSGVSSGLNTMIPTPGMSQ  566

Query  1769  qgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLE  1948
             Q Q GMQP+G NNNSA N+ +SQQ           KYVK WEGNLSGQR+GQPVFITRL 
Sbjct  567   QVQSGMQPLGANNNSADNLSMSQQTAGGLQPPQS-KYVKAWEGNLSGQREGQPVFITRLG  625

Query  1949  GYRSASASETL  1981
             GYRS SAS+T 
Sbjct  626   GYRSPSASDTF  636



>ref|XP_010672165.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X3 [Beta vulgaris subsp. vulgaris]
Length=704

 Score =   452 bits (1164),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 321/525 (61%), Positives = 390/525 (74%), Gaps = 31/525 (6%)
 Frame = +2

Query  689   VAKSFAQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEA  868
             ++     CSVSLSV+CPK + KLK IY A KRNPR AD  +D  K P++ V IS+NF EA
Sbjct  37    ISSRVKMCSVSLSVICPKPLPKLKAIYNAGKRNPRSADPAVDV-KQPHFFVQISDNFTEA  95

Query  869   RAAFNRTGMPSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHP  1048
              AA +R+G   L  +QNPV    +++PP SG       S+ + NG +MNR PI TG+   
Sbjct  96    LAALSRSG---LVQSQNPV----TTLPPGSGTS----TSMSTVNGSIMNRPPISTGSAPQ  144

Query  1049  ATVKIEPTTVTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKP  1225
             ATVKIEP+TVTSM  GP   H+P++PRAA+Q V +LQ SSP +VSQE+   NEN+ E KP
Sbjct  145   ATVKIEPSTVTSMTSGPAIPHMPAIPRAAAQNVPSLQASSPPAVSQELTTINENVPELKP  204

Query  1226  MVVHGMGQSVRPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPM---LSNmissg  1396
             MV   M QS+RPVGA      ILN+++QAR AL GGTS+GL SMGG  +   ++NMIS+G
Sbjct  205   MV--SMSQSLRPVGA------ILNNISQARVALTGGTSLGLPSMGGNSIGMHMTNMISNG  256

Query  1397  massvsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsq  1576
             MASSV  +Q+V+SS Q G+ ++++S  +AG  Q +Q+S   S+   TS++S  SN  +SQ
Sbjct  257   MASSVPPSQTVLSSGQPGIAAVSASGSIAGASQPIQNSTLNSYGTATSNVSGNSNHGISQ  316

Query  1577  smNTLPSSVS--VGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvp  1750
              +  L  +VS  +GQ+V G++Q N+P   M Q  T  + NM+  +G A+G  SGTG M+P
Sbjct  317   PLTNLQGNVSNTMGQSVSGISQGNLPA--MTQNGTTMNPNMIPNLG-ATGAQSGTGPMMP  373

Query  1751  tpgmtqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPV  1930
             TPGM+QQ Q GMQ +GV+N SAANMP+SQQ T+S   S   KYVKVWEGNLSGQRQGQPV
Sbjct  374   TPGMSQQVQSGMQSVGVSN-SAANMPISQQATTSLQSSQS-KYVKVWEGNLSGQRQGQPV  431

Query  1931  FITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLG  2110
             FITRLEGYR+ASASETLAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFL 
Sbjct  432   FITRLEGYRNASASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLA  491

Query  2111  QLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             QLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI
Sbjct  492   QLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  536



>ref|XP_009336605.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X1 [Pyrus x bretschneideri]
Length=682

 Score =   442 bits (1137),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 232/403 (58%), Positives = 287/403 (71%), Gaps = 17/403 (4%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             M EKQLI+AVEGT AM P+W +IVSDYL+KIIR FCG E+  QK   +  E  LV F +H
Sbjct  1     MVEKQLIVAVEGTTAMRPYWATIVSDYLDKIIRSFCGKESSGQKLCTSTFELSLVTFKTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSP-NGNQSK  535
             GSY   LV RSGWTRD+DLFLHWLS+I F GGGF DAAIAEGL+EA+MM S+  NG+Q++
Sbjct  61    GSYCGYLVGRSGWTRDVDLFLHWLSAIPFSGGGFGDAAIAEGLSEAIMMFSTAQNGSQNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q V+ QKHC+L+AASNP+ LPTPVYRPQ+ N EQ+EN     +  L DAE VAKSF QCS
Sbjct  121   QNVDCQKHCVLIAASNPHALPTPVYRPQMQNLEQNENIDAQTENHLCDAEAVAKSFPQCS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK + KL+ IY A KRN   AD PI N K P++LVLISENFMEA A  +R G+
Sbjct  181   VSLSVICPKQLPKLRAIYNAGKRNAGAADPPIGNAKEPHFLVLISENFMEACATLSRPGI  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              +LPS Q+PVKM+++ V  ++ P P+   S+PS NG VMNRQPI  GN+ PATVK+EP+T
Sbjct  241   TTLPSNQSPVKMEIAPVASVTVPPPT---SMPSVNGSVMNRQPILVGNVPPATVKVEPST  297

Query  1076  VTSMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
             ++SM GP FAH+P V    SQ V +LQTS+P S SQ M   N+++ + KP VV  M    
Sbjct  298   LSSM-GPGFAHIPCV-HPPSQAVPSLQTSTPFSASQGMTTINDSIPDFKP-VVSSMTHPS  354

Query  1256  RPVGAAAANVRILNDVAQAR----QALAGGTSIGLSSMGGTPM  1372
             RPVG       ILN+++QA      AL GGT +GL +M   PM
Sbjct  355   RPVGC------ILNNISQAHFMNAAALTGGTFMGLQTMVQNPM  391


 Score =   216 bits (550),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = +2

Query  1793  IGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASAS  1972
             +G NN+SAA++P SQQ TS+   +    YVKVWEGNL+G R GQP FIT LEG+  ASAS
Sbjct  431   LGANNSSAASVPFSQQTTSALASAQS-NYVKVWEGNLAGLRYGQPTFITILEGFGCASAS  489

Query  1973  ETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLP  2152
               LAANWP TM IVRLIS+DHM+NKQYVGKADFLVFRA NQH FLG+LQEKKLCAVIQLP
Sbjct  490   GMLAANWPPTMLIVRLISEDHMHNKQYVGKADFLVFRAKNQHAFLGKLQEKKLCAVIQLP  549

Query  2153  SQTLLLSVSDKACRLIGMLFPGDMVVFK  2236
             SQTLLLSVSD+A RL GMLFPGDMV+FK
Sbjct  550   SQTLLLSVSDRAYRLNGMLFPGDMVLFK  577



>ref|XP_010477906.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Camelina sativa]
Length=828

 Score =   442 bits (1138),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 218/383 (57%), Positives = 286/383 (75%), Gaps = 9/383 (2%)
 Frame = +2

Query  188   KQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGSY  367
             KQLI+  EGTAA+GP+W +IVSDYL KIIR FCG+E   ++   + VE  LV+FNSHGSY
Sbjct  7     KQLIVVAEGTAALGPYWQTIVSDYLHKIIRSFCGSEVNGERNPASTVELSLVIFNSHGSY  66

Query  368   SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTVE  547
              ACLVQRSGWTRD+D+FLHWLSSI FGGGGFN+ A AEGLAEALMM   P+G Q++ + +
Sbjct  67    CACLVQRSGWTRDVDIFLHWLSSIQFGGGGFNEVATAEGLAEALMMFPPPSG-QAQPSND  125

Query  548   GQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLS  727
              ++HCIL+ ASNP+ LPTPVYRP++ N E+++N     + RLSDAETVA  FA+CSVSLS
Sbjct  126   LKRHCILITASNPHTLPTPVYRPRVQNVERNDNGDAQSESRLSDAETVASYFAKCSVSLS  185

Query  728   VVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSLP  907
             VVCPK + K++ +Y A K NP+ ADL +D  KNP+YLVLISENF+EARAA + +   +LP
Sbjct  186   VVCPKQLPKIRALYNAGKLNPQSADLSMDTVKNPFYLVLISENFVEARAALSHSAT-NLP  244

Query  908   STQNPVKMDVSSVP---PISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
              TQ+PVK+D ++V    P++G  P   A + SANGP++NRQP+  G +  ATVK+EP+TV
Sbjct  245   QTQSPVKVDRATVAPSLPVTGQPP---APVTSANGPILNRQPVSVGPVPTATVKVEPSTV  301

Query  1079  TSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
             TSM P P+F H+PSV R A+Q + ++QTSS   VSQ+MV N EN  + KP+VV GM   +
Sbjct  302   TSMAPVPSFPHIPSVARPATQAIPSIQTSSASPVSQDMVTNAENAPDIKPVVVSGMTPPL  361

Query  1256  RPVGAAAANVRILNDVAQARQAL  1324
             R   +  ANV +LN+++Q RQ +
Sbjct  362   RAGPSGGANVNLLNNLSQVRQVM  384


 Score =   283 bits (723),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 182/219 (83%), Gaps = 2/219 (1%)
 Frame = +2

Query  1595  SSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqg  1774
             S++ V Q + GM+Q +  G QMMQ     +QNMMSG+G  + + SGTG M+PTPG+ QQ 
Sbjct  466   SNLGVSQPMQGMSQGSHSGPQMMQGGISMNQNMMSGLGQGN-VSSGTGGMMPTPGVAQQT  524

Query  1775  qqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGY  1954
             Q  +Q +G NN+SA+NM LSQ  + +   S   KYVKVWEGNLSGQRQGQPV ITRLEGY
Sbjct  525   QSAIQQLGGNNSSASNMQLSQPSSGALQTSQS-KYVKVWEGNLSGQRQGQPVLITRLEGY  583

Query  1955  RSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLC  2134
             RSASAS+TLAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQ+KKLC
Sbjct  584   RSASASDTLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQDKKLC  643

Query  2135  AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI N
Sbjct  644   AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIPN  682



>ref|XP_006306776.1| hypothetical protein CARUB_v10008315mg [Capsella rubella]
 gb|EOA39674.1| hypothetical protein CARUB_v10008315mg [Capsella rubella]
Length=827

 Score =   441 bits (1134),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 219/383 (57%), Positives = 283/383 (74%), Gaps = 9/383 (2%)
 Frame = +2

Query  188   KQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGSY  367
             KQLI+  EGTAA+GP+W +IVSDYL+KIIR FCG E   ++   + VE  LV+FNSHGSY
Sbjct  7     KQLIVVAEGTAALGPYWQTIVSDYLDKIIRSFCGTELNGERNPVSTVELSLVIFNSHGSY  66

Query  368   SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTVE  547
              ACLVQRSGWTRD+D+FLHWLSSI FGGGGFN+ A AEGLAEALMM   P+G Q++ + +
Sbjct  67    CACLVQRSGWTRDVDIFLHWLSSIQFGGGGFNEVATAEGLAEALMMFPPPSG-QAQPSSD  125

Query  548   GQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLS  727
              ++HCIL+ ASNP+ LPTPVYRP++ N E++EN     + RLSDAETVA  FA+CSVSLS
Sbjct  126   LKRHCILITASNPHTLPTPVYRPRLQNVERNENGDTQSESRLSDAETVASYFAKCSVSLS  185

Query  728   VVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSLP  907
             VVCPK + K++ +Y A K NP+  DL ID  KNP+YLVLISENF+EARAA + +   +LP
Sbjct  186   VVCPKQLPKIRALYNAGKLNPQSVDLSIDTVKNPFYLVLISENFVEARAALSHSAT-NLP  244

Query  908   STQNPVKMDVSSVP---PISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
              TQ+PVKMD ++V    P++G  P   A + SANGP++NRQP+  G +  ATVK+EP+TV
Sbjct  245   QTQSPVKMDRATVAPSLPVTGQPP---APVTSANGPILNRQPVSVGPVPTATVKVEPSTV  301

Query  1079  TSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
             TSM P P+F H+PSV R A+Q + ++QTSS    SQ+MV N EN  + KP+VV GM   +
Sbjct  302   TSMAPVPSFPHIPSVARPATQAIPSIQTSSASPASQDMVTNAENAPDIKPVVVGGMTAPL  361

Query  1256  RPVGAAAANVRILNDVAQARQAL  1324
             R      ANV +LN+++Q RQ +
Sbjct  362   RAGPPGGANVNLLNNLSQVRQVM  384


 Score =   281 bits (718),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 180/219 (82%), Gaps = 2/219 (1%)
 Frame = +2

Query  1595  SSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqg  1774
             S++ V Q + GMNQ +  G QMMQ     +QNMMSG+G  + + SGTG M+PTPG+ QQ 
Sbjct  466   SNLGVSQPMQGMNQGSHSGAQMMQGGISMNQNMMSGLGHGN-VSSGTGGMMPTPGVAQQA  524

Query  1775  qqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGY  1954
             Q  +Q +G +N+S  NM LSQ  + +   S   KYVKVWEGNLSGQRQGQPV ITRLEGY
Sbjct  525   QSVIQQLGGSNSSGPNMQLSQPSSGALQTSQS-KYVKVWEGNLSGQRQGQPVLITRLEGY  583

Query  1955  RSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLC  2134
             RSASAS+TLAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQ+KKLC
Sbjct  584   RSASASDTLAANWPATMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQDKKLC  643

Query  2135  AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI N
Sbjct  644   AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIPN  682



>ref|XP_010532164.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Tarenaya hassleriana]
Length=810

 Score =   440 bits (1131),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 226/396 (57%), Positives = 294/396 (74%), Gaps = 15/396 (4%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEKQLII VEGTAA+GP+W +IVSDYLEKIIR FCG E G + P+ +N+E  LV FNSH
Sbjct  1     MAEKQLIIVVEGTAALGPYWQTIVSDYLEKIIRSFCGMENGQRVPA-SNIELSLVTFNSH  59

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQ  538
             GSYS CLVQRSGWTR+ID+F+ WLSSI F GGGFN+AA AEGLAEALMM S P G Q++Q
Sbjct  60    GSYSGCLVQRSGWTRNIDMFIQWLSSIQFAGGGFNEAATAEGLAEALMMFSPPPG-QAQQ  118

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             + + + HCILVAASNPY LPTPVY P + N E++E      + RLSDAETVAK F +CS+
Sbjct  119   SSDFKMHCILVAASNPYTLPTPVYHPPLQNVERNETGEGQSESRLSDAETVAKYFPKCSI  178

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSV+CPK +LK++ IY A K NP+  DL ID  KNP+YLVLISENF+EARAA +RT   
Sbjct  179   SLSVICPKELLKIRAIYNAGKLNPQTTDLSIDTVKNPFYLVLISENFVEARAALSRTPT-  237

Query  899   SLPSTQNPVKMDVSSV--PPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPT  1072
             +LP  Q+P+K+D S++  PP++G      A +PSANG V+ RQ +  G +  ATVK+EP+
Sbjct  238   NLPQIQSPLKVDRSTIAPPPVTG---QPQAPVPSANGSVLTRQSVSAGIVQNATVKVEPS  294

Query  1073  TVTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQ  1249
             +V SM P P+F+H+P++ R A+  +  +QT+S   +SQE++++ E++Q+ KP VV GM Q
Sbjct  295   SVPSMAPLPSFSHIPTIARPATPAIPAMQTTSASPISQEVISSAESVQDIKP-VVGGMTQ  353

Query  1250  SVRPVGAAAANVRILNDVAQARQ-----ALAGGTSI  1342
             S+R      ANV +LN+++Q RQ     ALAG TS+
Sbjct  354   SLRAGPLGGANVNLLNNLSQVRQVMSSAALAGATSL  389


 Score =   261 bits (667),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 174/216 (81%), Gaps = 7/216 (3%)
 Frame = +2

Query  1598  SVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgq  1777
             S+ V Q + GM+Q +  G  +M      +QN+MSG+G A+       +M+PTPG+ QQ Q
Sbjct  463   SLGVSQPMQGMSQGSHQGGIVM------NQNLMSGLGQANVSSGTGSSMMPTPGIAQQVQ  516

Query  1778  qgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYR  1957
              G QP+ VNN+SA+N+  SQ  + +   S   KYVKVWEG+LSGQRQGQPV ITRLEGY+
Sbjct  517   SGTQPLSVNNSSASNVQFSQPSSGAIQASQS-KYVKVWEGHLSGQRQGQPVLITRLEGYK  575

Query  1958  SASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCA  2137
             SASA ++LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQEKKLCA
Sbjct  576   SASAPDSLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQEKKLCA  635

Query  2138  VIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             VIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI
Sbjct  636   VIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  671



>ref|XP_010462903.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Camelina sativa]
Length=792

 Score =   438 bits (1127),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 217/383 (57%), Positives = 285/383 (74%), Gaps = 9/383 (2%)
 Frame = +2

Query  188   KQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGSY  367
             KQLI+  EGTAA+GP+W +IVSDYL KIIR FCG+E   ++   + VE  LV+FNSHGSY
Sbjct  6     KQLIVVAEGTAALGPYWQTIVSDYLHKIIRSFCGSELNGERNPASTVELSLVIFNSHGSY  65

Query  368   SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTVE  547
              ACLVQRSGWTRD+D+FLHWLSSI FGGGGF++ A AEGLAEALMM   P+G Q++ + +
Sbjct  66    CACLVQRSGWTRDVDIFLHWLSSIQFGGGGFSEVATAEGLAEALMMFPPPSG-QAQPSND  124

Query  548   GQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLS  727
              ++HCIL+ ASNP+ LPTPVYRP++ N E+++N     + RLSDAETVA  FA+CSVSLS
Sbjct  125   LKRHCILITASNPHTLPTPVYRPRVQNVERNDNGDAQSESRLSDAETVASYFAKCSVSLS  184

Query  728   VVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSLP  907
             VVCPK + K++ +Y A K NP+ ADL +D  KNP+YLVLISENF+EARAA + +   +LP
Sbjct  185   VVCPKQLPKIRALYNAGKLNPQSADLSMDTVKNPFYLVLISENFVEARAALSHSAT-NLP  243

Query  908   STQNPVKMDVSSVP---PISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
              TQ+PVK+D ++V    P++G  P   A + SANGP++NRQP+  G +  ATVK+EP+TV
Sbjct  244   QTQSPVKVDRATVAPSLPVTGQPP---APVTSANGPILNRQPVSVGPVPTATVKVEPSTV  300

Query  1079  TSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
             TSM P P+F H+PSV R A+Q   ++QTSS   VSQ+MV N EN  + KP+VV GM   +
Sbjct  301   TSMAPVPSFPHIPSVARPATQATPSIQTSSASPVSQDMVTNAENAPDIKPVVVSGMTPPL  360

Query  1256  RPVGAAAANVRILNDVAQARQAL  1324
             R   +  ANV +LN+++Q RQ +
Sbjct  361   RAGPSGGANVNLLNNLSQVRQVM  383


 Score =   147 bits (371),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 109/219 (50%), Positives = 132/219 (60%), Gaps = 44/219 (20%)
 Frame = +2

Query  1595  SSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqg  1774
             S++ V Q + GM+Q +  G QMMQ     +QNMMSG+G  + + SGTG M+PTPG+ QQ 
Sbjct  465   SNLGVSQPMQGMSQGSHSGPQMMQGGISMNQNMMSGLGQGN-VSSGTGGMMPTPGVAQQT  523

Query  1775  qqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGY  1954
             Q  +Q +G NN+SA+NM LSQ  + +   S   KYVKVWEGNLSGQRQGQPV ITRLEGY
Sbjct  524   QSAIQQLGGNNSSASNMQLSQPSSGALQTSQS-KYVKVWEGNLSGQRQGQPVLITRLEGY  582

Query  1955  RSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLC  2134
             RSASAS+TLAANWP TMQIVRLISQDHMNNK                             
Sbjct  583   RSASASDTLAANWPPTMQIVRLISQDHMNNK-----------------------------  613

Query  2135  AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
                          ++ + C +  + F  DMVVFKPQI N
Sbjct  614   -------------LTLEFCFVFCVGFAQDMVVFKPQIPN  639



>ref|XP_002890684.1| hypothetical protein ARALYDRAFT_472815 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66943.1| hypothetical protein ARALYDRAFT_472815 [Arabidopsis lyrata subsp. 
lyrata]
Length=832

 Score =   439 bits (1130),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 220/383 (57%), Positives = 285/383 (74%), Gaps = 9/383 (2%)
 Frame = +2

Query  188   KQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGSY  367
             KQLI+  EGTAA+GP+W +IVSDYLEKIIR FCG+E   ++   + VE  LV+FNSHGSY
Sbjct  6     KQLIVVAEGTAALGPYWQTIVSDYLEKIIRSFCGSELNGERNPVSTVELSLVIFNSHGSY  65

Query  368   SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTVE  547
              ACLVQRSGWTRD+D+FLHWLSSI FGGGGFN+ A AEGLAEALMM S P+G Q++ + +
Sbjct  66    CACLVQRSGWTRDVDIFLHWLSSIQFGGGGFNEVATAEGLAEALMMFSPPSG-QAQPSND  124

Query  548   GQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLS  727
              ++HCIL+ ASNP+ LPTPV+RP++ + E++EN     + RLSDAETVA  FA+CSVSLS
Sbjct  125   LKRHCILITASNPHTLPTPVFRPRLQSVERNENGDAQAESRLSDAETVASYFAKCSVSLS  184

Query  728   VVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSLP  907
             VVCPK + K++ +Y A K NP+ ADL ID  KN +YLVLISENF+EARAA + +   +LP
Sbjct  185   VVCPKQLPKIRALYNAGKLNPQSADLSIDTAKNTFYLVLISENFVEARAALSHSAT-NLP  243

Query  908   STQNPVKMDVSSVP---PISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
              TQ+PVK+D ++V    P++G  P   A + SANGP+ NRQP+  G +  ATVK+EP+TV
Sbjct  244   QTQSPVKVDRATVAPSLPVTGQPP---APVTSANGPIQNRQPVSVGPVPTATVKVEPSTV  300

Query  1079  TSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
             TSM P P F H+PSV R A+QP+ ++QTSS   VSQ+MV N EN  + KP+VV GM   +
Sbjct  301   TSMAPVPNFPHIPSVARPATQPIPSIQTSSASPVSQDMVTNAENAPDIKPVVVGGMTPPL  360

Query  1256  RPVGAAAANVRILNDVAQARQAL  1324
             R      ANV +LN+++Q RQ +
Sbjct  361   RTGPPGGANVNLLNNLSQVRQVM  383


 Score =   254 bits (649),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 181/219 (83%), Gaps = 3/219 (1%)
 Frame = +2

Query  1595  SSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqg  1774
             S++ V Q + GMNQ +  G  MMQ     +QN++SG+G  + + SGTG M+PTPG+ QQ 
Sbjct  465   SNLGVSQPMQGMNQGSHSGA-MMQGGISMNQNIVSGLGQGN-VSSGTGGMMPTPGVGQQA  522

Query  1775  qqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGY  1954
             Q G+Q +G +N+SA NM LSQ  + +   S   KYVKVWEGNLSGQRQGQPV ITRLEGY
Sbjct  523   QSGIQQLGGSNSSAPNMQLSQPSSGALQTSQS-KYVKVWEGNLSGQRQGQPVLITRLEGY  581

Query  1955  RSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLC  2134
             RSASAS++LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQ+KKLC
Sbjct  582   RSASASDSLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQDKKLC  641

Query  2135  AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI N
Sbjct  642   AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIPN  680



>gb|KFK44547.1| phytochrome and flowering time regulatory protein 1 [Arabis alpina]
Length=822

 Score =   431 bits (1109),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 217/386 (56%), Positives = 288/386 (75%), Gaps = 16/386 (4%)
 Frame = +2

Query  188   KQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGSY  367
             KQLI+  EGTAA+GP+W +IVSDYLEKIIR FCG+E   ++   +NVE  LV+FNSHGSY
Sbjct  6     KQLIVVAEGTAALGPYWQTIVSDYLEKIIRSFCGSELNGERNPVSNVELSLVIFNSHGSY  65

Query  368   SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTVE  547
              ACLVQRSGWTRD+D+FLHWLSSI F GGGF++AA AEGLAEALMM S P+G Q++ + +
Sbjct  66    CACLVQRSGWTRDVDIFLHWLSSIQFAGGGFSEAATAEGLAEALMMFSPPSG-QAQPSND  124

Query  548   GQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLS  727
              ++HCIL+ ASNP+ LPTPV+RPQ+ N+E++EN     + RLSDAETVA  F++CSVSLS
Sbjct  125   LKRHCILITASNPHSLPTPVFRPQLQNTERNENGDGQSESRLSDAETVASYFSRCSVSLS  184

Query  728   VVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSLP  907
             VVCPK + K++ ++ A K NP+ ADL ID  KNP+YLVLISENF+EARAA + +   +LP
Sbjct  185   VVCPKQLPKIRALFNAGKLNPQSADLSIDTVKNPFYLVLISENFVEARAALSPSAT-NLP  243

Query  908   STQNPVKMDVSSVP---PISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
               Q+PVK+D +++    P++G  P   AS+ SANGP++NRQP+  G +  ATVK+EPTTV
Sbjct  244   QNQSPVKVDRATIAPSLPVTGQPP---ASVASANGPILNRQPVSVGPVPTATVKVEPTTV  300

Query  1079  TSMPG-PTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
             +SM G P+F H+ SV R A+Q + ++QTSS   VSQEMV N EN+ + KP+V    G + 
Sbjct  301   SSMAGVPSFPHIASVARPATQAIPSIQTSSASPVSQEMVTNAENVPDVKPVV----GVTT  356

Query  1256  RPVGA---AAANVRILNDVAQARQAL  1324
              P+       ANV +LN+++Q RQ +
Sbjct  357   APLRTGPPGGANVNLLNNLSQVRQVM  382


 Score =   261 bits (668),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 178/210 (85%), Gaps = 2/210 (1%)
 Frame = +2

Query  1622  PGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgmqpIGV  1801
             PGMNQ +  G QMMQ     +QNMM+G+G  + + SGTG M+PTPG+ QQ Q G+Q +G 
Sbjct  472   PGMNQGSHSGVQMMQGGISMNQNMMNGLGQGN-VSSGTGGMMPTPGVGQQAQSGIQQLGG  530

Query  1802  NNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETL  1981
             +N+SA NM +SQ  +++   S   KYVKVWEGNLSGQRQGQPV ITRLEGYRSASAS++L
Sbjct  531   SNSSAPNMQMSQPSSAALQTSQS-KYVKVWEGNLSGQRQGQPVLITRLEGYRSASASDSL  589

Query  1982  AANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQT  2161
             AANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQ+KKLCAVIQLPSQT
Sbjct  590   AANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQDKKLCAVIQLPSQT  649

Query  2162  LLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             LLLSVSDKACRLIGMLFPGDMVVFKPQI N
Sbjct  650   LLLSVSDKACRLIGMLFPGDMVVFKPQIPN  679



>ref|XP_006415883.1| hypothetical protein EUTSA_v10006778mg [Eutrema salsugineum]
 gb|ESQ34236.1| hypothetical protein EUTSA_v10006778mg [Eutrema salsugineum]
Length=643

 Score =   425 bits (1093),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 217/383 (57%), Positives = 282/383 (74%), Gaps = 14/383 (4%)
 Frame = +2

Query  188   KQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGSY  367
             KQLI+  EGTAA+GP+W +IVSDYLEKIIR FCG+E   ++    NVE  LV+FNSHGSY
Sbjct  6     KQLIVVAEGTAALGPYWHTIVSDYLEKIIRSFCGSELNGER----NVELSLVIFNSHGSY  61

Query  368   SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTVE  547
              ACLVQRSGWT+D+D+FLHWLSSI F GGGF++AA AEGLAEALMM S P+G Q++ + +
Sbjct  62    CACLVQRSGWTKDVDIFLHWLSSIQFAGGGFSEAATAEGLAEALMMFSPPSG-QAQPSND  120

Query  548   GQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLS  727
              ++HCIL+ ASNP+ LPTPVYRP++ N+E++EN     + RLSDAETVA  F++CSVSLS
Sbjct  121   LKRHCILITASNPHSLPTPVYRPKLPNAERNENGDAQSESRLSDAETVASYFSRCSVSLS  180

Query  728   VVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSLP  907
             V+CPK + K++ +Y A K NP+  DL ID  KN +YLVLI ENF+EARAA + +   +LP
Sbjct  181   VICPKQLPKIRALYNAGKLNPQSPDLSIDTVKNTFYLVLIPENFVEARAALSHSAT-NLP  239

Query  908   STQNPVKMDVSSVP---PISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
              TQ+PVK+D S+V    P++G  P   A +PSANGP++NRQP+  G +  ATVK+EP+TV
Sbjct  240   QTQSPVKVDRSTVAPSLPVTGQPP---APVPSANGPILNRQPVSIGPVPTATVKVEPSTV  296

Query  1079  TSMPG-PTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
              SM    TF H+ SV R A+Q + ++QTSSP  VSQEMV N EN  + KP VV GM   +
Sbjct  297   PSMAAVSTFPHIQSVARPATQAIPSIQTSSPSPVSQEMVTNAENAPDVKP-VVTGMTPPL  355

Query  1256  RPVGAAAANVRILNDVAQARQAL  1324
             R      ANV +LN+++Q RQ +
Sbjct  356   RTGPPGGANVNLLNNLSQVRQVM  378


 Score =   189 bits (481),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 149/185 (81%), Gaps = 2/185 (1%)
 Frame = +2

Query  1595  SSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqg  1774
             S++ V Q +PGMNQ +  G QMMQ     +QNMMSG+G  + + SGTG M+PTPG+ QQ 
Sbjct  460   SNLGVSQPMPGMNQGSHSGAQMMQGGIPMNQNMMSGLGQGN-VSSGTGGMMPTPGVGQQA  518

Query  1775  qqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGY  1954
             Q G+Q +G +N+SA NM LSQ  +++   S   KYVKVWEGNLSGQRQGQPV ITRLEGY
Sbjct  519   QSGIQQLGGSNSSAPNMQLSQPSSAALQTSQS-KYVKVWEGNLSGQRQGQPVLITRLEGY  577

Query  1955  RSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLC  2134
             RSASAS++LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQ+KKL 
Sbjct  578   RSASASDSLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQDKKLV  637

Query  2135  AVIQL  2149
             +++ +
Sbjct  638   SLVDI  642



>ref|NP_173925.3| mediator of RNA polymerase II transcription subunit 25 [Arabidopsis 
thaliana]
 sp|Q7XYY2.1|MED25_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 
25; Short=AtMED25; AltName: Full=Phytochrome and flowering 
time 1 protein; AltName: Full=Phytochrome and flowering 
time regulatory protein 1 [Arabidopsis thaliana]
 gb|AAO39425.1| phytochrome and flowering time 1 protein [Arabidopsis thaliana]
 gb|AEE30639.1| mediator of RNA polymerase II transcription subunit 25 [Arabidopsis 
thaliana]
Length=836

 Score =   430 bits (1105),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 217/383 (57%), Positives = 283/383 (74%), Gaps = 9/383 (2%)
 Frame = +2

Query  188   KQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGSY  367
             KQLI+  EGTAA+GP+W +IVSDYLEKIIR FCG+E   ++   + VE  LV+FNSHGSY
Sbjct  6     KQLIVVAEGTAALGPYWQTIVSDYLEKIIRSFCGSELNGERNPVSTVELSLVIFNSHGSY  65

Query  368   SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTVE  547
              ACLVQRSGWTRD+D+FLHWLSSI FGGGGFN+ A AEGLAEALMM S P+G Q++ + +
Sbjct  66    CACLVQRSGWTRDVDIFLHWLSSIQFGGGGFNEVATAEGLAEALMMFSPPSG-QAQPSND  124

Query  548   GQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLS  727
              ++HCIL+ ASNP+ LPTPVYRP++ N E++EN     + RLSDAETVA  FA+CSVSLS
Sbjct  125   LKRHCILITASNPHILPTPVYRPRLQNVERNENGDAQAESRLSDAETVASYFAKCSVSLS  184

Query  728   VVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSLP  907
             VVCPK +  ++ +Y A K N + ADL ID  KN +YLVLISENF+EA AA + +   +LP
Sbjct  185   VVCPKQLPTIRALYNAGKPNQQSADLSIDTAKNTFYLVLISENFVEACAALSHSAT-NLP  243

Query  908   STQNPVKMDVSSVP---PISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
              TQ+PVK+D ++V    P++G  P   A + SANGP+ NRQP+  G +  ATVK+EP+TV
Sbjct  244   QTQSPVKVDRATVAPSIPVTGQPP---APVSSANGPIQNRQPVSVGPVPTATVKVEPSTV  300

Query  1079  TSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
             TSM P P+F H+P+V R A+Q + ++QTSS   VSQ+MV+N EN  + KP+VV GM   +
Sbjct  301   TSMAPVPSFPHIPAVARPATQAIPSIQTSSASPVSQDMVSNAENAPDIKPVVVSGMTPPL  360

Query  1256  RPVGAAAANVRILNDVAQARQAL  1324
             R      ANV +LN+++Q RQ +
Sbjct  361   RTGPPGGANVNLLNNLSQVRQVM  383


 Score =   258 bits (658),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 181/219 (83%), Gaps = 3/219 (1%)
 Frame = +2

Query  1595  SSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqg  1774
             S++ V Q + GMNQ +  G  MMQ     +QNMMSG+G  + + SGTG M+PTPG+ QQ 
Sbjct  465   SNLGVSQPMQGMNQGSHSGA-MMQGGISMNQNMMSGLGQGN-VSSGTGGMMPTPGVGQQA  522

Query  1775  qqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGY  1954
             Q G+Q +G +N+SA NM LSQ  + +   S   KYVKVWEGNLSGQRQGQPV ITRLEGY
Sbjct  523   QSGIQQLGGSNSSAPNMQLSQPSSGAMQTSQS-KYVKVWEGNLSGQRQGQPVLITRLEGY  581

Query  1955  RSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLC  2134
             RSASAS++LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQ+KKLC
Sbjct  582   RSASASDSLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQDKKLC  641

Query  2135  AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI N
Sbjct  642   AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIPN  680



>ref|XP_009109891.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Brassica rapa]
Length=832

 Score =   429 bits (1104),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 219/385 (57%), Positives = 286/385 (74%), Gaps = 13/385 (3%)
 Frame = +2

Query  185   EKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGS  364
             +KQLI+  EGTAA+GP+W +IVSDYL KIIR FCG+E   ++   ++VE  LV+FNSHGS
Sbjct  5     KKQLIVVAEGTAALGPYWQTIVSDYLHKIIRSFCGSELNGERNPVSSVELSLVIFNSHGS  64

Query  365   YSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
             Y  CLVQRSGWTRD+D+FLHWLSSI F GGGF++AA AEGLAEALMM   P G Q++ + 
Sbjct  65    YCGCLVQRSGWTRDVDIFLHWLSSIQFAGGGFSEAATAEGLAEALMMFPPPPG-QAQPSN  123

Query  545   EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
             + ++HCIL+ ASNPY LPTPVYRP++ N+E++EN     + RLSDAETVA  F++C+VSL
Sbjct  124   DLKRHCILITASNPYSLPTPVYRPKLQNAERNENGDALPESRLSDAETVASYFSRCAVSL  183

Query  725   SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSL  904
             SVVCPK + K++ +Y A K NP+ +DL ID  KN +YLVLISENF+EARAA + +   ++
Sbjct  184   SVVCPKQLPKIRALYNAGKLNPQSSDLSIDTVKNTFYLVLISENFVEARAALSHSAT-NV  242

Query  905   PSTQNPVKMDVSSVP---PISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
             P TQ+PVKMD ++V    P++GP P   AS+PSANGP++NRQP+  G +  ATVK+EP+T
Sbjct  243   PQTQSPVKMDRATVAPSLPVTGPPP---ASLPSANGPILNRQPVSVGPVPTATVKVEPST  299

Query  1076  VTSMPG-PTFAHVP-SVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQ  1249
             V+SM   PTF H+P SV R ASQ + ++QTSS  SVSQEMV N EN  + KP VV GM  
Sbjct  300   VSSMAAVPTFPHIPSSVARPASQAIPSVQTSSASSVSQEMVTNAENAPDVKP-VVTGMTP  358

Query  1250  SVRPVGAAAANVRILNDVAQARQAL  1324
              +R       NV +LN+++Q RQ +
Sbjct  359   PLR--TGPPGNVNLLNNLSQVRQVM  381


 Score =   278 bits (710),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 182/219 (83%), Gaps = 2/219 (1%)
 Frame = +2

Query  1595  SSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqg  1774
             S++ V Q +P MNQ +  G QMMQ     +QNM++ +G  + + SGTG M+PTPG+ QQ 
Sbjct  463   SNLGVSQPMPAMNQGSHSGGQMMQGGISMNQNMITSLGQGN-VSSGTGGMMPTPGVGQQA  521

Query  1775  qqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGY  1954
             Q G+Q +G +N+SA NM LSQ  + +   S   KYVKVWEGNLSGQRQGQPV ITRLEGY
Sbjct  522   QSGIQQLGGSNSSAPNMQLSQASSGALQPSQS-KYVKVWEGNLSGQRQGQPVLITRLEGY  580

Query  1955  RSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLC  2134
             R+A+AS++LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQ+KKLC
Sbjct  581   RNATASDSLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQDKKLC  640

Query  2135  AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN
Sbjct  641   AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  679



>ref|XP_009109890.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Brassica rapa]
Length=837

 Score =   429 bits (1103),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 219/385 (57%), Positives = 286/385 (74%), Gaps = 13/385 (3%)
 Frame = +2

Query  185   EKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGS  364
             +KQLI+  EGTAA+GP+W +IVSDYL KIIR FCG+E   ++   ++VE  LV+FNSHGS
Sbjct  5     KKQLIVVAEGTAALGPYWQTIVSDYLHKIIRSFCGSELNGERNPVSSVELSLVIFNSHGS  64

Query  365   YSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
             Y  CLVQRSGWTRD+D+FLHWLSSI F GGGF++AA AEGLAEALMM   P G Q++ + 
Sbjct  65    YCGCLVQRSGWTRDVDIFLHWLSSIQFAGGGFSEAATAEGLAEALMMFPPPPG-QAQPSN  123

Query  545   EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
             + ++HCIL+ ASNPY LPTPVYRP++ N+E++EN     + RLSDAETVA  F++C+VSL
Sbjct  124   DLKRHCILITASNPYSLPTPVYRPKLQNAERNENGDALPESRLSDAETVASYFSRCAVSL  183

Query  725   SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSL  904
             SVVCPK + K++ +Y A K NP+ +DL ID  KN +YLVLISENF+EARAA + +   ++
Sbjct  184   SVVCPKQLPKIRALYNAGKLNPQSSDLSIDTVKNTFYLVLISENFVEARAALSHSAT-NV  242

Query  905   PSTQNPVKMDVSSVP---PISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
             P TQ+PVKMD ++V    P++GP P   AS+PSANGP++NRQP+  G +  ATVK+EP+T
Sbjct  243   PQTQSPVKMDRATVAPSLPVTGPPP---ASLPSANGPILNRQPVSVGPVPTATVKVEPST  299

Query  1076  VTSMPG-PTFAHVP-SVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQ  1249
             V+SM   PTF H+P SV R ASQ + ++QTSS  SVSQEMV N EN  + KP VV GM  
Sbjct  300   VSSMAAVPTFPHIPSSVARPASQAIPSVQTSSASSVSQEMVTNAENAPDVKP-VVTGMTP  358

Query  1250  SVRPVGAAAANVRILNDVAQARQAL  1324
              +R       NV +LN+++Q RQ +
Sbjct  359   PLR--TGPPGNVNLLNNLSQVRQVM  381


 Score =   271 bits (694),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 182/224 (81%), Gaps = 7/224 (3%)
 Frame = +2

Query  1595  SSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqg  1774
             S++ V Q +P MNQ +  G QMMQ     +QNM++ +G  + + SGTG M+PTPG+ QQ 
Sbjct  463   SNLGVSQPMPAMNQGSHSGGQMMQGGISMNQNMITSLGQGN-VSSGTGGMMPTPGVGQQA  521

Query  1775  qqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGY  1954
             Q G+Q +G +N+SA NM LSQ  + +   S   KYVKVWEGNLSGQRQGQPV ITRLEGY
Sbjct  522   QSGIQQLGGSNSSAPNMQLSQASSGALQPSQS-KYVKVWEGNLSGQRQGQPVLITRLEGY  580

Query  1955  RSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLC  2134
             R+A+AS++LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQ+KKLC
Sbjct  581   RNATASDSLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQDKKLC  640

Query  2135  AVIQLPSQTLLLSVSDKACRLIGMLFPG-----DMVVFKPQITN  2251
             AVIQLPSQTLLLSVSDKACRLIGMLFPG     DMVVFKPQITN
Sbjct  641   AVIQLPSQTLLLSVSDKACRLIGMLFPGVSKHQDMVVFKPQITN  684



>ref|XP_009336606.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X2 [Pyrus x bretschneideri]
Length=658

 Score =   423 bits (1088),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 221/399 (55%), Positives = 274/399 (69%), Gaps = 33/399 (8%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             M EKQLI+AVEGT AM P+W +IVSDYL+KIIR FCG E+  QK   +  E  LV F +H
Sbjct  1     MVEKQLIVAVEGTTAMRPYWATIVSDYLDKIIRSFCGKESSGQKLCTSTFELSLVTFKTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSP-NGNQSK  535
             GSY   LV RSGWTRD+DLFLHWLS+I F GGGF DAAIAEGL+EA+MM S+  NG+Q++
Sbjct  61    GSYCGYLVGRSGWTRDVDLFLHWLSAIPFSGGGFGDAAIAEGLSEAIMMFSTAQNGSQNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q V+ QKHC+L+AASNP+ LPTPVYRPQ+ N EQ+EN     +  L DAE VAKSF QCS
Sbjct  121   QNVDCQKHCVLIAASNPHALPTPVYRPQMQNLEQNENIDAQTENHLCDAEAVAKSFPQCS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK + KL+ IY A KRN   AD PI N K P++LVLISENFMEA A  +R G+
Sbjct  181   VSLSVICPKQLPKLRAIYNAGKRNAGAADPPIGNAKEPHFLVLISENFMEACATLSRPGI  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              +LPS Q+PVKM+++ V  ++ P P+   S+PS NG VMNRQPI  GN+ PATVK+EP+T
Sbjct  241   TTLPSNQSPVKMEIAPVASVTVPPPT---SMPSVNGSVMNRQPILVGNVPPATVKVEPST  297

Query  1076  VTSMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
             ++SM GP FAH+P V    SQ V +LQTS+P S SQ M   N+++ + KP+V        
Sbjct  298   LSSM-GPGFAHIPCV-HPPSQAVPSLQTSTPFSASQGMTTINDSIPDFKPVV--------  347

Query  1256  RPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPM  1372
                                  AL GGT +GL +M   PM
Sbjct  348   -------------------STALTGGTFMGLQTMVQNPM  367


 Score =   216 bits (550),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = +2

Query  1793  IGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASAS  1972
             +G NN+SAA++P SQQ TS+   +    YVKVWEGNL+G R GQP FIT LEG+  ASAS
Sbjct  407   LGANNSSAASVPFSQQTTSALASAQS-NYVKVWEGNLAGLRYGQPTFITILEGFGCASAS  465

Query  1973  ETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLP  2152
               LAANWP TM IVRLIS+DHM+NKQYVGKADFLVFRA NQH FLG+LQEKKLCAVIQLP
Sbjct  466   GMLAANWPPTMLIVRLISEDHMHNKQYVGKADFLVFRAKNQHAFLGKLQEKKLCAVIQLP  525

Query  2153  SQTLLLSVSDKACRLIGMLFPGDMVVFK  2236
             SQTLLLSVSD+A RL GMLFPGDMV+FK
Sbjct  526   SQTLLLSVSDRAYRLNGMLFPGDMVLFK  553



>ref|XP_010551298.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X3 [Tarenaya hassleriana]
Length=765

 Score =   426 bits (1095),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 227/407 (56%), Positives = 295/407 (72%), Gaps = 18/407 (4%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MA+KQL + VEGTAA+GP+W +IVSDYLEKIIR FC  E G + P+ +N E  LV FNSH
Sbjct  1     MADKQLTVVVEGTAALGPYWQTIVSDYLEKIIRSFCDIENGQRVPA-SNFELSLVTFNSH  59

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQ  538
             GSY ACLVQRSGWTR+ID+F+ WLSSI F GGGFN+AA AEGLAEALMM S P+G Q++ 
Sbjct  60    GSYCACLVQRSGWTRNIDMFIQWLSSIQFSGGGFNEAATAEGLAEALMMFSPPSG-QAQP  118

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             + + ++HCIL+AASNP+ LPTPV+RPQ+ N E+ EN     + RLSDAETVAK F++CSV
Sbjct  119   SNDFKRHCILIAASNPHTLPTPVFRPQLQNVERGENGEVQSESRLSDAETVAKYFSRCSV  178

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSV+CPK + K++ IY A K NP+GADL I+  KNP+YLVLISENF+EARAA + T   
Sbjct  179   SLSVICPKQLPKIRAIYNAGKFNPQGADLSIETVKNPFYLVLISENFLEARAALSHTAT-  237

Query  899   SLPSTQNPVKMDVSSV--PPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPT  1072
             +LP  Q+P+K+D +++  PP++G      A + SANG V+ RQ +  G I  ATVK+EP+
Sbjct  238   NLPQIQSPLKVDRTTIAPPPVTG---QPQAPVASANGSVLTRQSVSVGAIPNATVKVEPS  294

Query  1073  TVTSMPG-PTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQ  1249
             TVTSM   P+F  + SV    +Q +  +Q SS   VSQEMV+N E++Q+ KP  V GM Q
Sbjct  295   TVTSMASHPSFPCISSVAHPTTQAIPAMQASSASPVSQEMVSNAESVQDIKPF-VGGMPQ  353

Query  1250  SVRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPML  1375
                P+ A  ANV +LN+++Q RQ     ALAG TS G++S+ G+  L
Sbjct  354   ---PLHAGGANVNLLNNLSQLRQVMSSAALAGATSSGITSVPGSGTL  397


 Score =   264 bits (674),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 181/215 (84%), Gaps = 2/215 (1%)
 Frame = +2

Query  1601  VSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqq  1780
             + V Q++PGMNQ   PG QM+      SQN+MSG+G A+   SGTG+M+P PG +Q+ Q 
Sbjct  425   IGVPQSMPGMNQGGHPGAQMVPGGIVMSQNLMSGLGQANA-SSGTGSMMPIPGFSQEVQS  483

Query  1781  gmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRS  1960
             G QP+ V+N+SA+NM LSQQ + +       KYVKVWEGNLSGQRQGQPV IT+LEGYRS
Sbjct  484   GTQPLSVSNSSASNMQLSQQSSGAMQNPQS-KYVKVWEGNLSGQRQGQPVLITKLEGYRS  542

Query  1961  ASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAV  2140
             ASAS++LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQEKKLCAV
Sbjct  543   ASASDSLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQEKKLCAV  602

Query  2141  IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI
Sbjct  603   IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  637



>ref|XP_009336607.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X3 [Pyrus x bretschneideri]
Length=657

 Score =   422 bits (1085),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 220/399 (55%), Positives = 273/399 (68%), Gaps = 34/399 (9%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             M EKQLI+AVEGT AM P+W +IVSDYL+KIIR FCG E+  QK   +  E  LV F +H
Sbjct  1     MVEKQLIVAVEGTTAMRPYWATIVSDYLDKIIRSFCGKESSGQKLCTSTFELSLVTFKTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSP-NGNQSK  535
             GSY   LV RSGWTRD+DLFLHWLS+I F GGGF DAAIAEGL+EA+MM S+  NG+Q++
Sbjct  61    GSYCGYLVGRSGWTRDVDLFLHWLSAIPFSGGGFGDAAIAEGLSEAIMMFSTAQNGSQNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q V+ QKHC+L+AASNP+ LPTPVYRPQ+ N EQ+EN     +  L DAE VAKSF QCS
Sbjct  121   QNVDCQKHCVLIAASNPHALPTPVYRPQMQNLEQNENIDAQTENHLCDAEAVAKSFPQCS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+CPK + KL+ IY A KRN   AD PI N K P++LVLISENFMEA A  +R G+
Sbjct  181   VSLSVICPKQLPKLRAIYNAGKRNAGAADPPIGNAKEPHFLVLISENFMEACATLSRPGI  240

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              +LPS Q+PVKM+++ V  ++ P P+   S+PS NG VMNRQPI  GN+ PATVK+EP+T
Sbjct  241   TTLPSNQSPVKMEIAPVASVTVPPPT---SMPSVNGSVMNRQPILVGNVPPATVKVEPST  297

Query  1076  VTSMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
             ++SM GP FAH+P V    SQ V +LQTS+P S SQ M   N+++ + KP+V        
Sbjct  298   LSSM-GPGFAHIPCV-HPPSQAVPSLQTSTPFSASQGMTTINDSIPDFKPVV--------  347

Query  1256  RPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPM  1372
                                   L GGT +GL +M   PM
Sbjct  348   --------------------STLTGGTFMGLQTMVQNPM  366


 Score =   216 bits (550),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = +2

Query  1793  IGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASAS  1972
             +G NN+SAA++P SQQ TS+   +    YVKVWEGNL+G R GQP FIT LEG+  ASAS
Sbjct  406   LGANNSSAASVPFSQQTTSALASAQS-NYVKVWEGNLAGLRYGQPTFITILEGFGCASAS  464

Query  1973  ETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLP  2152
               LAANWP TM IVRLIS+DHM+NKQYVGKADFLVFRA NQH FLG+LQEKKLCAVIQLP
Sbjct  465   GMLAANWPPTMLIVRLISEDHMHNKQYVGKADFLVFRAKNQHAFLGKLQEKKLCAVIQLP  524

Query  2153  SQTLLLSVSDKACRLIGMLFPGDMVVFK  2236
             SQTLLLSVSD+A RL GMLFPGDMV+FK
Sbjct  525   SQTLLLSVSDRAYRLNGMLFPGDMVLFK  552



>emb|CDY24392.1| BnaCnng04590D [Brassica napus]
Length=779

 Score =   424 bits (1090),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 223/400 (56%), Positives = 292/400 (73%), Gaps = 14/400 (4%)
 Frame = +2

Query  188   KQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGSY  367
             KQLI+  EGTAA+GP+W +IVSDYL KIIR FCG+E    +   ++VE  LV+FNSHGSY
Sbjct  6     KQLIVVAEGTAALGPYWQTIVSDYLHKIIRSFCGSELNGDRNPVSSVELSLVIFNSHGSY  65

Query  368   SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTVE  547
               CLVQRSGWTRD+D+FLHWLSSI F GGGF++AA AEGLAEALMM   P G Q++ + +
Sbjct  66    CGCLVQRSGWTRDVDIFLHWLSSIQFAGGGFSEAATAEGLAEALMMFPPPPG-QAQPSND  124

Query  548   GQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLS  727
              ++HCIL+ ASNPY LPTP+YRP++ N+E++EN     + RLSDAETVA  F++CSVSLS
Sbjct  125   LKRHCILITASNPYSLPTPIYRPKLQNAERNENGDALPESRLSDAETVASYFSRCSVSLS  184

Query  728   VVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSLP  907
             VVCPK + K++ +Y A K NP+  DL ID  KN +YLVLISENF+EARAA + +   ++P
Sbjct  185   VVCPKQLPKIRALYNAGKLNPQSPDLSIDTVKNTFYLVLISENFVEARAALSHSAT-NVP  243

Query  908   STQNPVKMDVSSVP---PISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
              TQ+PVKMD ++VP   P++GP P+ L S+ SANGP++NRQP+  G +  ATVK+EP TV
Sbjct  244   QTQSPVKMDRATVPPSLPVTGPPPASLPSV-SANGPILNRQPVSVGPVPTATVKVEPCTV  302

Query  1079  TSMPG-PTFAHVP-SVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             +SM   PTF H+P SV R A+Q + ++QTSS  SVSQEMVAN EN  + KP VV GM   
Sbjct  303   SSMAAVPTFPHIPSSVARPAAQAIPSVQTSSASSVSQEMVANAENAPDVKP-VVSGMTPP  361

Query  1253  VRPVGAAAANVRILNDVAQ--ARQALAGGTSIGLSSMGGT  1366
             +R       NV +LN+++Q  ++ A + G   G +SM G+
Sbjct  362   LR--TGPPGNVNLLNNLSQPPSQTAFSSGQQ-GNTSMAGS  398


 Score =   282 bits (721),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 183/219 (84%), Gaps = 2/219 (1%)
 Frame = +2

Query  1595  SSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqg  1774
             S++ V Q +PGMNQ +  G QMMQ     +QNMM+ +G  + + SGTG M+PTPG+ QQ 
Sbjct  427   SNLGVSQPMPGMNQGSHSGAQMMQGGISMNQNMMTSLGQGN-VSSGTGGMMPTPGVGQQA  485

Query  1775  qqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGY  1954
             Q G+Q +G +N+SA NM LSQ  + +   S   KYVKVWEGNLSGQRQGQPV ITRLEGY
Sbjct  486   QSGVQQLGGSNSSAPNMQLSQASSGALQPSQS-KYVKVWEGNLSGQRQGQPVLITRLEGY  544

Query  1955  RSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLC  2134
             R+A+AS++LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQ+KKLC
Sbjct  545   RNATASDSLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQDKKLC  604

Query  2135  AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN
Sbjct  605   AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  643



>ref|XP_004513304.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X2 [Cicer arietinum]
Length=751

 Score =   422 bits (1085),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 221/397 (56%), Positives = 281/397 (71%), Gaps = 13/397 (3%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEKQLI+ VE TAAMGP+W ++  DY+EKI+RC CG E+  QKPS +NVEF LV +N+H
Sbjct  1     MAEKQLIVVVESTAAMGPYWDTLQMDYIEKIVRCLCGNESSGQKPSVSNVEFALVTYNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSK  535
             G YS  LVQR+GWT+D D+FL WLSS+ F GGGFND AIAEGLAEALMM   S +G  ++
Sbjct  61    GCYSGILVQRTGWTKDPDVFLQWLSSVPFSGGGFNDVAIAEGLAEALMMFPHSQSGGPNQ  120

Query  536   QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
             Q+ +   HCILVAASNPYPL TPVY PQ+ + EQSE+      ++L DAE VAK F Q S
Sbjct  121   QSADMHMHCILVAASNPYPLQTPVYVPQLQSLEQSESVDSEPGKQLYDAEAVAKVFPQFS  180

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             +SLS++CPK + K+K +Y A KRN R AD P+D  K  ++L+LISE F EAR A +R+G+
Sbjct  181   ISLSIICPKQLPKVKAVYNAGKRNNRAADPPVD-AKTSHFLILISEGFREARGALSRSGI  239

Query  896   PSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
              +LPS Q+PVK+D  SV P++G  P+   S+PS NG + NRQPIP GN+ PATVK+E   
Sbjct  240   TNLPSNQSPVKVDTVSVTPVTGGPPT---SLPSVNGTIANRQPIPAGNVTPATVKVEQVP  296

Query  1076  VTSM-PGPTFAHVPSVPRAASQPVQN--LQTSSPISVSQEMVANNENLQETKPMVVHGMG  1246
             VTSM  GP F H  S  RA S    N  LQ SSP SVSQ+++ +NEN Q+TKP+V   M 
Sbjct  297   VTSMITGPAFPHNSSAARATSTGQGNPSLQASSPSSVSQDIMTSNENAQDTKPIV--SML  354

Query  1247  QSVRPVGAAAANVRILNDVAQARQALAGGTSIGLSSM  1357
             Q +RPV  A  N  ILN+++QARQ      + GL+S+
Sbjct  355   QPLRPVNPAQVNGNILNNLSQARQV---AQNTGLASL  388


 Score =   271 bits (693),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 165/217 (76%), Gaps = 8/217 (4%)
 Frame = +2

Query  1589  LPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtq  1768
             L  +VS+GQ   GMN  N+ G QM+Q     +QN+M+G+G    + S     +       
Sbjct  410   LQGAVSMGQQASGMNPGNLSGAQMVQGGVNMNQNVMNGLG--QSVVSSGNGAMIPTPGMP  467

Query  1769  qgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLE  1948
             Q  Q      VNN ++AN+PLSQQ ++        KY++VWEG+LSGQRQGQPVFIT+LE
Sbjct  468   QQVQSGMQPLVNNAASANLPLSQQTSAQS------KYIRVWEGSLSGQRQGQPVFITKLE  521

Query  1949  GYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  2128
             GYRS+SASETLAANWP  MQIVRLISQDHMNNKQYVGKADFLVFRAMN HGFLGQLQEKK
Sbjct  522   GYRSSSASETLAANWPPVMQIVRLISQDHMNNKQYVGKADFLVFRAMNPHGFLGQLQEKK  581

Query  2129  LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  2239
             LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP
Sbjct  582   LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  618



>dbj|BAJ34376.1| unnamed protein product [Thellungiella halophila]
Length=852

 Score =   425 bits (1092),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 217/383 (57%), Positives = 282/383 (74%), Gaps = 14/383 (4%)
 Frame = +2

Query  188   KQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGSY  367
             KQLI+  EGTAA+GP+W +IVSDYLEKIIR FCG+E   ++    NVE  LV+FNSHGSY
Sbjct  6     KQLIVVAEGTAALGPYWHTIVSDYLEKIIRSFCGSELNGER----NVELSLVIFNSHGSY  61

Query  368   SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTVE  547
              ACLVQRSGWT+D+D+FLHWLSSI F GGGF++AA AEGLAEALMM S P+G Q++ + +
Sbjct  62    CACLVQRSGWTKDVDIFLHWLSSIQFAGGGFSEAATAEGLAEALMMFSPPSG-QAQPSND  120

Query  548   GQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLS  727
              ++HCIL+ ASNP+ LPTPVYRP++ N+E++EN     + RLSDAETVA  F++CSVSLS
Sbjct  121   LKRHCILITASNPHSLPTPVYRPKLPNAERNENGDAQSESRLSDAETVASYFSRCSVSLS  180

Query  728   VVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSLP  907
             V+CPK + K++ +Y A K NP+  DL ID  KN +YLVLI ENF+EARAA + +   +LP
Sbjct  181   VICPKQLPKIRALYNAGKLNPQSPDLSIDTVKNTFYLVLIPENFVEARAALSHSAT-NLP  239

Query  908   STQNPVKMDVSSVP---PISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
              TQ+PVK+D S+V    P++G  P   A +PSANGP++NRQP+  G +  ATVK+EP+TV
Sbjct  240   QTQSPVKVDRSTVAPSLPVTGQPP---APVPSANGPILNRQPVSIGPVPTATVKVEPSTV  296

Query  1079  TSMPG-PTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
              SM    TF H+ SV R A+Q + ++QTSSP  VSQEMV N EN  + KP VV GM   +
Sbjct  297   PSMAAVSTFPHIQSVARPATQAIPSIQTSSPSPVSQEMVTNAENAPDVKP-VVTGMTPPL  355

Query  1256  RPVGAAAANVRILNDVAQARQAL  1324
             R      ANV +LN+++Q RQ +
Sbjct  356   RTGPPGGANVNLLNNLSQVRQVM  378


 Score =   263 bits (673),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 183/219 (84%), Gaps = 2/219 (1%)
 Frame = +2

Query  1595  SSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqg  1774
             S++ V Q +PGMNQ +  G QMMQ     +QNMMSG+G  + + SGTG M+PTPG+ QQ 
Sbjct  460   SNLGVSQPMPGMNQGSHSGAQMMQGGIPMNQNMMSGLGQGN-VSSGTGGMMPTPGVGQQA  518

Query  1775  qqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGY  1954
             Q G+Q +G +N+SA NM LSQ  +++   S   KYVKVWEGNLSGQRQGQPV ITRLEGY
Sbjct  519   QSGIQQLGGSNSSAPNMQLSQPSSAALQTSQS-KYVKVWEGNLSGQRQGQPVLITRLEGY  577

Query  1955  RSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLC  2134
             RSASAS++LAANWP TMQIVRLISQDHMNNKQYVGKAD LVFRAM+QHGFLGQLQ+KKLC
Sbjct  578   RSASASDSLAANWPPTMQIVRLISQDHMNNKQYVGKADSLVFRAMSQHGFLGQLQDKKLC  637

Query  2135  AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI N
Sbjct  638   AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIPN  676



>ref|XP_006415884.1| hypothetical protein EUTSA_v10006778mg [Eutrema salsugineum]
 gb|ESQ34237.1| hypothetical protein EUTSA_v10006778mg [Eutrema salsugineum]
Length=852

 Score =   425 bits (1092),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 217/383 (57%), Positives = 282/383 (74%), Gaps = 14/383 (4%)
 Frame = +2

Query  188   KQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGSY  367
             KQLI+  EGTAA+GP+W +IVSDYLEKIIR FCG+E   ++    NVE  LV+FNSHGSY
Sbjct  6     KQLIVVAEGTAALGPYWHTIVSDYLEKIIRSFCGSELNGER----NVELSLVIFNSHGSY  61

Query  368   SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTVE  547
              ACLVQRSGWT+D+D+FLHWLSSI F GGGF++AA AEGLAEALMM S P+G Q++ + +
Sbjct  62    CACLVQRSGWTKDVDIFLHWLSSIQFAGGGFSEAATAEGLAEALMMFSPPSG-QAQPSND  120

Query  548   GQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLS  727
              ++HCIL+ ASNP+ LPTPVYRP++ N+E++EN     + RLSDAETVA  F++CSVSLS
Sbjct  121   LKRHCILITASNPHSLPTPVYRPKLPNAERNENGDAQSESRLSDAETVASYFSRCSVSLS  180

Query  728   VVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSLP  907
             V+CPK + K++ +Y A K NP+  DL ID  KN +YLVLI ENF+EARAA + +   +LP
Sbjct  181   VICPKQLPKIRALYNAGKLNPQSPDLSIDTVKNTFYLVLIPENFVEARAALSHSAT-NLP  239

Query  908   STQNPVKMDVSSVP---PISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
              TQ+PVK+D S+V    P++G  P   A +PSANGP++NRQP+  G +  ATVK+EP+TV
Sbjct  240   QTQSPVKVDRSTVAPSLPVTGQPP---APVPSANGPILNRQPVSIGPVPTATVKVEPSTV  296

Query  1079  TSMPG-PTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
              SM    TF H+ SV R A+Q + ++QTSSP  VSQEMV N EN  + KP VV GM   +
Sbjct  297   PSMAAVSTFPHIQSVARPATQAIPSIQTSSPSPVSQEMVTNAENAPDVKP-VVTGMTPPL  355

Query  1256  RPVGAAAANVRILNDVAQARQAL  1324
             R      ANV +LN+++Q RQ +
Sbjct  356   RTGPPGGANVNLLNNLSQVRQVM  378


 Score =   267 bits (682),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 163/219 (74%), Positives = 184/219 (84%), Gaps = 2/219 (1%)
 Frame = +2

Query  1595  SSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqg  1774
             S++ V Q +PGMNQ +  G QMMQ     +QNMMSG+G  + + SGTG M+PTPG+ QQ 
Sbjct  460   SNLGVSQPMPGMNQGSHSGAQMMQGGIPMNQNMMSGLGQGN-VSSGTGGMMPTPGVGQQA  518

Query  1775  qqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGY  1954
             Q G+Q +G +N+SA NM LSQ  +++   S   KYVKVWEGNLSGQRQGQPV ITRLEGY
Sbjct  519   QSGIQQLGGSNSSAPNMQLSQPSSAALQTSQS-KYVKVWEGNLSGQRQGQPVLITRLEGY  577

Query  1955  RSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLC  2134
             RSASAS++LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQ+KKLC
Sbjct  578   RSASASDSLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQDKKLC  637

Query  2135  AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI N
Sbjct  638   AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIPN  676



>emb|CDY42096.1| BnaA09g28640D [Brassica napus]
Length=781

 Score =   422 bits (1086),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 217/384 (57%), Positives = 279/384 (73%), Gaps = 11/384 (3%)
 Frame = +2

Query  188   KQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGSY  367
             KQLI+ VEGTAA+GP+W +IVSDYL KIIR FCG E   ++   +NVE  LV+FNSHGSY
Sbjct  6     KQLIVVVEGTAALGPYWQTIVSDYLLKIIRSFCGTELNGERNPVSNVELSLVIFNSHGSY  65

Query  368   SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTVE  547
              ACLVQRSGWT+D+++FL WLSSI F GGGFN+AA AEGLAEALMM S P+G Q++ + +
Sbjct  66    CACLVQRSGWTKDVNIFLRWLSSIQFAGGGFNEAATAEGLAEALMMFSPPSG-QAQPSND  124

Query  548   GQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLS  727
              ++HCIL+ ASNPY LPTPVYRP++ N E+ EN     + RLSDAETVA  F++CSVSLS
Sbjct  125   LKRHCILITASNPYSLPTPVYRPKLQNPERYENGHAQSESRLSDAETVASYFSRCSVSLS  184

Query  728   VVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSLP  907
             VVCPK + K++ +Y A K N + ADL ID  KN +YLVLISENF+EARAA + +      
Sbjct  185   VVCPKQLPKIRALYNAGKPNAQSADLSIDTVKNAFYLVLISENFVEARAALSHSATNFPQ  244

Query  908   STQNPVKMDVSSVP---PISG-PLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
             +TQ+PVK+D ++V    P++G PLP     +PSANGP+MNRQP+  G +  ATVK+EP T
Sbjct  245   TTQSPVKVDRATVAPSLPVTGQPLP----PVPSANGPIMNRQPVSVGPVPTATVKVEPGT  300

Query  1076  VTSMPG-PTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             ++SM   PTF H+PSV R A+Q + ++QTSS   VSQEMV   EN  + KP VV GM   
Sbjct  301   ISSMAAVPTFPHIPSVARPATQAIPSVQTSSASPVSQEMVTKAENAPDIKP-VVGGMTPQ  359

Query  1253  VRPVGAAAANVRILNDVAQARQAL  1324
             +R      ANV +LN+++Q RQ +
Sbjct  360   LRTGPPGGANVNLLNNLSQVRQVM  383


 Score =   250 bits (638),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 161/221 (73%), Gaps = 17/221 (8%)
 Frame = +2

Query  1595  SSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMS------GMGGASGIPSgtgtmvptp  1756
             S++ V Q + GMNQ +  G QMMQ+    +QNMMS      G GG    P          
Sbjct  431   SNLGVSQPMQGMNQGSHSGAQMMQSGISMNQNMMSQGNVSSGTGGMMPTPGVGQQTQSGI  490

Query  1757  gmtqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFI  1936
                         +G +N+SA N+ LSQ  + +   S   KYVKVWEGNLSGQRQGQPV I
Sbjct  491   QQ----------LGGSNSSAPNVQLSQPSSGAMQPSQS-KYVKVWEGNLSGQRQGQPVLI  539

Query  1937  TRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQL  2116
             TRLEGYRSASAS++LAANWP  MQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQL
Sbjct  540   TRLEGYRSASASDSLAANWPPNMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQL  599

Query  2117  QEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  2239
             Q+KKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP
Sbjct  600   QDKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  640



>ref|XP_009115336.1| PREDICTED: LOW QUALITY PROTEIN: mediator of RNA polymerase II 
transcription subunit 25-like [Brassica rapa]
Length=858

 Score =   423 bits (1087),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 217/384 (57%), Positives = 279/384 (73%), Gaps = 11/384 (3%)
 Frame = +2

Query  188   KQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGSY  367
             KQLI+ VEGTAA+GP+W +IVSDYL KIIR FCG E   ++   +NVE  LV+FNSHGSY
Sbjct  6     KQLIVVVEGTAALGPYWQTIVSDYLLKIIRSFCGTELNGERNPVSNVELSLVIFNSHGSY  65

Query  368   SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTVE  547
              ACLVQRSGWT+D+++FL WLSSI F GGGFN+AA AEGLAEALMM S P+G Q++ + +
Sbjct  66    CACLVQRSGWTKDVNIFLRWLSSIQFAGGGFNEAATAEGLAEALMMFSPPSG-QAQPSND  124

Query  548   GQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLS  727
              ++HCIL+ ASNPY LPTPVYRP++ N E+ EN     + RLSDAETVA  F++CSVSLS
Sbjct  125   LKRHCILITASNPYSLPTPVYRPKLQNPERYENGHAQSESRLSDAETVASYFSRCSVSLS  184

Query  728   VVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSLP  907
             VVCPK + K++ +Y A K N + ADL ID  KN +YLVLISENF+EARAA + +      
Sbjct  185   VVCPKQLPKIRALYNAGKPNAQSADLSIDTVKNAFYLVLISENFVEARAALSHSATNFPQ  244

Query  908   STQNPVKMDVSSVP---PISG-PLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
             +TQ+PVK+D ++V    P++G PLP     +PSANGP+MNRQP+  G +  ATVK+EP T
Sbjct  245   TTQSPVKVDRATVAPSLPVTGQPLP----PVPSANGPIMNRQPVSVGPVPTATVKVEPGT  300

Query  1076  VTSMPG-PTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             ++SM   PTF H+PSV R A+Q + ++QTSS   VSQEMV   EN  + KP VV GM   
Sbjct  301   ISSMAAVPTFPHIPSVARPATQAIPSVQTSSASPVSQEMVTKAENAPDIKP-VVGGMTPQ  359

Query  1253  VRPVGAAAANVRILNDVAQARQAL  1324
             +R      ANV +LN+++Q RQ +
Sbjct  360   LRTGPPGGANVNLLNNLSQVRQVM  383


 Score =   250 bits (639),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 161/221 (73%), Gaps = 17/221 (8%)
 Frame = +2

Query  1595  SSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMS------GMGGASGIPSgtgtmvptp  1756
             S++ V Q + GMNQ +  G QMMQ+    +QNMMS      G GG    P          
Sbjct  460   SNLGVSQPMQGMNQGSHSGAQMMQSGISMNQNMMSQGNVSSGTGGMMPTPGVGQQTQSGI  519

Query  1757  gmtqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFI  1936
                         +G +N+SA N+ LSQ  + +   S   KYVKVWEGNLSGQRQGQPV I
Sbjct  520   QQ----------LGGSNSSAPNVQLSQPSSGAMQPSQS-KYVKVWEGNLSGQRQGQPVLI  568

Query  1937  TRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQL  2116
             TRLEGYRSASAS++LAANWP  MQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQL
Sbjct  569   TRLEGYRSASASDSLAANWPPNMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQL  628

Query  2117  QEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  2239
             Q+KKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP
Sbjct  629   QDKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  669



>ref|XP_010551292.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Tarenaya hassleriana]
 ref|XP_010551293.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Tarenaya hassleriana]
 ref|XP_010551296.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Tarenaya hassleriana]
 ref|XP_010551297.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Tarenaya hassleriana]
Length=799

 Score =   421 bits (1082),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 223/395 (56%), Positives = 287/395 (73%), Gaps = 18/395 (5%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MA+KQL + VEGTAA+GP+W +IVSDYLEKIIR FC  E G + P+ +N E  LV FNSH
Sbjct  1     MADKQLTVVVEGTAALGPYWQTIVSDYLEKIIRSFCDIENGQRVPA-SNFELSLVTFNSH  59

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQ  538
             GSY ACLVQRSGWTR+ID+F+ WLSSI F GGGFN+AA AEGLAEALMM S P+G Q++ 
Sbjct  60    GSYCACLVQRSGWTRNIDMFIQWLSSIQFSGGGFNEAATAEGLAEALMMFSPPSG-QAQP  118

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             + + ++HCIL+AASNP+ LPTPV+RPQ+ N E+ EN     + RLSDAETVAK F++CSV
Sbjct  119   SNDFKRHCILIAASNPHTLPTPVFRPQLQNVERGENGEVQSESRLSDAETVAKYFSRCSV  178

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSV+CPK + K++ IY A K NP+GADL I+  KNP+YLVLISENF+EARAA + T   
Sbjct  179   SLSVICPKQLPKIRAIYNAGKFNPQGADLSIETVKNPFYLVLISENFLEARAALSHTAT-  237

Query  899   SLPSTQNPVKMDVSSV--PPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPT  1072
             +LP  Q+P+K+D +++  PP++G      A + SANG V+ RQ +  G I  ATVK+EP+
Sbjct  238   NLPQIQSPLKVDRTTIAPPPVTG---QPQAPVASANGSVLTRQSVSVGAIPNATVKVEPS  294

Query  1073  TVTSMPG-PTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQ  1249
             TVTSM   P+F  + SV    +Q +  +Q SS   VSQEMV+N E++Q+ KP  V GM Q
Sbjct  295   TVTSMASHPSFPCISSVAHPTTQAIPAMQASSASPVSQEMVSNAESVQDIKPF-VGGMPQ  353

Query  1250  SVRPVGAAAANVRILNDVAQARQ-----ALAGGTS  1339
                P+ A  ANV +LN+++Q RQ     ALAG TS
Sbjct  354   ---PLHAGGANVNLLNNLSQLRQVMSSAALAGATS  385


 Score =   264 bits (675),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 181/215 (84%), Gaps = 2/215 (1%)
 Frame = +2

Query  1601  VSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqq  1780
             + V Q++PGMNQ   PG QM+      SQN+MSG+G A+   SGTG+M+P PG +Q+ Q 
Sbjct  459   IGVPQSMPGMNQGGHPGAQMVPGGIVMSQNLMSGLGQANA-SSGTGSMMPIPGFSQEVQS  517

Query  1781  gmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRS  1960
             G QP+ V+N+SA+NM LSQQ + +       KYVKVWEGNLSGQRQGQPV IT+LEGYRS
Sbjct  518   GTQPLSVSNSSASNMQLSQQSSGAMQNPQS-KYVKVWEGNLSGQRQGQPVLITKLEGYRS  576

Query  1961  ASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAV  2140
             ASAS++LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQEKKLCAV
Sbjct  577   ASASDSLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQEKKLCAV  636

Query  2141  IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI
Sbjct  637   IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  671



>emb|CDY36100.1| BnaA08g19480D [Brassica napus]
Length=796

 Score =   421 bits (1082),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 221/400 (55%), Positives = 293/400 (73%), Gaps = 14/400 (4%)
 Frame = +2

Query  188   KQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGSY  367
             KQLI+  EGTAA+GP+W +IVSDYL KIIR FCG+E   ++   ++VE  LV+FNSHGSY
Sbjct  6     KQLIVVAEGTAALGPYWQTIVSDYLHKIIRSFCGSELNGERNPVSSVELSLVIFNSHGSY  65

Query  368   SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTVE  547
               CLVQRSGWTRD+D+FLHWLSSI F GGGF++AA AEGLAEALMM   P G Q++ + +
Sbjct  66    CGCLVQRSGWTRDVDIFLHWLSSIQFAGGGFSEAATAEGLAEALMMFPPPPG-QAQPSND  124

Query  548   GQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLS  727
              ++HCIL+ ASNPY LPTPVYRP++ N+E++EN     + RLSDAETVA  F++C+VSLS
Sbjct  125   LKRHCILITASNPYSLPTPVYRPKLQNAERNENGDALPESRLSDAETVASYFSRCAVSLS  184

Query  728   VVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSLP  907
             VVCPK + K++ +Y A K NP+ +DL ID  KN +YLVLISENF+EARAA + +   ++P
Sbjct  185   VVCPKQLPKIRALYNAGKLNPQSSDLSIDTVKNTFYLVLISENFVEARAALSHSAT-NVP  243

Query  908   STQNPVKMDVSSVP---PISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
              TQ+PVKMD ++V    P++GP P+ L S+ SANGP++NRQP+  G +  ATVK+EP+TV
Sbjct  244   QTQSPVKMDRATVAPSLPVTGPPPASLPSV-SANGPILNRQPVSVGPVPTATVKVEPSTV  302

Query  1079  TSMPG-PTFAHVP-SVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             +SM   PTF H+P SV R A+Q + ++QTSS  SVSQEMV N EN  + KP VV GM   
Sbjct  303   SSMAAVPTFPHIPSSVARPAAQAMPSVQTSSASSVSQEMVTNAENAPDVKP-VVTGMTPP  361

Query  1253  VRPVGAAAANVRILNDVAQ--ARQALAGGTSIGLSSMGGT  1366
             +R       NV +LN+++Q  ++ A + G   G +SM G+
Sbjct  362   LR--TGPPGNVNLLNNLSQPPSQTAFSSGQQ-GNTSMAGS  398


 Score =   278 bits (710),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 182/219 (83%), Gaps = 2/219 (1%)
 Frame = +2

Query  1595  SSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqg  1774
             S++ V Q +P MNQ +  G QMMQ     +QNM++ +G  + + SGTG M+PTPG+ QQ 
Sbjct  427   SNLGVSQPMPAMNQGSHSGGQMMQGGISMNQNMITSLGQGN-VSSGTGGMMPTPGVGQQA  485

Query  1775  qqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGY  1954
             Q G+Q +G +N+SA NM LSQ  + +   S   KYVKVWEGNLSGQRQGQPV ITRLEGY
Sbjct  486   QSGIQQLGGSNSSAPNMQLSQASSGALQPSQS-KYVKVWEGNLSGQRQGQPVLITRLEGY  544

Query  1955  RSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLC  2134
             R+A+AS++LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQ+KKLC
Sbjct  545   RNATASDSLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQDKKLC  604

Query  2135  AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN
Sbjct  605   AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  643



>emb|CDX84998.1| BnaC05g20570D [Brassica napus]
Length=779

 Score =   416 bits (1070),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 212/380 (56%), Positives = 273/380 (72%), Gaps = 3/380 (1%)
 Frame = +2

Query  188   KQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGSY  367
             KQLI+ VEGTAA+GP+W +IVSDYL KIIR FCG     ++   +NVE  LV+FNSHGSY
Sbjct  6     KQLIVVVEGTAALGPYWQTIVSDYLLKIIRSFCGTALNGERNPVSNVELSLVIFNSHGSY  65

Query  368   SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTVE  547
              ACLVQRSGWT+D+++F +WLSSI F GGGFN+AA AEGLAEALMM S P+G Q++ + +
Sbjct  66    CACLVQRSGWTKDVNIFFNWLSSIQFAGGGFNEAATAEGLAEALMMFSPPSG-QAQPSND  124

Query  548   GQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLS  727
              ++HCIL+ ASNPY LPTPVYRP++ N E+ EN     + RLSDAETVA  F++CSVSLS
Sbjct  125   LKRHCILITASNPYSLPTPVYRPKLQNPERYENGHAQSESRLSDAETVASYFSRCSVSLS  184

Query  728   VVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSLP  907
             VVCPK + K++ +Y A K NP+ ADL ID  KN +YLVLISENF+EARAA + +      
Sbjct  185   VVCPKQLPKIRALYNAGKLNPQSADLSIDTVKNAFYLVLISENFVEARAALSHSATNLPQ  244

Query  908   STQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTVTSM  1087
             +TQ+PVK+D ++V P        LA +PSANGP+M+RQP+  G +  ATVK+EP+TV+SM
Sbjct  245   TTQSPVKVDRATVAPSLPVTGQPLAPVPSANGPIMSRQPVSVGPVPIATVKVEPSTVSSM  304

Query  1088  PG-PTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSVRPV  1264
                PTF H+PSV   A+Q + + QTSS   VS EMV   EN  + KP VV GM   +R  
Sbjct  305   AAVPTFPHIPSVAGPATQAIPSAQTSSASPVSHEMVTKAENAPDVKP-VVGGMTPQLRTG  363

Query  1265  GAAAANVRILNDVAQARQAL  1324
                 ANV +LN+++Q RQ +
Sbjct  364   PPGGANVNLLNNLSQVRQVM  383


 Score =   245 bits (626),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 171/205 (83%), Gaps = 2/205 (1%)
 Frame = +2

Query  1625  GMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgmqpIGVN  1804
             GMNQ +  G QMMQ+    +QNM+S +G  + + SGTG M+PTPG+ QQ Q G+Q +G +
Sbjct  436   GMNQGSHSGAQMMQSGISMNQNMISCIGQGN-VSSGTGGMMPTPGVGQQAQSGIQQLGGS  494

Query  1805  NNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLA  1984
             N+SA  + LSQ  + +   S   KYVKVWEGNLSGQRQGQPV ITRLEGYRSASAS++LA
Sbjct  495   NSSAPTVQLSQPSSGAMQPSQS-KYVKVWEGNLSGQRQGQPVLITRLEGYRSASASDSLA  553

Query  1985  ANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTL  2164
             ANWP  MQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQ+KKLCAVIQLPSQTL
Sbjct  554   ANWPPNMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQDKKLCAVIQLPSQTL  613

Query  2165  LLSVSDKACRLIGMLFPGDMVVFKP  2239
             LLSVSDKACRLIGMLFPGDMVVFKP
Sbjct  614   LLSVSDKACRLIGMLFPGDMVVFKP  638



>ref|XP_010551299.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X4 [Tarenaya hassleriana]
Length=740

 Score =   403 bits (1035),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 211/371 (57%), Positives = 271/371 (73%), Gaps = 13/371 (4%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MA+KQL + VEGTAA+GP+W +IVSDYLEKIIR FC  E G + P+ +N E  LV FNSH
Sbjct  1     MADKQLTVVVEGTAALGPYWQTIVSDYLEKIIRSFCDIENGQRVPA-SNFELSLVTFNSH  59

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQ  538
             GSY ACLVQRSGWTR+ID+F+ WLSSI F GGGFN+AA AEGLAEALMM S P+G Q++ 
Sbjct  60    GSYCACLVQRSGWTRNIDMFIQWLSSIQFSGGGFNEAATAEGLAEALMMFSPPSG-QAQP  118

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             + + ++HCIL+AASNP+ LPTPV+RPQ+ N E+ EN     + RLSDAETVAK F++CSV
Sbjct  119   SNDFKRHCILIAASNPHTLPTPVFRPQLQNVERGENGEVQSESRLSDAETVAKYFSRCSV  178

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSV+CPK + K++ IY A K NP+GADL I+  KNP+YLVLISENF+EARAA + T   
Sbjct  179   SLSVICPKQLPKIRAIYNAGKFNPQGADLSIETVKNPFYLVLISENFLEARAALSHTAT-  237

Query  899   SLPSTQNPVKMDVSSV--PPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPT  1072
             +LP  Q+P+K+D +++  PP++G      A + SANG V+ RQ +  G I  ATVK+EP+
Sbjct  238   NLPQIQSPLKVDRTTIAPPPVTG---QPQAPVASANGSVLTRQSVSVGAIPNATVKVEPS  294

Query  1073  TVTSMPG-PTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQ  1249
             TVTSM   P+F  + SV    +Q +  +Q SS   VSQEMV+N E++Q+ KP  V GM Q
Sbjct  295   TVTSMASHPSFPCISSVAHPTTQAIPAMQASSASPVSQEMVSNAESVQDIKPF-VGGMPQ  353

Query  1250  SVRPVGAAAAN  1282
                P+ A  AN
Sbjct  354   ---PLHAGGAN  361


 Score =   264 bits (674),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 181/215 (84%), Gaps = 2/215 (1%)
 Frame = +2

Query  1601  VSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqq  1780
             + V Q++PGMNQ   PG QM+      SQN+MSG+G A+   SGTG+M+P PG +Q+ Q 
Sbjct  400   IGVPQSMPGMNQGGHPGAQMVPGGIVMSQNLMSGLGQANA-SSGTGSMMPIPGFSQEVQS  458

Query  1781  gmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRS  1960
             G QP+ V+N+SA+NM LSQQ + +       KYVKVWEGNLSGQRQGQPV IT+LEGYRS
Sbjct  459   GTQPLSVSNSSASNMQLSQQSSGAMQNPQS-KYVKVWEGNLSGQRQGQPVLITKLEGYRS  517

Query  1961  ASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAV  2140
             ASAS++LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQEKKLCAV
Sbjct  518   ASASDSLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQEKKLCAV  577

Query  2141  IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI
Sbjct  578   IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  612



>ref|XP_008353070.1| PREDICTED: LOW QUALITY PROTEIN: mediator of RNA polymerase II 
transcription subunit 25-like, partial [Malus domestica]
Length=466

 Score =   390 bits (1002),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 207/338 (61%), Positives = 254/338 (75%), Gaps = 16/338 (5%)
 Frame = +2

Query  374   CLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSS-PNGNQSKQTVEG  550
             CLVQRSGWTRD+DLFLH LS+I F GGGF+DAAIAEGL+EALMM  +  NG+Q++Q V+ 
Sbjct  3     CLVQRSGWTRDVDLFLHRLSAIPFSGGGFSDAAIAEGLSEALMMFPTVQNGSQNQQNVDC  62

Query  551   QKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLSV  730
             QKHC+L+AAS P+PLPTPVYRPQI N EQ+EN     + RL DAE VAKSF Q SVSLSV
Sbjct  63    QKHCVLIAASKPHPLPTPVYRPQIQNLEQNENIDAQTENRLYDAEAVAKSFPQSSVSLSV  122

Query  731   VCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSLPS  910
             +CP  + +L+ IY A KRNPR AD PIDN KNP +LVLISENFMEARA  +R G+ +L S
Sbjct  123   ICPIQLPELRAIYNAGKRNPRAADPPIDNAKNPXFLVLISENFMEARATLSRPGITTLXS  182

Query  911   TQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTVTSMP  1090
              Q+PVKMD++ V  ++GP P+   S+PS NGPVMNRQPI  GN+ PATVK+EP+TV+SM 
Sbjct  183   NQSPVKMDIAPVASVTGPPPT---SMPSVNGPVMNRQPISVGNVPPATVKVEPSTVSSM-  238

Query  1091  GPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSVRPVGA  1270
             GP+FAH+PSV R  SQ V +LQTSSP S SQEM  NN+N+ + KP VV G+    RPV  
Sbjct  239   GPSFAHIPSV-RPPSQGVPSLQTSSPSSASQEMATNNDNVPDLKP-VVSGVTHPSRPVXV  296

Query  1271  AAANVRILNDVAQAR----QALAGGTSIGLSSMGGTPM  1372
             A++      +++QAR     AL GGTS+GL +MG  PM
Sbjct  297   ASS-----XNISQARVMNAAALTGGTSMGLPTMGQNPM  329



>ref|XP_010551294.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Tarenaya hassleriana]
 ref|XP_010551295.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Tarenaya hassleriana]
Length=799

 Score =   399 bits (1026),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 214/395 (54%), Positives = 279/395 (71%), Gaps = 18/395 (5%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             M  KQL++ VE +A M P W +I+ DYL  I+R FC  E G + P+ +N E  LV FNSH
Sbjct  1     MDMKQLVVVVEVSAEMSPFWNTIMLDYLVGIVRSFCDIENGQRVPA-SNFELSLVTFNSH  59

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQ  538
             GSY ACLVQRSGWTR+ID+F+ WLSSI F GGGFN+AA AEGLAEALMM S P+G Q++ 
Sbjct  60    GSYCACLVQRSGWTRNIDMFIQWLSSIQFSGGGFNEAATAEGLAEALMMFSPPSG-QAQP  118

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             + + ++HCIL+AASNP+ LPTPV+RPQ+ N E+ EN     + RLSDAETVAK F++CSV
Sbjct  119   SNDFKRHCILIAASNPHTLPTPVFRPQLQNVERGENGEVQSESRLSDAETVAKYFSRCSV  178

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSV+CPK + K++ IY A K NP+GADL I+  KNP+YLVLISENF+EARAA + T   
Sbjct  179   SLSVICPKQLPKIRAIYNAGKFNPQGADLSIETVKNPFYLVLISENFLEARAALSHTAT-  237

Query  899   SLPSTQNPVKMDVSSV--PPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPT  1072
             +LP  Q+P+K+D +++  PP++G      A + SANG V+ RQ +  G I  ATVK+EP+
Sbjct  238   NLPQIQSPLKVDRTTIAPPPVTG---QPQAPVASANGSVLTRQSVSVGAIPNATVKVEPS  294

Query  1073  TVTSMPG-PTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQ  1249
             TVTSM   P+F  + SV    +Q +  +Q SS   VSQEMV+N E++Q+ KP  V GM Q
Sbjct  295   TVTSMASHPSFPCISSVAHPTTQAIPAMQASSASPVSQEMVSNAESVQDIKPF-VGGMPQ  353

Query  1250  SVRPVGAAAANVRILNDVAQARQ-----ALAGGTS  1339
                P+ A  ANV +LN+++Q RQ     ALAG TS
Sbjct  354   ---PLHAGGANVNLLNNLSQLRQVMSSAALAGATS  385


 Score =   264 bits (675),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 181/215 (84%), Gaps = 2/215 (1%)
 Frame = +2

Query  1601  VSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqq  1780
             + V Q++PGMNQ   PG QM+      SQN+MSG+G A+   SGTG+M+P PG +Q+ Q 
Sbjct  459   IGVPQSMPGMNQGGHPGAQMVPGGIVMSQNLMSGLGQANA-SSGTGSMMPIPGFSQEVQS  517

Query  1781  gmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRS  1960
             G QP+ V+N+SA+NM LSQQ + +       KYVKVWEGNLSGQRQGQPV IT+LEGYRS
Sbjct  518   GTQPLSVSNSSASNMQLSQQSSGAMQNPQS-KYVKVWEGNLSGQRQGQPVLITKLEGYRS  576

Query  1961  ASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAV  2140
             ASAS++LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQEKKLCAV
Sbjct  577   ASASDSLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQEKKLCAV  636

Query  2141  IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI
Sbjct  637   IQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  671



>ref|XP_006843755.1| hypothetical protein AMTR_s00007p00235560 [Amborella trichopoda]
 gb|ERN05430.1| hypothetical protein AMTR_s00007p00235560 [Amborella trichopoda]
Length=717

 Score =   394 bits (1011),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 224/407 (55%), Positives = 286/407 (70%), Gaps = 21/407 (5%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEKQL++ VEGTAAMGP W SI S+ LEKIIR F G++   QK  GANVEF L+MF SH
Sbjct  1     MAEKQLVVIVEGTAAMGPFWPSIQSEILEKIIRVFYGSDLSGQKLPGANVEFALIMFYSH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQ  538
             G YS CL+QRSGWTR++DLFL WLSSI F GGGF +AAI EGL+EAL + S+       Q
Sbjct  61    GPYSDCLLQRSGWTRNLDLFLRWLSSISFSGGGFGEAAIGEGLSEALWICSN-----MTQ  115

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNS-EQSENETQTDDRRLSDAETVAKSFAQCS  715
             ++EG KHCILVAASNP+ LPTPV  PQ+  S +Q+ +     +  L+DAETVAK+F+Q S
Sbjct  116   SLEGHKHCILVAASNPHALPTPV--PQLPKSLDQNGSSDGQKEIYLADAETVAKAFSQYS  173

Query  716   VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
             VSLSV+ PK + KL+ IY AAKRN R  D  IDN K P+YL+L+S+ F+EARAA  R G+
Sbjct  174   VSLSVISPKNLPKLRAIYNAAKRNSRVPDPAIDNTKYPHYLILLSDLFVEARAAL-RPGI  232

Query  896   PSLPSTQNPVKMDVSSVPP-ISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPT  1072
              +LP++QN +K D SSVP  +SGP P   A++PSAN  +MNRQP+P   +  ATVK+E T
Sbjct  233   TNLPASQNQMKFDSSSVPSTVSGPPP---ATMPSANVSMMNRQPMPGSAVPIATVKVEAT  289

Query  1073  TVTSM--PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMG  1246
             TVT M     +     S+    S  V ++QTSSP + SQEM+  N + QE KP++  G  
Sbjct  290   TVTPMSSMSGSSHLSSSILHGTSPNVPSIQTSSPPTTSQEMIG-NVDAQEFKPVLTSGTT  348

Query  1247  QSVRPVGAAAANVRILNDVAQARQ-----ALAGGTSIGLSSMGGTPM  1372
             QS+RPV +A ANV ILN+++QARQ     +L G ++IGL +MGG PM
Sbjct  349   QSLRPVSSATANVSILNNLSQARQVMGNASLTGASNIGLQAMGGAPM  395


 Score =   220 bits (561),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 166/211 (79%), Gaps = 7/211 (3%)
 Frame = +2

Query  1601  VSVGQTVP-GMNQANMP-GTQMMQTATGR--SQNMMSGMGGASGIPSgtgtmvptpgmtq  1768
             V +GQ++P GM Q N+  GTQM Q   G   + NM++ +G A G+PSG GTM+PTPGMTQ
Sbjct  490   VGMGQSIPPGMGQGNLSSGTQMGQQTGGLGINHNMLNSLGQA-GMPSGMGTMIPTPGMTQ  548

Query  1769  qgqqgmqp-IGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRL  1945
             Q Q G    IG+N+ SA NM + Q  ++SQ      +Y+K+WEG+LSGQRQGQ VFI +L
Sbjct  549   QVQAGGLQPIGMNSGSANNMQIPQLASASQQPGQM-RYIKMWEGSLSGQRQGQAVFICKL  607

Query  1946  EGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEK  2125
             EGYR  ++SETLAA+WP  MQI+RLISQDHMNNKQYVGKADFLVFRA+N+HGFL QLQEK
Sbjct  608   EGYRHMNSSETLAADWPPAMQIMRLISQDHMNNKQYVGKADFLVFRALNRHGFLDQLQEK  667

Query  2126  KLCAVIQLPSQTLLLSVSDKACRLIGMLFPG  2218
             KLCAVIQL SQTLLLSVSDKA RLIGMLFPG
Sbjct  668   KLCAVIQLQSQTLLLSVSDKASRLIGMLFPG  698



>ref|XP_004956526.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Setaria italica]
Length=773

 Score =   395 bits (1014),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 212/404 (52%), Positives = 276/404 (68%), Gaps = 15/404 (4%)
 Frame = +2

Query  182   AEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHG  361
             AE+QL++AVEGTAA+GP+W++IV DY+EKI+R FC  E   QK +GA  E  LV+F++HG
Sbjct  6     AERQLVVAVEGTAALGPYWSTIVGDYVEKIVRSFCANEVPGQKLAGAPPELALVVFHTHG  65

Query  362   SYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSKQ  538
              YSA  VQRSGWT+DID FL WLS I F GGGF++A+  EGLAEALM+L  +PN  QS  
Sbjct  66    PYSAFGVQRSGWTKDIDSFLSWLSGIPFSGGGFSEASTCEGLAEALMILQGTPNTTQSHP  125

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
               E QKHC+LVAASNPYPLPTPVY     +++  EN   + +  ++DAETVAKSFAQCSV
Sbjct  126   NHEAQKHCVLVAASNPYPLPTPVYCLPTQSTDHKENTESSKEPSIADAETVAKSFAQCSV  185

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSV+ PK +  LK IY A KRNPR AD  +D+ KNP++LVL+SENFMEAR A +R    
Sbjct  186   SLSVISPKQLPTLKAIYNAGKRNPRAADPSVDHAKNPHFLVLLSENFMEARTALSRPLHG  245

Query  899   SLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
             +L   Q   KMD +    ++GP  +   + PS NGP+M RQP+  G I  ATVK+EP TV
Sbjct  246   NLAPNQTVTKMDTTPSVTMAGPTSN---ANPSVNGPMMGRQPVGVGGISTATVKVEPATV  302

Query  1079  TSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
               M   P F+HV  +   +SQ +  LQTSSP  +SQE    N+N+QE KP ++H + Q V
Sbjct  303   PPMVSAPAFSHVTPISNVSSQGISALQTSSPSLISQEANFANDNVQEHKP-IIHPVQQPV  361

Query  1256  RPVGAAAANVRILNDVAQAR----QALAGG-TSIGLSSMGGTPM  1372
             RP G  +    +LN+++Q R     +L GG TS+GL ++G TP+
Sbjct  362   RPGGHGS----LLNNLSQVRLMNSTSLGGGATSMGLPNIGATPI  401


 Score =   249 bits (636),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 133/151 (88%), Gaps = 3/151 (2%)
 Frame = +2

Query  1793  IGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASAS  1972
             +GV NNSA NMP+ Q   + QL     KYV++WEG LSGQRQGQPVFI +LEGYRS +AS
Sbjct  530   LGVTNNSAMNMPIGQHPNAQQLPP---KYVRIWEGTLSGQRQGQPVFICKLEGYRSGTAS  586

Query  1973  ETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLP  2152
             ETLAA+WPETMQIVRLI+Q+HMNNKQYVGKAD LVFR +NQHGFLGQLQEKKLCAVIQLP
Sbjct  587   ETLAADWPETMQIVRLIAQEHMNNKQYVGKADLLVFRTLNQHGFLGQLQEKKLCAVIQLP  646

Query  2153  SQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             SQTLLLS+SDKA RLIGMLFPGDMVVFKPQ+
Sbjct  647   SQTLLLSMSDKAGRLIGMLFPGDMVVFKPQV  677



>ref|XP_010499097.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Camelina sativa]
Length=819

 Score =   393 bits (1010),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 196/357 (55%), Positives = 262/357 (73%), Gaps = 9/357 (3%)
 Frame = +2

Query  266   KIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGSYSACLVQRSGWTRDIDLFLHWLSSIHF  445
             ++ R FCG+E   ++   + VE  LV+FNSHGSY ACLVQRSGWTRD+D+FLHWLSSI F
Sbjct  15    RLSRSFCGSELNGERNPASTVELSLVIFNSHGSYCACLVQRSGWTRDVDIFLHWLSSIQF  74

Query  446   GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIH  625
             GGGGFN+ A AEGLAEALMM   P+G Q++ + + ++HCIL+ ASNP+ LPTPVYRP++ 
Sbjct  75    GGGGFNEVATAEGLAEALMMFPPPSG-QAQPSNDLKRHCILITASNPHTLPTPVYRPRVQ  133

Query  626   NSEQSENETQTDDRRLSDAETVAKSFAQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADL  805
             N E+++N     + RLSDAETVA  FA+CSVSLSVVCPK + K++ +Y A K NP+ ADL
Sbjct  134   NVERNDNGDAQSESRLSDAETVASYFAKCSVSLSVVCPKQLPKIRALYNAGKLNPQSADL  193

Query  806   PIDNPKNPYYLVLISENFMEARAAFNRTGMPSLPSTQNPVKMDVSSVP---PISGPLPSG  976
              +D  KNP+YLVLISENF+EARAA + +   +LP TQ+PVK+D ++     P++G  P  
Sbjct  194   SMDTVKNPFYLVLISENFVEARAALSHSAA-NLPQTQSPVKVDRATAAPSLPVTGQPP--  250

Query  977   LASIPSANGPVMNRQPIPTGNIHPATVKIEPTTVTSM-PGPTFAHVPSVPRAASQPVQNL  1153
              A + SANGP++NRQP+  G +  ATVK+EP+TVTSM P P+F H+PSV R A+Q + ++
Sbjct  251   -APVTSANGPILNRQPVSVGPVPTATVKVEPSTVTSMAPVPSFPHIPSVARPATQAIPSI  309

Query  1154  QTSSPISVSQEMVANNENLQETKPMVVHGMGQSVRPVGAAAANVRILNDVAQARQAL  1324
             QTSS   VSQ+MV N EN  + KP+VV GM   +R   +  ANV +LN+++Q RQ +
Sbjct  310   QTSSASPVSQDMVTNAENAPDIKPVVVSGMTPPLRAGPSGGANVNLLNNLSQVRQVM  366


 Score =   284 bits (727),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 163/219 (74%), Positives = 182/219 (83%), Gaps = 2/219 (1%)
 Frame = +2

Query  1595  SSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqg  1774
             S++ V Q + GM+Q N  G QMMQ     +QNMMSG+G  + + SGTG M+PTPG+ QQ 
Sbjct  448   SNLGVSQPMQGMSQGNHSGPQMMQGGISMNQNMMSGLGQGN-LSSGTGGMMPTPGVAQQT  506

Query  1775  qqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGY  1954
             Q  +Q +G NN+SA+NM LSQ  + +   S   KYVKVWEGNLSGQRQGQPV ITRLEGY
Sbjct  507   QSAIQQLGGNNSSASNMQLSQPSSGALQTSQS-KYVKVWEGNLSGQRQGQPVLITRLEGY  565

Query  1955  RSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLC  2134
             RSASAS+TLAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQ+KKLC
Sbjct  566   RSASASDTLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQDKKLC  625

Query  2135  AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI N
Sbjct  626   AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIPN  664



>ref|XP_010238042.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 [Brachypodium distachyon]
Length=820

 Score =   368 bits (944),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 204/399 (51%), Positives = 271/399 (68%), Gaps = 16/399 (4%)
 Frame = +2

Query  182   AEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHG  361
             AE+QL++ VEGTAA+GP+W +I ++Y+EKI+R FC A+   QK +G   E  LV+F++HG
Sbjct  7     AERQLVVVVEGTAALGPYWHTIAAEYVEKIVRSFCAAQLSGQKLAGVPPELALVVFHTHG  66

Query  362   SYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQSKQ  538
              YSA +VQRSGWT+D+D FL WLS I F GGGF++AAI EGLAEALM+L  SP+ NQ+ Q
Sbjct  67    PYSAFVVQRSGWTKDMDTFLSWLSGISFSGGGFSEAAICEGLAEALMILQGSPSNNQNHQ  126

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
               E QKHC+LVAASNPYPLPTPVYRP + + +  +N   T +  L+DAE VA SF+QC V
Sbjct  127   NHELQKHCVLVAASNPYPLPTPVYRPFVQSGDHKKNNEVTKESCLADAEAVAISFSQCCV  186

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSVV PK +  LK IY A KRNP+ +D  +D+ KNP++LVL+SE+FMEAR A +     
Sbjct  187   SLSVVSPKQLPTLKAIYNAGKRNPQASDPSVDHVKNPHFLVLLSESFMEARTALSHPSPG  246

Query  899   SLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
             +L   Q   KMD++    + GP  +   + PS NG +M RQP        A +K+EPT +
Sbjct  247   NLVPNQIITKMDIAPAATVPGPTSN---ANPSVNGSMMGRQPT-------ANIKVEPTII  296

Query  1079  TSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
             T M   P F+H+  +    SQ V  LQ+SSP  +SQE    NE LQE KP+ V+ + Q V
Sbjct  297   TPMVSAPAFSHMTPISNVTSQGVSALQSSSPSIISQETNVANEILQEHKPL-VNPIQQQV  355

Query  1256  RPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPM  1372
             RP G   ANV ILN+++Q R +L+G TS+G  +MG TP+
Sbjct  356   RPGG--PANVSILNNLSQHRHSLSGATSMG-PNMGATPI  391


 Score =   251 bits (641),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 134/152 (88%), Gaps = 4/152 (3%)
 Frame = +2

Query  1793  IGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASAS  1972
             + VNN+SA NMP+ QQ    Q      KYVK+WEG LSGQRQGQPVFI +LEGYRS +AS
Sbjct  524   LSVNNSSAMNMPMPQQPNGQQQS----KYVKIWEGTLSGQRQGQPVFICKLEGYRSGTAS  579

Query  1973  ETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLP  2152
             +TLAA+WPETMQIVRLI+Q+HMNNKQYVGKADFLVFR +NQHGFLGQLQEKKLCAVIQLP
Sbjct  580   DTLAADWPETMQIVRLIAQEHMNNKQYVGKADFLVFRTLNQHGFLGQLQEKKLCAVIQLP  639

Query  2153  SQTLLLSVSDKACRLIGMLFPGDMVVFKPQIT  2248
             SQTLLLSVSDKA RLIGMLFPGDMVVFKPQ++
Sbjct  640   SQTLLLSVSDKAGRLIGMLFPGDMVVFKPQVS  671



>dbj|BAD36509.1| putative SMA-9 class B [Oryza sativa Japonica Group]
 dbj|BAH01495.1| unnamed protein product [Oryza sativa Japonica Group]
Length=842

 Score =   365 bits (938),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 202/381 (53%), Positives = 269/381 (71%), Gaps = 15/381 (4%)
 Frame = +2

Query  182   AEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHG  361
             AE+QL++AVEGTAA+GP+W   V+DY+EKI+R FC  E   QK +G   E  LV+F++HG
Sbjct  6     AERQLVVAVEGTAALGPYWPVTVADYVEKIVRSFCAHEMAGQKLAGTPPELALVVFHTHG  65

Query  362   SYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSKQ  538
              YSA  VQRSGWT+D+++FL WLS I F GGGF++AAI+EGLAEALM+L  S + +Q+ Q
Sbjct  66    PYSAFCVQRSGWTKDMNVFLSWLSGISFSGGGFSEAAISEGLAEALMILQGSSSNSQNHQ  125

Query  539   TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             + E QKHCILVAASNPYPLPTPVYRP + +S+  EN     +  L+DAETVAKSFAQCSV
Sbjct  126   SHEVQKHCILVAASNPYPLPTPVYRPLVQSSDHKENNDGAKESCLADAETVAKSFAQCSV  185

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMP  898
             SLSVV PK +  LK IY AAKRNPR AD  +D+ KNP++LVL+S+NF+EAR A +R  +P
Sbjct  186   SLSVVSPKQLPTLKAIYNAAKRNPRAADPSVDHAKNPHFLVLLSDNFLEARTALSRP-LP  244

Query  899   SLPSTQNPV-KMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTT  1075
                 T +P+ KMD ++    S P+P+   + PS NGP++ RQP    N   A +K EPTT
Sbjct  245   GNLVTNHPITKMDTAAT---SVPVPTSNGN-PSVNGPMLTRQP----NGVVANIKTEPTT  296

Query  1076  VTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQS  1252
             +  M   P F+HV  V    SQ + ++Q+ SP  +SQE    N+++QE KP+ ++ + QS
Sbjct  297   LPPMVSAPAFSHVTPVANGVSQGLSSVQSPSPSLISQETNLANDSVQEHKPL-INPIQQS  355

Query  1253  VRPVGAAAANVRILNDVAQAR  1315
             +RP G   ANV ILN+++Q R
Sbjct  356   IRPGG--PANVSILNNLSQHR  374


 Score =   249 bits (635),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 155/212 (73%), Gaps = 13/212 (6%)
 Frame = +2

Query  1637  ANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgmqpIGVNNNSA  1816
              +M  TQ+ Q     +QNM+S +G  +     +      P      Q G+  +GV N+SA
Sbjct  443   GSMGSTQLGQGGINTNQNMISSLGTTT----VSSAPAMMPTPGMAQQAGVNSLGVTNSSA  498

Query  1817  ANMPLsqqqtssqlqsaqs---------KYVKVWEGNLSGQRQGQPVFITRLEGYRSASA  1969
              NMP+ Q   + Q Q  Q          KYVK+WEG LSGQRQGQPVFI +LEGYRS +A
Sbjct  499   MNMPIVQHPNAQQQQQQQQQQQQQQPPPKYVKIWEGTLSGQRQGQPVFICKLEGYRSGTA  558

Query  1970  SETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQL  2149
             SETLAA+WPETMQIVRLI+Q+HMNNKQYVGKADFLVFR +NQHGFLGQLQEKKLCAVIQL
Sbjct  559   SETLAADWPETMQIVRLIAQEHMNNKQYVGKADFLVFRTLNQHGFLGQLQEKKLCAVIQL  618

Query  2150  PSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI  2245
             PSQTLLLSVSDKA RLIGMLFPGDMVVFKPQ+
Sbjct  619   PSQTLLLSVSDKAGRLIGMLFPGDMVVFKPQV  650



>ref|XP_009336608.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X4 [Pyrus x bretschneideri]
 ref|XP_009336609.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X4 [Pyrus x bretschneideri]
Length=626

 Score =   359 bits (921),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 242/340 (71%), Gaps = 17/340 (5%)
 Frame = +2

Query  368   SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSP-NGNQSKQTV  544
             S  LV RSGWTRD+DLFLHWLS+I F GGGF DAAIAEGL+EA+MM S+  NG+Q++Q V
Sbjct  8     SGYLVGRSGWTRDVDLFLHWLSAIPFSGGGFGDAAIAEGLSEAIMMFSTAQNGSQNQQNV  67

Query  545   EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
             + QKHC+L+AASNP+ LPTPVYRPQ+ N EQ+EN     +  L DAE VAKSF QCSVSL
Sbjct  68    DCQKHCVLIAASNPHALPTPVYRPQMQNLEQNENIDAQTENHLCDAEAVAKSFPQCSVSL  127

Query  725   SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSL  904
             SV+CPK + KL+ IY A KRN   AD PI N K P++LVLISENFMEA A  +R G+ +L
Sbjct  128   SVICPKQLPKLRAIYNAGKRNAGAADPPIGNAKEPHFLVLISENFMEACATLSRPGITTL  187

Query  905   PSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTVTS  1084
             PS Q+PVKM+++ V  ++ P P+   S+PS NG VMNRQPI  GN+ PATVK+EP+T++S
Sbjct  188   PSNQSPVKMEIAPVASVTVPPPT---SMPSVNGSVMNRQPILVGNVPPATVKVEPSTLSS  244

Query  1085  MPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSVRPV  1264
             M GP FAH+P V    SQ V +LQTS+P S SQ M   N+++ + KP VV  M    RPV
Sbjct  245   M-GPGFAHIPCV-HPPSQAVPSLQTSTPFSASQGMTTINDSIPDFKP-VVSSMTHPSRPV  301

Query  1265  GAAAANVRILNDVAQAR----QALAGGTSIGLSSMGGTPM  1372
             G       ILN+++QA      AL GGT +GL +M   PM
Sbjct  302   GC------ILNNISQAHFMNAAALTGGTFMGLQTMVQNPM  335


 Score =   216 bits (550),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = +2

Query  1793  IGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASAS  1972
             +G NN+SAA++P SQQ TS+   +    YVKVWEGNL+G R GQP FIT LEG+  ASAS
Sbjct  375   LGANNSSAASVPFSQQTTSALASAQS-NYVKVWEGNLAGLRYGQPTFITILEGFGCASAS  433

Query  1973  ETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLP  2152
               LAANWP TM IVRLIS+DHM+NKQYVGKADFLVFRA NQH FLG+LQEKKLCAVIQLP
Sbjct  434   GMLAANWPPTMLIVRLISEDHMHNKQYVGKADFLVFRAKNQHAFLGKLQEKKLCAVIQLP  493

Query  2153  SQTLLLSVSDKACRLIGMLFPGDMVVFK  2236
             SQTLLLSVSD+A RL GMLFPGDMV+FK
Sbjct  494   SQTLLLSVSDRAYRLNGMLFPGDMVLFK  521



>gb|EEC84311.1| hypothetical protein OsI_30806 [Oryza sativa Indica Group]
Length=959

 Score =   363 bits (931),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 201/380 (53%), Positives = 268/380 (71%), Gaps = 15/380 (4%)
 Frame = +2

Query  185   EKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGS  364
             E+QL++AVEGTAA+GP+W   V+DY+EKI+R FC  E   QK +G   E  LV+F++HG 
Sbjct  106   ERQLVVAVEGTAALGPYWPVTVADYVEKIVRSFCAHEMAGQKLAGTPPELALVVFHTHGP  165

Query  365   YSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSKQT  541
             YSA  VQRSGWT+D+++FL WLS I F GGGF++AAI+EGLAEALM+L  S + +Q+ Q+
Sbjct  166   YSAFCVQRSGWTKDMNVFLSWLSGISFSGGGFSEAAISEGLAEALMILQGSSSNSQNHQS  225

Query  542   VEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVS  721
              E QKHCILVAASNPYPLPTPVYRP + +S+  EN     +  L+DAETVAKSFAQCSVS
Sbjct  226   HEVQKHCILVAASNPYPLPTPVYRPLVQSSDHKENNDGAKESCLADAETVAKSFAQCSVS  285

Query  722   LSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPS  901
             LSVV PK +  LK IY AAKRNPR AD  +D+ KNP++LVL+S+NF+EAR A +R  +P 
Sbjct  286   LSVVSPKQLPTLKAIYNAAKRNPRAADPSVDHAKNPHFLVLLSDNFLEARTALSRP-LPG  344

Query  902   LPSTQNPV-KMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTV  1078
                T +P+ KMD ++    S P+P+   + PS NGP++ RQP    N   A +K EPTT+
Sbjct  345   NLVTNHPITKMDTAAT---SVPVPTSNGN-PSVNGPMLTRQP----NGVVANIKTEPTTL  396

Query  1079  TSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSV  1255
               M   P F+HV  V    SQ + ++Q+ SP  +SQE    N+++QE KP+ ++ + QS+
Sbjct  397   PPMVSAPAFSHVTPVANGVSQGLSSVQSPSPSLISQETNLANDSVQEHKPL-INPIQQSI  455

Query  1256  RPVGAAAANVRILNDVAQAR  1315
             RP G   ANV ILN+++Q R
Sbjct  456   RPGG--PANVSILNNLSQHR  473


 Score =   228 bits (582),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 146/205 (71%), Gaps = 15/205 (7%)
 Frame = +2

Query  1637  ANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgmqpIGVNNNSA  1816
              +M  TQ+ Q     +QNM+S +G      + +      P      Q G+  +GV N+SA
Sbjct  542   GSMGSTQLGQGGINTNQNMISSLG----TTTVSSAPAMMPTPGMAQQAGVNSLGVTNSSA  597

Query  1817  ANMPLsqqqtssqlqsaqs-----------KYVKVWEGNLSGQRQGQPVFITRLEGYRSA  1963
              NMP+ Q   + Q Q  Q            KYVK+WEG LSGQRQGQPVFI +LEGYRS 
Sbjct  598   MNMPIVQHPNAQQQQQQQQQQQQQQQQPPPKYVKIWEGTLSGQRQGQPVFICKLEGYRSG  657

Query  1964  SASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVI  2143
             +ASETLAA+WPETMQIVRLI+Q+HMNNKQYVGKADFLVFR +NQHGFLGQLQEKKLCAVI
Sbjct  658   TASETLAADWPETMQIVRLIAQEHMNNKQYVGKADFLVFRTLNQHGFLGQLQEKKLCAVI  717

Query  2144  QLPSQTLLLSVSDKACRLIGMLFPG  2218
             QLPSQTLLLSVSDKA RLIGMLFPG
Sbjct  718   QLPSQTLLLSVSDKAGRLIGMLFPG  742



>ref|XP_006661102.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Oryza brachyantha]
Length=866

 Score =   343 bits (879),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 185/362 (51%), Positives = 250/362 (69%), Gaps = 12/362 (3%)
 Frame = +2

Query  236   WTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGSYSACLVQRSGWTRDIDL  415
             W S+   +++ +I+ FC  E   QK SGA  E  LV+F++HG YSA  VQRSGWT+D+++
Sbjct  15    WPSV---FVDALIQSFCAHEMAGQKLSGAPPELALVVFHTHGPYSAFCVQRSGWTKDMNV  71

Query  416   FLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSKQTVEGQKHCILVAASNPYP  592
             FL WLS I F GGGF++AAI+EGLAEALM+L  SP+ +Q+ Q++E QKHCILVAASNPYP
Sbjct  72    FLSWLSGISFSGGGFSEAAISEGLAEALMILQGSPSNSQNHQSLEVQKHCILVAASNPYP  131

Query  593   LPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLSVVCPKLVLKLKTIYA  772
             LPTPVYRP + +S+  +N     +  L+DAETVAKSFAQCSVSLSV+ PK +  LK IY 
Sbjct  132   LPTPVYRPLVQSSDLKDNNDGAKESCLADAETVAKSFAQCSVSLSVISPKQLPTLKAIYN  191

Query  773   AAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSLPSTQNPVKMDVSSVPP  952
             A KRNPR AD  +D+ KNP++LVL+S+NF+EAR+A  R    +L S     KMD ++   
Sbjct  192   AGKRNPRAADPSVDHAKNPHFLVLLSDNFLEARSALTRPLPGNLVSNHPIAKMDTTAT--  249

Query  953   ISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTVTSM-PGPTFAHVPSVPRA  1129
              S P+P+  A+ PS NGP++ RQP     I  A +K+EPTT+  M   P F+HV  V   
Sbjct  250   -SVPIPTSNAN-PSVNGPILARQPNGVVGIPTANIKVEPTTIPPMVSAPAFSHVTPVSNG  307

Query  1130  ASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSVRPVGAAAANVRILNDVAQ  1309
              SQ +  +Q+ SP  +SQ+    N+++QE KP+ ++ + QSVRPVG   ANV ILN+++Q
Sbjct  308   VSQGLSTVQSPSPSLISQDTNLGNDSVQEHKPL-INPIQQSVRPVG--PANVNILNNLSQ  364

Query  1310  AR  1315
              R
Sbjct  365   HR  366


 Score =   256 bits (654),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 154/202 (76%), Gaps = 5/202 (2%)
 Frame = +2

Query  1643  MPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgmqpIGVNNNSAAN  1822
             M  TQ+ Q     +QN+MS +G A+ IPS    M       Q G      +GV N+SA N
Sbjct  430   MAATQLGQGGINTNQNVMSSLGAAT-IPSAPAMMPTPGMAQQAGVNT---LGVTNSSAMN  485

Query  1823  MPLsqq-qtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPE  1999
             MP+ Q      Q Q    KYVK+WEG LSGQRQGQPVFI +LEGYRS +ASETLAA+WPE
Sbjct  486   MPIVQHPNAQQQQQQPPPKYVKIWEGTLSGQRQGQPVFICKLEGYRSGTASETLAADWPE  545

Query  2000  TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVS  2179
             TMQIVRLI+Q+HMNNKQYVGKADFLVFR +NQHGFLGQLQEKKLCAVIQLPSQTLLLSVS
Sbjct  546   TMQIVRLIAQEHMNNKQYVGKADFLVFRTLNQHGFLGQLQEKKLCAVIQLPSQTLLLSVS  605

Query  2180  DKACRLIGMLFPGDMVVFKPQI  2245
             DKA RLIGMLFPGDMVVFKPQ+
Sbjct  606   DKAGRLIGMLFPGDMVVFKPQV  627



>ref|XP_004300904.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Fragaria vesca subsp. vesca]
Length=521

 Score =   306 bits (785),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 159/260 (61%), Positives = 191/260 (73%), Gaps = 9/260 (3%)
 Frame = +2

Query  179  MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGS--QKPSG-ANVEFGLVMF  349
            MAEKQLI+ VEGT AM P+W ++  DY+EKIIR   G E     QKPS  + VE  L+ F
Sbjct  1    MAEKQLIVVVEGTMAMQPYWPTVFCDYVEKIIRSLPGNELSGCGQKPSSTSTVEMSLITF  60

Query  350  NSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMM-LSSPNGN  526
            N+HGS   CLVQRSGWTRDI+LFL WLS++   GGGF+DAAIAEGL+EALMM L+  NG+
Sbjct  61   NTHGS--GCLVQRSGWTRDIELFLQWLSALPLNGGGFSDAAIAEGLSEALMMFLTIQNGS  118

Query  527  QSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFA  706
            Q++Q V+ QKHCILVAAS+P PLPTP YRPQ+ N EQSE      +  L DAE VAKSFA
Sbjct  119  QNQQNVDFQKHCILVAASDPCPLPTPGYRPQMQNMEQSEISDAQTESCLYDAEAVAKSFA  178

Query  707  QCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNR  886
            QC VSLS++CPK + KL+ IY A KRNPR AD PIDN K P++LVLISENF+EA+A  +R
Sbjct  179  QCFVSLSIICPKQLPKLRAIYNAGKRNPRAADPPIDNVKTPHFLVLISENFIEAQATLSR  238

Query  887  TGMPSLPSTQNPVKMDVSSV  946
             G  +LPS    +K  V SV
Sbjct  239  PGSTTLPSY---LKASVGSV  255


 Score =   145 bits (367),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 111/154 (72%), Gaps = 4/154 (3%)
 Frame = +2

Query  1793  IGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNL--SGQRQGQPVFITRLEGYRSAS  1966
             +G +N+S +N PLSQQ +S+   +   ++VKVWEGNL  SG+RQG PVFITRLEGY   S
Sbjct  311   LGADNSSVSN-PLSQQTSSALHPAQF-EFVKVWEGNLYFSGRRQGPPVFITRLEGYICFS  368

Query  1967  ASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQ  2146
             AS  LA N P T+QIVR+  Q+ M ++ +V +  + +F+AM+Q+ F G LQEKKLCA+I+
Sbjct  369   ASVALAVNLPPTLQIVRVTPQELMYSRHFVRRVKYQIFKAMDQNDFFGMLQEKKLCAIIK  428

Query  2147  LPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIT  2248
             LPS+ LLLSVSDK   ++GM+ P D+ +  PQ T
Sbjct  429   LPSEILLLSVSDKLNCMVGMVCPLDLFLSAPQPT  462



>ref|XP_004959349.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Setaria italica]
Length=506

 Score =   295 bits (754),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 153/302 (51%), Positives = 201/302 (67%), Gaps = 14/302 (5%)
 Frame = +2

Query  185   EKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGS  364
             E++L+IAVEGTAA+GP+W +I+ DY+EKI+R  C +E   +K +GA  E  LV+F++ G 
Sbjct  5     ERRLVIAVEGTAALGPYWPAILGDYVEKIVRSLCASELPGKKLAGAPPELALVVFHTRGP  64

Query  365   YSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSKQT  541
             YSA  VQRSGWT+DID FL WLS I F GGG ++AA  EGL EALM+L  S N  Q+ Q 
Sbjct  65    YSAFCVQRSGWTKDIDAFLSWLSGISFTGGGLSEAATCEGLTEALMILHGSRNTTQNNQN  124

Query  542   VEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVS  721
              E  KHCILVAASNPYPLPTPVY   I +++  +N   + +  ++DAET AK F QCSVS
Sbjct  125   QEAHKHCILVAASNPYPLPTPVYCLPIRSTDHRKNIESSKEPSIADAETFAKLFPQCSVS  184

Query  722   LSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPS  901
             LSV+ PK +  LK IY A KRNP+ AD P+D+ KNP +LVL+SENFMEAR A +     +
Sbjct  185   LSVISPKQLPTLKAIYNAGKRNPQAADPPVDHAKNPQFLVLLSENFMEARTALSLPLRGN  244

Query  902   LPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPTTVT  1081
             L   Q  +KMD            S  A++ S +GP++  +P+    I  ATV +EP T+ 
Sbjct  245   LAPNQTKLKMD------------SAFANL-SVSGPMIGCKPVGVVGISTATVNVEPATIP  291

Query  1082  SM  1087
             +M
Sbjct  292   AM  293


 Score =   189 bits (479),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 118/149 (79%), Gaps = 3/149 (2%)
 Frame = +2

Query  1793  IGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASAS  1972
             +GV NN   NMP+ Q   + Q  S   K+VK+WEG L+  RQGQ VFI +LEGYRS ++S
Sbjct  335   LGVTNNFDINMPIGQHPNAQQPPS---KFVKIWEGTLTALRQGQSVFICKLEGYRSGASS  391

Query  1973  ETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLP  2152
             E LAA+WP+TMQIV LI+Q+ MN+K+Y GKA+FLVFR++N+HGFL QL++KKLCAVIQLP
Sbjct  392   EKLAADWPDTMQIVSLINQEDMNDKKYAGKAEFLVFRSLNRHGFLRQLKKKKLCAVIQLP  451

Query  2153  SQTLLLSVSDKACRLIGMLFPGDMVVFKP  2239
             SQTLLLSVS    RLIG+LFP D+V ++P
Sbjct  452   SQTLLLSVSGIEGRLIGILFPRDVVEYRP  480



>gb|AAF65166.2|AF166494_1 putative phloem transcription factor M1 [Apium graveolens]
Length=353

 Score =   286 bits (733),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 173/198 (87%), Gaps = 2/198 (1%)
 Frame = +2

Query  1658  MMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgmqpIGVNNNSAANMPLsq  1837
             MMQ   G +QNM+SG+G  SGI S   TM+PTPGM QQGQ G Q +G+ NN+AANMPL  
Sbjct  1     MMQNGIGMNQNMISGVG-QSGISSANSTMMPTPGMGQQGQPGPQSLGMANNAAANMPLPS  59

Query  1838  qqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVR  2017
             Q +++   +   KYV+VWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWP TMQIVR
Sbjct  60    QTSNAMQSAQS-KYVRVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPSTMQIVR  118

Query  2018  LISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRL  2197
             LISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRL
Sbjct  119   LISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRL  178

Query  2198  IGMLFPGDMVVFKPQITN  2251
             IGMLFPGDMVVFKPQI+N
Sbjct  179   IGMLFPGDMVVFKPQISN  196



>ref|XP_008340292.1| PREDICTED: LOW QUALITY PROTEIN: mediator of RNA polymerase II 
transcription subunit 25-like [Malus domestica]
Length=600

 Score =   294 bits (753),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 185/217 (85%), Gaps = 2/217 (1%)
 Frame = +2

Query  1589  LPSSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtq  1768
             L   VS+GQ VPGM+Q N+ G QM+Q+  G + NMMS +G ++G  SGTGTM+PTPGM Q
Sbjct  211   LQGGVSMGQAVPGMSQGNLSGPQMVQSGIGMNPNMMSALG-STGASSGTGTMIPTPGMAQ  269

Query  1769  qgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLE  1948
             Q Q G Q +G NNNSA+N+P SQQ +S+   +   KYVKVWEG LSGQRQGQPVFITRLE
Sbjct  270   QVQSGXQSLGANNNSASNVPFSQQTSSALASAQS-KYVKVWEGXLSGQRQGQPVFITRLE  328

Query  1949  GYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  2128
             GYRSASASETLAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK
Sbjct  329   GYRSASASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  388

Query  2129  LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  2239
             LCAVIQLPSQTLLLSVSDKA RLIGMLFPGDMVVFKP
Sbjct  389   LCAVIQLPSQTLLLSVSDKAXRLIGMLFPGDMVVFKP  425


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 55/96 (57%), Gaps = 13/96 (14%)
 Frame = +2

Query  1091  GPTFAHVPSVP--RAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSVRPV  1264
             G  F   P +P  R  SQ V  LQTSSP S SQE+  NN+N+ + KP VV G+      +
Sbjct  43    GRRFWFDPKIPSVRPHSQRVPGLQTSSPXSTSQEIATNNDNVPDLKP-VVSGVTHPSHSI  101

Query  1265  GAAAANVRILNDVAQAR----QALAGGTSIGLSSMG  1360
              +      ILN+++QAR     AL GGTSIGL +MG
Sbjct  102   SS------ILNNISQARVMNAAALTGGTSIGLPTMG  131



>gb|KEH39855.1| mediator of RNA polymerase II transcription subunit 25 [Medicago 
truncatula]
Length=600

 Score =   291 bits (745),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 162/308 (53%), Positives = 205/308 (67%), Gaps = 24/308 (8%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             MAEK++I+ VE TAAMGPHW ++  DYL KI++  CG E     P+ +N +F LV +++H
Sbjct  1     MAEKKVIVVVESTAAMGPHWDTLQVDYLNKIVKSLCGNE-----PAVSNAQFALVTYHTH  55

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQS--  532
             G YS  LVQRSGWTRD ++FL WLSSI F GGG ND A+AEGLAEALMM  SP+ ++S  
Sbjct  56    GIYSPVLVQRSGWTRDPEVFLDWLSSISFSGGGLNDTAVAEGLAEALMMF-SPSQSESPN  114

Query  533   KQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQC  712
             ++ V+   HCILVAASNPYPL  P+Y P+ + S  SE+  Q       DAE VAK+F Q 
Sbjct  115   QKNVDMPMHCILVAASNPYPLKRPIYVPKKNESIDSESGNQ-----FYDAEDVAKAFPQF  169

Query  713   SVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTG  892
             S+SLSV+CP+ + K+K IY A   NP     P+D  K P  LVLISE F EAR A + +G
Sbjct  170   SISLSVICPRNLPKIKAIYNAGAVNP-----PVDA-KPP--LVLISEGFREARTALSPSG  221

Query  893   MPSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNIHPATVKIEPT  1072
               +LPS Q  VK+D  SV P++G  PS   S+PS NG + NRQPIP  ++ PATVK EP 
Sbjct  222   TTNLPSNQIHVKVDDVSVAPVTGAPPS---SLPSVNGSIANRQPIPNVSVTPATVKAEPV  278

Query  1073  TVTSMPGP  1096
              V   P P
Sbjct  279   PVKVEPLP  286


 Score =   225 bits (574),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 125/146 (86%), Gaps = 4/146 (3%)
 Frame = +2

Query  1799  VNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASET  1978
             VNN +A NMPLSQQ TS+Q      KY+K WEG L+G RQGQPVFI++LEGYRS SASET
Sbjct  370   VNNAAATNMPLSQQTTSAQPP----KYIKAWEGTLTGLRQGQPVFISKLEGYRSFSASET  425

Query  1979  LAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQ  2158
             L A+WP  MQI RLISQDHMNNKQY+GKADFLVFRAMNQHGFLGQL+EKK CAVIQLPSQ
Sbjct  426   LTADWPAGMQIGRLISQDHMNNKQYIGKADFLVFRAMNQHGFLGQLKEKKQCAVIQLPSQ  485

Query  2159  TLLLSVSDKACRLIGMLFPGDMVVFK  2236
             TLL+SVSDK CRLIGM+FP +MVV K
Sbjct  486   TLLMSVSDKPCRLIGMIFPKEMVVTK  511



>ref|XP_006574880.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Glycine max]
Length=308

 Score =   276 bits (707),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/235 (59%), Positives = 172/235 (73%), Gaps = 3/235 (1%)
 Frame = +2

Query  179  MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
            MA K+LI+ VE TAAMGP+W +I+ DYL+KIIRCF G    + + S +NVEF LV +N+H
Sbjct  1    MAAKRLIVVVESTAAMGPYWETILRDYLDKIIRCF-GENDSTVQNSCSNVEFALVSYNTH  59

Query  359  GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSK  535
            G YS CLVQR+GWTRD D+F  WLSSI F GGGFNDA IAEGLAEAL+M  +S +G+ ++
Sbjct  60   GCYSGCLVQRTGWTRDPDVFFMWLSSIPFSGGGFNDAVIAEGLAEALVMFPNSQSGDPNQ  119

Query  536  QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
            Q V+  +HCILVAASNPYPL TP+Y PQ+ N EQSE        RL DAE VAK+F Q S
Sbjct  120  QNVDMHQHCILVAASNPYPLQTPIYVPQLQNLEQSETIDSFPGNRLYDAEAVAKAFPQFS  179

Query  716  VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAF  880
            +SLSV+CPK + K+K IY A  RN + AD P+   K P++L+LISE F EA+ A 
Sbjct  180  ISLSVICPKELPKIKGIYNAGNRNSKAADPPVL-AKTPHFLILISEGFREAQGAL  233



>ref|XP_006573263.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X6 [Glycine max]
Length=247

 Score =   273 bits (698),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 137/235 (58%), Positives = 170/235 (72%), Gaps = 3/235 (1%)
 Frame = +2

Query  179  MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
            MA K+LI+ VE TAAMGP+W +I+ DYL+KIIRCF G    + + S ++VEF LV +N+H
Sbjct  1    MAAKRLIVVVESTAAMGPYWETILRDYLDKIIRCF-GENVSTVQNSSSSVEFALVSYNTH  59

Query  359  GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSK  535
            G YS CLVQR+GWTRD D+F  WLSSI F GGGFNDA IAEGLAEALMM  +S +G+ ++
Sbjct  60   GCYSDCLVQRTGWTRDPDVFFLWLSSIPFSGGGFNDAVIAEGLAEALMMFPNSQSGDPNQ  119

Query  536  QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
            Q VE  +HCILVAASNPYPL TP+  PQ+ N EQSE         L DAE VAK+F Q S
Sbjct  120  QNVEIHQHCILVAASNPYPLRTPICVPQLQNLEQSETIESFPGNCLYDAEAVAKAFPQFS  179

Query  716  VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAF  880
            +SLSV+CPK + K+K IY A KRN + AD P+   K P++L+LISE F EA+   
Sbjct  180  ISLSVICPKQLPKIKAIYNAGKRNSKAADPPV-LAKTPHFLILISEGFREAQGVL  233



>ref|XP_006573262.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X5 [Glycine max]
Length=263

 Score =   273 bits (699),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 170/232 (73%), Gaps = 3/232 (1%)
 Frame = +2

Query  179  MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
            MA K+LI+ VE TAAMGP+W +I+ DYL+KIIRCF G    + + S ++VEF LV +N+H
Sbjct  1    MAAKRLIVVVESTAAMGPYWETILRDYLDKIIRCF-GENVSTVQNSSSSVEFALVSYNTH  59

Query  359  GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSK  535
            G YS CLVQR+GWTRD D+F  WLSSI F GGGFNDA IAEGLAEALMM  +S +G+ ++
Sbjct  60   GCYSDCLVQRTGWTRDPDVFFLWLSSIPFSGGGFNDAVIAEGLAEALMMFPNSQSGDPNQ  119

Query  536  QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
            Q VE  +HCILVAASNPYPL TP+  PQ+ N EQSE         L DAE VAK+F Q S
Sbjct  120  QNVEIHQHCILVAASNPYPLRTPICVPQLQNLEQSETIESFPGNCLYDAEAVAKAFPQFS  179

Query  716  VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEAR  871
            +SLSV+CPK + K+K IY A KRN + AD P+   K P++L+LISE F EA+
Sbjct  180  ISLSVICPKQLPKIKAIYNAGKRNSKAADPPV-LAKTPHFLILISEGFREAQ  230



>ref|XP_006573258.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X1 [Glycine max]
 ref|XP_006573259.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X2 [Glycine max]
 ref|XP_006573260.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X3 [Glycine max]
 ref|XP_006573261.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X4 [Glycine max]
Length=266

 Score =   273 bits (699),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 170/236 (72%), Gaps = 3/236 (1%)
 Frame = +2

Query  179  MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
            MA K+LI+ VE TAAMGP+W +I+ DYL+KIIRCF G    + + S ++VEF LV +N+H
Sbjct  1    MAAKRLIVVVESTAAMGPYWETILRDYLDKIIRCF-GENVSTVQNSSSSVEFALVSYNTH  59

Query  359  GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSK  535
            G YS CLVQR+GWTRD D+F  WLSSI F GGGFNDA IAEGLAEALMM  +S +G+ ++
Sbjct  60   GCYSDCLVQRTGWTRDPDVFFLWLSSIPFSGGGFNDAVIAEGLAEALMMFPNSQSGDPNQ  119

Query  536  QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
            Q VE  +HCILVAASNPYPL TP+  PQ+ N EQSE         L DAE VAK+F Q S
Sbjct  120  QNVEIHQHCILVAASNPYPLRTPICVPQLQNLEQSETIESFPGNCLYDAEAVAKAFPQFS  179

Query  716  VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFN  883
            +SLSV+CPK + K+K IY A KRN + AD P+   K P++L+LISE F EA+    
Sbjct  180  ISLSVICPKQLPKIKAIYNAGKRNSKAADPPV-LAKTPHFLILISEGFREAQGVLK  234



>gb|EMT10095.1| hypothetical protein F775_05844 [Aegilops tauschii]
Length=278

 Score =   274 bits (700),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/264 (55%), Positives = 187/264 (71%), Gaps = 3/264 (1%)
 Frame = +2

Query  182  AEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRC--FCGAEAGSQKPSGANVEFGLVMFNS  355
            +E+QL++AVEGTAA GP+W +I ++Y+EKI+R   FC  E   QK +G   E  LV+F++
Sbjct  7    SERQLVVAVEGTAARGPYWPAIAAEYVEKIVRWRSFCSTELSGQKLAGVPPELALVVFHT  66

Query  356  HGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS-SPNGNQS  532
            HG YSA +VQRSGWT+D+D FL WLS I F GGGF++AAI EGLAEALM+L  SP  + +
Sbjct  67   HGPYSAFIVQRSGWTKDMDAFLSWLSGISFSGGGFSEAAICEGLAEALMILQGSPGSSLN  126

Query  533  KQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQC  712
             Q  E QKHC+LVAASNPYPLPTPVYRP + +S+  ++   T +  L+DAETVA SFAQ 
Sbjct  127  HQNRELQKHCLLVAASNPYPLPTPVYRPSVQSSDHKKSNEATKESCLADAETVAVSFAQS  186

Query  713  SVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTG  892
            SVSLSVV PK +  LK IY A KRNP+ +D  +D+ KNP++LVL+SE+FMEAR A +   
Sbjct  187  SVSLSVVSPKQLPTLKAIYNAGKRNPQASDPSVDHAKNPHFLVLLSESFMEARTALSHPL  246

Query  893  MPSLPSTQNPVKMDVSSVPPISGP  964
              +L       KMD +    + GP
Sbjct  247  PGNLVPNHTITKMDTAPAATVPGP  270



>ref|XP_010477908.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Camelina sativa]
Length=718

 Score =   284 bits (726),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 182/219 (83%), Gaps = 2/219 (1%)
 Frame = +2

Query  1595  SSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqg  1774
             S++ V Q + GM+Q +  G QMMQ     +QNMMSG+G  + + SGTG M+PTPG+ QQ 
Sbjct  356   SNLGVSQPMQGMSQGSHSGPQMMQGGISMNQNMMSGLGQGN-VSSGTGGMMPTPGVAQQT  414

Query  1775  qqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGY  1954
             Q  +Q +G NN+SA+NM LSQ  + +   S   KYVKVWEGNLSGQRQGQPV ITRLEGY
Sbjct  415   QSAIQQLGGNNSSASNMQLSQPSSGALQTSQS-KYVKVWEGNLSGQRQGQPVLITRLEGY  473

Query  1955  RSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLC  2134
             RSASAS+TLAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQ+KKLC
Sbjct  474   RSASASDTLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQDKKLC  533

Query  2135  AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI N
Sbjct  534   AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIPN  572


 Score =   271 bits (692),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 144/279 (52%), Positives = 200/279 (72%), Gaps = 9/279 (3%)
 Frame = +2

Query  500   MMLSSPNGNQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSD  679
             MM   P+G Q++ + + ++HCIL+ ASNP+ LPTPVYRP++ N E+++N     + RLSD
Sbjct  1     MMFPPPSG-QAQPSNDLKRHCILITASNPHTLPTPVYRPRVQNVERNDNGDAQSESRLSD  59

Query  680   AETVAKSFAQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENF  859
             AETVA  FA+CSVSLSVVCPK + K++ +Y A K NP+ ADL +D  KNP+YLVLISENF
Sbjct  60    AETVASYFAKCSVSLSVVCPKQLPKIRALYNAGKLNPQSADLSMDTVKNPFYLVLISENF  119

Query  860   MEARAAFNRTGMPSLPSTQNPVKMDVSSVP---PISGPLPSGLASIPSANGPVMNRQPIP  1030
             +EARAA + +   +LP TQ+PVK+D ++V    P++G  P   A + SANGP++NRQP+ 
Sbjct  120   VEARAALSHSAT-NLPQTQSPVKVDRATVAPSLPVTGQPP---APVTSANGPILNRQPVS  175

Query  1031  TGNIHPATVKIEPTTVTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNEN  1207
              G +  ATVK+EP+TVTSM P P+F H+PSV R A+Q + ++QTSS   VSQ+MV N EN
Sbjct  176   VGPVPTATVKVEPSTVTSMAPVPSFPHIPSVARPATQAIPSIQTSSASPVSQDMVTNAEN  235

Query  1208  LQETKPMVVHGMGQSVRPVGAAAANVRILNDVAQARQAL  1324
               + KP+VV GM   +R   +  ANV +LN+++Q RQ +
Sbjct  236   APDIKPVVVSGMTPPLRAGPSGGANVNLLNNLSQVRQVM  274



>ref|XP_010663571.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Vitis vinifera]
Length=249

 Score =   251 bits (642),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/250 (52%), Positives = 167/250 (67%), Gaps = 2/250 (1%)
 Frame = +2

Query  179  MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
            M+ KQL+IAV+GTA MG +W  I+SDYL KIIR  CG     Q+ SG  VE  LVM+NSH
Sbjct  1    MSVKQLVIAVDGTAEMGFYWAPILSDYLVKIIRYLCGQNLTGQEASGGRVELSLVMYNSH  60

Query  359  GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSK  535
            G YS  L Q S  TR +  FL WLS+I F G G++D AIAEGLA+AL+M    P+G Q++
Sbjct  61   GPYSGFLTQDSRTTRSMGTFLQWLSAISFSGDGYDDLAIAEGLADALLMFPRHPHGTQTQ  120

Query  536  QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
            Q + G++HCILVAASNP+P P PV+ P+I N + ++    T +  L+D   VAK F QC 
Sbjct  121  QRLLGRRHCILVAASNPFPFPIPVHLPKIQNLQGAQISGATTEFSLADPNMVAKLFTQCC  180

Query  716  VSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGM  895
            VSLSV+ PK + KL+ IY +A  N +G +  + N  NP +L+LIS+NF EA AA N   +
Sbjct  181  VSLSVISPKQLPKLREIYNSANSNLQGEN-SLVNGMNPQFLILISKNFPEAHAALNEYNV  239

Query  896  PSLPSTQNPV  925
             S PS QNPV
Sbjct  240  TSTPSIQNPV  249



>gb|AAG50810.1|AC079281_12 hypothetical protein [Arabidopsis thaliana]
Length=534

 Score =   259 bits (661),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 181/219 (83%), Gaps = 3/219 (1%)
 Frame = +2

Query  1595  SSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqg  1774
             S++ V Q + GMNQ +  G  MMQ     +QNMMSG+G  + + SGTG M+PTPG+ QQ 
Sbjct  163   SNLGVSQPMQGMNQGSHSGA-MMQGGISMNQNMMSGLGQGN-VSSGTGGMMPTPGVGQQA  220

Query  1775  qqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGY  1954
             Q G+Q +G +N+SA NM LSQ  + +   S   KYVKVWEGNLSGQRQGQPV ITRLEGY
Sbjct  221   QSGIQQLGGSNSSAPNMQLSQPSSGAMQTSQS-KYVKVWEGNLSGQRQGQPVLITRLEGY  279

Query  1955  RSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLC  2134
             RSASAS++LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQ+KKLC
Sbjct  280   RSASASDSLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQDKKLC  339

Query  2135  AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI N
Sbjct  340   AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIPN  378


 Score = 68.2 bits (165),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +2

Query  1088  PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKPMVVHGMGQSVRPVG  1267
             P P+F H+P+V R A+Q + ++QTSS   VSQ+MV+N EN  + KP+VV GM   +R   
Sbjct  3     PVPSFPHIPAVARPATQAIPSIQTSSASPVSQDMVSNAENAPDIKPVVVSGMTPPLRTGP  62

Query  1268  AAAANVRILNDVAQARQAL  1324
                ANV +LN+++Q RQ +
Sbjct  63    PGGANVNLLNNLSQVRQVM  81



>ref|NP_001077596.1| mediator of RNA polymerase II transcription subunit 25 [Arabidopsis 
thaliana]
 gb|AEE30640.1| mediator of RNA polymerase II transcription subunit 25 [Arabidopsis 
thaliana]
Length=727

 Score =   259 bits (661),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 181/219 (83%), Gaps = 3/219 (1%)
 Frame = +2

Query  1595  SSVSVGQTVPGMNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqg  1774
             S++ V Q + GMNQ +  G  MMQ     +QNMMSG+G  + + SGTG M+PTPG+ QQ 
Sbjct  356   SNLGVSQPMQGMNQGSHSGA-MMQGGISMNQNMMSGLGQGN-VSSGTGGMMPTPGVGQQA  413

Query  1775  qqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGY  1954
             Q G+Q +G +N+SA NM LSQ  + +   S   KYVKVWEGNLSGQRQGQPV ITRLEGY
Sbjct  414   QSGIQQLGGSNSSAPNMQLSQPSSGAMQTSQS-KYVKVWEGNLSGQRQGQPVLITRLEGY  472

Query  1955  RSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLC  2134
             RSASAS++LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQ+KKLC
Sbjct  473   RSASASDSLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQDKKLC  532

Query  2135  AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI N
Sbjct  533   AVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIPN  571


 Score =   258 bits (659),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 142/279 (51%), Positives = 196/279 (70%), Gaps = 9/279 (3%)
 Frame = +2

Query  500   MMLSSPNGNQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSD  679
             MM S P+G Q++ + + ++HCIL+ ASNP+ LPTPVYRP++ N E++EN     + RLSD
Sbjct  1     MMFSPPSG-QAQPSNDLKRHCILITASNPHILPTPVYRPRLQNVERNENGDAQAESRLSD  59

Query  680   AETVAKSFAQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENF  859
             AETVA  FA+CSVSLSVVCPK +  ++ +Y A K N + ADL ID  KN +YLVLISENF
Sbjct  60    AETVASYFAKCSVSLSVVCPKQLPTIRALYNAGKPNQQSADLSIDTAKNTFYLVLISENF  119

Query  860   MEARAAFNRTGMPSLPSTQNPVKMDVSSVP---PISGPLPSGLASIPSANGPVMNRQPIP  1030
             +EA AA + +   +LP TQ+PVK+D ++V    P++G  P   A + SANGP+ NRQP+ 
Sbjct  120   VEACAALSHSAT-NLPQTQSPVKVDRATVAPSIPVTGQPP---APVSSANGPIQNRQPVS  175

Query  1031  TGNIHPATVKIEPTTVTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNEN  1207
              G +  ATVK+EP+TVTSM P P+F H+P+V R A+Q + ++QTSS   VSQ+MV+N EN
Sbjct  176   VGPVPTATVKVEPSTVTSMAPVPSFPHIPAVARPATQAIPSIQTSSASPVSQDMVSNAEN  235

Query  1208  LQETKPMVVHGMGQSVRPVGAAAANVRILNDVAQARQAL  1324
               + KP+VV GM   +R      ANV +LN+++Q RQ +
Sbjct  236   APDIKPVVVSGMTPPLRTGPPGGANVNLLNNLSQVRQVM  274



>gb|EPS63132.1| hypothetical protein M569_11655, partial [Genlisea aurea]
Length=164

 Score =   233 bits (594),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +2

Query  1874  KYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQY  2053
             +Y+KVWEGNLSG RQ QPVFITRLEG+R+ SASETLA +WP TMQIVRLISQDHMNNKQY
Sbjct  2     RYIKVWEGNLSGLRQRQPVFITRLEGFRNISASETLAVHWPPTMQIVRLISQDHMNNKQY  61

Query  2054  VGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVF  2233
             +GKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKA RLIGMLFPGDMVVF
Sbjct  62    LGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKAHRLIGMLFPGDMVVF  121

Query  2234  K  2236
             K
Sbjct  122   K  122



>gb|EMT10094.1| hypothetical protein F775_05843 [Aegilops tauschii]
Length=542

 Score =   243 bits (620),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 202/433 (47%), Positives = 258/433 (60%), Gaps = 72/433 (17%)
 Frame = +2

Query  1007  VMNRQPIPTGNIHPATVKIEPTTVTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQ  1183
             +M RQP        A VK+EPTT+  M   P F+H+  +   ASQ V  +QTSSP  +SQ
Sbjct  1     MMGRQPT-------ANVKVEPTTIPPMVSAPAFSHMTPISNVASQGVSAMQTSSPSIISQ  53

Query  1184  EMVANNENLQETKPMVVHGMGQSVRPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGG  1363
             E    NE LQE KP+V + + Q VRP G A  NV ILN+++Q R +L   TS+G  +MG 
Sbjct  54    ETNVANEILQEHKPLV-NPIQQQVRPGGPA--NVSILNNLSQHRHSLTAATSMG-PNMGA  109

Query  1364  TPM---LSNmissgmassvsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftat  1534
             TP+   +SNMISSGM S+ +   S+  + Q          P+ G  Q+VQ++A  SF + 
Sbjct  110   TPIQVHMSNMISSGMTSTPAVISSISGTVQ----------PI-GAQQLVQNTALGSFGSN  158

Query  1535  tssmsstsnlvmsqsmNTLPSSVSVGQTVPGMNQAN-MPGTQMMQTATGRSQNMMSGMGG  1711
             TS++S  SN+ +S S+  + S++++GQ+VP M Q   M G Q  Q   G +QNM++ +G 
Sbjct  159   TSTVSGNSNIAVSSSLANIQSNMAMGQSVPSMAQGGLMAGPQSGQGGIGTNQNMINNLG-  217

Query  1712  ASGIPSgtgtmvptpgmtqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVW  1891
                  + + T    P      Q G+  +  NN+SA NMPL+Q     Q      KYVK+W
Sbjct  218   ---TTAISSTPTMMPTPGMVQQTGVNALSANNSSAMNMPLAQHPNGQQPS----KYVKIW  270

Query  1892  EG--------------NLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQ  2029
             EG               LSGQRQGQPVFI +LEGYRS +AS+T                 
Sbjct  271   EGYSSGHDFLLFIFQGTLSGQRQGQPVFICKLEGYRSGTASDT-----------------  313

Query  2030  DHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGML  2209
                   QYVGKADFLVFR +NQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKA RLIGML
Sbjct  314   ------QYVGKADFLVFRTLNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKAGRLIGML  367

Query  2210  FPGDMVVFKPQIT  2248
             FPGDMVVFKPQ++
Sbjct  368   FPGDMVVFKPQVS  380



>gb|KHN27175.1| Mediator of RNA polymerase II transcription subunit 25 [Glycine 
soja]
Length=247

 Score =   231 bits (590),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 148/210 (70%), Gaps = 3/210 (1%)
 Frame = +2

Query  254  DYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGSYSACLVQRSGWTRDIDLFLHWLS  433
            + L  + RCF G    + + S +NVEF LV +N+HG YS CLVQR+GWTRD D+F  WLS
Sbjct  7    NLLWCLYRCF-GENDSTVQNSCSNVEFALVSYNTHGCYSGCLVQRTGWTRDPDVFFMWLS  65

Query  434  SIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSKQTVEGQKHCILVAASNPYPLPTPVY  610
            SI F GGGFNDA IAEGLAEAL+M  +S +G+ ++Q V+  +HCILVAASNPYPL TP+Y
Sbjct  66   SIPFSGGGFNDAVIAEGLAEALVMFPNSQSGDPNQQNVDMHQHCILVAASNPYPLQTPIY  125

Query  611  RPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLSVVCPKLVLKLKTIYAAAKRNP  790
             PQ+ N EQSE        RL DAE VAK+F Q S+SLSV+CPK + K+K IY A  RN 
Sbjct  126  VPQLQNLEQSETIDSFPGNRLYDAEAVAKAFPQFSISLSVICPKELPKIKGIYNAGNRNS  185

Query  791  RGADLPIDNPKNPYYLVLISENFMEARAAF  880
            + AD P+   K P++L+LISE F EA+ A 
Sbjct  186  KAADPPVL-AKTPHFLILISEGFREAQGAL  214



>ref|XP_011070854.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Sesamum indicum]
Length=264

 Score =   232 bits (591),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 152/194 (78%), Gaps = 7/194 (4%)
 Frame = +2

Query  1682  SQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqg---mqpIGVN-NNSAANMPLsqqqts  1849
             +QNM+SG  GASG+PSGTGT++     T Q        QP+G+N NNS  NMPL+QQ +S
Sbjct  2     NQNMLSG-SGASGMPSGTGTIMIPTLGTSQQAGQPGMQQPVGLNSNNSGTNMPLNQQPSS  60

Query  1850  sqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQ  2029
             +   +   KYVKVWEGNLSG RQGQPVFITRLEGYR ASASETLAANWP  MQIVRLISQ
Sbjct  61    TIQSARS-KYVKVWEGNLSGPRQGQPVFITRLEGYRRASASETLAANWPPVMQIVRLISQ  119

Query  2030  DHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGML  2209
             DHMN K Y GK DFLVFRAMNQHGFLG+LQEKKLCAVIQLPSQTLLLS S +A RL+ +L
Sbjct  120   DHMNKKHY-GKTDFLVFRAMNQHGFLGELQEKKLCAVIQLPSQTLLLSASSRAYRLLAVL  178

Query  2210  FPGDMVVFKPQITN  2251
             F GDMV F PQI N
Sbjct  179   FTGDMVAFNPQIPN  192



>ref|XP_002969081.1| hypothetical protein SELMODRAFT_440592 [Selaginella moellendorffii]
 gb|EFJ30197.1| hypothetical protein SELMODRAFT_440592 [Selaginella moellendorffii]
Length=1048

 Score =   244 bits (622),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 168/432 (39%), Positives = 245/432 (57%), Gaps = 51/432 (12%)
 Frame = +2

Query  170   QSPMAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMF  349
             Q P A+  L++AVE TAA+GP W  + S+YL+KI R F G +   QK +GA +E  LV+F
Sbjct  19    QQPQAQY-LVLAVEATAALGPSWPLLRSEYLDKIARAFYGQDGNVQKDNGATLEMALVVF  77

Query  350   NSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQ  529
               H SYS CL+QRSGWT  ++LF  WLSSI F GGGF + A+AEGLAEAL+M        
Sbjct  78    RGHDSYSGCLLQRSGWTPSLELFQLWLSSIDFSGGGFGEVAVAEGLAEALVMCCPTTQPP  137

Query  530   SKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQ  709
             S Q    Q+HCILVAASNP+ L TPV  P +        + + D   L+DAE VA++F+Q
Sbjct  138   SNQAC--QRHCILVAASNPHRLQTPVPHPPLSTGA----DAKPDHWWLADAEAVARAFSQ  191

Query  710   CSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNR-  886
             C +SLSVVCP+ +  LK +Y+ AK+NPR +D   +  K+  +LVLISE+F+EAR    R 
Sbjct  192   CHISLSVVCPRQLPSLKNLYSVAKQNPRASDPSNEIAKHTQHLVLISESFLEARNCLRRV  251

Query  887   TGMP------SLPSTQNPVKMDVSSVPPI----SGPLPS------GLASIPSANGPVMNR  1018
             T  P      S+P +   VK++  +  P+    + P+P+         ++P+ +G     
Sbjct  252   TQAPALAAAVSMPPSPTSVKVEQQAAAPLTVQTTQPVPATAVPSVSTGTVPTTSG--RQS  309

Query  1019  QPIPTGNIHPATVKIEPTTVT---SMPGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEM  1189
             Q +  GNI  +TVKIE  + +   S   P  A+      A S P+Q+   +S  ++SQE+
Sbjct  310   QIMSNGNIPTSTVKIEHVSTSGPLSYGSPPMANTSMA--AVSLPIQSSGATS--AMSQEV  365

Query  1190  VA------NNENLQETKPMVVHGMGQSVRPVGAAAANVRILNDVAQARQAL-------AG  1330
             +       ++  +Q+ K +  + + QS RPV AA+    +LN + Q   +        AG
Sbjct  366   LRPPLGSDSSTAVQDFKSINTNTL-QSHRPVPAAS----VLNQIRQGAGSAAVSSILSAG  420

Query  1331  GTSIGLSSMGGT  1366
               ++G + MG T
Sbjct  421   SLAVGQAGMGIT  432


 Score =   192 bits (489),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  1874  KYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQY  2053
             KY K+W+G L+GQR G+PV I  LEGYR  S+ ETLAA+WP TMQIVRLI QD+M+N++Y
Sbjct  576   KYTKLWQGTLAGQRHGKPVPICSLEGYRQISSPETLAADWPLTMQIVRLIPQDYMSNREY  635

Query  2054  VGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVF  2233
              GKA+ LVFR +NQHGFL QL +KKLCAVIQLPSQTLLL+ +DK  R+IGMLFPGD VVF
Sbjct  636   QGKAELLVFRPLNQHGFLQQLADKKLCAVIQLPSQTLLLASADKPQRMIGMLFPGDTVVF  695

Query  2234  KPQITN  2251
             KPQ  N
Sbjct  696   KPQGQN  701



>ref|XP_002973982.1| hypothetical protein SELMODRAFT_442372 [Selaginella moellendorffii]
 gb|EFJ24937.1| hypothetical protein SELMODRAFT_442372 [Selaginella moellendorffii]
Length=750

 Score =   229 bits (585),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 158/408 (39%), Positives = 232/408 (57%), Gaps = 47/408 (12%)
 Frame = +2

Query  170   QSPMAEKQLIIAVEGTAAMGPHWTSIVSDYL--EKIIRCFCGAEAGSQKPSGANVEFGLV  343
             Q P A+  L++AVE TAA+GP W  + S+ L  +   R F G +   QK +GA +E  LV
Sbjct  19    QQPQAQY-LVLAVEATAALGPSWPLLRSEILVPDWYFRAFYGQDGNVQKDNGATLEMALV  77

Query  344   MFNSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNG  523
             +F  H SYS CL+QRSGWT  ++LF  WLSSI F GGGF + A+AEGLAEAL+M      
Sbjct  78    VFRGHDSYSGCLLQRSGWTPSLELFQLWLSSIDFSGGGFGEVAVAEGLAEALVMCCPTTQ  137

Query  524   NQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSF  703
               S Q    Q+HCILVAASNP+ L TPV  P +        + + D   L+DAE VA++F
Sbjct  138   PPSNQAC--QRHCILVAASNPHRLQTPVPHPPLSTGA----DAKPDHWWLADAEAVARAF  191

Query  704   AQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFN  883
             +QC +SLSVVCP+ +  LK +Y+ AK+NPR +D   +  K+  +LVLISE+F+EAR    
Sbjct  192   SQCHISLSVVCPRQLPSLKNLYSVAKQNPRASDPSNEIAKHTQHLVLISESFLEARNCLR  251

Query  884   R-TGMP-----SLPSTQNPVKMDVSSVPPI----SGPLPS------GLASIPSANGPVMN  1015
             R T  P     S+P +   VK++  +  P+    + P+P+         ++P+ +G    
Sbjct  252   RVTQAPALAAVSMPPSPTSVKVEQQAAAPLTVQTTQPVPATAVPSVSTGTVPTTSG--RQ  309

Query  1016  RQPIPTGNIHPATVKIEPTTVTSMPGPTFAHVPSVPR----AASQPVQNLQTSSPISVSQ  1183
              Q +  GNI  +TVKIE  + +   GP     P +      A S P+Q+   +S  ++SQ
Sbjct  310   SQIMSNGNIPTSTVKIEHVSTS---GPLSYGSPPMANTSMAAVSLPIQSSGATS--AMSQ  364

Query  1184  EMVA------NNENLQETKPMVVHGMGQSVRPVGAAAANVRILNDVAQ  1309
             +++       ++  +Q+ K +  + + QS RPV AA+    +LN + Q
Sbjct  365   DVLRPPLGSDSSTAVQDFKSINTNSL-QSHRPVPAAS----VLNQIRQ  407


 Score =   188 bits (478),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 103/126 (82%), Gaps = 1/126 (1%)
 Frame = +2

Query  1874  KYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQY  2053
             KY K+W+G L+GQR G+PV I  LEGYR  S+ ETLAA+WP TMQIVRLI QD+M+ K+Y
Sbjct  577   KYTKLWQGTLAGQRHGKPVPICSLEGYRQISSPETLAADWPLTMQIVRLIPQDYMS-KEY  635

Query  2054  VGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVF  2233
              GKA+ LVFR +NQHGFL QL +KKLCAVIQLPSQTLLL+ +DK  R+IGMLFPGD VVF
Sbjct  636   QGKAELLVFRPLNQHGFLQQLADKKLCAVIQLPSQTLLLASADKPQRMIGMLFPGDTVVF  695

Query  2234  KPQITN  2251
             KPQ  N
Sbjct  696   KPQGQN  701



>gb|EMS65916.1| hypothetical protein TRIUR3_16672 [Triticum urartu]
Length=708

 Score =   219 bits (557),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 188/409 (46%), Positives = 240/409 (59%), Gaps = 65/409 (16%)
 Frame = +2

Query  1049  ATVKIEPTTVTSM-PGPTFAHVPSVPRAASQPVQNLQTSSPISVSQEMVANNENLQETKP  1225
             A    EPTT+  M   P F+H+  +   ASQ V  +QTSSP  +SQE    NE LQE KP
Sbjct  185   AIYNAEPTTIPPMVSAPAFSHMTPISNVASQGVSAMQTSSPSIISQETNVANEILQEHKP  244

Query  1226  MVVHGMGQSVRPVGAAAANVRILNDVAQARQALAGGTSIGLSSMGGTPM---LSNmissg  1396
             +V + + Q VRP G A  NV ILN+++Q R +L   TS+G  +MG TP+   +SNMISSG
Sbjct  245   LV-NPIQQQVRPGGPA--NVSILNNLSQHRHSLTAATSMG-PNMGATPIQVHMSNMISSG  300

Query  1397  massvsaaqsvisssqsgvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsq  1576
             M S+ +   S+  + Q          P+ G  Q+VQ++A  SF + TS++S  SN+ +S 
Sbjct  301   MTSTPAVISSISGTVQ----------PI-GAQQLVQNTALGSFGSNTSTVSGNSNIAVSS  349

Query  1577  smNTLPSSVSVGQTVPGMNQAN-MPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvpt  1753
             S+  + S++++GQ+VP M Q   M G Q  Q   G +QNM++ +G      + + T    
Sbjct  350   SLANIQSNMAMGQSVPSMAQGGLMAGPQSGQGGIGTNQNMINNLG----TTAISSTPTMM  405

Query  1754  pgmtqqgqqgmqpIGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWE-------------  1894
             P      Q G+  +  NN+SA NMPL+Q     Q      KYVK+WE             
Sbjct  406   PTPGMVQQTGVNALSANNSSAMNMPLAQHPNGQQPS----KYVKIWEEYNSGHDFLLFIF  461

Query  1895  -GNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADF  2071
              G LSGQRQGQPVFI +LEGYRS +AS+T                       QYVGKADF
Sbjct  462   QGTLSGQRQGQPVFICKLEGYRSGTASDT-----------------------QYVGKADF  498

Query  2072  LVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPG  2218
             LVFR +NQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKA RLIGMLFPG
Sbjct  499   LVFRTLNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKAGRLIGMLFPG  547


 Score =   198 bits (504),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 131/181 (72%), Gaps = 3/181 (2%)
 Frame = +2

Query  242  SIVSDYLEKIIR--CFCGAEAGSQKPSGANVEFGLVMFNSHGSYSACLVQRSGWTRDIDL  415
            +I ++Y+EKI+R   FC  E   QK +G   E  LV+F++HG YSA +VQRSGWT+D+D 
Sbjct  9    AIAAEYVEKIVRWRSFCSTELSGQKLAGVPPELALVVFHTHGPYSAFIVQRSGWTKDMDA  68

Query  416  FLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSKQTVEGQKHCILVAASNPYP  592
            FL WLS I F GGGF++AAI EGLAEALM+L  SP  +Q+ Q  E QKHC+LVAASNPYP
Sbjct  69   FLSWLSGISFSGGGFSEAAICEGLAEALMILQGSPGSSQNHQNRELQKHCLLVAASNPYP  128

Query  593  LPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLSVVCPKLVLKLKTIYA  772
            LPTPVYRP + +S+  ++   T +  L+DAE VA SFAQ SVSLSVV PK +  LK IY 
Sbjct  129  LPTPVYRPSVQSSDHKKSNEATKESCLADAEAVAVSFAQSSVSLSVVSPKQLPTLKAIYN  188

Query  773  A  775
            A
Sbjct  189  A  189



>ref|XP_003614497.1| PHYTOCHROME AND FLOWERING TIME [Medicago truncatula]
 gb|AES97455.1| hypothetical protein MTR_5g054690 [Medicago truncatula]
Length=358

 Score =   203 bits (517),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  1886  VWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKA  2065
             +WEG+L G++QG+P+FIT+LEGYR +SASETLAANWP  M IVR+ISQDHMNNK+YVG+A
Sbjct  28    IWEGSLYGRKQGEPIFITKLEGYRRSSASETLAANWPPEMHIVRIISQDHMNNKKYVGEA  87

Query  2066  DFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFK  2236
             DFLVFRA N HGFLG LQEKKLCAVIQL SQTLLLSVSDKACRL+G+LFPGD +V K
Sbjct  88    DFLVFRARNTHGFLGLLQEKKLCAVIQLQSQTLLLSVSDKACRLMGVLFPGDKLVSK  144


 Score =   192 bits (487),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 102/121 (84%), Gaps = 2/121 (2%)
 Frame = +2

Query  1877  YVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNN-KQY  2053
             Y+ VWEG+L G R GQP FI++LE YRS+S+SETL ANW   MQIV+LI QDHMNN +QY
Sbjct  170   YISVWEGSLLGLRHGQPKFISKLEAYRSSSSSETLVANWSPEMQIVQLIPQDHMNNLQQY  229

Query  2054  VGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKA-CRLIGMLFPGDMVV  2230
             VG ADFLVFRAMN HGFLGQLQEKKLCAVIQLPSQTLLLSVSD A CRLIGMLF  DM V
Sbjct  230   VGNADFLVFRAMNPHGFLGQLQEKKLCAVIQLPSQTLLLSVSDIACCRLIGMLFSRDMFV  289

Query  2231  F  2233
             F
Sbjct  290   F  290



>gb|AFK48085.1| unknown [Medicago truncatula]
Length=357

 Score =   201 bits (510),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +2

Query  1886  VWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKA  2065
             +WEG+L G++QG+P+FIT+LEGYR +SASETLAANWP  M IVR+ISQDHMNNK+YVG+A
Sbjct  27    IWEGSLYGRKQGEPIFITKLEGYRRSSASETLAANWPPEMHIVRIISQDHMNNKKYVGEA  86

Query  2066  DFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFK  2236
             DFLVFRA N HGFLG LQEKKLCAVIQL SQTLLLSVSDKACR +G+LFPGD +V K
Sbjct  87    DFLVFRARNTHGFLGLLQEKKLCAVIQLQSQTLLLSVSDKACRSMGVLFPGDKLVSK  143


 Score =   190 bits (482),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 102/121 (84%), Gaps = 2/121 (2%)
 Frame = +2

Query  1877  YVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNN-KQY  2053
             Y+ VWEG+L G R GQP FI++LE YRS+S+SETL ANW   MQIV+LI QDHMN+ +QY
Sbjct  169   YISVWEGSLLGLRHGQPKFISKLEAYRSSSSSETLVANWSPEMQIVQLIPQDHMNSLQQY  228

Query  2054  VGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKA-CRLIGMLFPGDMVV  2230
             VG ADFLVFRAMN HGFLGQLQEKKLCAVIQLPSQTLLLSVSD A CRLIGMLF  DM V
Sbjct  229   VGNADFLVFRAMNPHGFLGQLQEKKLCAVIQLPSQTLLLSVSDIACCRLIGMLFSRDMFV  288

Query  2231  F  2233
             F
Sbjct  289   F  289



>gb|KEH27968.1| hypothetical protein MTR_5g054690 [Medicago truncatula]
Length=318

 Score =   192 bits (488),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 102/121 (84%), Gaps = 2/121 (2%)
 Frame = +2

Query  1877  YVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNN-KQY  2053
             Y+ VWEG+L G R GQP FI++LE YRS+S+SETL ANW   MQIV+LI QDHMNN +QY
Sbjct  130   YISVWEGSLLGLRHGQPKFISKLEAYRSSSSSETLVANWSPEMQIVQLIPQDHMNNLQQY  189

Query  2054  VGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKA-CRLIGMLFPGDMVV  2230
             VG ADFLVFRAMN HGFLGQLQEKKLCAVIQLPSQTLLLSVSD A CRLIGMLF  DM V
Sbjct  190   VGNADFLVFRAMNPHGFLGQLQEKKLCAVIQLPSQTLLLSVSDIACCRLIGMLFSRDMFV  249

Query  2231  F  2233
             F
Sbjct  250   F  250


 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  1979  LAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVI  2143
             L  NWP  M IVR+ISQDHMNNK+YVG+ADFLVFRA N HGFLG LQEKKL  ++
Sbjct  48    LRPNWPPEMHIVRIISQDHMNNKKYVGEADFLVFRARNTHGFLGLLQEKKLDKLV  102



>ref|XP_010501597.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Camelina sativa]
Length=141

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  1874  KYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQY  2053
             KYVKVWEGNLSGQRQGQPV ITRLEGYRSASAS+TLAANWP TMQIVRLISQDHMNNKQY
Sbjct  27    KYVKVWEGNLSGQRQGQPVLITRLEGYRSASASDTLAANWPPTMQIVRLISQDHMNNKQY  86

Query  2054  VGKADFLVFRAMNQHGFLGQLQEKKLCAVI  2143
             VGKADFLVFRAM+QHGFLGQLQ+KKLCAVI
Sbjct  87    VGKADFLVFRAMSQHGFLGQLQDKKLCAVI  116



>gb|KEH27966.1| hypothetical protein MTR_5g054690 [Medicago truncatula]
Length=329

 Score =   192 bits (487),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 102/121 (84%), Gaps = 2/121 (2%)
 Frame = +2

Query  1877  YVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNN-KQY  2053
             Y+ VWEG+L G R GQP FI++LE YRS+S+SETL ANW   MQIV+LI QDHMNN +QY
Sbjct  141   YISVWEGSLLGLRHGQPKFISKLEAYRSSSSSETLVANWSPEMQIVQLIPQDHMNNLQQY  200

Query  2054  VGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKA-CRLIGMLFPGDMVV  2230
             VG ADFLVFRAMN HGFLGQLQEKKLCAVIQLPSQTLLLSVSD A CRLIGMLF  DM V
Sbjct  201   VGNADFLVFRAMNPHGFLGQLQEKKLCAVIQLPSQTLLLSVSDIACCRLIGMLFSRDMFV  260

Query  2231  F  2233
             F
Sbjct  261   F  261


 Score =   145 bits (366),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +2

Query  1886  VWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKA  2065
             +WEG+L G++QG+P+FIT+LEGYR +SASETLAANWP  M IVR+ISQDHMNNK+YVG+A
Sbjct  28    IWEGSLYGRKQGEPIFITKLEGYRRSSASETLAANWPPEMHIVRIISQDHMNNKKYVGEA  87

Query  2066  DFLVFRAMNQHGFLGQLQEKKLCAVI  2143
             DFLVFRA N HGFLG LQEKKL  ++
Sbjct  88    DFLVFRARNTHGFLGLLQEKKLDKLV  113



>gb|KEH27967.1| hypothetical protein MTR_5g054690 [Medicago truncatula]
Length=347

 Score =   192 bits (488),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 102/121 (84%), Gaps = 2/121 (2%)
 Frame = +2

Query  1877  YVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNN-KQY  2053
             Y+ VWEG+L G R GQP FI++LE YRS+S+SETL ANW   MQIV+LI QDHMNN +QY
Sbjct  159   YISVWEGSLLGLRHGQPKFISKLEAYRSSSSSETLVANWSPEMQIVQLIPQDHMNNLQQY  218

Query  2054  VGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKA-CRLIGMLFPGDMVV  2230
             VG ADFLVFRAMN HGFLGQLQEKKLCAVIQLPSQTLLLSVSD A CRLIGMLF  DM V
Sbjct  219   VGNADFLVFRAMNPHGFLGQLQEKKLCAVIQLPSQTLLLSVSDIACCRLIGMLFSRDMFV  278

Query  2231  F  2233
             F
Sbjct  279   F  279


 Score =   147 bits (372),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +2

Query  1979  LAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQ  2158
             L  NWP  M IVR+ISQDHMNNK+YVG+ADFLVFRA N HGFLG LQEKKLCAVIQL SQ
Sbjct  48    LRPNWPPEMHIVRIISQDHMNNKKYVGEADFLVFRARNTHGFLGLLQEKKLCAVIQLQSQ  107

Query  2159  TLLLSVSDKACRLIGMLFPGDMVVFK  2236
             TLLLSVSDKACRL+G+LFPGD +V K
Sbjct  108   TLLLSVSDKACRLMGVLFPGDKLVSK  133



>ref|XP_002964016.1| hypothetical protein SELMODRAFT_405603 [Selaginella moellendorffii]
 gb|EFJ34349.1| hypothetical protein SELMODRAFT_405603 [Selaginella moellendorffii]
Length=626

 Score =   196 bits (499),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 126/320 (39%), Positives = 181/320 (57%), Gaps = 31/320 (10%)
 Frame = +2

Query  167   GQSPMAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGA-------EAGSQKPSGAN  325
              Q P A+  L++AVE TAA+GP W  + S+YL+K+ R   G           +  P+   
Sbjct  18    AQQPQAQY-LVLAVEATAALGPSWPLLRSEYLDKLARRTMGLLWRWRSWSFEAMIPTVVG  76

Query  326   VEFGLVMFNSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMM  505
              +F  V    + S + CL+QRSGWT  ++LF  WLSSI F GGGF + A+AEGLAEAL+M
Sbjct  77    KDFREV----YPSITGCLLQRSGWTPSLELFQLWLSSIDFSGGGFGEVAVAEGLAEALVM  132

Query  506   LSSPNGNQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAE  685
                     S Q    Q+HCILV ASNP+ L  PV  P +        + + D   L+DAE
Sbjct  133   CCPTTQPPSNQAC--QRHCILVPASNPHRLQAPVPHPPLSTGA----DAKPDQWWLADAE  186

Query  686   TVAKSFAQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFME  865
             TVA++F+QC +SLSVVCP+ +  LK +Y+ AK+NPR +D   +  K+  +LVLISE+F+E
Sbjct  187   TVARAFSQCHISLSVVCPRQLPSLKNLYSVAKQNPRASDPSNEIAKHTQHLVLISESFLE  246

Query  866   ARAAFNRT------GMPSLPSTQNPVKMDVSSVPPI----SGPLP-SGLASIPSANGPVM  1012
             AR    R          S+P +   VK++  +  P+    + P+P + + S+ +   P  
Sbjct  247   ARNCLRRVIQAPALAAVSMPPSPTSVKVEQQAAAPLAVQTTQPVPATAVPSVSTGTVPTN  306

Query  1013  NRQP--IPTGNIHPATVKIE  1066
              RQ   +  G+I  +TVKIE
Sbjct  307   GRQSQIMSNGSIPMSTVKIE  326


 Score =   108 bits (270),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 76/121 (63%), Gaps = 20/121 (17%)
 Frame = +2

Query  1874  KYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMN----  2041
             KY K+W+G L+GQR G+PV I  LEGYR  S+        PET    RL + +  +    
Sbjct  488   KYTKLWQGTLAGQRHGKPVQICSLEGYRQTSS--------PETYVGYRLAADNADSAFNY  539

Query  2042  ---NKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLF  2212
                ++Q  GKA+ LVFR +NQHGFL QL +KKL     LPSQTLLL+ +DK  R+IGMLF
Sbjct  540   TGLHEQQEGKAELLVFRPLNQHGFLQQLADKKL-----LPSQTLLLASADKPQRMIGMLF  594

Query  2213  P  2215
             P
Sbjct  595   P  595



>gb|ABR17109.1| unknown [Picea sitchensis]
Length=410

 Score =   186 bits (473),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  1874  KYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQY  2053
             KY KVWEG L G RQG+PV I RLEGYR+  +SE +AA+WP +MQI+RLISQDH+ +  Y
Sbjct  227   KYTKVWEGLLGGSRQGKPVPICRLEGYRNIRSSEIIAADWPSSMQIIRLISQDHITSIHY  286

Query  2054  VGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVF  2233
              GKADFL+FR +N HGFL QL E+KL AVIQLP+QTLLLS SDK  R+ GMLFPGD VVF
Sbjct  287   PGKADFLIFRPLNSHGFLMQLAERKLSAVIQLPTQTLLLSTSDKPSRMCGMLFPGDTVVF  346

Query  2234  KPQI  2245
             +PQ+
Sbjct  347   EPQL  350



>ref|XP_001778121.1| predicted protein [Physcomitrella patens]
 gb|EDQ57011.1| predicted protein [Physcomitrella patens]
Length=878

 Score =   193 bits (490),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  1874  KYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQY  2053
             KY K+WEG L+GQRQ +PV I +LEGYR  S+SE LAA+WP TMQIVRLI+Q++MN+K+Y
Sbjct  535   KYTKLWEGILAGQRQQKPVPICKLEGYRQTSSSEKLAADWPPTMQIVRLIAQEYMNSKEY  594

Query  2054  VGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVF  2233
              GKA+ LVFR ++ HGFL QL EKKLCAVIQLPSQTLLL+ +DK  R+IGMLFPGDMVVF
Sbjct  595   QGKAELLVFRPLSSHGFLVQLAEKKLCAVIQLPSQTLLLASTDKPGRMIGMLFPGDMVVF  654

Query  2234  KPQI  2245
             KP +
Sbjct  655   KPNV  658


 Score =   176 bits (447),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 114/309 (37%), Positives = 163/309 (53%), Gaps = 54/309 (17%)
 Frame = +2

Query  179   MAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSH  358
             M+++QL++AVE T A+GP W+ ++++Y++KI+R F   E+ +QK   +  E  LV+FN+H
Sbjct  2     MSQRQLVVAVEATGALGPFWSVLLTEYVDKIVRAFFD-ESNNQKNGSSPGEVALVVFNTH  60

Query  359   GSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDA-------------AIAEGLAEAL  499
             GS+S  L+++SGWT  +DLF  WLS++ F GGGF++A              I+  L E  
Sbjct  61    GSHSDFLLRQSGWTSSMDLFFKWLSALTFEGGGFSEAAVAEALAEALMEWTISYDLYELN  120

Query  500   MMLSSPNGNQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSD  679
             + +  P       TV  QKHC+L+AASNPY LPTPV RP +      + E Q++   L+D
Sbjct  121   LQMCCPGPK--PPTVPHQKHCLLIAASNPYRLPTPVMRPPVILLSTGQAELQSEQWWLAD  178

Query  680   AETVAKSFAQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENF  859
             AETVAK+F                        AKRNPR AD   D  K   +LVLISE F
Sbjct  179   AETVAKAF----------------------PPAKRNPRAADTGPDFSK--LHLVLISEGF  214

Query  860   MEARAAFNRTG-------MPSLPSTQNPVKMDVSSVP--PISGPLPSGLASIPSANGPVM  1012
              E + A  R           SL +   P+    +S P  P   P+P       +A G +M
Sbjct  215   PEGKLALRRASGASNTAVSSSLSAKLEPLLATTTSAPSQPAVRPMPPS-----TAVGAMM  269

Query  1013  NRQPIPTGN  1039
              RQ +  G+
Sbjct  270   GRQAVSNGS  278



>ref|XP_004173267.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Cucumis sativus]
Length=238

 Score =   180 bits (457),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/83 (98%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +2

Query  2003  MQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSD  2182
             MQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSD
Sbjct  1     MQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSD  60

Query  2183  KACRLIGMLFPGDMVVFKPQITN  2251
             KACRLIGMLFPGDMVVFKPQI++
Sbjct  61    KACRLIGMLFPGDMVVFKPQISS  83



>ref|XP_008670907.1| PREDICTED: uncharacterized protein LOC103648198 isoform X2 [Zea 
mays]
 tpg|DAA42405.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=1052

 Score =   190 bits (483),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 106/127 (83%), Gaps = 5/127 (4%)
 Frame = +2

Query  1874  KYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNK--  2047
             KYVK+WEG+L GQRQGQPVFI++LE +   + S  +A +WPETMQIVRLI+Q+HMN K  
Sbjct  791   KYVKIWEGDLYGQRQGQPVFISKLESW-GGTVSRKVAEDWPETMQIVRLIAQEHMNKKYS  849

Query  2048  --QYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGD  2221
               QYVG  DFL+FRA+NQHGFLGQLQE+KLC VIQLPSQTLLLS+ DK  R++GMLFP +
Sbjct  850   ESQYVGNTDFLIFRALNQHGFLGQLQERKLCGVIQLPSQTLLLSMYDKTSRMVGMLFPKN  909

Query  2222  MVVFKPQ  2242
             M++F+P+
Sbjct  910   MLMFRPE  916



>ref|XP_008670906.1| PREDICTED: uncharacterized protein LOC103648198 isoform X1 [Zea 
mays]
Length=1053

 Score =   190 bits (483),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 106/127 (83%), Gaps = 5/127 (4%)
 Frame = +2

Query  1874  KYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNK--  2047
             KYVK+WEG+L GQRQGQPVFI++LE +   + S  +A +WPETMQIVRLI+Q+HMN K  
Sbjct  791   KYVKIWEGDLYGQRQGQPVFISKLESW-GGTVSRKVAEDWPETMQIVRLIAQEHMNKKYS  849

Query  2048  --QYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGD  2221
               QYVG  DFL+FRA+NQHGFLGQLQE+KLC VIQLPSQTLLLS+ DK  R++GMLFP +
Sbjct  850   ESQYVGNTDFLIFRALNQHGFLGQLQERKLCGVIQLPSQTLLLSMYDKTSRMVGMLFPKN  909

Query  2222  MVVFKPQ  2242
             M++F+P+
Sbjct  910   MLMFRPE  916



>gb|KDP29374.1| hypothetical protein JCGZ_18295 [Jatropha curcas]
Length=231

 Score =   176 bits (446),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/81 (99%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  2003  MQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSD  2182
             MQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQEKKLCAVIQLPSQTLLLSVSD
Sbjct  1     MQIVRLISQDHMNNKQYVGKADFLVFRAMDQHGFLGQLQEKKLCAVIQLPSQTLLLSVSD  60

Query  2183  KACRLIGMLFPGDMVVFKPQI  2245
             KACRLIGMLFPGDMVVFKPQI
Sbjct  61    KACRLIGMLFPGDMVVFKPQI  81



>ref|XP_009616759.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Nicotiana tomentosiformis]
Length=236

 Score =   174 bits (441),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/81 (99%), Positives = 80/81 (99%), Gaps = 0/81 (0%)
 Frame = +2

Query  2003  MQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSD  2182
             MQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFL QLQEKKLCAVIQLPSQTLLLSVSD
Sbjct  1     MQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLSQLQEKKLCAVIQLPSQTLLLSVSD  60

Query  2183  KACRLIGMLFPGDMVVFKPQI  2245
             KACRLIGMLFPGDMVVFKPQI
Sbjct  61    KACRLIGMLFPGDMVVFKPQI  81



>ref|XP_008390014.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 [Malus domestica]
Length=428

 Score =   165 bits (418),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +2

Query  1979  LAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQ  2158
             LAANWP TM+IV  IS+DHM+NKQYVGKADFLVFRAMN+HGF+G+LQEKKLCAVIQLPSQ
Sbjct  239   LAANWPPTMRIVXXISEDHMHNKQYVGKADFLVFRAMNRHGFVGKLQEKKLCAVIQLPSQ  298

Query  2159  TLLLSVSDKACRLIGMLFPGDMVVFKP  2239
             TLL SVSDKA RLIGMLFPGDMVVFKP
Sbjct  299   TLLXSVSDKAYRLIGMLFPGDMVVFKP  325


 Score = 81.6 bits (200),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 76/136 (56%), Gaps = 22/136 (16%)
 Frame = +2

Query  998   NGPVMNRQPIPTGNIHPATVKIEPTTVT-------SMPGPTFAHVPSVPRAASQPVQNLQ  1156
             NG VMNRQPI  GN+ PATVK+    +        SM GP FA +P V    SQ V +LQ
Sbjct  30    NGSVMNRQPISVGNVPPATVKVSSDMICLGAKYPNSM-GPGFALIPFV-HPPSQGVPSLQ  87

Query  1157  TSSPISVSQEMVANNENLQETKPMVVHGMGQSVRPVGAAAANVRILNDVAQAR----QAL  1324
             TSSP S SQ M     N+ + KP VV GM    RPVG       ILN+++QA      AL
Sbjct  88    TSSPFSASQGM--TTINVPDFKP-VVSGMTHPSRPVGC------ILNNISQAHFMNAAAL  138

Query  1325  AGGTSIGLSSMGGTPM  1372
              GGTS+GL +M   PM
Sbjct  139   TGGTSMGLQTMVHNPM  154



>ref|XP_004238955.2| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Solanum lycopersicum]
Length=350

 Score =   157 bits (397),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 129/222 (58%), Gaps = 46/222 (21%)
 Frame = +2

Query  377   LVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTVEGQK  556
             ++Q+SGWT+D +LF  WLS++ F GGGFND A AEGLAEALMM S      S +  +GQ+
Sbjct  1     MLQKSGWTKDRNLFFQWLSALPFSGGGFNDVAAAEGLAEALMMFS------SLKDADGQR  54

Query  557   HCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLSVVC  736
             HCILVAASNPYPLP  VY P + N EQS+NE  T   RL+DAETVA++F QCSV+LSV+C
Sbjct  55    HCILVAASNPYPLPRRVYYPAMLNLEQSDNEAHT-SLRLADAETVARAFPQCSVTLSVIC  113

Query  737   PKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSLPSTQ  916
             P+ + KL+ IY A KR+ + A   +D   +P                          ST 
Sbjct  114   PRKLPKLRAIYNAGKRDQQAAAPTVDMFSSP-------------------------ASTS  148

Query  917   NPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNI  1042
             NP     S  P         LA +     PV+N+QPI  GNI
Sbjct  149   NPASQANSGTP---------LAYM-----PVLNQQPISAGNI  176


 Score =   121 bits (304),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 103/155 (66%), Gaps = 2/155 (1%)
 Frame = +2

Query  1793  IGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASAS  1972
             +G NN++ ANM LSQQQT + + SAQS YVK WEGNL   R+GQP  I RL+GY+ +SAS
Sbjct  178   LGKNNSAEANMSLSQQQTLATVPSAQSGYVKFWEGNLCMVREGQPQHILRLQGYKKSSAS  237

Query  1973  ETLAANWPETMQIVRLISQDHMNN--KQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQ  2146
             E+ AAN P+T+QI R + +DHM    ++  GKAD L F A + HG L  L EK L AVIQ
Sbjct  238   ESSAANLPQTLQIRRFMLKDHMFQLVRECTGKADILAFWASDWHGVLNALHEKNLSAVIQ  297

Query  2147  LPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             LPSQTL +    ++  LIG+L   + +  +P I N
Sbjct  298   LPSQTLFIHADKRSFPLIGLLLSNENIRSRPTIPN  332



>ref|XP_001778157.1| predicted protein [Physcomitrella patens]
 gb|EDQ57047.1| predicted protein [Physcomitrella patens]
Length=340

 Score =   149 bits (376),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +2

Query  1949  GYRSASASETLAANWPETMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKK  2128
             GYR+ S+SE LAA+WP TMQIVRL+ Q HMN+K+  GKA+ LVFR  + HGFL QL EKK
Sbjct  215   GYRATSSSENLAADWPSTMQIVRLVEQRHMNSKECQGKAELLVFRLHSSHGFLLQLAEKK  274

Query  2129  LCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIT  2248
             LCAVIQLPSQTLLL+  DK  R+IGMLFPGDMVVFKP  T
Sbjct  275   LCAVIQLPSQTLLLASFDKPDRMIGMLFPGDMVVFKPSKT  314


 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 81/138 (59%), Gaps = 15/138 (11%)
 Frame = +2

Query  329  EFGLVMFNSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDA-------------  469
            E  LV+F +HGS+S  L+ +SGWT  +DLF  WLS++ F GGGF++A             
Sbjct  77   EVALVVFKTHGSHSDFLLWQSGWTSSMDLFFKWLSALTFEGGGFSEAAVAEALAEALMEW  136

Query  470  AIAEGLAEALMMLSSPNGNQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENE  649
             I+  L E  + +  P       TV   KHC+L+AASNP+P+PTPV RP +      + E
Sbjct  137  TISYDLYELNLQMCCP--GPKPPTVPQHKHCLLIAASNPHPIPTPVMRPPVILLPTGQAE  194

Query  650  TQTDDRRLSDAETVAKSF  703
             Q+D   L+DAETVAK+F
Sbjct  195  LQSDKWWLADAETVAKAF  212



>gb|AAX47175.1| PHYTOCHROME AND FLOWERING TIME 1 [Pisum sativum]
Length=250

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 170/257 (66%), Gaps = 12/257 (5%)
 Frame = +2

Query  1283  VRILNDVAQARQ-----ALAGGTSIGLSSMGGTPMLSNmissgmassvsaaqsvisssqs  1447
             V ILN+++QARQ     AL+GGTS+GL SMG TP+  +M +   + + S+  +  +   S
Sbjct  1     VNILNNLSQARQVMNSAALSGGTSMGLPSMGQTPIAIHMSNMISSGTTSSGPAGQNVFSS  60

Query  1448  gvtsmtssMPLAGPGQVVQssaptsftattssmsstsnlvmsqsmNTLPSSVSVGQTVPG  1627
             G   +TSS  L    QV Q+S   S  + TS++SS+ N  +SQ    L  +VS+GQ VP 
Sbjct  61    GPPVITSSGSLTASAQVRQNSGLASLPSATSNLSSSPNNGISQPSTNLQGAVSMGQQVPR  120

Query  1628  MNQANMPGTQMMQTATGRSQNMMSGMGGASGIPSgtgtmvptpgmtqqgqqgmqpIGVNN  1807
                 ++ G QM Q     SQN+M+G+G  S + SGTG M+PTPGMTQQ Q GM P+  NN
Sbjct  121   YEPRSLSGAQMAQGGVNMSQNVMNGLG-QSDVSSGTGAMIPTPGMTQQVQSGMPPL-ANN  178

Query  1808  NSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAA  1987
              + ANMPL QQ    Q      KY++VWEG+LSGQRQGQPVFIT+LEGYRS+SASETLAA
Sbjct  179   ATTANMPLPQQTVYVQS-----KYIRVWEGSLSGQRQGQPVFITKLEGYRSSSASETLAA  233

Query  1988  NWPETMQIVRLISQDHM  2038
             NWP  MQIVRLISQDHM
Sbjct  234   NWPPVMQIVRLISQDHM  250



>ref|XP_003623987.1| PHYTOCHROME AND FLOWERING TIME [Medicago truncatula]
 gb|AES80205.1| hypothetical protein MTR_7g077950 [Medicago truncatula]
Length=192

 Score =   133 bits (335),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = +2

Query  1874  KYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMN-NKQ  2050
             KY + W+G+L+  RQGQ V IT+LE  RS+SAS+TL  NWP  MQIVRLISQ+ M  +KQ
Sbjct  72    KYTRFWKGSLTELRQGQRVLITKLECSRSSSASKTLTTNWPSDMQIVRLISQERMTIHKQ  131

Query  2051  YVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFP  2215
             +  K D LVFR +N    L  L+EKKL AVIQLPSQTLLL VS+K  +LIGM  P
Sbjct  132   HARKEDLLVFRPVNPGRSLSHLKEKKLGAVIQLPSQTLLLFVSEKPNQLIGMFIP  186



>emb|CBI15421.3| unnamed protein product [Vitis vinifera]
Length=141

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 84/119 (71%), Gaps = 1/119 (1%)
 Frame = +2

Query  416  FLHWLSSIHFGGGGFNDAAIAEGLAEALMML-SSPNGNQSKQTVEGQKHCILVAASNPYP  592
            FL WLS+I F G G++D AIAEGLA+AL+M    P+G Q++Q + G++HCILVAASNP+P
Sbjct  4    FLQWLSAISFSGDGYDDLAIAEGLADALLMFPRHPHGTQTQQRLLGRRHCILVAASNPFP  63

Query  593  LPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLSVVCPKLVLKLKTIY  769
             P PV+ P+I N + ++    T +  L+D   VAK F QC VSLSV+ PK + KL+ IY
Sbjct  64   FPIPVHLPKIQNLQGAQISGATTEFSLADPNMVAKLFTQCCVSLSVISPKQLPKLREIY  122



>ref|XP_002967906.1| hypothetical protein SELMODRAFT_408814 [Selaginella moellendorffii]
 gb|EFJ31253.1| hypothetical protein SELMODRAFT_408814 [Selaginella moellendorffii]
Length=195

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 108/183 (59%), Gaps = 31/183 (17%)
 Frame = +2

Query  170  QSPMAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMF  349
            Q P A+  L++AVE  AA+GP W  + S+YL+KI R          +  GA +E  LV+F
Sbjct  16   QQPQAQY-LVLAVE-AAALGPSWPLLRSEYLDKIAR----------RTMGATLEMALVVF  63

Query  350  NSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQ  529
              H SYS CL+QRSG T  ++LF  WLSSI F GGGF + A+AEGLAEAL+    P  NQ
Sbjct  64   RGHDSYSGCLLQRSGRTPSLELFQLWLSSIDFSGGGFGEVAVAEGLAEALV----PPSNQ  119

Query  530  SKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQ  709
            +      Q+HCILVAASNP+ L + +             + +     L+DAETV+++F+Q
Sbjct  120  AS-----QRHCILVAASNPHRLQSLI----------RGADAKPGHWWLADAETVSRAFSQ  164

Query  710  CSV  718
              V
Sbjct  165  LFV  167



>ref|XP_006606654.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Glycine max]
Length=584

 Score =   134 bits (336),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/242 (34%), Positives = 124/242 (51%), Gaps = 12/242 (5%)
 Frame = +2

Query  170  QSPMAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGAN--VEFGLV  343
            +S   +K L + ++G + +GP+W  IVS+YLEKI+R F      + +  GAN   E GLV
Sbjct  17   KSMTTKKWLNLIIDGNSTLGPYWPKIVSEYLEKIVRTFID----NSREEGANHHCEVGLV  72

Query  344  MFNSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSP-N  520
            M+N +    +  VQ   WTRD+D FL  LS + F G   N   + EGLA AL +   P N
Sbjct  73   MYNDNSDLGSN-VQYIHWTRDVDYFLGILSCLVFKGDSLNQNTMVEGLASALTLFPRPSN  131

Query  521  GNQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKS  700
               +++  +G++HCIL+ A +P P    V  P+I    Q            +D   VAK 
Sbjct  132  KMTAQEYYDGERHCILITARDPIPKRMLVSVPEI----QGRFIGTKLHTLKADFYEVAKM  187

Query  701  FAQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAF  880
            F   +VSLS++ P        I+     +   A+ PI + +N  ++VL+S NF EA  A 
Sbjct  188  FGSLAVSLSIISPIQHPIFGVIFNMGNNDSSLANTPISDCRNEQFIVLLSRNFREAHYAL  247

Query  881  NR  886
            + 
Sbjct  248  HE  249


 Score = 60.5 bits (145),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 64/126 (51%), Gaps = 7/126 (6%)
 Frame = +2

Query  1877  YVKVWEGNLSGQ--RQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQ  2050
             Y+  WEG+L+G+  ++ + + +  ++  R A++  TL   WP  ++I   + Q  +N+  
Sbjct  458   YLLEWEGSLAGKIVKKNRQLHL-WVKVLRKATSPLTLTIEWPSRLEIALYLPQKAVNHTV  516

Query  2051  YV--GKAD--FLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPG  2218
              +  G  D  FL  +  +       L  K L A I LPSQ L+L+ +      IG++FPG
Sbjct  517   KICRGPVDYVFLYLKQFDNLDLHDHLNNKNLSAKIHLPSQILMLTPTKSKHHFIGIVFPG  576

Query  2219  DMVVFK  2236
             D +  +
Sbjct  577   DTIFIE  582



>ref|NP_001062824.2| Os09g0306700 [Oryza sativa Japonica Group]
 dbj|BAF24738.2| Os09g0306700, partial [Oryza sativa Japonica Group]
Length=170

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +2

Query  224  MGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGSYSACLVQRSGWTR  403
            +GP+W   V+DY+EKI+R FC  E   QK +G   E  LV+F++HG YSA  VQRSGWT+
Sbjct  63   LGPYWPVTVADYVEKIVRSFCAHEMAGQKLAGTPPELALVVFHTHGPYSAFCVQRSGWTK  122

Query  404  DIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLS  511
            D+++FL WLS I F GGGF++AAI+EGLAEALM+L+
Sbjct  123  DMNVFLSWLSGISFSGGGFSEAAISEGLAEALMVLT  158



>ref|XP_010320776.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Solanum lycopersicum]
Length=308

 Score =   122 bits (306),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 103/155 (66%), Gaps = 2/155 (1%)
 Frame = +2

Query  1793  IGVNNNSAANMPLsqqqtssqlqsaqsKYVKVWEGNLSGQRQGQPVFITRLEGYRSASAS  1972
             +G NN++ ANM LSQQQT + + SAQS YVK WEGNL   R+GQP  I RL+GY+ +SAS
Sbjct  136   LGKNNSAEANMSLSQQQTLATVPSAQSGYVKFWEGNLCMVREGQPQHILRLQGYKKSSAS  195

Query  1973  ETLAANWPETMQIVRLISQDHMNN--KQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQ  2146
             E+ AAN P+T+QI R + +DHM    ++  GKAD L F A + HG L  L EK L AVIQ
Sbjct  196   ESSAANLPQTLQIRRFMLKDHMFQLVRECTGKADILAFWASDWHGVLNALHEKNLSAVIQ  255

Query  2147  LPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQITN  2251
             LPSQTL +    ++  LIG+L   + +  +P I N
Sbjct  256   LPSQTLFIHADKRSFPLIGLLLSNENIRSRPTIPN  290


 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 92/171 (54%), Gaps = 40/171 (23%)
 Frame = +2

Query  530   SKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQ  709
             S +  +GQ+HCILVAASNPYPLP  VY P + N EQS+NE  T   RL+DAETVA++F Q
Sbjct  4     SLKDADGQRHCILVAASNPYPLPRRVYYPAMLNLEQSDNEAHT-SLRLADAETVARAFPQ  62

Query  710   CSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRT  889
             CSV+LSV+CP+ + KL+ IY A KR+ + A   +D   +P                    
Sbjct  63    CSVTLSVICPRKLPKLRAIYNAGKRDQQAAAPTVDMFSSP--------------------  102

Query  890   GMPSLPSTQNPVKMDVSSVPPISGPLPSGLASIPSANGPVMNRQPIPTGNI  1042
                   ST NP     S  P         LA +     PV+N+QPI  GNI
Sbjct  103   -----ASTSNPASQANSGTP---------LAYM-----PVLNQQPISAGNI  134



>gb|KEH27075.1| mediator complex subunit 25 von willebrand factor type A protein 
[Medicago truncatula]
Length=713

 Score =   124 bits (311),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 85/250 (34%), Positives = 127/250 (51%), Gaps = 20/250 (8%)
 Frame = +2

Query  185  EKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGS  364
            ++ L I V+G  A+  +WT I+S+YLEKI+RCF G E+  Q+        GLV++N++  
Sbjct  4    KRWLNIVVDGNKALEKYWTDILSNYLEKIVRCFVG-ESQEQESY-----LGLVLYNANSE  57

Query  365  Y--SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQS-K  535
               +   +Q   WT+D++ F+  LS + F G   N + +AEGLAEAL+M   P    + +
Sbjct  58   LVEAGYDMQFINWTKDVNKFMENLSHLSFNGNDANQSTMAEGLAEALVMYPKPCDTMTER  117

Query  536  QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRL----SDAETVAKSF  703
            +    ++HCILVA  +P P    V  P I  +       Q   +RL    +D   VAK+ 
Sbjct  118  EYYISERHCILVAPGDPAPKSMLVCLPMIQRA-------QVIGQRLKACQADFLEVAKTC  170

Query  704  AQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFN  883
               SVSLSV+ P  V     I+         ++ PI +       VL+S+NF EA  A  
Sbjct  171  IPLSVSLSVITPNPVPIFGAIFNMGNNALTLSNAPISSYSTGQLTVLLSKNFREAHVALK  230

Query  884  RTGMPSLPST  913
              G+   PST
Sbjct  231  EKGIMEYPST  240


 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 60/122 (49%), Gaps = 3/122 (2%)
 Frame = +2

Query  1877  YVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDH-MNNKQY  2053
             YV+ WEG L+G+     + I R + +R +S   TL  +WP  ++I   + Q   ++ +++
Sbjct  592   YVQTWEGTLAGKITSSRITILRAKAFRKSSTPPTLTLDWPGRLEISNYLPQKALLHTRRF  651

Query  2054  VGKADFLVFRAMNQHG--FLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMV  2227
                  +L F              + +  CA + L  QT++LS +++    +G +FPG  +
Sbjct  652   SQPIHYLFFHVAKYSNVDLYNHCKTRNNCAKVDLQFQTIILSPTEREPLFVGTVFPGVSI  711

Query  2228  VF  2233
             +F
Sbjct  712   IF  713



>gb|KEH27076.1| mediator complex subunit 25 von willebrand factor type A protein 
[Medicago truncatula]
Length=752

 Score =   119 bits (299),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 84/250 (34%), Positives = 125/250 (50%), Gaps = 20/250 (8%)
 Frame = +2

Query  185  EKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGS  364
            ++ L I V+G  A+  +W  I+S+YLEKI+RCF G E+  Q+        GLV++N++  
Sbjct  4    KRWLNIVVDGNKALEQYWHDILSNYLEKIVRCFVG-ESQEQESY-----LGLVLYNANSE  57

Query  365  Y--SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQS-K  535
               +   +Q   WT+D+  F+  LS + F G   N + +AEGLAEAL+M   P    + +
Sbjct  58   LVEAGYDMQFINWTKDVTKFMENLSHLSFNGNDANQSTMAEGLAEALVMYPKPCDTMTER  117

Query  536  QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRL----SDAETVAKSF  703
            +    ++HCILVA  +P P    V  P I  +       Q   +RL    +D   VAK+ 
Sbjct  118  EYYISERHCILVAPGDPAPKSMLVCLPMIQRA-------QVIGQRLKACQADFLEVAKTC  170

Query  704  AQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFN  883
               SVSLSV+ P  V     I+         ++ PI +       VL+S+NF EA  A  
Sbjct  171  IPLSVSLSVITPNPVPIFGAIFNMGNNALTLSNAPISSYSTGQLTVLMSKNFREAHIALK  230

Query  884  RTGMPSLPST  913
              G+   PST
Sbjct  231  EKGIMEYPST  240


 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 61/124 (49%), Gaps = 3/124 (2%)
 Frame = +2

Query  1874  KYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQY  2053
              YV+ WEG L+G+       I R + ++ +S   TL   WP  ++I   + Q  + + + 
Sbjct  627   DYVQTWEGTLAGKITSSRTTILRAKAFKKSSTPPTLTLGWPGRLEISNYLPQKALLHTRR  686

Query  2054  VGKADFLVFRAMNQHG---FLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDM  2224
               +    +F  + ++G        + +  CA + L  QT++LS +++    +G +FPG  
Sbjct  687   FSQPIHYLFFHVAKYGNVDLYNHCKTRNNCAKVDLQFQTIILSPTEREPLFVGTVFPGVS  746

Query  2225  VVFK  2236
             ++F+
Sbjct  747   IIFQ  750



>ref|XP_008361736.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Malus domestica]
Length=236

 Score = 97.8 bits (242),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 50/58 (86%), Gaps = 7/58 (12%)
 Frame = +2

Query  2087  MNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPG-------DMVVFKP  2239
             MNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKA RLIGMLFPG       DMVVFKP
Sbjct  1     MNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKAYRLIGMLFPGLNLPSVQDMVVFKP  58



>ref|XP_007152798.1| hypothetical protein PHAVU_004G1605000g, partial [Phaseolus vulgaris]
 gb|ESW24792.1| hypothetical protein PHAVU_004G1605000g, partial [Phaseolus vulgaris]
Length=489

 Score =   100 bits (248),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 98/188 (52%), Gaps = 5/188 (3%)
 Frame = +2

Query  317  GANVEFGLVMFNSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEA  496
            GAN + GL+++N++ +     VQ   WT+++D FL  L S+ F G   N   I +GLAEA
Sbjct  1    GANAQVGLILYNANDN-PGLGVQYIYWTKEVDDFLAVLPSLVFTGNNENQHTIVQGLAEA  59

Query  497  LMMLSSP-NGNQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRL  673
            L+M   P N   +++   G +HCI++AA +P PL  PV  P+I   +    +  T +   
Sbjct  60   LVMFPRPSNVMTAEEYYHGTRHCIVIAARDPVPLRMPVSVPEISRGKTIGTQLYTANADF  119

Query  674  SDAETVAKSFAQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISE  853
             D   VA+ F   +VSLS++ P      + I+          + PI N +  ++ VL+S 
Sbjct  120  YD---VAELFGPLAVSLSIISPVHHPCFEVIFNMGSIGTEQENSPISNIRIGHFNVLLSR  176

Query  854  NFMEARAA  877
            NF EA  A
Sbjct  177  NFREAHVA  184



>ref|XP_007152799.1| hypothetical protein PHAVU_004G160600g [Phaseolus vulgaris]
 gb|ESW24793.1| hypothetical protein PHAVU_004G160600g [Phaseolus vulgaris]
Length=440

 Score = 94.0 bits (232),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 71/250 (28%), Positives = 110/250 (44%), Gaps = 26/250 (10%)
 Frame = +2

Query  344   MFNSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNG  523
             M+NS+ +     +Q   WTRD++ FL  LS + F G   N   + EGLAEAL+M   P+ 
Sbjct  1     MYNSNYNNIGLDLQYIHWTRDVNYFLDILSCLTFNGDNLNRHVMVEGLAEALVMFPRPSD  60

Query  524   NQSKQ-TVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKS  700
               + Q    G++HC+L+AA +P+P    V  P+I  +++    TQ+     +D   VA+ 
Sbjct  61    IMTTQEYYNGERHCVLIAARDPFPRRMVVSVPEI--TKEGIIGTQSHHVN-ADFYEVAEM  117

Query  701   FAQCSVSLSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAF  880
             F   +VSLS++ P L      I+         +  PI N     + VL+S  F EA  AF
Sbjct  118   FGPLAVSLSIISPMLHPIFGVIFNMGNDGSVLSTTPISNTGMDQFTVLLSRKFKEAHDAF  177

Query  881   -----------------NRTGMPSLPSTQNPVKMDVSSVPP-----ISGPLPSGLASIPS  994
                               R  +P  P+    ++    S        + G +P   +  P 
Sbjct  178   RGKRKMDQRTEEWLESMKRINVPRFPNVAKYLQAGEGSSKERDRKVVLGGMPENWSMFPR  237

Query  995   ANGPVMNRQP  1024
             + G   N QP
Sbjct  238   STGSSFNIQP  247


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 4/125 (3%)
 Frame = +2

Query  1877  YVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNN--KQ  2050
             Y   WEG L G            +  + AS+  TLA +W   ++I+  +S+  +N+  + 
Sbjct  315   YSLAWEGYLVGNINNIASSFHIAKALKRASSPATLAKDWSRRLEILLYLSEKAVNHTIRN  374

Query  2051  YVGKADFLVFRAM--NQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDM  2224
             Y    DF+    M  N       L+   LCA I LP+QT++LS ++     IG +F GD 
Sbjct  375   YSEPIDFVFITIMQFNNLDLYEYLKSGNLCAKICLPTQTMILSPTESKHHYIGTIFLGDT  434

Query  2225  VVFKP  2239
             V  +P
Sbjct  435   VFVEP  439



>ref|XP_004071275.1| PREDICTED: uncharacterized protein LOC101164559 [Oryzias latipes]
Length=695

 Score = 84.3 bits (207),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 62/222 (28%), Positives = 101/222 (45%), Gaps = 22/222 (10%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAYEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP                  ++       AE++AK      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA----------------VESVSYTGCTAESLAKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPI-DNPKNPYYLVLI  847
            SVV P+ +  L++++  A     GA  P+ D  ++P+++VLI
Sbjct  178  SVVAPRKLPALRSLFERASPL-NGAVEPLPDYSQDPFHMVLI  218



>ref|XP_010087336.1| hypothetical protein L484_012669 [Morus notabilis]
 gb|EXB28910.1| hypothetical protein L484_012669 [Morus notabilis]
Length=364

 Score = 82.0 bits (201),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 71/125 (57%), Gaps = 9/125 (7%)
 Frame = +2

Query  353  SHGSYSACLVQRS-GWTRDIDLFLHWLSSIHFGGG-GFNDAAIAEGLAEALMMLSSPNGN  526
            +HG Y+A    +S  WTRD++ FL  LS + F GG G NDAAIA+G   AL++   P+  
Sbjct  2    AHGDYNADFTAKSWAWTRDVNKFLEQLSGLVFSGGCGLNDAAIADGFNNALVLYPKPHLR  61

Query  527  QSK----QTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVA  694
            +        V  ++HC+LVAASNP  L   +  P I + + S+ ET++   R    + VA
Sbjct  62   EHDLFVDHHVSAERHCVLVAASNPIALAMRLCLPIIKDGQFSDLETES---RSVVVDDVA  118

Query  695  KSFAQ  709
            K FA+
Sbjct  119  KMFAE  123


 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 61/109 (56%), Gaps = 6/109 (6%)
 Frame = +2

Query  1895  GNLSGQRQGQPVFITRLEGYRSASASETLAANWPETM---QIVRLISQDHMNNKQYVGKA  2065
             GN++   +G+   + + + YR   A  +L  +WPET+   Q++RL+S   +    Y G+A
Sbjct  201   GNINANHRGKTYSLGQAQAYRKLPAPASLTVDWPETILIGQVLRLLS---VYILPYRGEA  257

Query  2066  DFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLF  2212
             + +VF A  +H    +++ + +C  + LPSQT+L   + +  R IG LF
Sbjct  258   EIVVFAASAKHKLYEEMKNQAICIRVDLPSQTMLFLSTKRDRRFIGALF  306



>ref|NP_001096266.1| mediator of RNA polymerase II transcription subunit 25 [Xenopus 
(Silurana) tropicalis]
 sp|A4IHD9.1|MED25_XENTR RecName: Full=Mediator of RNA polymerase II transcription subunit 
25; AltName: Full=Mediator complex subunit 25 [Xenopus 
(Silurana) tropicalis]
 gb|AAI35483.1| LOC100124831 protein [Xenopus (Silurana) tropicalis]
Length=805

 Score = 84.0 bits (206),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 98/221 (44%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+   YL   I  F G         G     ++ LV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL SI F GGGG + + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAYEFVQWLDSIRFMGGGGESCSLIAEGLSTALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K CIL+  S PY LP       + ++  S   T          E + +   +  +  
Sbjct  134  QTHKVCILICNSPPYLLPA------VESTTYSGYTT----------ENLVQKIGERGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SV+ P+ +  L+T++  A         P D  ++P +++L+
Sbjct  178  SVISPRKLPALRTLFEKAMPVGLIEPQPKDYSQDPRHMILV  218



>ref|NP_001085778.1| mediator of RNA polymerase II transcription subunit 25 [Xenopus 
laevis]
 sp|Q6GP15.1|MED25_XENLA RecName: Full=Mediator of RNA polymerase II transcription subunit 
25; AltName: Full=Mediator complex subunit 25 [Xenopus 
laevis]
 gb|AAH73333.1| MGC80744 protein [Xenopus laevis]
Length=801

 Score = 82.0 bits (201),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/221 (27%), Positives = 98/221 (44%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+   YL   I  F G         G     ++ LV+FN+    
Sbjct  14   VVFVIEGTANLGPYFESLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  73

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL SI F GGGG + + IAEGL+ AL +         +Q  
Sbjct  74   PESYVQCHAPTSSAYEFVQWLDSIKFMGGGGESCSLIAEGLSTALQLFDD-FKKMREQIG  132

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K CIL+  S PY LP       + ++  S   T          E + +   +  +  
Sbjct  133  QTHKVCILICNSPPYLLPA------VESTTYSGYTT----------ENLVQKIGERGIHF  176

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            S++ P+ +  L+T++  A         P D  ++P +++L+
Sbjct  177  SIISPRKLPALRTLFEKAMPVGLIEPQPKDYSQDPRHMILV  217



>ref|XP_003964989.1| PREDICTED: uncharacterized protein LOC101068687 [Takifugu rubripes]
Length=704

 Score = 81.3 bits (199),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 97/221 (44%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  22   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  81

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGLA AL +         +Q  
Sbjct  82   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLAVALQLFDDFK-KMREQIG  140

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+ + K      +  
Sbjct  141  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADNLVKIIRDRGIHF  184

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ +Y  A       +   D  ++P+++VL+
Sbjct  185  SVVAPRKLPALRALYERASSVGGAVESHPDYSQDPFHMVLV  225



>ref|XP_006274932.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Alligator mississippiensis]
Length=779

 Score = 81.3 bits (199),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 97/221 (44%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+   YL   I  F G         G     ++ LV+FN+    
Sbjct  5    VVFVIEGTANLGPYFESLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  64

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL SI F GGGG + + IAEGL+ AL +         +Q  
Sbjct  65   PESYVQCHAPTSSAYEFVTWLDSIQFVGGGGESCSLIAEGLSTALQLFDD-FKKMREQIG  123

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K CIL+  S PY LP       + ++  S   T          E + +   +  +  
Sbjct  124  QTHKVCILICNSPPYLLPA------VESTTYSGYTT----------ENLVQKIGERGIHF  167

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            S+V P+ +  L+ ++  A         P D  ++P +++LI
Sbjct  168  SIVSPRKLPALRMLFEKAVPAGMMEAQPKDYSQDPRHMILI  208



>ref|XP_006274931.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Alligator mississippiensis]
Length=779

 Score = 81.3 bits (199),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 97/221 (44%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+   YL   I  F G         G     ++ LV+FN+    
Sbjct  5    VVFVIEGTANLGPYFESLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  64

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL SI F GGGG + + IAEGL+ AL +         +Q  
Sbjct  65   PESYVQCHAPTSSAYEFVTWLDSIQFVGGGGESCSLIAEGLSTALQLFDD-FKKMREQIG  123

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K CIL+  S PY LP       + ++  S   T          E + +   +  +  
Sbjct  124  QTHKVCILICNSPPYLLPA------VESTTYSGYTT----------ENLVQKIGERGIHF  167

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            S+V P+ +  L+ ++  A         P D  ++P +++LI
Sbjct  168  SIVSPRKLPALRMLFEKAVPAGMMEAQPKDYSQDPRHMILI  208



>ref|XP_010766997.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X2 [Notothenia coriiceps]
Length=743

 Score = 80.9 bits (198),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/221 (27%), Positives = 98/221 (44%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+ + K      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADNLVKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L++++  A       D   D  ++P+++VL+
Sbjct  178  SVVAPRKLPALRSLFERASPVGGAGDPHPDYSQDPFHMVLV  218



>ref|XP_010766989.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X1 [Notothenia coriiceps]
Length=744

 Score = 80.9 bits (198),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/221 (27%), Positives = 98/221 (44%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+ + K      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADNLVKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L++++  A       D   D  ++P+++VL+
Sbjct  178  SVVAPRKLPALRSLFERASPVGGAGDPHPDYSQDPFHMVLV  218



>ref|XP_008843323.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X4 [Nannospalax galili]
Length=746

 Score = 80.9 bits (198),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 60/225 (27%), Positives = 102/225 (45%), Gaps = 25/225 (11%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++  +  DYL   I  F G         G     ++ LV+FN+    
Sbjct  18   VVFVIEGTANLGPYFEGLRKDYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  77

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL  I F GGGG + + IAEGL+ AL +    +  + ++ +
Sbjct  78   PESYVQCHAPTSSAYEFVTWLDGIKFLGGGGESCSLIAEGLSTALQLFD--DFKKMREQI  135

Query  545  EGQKH--CILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             GQ H  C+L+  S PY LP       + ++  S   T          E++ +   +  +
Sbjct  136  SGQTHRVCLLICNSPPYLLPA------VESTTYSGCTT----------ESLVQKIGERGI  179

Query  719  SLSVVCPKLVLKLKTIYAAAKRNPRGADL--PIDNPKNPYYLVLI  847
              S+V P+ +  L+ ++  A        L  P D  ++P ++VL+
Sbjct  180  HFSIVSPRKLPALRLLFEKAAPPALLEPLQPPADVSQDPRHMVLV  224



>ref|XP_010767004.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X3 [Notothenia coriiceps]
Length=720

 Score = 80.9 bits (198),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/221 (27%), Positives = 98/221 (44%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+ + K      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADNLVKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L++++  A       D   D  ++P+++VL+
Sbjct  178  SVVAPRKLPALRSLFERASPVGGAGDPHPDYSQDPFHMVLV  218



>ref|XP_006681386.1| hypothetical protein BATDEDRAFT_27121 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77840.1| hypothetical protein BATDEDRAFT_27121 [Batrachochytrium dendrobatidis 
JAM81]
Length=891

 Score = 80.9 bits (198),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 81/149 (54%), Gaps = 13/149 (9%)
 Frame = +2

Query  188  KQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCF--CGAEAGSQKPSGANVEFGLVMFNSHG  361
            K ++  V+G+AAM   ++SI + Y+E I++ F  C   A  Q      V  GLV++ S+ 
Sbjct  6    KDVVFVVDGSAAM-KRYSSIFTTYIEPIVKTFTECTETAVGQTEC---VRLGLVVYRSYP  61

Query  362  SYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQT  541
            SYS   VQ   +T D  +FL    +I +  GG    A AEGLA A+ +LSS    Q+K+ 
Sbjct  62   SYSPFTVQTVVFTSDPAVFLSAYKAIDYRHGGITHNAAAEGLAVAMQLLSS--SQQTKEQ  119

Query  542  VEGQKHCILVAAS--NPYPLPTP---VYR  613
                +HC+LV+A+  NP P   P   +YR
Sbjct  120  RVSDQHCVLVSATMINPSPCRLPCNNLYR  148



>ref|XP_008173946.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 [Chrysemys picta bellii]
Length=612

 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 96/221 (43%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+   YL   I  F G         G     ++ LV+FN+    
Sbjct  20   VVFVIEGTANLGPYFESLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  79

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL  I F GGGG + + IAEGL+ AL +         +Q  
Sbjct  80   PESYVQCHAPTSSAYEFVAWLDGIQFVGGGGESCSLIAEGLSTALQLFDD-FKKMREQIG  138

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K CIL+  S PY LP       + ++  S   T          E + +   +  +  
Sbjct  139  QTHKVCILICNSPPYLLPA------VESTTYSGYTT----------ENLVQKIGERGIHF  182

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A         P D  ++P +++LI
Sbjct  183  SVVSPRKLPALRALFDKATPGGMLEAQPKDFSQDPRHMILI  223



>ref|XP_008296616.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X3 [Stegastes partitus]
Length=750

 Score = 79.7 bits (195),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 95/221 (43%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP                  ++       A+ + K      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA----------------VESVSYTGCTADNLVKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A       +   D  ++P+++VL+
Sbjct  178  SVVAPRKLPALRALFERASPVGGAVEPHPDYSQDPFHMVLV  218



>ref|XP_008296615.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Stegastes partitus]
Length=750

 Score = 79.7 bits (195),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 95/221 (43%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP                  ++       A+ + K      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA----------------VESVSYTGCTADNLVKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A       +   D  ++P+++VL+
Sbjct  178  SVVAPRKLPALRALFERASPVGGAVEPHPDYSQDPFHMVLV  218



>ref|XP_005810191.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Xiphophorus maculatus]
Length=711

 Score = 79.7 bits (195),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 60/241 (25%), Positives = 101/241 (42%), Gaps = 20/241 (8%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP                  ++       A+ + K      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA----------------VESVSYTGFTADNLVKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLISENFMEARAAFNRTGMPSL  904
            SVV P+ +  L+ ++  A       +   D  ++P+++VL+    +   A   +   P L
Sbjct  178  SVVAPRKLPALRALFEWASPVTGAVEPHPDYSQDPFHMVLVRGISLPVSAGGGQPHKPVL  237

Query  905  P  907
            P
Sbjct  238  P  238



>ref|XP_008296614.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Stegastes partitus]
Length=751

 Score = 79.7 bits (195),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 95/221 (43%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP                  ++       A+ + K      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA----------------VESVSYTGCTADNLVKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A       +   D  ++P+++VL+
Sbjct  178  SVVAPRKLPALRALFERASPVGGAVEPHPDYSQDPFHMVLV  218



>ref|XP_008296617.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X4 [Stegastes partitus]
Length=743

 Score = 79.3 bits (194),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 95/221 (43%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP                  ++       A+ + K      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA----------------VESVSYTGCTADNLVKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A       +   D  ++P+++VL+
Sbjct  178  SVVAPRKLPALRALFERASPVGGAVEPHPDYSQDPFHMVLV  218



>ref|XP_004811689.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Mustela putorius furo]
Length=993

 Score = 79.7 bits (195),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 83/316 (26%), Positives = 135/316 (43%), Gaps = 43/316 (14%)
 Frame = +2

Query  194   LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
             ++  +EGTA +GP++  +   YL   I  F G         G     ++ LV+FN+    
Sbjct  83    VVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  142

Query  368   SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                 VQ    T     F+ WL  I F GGGG + + IAEGL+ AL +    +  + ++ +
Sbjct  143   PESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFD--DFKKMREQI  200

Query  545   EGQKH--CILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
              GQ H  C+L+  S PY LP       + ++  S   T          E++ +   +  +
Sbjct  201   -GQTHRVCLLICNSPPYLLPA------VESTTYSGYTT----------ESLVQKIGEQGI  243

Query  719   SLSVVCPKLVLKLKTIYAAAKRNPRGADL--PIDNPKNPYYLVLISENFM--EARA-AFN  883
               S+V P+ +  L+ ++  A        L  P D  ++P ++VL+    +  EAR  A  
Sbjct  244   HFSIVSPRKLPALRLLFEKAAPPALLEPLQPPTDVSQDPRHMVLVRGLVLPGEARVPAVE  303

Query  884   RTGMPSLPSTQNPVKMDVSSVPPISGPLPSGLASIP-------SANGPVMNRQPIPTGNI  1042
             R G+P       P  +D S   P+S P        P       SA GP+  +QP+P    
Sbjct  304   RLGVP----PPAPSDLDFS---PLSNPSTWDSVVHPLLSVGGGSAPGPLQTKQPVPLPPA  356

Query  1043  HPATVKIEPTTVTSMP  1090
              P+   +      S+P
Sbjct  357   APSGTSLSAAPQQSLP  372



>ref|XP_004552537.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X1 [Maylandia zebra]
 ref|XP_004552538.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X2 [Maylandia zebra]
Length=742

 Score = 79.3 bits (194),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 101/224 (45%), Gaps = 26/224 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  22   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  81

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ +I F GGG    + IAEGL+ AL +         +Q  
Sbjct  82   PESYVQCHAPTSSAFEFVSWIDNIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  140

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP                  ++       A+++ K      ++ 
Sbjct  141  QTHKVCVLLCNSPPYLLPA----------------VESVSYTGCTADSLVKIIRDRGINF  184

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGA---DLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A  +P G     LP D  ++P+++VL+
Sbjct  185  SVVAPRKLPPLRALFERA--SPVGGAVESLP-DYSQDPFHMVLV  225



>ref|XP_004552539.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X3 [Maylandia zebra]
Length=741

 Score = 79.3 bits (194),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 101/224 (45%), Gaps = 26/224 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  22   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  81

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ +I F GGG    + IAEGL+ AL +         +Q  
Sbjct  82   PESYVQCHAPTSSAFEFVSWIDNIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  140

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP                  ++       A+++ K      ++ 
Sbjct  141  QTHKVCVLLCNSPPYLLPA----------------VESVSYTGCTADSLVKIIRDRGINF  184

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGA---DLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A  +P G     LP D  ++P+++VL+
Sbjct  185  SVVAPRKLPPLRALFERA--SPVGGAVESLP-DYSQDPFHMVLV  225



>ref|XP_006362546.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Solanum tuberosum]
Length=98

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  2057  GKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFK  2236
             GKAD L F A+++HG L  LQE+ L AVI+LPSQTL + V+D++ RLIG+L   + + F+
Sbjct  16    GKADILAFWAIDRHGVLNNLQERNLSAVIKLPSQTLFIYVADRSFRLIGLLLSNENMRFR  75

Query  2237  PQITN  2251
             P I N
Sbjct  76    PTIPN  80



>ref|XP_008843319.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Nannospalax galili]
Length=802

 Score = 79.3 bits (194),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 60/225 (27%), Positives = 102/225 (45%), Gaps = 25/225 (11%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++  +  DYL   I  F G         G     ++ LV+FN+    
Sbjct  18   VVFVIEGTANLGPYFEGLRKDYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  77

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL  I F GGGG + + IAEGL+ AL +    +  + ++ +
Sbjct  78   PESYVQCHAPTSSAYEFVTWLDGIKFLGGGGESCSLIAEGLSTALQLFD--DFKKMREQI  135

Query  545  EGQKH--CILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             GQ H  C+L+  S PY LP       + ++  S   T          E++ +   +  +
Sbjct  136  SGQTHRVCLLICNSPPYLLPA------VESTTYSGCTT----------ESLVQKIGERGI  179

Query  719  SLSVVCPKLVLKLKTIYAAAKRNPRGADL--PIDNPKNPYYLVLI  847
              S+V P+ +  L+ ++  A        L  P D  ++P ++VL+
Sbjct  180  HFSIVSPRKLPALRLLFEKAAPPALLEPLQPPADVSQDPRHMVLV  224



>ref|XP_008296620.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X7 [Stegastes partitus]
Length=719

 Score = 79.3 bits (194),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 95/221 (43%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP                  ++       A+ + K      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA----------------VESVSYTGCTADNLVKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A       +   D  ++P+++VL+
Sbjct  178  SVVAPRKLPALRALFERASPVGGAVEPHPDYSQDPFHMVLV  218



>ref|XP_008296619.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X6 [Stegastes partitus]
Length=726

 Score = 79.3 bits (194),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 95/221 (43%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP                  ++       A+ + K      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA----------------VESVSYTGCTADNLVKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A       +   D  ++P+++VL+
Sbjct  178  SVVAPRKLPALRALFERASPVGGAVEPHPDYSQDPFHMVLV  218



>ref|XP_008296618.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X5 [Stegastes partitus]
Length=727

 Score = 79.3 bits (194),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 97/221 (44%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+ + K      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADNLVKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A       +   D  ++P+++VL+
Sbjct  178  SVVAPRKLPALRALFERASPVGGAVEPHPDYSQDPFHMVLV  218



>ref|XP_005726321.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X1 [Pundamilia nyererei]
 ref|XP_005726322.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X2 [Pundamilia nyererei]
Length=742

 Score = 79.3 bits (194),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 101/224 (45%), Gaps = 26/224 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  22   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  81

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ +I F GGG    + IAEGL+ AL +         +Q  
Sbjct  82   PESYVQCHAPTSSAFEFVSWIDNIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  140

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP                  ++       A+++ K      ++ 
Sbjct  141  QTHKVCVLLCNSPPYLLPA----------------VESVSYTGCTADSLVKIIRDRGINF  184

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGA---DLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A  +P G     LP D  ++P+++VL+
Sbjct  185  SVVAPRKLPPLRALFERA--SPVGGAVESLP-DYSQDPFHMVLV  225



>ref|XP_005726323.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X3 [Pundamilia nyererei]
Length=741

 Score = 79.3 bits (194),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 101/224 (45%), Gaps = 26/224 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  22   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  81

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ +I F GGG    + IAEGL+ AL +         +Q  
Sbjct  82   PESYVQCHAPTSSAFEFVSWIDNIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  140

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP                  ++       A+++ K      ++ 
Sbjct  141  QTHKVCVLLCNSPPYLLPA----------------VESVSYTGCTADSLVKIIRDRGINF  184

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGA---DLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A  +P G     LP D  ++P+++VL+
Sbjct  185  SVVAPRKLPPLRALFERA--SPVGGAVESLP-DYSQDPFHMVLV  225



>ref|XP_005726325.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X5 [Pundamilia nyererei]
 ref|XP_005921845.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X4 [Haplochromis burtoni]
Length=713

 Score = 79.0 bits (193),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 103/224 (46%), Gaps = 26/224 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  22   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  81

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ +I F GGG    + IAEGL+ AL +         +Q  
Sbjct  82   PESYVQCHAPTSSAFEFVSWIDNIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  140

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+++ K      ++ 
Sbjct  141  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADSLVKIIRDRGINF  184

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGA---DLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A  +P G     LP D  ++P+++VL+
Sbjct  185  SVVAPRKLPPLRALFERA--SPVGGAVESLP-DYSQDPFHMVLV  225



>ref|XP_007562204.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Poecilia formosa]
Length=731

 Score = 79.0 bits (193),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 97/221 (44%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+ + K      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----FTADNLVKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A       +   D  ++P+++VL+
Sbjct  178  SVVAPRKLPALRALFEWASPVTGAVEPHPDYSQDPFHMVLV  218



>ref|XP_008414619.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Poecilia reticulata]
Length=731

 Score = 79.0 bits (193),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 95/221 (43%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP                  ++       A+ + K      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA----------------VESVSYTGFTADNLVKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A       +   D  ++P+++VL+
Sbjct  178  SVVAPRKLPALRALFEWASPVTGAVEPHPDYSQDPFHMVLV  218



>ref|XP_004552540.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X4 [Maylandia zebra]
Length=718

 Score = 79.0 bits (193),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 101/224 (45%), Gaps = 26/224 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  22   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  81

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ +I F GGG    + IAEGL+ AL +         +Q  
Sbjct  82   PESYVQCHAPTSSAFEFVSWIDNIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  140

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP                  ++       A+++ K      ++ 
Sbjct  141  QTHKVCVLLCNSPPYLLPA----------------VESVSYTGCTADSLVKIIRDRGINF  184

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGA---DLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A  +P G     LP D  ++P+++VL+
Sbjct  185  SVVAPRKLPPLRALFERA--SPVGGAVESLP-DYSQDPFHMVLV  225



>ref|XP_004552541.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X5 [Maylandia zebra]
Length=713

 Score = 79.0 bits (193),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 103/224 (46%), Gaps = 26/224 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  22   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  81

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ +I F GGG    + IAEGL+ AL +         +Q  
Sbjct  82   PESYVQCHAPTSSAFEFVSWIDNIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  140

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+++ K      ++ 
Sbjct  141  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADSLVKIIRDRGINF  184

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGA---DLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A  +P G     LP D  ++P+++VL+
Sbjct  185  SVVAPRKLPPLRALFERA--SPVGGAVESLP-DYSQDPFHMVLV  225



>ref|XP_007562206.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X3 [Poecilia formosa]
Length=730

 Score = 79.0 bits (193),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 97/221 (44%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+ + K      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----FTADNLVKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A       +   D  ++P+++VL+
Sbjct  178  SVVAPRKLPALRALFEWASPVTGAVEPHPDYSQDPFHMVLV  218



>ref|XP_007562205.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Poecilia formosa]
Length=730

 Score = 79.0 bits (193),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 97/221 (44%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+ + K      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----FTADNLVKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A       +   D  ++P+++VL+
Sbjct  178  SVVAPRKLPALRALFEWASPVTGAVEPHPDYSQDPFHMVLV  218



>ref|XP_008296622.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X8 [Stegastes partitus]
Length=718

 Score = 79.0 bits (193),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 95/221 (43%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP                  ++       A+ + K      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA----------------VESVSYTGCTADNLVKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A       +   D  ++P+++VL+
Sbjct  178  SVVAPRKLPALRALFERASPVGGAVEPHPDYSQDPFHMVLV  218



>ref|XP_008843322.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X3 [Nannospalax galili]
Length=779

 Score = 79.0 bits (193),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/225 (27%), Positives = 102/225 (45%), Gaps = 25/225 (11%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++  +  DYL   I  F G         G     ++ LV+FN+    
Sbjct  18   VVFVIEGTANLGPYFEGLRKDYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  77

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL  I F GGGG + + IAEGL+ AL +    +  + ++ +
Sbjct  78   PESYVQCHAPTSSAYEFVTWLDGIKFLGGGGESCSLIAEGLSTALQLFD--DFKKMREQI  135

Query  545  EGQKH--CILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             GQ H  C+L+  S PY LP       + ++  S   T          E++ +   +  +
Sbjct  136  SGQTHRVCLLICNSPPYLLPA------VESTTYSGCTT----------ESLVQKIGERGI  179

Query  719  SLSVVCPKLVLKLKTIYAAAKRNPRGADL--PIDNPKNPYYLVLI  847
              S+V P+ +  L+ ++  A        L  P D  ++P ++VL+
Sbjct  180  HFSIVSPRKLPALRLLFEKAAPPALLEPLQPPADVSQDPRHMVLV  224



>ref|XP_008414620.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Poecilia reticulata]
Length=707

 Score = 79.0 bits (193),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 97/221 (44%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+ + K      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----FTADNLVKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A       +   D  ++P+++VL+
Sbjct  178  SVVAPRKLPALRALFEWASPVTGAVEPHPDYSQDPFHMVLV  218



>ref|XP_007562207.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X4 [Poecilia formosa]
Length=706

 Score = 79.0 bits (193),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 97/221 (44%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+ + K      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----FTADNLVKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A       +   D  ++P+++VL+
Sbjct  178  SVVAPRKLPALRALFEWASPVTGAVEPHPDYSQDPFHMVLV  218



>ref|XP_008347052.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Malus domestica]
Length=212

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +2

Query  2105  LGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP  2239
             LG  Q   +CAVIQLPSQTLL SVSDKA RLIGMLFPGDMVVFKP
Sbjct  65    LGTPQGIVMCAVIQLPSQTLLXSVSDKAYRLIGMLFPGDMVVFKP  109



>ref|XP_010872425.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X3 [Esox lucius]
Length=738

 Score = 79.0 bits (193),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 97/221 (44%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+  I F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDGIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+ + K      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADGLVKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L++++  A       D   D  ++P+++VL+
Sbjct  178  SVVAPRKLPALRSLFDRASPVGGPVDTHPDYSQDPFHMVLV  218



>ref|XP_005921844.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X3 [Haplochromis burtoni]
Length=717

 Score = 79.0 bits (193),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 101/224 (45%), Gaps = 26/224 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  22   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  81

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ +I F GGG    + IAEGL+ AL +         +Q  
Sbjct  82   PESYVQCHAPTSSAFEFVSWIDNIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  140

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP                  ++       A+++ K      ++ 
Sbjct  141  QTHKVCVLLCNSPPYLLPA----------------VESVSYTGCTADSLVKIIRDRGINF  184

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGA---DLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A  +P G     LP D  ++P+++VL+
Sbjct  185  SVVAPRKLPPLRALFERA--SPVGGAVESLP-DYSQDPFHMVLV  225



>ref|XP_010872422.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Esox lucius]
 ref|XP_010872423.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Esox lucius]
Length=739

 Score = 79.0 bits (193),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 97/221 (44%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+  I F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDGIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+ + K      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADGLVKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L++++  A       D   D  ++P+++VL+
Sbjct  178  SVVAPRKLPALRSLFDRASPVGGPVDTHPDYSQDPFHMVLV  218



>ref|XP_005469051.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X1 [Oreochromis niloticus]
 ref|XP_005469052.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X2 [Oreochromis niloticus]
Length=741

 Score = 79.0 bits (193),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 100/224 (45%), Gaps = 26/224 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  22   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  81

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ +I F GGG    + IAEGL+ AL +         +Q  
Sbjct  82   PESYVQCHAPTSSAFEFVSWIDNIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  140

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP                  ++       A+++ K      +  
Sbjct  141  QTHKVCVLLCNSPPYLLPA----------------VESVSYTGCTADSLVKIIRDRGIHF  184

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGA---DLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A  +P G     LP D  ++P+++VL+
Sbjct  185  SVVAPRKLPPLRALFERA--SPVGGAVESLP-DYSQDPFHMVLV  225



>ref|XP_010872424.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Esox lucius]
Length=738

 Score = 79.0 bits (193),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 97/221 (44%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+  I F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDGIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+ + K      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADGLVKIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L++++  A       D   D  ++P+++VL+
Sbjct  178  SVVAPRKLPALRSLFDRASPVGGPVDTHPDYSQDPFHMVLV  218



>ref|XP_005726324.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X4 [Pundamilia nyererei]
 ref|XP_005921842.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X1 [Haplochromis burtoni]
 ref|XP_005921843.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X2 [Haplochromis burtoni]
Length=718

 Score = 78.6 bits (192),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 101/224 (45%), Gaps = 26/224 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  22   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  81

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ +I F GGG    + IAEGL+ AL +         +Q  
Sbjct  82   PESYVQCHAPTSSAFEFVSWIDNIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  140

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP                  ++       A+++ K      ++ 
Sbjct  141  QTHKVCVLLCNSPPYLLPA----------------VESVSYTGCTADSLVKIIRDRGINF  184

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGA---DLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A  +P G     LP D  ++P+++VL+
Sbjct  185  SVVAPRKLPPLRALFERA--SPVGGAVESLP-DYSQDPFHMVLV  225



>ref|XP_010743886.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 [Larimichthys crocea]
Length=743

 Score = 78.6 bits (192),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 98/221 (44%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  22   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  81

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ +I F GGG    + IAEGL+ AL +         +Q  
Sbjct  82   PESYVQCHAPTSSAFEFVSWIDNIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  140

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+++ K      +  
Sbjct  141  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADSLVKIIRDRGIHF  184

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ +Y  A       +   D  ++P+++VL+
Sbjct  185  SVVAPRKLPALRALYERASPVGGVVEPHPDYSQDPFHMVLV  225



>ref|XP_005469053.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X3 [Oreochromis niloticus]
Length=717

 Score = 78.6 bits (192),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 102/224 (46%), Gaps = 26/224 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  22   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  81

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ +I F GGG    + IAEGL+ AL +         +Q  
Sbjct  82   PESYVQCHAPTSSAFEFVSWIDNIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  140

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+++ K      +  
Sbjct  141  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADSLVKIIRDRGIHF  184

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGA---DLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A  +P G     LP D  ++P+++VL+
Sbjct  185  SVVAPRKLPPLRALFERA--SPVGGAVESLP-DYSQDPFHMVLV  225



>ref|XP_006803141.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like [Neolamprologus brichardi]
Length=676

 Score = 78.2 bits (191),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 102/224 (46%), Gaps = 26/224 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  22   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  81

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ +I F GGG    + IAEGL+ AL +         +Q  
Sbjct  82   PESYVQCHAPTSSAFEFVSWIDNIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  140

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+++ K      +  
Sbjct  141  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADSLVKIIRDRGIHF  184

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGA---DLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A  +P G     LP D  ++P+++VL+
Sbjct  185  SVVAPRKLPPLRALFERA--SPVGGAVESLP-DYSQDPFHMVLV  225



>gb|ACB88867.1| mediator complex subunit MED25 variant MED25_i8 [Homo sapiens]
Length=253

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 64/241 (27%), Positives = 106/241 (44%), Gaps = 26/241 (11%)
 Frame = +2

Query  191  QLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGS  364
             ++  +EGTA +GP++  +   YL   I CF G         G     ++ LV+FN+   
Sbjct  17   DVVFVIEGTANLGPYFEGLRKHYLLPAIECFNGGPPAETDFGGDYGGTQYSLVVFNTVDC  76

Query  365  YSACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQT  541
                 VQ    T     F+ WL  I F GGGG + + IAEGL+ AL +    +  + ++ 
Sbjct  77   APESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFD--DFKKMREQ  134

Query  542  VEGQKH--CILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCS  715
            + GQ H  C+L+  S PY LP       + ++  S   T          E + +   +  
Sbjct  135  I-GQTHRVCLLICNSPPYLLPA------VESTTYSGCTT----------ENLVQQIGERG  177

Query  716  VSLSVVCPKLVLKLKTIYAAAKRNPRGADL--PIDNPKNPYYLVLISENFMEARAAFNRT  889
            +  S+V P+ +  L+ ++  A        L  P D  ++P ++VL+    + A  A  R 
Sbjct  178  IHFSIVSPRKLPALRLLFEKAAPPALLEPLQPPTDVSQDPRHMVLVRGLVLPAGPAAQRH  237

Query  890  G  892
            G
Sbjct  238  G  238



>ref|XP_005469054.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X4 [Oreochromis niloticus]
Length=684

 Score = 77.8 bits (190),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 100/224 (45%), Gaps = 26/224 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  22   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  81

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ +I F GGG    + IAEGL+ AL +         +Q  
Sbjct  82   PESYVQCHAPTSSAFEFVSWIDNIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  140

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP                  ++       A+++ K      +  
Sbjct  141  QTHKVCVLLCNSPPYLLPA----------------VESVSYTGCTADSLVKIIRDRGIHF  184

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGA---DLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A  +P G     LP D  ++P+++VL+
Sbjct  185  SVVAPRKLPPLRALFERA--SPVGGAVESLP-DYSQDPFHMVLV  225



>ref|XP_005469055.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X5 [Oreochromis niloticus]
Length=660

 Score = 77.8 bits (190),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 102/224 (46%), Gaps = 26/224 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  22   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  81

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ +I F GGG    + IAEGL+ AL +         +Q  
Sbjct  82   PESYVQCHAPTSSAFEFVSWIDNIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  140

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+++ K      +  
Sbjct  141  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADSLVKIIRDRGIHF  184

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGA---DLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A  +P G     LP D  ++P+++VL+
Sbjct  185  SVVAPRKLPPLRALFERA--SPVGGAVESLP-DYSQDPFHMVLV  225



>ref|XP_005163996.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X3 [Danio rerio]
Length=724

 Score = 77.8 bits (190),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 104/223 (47%), Gaps = 23/223 (10%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+ ++Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRNNYILPTIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+++ +      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADSLVQIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIY--AAAKRNPRGADLPIDNPKNPYYLVLI  847
            SV+ P+ +  L++++  A++   P  +  P D  ++P+++VL+
Sbjct  178  SVIAPRKLPALRSLFERASSVAGPPESSHP-DYSQDPFHMVLV  219



>ref|XP_004337130.1| hypothetical protein ACA1_215990 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR15117.1| hypothetical protein ACA1_215990 [Acanthamoeba castellanii str. 
Neff]
Length=820

 Score = 77.8 bits (190),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/197 (26%), Positives = 87/197 (44%), Gaps = 23/197 (12%)
 Frame = +2

Query  188  KQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGLVMFNSHGSY  367
            + L+  V+ TAAMGPH   +   Y++ +IR      A  ++     +E  +V F  +   
Sbjct  6    RHLVFIVDTTAAMGPHLPVLRDAYIDPLIRTVVEQSASKKE----KLELAMVAFRDYPPA  61

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTVE  547
               +V+ SG+TRD   F  W+  + F  GG     +AE  A A         N S + + 
Sbjct  62   GNYVVRVSGFTRDPKQFGSWMDRLDFAAGGHQTVPLAEAFAAAF--------NLSYERMA  113

Query  548  GQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSLS  727
             +++ +LV+ + PY    P     I    Q    T  D         +A +F +  ++LS
Sbjct  114  KERYFVLVSNTAPYQQGIPARLYSIPG--QPLGSTAAD---------IATTFPKAQIALS  162

Query  728  VVCPKLVLKLKTIYAAA  778
            V+ P+ + +L  I+  A
Sbjct  163  VISPRQLNELAEIFQKA  179



>ref|XP_005163994.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Danio rerio]
 ref|XP_005163995.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Danio rerio]
Length=725

 Score = 77.4 bits (189),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 104/223 (47%), Gaps = 23/223 (10%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+ ++Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRNNYILPTIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+++ +      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADSLVQIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIY--AAAKRNPRGADLPIDNPKNPYYLVLI  847
            SV+ P+ +  L++++  A++   P  +  P D  ++P+++VL+
Sbjct  178  SVIAPRKLPALRSLFERASSVAGPPESSHP-DYSQDPFHMVLV  219



>ref|XP_001627984.1| predicted protein [Nematostella vectensis]
 gb|EDO35921.1| predicted protein [Nematostella vectensis]
Length=855

 Score = 77.4 bits (189),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 107/228 (47%), Gaps = 24/228 (11%)
 Frame = +2

Query  185  EKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGA---EAGS--QKPSGANVEFGLVMF  349
            E +++  VEGTA +  H+ ++ ++Y++ II    G    E+ S     +G N ++ LV++
Sbjct  9    EHEVVFVVEGTANLLLHFETLKTEYIDPIIEYINGGPVQESNSFFGDENGPN-QYCLVVY  67

Query  350  NSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGN  526
             +  S+    VQ   +TRD+  FL  L+ + F GGG  D + +AEG+  AL         
Sbjct  68   GTKASHPEDAVQLVRYTRDVHDFLQALNEVKFDGGGGQDCSLLAEGMGFALQAFD--EMR  125

Query  527  QSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFA  706
             S+ +V   +HCI+V  S P+P P+               E  +   +  D      +  
Sbjct  126  VSRGSVNCHRHCIVVCNSPPFPQPS--------------RECLSYLNKTVDQLAAIMAKP  171

Query  707  QCSVSLSVVCPKLVLKLKTIYAAAKRNP-RGADLPIDNPKNPYYLVLI  847
            + ++ LS++ P+    L+ ++  + R+  +G     D  K P ++  +
Sbjct  172  ENNIHLSIISPRKFPALQLVFDKSLRDDTKGMKSKTDYAKEPQHMACL  219



>ref|XP_005163997.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Danio rerio]
Length=701

 Score = 77.4 bits (189),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 104/223 (47%), Gaps = 23/223 (10%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+ ++Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRNNYILPTIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+++ +      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADSLVQIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIY--AAAKRNPRGADLPIDNPKNPYYLVLI  847
            SV+ P+ +  L++++  A++   P  +  P D  ++P+++VL+
Sbjct  178  SVIAPRKLPALRSLFERASSVAGPPESSHP-DYSQDPFHMVLV  219



>emb|CDQ96874.1| unnamed protein product [Oncorhynchus mykiss]
Length=296

 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 96/222 (43%), Gaps = 20/222 (9%)
 Frame = +2

Query  191  QLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGS  364
             ++  +EGTA +GP++ S+   Y+   I  F G         G     ++GLV+FN+   
Sbjct  14   DVVFVIEGTANLGPYFESLRKHYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDC  73

Query  365  YSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQT  541
                 VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q 
Sbjct  74   APESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQI  132

Query  542  VEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVS  721
             +  K C+L+  S PY LP              E+ + T       A+ + K      + 
Sbjct  133  GQTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADNLVKIIRDRGIH  176

Query  722  LSVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
             SVV P+ +  L+ ++  A       D   D  ++P++++L+
Sbjct  177  FSVVSPRKLPALRALFDRASPVGGQVDPHPDYSQDPFHMILV  218



>ref|XP_009297717.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X4 [Danio rerio]
Length=648

 Score = 76.6 bits (187),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 104/223 (47%), Gaps = 23/223 (10%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+ ++Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRNNYILPTIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+++ +      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADSLVQIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIY--AAAKRNPRGADLPIDNPKNPYYLVLI  847
            SV+ P+ +  L++++  A++   P  +  P D  ++P+++VL+
Sbjct  178  SVIAPRKLPALRSLFERASSVAGPPESSHP-DYSQDPFHMVLV  219



>ref|NP_999931.1| mediator of RNA polymerase II transcription subunit 25 [Danio 
rerio]
 sp|Q6PEH8.1|MED25_DANRE RecName: Full=Mediator of RNA polymerase II transcription subunit 
25; AltName: Full=Mediator complex subunit 25 [Danio rerio]
 gb|AAH58057.1| Mediator of RNA polymerase II transcription, subunit 25 homolog 
(yeast) [Danio rerio]
Length=701

 Score = 76.6 bits (187),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 103/225 (46%), Gaps = 27/225 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+ ++Y+   I  F G         G     ++GLV+FN+    
Sbjct  15   VVFVIEGTANLGPYFESLRNNYILPTIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  74

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ SI F GGG    + IAEGL+ AL +         +Q  
Sbjct  75   PESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  133

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+++ +      +  
Sbjct  134  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADSLVQIIRDRGIHF  177

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPI----DNPKNPYYLVLI  847
            SV+ P+ +  L++++   +R    A LP     D  ++P+++VL+
Sbjct  178  SVIAPRKLPALRSLF---ERASSVAGLPESSHPDYSQDPFHMVLV  219



>ref|XP_008111806.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X3 [Anolis carolinensis]
Length=770

 Score = 76.6 bits (187),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 63/255 (25%), Positives = 110/255 (43%), Gaps = 36/255 (14%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+   YL   I  F G         G     ++ LV+FN+    
Sbjct  19   VVFVIEGTANLGPYFESLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  78

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL SI F GGGG + + I+EGL+ AL +         +Q  
Sbjct  79   PESYVQCHAPTSSAYEFVTWLDSIQFVGGGGESCSLISEGLSTALQLFDD-FKKMREQIG  137

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
               K CIL+  S PY LP       + ++  S   T          E + +   +  +  
Sbjct  138  PTHKVCILICNSPPYLLPA------VESTTYSGYTT----------ENLVQKIGERGIHF  181

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPI---DNPKNPYYLVLI----------SENFME  865
            S++ P+ +  L+ ++  A     G  L +   D  ++P +++LI          + N ++
Sbjct  182  SIISPRKLPALRILFEKAV---TGGMLEVQLKDYSQDPRHMILIRGMVLPGGGTTANPLQ  238

Query  866  ARAAFNRTGMPSLPS  910
             +    +T +P +P+
Sbjct  239  PKQTVPQTQLPPVPA  253



>ref|XP_005921846.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like isoform X5 [Haplochromis burtoni]
Length=584

 Score = 76.3 bits (186),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 103/224 (46%), Gaps = 26/224 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  22   VVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  81

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+ +I F GGG    + IAEGL+ AL +         +Q  
Sbjct  82   PESYVQCHAPTSSAFEFVSWIDNIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  140

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+++ K      ++ 
Sbjct  141  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADSLVKIIRDRGINF  184

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGA---DLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A  +P G     LP D  ++P+++VL+
Sbjct  185  SVVAPRKLPPLRALFERA--SPVGGAVESLP-DYSQDPFHMVLV  225



>ref|XP_005412881.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Chinchilla lanigera]
Length=813

 Score = 76.6 bits (187),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 60/225 (27%), Positives = 102/225 (45%), Gaps = 26/225 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++  +   YL   I  F G         G     ++ LV+FN+    
Sbjct  85   VVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  144

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL  I F GGGG + + IAEGL+ AL +    +  + ++ +
Sbjct  145  PESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFD--DFKKMREQI  202

Query  545  EGQKH--CILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             GQ H  C+L+  S PY LP       + ++  S   T          E++ +   +  +
Sbjct  203  -GQTHRVCLLICNSPPYLLPA------VESTTYSGYTT----------ESLVQEIGERGI  245

Query  719  SLSVVCPKLVLKLKTIY--AAAKRNPRGADLPIDNPKNPYYLVLI  847
              S+V P+ +  L+ ++  AA         LP D  ++P ++VL+
Sbjct  246  HFSIVSPRKLPALRLLFEKAAPPAMLEPMQLPADVSQDPRHMVLV  290



>ref|XP_007429826.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X5 [Python bivittatus]
Length=734

 Score = 76.3 bits (186),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 57/221 (26%), Positives = 95/221 (43%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+   YL   I  F G         G     ++ LV+FN+    
Sbjct  19   VVFVIEGTANLGPYFESLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  78

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL SI F GGGG + + I+EGL+ AL +         +Q  
Sbjct  79   PESYVQCHAPTSSAYEFVTWLDSIQFVGGGGESCSLISEGLSTALQLFDD-FKKMREQIG  137

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
               K CIL+  S PY LP       + ++  S   T          E + +   +  +  
Sbjct  138  PTHKVCILICNSPPYLLPA------VESTTYSGYTT----------ENLVQKIGERGIHF  181

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            S++ P+ +  L+ ++  A           D  ++P +++LI
Sbjct  182  SIISPRKLPALRILFEKAVTGTMLETQLKDYSQDPRHMILI  222



>ref|XP_008843324.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X5 [Nannospalax galili]
Length=745

 Score = 76.3 bits (186),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 60/225 (27%), Positives = 102/225 (45%), Gaps = 26/225 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++  +  DYL   I  F G         G     ++ LV+FN+    
Sbjct  18   VVFVIEGTANLGPYFEGLRKDYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  77

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL  I F GGGG + + IAEGL+ AL +    +  + ++ +
Sbjct  78   PESYVQCHAPTSSAYEFVTWLDGIKFLGGGGESCSLIAEGLSTALQLFD--DFKKMREQI  135

Query  545  EGQKH--CILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             GQ H  C+L+  S PY LP       + ++  S   T          E++ +   +  +
Sbjct  136  -GQTHRVCLLICNSPPYLLPA------VESTTYSGCTT----------ESLVQKIGERGI  178

Query  719  SLSVVCPKLVLKLKTIYAAAKRNPRGADL--PIDNPKNPYYLVLI  847
              S+V P+ +  L+ ++  A        L  P D  ++P ++VL+
Sbjct  179  HFSIVSPRKLPALRLLFEKAAPPALLEPLQPPADVSQDPRHMVLV  223



>ref|XP_007429822.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Python bivittatus]
 ref|XP_007429823.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Python bivittatus]
Length=770

 Score = 76.3 bits (186),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 57/221 (26%), Positives = 95/221 (43%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+   YL   I  F G         G     ++ LV+FN+    
Sbjct  19   VVFVIEGTANLGPYFESLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  78

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL SI F GGGG + + I+EGL+ AL +         +Q  
Sbjct  79   PESYVQCHAPTSSAYEFVTWLDSIQFVGGGGESCSLISEGLSTALQLFDD-FKKMREQIG  137

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
               K CIL+  S PY LP       + ++  S   T          E + +   +  +  
Sbjct  138  PTHKVCILICNSPPYLLPA------VESTTYSGYTT----------ENLVQKIGERGIHF  181

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            S++ P+ +  L+ ++  A           D  ++P +++LI
Sbjct  182  SIISPRKLPALRILFEKAVTGTMLETQLKDYSQDPRHMILI  222



>ref|XP_007429824.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X3 [Python bivittatus]
Length=769

 Score = 76.3 bits (186),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 57/221 (26%), Positives = 95/221 (43%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+   YL   I  F G         G     ++ LV+FN+    
Sbjct  19   VVFVIEGTANLGPYFESLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  78

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL SI F GGGG + + I+EGL+ AL +         +Q  
Sbjct  79   PESYVQCHAPTSSAYEFVTWLDSIQFVGGGGESCSLISEGLSTALQLFDD-FKKMREQIG  137

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
               K CIL+  S PY LP       + ++  S   T          E + +   +  +  
Sbjct  138  PTHKVCILICNSPPYLLPA------VESTTYSGYTT----------ENLVQKIGERGIHF  181

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            S++ P+ +  L+ ++  A           D  ++P +++LI
Sbjct  182  SIISPRKLPALRILFEKAVTGTMLETQLKDYSQDPRHMILI  222



>ref|XP_008111805.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Anolis carolinensis]
Length=770

 Score = 76.3 bits (186),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 63/256 (25%), Positives = 110/256 (43%), Gaps = 37/256 (14%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+   YL   I  F G         G     ++ LV+FN+    
Sbjct  19   VVFVIEGTANLGPYFESLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  78

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL SI F GGGG + + I+EGL+ AL +         +Q  
Sbjct  79   PESYVQCHAPTSSAYEFVTWLDSIQFVGGGGESCSLISEGLSTALQLFDD-FKKMREQIG  137

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
               K CIL+  S PY LP       + ++  S   T          E + +   +  +  
Sbjct  138  PTHKVCILICNSPPYLLPA------VESTTYSGYTT----------ENLVQKIGERGIHF  181

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPI---DNPKNPYYLVLI-----------SENFM  862
            S++ P+ +  L+ ++  A     G  L +   D  ++P +++LI           + N +
Sbjct  182  SIISPRKLPALRILFEKAV---TGGMLEVQLKDYSQDPRHMILIRGMVLPVGGGTTANPL  238

Query  863  EARAAFNRTGMPSLPS  910
            + +    +T +P +P+
Sbjct  239  QPKQTVPQTQLPPVPA  254



>ref|XP_008111803.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Anolis carolinensis]
Length=771

 Score = 76.3 bits (186),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 63/256 (25%), Positives = 110/256 (43%), Gaps = 37/256 (14%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+   YL   I  F G         G     ++ LV+FN+    
Sbjct  19   VVFVIEGTANLGPYFESLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  78

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL SI F GGGG + + I+EGL+ AL +         +Q  
Sbjct  79   PESYVQCHAPTSSAYEFVTWLDSIQFVGGGGESCSLISEGLSTALQLFDD-FKKMREQIG  137

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
               K CIL+  S PY LP       + ++  S   T          E + +   +  +  
Sbjct  138  PTHKVCILICNSPPYLLPA------VESTTYSGYTT----------ENLVQKIGERGIHF  181

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPI---DNPKNPYYLVLI-----------SENFM  862
            S++ P+ +  L+ ++  A     G  L +   D  ++P +++LI           + N +
Sbjct  182  SIISPRKLPALRILFEKAV---TGGMLEVQLKDYSQDPRHMILIRGMVLPVGGGTTANPL  238

Query  863  EARAAFNRTGMPSLPS  910
            + +    +T +P +P+
Sbjct  239  QPKQTVPQTQLPPVPA  254



>ref|XP_007429825.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X4 [Python bivittatus]
Length=747

 Score = 76.3 bits (186),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 57/221 (26%), Positives = 95/221 (43%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+   YL   I  F G         G     ++ LV+FN+    
Sbjct  19   VVFVIEGTANLGPYFESLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  78

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL SI F GGGG + + I+EGL+ AL +         +Q  
Sbjct  79   PESYVQCHAPTSSAYEFVTWLDSIQFVGGGGESCSLISEGLSTALQLFDD-FKKMREQIG  137

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
               K CIL+  S PY LP       + ++  S   T          E + +   +  +  
Sbjct  138  PTHKVCILICNSPPYLLPA------VESTTYSGYTT----------ENLVQKIGERGIHF  181

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            S++ P+ +  L+ ++  A           D  ++P +++LI
Sbjct  182  SIISPRKLPALRILFEKAVTGTMLETQLKDYSQDPRHMILI  222



>ref|XP_008843325.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X6 [Nannospalax galili]
Length=722

 Score = 76.3 bits (186),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 60/225 (27%), Positives = 102/225 (45%), Gaps = 26/225 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++  +  DYL   I  F G         G     ++ LV+FN+    
Sbjct  18   VVFVIEGTANLGPYFEGLRKDYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  77

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL  I F GGGG + + IAEGL+ AL +    +  + ++ +
Sbjct  78   PESYVQCHAPTSSAYEFVTWLDGIKFLGGGGESCSLIAEGLSTALQLFD--DFKKMREQI  135

Query  545  EGQKH--CILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             GQ H  C+L+  S PY LP       + ++  S   T          E++ +   +  +
Sbjct  136  -GQTHRVCLLICNSPPYLLPA------VESTTYSGCTT----------ESLVQKIGERGI  178

Query  719  SLSVVCPKLVLKLKTIYAAAKRNPRGADL--PIDNPKNPYYLVLI  847
              S+V P+ +  L+ ++  A        L  P D  ++P ++VL+
Sbjct  179  HFSIVSPRKLPALRLLFEKAAPPALLEPLQPPADVSQDPRHMVLV  223



>ref|XP_003510925.2| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Cricetulus griseus]
Length=789

 Score = 75.9 bits (185),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 103/225 (46%), Gaps = 26/225 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++  +   YL   I  F G         G     ++ LV+FN+    
Sbjct  65   VVFVIEGTANLGPYFDELRDHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  124

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL+ I F GGGG + + IAEGL+ AL +    +  + ++ +
Sbjct  125  PESYVQCHAPTSSAYEFVTWLNGIKFMGGGGESCSLIAEGLSTALQLFD--DFKKMREQI  182

Query  545  EGQKH--CILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             GQ H  C+L+  S PY LP       + ++  S   T          E++ +   +  +
Sbjct  183  -GQTHRVCLLICNSPPYLLPA------VESTTYSGCTT----------ESLVQKIGERGI  225

Query  719  SLSVVCPKLVLKLKTIYAAAKRNPRGADL--PIDNPKNPYYLVLI  847
              S+V P+ +  L+ ++  A        L  P+D  ++P ++VL+
Sbjct  226  HFSIVSPRKLPALRLLFEKAAPPALLEPLQQPVDVSQDPRHMVLV  270



>ref|XP_008327856.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Cynoglossus semilaevis]
Length=756

 Score = 75.9 bits (185),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/221 (25%), Positives = 94/221 (43%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  22   VVFVIEGTANLGPYFESLRKNYILPAIEFFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  81

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+  I F GGG    + IAEGL+ AL +         +Q  
Sbjct  82   PESYVQCHAPTSSAFEFVSWIDGIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  140

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP                  ++       A+ + K      +  
Sbjct  141  QTHKVCVLLCNSPPYLLPA----------------VESVSYTGCTADNLVKIIRDKGIHF  184

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A     G +   D  ++ +++VL+
Sbjct  185  SVVAPRKLPALRALFERASPVVGGVEPHPDCSQDAFHMVLV  225



>gb|EPB90050.1| hypothetical protein HMPREF1544_03162 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=1076

 Score = 75.9 bits (185),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 90/199 (45%), Gaps = 28/199 (14%)
 Frame = +2

Query  185  EKQLIIAVEGTAAMGPHWTSIVSDYLEKIIR-----CFCGAEAGSQKPSGANV-EFGLVM  346
            E  ++  V+GTA M PH+  +   Y+E II+         AE G  K     V ++GLV+
Sbjct  45   EVVIVFVVDGTARMKPHFDLLYEAYVEPIIKQLRLPIVTEAEEGQPKTKITPVLKYGLVV  104

Query  347  FNSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPNGN  526
            F  +  +S   V R  +T D   F     SI F  GG    A+ EG+  AL +      +
Sbjct  105  FGDYEPFSVATVDRKYFTSDPIQFQDIFKSIPFRNGGIVKNAVGEGMVAALELF-----D  159

Query  527  QSKQTVEGQ---KHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAK  697
            + K+ ++G+   +HCIL++ S PY +             +     + D  +L D   VA 
Sbjct  160  EYKEELDGKELIQHCILLSNSLPYNM-----------GSKCNLVDKYDGYKLDD---VAV  205

Query  698  SFAQCSVSLSVVCPKLVLK  754
               + ++ LS++ PK   K
Sbjct  206  EMKKSNIRLSLISPKKACK  224



>ref|XP_007649653.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Cricetulus griseus]
Length=788

 Score = 75.9 bits (185),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 103/225 (46%), Gaps = 26/225 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++  +   YL   I  F G         G     ++ LV+FN+    
Sbjct  65   VVFVIEGTANLGPYFDELRDHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  124

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL+ I F GGGG + + IAEGL+ AL +    +  + ++ +
Sbjct  125  PESYVQCHAPTSSAYEFVTWLNGIKFMGGGGESCSLIAEGLSTALQLFD--DFKKMREQI  182

Query  545  EGQKH--CILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             GQ H  C+L+  S PY LP       + ++  S   T          E++ +   +  +
Sbjct  183  -GQTHRVCLLICNSPPYLLPA------VESTTYSGCTT----------ESLVQKIGERGI  225

Query  719  SLSVVCPKLVLKLKTIYAAAKRNPRGADL--PIDNPKNPYYLVLI  847
              S+V P+ +  L+ ++  A        L  P+D  ++P ++VL+
Sbjct  226  HFSIVSPRKLPALRLLFEKAAPPALLEPLQQPVDVSQDPRHMVLV  270



>ref|XP_003230191.2| PREDICTED: mediator of RNA polymerase II transcription subunit 
25-like, partial [Anolis carolinensis]
Length=464

 Score = 74.7 bits (182),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 63/256 (25%), Positives = 110/256 (43%), Gaps = 37/256 (14%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+   YL   I  F G         G     ++ LV+FN+    
Sbjct  19   VVFVIEGTANLGPYFESLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  78

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL SI F GGGG + + I+EGL+ AL +         +Q  
Sbjct  79   PESYVQCHAPTSSAYEFVTWLDSIQFVGGGGESCSLISEGLSTALQLFDD-FKKMREQIG  137

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
               K CIL+  S PY LP       + ++  S   T          E + +   +  +  
Sbjct  138  PTHKVCILICNSPPYLLPA------VESTTYSGYTT----------ENLVQKIGERGIHF  181

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPI---DNPKNPYYLVLI-----------SENFM  862
            S++ P+ +  L+ ++  A     G  L +   D  ++P +++LI           + N +
Sbjct  182  SIISPRKLPALRILFEKAV---TGGMLEVQLKDYSQDPRHMILIRGMVLPVGGGTTANPL  238

Query  863  EARAAFNRTGMPSLPS  910
            + +    +T +P +P+
Sbjct  239  QPKQTVPQTQLPPVPA  254



>ref|XP_008327857.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Cynoglossus semilaevis]
Length=732

 Score = 75.5 bits (184),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/221 (26%), Positives = 96/221 (43%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+  +Y+   I  F G         G     ++GLV+FN+    
Sbjct  22   VVFVIEGTANLGPYFESLRKNYILPAIEFFNGGPPAETDFGGDYGGTQYGLVVFNTVDCA  81

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAA-IAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ W+  I F GGG    + IAEGL+ AL +         +Q  
Sbjct  82   PESYVQCHAPTSSAFEFVSWIDGIQFMGGGAESCSLIAEGLSVALQLFDD-FKKMREQIG  140

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            +  K C+L+  S PY LP              E+ + T       A+ + K      +  
Sbjct  141  QTHKVCVLLCNSPPYLLPA------------VESVSYTG----CTADNLVKIIRDKGIHF  184

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            SVV P+ +  L+ ++  A     G +   D  ++ +++VL+
Sbjct  185  SVVAPRKLPALRALFERASPVVGGVEPHPDCSQDAFHMVLV  225



>gb|ERE70128.1| mediator of RNA polymerase II transcription subunit 25 [Cricetulus 
griseus]
Length=741

 Score = 75.5 bits (184),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 103/225 (46%), Gaps = 26/225 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++  +   YL   I  F G         G     ++ LV+FN+    
Sbjct  18   VVFVIEGTANLGPYFDELRDHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  77

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL+ I F GGGG + + IAEGL+ AL +    +  + ++ +
Sbjct  78   PESYVQCHAPTSSAYEFVTWLNGIKFMGGGGESCSLIAEGLSTALQLFD--DFKKMREQI  135

Query  545  EGQKH--CILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             GQ H  C+L+  S PY LP       + ++  S   T          E++ +   +  +
Sbjct  136  -GQTHRVCLLICNSPPYLLPA------VESTTYSGCTT----------ESLVQKIGERGI  178

Query  719  SLSVVCPKLVLKLKTIYAAAKRNPRGADL--PIDNPKNPYYLVLI  847
              S+V P+ +  L+ ++  A        L  P+D  ++P ++VL+
Sbjct  179  HFSIVSPRKLPALRLLFEKAAPPALLEPLQQPVDVSQDPRHMVLV  223



>gb|ERE70130.1| mediator of RNA polymerase II transcription subunit 25 [Cricetulus 
griseus]
Length=742

 Score = 75.5 bits (184),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 103/225 (46%), Gaps = 26/225 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++  +   YL   I  F G         G     ++ LV+FN+    
Sbjct  18   VVFVIEGTANLGPYFDELRDHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  77

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL+ I F GGGG + + IAEGL+ AL +    +  + ++ +
Sbjct  78   PESYVQCHAPTSSAYEFVTWLNGIKFMGGGGESCSLIAEGLSTALQLFD--DFKKMREQI  135

Query  545  EGQKH--CILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             GQ H  C+L+  S PY LP       + ++  S   T          E++ +   +  +
Sbjct  136  -GQTHRVCLLICNSPPYLLPA------VESTTYSGCTT----------ESLVQKIGERGI  178

Query  719  SLSVVCPKLVLKLKTIYAAAKRNPRGADL--PIDNPKNPYYLVLI  847
              S+V P+ +  L+ ++  A        L  P+D  ++P ++VL+
Sbjct  179  HFSIVSPRKLPALRLLFEKAAPPALLEPLQQPVDVSQDPRHMVLV  223



>gb|ERE70129.1| mediator of RNA polymerase II transcription subunit 25 [Cricetulus 
griseus]
Length=674

 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 103/225 (46%), Gaps = 26/225 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++  +   YL   I  F G         G     ++ LV+FN+    
Sbjct  18   VVFVIEGTANLGPYFDELRDHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  77

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL+ I F GGGG + + IAEGL+ AL +    +  + ++ +
Sbjct  78   PESYVQCHAPTSSAYEFVTWLNGIKFMGGGGESCSLIAEGLSTALQLFD--DFKKMREQI  135

Query  545  EGQKH--CILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             GQ H  C+L+  S PY LP       + ++  S   T          E++ +   +  +
Sbjct  136  -GQTHRVCLLICNSPPYLLPA------VESTTYSGCTT----------ESLVQKIGERGI  178

Query  719  SLSVVCPKLVLKLKTIYAAAKRNPRGADL--PIDNPKNPYYLVLI  847
              S+V P+ +  L+ ++  A        L  P+D  ++P ++VL+
Sbjct  179  HFSIVSPRKLPALRLLFEKAAPPALLEPLQQPVDVSQDPRHMVLV  223



>ref|XP_005820011.1| hypothetical protein GUITHDRAFT_120768 [Guillardia theta CCMP2712]
 gb|EKX33031.1| hypothetical protein GUITHDRAFT_120768 [Guillardia theta CCMP2712]
Length=401

 Score = 74.3 bits (181),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/201 (25%), Positives = 84/201 (42%), Gaps = 24/201 (12%)
 Frame = +2

Query  161  FAGQSPMAEKQLIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGANVEFGL  340
             A Q+P+  +Q+++ V+ T+ M P+WTS+   Y   I       +   +  +    E+ L
Sbjct  1    MANQAPLINRQVVLVVDSTSYMEPYWTSL---YKNCIYPALTYLDTRHKPDTILKTEYAL  57

Query  341  VMFNSHGSYSACLVQRSGWTRDIDLFLHWLSSIHFGGGGFNDAAIAEGLAEALMMLSSPN  520
            V F  H  Y    ++ + +T  + LF  W  ++ F GGG+   A+ EGL  AL +   P 
Sbjct  58   VCFCDHAPYGDKTIKTNYFTNKLPLFDSWAKNVEFVGGGYAQNAVTEGLFAALELF--PE  115

Query  521  GNQSKQTVEGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKS  700
             N   ++ E  K+ +L +                 NS   E   +      SD   + K 
Sbjct  116  KNSEGRSSE--KYILLAS-----------------NSRHHEIPCRLGGSDASDLPEIVKR  156

Query  701  FAQCSVSLSVVCPKLVLKLKT  763
             +Q    LS   P  +  LK+
Sbjct  157  ISQMGAMLSCFLPHTLDPLKS  177



>ref|XP_005084810.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 [Mesocricetus auratus]
Length=741

 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 104/225 (46%), Gaps = 26/225 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++  + + YL   I  F G         G     ++ LV+FN+    
Sbjct  18   VVFVIEGTANLGPYFEELRNHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  77

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL+ I F GGGG + + IAEGL+ AL +    +  + ++ +
Sbjct  78   PESYVQCHAPTSSAYEFVTWLNGIKFMGGGGESCSLIAEGLSTALQLFD--DFKKMREQI  135

Query  545  EGQKH--CILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             GQ H  C+L+  S PY LP       + ++  S   T          E++ +   +  +
Sbjct  136  -GQTHRVCLLICNSPPYLLPA------VESTTYSGCTT----------ESLVQKIGERGI  178

Query  719  SLSVVCPKLVLKLKTIYAAAKRNPRGADL--PIDNPKNPYYLVLI  847
              S+V P+ +  L+ ++  A        L  P+D  ++P ++VL+
Sbjct  179  HFSIVSPRKLPALRLLFEKAAPPAMLEPLQPPVDVSQDPRHMVLV  223



>gb|ETE70944.1| Mediator of RNA polymerase II transcription subunit 25 [Ophiophagus 
hannah]
Length=713

 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 95/221 (43%), Gaps = 20/221 (9%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++ S+   YL   I  F G         G     ++ LV+FN+    
Sbjct  19   VVFVIEGTANLGPYFESLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  78

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL SI F GGGG + + I+EGL+ AL +         +Q  
Sbjct  79   PESYVQCHAPTSSAYEFVTWLDSIQFVGGGGESCSLISEGLSTALQLFDD-FKKMREQIG  137

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
               K CIL+  S PY LP       + ++  S   T          E + +   +  +  
Sbjct  138  PTHKVCILICNSPPYLLPA------VESTTYSGYTT----------ENLVQKIGERGIHF  181

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADLPIDNPKNPYYLVLI  847
            S++ P+ +  L+ ++  +           D  ++P +++LI
Sbjct  182  SIISPRKLPALRILFEKSVTGNMLETQLKDYSQDPRHMILI  222



>gb|EGW13426.1| Mediator of RNA polymerase II transcription subunit 25 [Cricetulus 
griseus]
Length=735

 Score = 75.1 bits (183),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 103/225 (46%), Gaps = 26/225 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++  +   YL   I  F G         G     ++ LV+FN+    
Sbjct  18   VVFVIEGTANLGPYFDELRDHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  77

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL+ I F GGGG + + IAEGL+ AL +    +  + ++ +
Sbjct  78   PESYVQCHAPTSSAYEFVTWLNGIKFMGGGGESCSLIAEGLSTALQLFD--DFKKMREQI  135

Query  545  EGQKH--CILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             GQ H  C+L+  S PY LP       + ++  S   T          E++ +   +  +
Sbjct  136  -GQTHRVCLLICNSPPYLLPA------VESTTYSGCTT----------ESLVQKIGERGI  178

Query  719  SLSVVCPKLVLKLKTIYAAAKRNPRGADL--PIDNPKNPYYLVLI  847
              S+V P+ +  L+ ++  A        L  P+D  ++P ++VL+
Sbjct  179  HFSIVSPRKLPALRLLFEKAAPPALLEPLQQPVDVSQDPRHMVLV  223



>ref|XP_003465545.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 [Cavia porcellus]
Length=747

 Score = 75.1 bits (183),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/225 (27%), Positives = 103/225 (46%), Gaps = 26/225 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSGAN--VEFGLVMFNSHGSY  367
            ++  +EGTA +GP++  +   YL   I  F G         G +   ++ LV+FN+    
Sbjct  18   VVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPAETNFEGDDGGTQYSLVVFNTVDCA  77

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL SI F GGGG + + IAEGL+ AL +    +  + ++ +
Sbjct  78   PESYVQCHAPTSSAYEFVTWLDSIKFMGGGGESCSLIAEGLSTALQLFD--DFKKMREQI  135

Query  545  EGQKH--CILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             GQ H  C+L+  S PY LP       + ++  S   T          E++ +   +  +
Sbjct  136  -GQTHRVCLLICNSPPYLLPA------VESTTYSGYTT----------ESLVQEIGERGI  178

Query  719  SLSVVCPKLVLKLKTIYAAAKRNPRGADL--PIDNPKNPYYLVLI  847
              S+V P+ +  L+ ++  A        L  P D  ++P ++VL+
Sbjct  179  HFSIVSPRKLPALRLLFEKAAPPAMLEPLQPPADVSQDPRHMVLV  223



>ref|XP_005412880.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X1 [Chinchilla lanigera]
Length=862

 Score = 75.1 bits (183),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/225 (27%), Positives = 102/225 (45%), Gaps = 26/225 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++  +   YL   I  F G         G     ++ LV+FN+    
Sbjct  85   VVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  144

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL  I F GGGG + + IAEGL+ AL +    +  + ++ +
Sbjct  145  PESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFD--DFKKMREQI  202

Query  545  EGQKH--CILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             GQ H  C+L+  S PY LP       + ++  S   T          E++ +   +  +
Sbjct  203  -GQTHRVCLLICNSPPYLLPA------VESTTYSGYTT----------ESLVQEIGERGI  245

Query  719  SLSVVCPKLVLKLKTIY--AAAKRNPRGADLPIDNPKNPYYLVLI  847
              S+V P+ +  L+ ++  AA         LP D  ++P ++VL+
Sbjct  246  HFSIVSPRKLPALRLLFEKAAPPAMLEPMQLPADVSQDPRHMVLV  290



>ref|XP_008843321.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 isoform X2 [Nannospalax galili]
Length=801

 Score = 75.1 bits (183),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/225 (27%), Positives = 102/225 (45%), Gaps = 26/225 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++  +  DYL   I  F G         G     ++ LV+FN+    
Sbjct  18   VVFVIEGTANLGPYFEGLRKDYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  77

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL  I F GGGG + + IAEGL+ AL +    +  + ++ +
Sbjct  78   PESYVQCHAPTSSAYEFVTWLDGIKFLGGGGESCSLIAEGLSTALQLFD--DFKKMREQI  135

Query  545  EGQKH--CILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             GQ H  C+L+  S PY LP       + ++  S   T          E++ +   +  +
Sbjct  136  -GQTHRVCLLICNSPPYLLPA------VESTTYSGCTT----------ESLVQKIGERGI  178

Query  719  SLSVVCPKLVLKLKTIYAAAKRNPRGADL--PIDNPKNPYYLVLI  847
              S+V P+ +  L+ ++  A        L  P D  ++P ++VL+
Sbjct  179  HFSIVSPRKLPALRLLFEKAAPPALLEPLQPPADVSQDPRHMVLV  223



>ref|XP_004619909.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 [Sorex araneus]
Length=749

 Score = 74.7 bits (182),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 97/223 (43%), Gaps = 22/223 (10%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++  +   YL   I  F G         G     ++ LV+FN+    
Sbjct  18   VVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  77

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL  I F GGGG + + IAEGL+ AL +         +Q  
Sbjct  78   PESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFDD-FKKMREQIG  136

Query  545  EGQKHCILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSVSL  724
            E  + C+L+  S PY LP       + ++  S   T          E++ +   +  +  
Sbjct  137  ETHRVCLLICNSPPYLLPA------VESTTYSGYTT----------ESLVQKIGEQGIHF  180

Query  725  SVVCPKLVLKLKTIYAAAKRNPRGADL--PIDNPKNPYYLVLI  847
            S+V P+ +  L+ ++  A        L  P D  ++P ++VL+
Sbjct  181  SIVSPRKLPALRLLFEKAAPPALLEPLQPPTDVSQDPRHMVLV  223



>ref|XP_006575862.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Glycine 
max]
Length=504

 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 62/125 (50%), Gaps = 4/125 (3%)
 Frame = +2

Query  1877  YVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPETMQIVRLISQDHMNNKQYV  2056
             +V  WEG+L G+      F+ +    R  ++   L A W E ++IV  I  + +N    +
Sbjct  379   FVHAWEGSLVGKIHSYCEFLNQARVVRKPTSPVMLTAEWSERLKIVLFIPTNAINYTMKI  438

Query  2057  --GKADFLVFRAM--NQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDM  2224
               G  D++ F  +  N       +  K LCA I+LPSQTL+LS++      +G +FP D 
Sbjct  439   IGGPIDYVFFHIIQFNNLNLYDYMMSKNLCAKIELPSQTLILSITQSKYHYLGAIFPEDT  498

Query  2225  VVFKP  2239
             +  +P
Sbjct  499   IFVEP  503



>ref|XP_007463452.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25 [Lipotes vexillifer]
Length=747

 Score = 74.3 bits (181),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 101/225 (45%), Gaps = 26/225 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++  +   YL   I  F G         G     ++ LV+FN+    
Sbjct  18   VVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  77

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL  I F GGGG + + IAEGL+ AL +    +  + ++ +
Sbjct  78   PESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFD--DFRKMREQI  135

Query  545  EGQKH--CILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             GQ H  C+L+  S PY LP       + ++  S   T          ET+ +   +  +
Sbjct  136  -GQTHRVCLLICNSPPYLLPA------VESTTYSGCTT----------ETLVQKIGERGI  178

Query  719  SLSVVCPKLVLKLKTIYAAAKRNPRGADL--PIDNPKNPYYLVLI  847
              SVV P+ +  L+ ++  A        L  P D  ++P ++VL+
Sbjct  179  YFSVVSPRKLPALRLLFEKAAPPAMLEPLQPPADVSQDPRHMVLV  223



>ref|XP_004767837.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
25, partial [Mustela putorius furo]
Length=730

 Score = 74.3 bits (181),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 101/225 (45%), Gaps = 26/225 (12%)
 Frame = +2

Query  194  LIIAVEGTAAMGPHWTSIVSDYLEKIIRCFCGAEAGSQKPSG--ANVEFGLVMFNSHGSY  367
            ++  +EGTA +GP++  +   YL   I  F G         G     ++ LV+FN+    
Sbjct  2    VVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCA  61

Query  368  SACLVQRSGWTRDIDLFLHWLSSIHF-GGGGFNDAAIAEGLAEALMMLSSPNGNQSKQTV  544
                VQ    T     F+ WL  I F GGGG + + IAEGL+ AL +    +  + ++ +
Sbjct  62   PESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFD--DFKKMREQI  119

Query  545  EGQKH--CILVAASNPYPLPTPVYRPQIHNSEQSENETQTDDRRLSDAETVAKSFAQCSV  718
             GQ H  C+L+  S PY LP       + ++  S   T          E++ +   +  +
Sbjct  120  -GQTHRVCLLICNSPPYLLPA------VESTTYSGYTT----------ESLVQKIGEQGI  162

Query  719  SLSVVCPKLVLKLKTIYAAAKRNPRGADL--PIDNPKNPYYLVLI  847
              S+V P+ +  L+ ++  A        L  P D  ++P ++VL+
Sbjct  163  HFSIVSPRKLPALRLLFEKAAPPALLEPLQPPTDVSQDPRHMVLV  207



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7262555610982