BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25515_g1_i5 len=1411 path=[9418:0-22 44:23-55 77:56-79 101:80-164
8436:165-237 256:238-249 9551:250-259 9561:260-260 9562:261-279
9011:280-309 328:310-340 359:341-541 560:542-657 6440:658-675
694:676-705 724:706-745 764:746-803 822:804-836 855:837-902
9723:903-915 9737:916-920 9742:921-942 8754:943-943 8755:944-970
8781:971-1003 1081:1004-1027 1105:1028-1047 1125:1048-1072
1150:1073-1159 9266:1160-1176 1254:1177-1201 6516:1202-1212
1290:1213-1268 6629:1269-1277 1355:1278-1301 1379:1302-1329
1407:1330-1410]

Length=1411
                                                                      Score     E

ref|XP_009799834.1|  PREDICTED: protein notum homolog                   299   4e-93   
ref|XP_006355154.1|  PREDICTED: protein notum homolog                   296   1e-91   
ref|XP_009605804.1|  PREDICTED: protein notum homolog                   293   5e-91   
ref|XP_009600038.1|  PREDICTED: protein notum homolog                   293   6e-91   
ref|XP_009601364.1|  PREDICTED: protein notum homolog                   292   3e-90   
gb|EYU29129.1|  hypothetical protein MIMGU_mgv1a023759mg                291   4e-90   
ref|XP_009590663.1|  PREDICTED: protein notum homolog isoform X1        292   4e-90   
ref|XP_009589914.1|  PREDICTED: uncharacterized protein LOC104087...    290   1e-89   
ref|XP_009589915.1|  PREDICTED: uncharacterized protein LOC104087...    290   2e-89   
ref|XP_009784099.1|  PREDICTED: protein notum homolog                   290   2e-89   
ref|XP_009803843.1|  PREDICTED: uncharacterized protein LOC104249167    290   2e-89   
ref|XP_010318089.1|  PREDICTED: protein notum homolog                   289   7e-89   
ref|XP_008451860.1|  PREDICTED: protein notum homolog isoform X1        288   7e-89   
ref|XP_008451861.1|  PREDICTED: protein notum homolog isoform X2        288   7e-89   
ref|XP_003613922.1|  Notum-like protein                                 287   2e-88   
ref|XP_009624847.1|  PREDICTED: protein notum homolog isoform X2        286   4e-88   
ref|XP_011028476.1|  PREDICTED: protein notum homolog                   286   5e-88   
ref|XP_006385133.1|  pectinacetylesterase family protein                286   6e-88   
ref|XP_010314003.1|  PREDICTED: protein notum homolog isoform X1        285   1e-87   
ref|XP_006587657.1|  PREDICTED: protein notum homolog isoform X3        285   1e-87   
ref|XP_009778395.1|  PREDICTED: protein notum homolog                   285   2e-87   
ref|XP_008797987.1|  PREDICTED: protein notum homolog isoform X1        284   2e-87   
ref|XP_011012520.1|  PREDICTED: protein notum homolog                   284   2e-87   
ref|XP_009779347.1|  PREDICTED: protein notum homolog isoform X1        284   2e-87   
ref|XP_006587656.1|  PREDICTED: protein notum homolog isoform X2        286   3e-87   
ref|XP_004172255.1|  PREDICTED: protein notum homolog                   284   3e-87   
ref|XP_010314004.1|  PREDICTED: protein notum homolog isoform X2        284   4e-87   
ref|XP_009397056.1|  PREDICTED: protein notum homolog                   284   4e-87   
ref|XP_003628996.1|  Carboxylic ester hydrolase                         284   4e-87   
gb|ADR82372.1|  pectin acetylesterase                                   283   5e-87   
ref|NP_001047850.1|  Os02g0702400                                       283   6e-87   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011073252.1|  PREDICTED: protein notum homolog isoform X2        283   6e-87   
gb|KCW72720.1|  hypothetical protein EUGRSUZ_E01169                     283   1e-86   
ref|XP_004244682.2|  PREDICTED: uncharacterized protein LOC101248898    282   2e-86   
ref|XP_011073171.1|  PREDICTED: protein notum homolog isoform X1        283   2e-86   
ref|XP_009413211.1|  PREDICTED: protein notum homolog                   281   3e-86   
ref|XP_009624845.1|  PREDICTED: protein notum homolog isoform X1        281   3e-86   
ref|XP_003547731.1|  PREDICTED: protein notum homolog isoform X1        281   3e-86   
ref|XP_002303225.2|  pectinacetylesterase family protein                281   3e-86   Populus trichocarpa [western balsam poplar]
ref|XP_009797876.1|  PREDICTED: protein notum homolog isoform X2        281   3e-86   
ref|XP_010056132.1|  PREDICTED: protein notum homolog isoform X3        283   4e-86   
gb|KHN27509.1|  Protein notum like                                      281   4e-86   
ref|XP_010056129.1|  PREDICTED: protein notum homolog isoform X1        283   5e-86   
ref|XP_006573492.1|  PREDICTED: protein notum homolog isoform X2        281   5e-86   
gb|KHN27511.1|  Protein notum like                                      281   5e-86   
ref|XP_010056131.1|  PREDICTED: protein notum homolog isoform X2        283   5e-86   
ref|XP_009607289.1|  PREDICTED: protein notum homolog                   281   7e-86   
ref|XP_004150551.1|  PREDICTED: protein notum homolog                   285   9e-86   
gb|EPS71696.1|  hypothetical protein M569_03061                         280   1e-85   
ref|XP_006587655.1|  PREDICTED: protein notum homolog isoform X1        281   1e-85   
ref|XP_006573491.1|  PREDICTED: protein notum homolog isoform X1        281   1e-85   
gb|KHN41756.1|  Protein notum like                                      281   1e-85   
ref|XP_003548585.1|  PREDICTED: protein notum homolog                   280   2e-85   
ref|XP_010327577.1|  PREDICTED: uncharacterized protein LOC101244626    279   3e-85   
ref|XP_003547822.1|  PREDICTED: protein notum homolog                   279   3e-85   
ref|XP_007156332.1|  hypothetical protein PHAVU_003G277600g             279   3e-85   
ref|XP_002519911.1|  pectin acetylesterase, putative                    279   4e-85   Ricinus communis
ref|XP_006365947.1|  PREDICTED: uncharacterized protein LOC102601254    279   4e-85   
ref|XP_006652763.1|  PREDICTED: protein notum homolog                   278   5e-85   
gb|KDP28066.1|  hypothetical protein JCGZ_19474                         278   8e-85   
ref|XP_010911666.1|  PREDICTED: protein notum homolog                   278   8e-85   
ref|XP_011082149.1|  PREDICTED: protein notum homolog isoform X1        278   1e-84   
ref|XP_003547821.1|  PREDICTED: protein notum homolog                   277   1e-84   
ref|XP_006878664.1|  hypothetical protein AMTR_s00011p00266820          277   1e-84   
ref|XP_003580427.1|  PREDICTED: uncharacterized protein LOC100827...    277   2e-84   
ref|XP_009797875.1|  PREDICTED: protein notum homolog isoform X1        276   2e-84   
ref|XP_010240371.1|  PREDICTED: uncharacterized protein LOC100827...    277   2e-84   
ref|XP_010439718.1|  PREDICTED: protein notum homolog                   276   2e-84   
gb|EYU29131.1|  hypothetical protein MIMGU_mgv1a007782mg                276   2e-84   
ref|XP_004509558.1|  PREDICTED: protein notum homolog                   276   4e-84   
ref|XP_010449357.1|  PREDICTED: protein notum homolog                   276   6e-84   
dbj|BAJ97261.1|  predicted protein                                      275   6e-84   
ref|XP_010644665.1|  PREDICTED: uncharacterized protein LOC100245856    275   1e-83   
ref|XP_007158098.1|  hypothetical protein PHAVU_002G123900g             275   1e-83   
ref|XP_009771151.1|  PREDICTED: uncharacterized protein LOC104221730    275   1e-83   
ref|XP_002519912.1|  pectin acetylesterase, putative                    276   1e-83   Ricinus communis
ref|XP_009108426.1|  PREDICTED: protein notum homolog                   274   2e-83   
ref|XP_010434420.1|  PREDICTED: protein notum homolog                   275   2e-83   
gb|EYU29130.1|  hypothetical protein MIMGU_mgv1a007782mg                274   2e-83   
emb|CDY09287.1|  BnaC03g63170D                                          274   2e-83   
ref|XP_006471634.1|  PREDICTED: uncharacterized protein LOC102628021    275   2e-83   
ref|XP_006494119.1|  PREDICTED: protein notum homolog isoform X1        274   2e-83   
ref|XP_009627060.1|  PREDICTED: uncharacterized protein LOC104117690    274   2e-83   
gb|KDO40410.1|  hypothetical protein CISIN_1g013734mg                   275   3e-83   
ref|XP_006432881.1|  hypothetical protein CICLE_v10001426mg             274   3e-83   
gb|KDP28068.1|  hypothetical protein JCGZ_19476                         274   3e-83   
ref|XP_010942974.1|  PREDICTED: protein notum homolog                   273   3e-83   
ref|XP_007209217.1|  hypothetical protein PRUPE_ppa006718mg             273   4e-83   
ref|XP_006432880.1|  hypothetical protein CICLE_v10001467mg             273   4e-83   
gb|KCW72726.1|  hypothetical protein EUGRSUZ_E01170                     272   6e-83   
ref|XP_009132797.1|  PREDICTED: protein notum homolog                   273   6e-83   
ref|XP_010942975.1|  PREDICTED: protein notum homolog isoform X1        273   6e-83   
ref|XP_006413980.1|  hypothetical protein EUTSA_v10025385mg             273   8e-83   
ref|NP_193677.2|  putative pectinacetylesterase                         273   8e-83   Arabidopsis thaliana [mouse-ear cress]
gb|KCW72718.1|  hypothetical protein EUGRSUZ_E01169                     273   9e-83   
ref|XP_007040900.1|  Pectinacetylesterase family protein                273   9e-83   
ref|XP_006359968.1|  PREDICTED: protein notum homolog                   271   9e-83   
emb|CDX78933.1|  BnaA01g10000D                                          274   1e-82   
ref|XP_009797415.1|  PREDICTED: uncharacterized protein LOC104243851    272   1e-82   
ref|XP_004509522.1|  PREDICTED: uncharacterized protein LOC101493...    273   1e-82   
ref|XP_010056136.1|  PREDICTED: protein notum homolog                   272   1e-82   
ref|XP_009350399.1|  PREDICTED: protein notum homolog                   272   1e-82   
ref|XP_010677538.1|  PREDICTED: protein notum homolog isoform X1        272   1e-82   
ref|XP_010056135.1|  PREDICTED: protein notum homolog                   272   1e-82   
ref|XP_009794297.1|  PREDICTED: protein notum homolog                   272   2e-82   
emb|CDX99378.1|  BnaC01g11740D                                          272   2e-82   
ref|XP_008808358.1|  PREDICTED: protein notum homolog                   272   2e-82   
ref|XP_009592441.1|  PREDICTED: uncharacterized protein LOC104089292    272   2e-82   
emb|CDX99377.1|  BnaC01g11750D                                          273   2e-82   
gb|KCW72723.1|  hypothetical protein EUGRSUZ_E01170                     271   2e-82   
ref|XP_010536220.1|  PREDICTED: protein notum homolog isoform X1        271   2e-82   
ref|XP_010434425.1|  PREDICTED: uncharacterized protein LOC104718...    271   2e-82   
ref|XP_002867938.1|  pectinacetylesterase family protein                271   3e-82   
ref|XP_010248193.1|  PREDICTED: uncharacterized protein LOC104591101    271   3e-82   
gb|KDP28067.1|  hypothetical protein JCGZ_19475                         271   3e-82   
ref|XP_009132784.1|  PREDICTED: uncharacterized protein LOC103857370    271   3e-82   
ref|XP_006599203.1|  PREDICTED: uncharacterized protein LOC100781...    271   3e-82   
ref|XP_010449359.1|  PREDICTED: uncharacterized protein LOC104731629    271   3e-82   
emb|CDX78932.1|  BnaA01g09990D                                          271   4e-82   
gb|ACF05806.1|  PAE                                                     271   4e-82   Litchi chinensis [litchi]
emb|CDY09289.1|  BnaC03g63190D                                          271   4e-82   
ref|XP_009388128.1|  PREDICTED: protein notum homolog                   271   4e-82   
ref|XP_010434424.1|  PREDICTED: uncharacterized protein LOC104718...    271   4e-82   
ref|XP_010536189.1|  PREDICTED: uncharacterized protein LOC104811...    271   4e-82   
gb|KHN41567.1|  Protein notum like                                      271   5e-82   
gb|EEC77932.1|  hypothetical protein OsI_17271                          275   5e-82   Oryza sativa Indica Group [Indian rice]
emb|CAD41867.2|  OSJNBa0041A02.14                                       270   6e-82   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006368062.1|  PREDICTED: protein notum homolog                   268   6e-82   
gb|EYU37455.1|  hypothetical protein MIMGU_mgv1a007934mg                270   8e-82   
ref|NP_001053773.1|  Os04g0602500                                       272   9e-82   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004953590.1|  PREDICTED: protein notum homolog isoform X1        270   1e-81   
ref|XP_009108427.1|  PREDICTED: protein notum homolog                   270   1e-81   
emb|CDP15690.1|  unnamed protein product                                270   2e-81   
ref|XP_010439720.1|  PREDICTED: uncharacterized protein LOC104723107    269   2e-81   
gb|AFK37852.1|  unknown                                                 269   2e-81   
ref|XP_010529277.1|  PREDICTED: protein notum homolog                   269   2e-81   
gb|KCW72722.1|  hypothetical protein EUGRSUZ_E01170                     269   2e-81   
ref|XP_008355284.1|  PREDICTED: uncharacterized protein LOC103418943    269   2e-81   
ref|XP_008378614.1|  PREDICTED: uncharacterized protein LOC103441693    269   2e-81   
ref|XP_009616254.1|  PREDICTED: protein notum homolog                   269   2e-81   
ref|XP_010325632.1|  PREDICTED: protein notum homolog isoform X1        269   2e-81   
ref|NP_567585.1|  pectinacetylesterase family protein                   269   2e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010677539.1|  PREDICTED: protein notum homolog isoform X2        268   3e-81   
ref|XP_010235850.1|  PREDICTED: protein notum homolog isoform X1        268   4e-81   
gb|KCW72721.1|  hypothetical protein EUGRSUZ_E01170                     268   4e-81   
ref|XP_002867940.1|  hypothetical protein ARALYDRAFT_492921             268   4e-81   
ref|XP_004300392.1|  PREDICTED: protein notum homolog                   268   6e-81   
ref|XP_004244767.2|  PREDICTED: protein notum homolog                   268   6e-81   
ref|XP_008808368.1|  PREDICTED: uncharacterized protein LOC103720...    268   6e-81   
ref|XP_011082152.1|  PREDICTED: protein notum homolog isoform X2        267   6e-81   
ref|XP_008808367.1|  PREDICTED: uncharacterized protein LOC103720...    268   7e-81   
ref|XP_010676220.1|  PREDICTED: uncharacterized protein LOC104892094    269   7e-81   
ref|XP_002865253.1|  pectin acetylesterase                              267   1e-80   
ref|XP_010244169.1|  PREDICTED: protein notum homolog                   267   1e-80   
ref|XP_006283887.1|  hypothetical protein CARUB_v10005004mg             266   1e-80   
ref|XP_007040902.1|  Pectinacetylesterase family protein                267   1e-80   
gb|EYU37453.1|  hypothetical protein MIMGU_mgv1a007583mg                267   1e-80   
ref|XP_006361594.1|  PREDICTED: protein notum homolog                   270   2e-80   
ref|NP_001151183.1|  LOC100284816 precursor                             266   2e-80   Zea mays [maize]
gb|EEE61621.1|  hypothetical protein OsJ_16047                          274   2e-80   Oryza sativa Japonica Group [Japonica rice]
emb|CAA67728.1|  pectinacetylesterase precursor                         266   3e-80   Vigna radiata var. radiata [golden gram]
ref|XP_006385137.1|  hypothetical protein POPTR_0004s24220g             266   3e-80   
gb|ACG39759.1|  carboxylic ester hydrolase                              266   3e-80   Zea mays [maize]
ref|XP_003628995.1|  Notum-like protein                                 266   4e-80   
ref|XP_011028483.1|  PREDICTED: uncharacterized protein LOC105128...    267   4e-80   
gb|ABK24433.1|  unknown                                                 266   4e-80   Picea sitchensis
gb|KEH20327.1|  pectinacetylesterase family protein                     266   4e-80   
gb|ABK24994.1|  unknown                                                 266   4e-80   Picea sitchensis
ref|XP_006413981.1|  hypothetical protein EUTSA_v10024796mg             271   4e-80   
ref|XP_006385138.1|  hypothetical protein POPTR_0004s24220g             266   4e-80   
ref|NP_974575.2|  putative pectinacetylesterase                         264   5e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004244443.1|  PREDICTED: uncharacterized protein LOC101251798    265   7e-80   
ref|XP_008347803.1|  PREDICTED: uncharacterized protein LOC103410929    265   7e-80   
ref|XP_006385134.1|  hypothetical protein POPTR_0004s24220g             266   8e-80   
ref|XP_010244170.1|  PREDICTED: uncharacterized protein LOC104588061    265   8e-80   
gb|AET03471.2|  pectinacetylesterase family protein                     266   8e-80   
gb|AAM65412.1|  pectin acetylesterase                                   265   9e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004300391.1|  PREDICTED: protein notum homolog                   265   9e-80   
ref|XP_004970861.1|  PREDICTED: protein notum homolog                   265   9e-80   
ref|XP_010266380.1|  PREDICTED: uncharacterized protein LOC104603...    265   1e-79   
ref|XP_006280604.1|  hypothetical protein CARUB_v10026563mg             264   1e-79   
ref|NP_199341.1|  pectinacetylesterase family protein                   264   1e-79   Arabidopsis thaliana [mouse-ear cress]
gb|AAP72959.1|  pectin acetylesterase                                   264   1e-79   Lactuca sativa [cultivated lettuce]
ref|XP_006361581.1|  PREDICTED: protein notum homolog                   264   1e-79   
gb|KDO40409.1|  hypothetical protein CISIN_1g016608mg                   263   1e-79   
ref|XP_006363883.1|  PREDICTED: uncharacterized protein LOC102589191    266   2e-79   
gb|KHG23648.1|  Notum                                                   264   2e-79   
ref|NP_001190770.1|  pectinacetylesterase family protein                268   2e-79   
ref|XP_008365238.1|  PREDICTED: uncharacterized protein LOC103428882    261   2e-79   
ref|XP_008808370.1|  PREDICTED: uncharacterized protein LOC103720...    264   2e-79   
ref|XP_009398466.1|  PREDICTED: protein notum homolog                   264   2e-79   
gb|ACJ85294.1|  unknown                                                 263   2e-79   Medicago truncatula
ref|XP_008373438.1|  PREDICTED: protein notum homolog isoform X1        266   3e-79   
ref|XP_006398195.1|  hypothetical protein EUTSA_v10000914mg             263   3e-79   
ref|XP_010325697.1|  PREDICTED: uncharacterized protein LOC101260962    269   3e-79   
ref|XP_010494620.1|  PREDICTED: uncharacterized protein LOC104771742    263   4e-79   
ref|XP_007209211.1|  hypothetical protein PRUPE_ppa006668mg             263   4e-79   
ref|XP_011028482.1|  PREDICTED: uncharacterized protein LOC105128...    266   4e-79   
ref|XP_010441760.1|  PREDICTED: uncharacterized protein LOC104724893    263   5e-79   
ref|XP_011028479.1|  PREDICTED: uncharacterized protein LOC105128...    266   6e-79   
ref|XP_010481611.1|  PREDICTED: uncharacterized protein LOC104760390    263   6e-79   
ref|XP_007156330.1|  hypothetical protein PHAVU_003G277500g             263   6e-79   
gb|AFK45147.1|  unknown                                                 262   7e-79   
ref|XP_008373439.1|  PREDICTED: protein notum homolog isoform X2        263   1e-78   
ref|XP_007156331.1|  hypothetical protein PHAVU_003G277500g             263   1e-78   
ref|XP_006363875.1|  PREDICTED: protein notum homolog                   262   1e-78   
ref|XP_007051327.1|  Pectinacetylesterase family protein                263   2e-78   
gb|KHG30410.1|  Protein notum                                           262   2e-78   
gb|AGT16732.1|  carboxylic ester hydrolase                              261   2e-78   
emb|CDY67801.1|  BnaAnng25210D                                          261   2e-78   
ref|XP_008673121.1|  PREDICTED: uncharacterized protein LOC100382...    262   2e-78   
emb|CDY26383.1|  BnaA02g23870D                                          261   3e-78   
ref|XP_003518126.1|  PREDICTED: protein notum homolog                   261   4e-78   
ref|XP_010266381.1|  PREDICTED: uncharacterized protein LOC104603...    260   4e-78   
gb|EYU37448.1|  hypothetical protein MIMGU_mgv1a007102mg                261   5e-78   
ref|XP_010536210.1|  PREDICTED: uncharacterized protein LOC104811251    259   6e-78   
ref|XP_006444639.1|  hypothetical protein CICLE_v10020385mg             260   7e-78   
ref|XP_010266384.1|  PREDICTED: uncharacterized protein LOC104603...    259   9e-78   
emb|CDX87799.1|  BnaC02g31500D                                          259   9e-78   
ref|XP_009128780.1|  PREDICTED: uncharacterized protein LOC103853624    259   1e-77   
gb|KDP28360.1|  hypothetical protein JCGZ_14131                         261   1e-77   
ref|XP_009407792.1|  PREDICTED: protein notum homolog                   260   1e-77   
ref|XP_004512351.1|  PREDICTED: protein notum homolog isoform X3        261   1e-77   
ref|XP_008227765.1|  PREDICTED: protein notum homolog isoform X2        260   1e-77   
ref|XP_008238012.1|  PREDICTED: protein notum homolog isoform X2        259   1e-77   
ref|XP_010235852.1|  PREDICTED: protein notum homolog isoform X2        257   2e-77   
ref|XP_006492439.1|  PREDICTED: protein notum homolog                   260   2e-77   
dbj|BAD94756.1|  putative pectinacetylesterase protein                  255   2e-77   Arabidopsis thaliana [mouse-ear cress]
gb|KDO40416.1|  hypothetical protein CISIN_1g013734mg                   256   2e-77   
ref|XP_003561153.1|  PREDICTED: protein notum homolog                   258   2e-77   
ref|XP_009408703.1|  PREDICTED: protein notum homolog                   258   3e-77   
ref|XP_008227764.1|  PREDICTED: protein notum homolog isoform X1        261   3e-77   
ref|XP_010266383.1|  PREDICTED: uncharacterized protein LOC104603...    259   3e-77   
gb|KHG13045.1|  Protein notum                                           260   3e-77   
ref|XP_004512349.1|  PREDICTED: protein notum homolog isoform X1        261   4e-77   
ref|XP_007221559.1|  hypothetical protein PRUPE_ppa006038mg             258   9e-77   
ref|XP_009612887.1|  PREDICTED: uncharacterized protein LOC104106115    256   1e-76   
ref|XP_002454426.1|  hypothetical protein SORBIDRAFT_04g030720          256   1e-76   Sorghum bicolor [broomcorn]
ref|XP_004248530.1|  PREDICTED: protein notum homolog isoform X2        257   1e-76   
ref|XP_008667853.1|  PREDICTED: hypothetical protein isoform X1         256   2e-76   
ref|XP_010544918.1|  PREDICTED: protein notum homolog isoform X2        257   2e-76   
tpg|DAA36173.1|  TPA: hypothetical protein ZEAMMB73_990456              255   2e-76   
ref|XP_009407790.1|  PREDICTED: protein notum homolog                   257   2e-76   
ref|XP_006432878.1|  hypothetical protein CICLE_v100013712mg            252   2e-76   
ref|XP_004509524.1|  PREDICTED: uncharacterized protein LOC101493...    253   2e-76   
gb|EMT14315.1|  hypothetical protein F775_08483                         256   2e-76   
ref|XP_006385136.1|  hypothetical protein POPTR_0004s24220g             256   2e-76   
gb|ADE77373.1|  unknown                                                 256   2e-76   
ref|XP_004304922.1|  PREDICTED: protein notum homolog                   256   3e-76   
ref|XP_010045528.1|  PREDICTED: protein notum homolog                   256   3e-76   
ref|XP_004953591.1|  PREDICTED: protein notum homolog isoform X2        253   3e-76   
ref|XP_003565180.2|  PREDICTED: uncharacterized protein LOC100841...    259   3e-76   
ref|XP_010544917.1|  PREDICTED: protein notum homolog isoform X1        258   3e-76   
ref|XP_009589853.1|  PREDICTED: uncharacterized protein LOC104087...    255   3e-76   
ref|XP_008810598.1|  PREDICTED: protein notum homolog                   256   3e-76   
ref|XP_002458902.1|  hypothetical protein SORBIDRAFT_03g042380          254   3e-76   Sorghum bicolor [broomcorn]
ref|XP_009142580.1|  PREDICTED: protein notum homolog                   256   4e-76   
ref|XP_010054028.1|  PREDICTED: uncharacterized protein LOC104442...    255   5e-76   
ref|XP_009619780.1|  PREDICTED: uncharacterized protein LOC104111729    254   6e-76   
ref|XP_009610135.1|  PREDICTED: protein notum homolog                   256   6e-76   
ref|XP_008238011.1|  PREDICTED: protein notum homolog isoform X1        254   9e-76   
emb|CDY41569.1|  BnaC04g00530D                                          255   1e-75   
ref|XP_004970864.1|  PREDICTED: protein notum homolog isoform X1        255   1e-75   
ref|XP_008656990.1|  PREDICTED: protein notum homolog isoform X2        255   1e-75   
ref|XP_010233620.1|  PREDICTED: protein notum homolog                   254   1e-75   
ref|XP_004970862.1|  PREDICTED: protein notum homolog                   254   2e-75   
ref|XP_009759657.1|  PREDICTED: uncharacterized protein LOC104212153    254   2e-75   
ref|XP_002515160.1|  pectin acetylesterase, putative                    254   2e-75   Ricinus communis
ref|XP_010111521.1|  hypothetical protein L484_021346                   253   2e-75   
dbj|BAJ89162.1|  predicted protein                                      254   2e-75   
ref|XP_004251486.1|  PREDICTED: uncharacterized protein LOC101264402    253   2e-75   
ref|XP_007205243.1|  hypothetical protein PRUPE_ppa006114mg             254   2e-75   
dbj|BAJ95183.1|  predicted protein                                      253   3e-75   
ref|XP_010327277.1|  PREDICTED: protein notum homolog isoform X1        253   3e-75   
ref|XP_004494487.1|  PREDICTED: protein notum homolog isoform X3        253   4e-75   
gb|AFK38038.1|  unknown                                                 253   4e-75   
tpg|DAA36176.1|  TPA: pectinacetylesterase                              256   5e-75   
gb|EMT09212.1|  hypothetical protein F775_13462                         253   5e-75   
ref|XP_006338904.1|  PREDICTED: protein notum homolog isoform X1        253   5e-75   
ref|XP_009771487.1|  PREDICTED: protein notum homolog                   252   6e-75   
ref|XP_006367726.1|  PREDICTED: uncharacterized protein LOC102600035    251   6e-75   
gb|EMS61917.1|  hypothetical protein TRIUR3_01659                       253   6e-75   
ref|XP_003536006.1|  PREDICTED: uncharacterized protein LOC100810716    253   7e-75   
ref|XP_004494486.1|  PREDICTED: protein notum homolog isoform X2        253   8e-75   
ref|XP_009779872.1|  PREDICTED: protein notum homolog                   253   9e-75   
ref|XP_010240825.1|  PREDICTED: protein notum homolog                   252   9e-75   
ref|XP_004494485.1|  PREDICTED: protein notum homolog isoform X1        253   1e-74   
ref|XP_009776987.1|  PREDICTED: uncharacterized protein LOC104226...    251   2e-74   
ref|XP_006604768.1|  PREDICTED: protein notum homolog isoform X2        251   2e-74   
ref|XP_004970863.1|  PREDICTED: protein notum homolog                   252   2e-74   
gb|ABR16604.1|  unknown                                                 252   2e-74   
ref|XP_008656989.1|  PREDICTED: protein notum homolog isoform X1        251   2e-74   
ref|XP_002880274.1|  hypothetical protein ARALYDRAFT_483863             251   3e-74   
emb|CBI26039.3|  unnamed protein product                                249   3e-74   
ref|XP_004495849.1|  PREDICTED: protein notum homolog isoform X1        251   3e-74   
ref|XP_006397884.1|  hypothetical protein EUTSA_v10001449mg             252   3e-74   
gb|KDO86754.1|  hypothetical protein CISIN_1g014548mg                   251   3e-74   
emb|CBI39680.3|  unnamed protein product                                249   3e-74   
ref|XP_002320250.2|  hypothetical protein POPTR_0014s10650g             252   3e-74   
ref|XP_009590664.1|  PREDICTED: uncharacterized protein LOC104087...    249   4e-74   
ref|XP_006351092.1|  PREDICTED: protein notum homolog                   248   4e-74   
ref|XP_003626089.1|  Pectin acetylesterase                              250   4e-74   
ref|XP_004970868.1|  PREDICTED: protein notum homolog isoform X5        248   5e-74   
ref|XP_003554582.1|  PREDICTED: protein notum homolog isoform X1        252   5e-74   
ref|XP_007145083.1|  hypothetical protein PHAVU_007G208200g             251   5e-74   
ref|NP_851135.1|  pectinacetylesterase family protein                   249   5e-74   
ref|XP_008246333.1|  PREDICTED: uncharacterized protein LOC103344...    251   5e-74   
ref|XP_003609911.1|  Pectin acetylesterase                              250   5e-74   
ref|XP_006363510.1|  PREDICTED: uncharacterized protein LOC102583822    249   6e-74   
ref|XP_009776988.1|  PREDICTED: uncharacterized protein LOC104226...    249   6e-74   
gb|KHN43400.1|  Protein notum like                                      252   6e-74   
gb|KHG23649.1|  Notum                                                   249   7e-74   
ref|XP_007163258.1|  hypothetical protein PHAVU_001G219200g             249   7e-74   
gb|KEH43170.1|  pectinacetylesterase family protein                     249   7e-74   
ref|XP_009603747.1|  PREDICTED: protein notum homolog isoform X1        249   8e-74   
ref|XP_011039993.1|  PREDICTED: uncharacterized protein LOC105136378    251   9e-74   
ref|XP_006293476.1|  hypothetical protein CARUB_v10023292mg             250   9e-74   
ref|XP_003626088.1|  Pectin acetylesterase                              251   1e-73   
gb|AFK42918.1|  unknown                                                 249   1e-73   
ref|XP_009763242.1|  PREDICTED: protein notum homolog isoform X1        248   1e-73   
emb|CDM87215.1|  unnamed protein product                                249   1e-73   
ref|XP_002279030.1|  PREDICTED: protein notum homolog                   249   1e-73   
ref|XP_006423958.1|  hypothetical protein CICLE_v10028674mg             248   1e-73   
emb|CAN62190.1|  hypothetical protein VITISV_020113                     249   1e-73   
ref|XP_002275616.1|  PREDICTED: protein notum homolog isoform X1        249   2e-73   
gb|KHN14241.1|  Protein notum like                                      249   2e-73   
ref|XP_009335553.1|  PREDICTED: uncharacterized protein LOC103928...    249   2e-73   
ref|XP_007163257.1|  hypothetical protein PHAVU_001G219200g             250   2e-73   
ref|XP_004508066.1|  PREDICTED: protein notum homolog                   249   2e-73   
ref|XP_008363956.1|  PREDICTED: protein notum homolog                   248   2e-73   
ref|XP_002280865.3|  PREDICTED: protein notum homolog                   248   3e-73   
gb|KHG09455.1|  Protein notum                                           248   3e-73   
ref|XP_002280816.3|  PREDICTED: protein notum homolog                   248   3e-73   
emb|CBI37039.3|  unnamed protein product                                247   3e-73   
ref|XP_009353455.1|  PREDICTED: protein notum homolog                   248   3e-73   
ref|XP_004970866.1|  PREDICTED: protein notum homolog isoform X3        246   3e-73   
ref|NP_182216.1|  pectinacetylesterase-like protein                     248   4e-73   
ref|XP_007154511.1|  hypothetical protein PHAVU_003G124700g             248   4e-73   
ref|XP_009626489.1|  PREDICTED: protein notum homolog isoform X1        247   4e-73   
ref|XP_006604776.1|  PREDICTED: protein notum homolog isoform X1        248   4e-73   
ref|XP_010546781.1|  PREDICTED: protein notum homolog                   248   4e-73   
ref|XP_010507953.1|  PREDICTED: protein notum homolog                   248   4e-73   
ref|XP_010506713.1|  PREDICTED: protein notum homolog isoform X1        248   5e-73   
ref|XP_010070108.1|  PREDICTED: protein notum homolog                   248   5e-73   
ref|XP_010266386.1|  PREDICTED: uncharacterized protein LOC104603...    246   5e-73   
ref|XP_003536008.1|  PREDICTED: protein notum homolog isoform X1        248   5e-73   
ref|XP_006480336.1|  PREDICTED: protein notum homolog                   248   6e-73   
ref|XP_004288665.1|  PREDICTED: protein notum homolog                   249   6e-73   
ref|XP_008388414.1|  PREDICTED: protein notum homolog                   247   7e-73   
ref|XP_008246335.1|  PREDICTED: uncharacterized protein LOC103344...    247   9e-73   
ref|XP_011082153.1|  PREDICTED: protein notum homolog                   246   9e-73   
ref|XP_010518382.1|  PREDICTED: protein notum homolog isoform X1        247   1e-72   
ref|XP_010999345.1|  PREDICTED: protein notum homolog isoform X2        247   1e-72   
gb|KHG26188.1|  Protein notum                                           247   1e-72   
ref|XP_006359967.1|  PREDICTED: protein notum homolog                   246   1e-72   
gb|KHN14181.1|  Protein notum like                                      247   1e-72   
gb|KHN14201.1|  Protein notum like                                      247   1e-72   
ref|XP_002447050.1|  hypothetical protein SORBIDRAFT_06g027560          246   1e-72   
ref|XP_003521640.1|  PREDICTED: protein notum homolog                   246   2e-72   
ref|XP_011074219.1|  PREDICTED: protein notum homolog                   245   2e-72   
gb|EYU37452.1|  hypothetical protein MIMGU_mgv1a007583mg                243   2e-72   
gb|KFK37453.1|  hypothetical protein AALP_AA4G259200                    246   2e-72   
ref|XP_006646555.1|  PREDICTED: protein notum homolog                   246   2e-72   
ref|XP_003551008.1|  PREDICTED: protein notum homolog                   246   2e-72   
ref|XP_008246334.1|  PREDICTED: protein notum homolog isoform X2        246   2e-72   
ref|XP_003555771.1|  PREDICTED: uncharacterized protein LOC100793403    246   3e-72   
ref|XP_010914805.1|  PREDICTED: protein notum homolog                   245   3e-72   
ref|XP_008360208.1|  PREDICTED: protein notum homolog isoform X3        246   3e-72   
ref|XP_010674458.1|  PREDICTED: protein notum homolog                   244   3e-72   
dbj|BAK01215.1|  predicted protein                                      246   4e-72   
emb|CBI37040.3|  unnamed protein product                                248   4e-72   
ref|XP_009794027.1|  PREDICTED: uncharacterized protein LOC104240572    244   5e-72   
ref|XP_003521625.1|  PREDICTED: protein notum homolog isoformX1         245   5e-72   
gb|AFK45877.1|  unknown                                                 245   5e-72   
gb|EEC71940.1|  hypothetical protein OsI_04754                          244   6e-72   
ref|XP_006378039.1|  hypothetical protein POPTR_0010s00700g             245   6e-72   
ref|XP_010524828.1|  PREDICTED: protein notum homolog                   244   7e-72   
ref|XP_007222071.1|  hypothetical protein PRUPE_ppa007506mg             243   7e-72   
ref|XP_010914803.1|  PREDICTED: protein notum homolog isoform X1        244   8e-72   
tpg|DAA56406.1|  TPA: hypothetical protein ZEAMMB73_392919              246   8e-72   
ref|XP_010054026.1|  PREDICTED: uncharacterized protein LOC104442...    245   8e-72   
ref|XP_008450496.1|  PREDICTED: protein notum homolog                   244   8e-72   
ref|XP_009589854.1|  PREDICTED: uncharacterized protein LOC104087...    241   1e-71   
ref|XP_010511331.1|  PREDICTED: protein notum homolog                   244   1e-71   
ref|XP_009771153.1|  PREDICTED: uncharacterized protein LOC104221731    248   1e-71   
ref|XP_006402417.1|  hypothetical protein EUTSA_v10005997mg             244   1e-71   
ref|XP_006577186.1|  PREDICTED: protein notum homolog isoform X2        245   1e-71   
ref|XP_007145058.1|  hypothetical protein PHAVU_007G206300g             244   1e-71   
gb|KDP23324.1|  hypothetical protein JCGZ_23157                         244   2e-71   
ref|XP_004968122.1|  PREDICTED: protein notum homolog isoform X1        244   2e-71   
ref|XP_006385140.1|  hypothetical protein POPTR_0004s24220g             241   2e-71   
emb|CDY19761.1|  BnaA09g04140D                                          243   2e-71   
gb|KDO86755.1|  hypothetical protein CISIN_1g014548mg                   240   3e-71   
ref|XP_002512590.1|  pectin acetylesterase, putative                    243   3e-71   
ref|XP_004304921.1|  PREDICTED: protein notum homolog                   243   3e-71   
gb|EYU37449.1|  hypothetical protein MIMGU_mgv1a011392mg                239   3e-71   
ref|XP_009116880.1|  PREDICTED: protein notum homolog                   243   3e-71   
ref|XP_009335552.1|  PREDICTED: protein notum homolog isoform X1        243   3e-71   
gb|KHN45022.1|  Protein notum like                                      243   3e-71   
ref|XP_004246219.1|  PREDICTED: protein notum homolog                   242   3e-71   
gb|EMS61914.1|  hypothetical protein TRIUR3_01654                       240   3e-71   
ref|XP_004135578.1|  PREDICTED: protein notum homolog                   243   3e-71   
gb|ABG34283.1|  pectin acetylesterase                                   241   4e-71   
ref|XP_008388417.1|  PREDICTED: uncharacterized protein LOC103450...    243   4e-71   
gb|KFK26428.1|  hypothetical protein AALP_AA8G247000                    243   4e-71   
gb|KDO40412.1|  hypothetical protein CISIN_1g013734mg                   241   5e-71   
ref|XP_006593986.1|  PREDICTED: protein notum homolog isoform X3        243   5e-71   
ref|XP_009344788.1|  PREDICTED: protein notum homolog                   244   5e-71   
ref|XP_008369575.1|  PREDICTED: protein notum homolog isoform X2        243   5e-71   
ref|XP_003542396.2|  PREDICTED: protein notum homolog isoform X1        242   5e-71   
ref|XP_008222318.1|  PREDICTED: protein notum homolog                   243   5e-71   
emb|CDX80575.1|  BnaC07g28690D                                          242   6e-71   
ref|NP_850878.2|  pectinacetylesterase family protein                   242   6e-71   
ref|XP_009138739.1|  PREDICTED: protein notum homolog isoform X2        242   6e-71   
ref|XP_003565721.1|  PREDICTED: protein notum homolog                   242   6e-71   
ref|XP_009768293.1|  PREDICTED: protein notum homolog                   243   6e-71   
ref|XP_006593985.1|  PREDICTED: protein notum homolog isoform X2        243   6e-71   
ref|XP_006291204.1|  hypothetical protein CARUB_v10017332mg             242   6e-71   
ref|XP_009151150.1|  PREDICTED: protein notum homolog                   242   6e-71   
gb|AGT17273.1|  hypothetical protein SHCRBa_020_L15_F_100               241   6e-71   
dbj|BAH19826.1|  AT5G26670                                              242   7e-71   
ref|XP_011074200.1|  PREDICTED: protein notum homolog                   241   7e-71   
dbj|BAD87540.1|  putative pectinacetylesterase precursor                242   8e-71   
ref|NP_191765.2|  pectinacetylesterase family protein                   242   8e-71   
gb|EAY76796.1|  hypothetical protein OsI_04753                          242   8e-71   
gb|KFK35390.1|  hypothetical protein AALP_AA5G279000                    242   8e-71   
ref|XP_011092213.1|  PREDICTED: protein notum homolog                   242   1e-70   
ref|XP_006840405.1|  hypothetical protein AMTR_s00045p00148030          243   1e-70   
ref|XP_008800308.1|  PREDICTED: protein notum homolog isoform X1        241   1e-70   
ref|XP_002894676.1|  hypothetical protein ARALYDRAFT_474842             242   1e-70   
emb|CDX87039.1|  BnaC09g03540D                                          241   1e-70   
gb|EMS59699.1|  hypothetical protein TRIUR3_12152                       240   1e-70   
ref|NP_001141895.1|  uncharacterized protein LOC100274042 precursor     241   1e-70   
ref|XP_002461086.1|  hypothetical protein SORBIDRAFT_02g040470          241   1e-70   
ref|XP_007154510.1|  hypothetical protein PHAVU_003G124700g             242   1e-70   
ref|XP_006658006.1|  PREDICTED: protein notum homolog                   241   2e-70   
ref|XP_009363058.1|  PREDICTED: LOW QUALITY PROTEIN: protein notu...    243   2e-70   
ref|XP_007163281.1|  hypothetical protein PHAVU_001G221400g             241   2e-70   
ref|XP_009600844.1|  PREDICTED: protein notum homolog                   241   2e-70   
ref|XP_002876658.1|  pectinacetylesterase family protein                241   2e-70   
ref|XP_009138738.1|  PREDICTED: protein notum homolog isoform X1        242   2e-70   
gb|AFK35535.1|  unknown                                                 241   2e-70   
emb|CDY58759.1|  BnaA04g27440D                                          242   2e-70   
ref|XP_006302295.1|  hypothetical protein CARUB_v10020343mg             241   2e-70   
tpg|DAA54427.1|  TPA: carboxylic ester hydrolase                        241   2e-70   
ref|XP_006408013.1|  hypothetical protein EUTSA_v10020818mg             241   2e-70   
ref|XP_009359821.1|  PREDICTED: protein notum homolog                   241   3e-70   
ref|XP_007031285.1|  Pectinacetylesterase family protein                241   3e-70   
ref|XP_010999344.1|  PREDICTED: protein notum homolog isoform X1        241   3e-70   
ref|XP_009805042.1|  PREDICTED: protein notum homolog                   241   3e-70   
emb|CDP15161.1|  unnamed protein product                                239   3e-70   
ref|XP_010421519.1|  PREDICTED: protein notum homolog                   240   3e-70   
ref|NP_001152013.1|  carboxylic ester hydrolase precursor               241   3e-70   
ref|XP_010512591.1|  PREDICTED: protein notum homolog                   241   3e-70   
ref|XP_008238015.1|  PREDICTED: protein notum homolog isoform X5        237   3e-70   
emb|CDX76613.1|  BnaC08g31990D                                          240   3e-70   
ref|XP_006646554.1|  PREDICTED: protein notum homolog                   239   4e-70   
ref|XP_010914807.1|  PREDICTED: protein notum homolog isoform X1        239   4e-70   
ref|XP_009111712.1|  PREDICTED: protein notum homolog                   240   4e-70   
ref|XP_011023896.1|  PREDICTED: protein notum homolog                   240   4e-70   
ref|XP_006358515.1|  PREDICTED: protein notum homolog                   240   4e-70   
ref|XP_002318919.2|  hypothetical protein POPTR_0013s00280g             240   4e-70   
gb|AAG50747.1|AC079733_15  pectinacetylesterase precursor, putative     240   4e-70   
ref|XP_006394896.1|  hypothetical protein EUTSA_v10004301mg             240   4e-70   
gb|EYU19372.1|  hypothetical protein MIMGU_mgv1a006907mg                238   5e-70   
gb|AAM74495.1|  At1g57590/T8L23_6                                       240   5e-70   
ref|XP_011087572.1|  PREDICTED: protein notum homolog isoform X1        240   5e-70   
ref|XP_010694126.1|  PREDICTED: protein notum homolog                   239   7e-70   
ref|NP_001060382.1|  Os07g0634600                                       239   8e-70   
ref|NP_176072.3|  pectinacetylesterase family protein                   240   9e-70   
emb|CDY11398.1|  BnaA09g39640D                                          239   1e-69   
ref|XP_010094916.1|  hypothetical protein L484_022666                   239   1e-69   
ref|XP_003562611.1|  PREDICTED: protein notum homolog                   239   1e-69   
ref|XP_008807933.1|  PREDICTED: protein notum homolog                   238   1e-69   
ref|XP_006392395.1|  hypothetical protein EUTSA_v10023485mg             239   1e-69   
gb|EMT00867.1|  hypothetical protein F775_21765                         242   1e-69   
ref|XP_004494501.1|  PREDICTED: uncharacterized protein LOC101497...    239   1e-69   
ref|XP_003566691.2|  PREDICTED: uncharacterized protein LOC100837473    240   1e-69   
ref|XP_004958440.1|  PREDICTED: protein notum homolog                   239   1e-69   
ref|XP_010325633.1|  PREDICTED: uncharacterized protein LOC101257...    238   1e-69   
ref|XP_008238014.1|  PREDICTED: protein notum homolog isoform X4        236   1e-69   
ref|XP_004960515.1|  PREDICTED: protein notum homolog                   239   1e-69   
ref|XP_010468989.1|  PREDICTED: protein notum homolog                   239   2e-69   
ref|XP_010493919.1|  PREDICTED: protein notum homolog                   238   2e-69   
ref|XP_008238013.1|  PREDICTED: protein notum homolog isoform X3        235   2e-69   
emb|CDY32190.1|  BnaCnng06990D                                          238   2e-69   
ref|XP_010455015.1|  PREDICTED: protein notum homolog                   238   2e-69   
ref|XP_009399871.1|  PREDICTED: uncharacterized protein LOC103984154    239   2e-69   
ref|XP_009366012.1|  PREDICTED: protein notum homolog                   238   2e-69   
ref|XP_008363955.1|  PREDICTED: protein notum homolog                   238   2e-69   
dbj|BAJ90066.1|  predicted protein                                      238   2e-69   
emb|CDX93989.1|  BnaC04g21480D                                          238   2e-69   
gb|EMT15342.1|  hypothetical protein F775_17167                         238   3e-69   
dbj|BAJ85221.1|  predicted protein                                      239   3e-69   
gb|EYU19373.1|  hypothetical protein MIMGU_mgv1a006907mg                238   3e-69   
ref|XP_010914804.1|  PREDICTED: protein notum homolog isoform X2        237   3e-69   
dbj|BAD87541.1|  putative pectinacetylesterase precursor                237   4e-69   
ref|XP_004230372.1|  PREDICTED: protein notum homolog                   238   4e-69   
gb|EEC71941.1|  hypothetical protein OsI_04755                          237   4e-69   
gb|KFK38001.1|  hypothetical protein AALP_AA3G057300                    238   4e-69   



>ref|XP_009799834.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=392

 Score =   299 bits (766),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 159/400 (40%), Positives = 228/400 (57%), Gaps = 24/400 (6%)
 Frame = +3

Query  93    MAVSPRSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLD  272
             M ++ R     CL++ SL I         I T    D   + + KTI++ A  KGAVCLD
Sbjct  1     MVMATRCLQLFCLIVCSLAI---------IKTESATDLDFYEVKKTIVKNAVSKGAVCLD  51

Query  273   GSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRM-GRELGSSFNM  449
             GSPPAYHF  G GE   NW + L GG WC S          VE C  R+   ++GS+  M
Sbjct  52    GSPPAYHFEPGFGEGVGNWFVQLAGGAWCTS----------VETCKERIRDNKVGSTTIM  101

Query  450   KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVV  626
              P  F+GI+  N++    FY WN+V+VRYCDGG+F GDVE  DP T L++RGARIF+ VV
Sbjct  102   GPFTFQGIYSKNQSANPDFYNWNKVLVRYCDGGAFTGDVEYVDPATNLHFRGARIFEAVV  161

Query  627   DELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEH  806
             ++++AKG+K+AKN I  G SAGG    ++CD F S  P   RVKC  D   F+  K+ + 
Sbjct  162   EDVLAKGLKNAKNAILAGSSAGGYPAMLYCDHFRSLLPNTPRVKCFVDGGYFIHAKNQKQ  221

Query  807   AKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQV  986
             A+ F+ +++ +V LH   K+LP  CTSKM P  C  P+N+ Q +K PLFI  SA+D FQ+
Sbjct  222   ARGFEEIYNGLVTLHGSGKTLPKSCTSKMKPLLCLFPENMQQNIKIPLFIAMSAFDIFQI  281

Query  987   QNTFPIDLYRAIKNGSSISPSDMALLQDFKKQIISALPKPSATK--GFIVTSNFGHSFAS  1160
               T   +L+  I+NG+  +  + A  ++F+ + +S LPKP+  K  G  + S   H+   
Sbjct  282   NTTVEPNLHDVIENGTCTTSQNKA-FREFRSEFLSTLPKPNNPKMRGVFIDSVNHHTSLL  340

Query  1161  NNYKKPMFADSKSKSIESGFYNWFFDKHPINLIDPNTVPI  1280
               +         + S+   F +W+FD+    +ID + +PI
Sbjct  341   TRWSPENATMINNLSLPKAFGDWYFDRKYWYVIDEHDLPI  380



>ref|XP_006355154.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=409

 Score =   296 bits (758),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 160/391 (41%), Positives = 227/391 (58%), Gaps = 21/391 (5%)
 Frame = +3

Query  123   ICLLIFSLVISVQYANVNPIPTPITEDYLD--FIIPKTIIQGADEKGAVCLDGSPPAYHF  296
             +CL I SL I    ++     TP    YLD  + + KTI++ A  KGAVCLDGSPPAYHF
Sbjct  9     LCLFICSLAIINTVSSTKENVTP----YLDEAYHVSKTIVKNAVSKGAVCLDGSPPAYHF  64

Query  297   SSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNMKPLIFKGIF  476
               G G+ A  WL+ L GG WC +          VE C  R   E GSS  M    F G+F
Sbjct  65    EPGFGDGAQTWLVQLSGGEWCRT----------VEACLERSKSEFGSSNLMNSWWFTGMF  114

Query  477   GMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMK  653
               N++    FY WN+V +RYCDGG F GDVE  DP TKL++RGARIF+ V+DEL+ KG+K
Sbjct  115   SKNQSGNPEFYNWNKVFIRYCDGGGFTGDVEYVDPATKLHFRGARIFKAVMDELLEKGLK  174

Query  654   DAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFS  833
              AK+ +  G SAGG    ++CD F +  P   RVKC++D+  F+  K+P  A  F  +++
Sbjct  175   TAKSALLGGSSAGGFPAMLYCDYFRTLLPNTPRVKCMNDAGYFINAKEPFRAN-FTELYT  233

Query  834   DVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFPIDLY  1013
              +V LH   K+LP ECTSKMSP  CF P+N+ QYVK+PLFI  SAYD +Q+ N+  + + 
Sbjct  234   ALVTLHGSAKALPKECTSKMSPELCFFPENMQQYVKTPLFIASSAYDKYQINNSIAVGIN  293

Query  1014  RAIKNGSSISPSDMALLQDFKKQIISALPKPS--ATKGFIVTSNFGHSFASNNYKKPMFA  1187
               I + +  + ++   L +F+ + ++ALPKP+    KG  + S   HS     +      
Sbjct  294   TCIGSSNCTATTNQTFL-EFRSRFLNALPKPTNPKLKGVFIDSFNHHSQVQFWWSPFNIT  352

Query  1188  DSKSKSIESGFYNWFFDKHPINLIDPNTVPI  1280
                + ++   F +WF+D++   +I  + +PI
Sbjct  353   TINNLTLSKAFADWFYDRNYTYVIHEHELPI  383



>ref|XP_009605804.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=385

 Score =   293 bits (751),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 156/400 (39%), Positives = 230/400 (58%), Gaps = 24/400 (6%)
 Frame = +3

Query  93    MAVSPRSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLD  272
             M ++ R+    CLL+ SL I         I +   +D   + + KTI++ A  KGAVCLD
Sbjct  1     MVMATRTLHLFCLLVCSLAI---------IKSECAKDLGSYNVTKTILKNAVSKGAVCLD  51

Query  273   GSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRM-GRELGSSFNM  449
             GSPPAYHF  G G+   NW++ L GG WC +          V+ C  R+  + +GS+   
Sbjct  52    GSPPAYHFEPGFGKGIGNWIVQLSGGAWCTN----------VKECQDRIWDKNVGSTNFT  101

Query  450   KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVV  626
                 F+GI+  N      FY WN+V VRYCDGG+F GDVE  D VT L++RGARIF+  +
Sbjct  102   DSWNFQGIYSENSTANPDFYNWNKVFVRYCDGGAFTGDVEYVDHVTNLHFRGARIFEAAM  161

Query  627   DELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEH  806
             +EL+AKG+K+AKN I  G SAGG    ++CD F S  P  +RVKCL DS  F+  K+P  
Sbjct  162   EELLAKGLKNAKNAILAGSSAGGYPTMLYCDHFRSLLPNTLRVKCLVDSGYFIHAKNPMQ  221

Query  807   AKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQV  986
             A+ F+ +++ ++ LH   K+LP  CTSKM+P  CF P+N+ Q++K+PLFI  SA+D +Q+
Sbjct  222   ARGFEKIYNSLLTLHGSTKALPKSCTSKMNPLLCFFPENMQQHIKTPLFIAMSAFDYYQM  281

Query  987   QNTFPIDLYRAIKNGSSISPSDMALLQDFKKQIISALPKPSATK--GFIVTSNFGHSFAS  1160
             + T   +  R ++N +     + A  ++F+ + +SALPK +  K  G  + S   HS  S
Sbjct  282   KTTIDPNADRCVENRTCTERQNKA-FREFRSEFLSALPKSNNPKLRGVFIDSVIHHSALS  340

Query  1161  NNYKKPMFADSKSKSIESGFYNWFFDKHPINLIDPNTVPI  1280
               +         + S    F +W+FD+    +ID + +PI
Sbjct  341   YRWTLENAIMINNLSAPKAFADWYFDRKYWYVIDKHDLPI  380



>ref|XP_009600038.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=370

 Score =   293 bits (749),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 148/344 (43%), Positives = 208/344 (60%), Gaps = 22/344 (6%)
 Frame = +3

Query  93    MAVSPRSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLD  272
             M ++ RS    CL++ SL I         I T    D   + + KTI++ A  KGAVCLD
Sbjct  1     MVMATRSLQLFCLIVCSLAI---------IKTESATDLDFYEVKKTIVKNAVSKGAVCLD  51

Query  273   GSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSR-MGRELGSSFNM  449
             GSPPAYHF  G GE   NW + L GG WC S          VE C  R    ++GS+  M
Sbjct  52    GSPPAYHFEPGFGEGVENWFVQLSGGAWCTS----------VEACKDRSRDNKVGSTTTM  101

Query  450   KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVV  626
              P  F+GI+  N++    FY WN+V+VRYCDGG+F GDVE  DP T L++RGARIF+ V+
Sbjct  102   GPYTFQGIYSKNQSANPDFYNWNKVLVRYCDGGAFTGDVEYVDPATNLHFRGARIFEAVM  161

Query  627   DELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEH  806
             ++++AKG+K+AKN I  G SAGG    ++CDRF S  P   RVKC  D+  F+  K+ + 
Sbjct  162   EDVLAKGLKNAKNAILAGSSAGGYPAMLYCDRFRSLLPNTPRVKCFVDAGYFIHAKNQKQ  221

Query  807   AKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQV  986
             A+ F+ +++ +V LH   K+LP  CTSKM P  CF P+++ Q +K+PLFI  SA+D FQ+
Sbjct  222   ARGFEDIYNTLVTLHGSAKTLPKSCTSKMKPLLCFFPESMQQNIKTPLFIAMSAFDIFQI  281

Query  987   QNTFPIDLYRAIKNGSSISPSDMALLQDFKKQIISALPKPSATK  1118
               T    L+  I+NG+  +  + A  ++F+ + +S LPKP+  K
Sbjct  282   NTTVEPHLHDVIENGTCTTSQNKA-FREFRSEFLSTLPKPNNPK  324



>ref|XP_009601364.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=392

 Score =   292 bits (747),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 158/386 (41%), Positives = 219/386 (57%), Gaps = 29/386 (8%)
 Frame = +3

Query  120   WICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHFS  299
             W   +IF L+ SV       +P  +          KT++Q A  KGAVCLDGSP AYH+ 
Sbjct  8     WYQWIIFLLICSVMKVKAEVLPNKVA---------KTLVQDAFSKGAVCLDGSPAAYHYD  58

Query  300   SGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNMKPLIFKGIFG  479
              G G+  +NW+++L+GGGWC            VE+C  R     G S +M    F G+  
Sbjct  59    KGYGDGVNNWVVWLEGGGWCKR----------VEDCGRRFNYSNGFSNHMDSKSFYGLLS  108

Query  480   MNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKD  656
              ++     FY W+R+++RYCDG S+ GDVE  D  T  +YRGARIFQ +++EL+AKGMK+
Sbjct  109   NSKTSNPEFYNWHRIMIRYCDGSSYTGDVELVDKATNQHYRGARIFQAIMEELLAKGMKN  168

Query  657   AKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFSD  836
             AKN I  G SAGGLG   HCDRF S  P  VRVKCLSD + FL+  D + AK  ++ +  
Sbjct  169   AKNAILSGCSAGGLGTMFHCDRFRSLLPSTVRVKCLSDGAYFLLDNDFKRAKILESTYRG  228

Query  837   VVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFPIDLYR  1016
             VV LH   K LP  CTS+M+P  CF P+++ Q +K+PLFI +SAYDS+Q+ +T      R
Sbjct  229   VVNLHNSAKMLPPSCTSRMNPTSCFFPQHIQQDIKTPLFILNSAYDSWQIVDTVIPFADR  288

Query  1017  ------AIKNGSSISPSDMALLQDFKKQIISALPK--PSATKGFIVTSNFGHSFASNNYK  1172
                     KN S  SP    +LQ F  + +SALPK    + +G  + S   H    +++ 
Sbjct  289   QDFAENCKKNLSKCSPDQQKMLQGFGAEFLSALPKSYSPSQRGMYINSCLMHCQTDHDWS  348

Query  1173  KPMFAD-SKSKSIESGFYNWFFDKHP  1247
                 +D   +K+I   F +WFF++ P
Sbjct  349   WNSNSDLLNNKTIAKVFGDWFFERDP  374



>gb|EYU29129.1| hypothetical protein MIMGU_mgv1a023759mg [Erythranthe guttata]
Length=384

 Score =   291 bits (746),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 152/358 (42%), Positives = 207/358 (58%), Gaps = 23/358 (6%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  KGAVCLDGSPPAYH   G G+  +NWLI+L+GGGWC +          V  C
Sbjct  15    TYVESAVAKGAVCLDGSPPAYHLDKGSGDGTNNWLIHLEGGGWCNN----------VTTC  64

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR    LGSS +M    +F GI   +  +   FY WNRVVVRYCDG SF GD+E  DP 
Sbjct  65    ISRANGHLGSSKHMSNRTMFFGIANNDPQFNPDFYNWNRVVVRYCDGASFTGDIEAVDPA  124

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T LYYRGAR+F  V+++L+ KGMK+AKNVI  G SAGGL   +HCDRF    P G  VKC
Sbjct  125   TNLYYRGARVFVAVMEDLLDKGMKNAKNVILTGCSAGGLASMLHCDRFKDLLPMGTNVKC  184

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             ++D+  FL VKD    + F+   +DVV  H   K+LP+ CTSKM P  CF P+ +VQ ++
Sbjct  185   MADAGFFLNVKDVSGNRRFEDFINDVVETHGSAKNLPLSCTSKMKPGLCFFPQQVVQEIQ  244

Query  942   SPLFIFHSAYDSFQVQNTFPIDL-------YRAIKNGSSISPSDMALLQDFKKQIISALP  1100
             +PLFI ++AYD++Q++N     +       Y    +  + S + +  L  F+K+ ++   
Sbjct  245   TPLFIVNAAYDAWQIKNVLAPAIADPSGIWYNCTTDIRNCSTAQLQTLHGFRKEFLNEFS  304

Query  1101  K--PSATKGFIVTSNFGHSFASNN--YKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
                 S T+G+ + S F H        + KP      +K+I     +WFFD+ P   ID
Sbjct  305   AIGTSITRGYFINSCFAHCQTEMQITWFKPNSPKLNNKTIAKAVGDWFFDRSPFQTID  362



>ref|XP_009590663.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana tomentosiformis]
Length=401

 Score =   292 bits (747),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 160/399 (40%), Positives = 229/399 (57%), Gaps = 17/399 (4%)
 Frame = +3

Query  99    VSPRSNDWICLLIFSLVISVQYANVNPIPTPITEDYLD--FIIPKTIIQGADEKGAVCLD  272
             ++ RS   +CLLI S  I ++ A+     +   E  +D  + +  TI+Q A  KGAVCLD
Sbjct  1     MATRSVQLVCLLICSQAI-IKTASAKVNESFKQEKGIDHAYFVDTTIVQNALSKGAVCLD  59

Query  273   GSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNMK  452
             GSPPAYH   G G    NW+I L GG WC +          + +C +R   +LGSS +M 
Sbjct  60    GSPPAYHLDRGFGHGVRNWIILLSGGAWCRN----------ITDCLNRSKTDLGSSKHMT  109

Query  453   PLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVD  629
             P IF GIF  +++    FY WN+V VRYCDGG F GD+E  DP T L++RGARIF  V++
Sbjct  110   PFIFLGIFSKSKSENPDFYNWNKVFVRYCDGGGFTGDIESIDPATNLHFRGARIFDAVIE  169

Query  630   ELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHA  809
             +L+AKG+KDAKN I  GGSA G    ++CDRF +   K  RVKCL D+  F+ VK+P  A
Sbjct  170   DLLAKGLKDAKNAILSGGSANGYPAVLYCDRFHNLLHKAHRVKCLVDAGYFIHVKNPRLA  229

Query  810   KYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQ  989
               F+++F DVV LH   K LP  CTSKM P  CF P+N+ Q +K+P F   SA+DS+QV 
Sbjct  230   NVFESLFRDVVTLHGSTKVLPKSCTSKMKPELCFFPENIQQDIKTPFFTVMSAFDSYQVD  289

Query  990   NTFPIDLYRAIKNGSSISPSDMALLQDFKKQIISALPKPS--ATKGFIVTSNFGHSFASN  1163
             N    D+   I+   + + S     ++ + + +SALPKP+    +G  + S   H+    
Sbjct  290   NIIGSDIGDCIR-ARNCTESQNNDFKELRSEFLSALPKPNDPKQRGAFIDSFNRHTQLEL  348

Query  1164  NYKKPMFADSKSKSIESGFYNWFFDKHPINLIDPNTVPI  1280
              + K       + +    F +W++D+    +ID + +P+
Sbjct  349   WWNKVNATPINNLTTIEVFGDWYYDRKYSYVIDDHDLPL  387



>ref|XP_009589914.1| PREDICTED: uncharacterized protein LOC104087209 isoform X1 [Nicotiana 
tomentosiformis]
Length=400

 Score =   290 bits (743),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 163/403 (40%), Positives = 231/403 (57%), Gaps = 21/403 (5%)
 Frame = +3

Query  87    LRMAVSPRSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVC  266
             +R ++       +CLLIFSL++ +    V  +     E+    ++  TI++ A  KGAVC
Sbjct  1     MRRSMEHTKLQCLCLLIFSLLV-LNGKTVLGVNQTSNENL--GMVDLTILESAVSKGAVC  57

Query  267   LDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSS-F  443
             LDGSPPA+++  G GE A+NW+IY +GG WC     Y+ +D     C +R   E GSS  
Sbjct  58    LDGSPPAFYYDKGHGEGANNWIIYFRGGEWC-----YNVID-----CLNRTKTEKGSSKL  107

Query  444   NMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQV  620
               K   F GI   N+     FY WNRV+V YCDG SF GDVE  DPVT L++RGARIF  
Sbjct  108   APKQRSFYGILSNNKTLNPDFYNWNRVMVIYCDGASFTGDVEIVDPVTNLHFRGARIFHA  167

Query  621   VVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDP  800
             +++  +AKGMKDAKN I  GGSAGGL   +HCDRF +  P   RVKCL+D S FL  K+ 
Sbjct  168   LIEHFLAKGMKDAKNAILAGGSAGGLPALLHCDRFRALLPNSARVKCLADGSYFLHKKNM  227

Query  801   EHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSF  980
             +   +   V   ++ LH   K LP  C SKM P  C  P+   Q +++P FI +S +D+F
Sbjct  228   KEIPFMDIVNEGLITLHHSAKMLPSSCISKMRPSLCLFPQYFQQEIQTPFFIVNSMFDTF  287

Query  981   QVQNTFPIDLYRAIKNGSSISPSDMALLQDFKKQIISALPKP---SATKGFIVTSNFGHS  1151
             Q+  TF +  Y  + N ++ S + +  LQDFK++ +SALPK    S+++G  + S   HS
Sbjct  288   QINKTF-LGYYEDLNN-NTCSATLVKTLQDFKQEFLSALPKQSDCSSSRGMFIDSCLIHS  345

Query  1152  FASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLIDPNTVPI  1280
                +      F    +K+I   F +W+FD+  + LID   +P+
Sbjct  346   QILSGVGWNGFT-VHNKTIAEAFSDWYFDRSSVQLIDTPDLPL  387



>ref|XP_009589915.1| PREDICTED: uncharacterized protein LOC104087209 isoform X2 [Nicotiana 
tomentosiformis]
Length=399

 Score =   290 bits (742),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 162/391 (41%), Positives = 227/391 (58%), Gaps = 21/391 (5%)
 Frame = +3

Query  123   ICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHFSS  302
             +CLLIFSL++ +    V  +     E+    ++  TI++ A  KGAVCLDGSPPA+++  
Sbjct  12    LCLLIFSLLV-LNGKTVLGVNQTSNENL--GMVDLTILESAVSKGAVCLDGSPPAFYYDK  68

Query  303   GKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSS-FNMKPLIFKGIFG  479
             G GE A+NW+IY +GG WC     Y+ +D     C +R   E GSS    K   F GI  
Sbjct  69    GHGEGANNWIIYFRGGEWC-----YNVID-----CLNRTKTEKGSSKLAPKQRSFYGILS  118

Query  480   MNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKD  656
              N+     FY WNRV+V YCDG SF GDVE  DPVT L++RGARIF  +++  +AKGMKD
Sbjct  119   NNKTLNPDFYNWNRVMVIYCDGASFTGDVEIVDPVTNLHFRGARIFHALIEHFLAKGMKD  178

Query  657   AKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFSD  836
             AKN I  GGSAGGL   +HCDRF +  P   RVKCL+D S FL  K+ +   +   V   
Sbjct  179   AKNAILAGGSAGGLPALLHCDRFRALLPNSARVKCLADGSYFLHKKNMKEIPFMDIVNEG  238

Query  837   VVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFPIDLYR  1016
             ++ LH   K LP  C SKM P  C  P+   Q +++P FI +S +D+FQ+  TF +  Y 
Sbjct  239   LITLHHSAKMLPSSCISKMRPSLCLFPQYFQQEIQTPFFIVNSMFDTFQINKTF-LGYYE  297

Query  1017  AIKNGSSISPSDMALLQDFKKQIISALPKP---SATKGFIVTSNFGHSFASNNYKKPMFA  1187
              + N ++ S + +  LQDFK++ +SALPK    S+++G  + S   HS   +      F 
Sbjct  298   DLNN-NTCSATLVKTLQDFKQEFLSALPKQSDCSSSRGMFIDSCLIHSQILSGVGWNGFT  356

Query  1188  DSKSKSIESGFYNWFFDKHPINLIDPNTVPI  1280
                +K+I   F +W+FD+  + LID   +P+
Sbjct  357   -VHNKTIAEAFSDWYFDRSSVQLIDTPDLPL  386



>ref|XP_009784099.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=392

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/386 (41%), Positives = 217/386 (56%), Gaps = 29/386 (8%)
 Frame = +3

Query  120   WICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHFS  299
             W   +I  L+ SV       IP  +          KT++Q A  KGAVCLDGSP AYH+ 
Sbjct  8     WYQWIIVLLICSVMKVKAEVIPNKVA---------KTLVQDAFSKGAVCLDGSPAAYHYD  58

Query  300   SGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNMKPLIFKGIFG  479
              G G+  +NW+++L+GGGWC S          VE+C  R     GSS ++    F G+  
Sbjct  59    QGSGDGVNNWIVWLEGGGWCRS----------VEDCGQRFNYSNGSSNHIDSKSFYGLLS  108

Query  480   MNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKD  656
              ++     FY W+R+++RYCDG S+ GDVE  D VT  +YRGARIFQ ++DEL+AKGMK+
Sbjct  109   NSKTSNPDFYNWHRIMIRYCDGSSYTGDVELVDKVTNQHYRGARIFQAIMDELLAKGMKN  168

Query  657   AKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFSD  836
             A N I  G SAGGLG   HCDRF S  P   RVKCLSD + FL+  D +     ++ +  
Sbjct  169   ATNAILSGCSAGGLGTMFHCDRFRSLLPSTARVKCLSDGAYFLLDNDFKRVNILESTYDG  228

Query  837   VVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFPIDLYR  1016
             VV LH   K LP  CTS+M+P  CF P+++ + +K+PLFI +SAYDS+Q+ +T      R
Sbjct  229   VVNLHNSAKVLPPSCTSRMNPASCFFPQHIQEDIKTPLFILNSAYDSWQIVDTVIPFADR  288

Query  1017  ------AIKNGSSISPSDMALLQDFKKQIISALPK--PSATKGFIVTSNFGHSFASNNYK  1172
                     KN S  SP    LLQ F  + +SALPK    + +G  + S   H    +++ 
Sbjct  289   QDFAENCKKNLSKCSPHQQKLLQGFGAEFLSALPKSYSPSQRGMYINSCLMHCQTDHDWS  348

Query  1173  KPMFAD-SKSKSIESGFYNWFFDKHP  1247
                 +D   +K+I   F +WFF++ P
Sbjct  349   WNSNSDLLNNKTIAKVFGDWFFERDP  374



>ref|XP_009803843.1| PREDICTED: uncharacterized protein LOC104249167 [Nicotiana sylvestris]
 ref|XP_009803844.1| PREDICTED: uncharacterized protein LOC104249167 [Nicotiana sylvestris]
Length=396

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 163/391 (42%), Positives = 223/391 (57%), Gaps = 21/391 (5%)
 Frame = +3

Query  123   ICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHFSS  302
             +CLLI SL++         +    T +    ++  TI++ A  KGAVCLDGSPPA+++  
Sbjct  9     LCLLICSLIV---LNGKTVLGGNQTSNENLGMVDITILESAVSKGAVCLDGSPPAFYYDK  65

Query  303   GKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSS-FNMKPLIFKGIFG  479
             G GE A+NW+IY +GG WC     Y+ LD     C +R   E GSS    K   F GI G
Sbjct  66    GHGEGANNWIIYFRGGEWC-----YNVLD-----CLNRTKTEKGSSKLAPKQRSFYGILG  115

Query  480   MNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKD  656
              N+     FY WNRV+V YCDG SF GDVE  DPVT L++RGAR+F  +++  +  GMKD
Sbjct  116   NNKTENPDFYNWNRVMVIYCDGSSFTGDVEIVDPVTNLHFRGARVFHALIEHFLVIGMKD  175

Query  657   AKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFSD  836
             AKN I  GGSAGGL   +HCDRF +  P   RVKCL+D S FL  K+ +   +   V   
Sbjct  176   AKNAILSGGSAGGLPALLHCDRFRALLPNSARVKCLADGSYFLHKKNMKEIPFMDIVNEG  235

Query  837   VVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFPIDLYR  1016
             ++ LH   K LP  CTSKM P  C  P+   Q +++P FI +S +D+FQ+  TFP   Y 
Sbjct  236   LITLHHSAKMLPSSCTSKMRPSLCLFPQYFQQEIQTPFFIVNSMFDTFQINKTFPG--YY  293

Query  1017  AIKNGSSISPSDMALLQDFKKQIISALPKP---SATKGFIVTSNFGHSFASNNYKKPMFA  1187
                N ++ S + +  LQDFK++ +SALPK    S+++G  + S   HS   +      F 
Sbjct  294   EDLNNNTCSATLVKTLQDFKQEFLSALPKQSNCSSSRGMFIDSCLIHSQILSGVGWNGFT  353

Query  1188  DSKSKSIESGFYNWFFDKHPINLIDPNTVPI  1280
                +K+I   F NW+FD  P+ LID   +P+
Sbjct  354   -VHNKTIAEAFSNWYFDLSPVQLIDTPDMPL  383



>ref|XP_010318089.1| PREDICTED: protein notum homolog [Solanum lycopersicum]
Length=407

 Score =   289 bits (739),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 159/391 (41%), Positives = 223/391 (57%), Gaps = 24/391 (6%)
 Frame = +3

Query  123   ICLLIFSLVI--SVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHF  296
             +CL I SL I  +V  AN N +P         + + KTI++ A  KGAVCLDGSPPAYHF
Sbjct  11    LCLSICSLAIINTVSSANENYLPEA-------YHVSKTIVKNAVAKGAVCLDGSPPAYHF  63

Query  297   SSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNMKPLIFKGIF  476
               G G+ A  WL+ L GG WC            VE C  R   +LGSS  M    F G+F
Sbjct  64    EPGFGDGAETWLVQLSGGEWCRD----------VEACLDRSKSDLGSSNVMGSWWFTGMF  113

Query  477   GMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMK  653
               N++    FY WN+V +RYCDGG F GDVE  DP TKL++RGARIF+ V+DEL+ KG+K
Sbjct  114   SKNQSGNPEFYNWNKVFIRYCDGGGFTGDVEYVDPATKLHFRGARIFKAVLDELLEKGLK  173

Query  654   DAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFS  833
              AK+ +  G SAGG    +HCD F +  P   RVKC++D+  F+  K+P     F  +++
Sbjct  174   TAKSALLSGSSAGGFPAMLHCDYFRTLLPNTPRVKCMNDAGYFINPKEP-FLTNFTELYT  232

Query  834   DVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFPIDLY  1013
              +V LH   K+LP ECTSKMSP  CF P+N+ QYVK+PLFI  SAYD +Q+ ++    + 
Sbjct  233   SLVTLHGSAKALPKECTSKMSPELCFFPENMQQYVKTPLFIASSAYDKYQINSSIANGIN  292

Query  1014  RAIKNGSSISPSDMALLQDFKKQIISALPKPS--ATKGFIVTSNFGHSFASNNYKKPMFA  1187
               I   +  + ++   L+ F+ + ++ALPKP+    KG  + S   HS     +      
Sbjct  293   TCIGYANCTAATNQTFLE-FRSRFLNALPKPTNPKLKGVFIDSFNHHSQVQYWWSPINIT  351

Query  1188  DSKSKSIESGFYNWFFDKHPINLIDPNTVPI  1280
                + +I     +WF+D++   +I  + +PI
Sbjct  352   TINNLTISKALADWFYDRNYTYVIHEHELPI  382



>ref|XP_008451860.1| PREDICTED: protein notum homolog isoform X1 [Cucumis melo]
Length=401

 Score =   288 bits (738),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 156/359 (43%), Positives = 210/359 (58%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +Q A  KGAVCLDGSPPAYHFS G G   +NWLI L+GGGWC +          V  C
Sbjct  33    TYVQDAGIKGAVCLDGSPPAYHFSDGFGSGINNWLIQLEGGGWCNN----------VTTC  82

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
               R    LGSS  M   L F GI      +   FY WNR+ VRYCDG SF GDVE  DP 
Sbjct  83    LQRRDTRLGSSKKMVTQLAFSGILSNKPQFNPDFYNWNRIKVRYCDGSSFTGDVEAVDPA  142

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGAR+F+ ++D L+AKGMK+AKN I  G SAGGL   +HCD F S  P   +VKC
Sbjct  143   TNLHFRGARVFRAIIDNLLAKGMKNAKNAILSGCSAGGLSSILHCDNFKSLLPPTTKVKC  202

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  F+  KD   A++ +  +SDVV  H   K+LP+ CTSKM P  CF P+N+VQ ++
Sbjct  203   LSDAGYFINAKDVSGAQHIEGFYSDVVTTHGSAKNLPISCTSKMKPEMCFFPQNVVQLIQ  262

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +P+F+ ++AYDS+Q++N        P   +   K +  + SP  + ++QDF+ Q +SAL 
Sbjct  263   TPIFLVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPIQLRIMQDFRVQFLSALT  322

Query  1101  --KPSATKGFIVTSNFGHSFASNNYKKPMFADSKSKS---IESGFYNWFFDKHPINLID  1262
                 S ++G  + S + H   +   +  + +DS   S   I     +WFFD+ P   ID
Sbjct  323   GVGSSLSRGLFIDSCYAHC-QTEMQETWLRSDSPMLSKTPIAKAVGDWFFDRAPFQKID  380



>ref|XP_008451861.1| PREDICTED: protein notum homolog isoform X2 [Cucumis melo]
Length=398

 Score =   288 bits (738),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 156/359 (43%), Positives = 210/359 (58%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +Q A  KGAVCLDGSPPAYHFS G G   +NWLI L+GGGWC +          V  C
Sbjct  30    TYVQDAGIKGAVCLDGSPPAYHFSDGFGSGINNWLIQLEGGGWCNN----------VTTC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
               R    LGSS  M   L F GI      +   FY WNR+ VRYCDG SF GDVE  DP 
Sbjct  80    LQRRDTRLGSSKKMVTQLAFSGILSNKPQFNPDFYNWNRIKVRYCDGSSFTGDVEAVDPA  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGAR+F+ ++D L+AKGMK+AKN I  G SAGGL   +HCD F S  P   +VKC
Sbjct  140   TNLHFRGARVFRAIIDNLLAKGMKNAKNAILSGCSAGGLSSILHCDNFKSLLPPTTKVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  F+  KD   A++ +  +SDVV  H   K+LP+ CTSKM P  CF P+N+VQ ++
Sbjct  200   LSDAGYFINAKDVSGAQHIEGFYSDVVTTHGSAKNLPISCTSKMKPEMCFFPQNVVQLIQ  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +P+F+ ++AYDS+Q++N        P   +   K +  + SP  + ++QDF+ Q +SAL 
Sbjct  260   TPIFLVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPIQLRIMQDFRVQFLSALT  319

Query  1101  --KPSATKGFIVTSNFGHSFASNNYKKPMFADSKSKS---IESGFYNWFFDKHPINLID  1262
                 S ++G  + S + H   +   +  + +DS   S   I     +WFFD+ P   ID
Sbjct  320   GVGSSLSRGLFIDSCYAHC-QTEMQETWLRSDSPMLSKTPIAKAVGDWFFDRAPFQKID  377



>ref|XP_003613922.1| Notum-like protein [Medicago truncatula]
 gb|AES96880.1| pectinacetylesterase family protein [Medicago truncatula]
Length=394

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/360 (42%), Positives = 217/360 (60%), Gaps = 25/360 (7%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P TI+Q A  KGAVCLDGSPPAY+F  G G+ +++WL++++GGGWC +          V
Sbjct  29    VPTTIVQNAVAKGAVCLDGSPPAYNFDKGYGKGSNSWLVHMEGGGWCHN----------V  78

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
              NC  RM   LGSS  M K L F GI    + +   FY WNR+ +RYCDG SF GDVE  
Sbjct  79    TNCLGRMTTRLGSSKQMNKTLAFSGILNDKKQFNPDFYNWNRIKIRYCDGSSFTGDVEAV  138

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DPVTKL++RGARIF+ V++EL+AKGMK A+N I  G SAGGL   +HCDRF +  PKG  
Sbjct  139   DPVTKLHFRGARIFEAVMEELLAKGMKKAQNAILSGCSAGGLTSLLHCDRFRALLPKGSN  198

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD   A +F+  F+ +V LH   K+LP  CTSK+ P  CF P+N V 
Sbjct  199   VKCISDAGYFINAKDISGAPHFEEYFNQIVTLHGSVKNLPGSCTSKLKPELCFFPQNFVS  258

Query  933   YVKSPLFIFHSAYDSFQVQNTFPIDL--YRAIK-NGSSISPSDMALLQDFKKQIISALP-  1100
              + +P+F+ +S  DS+Q++N    D   ++  K + +  +P+ +  +Q F+K+ + AL  
Sbjct  259   QITTPIFVVNSPIDSYQIKNILAPDADDWKNCKLDITKCTPAQLNQVQGFRKEFLRALAP  318

Query  1101  -KPSATKGFIVTSNFGHSFASNNY-----KKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
                S++ G  + S + H              P+ A++   +I     +WF+D+ P + ID
Sbjct  319   IGNSSSVGTFIDSCYLHCQTELQEFWLFNGSPLLANT---TIAKSVADWFYDRRPFHQID  375



>ref|XP_009624847.1| PREDICTED: protein notum homolog isoform X2 [Nicotiana tomentosiformis]
Length=388

 Score =   286 bits (732),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 161/403 (40%), Positives = 224/403 (56%), Gaps = 26/403 (6%)
 Frame = +3

Query  93    MAVSPRSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLD  272
             M +  RS     L IF L I +           +T++   + + KTI+  A  KGAVCLD
Sbjct  1     MMMVTRSFQLFVLFIFPLTIFITEC------AKVTQNPDVYNVTKTIVHSAVSKGAVCLD  54

Query  273   GSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNMK  452
             GSPPAYHF  G GE   NWL+ L GGGWC +          V++C +R   ++GSS  M 
Sbjct  55    GSPPAYHFDPGFGEGVGNWLVQLSGGGWCTN----------VKDCLNRSKSDVGSSSYMH  104

Query  453   PLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVD  629
             P  FKGIF  N++    FY WN+V VRYCDGGSF GDVE  DP T L++RGARIF  V++
Sbjct  105   PQPFKGIFSKNQSANPDFYNWNKVFVRYCDGGSFTGDVEYVDPATNLHFRGARIFTAVLE  164

Query  630   ELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHA  809
             EL+AKG+K+AKN I  G SAGG    ++CDRF +  P   RVKCL DS  F+  K+P   
Sbjct  165   ELLAKGLKNAKNAILAGSSAGGYPAILYCDRFRNLLPNTSRVKCLVDSGYFVHFKNPVLG  224

Query  810   KYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQ  989
             + F++++  V  L    K+LP  CTSKM P  C   +N+ Q +K+P+FI  SA+D+   Q
Sbjct  225   RPFESIYKGVATLQGSAKTLPKSCTSKMKPELCLFAENIQQDIKTPIFISMSAFDNIMTQ  284

Query  990   NTFPIDLYRAIKNGSSISPSDMALLQDFKKQIISALPK---PSATKGFIVTSNFGHSFAS  1160
              T    +Y  I+NG+  + S     Q+ +   +SA+PK   P     FI   +   S   
Sbjct  285   YTLGGTIYGCIQNGTCTA-SQNKTFQEMRSDFLSAIPKGNNPKLRGVFIDVVHHHTSLQK  343

Query  1161  NNY---KKPMFADSKSKSIESGFYNWFFDKHPINLIDPNTVPI  1280
                   +KP+   + +      F +W+FD++   LID + +P+
Sbjct  344   QTRWSPEKPIVVHNLAA--PKAFSDWYFDRNYTYLIDEHNLPL  384



>ref|XP_011028476.1| PREDICTED: protein notum homolog [Populus euphratica]
 ref|XP_011028477.1| PREDICTED: protein notum homolog [Populus euphratica]
Length=394

 Score =   286 bits (732),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 152/365 (42%), Positives = 210/365 (58%), Gaps = 30/365 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             IP TI++ A  +GAVCLDGSPP YHF  G G    NWL++++GGGWC S          V
Sbjct  27    IPITIVETAVSRGAVCLDGSPPGYHFDKGSGSGIDNWLVHMEGGGWCES----------V  76

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
             E+C SR     GSS  M K + F GI G  +     FY WNR+ VRYCDG SF GDVE  
Sbjct  77    ESCVSRRDTFRGSSSKMEKTMGFSGILGSKQAANPDFYNWNRIKVRYCDGSSFTGDVEAV  136

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP TKLY+RG R++Q V+DEL+AKGM++A+N I  G SAGGL   +HCD+F S  P   R
Sbjct  137   DPETKLYFRGERVWQAVIDELLAKGMQNARNAILSGCSAGGLAAILHCDKFQSLLPATAR  196

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+   D       ++ F  VV  H   K+LP  CTSKM+P  CF P+ + Q
Sbjct  197   VKCVSDAGYFIHGTDISGGSRIESFFGQVVKTHGSAKNLPASCTSKMNPELCFFPQYVAQ  256

Query  933   YVKSPLFIFHSAYDSFQVQNTF---PIDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLFI +SAYDS+Q++N      +D  +  K+        S S +  +QD++ Q + 
Sbjct  257   TMRTPLFIINSAYDSWQIKNILAPTAVDSKKEWKDCKLDLKKCSASQLQTVQDYRAQFLK  316

Query  1092  ALPK---PSATKGFIVTSNFGHSFASN-----NYKKPMFADSKSKSIESGFYNWFFDKHP  1247
             A+      S+T+G  + S + H  + +     N K P   D+K   +     +WF+D+  
Sbjct  317   AVNTGLGSSSTRGLWIDSCYAHCQSGSVSTWLNDKSPEVGDTK---MGKAVGDWFYDRSA  373

Query  1248  INLID  1262
             +  ID
Sbjct  374   MEKID  378



>ref|XP_006385133.1| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ERP62930.1| pectinacetylesterase family protein [Populus trichocarpa]
Length=394

 Score =   286 bits (731),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 152/365 (42%), Positives = 209/365 (57%), Gaps = 30/365 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             IP TI++ A   GAVCLDGSPP YHF  G G    NWL++++GGGWC S          V
Sbjct  27    IPITIVETAVSSGAVCLDGSPPGYHFDKGSGSGIDNWLVHMEGGGWCES----------V  76

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
             E+C SR     GSS  M K + F GI G  +     FY WNR+ VRYCDG SF GDVE  
Sbjct  77    ESCVSRRDTFRGSSSKMEKTMGFSGILGSKQAANPDFYNWNRIKVRYCDGSSFTGDVEAV  136

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP TKLY+RG R++Q V+DEL+AKGM++A+N I  G SAGGL   +HCD+F S  P   R
Sbjct  137   DPETKLYFRGERVWQAVIDELLAKGMQNARNAILSGCSAGGLAAILHCDKFQSLLPATAR  196

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+   D       ++ F  VV  H   K+LP  CTSKM+P  CF P+ + Q
Sbjct  197   VKCVSDAGYFIHGTDISGGSRIESFFGQVVKTHGSAKNLPASCTSKMNPELCFFPQYVAQ  256

Query  933   YVKSPLFIFHSAYDSFQVQNTF---PIDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLFI +SAYDS+Q++N      +D  +  K+        S S +  +QD++ Q + 
Sbjct  257   TMRTPLFIINSAYDSWQIKNILAPTAVDSKKEWKDCKLDLKKCSASQLQTVQDYRTQFLK  316

Query  1092  ALPK---PSATKGFIVTSNFGHSFASN-----NYKKPMFADSKSKSIESGFYNWFFDKHP  1247
             A+      S+T+G  + S + H  + +     N K P   D+K   +     +WF+D+  
Sbjct  317   AVDTGLGSSSTRGLWIDSCYAHCQSGSVSTWLNDKSPEVGDTK---MGKAVGDWFYDRSA  373

Query  1248  INLID  1262
             +  ID
Sbjct  374   MEKID  378



>ref|XP_010314003.1| PREDICTED: protein notum homolog isoform X1 [Solanum lycopersicum]
Length=404

 Score =   285 bits (730),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 155/400 (39%), Positives = 221/400 (55%), Gaps = 15/400 (4%)
 Frame = +3

Query  93    MAVSPRSNDWICLLIFSLVIS-VQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCL  269
             + +S RS   +CLLI SL IS       N +          + +  TI+Q A  KGAVCL
Sbjct  2     LTMSTRSVRLVCLLICSLAISKSDSTKANELLKQEKHADHAYFVDITIVQNAVSKGAVCL  61

Query  270   DGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNM  449
             DGSPPAYH   G G    NW+I L GG WC +            +C +R   +LGSS  M
Sbjct  62    DGSPPAYHLDPGFGHGVRNWIILLSGGAWCRN----------TTDCLNRSKTDLGSSTLM  111

Query  450   KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVV  626
              P IF GIF  ++     FY WN+V VRYCDGG+F GD+E  DP T L++RGARIF  ++
Sbjct  112   LPFIFLGIFSKSKTENPDFYNWNKVFVRYCDGGAFTGDIENVDPATNLHFRGARIFDAII  171

Query  627   DELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEH  806
             ++L+AKG+KDAKN I  GGSA G    ++CD F S  PK  RVKCL D+  F+ VK+P  
Sbjct  172   EDLLAKGLKDAKNAILSGGSANGYPAMLYCDHFHSLLPKAHRVKCLVDAGYFIRVKNPLL  231

Query  807   AKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQV  986
                F+++F DVV LH   K LP  CTS+M P  CF P+N+ + +K+P F   SA+DS+QV
Sbjct  232   TNVFESIFKDVVTLHGSTKVLPKSCTSRMKPELCFFPENIQRDIKTPFFTVMSAFDSYQV  291

Query  987   QNTFPIDLYRAIKNGSSISPSDMALLQDFKKQIISALPKPS--ATKGFIVTSNFGHSFAS  1160
              +    D+   I+  +     + A  ++ + + + ALPK +    +G  + S   H+   
Sbjct  292   NSIIGFDIGEYIQARNCTENQNNA-FKELRSEFLRALPKANDPKQRGVFIDSFNRHTQLE  350

Query  1161  NNYKKPMFADSKSKSIESGFYNWFFDKHPINLIDPNTVPI  1280
               + K       + +    F +W++D+    +ID + +P+
Sbjct  351   LWWNKINATPVNNLTTIKVFGDWYYDRKYSYVIDEHDLPL  390



>ref|XP_006587657.1| PREDICTED: protein notum homolog isoform X3 [Glycine max]
 gb|KHN11801.1| Protein notum like [Glycine soja]
Length=400

 Score =   285 bits (729),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 150/361 (42%), Positives = 214/361 (59%), Gaps = 23/361 (6%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P TI+Q A  KGAVCLDGSPPAYHF  G G   +NWL+  +GGGWC +          V
Sbjct  27    VPITIVQNAVAKGAVCLDGSPPAYHFDRGFGSGINNWLVAFEGGGWCNN----------V  76

Query  399   ENCSSRMGRELGSSFNMKPLI-FKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
               C +R    LGSS  M  LI F GI    E +   FY WNR+ VRYCDG SF GDVE  
Sbjct  77    TTCLARKTNRLGSSKQMAKLIAFSGILNNREMFNPDFYNWNRIKVRYCDGSSFTGDVEAV  136

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +PVTKL++RG RIF  V+++L+AKGMK+A+N I  G SAGGL   +HCDRF +  P+G R
Sbjct  137   NPVTKLHFRGGRIFNAVMEDLLAKGMKNARNAIISGCSAGGLTSVLHCDRFRALLPRGAR  196

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKCLSD+  F+  KD    ++ +  FS VVA H   ++LP  CTS++SP  CF P+ LV 
Sbjct  197   VKCLSDAGYFINGKDVLGEQHIEQYFSQVVATHGSARNLPQSCTSRLSPRLCFFPQYLVS  256

Query  933   YVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIIS  1091
              + +P+F  ++AYDS+Q++N        P   + + K + ++ SP  + L+Q F+ + + 
Sbjct  257   RITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLR  316

Query  1092  ALP--KPSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLI  1259
             A+     S++KG  + S + H  +     + +    + K  +I     +WF+++ P + I
Sbjct  317   AITVLGNSSSKGMFIDSCYAHCQTEMQETWLRSDSPELKKTTIAKAVADWFYERRPFHQI  376

Query  1260  D  1262
             D
Sbjct  377   D  377



>ref|XP_009778395.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=397

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 145/391 (37%), Positives = 223/391 (57%), Gaps = 19/391 (5%)
 Frame = +3

Query  123   ICLLIFSLVISVQYANVNPIPTPITEDYLD--FIIPKTIIQGADEKGAVCLDGSPPAYHF  296
             +C+LI  L I +   N+          Y+D  + + KT++  A  KGAVCLDGSPPAYHF
Sbjct  10    VCVLICFLAIII---NIEACVKENATSYIDQGYYVEKTVVHNAVSKGAVCLDGSPPAYHF  66

Query  297   SSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNMKPLIFKGIF  476
               G G+    WL++L GG WC +          VE C +R   + GSS  MKP  F+GI+
Sbjct  67    EPGFGDGVGKWLVHLSGGAWCTT----------VEECLNRSKSDFGSSNYMKPWWFQGIY  116

Query  477   GMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMK  653
                ++    FY WN+V VRYCDGG+F G+ E  DP T L++RGARIF+ V+++++AKG+K
Sbjct  117   SKTQSVNPDFYNWNKVFVRYCDGGAFTGNAEYVDPATNLHFRGARIFKAVMEDVLAKGLK  176

Query  654   DAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFS  833
             +A++ + +G SA G    ++CDRF    P   RVKC+ D+  F+ VKDP  A+ F  ++ 
Sbjct  177   NAQSALLIGSSAAGYPAMLYCDRFRKLLPNTPRVKCMVDAGYFIHVKDPHQARNFTEMYK  236

Query  834   DVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFPIDLY  1013
              +V LH   K+LP  CT KM P  CF P+N+   +K+PL+I  SA+D FQ+ NT   D  
Sbjct  237   AIVNLHGSAKTLPKSCTKKMKPEMCFFPENMQHKIKTPLYIAMSAFDKFQI-NTTIYDGI  295

Query  1014  RAIKNGSSISPSDMALLQDFKKQIISALPKPSATK--GFIVTSNFGHSFASNNYKKPMFA  1187
                  G + + ++  L ++F+ + ++ALPK +  K  G  + +   H+     +      
Sbjct  296   NICIEGGNCTATENKLFREFRLEFLNALPKANNPKLRGAFIDARNHHTQVQGWWSPKNVT  355

Query  1188  DSKSKSIESGFYNWFFDKHPINLIDPNTVPI  1280
               K+ ++   F +W++D++   +ID   +PI
Sbjct  356   TVKNLNLMKAFADWYYDRNYTYVIDERDLPI  386



>ref|XP_008797987.1| PREDICTED: protein notum homolog isoform X1 [Phoenix dactylifera]
Length=391

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/360 (41%), Positives = 206/360 (57%), Gaps = 20/360 (6%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +P T++Q A  KGAVCLDGSPPAYHF+ G G   +NWL++++GGGWC +         
Sbjct  27    FDVPLTLVQAAVAKGAVCLDGSPPAYHFAPGFGSGVNNWLVHMEGGGWCSN---------  77

Query  393   SVENCSSRMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEK  569
              VE C  R G   GSS  MK L F GI G  +N    FY WN+V +RYCDG SF GD+E 
Sbjct  78    -VEECKERTGNFRGSSKYMKQLSFSGILGNQQNLNPDFYNWNKVKIRYCDGSSFTGDIEA  136

Query  570   PDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGV  749
              +P T L++RGAR+++ ++DEL+AKGM  A+N +  G SAGGL   +HCD F    P G 
Sbjct  137   VNPATNLHFRGARVWRAIMDELLAKGMNKAQNALLSGCSAGGLASILHCDSFHDLLPAGA  196

Query  750   RVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLV  929
             RVKC SD+  F+  KD    +  K  ++ VV  H   K+LP  CTS+  P  CF P+ +V
Sbjct  197   RVKCFSDAGYFIDAKDVSGKETIKDFYNQVVTTHGSAKNLPSSCTSRFPPSLCFFPQYVV  256

Query  930   QYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQII  1088
             Q +++PLFI ++AYD++Q++N F      P  ++   K +    S S +  LQ F+ + +
Sbjct  257   QNMRTPLFILNAAYDAWQIKNIFAPSPSDPRKIWSECKLDIKKCSSSQLQALQGFRSEFL  316

Query  1089  SALPKPSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
              ALP+ S + G  + S + H  S A   +           SI     +WF+ +  +  ID
Sbjct  317   RALPRNSPSVGMFIDSCYSHCQSGAQETWLSSNSPAIDRMSIAKAVGDWFYGRSAVQKID  376



>ref|XP_011012520.1| PREDICTED: protein notum homolog [Populus euphratica]
Length=394

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 153/399 (38%), Positives = 222/399 (56%), Gaps = 47/399 (12%)
 Frame = +3

Query  120   WICLLIFSL-VISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHF  296
             W+CL++++L ++  + A+                IP TI+Q A  +GAVCLDGSPP YHF
Sbjct  9     WLCLIVYTLTLLKTEGAS----------------IPMTIVQTAVARGAVCLDGSPPGYHF  52

Query  297   SSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNM-KPLIFKGI  473
               G G   +NWL++++GGGWC S          VE+C SR     GSS  M K + F GI
Sbjct  53    EKGSGSGINNWLVHMEGGGWCES----------VESCVSRRDTYKGSSLKMEKTMGFSGI  102

Query  474   FGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGM  650
              G  +     FY WNR+ +RYCDG SF GDVE  DP TKLY+RG RI+Q V+D+L+AKGM
Sbjct  103   LGSKQAANPDFYNWNRIKIRYCDGSSFTGDVEAVDPKTKLYFRGERIWQAVIDDLLAKGM  162

Query  651   KDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVF  830
             ++A+N I  G SAGGL   +HCD+F S  P   RVKC+SD+  F+   D       ++ F
Sbjct  163   RNARNAILSGCSAGGLAAILHCDKFQSLLPASARVKCVSDAGYFIHGTDISGGSRIESFF  222

Query  831   SDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF---P  1001
               VV  H   K+LP  CTSK  P  CF P+ + Q +++PLFI +SAYDS+Q++N      
Sbjct  223   GQVVKTHGSAKNLPASCTSKTRPELCFFPQYVAQTMRTPLFIINSAYDSWQIKNILAPTA  282

Query  1002  IDLYRAIKNG----SSISPSDMALLQDFKKQIISALPK---PSATKGFIVTSNFGHSFAS  1160
             +D  +  KN        S + +  +Q+++ Q + A+      S+++G  + S + H  + 
Sbjct  283   VDSKKEWKNCKLDLKKCSATQLQTVQNYRTQFLKAVNTGLGSSSSRGLWINSCYAHCQSG  342

Query  1161  N-----NYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
             +       K P+  ++K   I     +WF+D+     ID
Sbjct  343   SVSTWLADKSPVVGNAK---IGKAVGDWFYDRSAFEKID  378



>ref|XP_009779347.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana sylvestris]
Length=386

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 154/398 (39%), Positives = 226/398 (57%), Gaps = 24/398 (6%)
 Frame = +3

Query  99    VSPRSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGS  278
             ++ R+    C L+ SL I         I +   +D   + + KTI++ A  KGAVCLDGS
Sbjct  1     MAARTLHLFCFLVCSLAI---------IKSECAKDLGSYNVTKTILKNAVSKGAVCLDGS  51

Query  279   PPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSR-MGRELGSSFNMKP  455
             PPAYHF  G G+   NW++ L GG WC +          V  C  R + + +GS+     
Sbjct  52    PPAYHFEPGFGKGVGNWIVQLSGGAWCTN----------VTECQDRILDKNVGSTNFTDS  101

Query  456   LIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDE  632
               F+GI+  N      FY WN+V VRYCDGG+F GDVE  D VT L++RGARIF+ V+++
Sbjct  102   WTFQGIYSENPTANPDFYNWNKVFVRYCDGGAFTGDVEYVDHVTNLHFRGARIFEAVMED  161

Query  633   LMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAK  812
             L+AKG+K+AKN I  G SAGG    ++CD F S  P   RVKCL DS  F+ VK+P  A 
Sbjct  162   LLAKGLKNAKNAILAGSSAGGYPTMLYCDHFRSLLPNTPRVKCLVDSGYFIHVKNPMQAS  221

Query  813   YFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQN  992
              F+ +++ ++ LH   K+LP  CTSKM+P  CF P+N+ Q++K+PLFI  SA+D +Q++ 
Sbjct  222   GFEKIYNSLLTLHGSTKALPKSCTSKMNPPLCFFPENMQQHIKTPLFIAMSAFDYYQIKT  281

Query  993   TFPIDLYRAIKNGSSISPSDMALLQDFKKQIISALPKPSATK--GFIVTSNFGHSFASNN  1166
             T   +  R ++N +     + A  ++F+ + +SALP  +  K  G  + S   HS  S  
Sbjct  282   TIDPNADRCVENRTCTECQNKA-FREFRSEFLSALPISNNPKLRGVFIDSVIHHSALSYR  340

Query  1167  YKKPMFADSKSKSIESGFYNWFFDKHPINLIDPNTVPI  1280
             +         + S    F +W+FD+    +ID + +PI
Sbjct  341   WTPENAILINNLSAPKAFADWYFDRKYWYVIDKHDLPI  378



>ref|XP_006587656.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=450

 Score =   286 bits (731),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 150/361 (42%), Positives = 214/361 (59%), Gaps = 23/361 (6%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P TI+Q A  KGAVCLDGSPPAYHF  G G   +NWL+  +GGGWC +          V
Sbjct  27    VPITIVQNAVAKGAVCLDGSPPAYHFDRGFGSGINNWLVAFEGGGWCNN----------V  76

Query  399   ENCSSRMGRELGSSFNMKPLI-FKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
               C +R    LGSS  M  LI F GI    E +   FY WNR+ VRYCDG SF GDVE  
Sbjct  77    TTCLARKTNRLGSSKQMAKLIAFSGILNNREMFNPDFYNWNRIKVRYCDGSSFTGDVEAV  136

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +PVTKL++RG RIF  V+++L+AKGMK+A+N I  G SAGGL   +HCDRF +  P+G R
Sbjct  137   NPVTKLHFRGGRIFNAVMEDLLAKGMKNARNAIISGCSAGGLTSVLHCDRFRALLPRGAR  196

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKCLSD+  F+  KD    ++ +  FS VVA H   ++LP  CTS++SP  CF P+ LV 
Sbjct  197   VKCLSDAGYFINGKDVLGEQHIEQYFSQVVATHGSARNLPQSCTSRLSPRLCFFPQYLVS  256

Query  933   YVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIIS  1091
              + +P+F  ++AYDS+Q++N        P   + + K + ++ SP  + L+Q F+ + + 
Sbjct  257   RITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLR  316

Query  1092  ALP--KPSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLI  1259
             A+     S++KG  + S + H  +     + +    + K  +I     +WF+++ P + I
Sbjct  317   AITVLGNSSSKGMFIDSCYAHCQTEMQETWLRSDSPELKKTTIAKAVADWFYERRPFHQI  376

Query  1260  D  1262
             D
Sbjct  377   D  377



>ref|XP_004172255.1| PREDICTED: protein notum homolog [Cucumis sativus]
 gb|KGN53459.1| hypothetical protein Csa_4G056500 [Cucumis sativus]
Length=398

 Score =   284 bits (727),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 154/359 (43%), Positives = 207/359 (58%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +Q A  KGAVCLDGSPPAYHFS G G   +NWLI L+GGGWC +          V  C
Sbjct  30    TYVQDAVIKGAVCLDGSPPAYHFSDGFGSGINNWLIQLEGGGWCNN----------VTTC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
               R    LGSS  M   L F GI      +   FY WNR+ VRYCDG SF GDVE  D  
Sbjct  80    LQRRDTRLGSSKKMVTQLAFSGILSNKPQFNPDFYNWNRIKVRYCDGSSFTGDVEAVDSA  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGAR+F+ ++D L+AKGMK+AKN I  G SAGGL   +HCD F S  P   +VKC
Sbjct  140   TNLHFRGARVFRAIIDNLLAKGMKNAKNAILSGCSAGGLSSILHCDNFKSLLPPTTKVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  F+  KD   A++ +  +SDVV  H   K+LP+ CTSKM P  CF P+N+VQ ++
Sbjct  200   LSDAGYFINAKDVSGAQHIEGFYSDVVTTHGSAKNLPISCTSKMKPEMCFFPQNVVQLIQ  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +P+F+ ++AYDS+Q++N        P   +   K +  + SP  +  +QDF+ Q +SAL 
Sbjct  260   TPIFLVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPIQLRTMQDFRVQFLSALN  319

Query  1101  --KPSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                 S ++G  + S + H   +   +  +  DS      +I     +WFFD+ P   ID
Sbjct  320   GVGSSLSRGLFIDSCYAHC-QTEMQETWLRTDSPVLSKTTIAKAVGDWFFDRAPFQKID  377



>ref|XP_010314004.1| PREDICTED: protein notum homolog isoform X2 [Solanum lycopersicum]
Length=401

 Score =   284 bits (727),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 155/398 (39%), Positives = 220/398 (55%), Gaps = 15/398 (4%)
 Frame = +3

Query  99    VSPRSNDWICLLIFSLVIS-VQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDG  275
             +S RS   +CLLI SL IS       N +          + +  TI+Q A  KGAVCLDG
Sbjct  1     MSTRSVRLVCLLICSLAISKSDSTKANELLKQEKHADHAYFVDITIVQNAVSKGAVCLDG  60

Query  276   SPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNMKP  455
             SPPAYH   G G    NW+I L GG WC +            +C +R   +LGSS  M P
Sbjct  61    SPPAYHLDPGFGHGVRNWIILLSGGAWCRN----------TTDCLNRSKTDLGSSTLMLP  110

Query  456   LIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDE  632
              IF GIF  ++     FY WN+V VRYCDGG+F GD+E  DP T L++RGARIF  ++++
Sbjct  111   FIFLGIFSKSKTENPDFYNWNKVFVRYCDGGAFTGDIENVDPATNLHFRGARIFDAIIED  170

Query  633   LMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAK  812
             L+AKG+KDAKN I  GGSA G    ++CD F S  PK  RVKCL D+  F+ VK+P    
Sbjct  171   LLAKGLKDAKNAILSGGSANGYPAMLYCDHFHSLLPKAHRVKCLVDAGYFIRVKNPLLTN  230

Query  813   YFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQN  992
              F+++F DVV LH   K LP  CTS+M P  CF P+N+ + +K+P F   SA+DS+QV +
Sbjct  231   VFESIFKDVVTLHGSTKVLPKSCTSRMKPELCFFPENIQRDIKTPFFTVMSAFDSYQVNS  290

Query  993   TFPIDLYRAIKNGSSISPSDMALLQDFKKQIISALPKPS--ATKGFIVTSNFGHSFASNN  1166
                 D+   I+  +     + A  ++ + + + ALPK +    +G  + S   H+     
Sbjct  291   IIGFDIGEYIQARNCTENQNNA-FKELRSEFLRALPKANDPKQRGVFIDSFNRHTQLELW  349

Query  1167  YKKPMFADSKSKSIESGFYNWFFDKHPINLIDPNTVPI  1280
             + K       + +    F +W++D+    +ID + +P+
Sbjct  350   WNKINATPVNNLTTIKVFGDWYYDRKYSYVIDEHDLPL  387



>ref|XP_009397056.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009397057.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=393

 Score =   284 bits (726),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 147/362 (41%), Positives = 213/362 (59%), Gaps = 23/362 (6%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             + +P T++  A  KGAVCLDGSPPAYHFS G G  A+NWL++++GGGWC +         
Sbjct  28    YDVPMTLLHSAVAKGAVCLDGSPPAYHFSPGSGSGANNWLVHMEGGGWCRN---------  78

Query  393   SVENCSSRMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEK  569
              VE C  R     GSS +MKPL F GI G ++     FY WNR+ +RYCDG SF GDVE+
Sbjct  79    -VEECLERKNNFRGSSNHMKPLSFSGILGNSKKSNPDFYNWNRIKIRYCDGSSFTGDVER  137

Query  570   PDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGV  749
              DP T L+YRGAR++  ++++L+ KGM  A+N +  G SAGGL   +HCD+F S  P   
Sbjct  138   VDPATNLHYRGARVWLAIMEDLLLKGMNRAENALLSGCSAGGLASILHCDKFRSLLPASA  197

Query  750   RVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLV  929
             +VKC SD+  F+  KD       +++++DVV LH   K+LP  CTS++SP  CF P+N+V
Sbjct  198   KVKCFSDAGYFIDGKDISGTTSVRSLYNDVVNLHGSGKNLPSSCTSRLSPSMCFFPQNVV  257

Query  930   QYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQII  1088
               + +PLFI ++AYD++Q++NT       P   + A K N  S S   +  +Q+F+ + +
Sbjct  258   PKMSTPLFILNAAYDAWQIKNTLAPSSADPRKSWNACKLNIKSCSSDQLEKMQEFRSEFL  317

Query  1089  SALPKP-SATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINL  1256
              ALP   + + G  + S + H   S +    + ADS       I     +WF+ +  +  
Sbjct  318   RALPASGNPSTGMFIISCYAHC-QSGSQDTWLGADSPMIDKMPIAKAVGDWFYGRSVVRK  376

Query  1257  ID  1262
             ID
Sbjct  377   ID  378



>ref|XP_003628996.1| Carboxylic ester hydrolase [Medicago truncatula]
 gb|AET03472.1| pectinacetylesterase family protein [Medicago truncatula]
Length=406

 Score =   284 bits (727),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 154/367 (42%), Positives = 212/367 (58%), Gaps = 35/367 (10%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T ++ A  KGAVCLDGSPPAYHF  G  E A+NW+++++GGGWC +          V
Sbjct  27    VPLTRLESAVSKGAVCLDGSPPAYHFDQGHDEGANNWIVHIEGGGWCHN----------V  76

Query  399   ENCSSRMGRELGSSFNMKPLI-FKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
               C  R    LGSS  M+    F G    N+ Y   FY WNRV VRYCDG SF GDVE+ 
Sbjct  77    TYCLYRRDSRLGSSHEMEEQTYFSGYLSDNQQYNPDFYNWNRVKVRYCDGSSFTGDVEEV  136

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP TKLYYRGARIF  V++EL+AKGM  A+N I  G SAGGL   +HCD F + FP   R
Sbjct  137   DPTTKLYYRGARIFSAVMEELLAKGMDHAENAILSGCSAGGLTTILHCDGFRALFPNETR  196

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+ V D     Y +  +S VVA H   KSLP  CTS +SP  CF P+ +  
Sbjct  197   VKCVSDAGYFVNVNDISGDHYIEDYYSQVVATHGSEKSLPSSCTSMLSPGLCFFPQYMAS  256

Query  933   YVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIIS  1091
              +++P+FI ++AYDS+Q++N        P   +R+ K N ++ SP  + ++QD++ Q + 
Sbjct  257   SIQTPIFIVNAAYDSWQIKNILAPGDADPDGQWRSCKTNLNNCSPEQLNIMQDYRTQFLE  316

Query  1092  ALP--KPSATKGFIVTSNFGHS--------FASNNYKKPMFADSKSKSIESGFYNWFFDK  1241
             AL     S + G  + S + H         F S++   PM  +   K++     +WF+++
Sbjct  317   ALSPISNSPSNGMFIDSCYVHCQTEPQETWFKSDS---PMVGN---KTVAKAVGDWFYER  370

Query  1242  HPINLID  1262
              P   ID
Sbjct  371   SPSREID  377



>gb|ADR82372.1| pectin acetylesterase [Populus trichocarpa]
Length=394

 Score =   283 bits (725),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 152/365 (42%), Positives = 208/365 (57%), Gaps = 30/365 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             IP TII+ A   GAVCLDGS P YHF  G G    NWL++++GGGWC S          V
Sbjct  27    IPITIIETAVSSGAVCLDGSQPGYHFDKGSGSGIDNWLVHMEGGGWCES----------V  76

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
             E+C SR     GSS  M K + F GI G  +     FY WNR+ VRYCDG SF GDVE  
Sbjct  77    ESCVSRRDTFRGSSSKMEKTMGFSGILGSKQAANPDFYNWNRIKVRYCDGSSFTGDVEAV  136

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP TKLY+RG R++Q V+DEL+AKGM++A+N I  G SAGGL   +HCD+F S  P   R
Sbjct  137   DPETKLYFRGERVWQAVIDELLAKGMQNARNAILSGCSAGGLAAILHCDKFQSLLPATAR  196

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+   D       ++ F  VV  H   K+LP  CTSKM+P  CF P+ + Q
Sbjct  197   VKCVSDAGYFIHGTDISGGSRIESFFGQVVKTHGSAKNLPASCTSKMNPELCFFPQYVAQ  256

Query  933   YVKSPLFIFHSAYDSFQVQNTF---PIDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLFI +SAYDS+Q++N      +D  +  K+        S S +  +QD++ Q + 
Sbjct  257   TMRTPLFIINSAYDSWQIKNILAPTAVDSKKEWKDCKLDLKKCSASQLQTVQDYRTQFLK  316

Query  1092  ALPK---PSATKGFIVTSNFGHSFASN-----NYKKPMFADSKSKSIESGFYNWFFDKHP  1247
             A+      S+T+G  + S + H  + +     N K P   D+K   +     +WF+D+  
Sbjct  317   AVDTGLGSSSTRGLWIDSCYAHCQSGSVSTWLNDKSPEVGDTK---MGKAVGDWFYDRSA  373

Query  1248  INLID  1262
             +  ID
Sbjct  374   MEKID  378



>ref|NP_001047850.1| Os02g0702400 [Oryza sativa Japonica Group]
 dbj|BAD07550.1| putative pectin acetylesterase [Oryza sativa Japonica Group]
 dbj|BAD08059.1| putative pectin acetylesterase [Oryza sativa Japonica Group]
 dbj|BAF09764.1| Os02g0702400 [Oryza sativa Japonica Group]
 dbj|BAG91018.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57637.1| hypothetical protein OsJ_08062 [Oryza sativa Japonica Group]
Length=397

 Score =   283 bits (725),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 159/399 (40%), Positives = 225/399 (56%), Gaps = 38/399 (10%)
 Frame = +3

Query  111   SNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAY  290
             +N  +CL   +LV ++ +  V+        D++D     T +  A  KGAVCLDGSPPAY
Sbjct  2     ANGGVCLSCSALVCALVFLTVD-------GDFVDI----TYVASAVAKGAVCLDGSPPAY  50

Query  291   HFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNM-KPLIFK  467
             H + G G   ++WL++ +GGGWC +          V  C  R    LGSS  M K + F 
Sbjct  51    HLARGFGSGVNSWLVHFEGGGWCSN----------VTTCLQRKRTRLGSSKQMAKQIAFS  100

Query  468   GIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAK  644
             GI     +Y   FY WN+V VRYCDG SF GDVEK DP TKL+YRGAR++Q V+D+L+AK
Sbjct  101   GILSNTPDYNPDFYNWNKVKVRYCDGSSFTGDVEKVDPATKLHYRGARVWQAVMDDLLAK  160

Query  645   GMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKA  824
             GM  A N +  G SAGGL   +HCDRF   FP   +VKCLSD+  F+  KD    +Y  A
Sbjct  161   GMNSANNALISGCSAGGLTSILHCDRFRDLFPVDTKVKCLSDAGFFINEKDIAGVEYIVA  220

Query  825   VFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF--  998
              F+ V   H   K+LP  CTS++SP  CF P+N V+ +++PLFI ++AYDS+QV+N    
Sbjct  221   FFNGVATTHGSAKNLPSACTSRLSPGMCFFPQNEVKQIQTPLFILNAAYDSWQVRNILVP  280

Query  999   ----PIDLYRAIKNGSSISP-SDMALLQDFKKQIISALPKPS--ATKGFIVTSNFGHSFA  1157
                 P   + + K+     P S + +LQ F+   + AL +    +T+G  + S F H   
Sbjct  281   GFADPHGKWHSCKHDIDQCPASQLQILQGFRDDFLKALKEQGTPSTRGLFINSCFVH--C  338

Query  1158  SNNYKKPMFADS----KSKSIESGFYNWFFDKHPINLID  1262
              +  ++  FA      ++K+I     +WF+D++P   ID
Sbjct  339   QSETQETWFASGSPMLETKTIADAVGDWFYDRNPFQKID  377



>ref|XP_011073252.1| PREDICTED: protein notum homolog isoform X2 [Sesamum indicum]
Length=398

 Score =   283 bits (725),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 151/365 (41%), Positives = 211/365 (58%), Gaps = 27/365 (7%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +  T +Q A  KGAVCLDGSPPAYH   G G   +NWL++++GGGWC +         
Sbjct  24    FFVDITYVQSAVAKGAVCLDGSPPAYHIDKGSGAGINNWLVHVEGGGWCNN---------  74

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              V  C +R    LGSS  M K + F GIF     +   FY WNR+ VRYCDG SF GDVE
Sbjct  75    -VTTCLARTKTRLGSSKLMAKQIAFSGIFSNKPQFNPDFYNWNRIKVRYCDGASFTGDVE  133

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               DP TKLYYRGAR+F  V+++L+AKGMK+A+N I  G SAGGL   +HCD F +  P G
Sbjct  134   VVDPATKLYYRGARVFVAVIEDLLAKGMKNAENAILSGCSAGGLTSILHCDNFKALLPVG  193

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKC SD+  F+  KD   A + +  ++DVV  H   K+LP  CTS+M P  CF P+N+
Sbjct  194   TKVKCFSDAGFFINAKDVSGAPHIQDFYNDVVTTHGSAKNLPQSCTSRMKPSLCFFPQNM  253

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIKNG-SSISPSDMALLQDFKKQI  1085
              Q +++PLFI ++AYDS+Q++N        P  L+   K      S + +  +Q+F+ Q 
Sbjct  254   AQGIRTPLFIVNAAYDSWQIKNILAPGVADPHGLWHDCKTDIVKCSTTQLQTMQEFRLQF  313

Query  1086  ISALP--KPSATKGFIVTSNFGHSFASNNYKKPMF-ADSK---SKSIESGFYNWFFDKHP  1247
             ++AL     S ++G+ +   + H       ++  F  DS    +K+I     +WF+D+ P
Sbjct  314   LNALSGLGSSTSRGYFINGCYAH--CQTEMQETWFRGDSPLLYNKTIAKAVGDWFYDRSP  371

Query  1248  INLID  1262
                ID
Sbjct  372   FQKID  376



>gb|KCW72720.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=420

 Score =   283 bits (725),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/360 (40%), Positives = 213/360 (59%), Gaps = 27/360 (8%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +Q A  KGAVCLDGSPPAYHF+ G G  A+NWL+  +GGGWC +          V  C
Sbjct  39    TYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQFEGGGWCNN----------VTTC  88

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              +R    LGSS  M K + F GI   N ++   FY WNR+ VRYCDG SF GDVE  DP 
Sbjct  89    LARRDTRLGSSKEMVKEVAFSGILSNNHSFNPDFYNWNRIKVRYCDGASFTGDVEAVDPA  148

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             TKL++RGAR F  ++++L++KGM DA+N I  G SAGGL   +HCDRF +  P    VKC
Sbjct  149   TKLHFRGARAFVAIIEDLLSKGMSDAENAILSGCSAGGLTSILHCDRFRALMPTSATVKC  208

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             ++D+  F+  KD   A++ +  +S+VVA H   K+LP  CTS++ P  CF P+N+V+ ++
Sbjct  209   VADAGYFINAKDISGAQHIETFYSEVVATHGSAKNLPTSCTSRLRPGLCFFPQNVVKQIQ  268

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +PLFI ++AYD++Q++N        P   + + K + ++ S   + ++QDF++Q + AL 
Sbjct  269   TPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDINNCSLDQLQIMQDFRQQFLDALS  328

Query  1101  K--PSATKGFIVTSNFGHSFASNNYKKPMFADSK----SKSIESGFYNWFFDKHPINLID  1262
             +   S ++G  + S + H    +  ++    D        SI     +W++D+ P   ID
Sbjct  329   RVGTSPSRGIFIDSCYAH--CQSEMQETWLRDDSPVLIETSIAKAVGDWYYDRRPFQKID  386



>ref|XP_004244682.2| PREDICTED: uncharacterized protein LOC101248898 [Solanum lycopersicum]
Length=390

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 157/390 (40%), Positives = 221/390 (57%), Gaps = 26/390 (7%)
 Frame = +3

Query  123   ICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHFSS  302
             +CL+IF L++      +    T         ++  TI++ A  KGAVCLDG+PPAY++  
Sbjct  10    LCLVIFCLIMLNDKVVIGEGET---------MVNLTILESAVSKGAVCLDGTPPAYYYEK  60

Query  303   GKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSS-FNMKPLIFKGIFG  479
             G GE A+NW+IY +GG WC     Y+ +D     C +R   E GSS + +K   F GI  
Sbjct  61    GYGEGANNWIIYFRGGEWC-----YNVID-----CVARTTTEKGSSKYALKQRSFYGILS  110

Query  480   MNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKD  656
              N+     FY WNRV+V YCDG SF GDVE  DP+ KL++RGARIF  +++  + KGMK+
Sbjct  111   NNKTINPDFYNWNRVMVIYCDGSSFTGDVELVDPINKLHFRGARIFLALIENFLEKGMKN  170

Query  657   AKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFSD  836
             AKN I  GGSAGGL   +HCDRF +  P   RVKCL+D S FL  +  +   +   V   
Sbjct  171   AKNAILSGGSAGGLPALIHCDRFKALLPNSARVKCLADGSYFLHREQMKEMAFMDTVNEG  230

Query  837   VVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFPIDLYR  1016
             ++ LH     LP  CTSKM+P  C  P+   + +K+P FI +S +D+FQ+  TFP     
Sbjct  231   LIKLHHSTNMLPSSCTSKMNPSLCLFPQYFQEGIKTPFFIVNSMFDTFQINKTFPGYYEN  290

Query  1017  AIKNGSSISPSDMALLQDFKKQIISALPKP--SATKGFIVTSNFGHSFASNNYKKPMFAD  1190
                N  + S S +  LQDFK+  I+ALPK   S+++G  + S   HS  ++      F+ 
Sbjct  291   LFSN--TCSTSLVKTLQDFKQDFINALPKQSNSSSRGMFIDSCLIHSQITSGVGWNGFS-  347

Query  1191  SKSKSIESGFYNWFFDKHPINLIDPNTVPI  1280
               +K+I   F +W+FDK    LID   +P+
Sbjct  348   VYNKTIAKTFSDWYFDKSHEQLIDKPDLPL  377



>ref|XP_011073171.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
Length=422

 Score =   283 bits (723),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 151/365 (41%), Positives = 211/365 (58%), Gaps = 27/365 (7%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +  T +Q A  KGAVCLDGSPPAYH   G G   +NWL++++GGGWC +         
Sbjct  48    FFVDITYVQSAVAKGAVCLDGSPPAYHIDKGSGAGINNWLVHVEGGGWCNN---------  98

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              V  C +R    LGSS  M K + F GIF     +   FY WNR+ VRYCDG SF GDVE
Sbjct  99    -VTTCLARTKTRLGSSKLMAKQIAFSGIFSNKPQFNPDFYNWNRIKVRYCDGASFTGDVE  157

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               DP TKLYYRGAR+F  V+++L+AKGMK+A+N I  G SAGGL   +HCD F +  P G
Sbjct  158   VVDPATKLYYRGARVFVAVIEDLLAKGMKNAENAILSGCSAGGLTSILHCDNFKALLPVG  217

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKC SD+  F+  KD   A + +  ++DVV  H   K+LP  CTS+M P  CF P+N+
Sbjct  218   TKVKCFSDAGFFINAKDVSGAPHIQDFYNDVVTTHGSAKNLPQSCTSRMKPSLCFFPQNM  277

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIKNG-SSISPSDMALLQDFKKQI  1085
              Q +++PLFI ++AYDS+Q++N        P  L+   K      S + +  +Q+F+ Q 
Sbjct  278   AQGIRTPLFIVNAAYDSWQIKNILAPGVADPHGLWHDCKTDIVKCSTTQLQTMQEFRLQF  337

Query  1086  ISALP--KPSATKGFIVTSNFGHSFASNNYKKPMF-ADSK---SKSIESGFYNWFFDKHP  1247
             ++AL     S ++G+ +   + H       ++  F  DS    +K+I     +WF+D+ P
Sbjct  338   LNALSGLGSSTSRGYFINGCYAH--CQTEMQETWFRGDSPLLYNKTIAKAVGDWFYDRSP  395

Query  1248  INLID  1262
                ID
Sbjct  396   FQKID  400



>ref|XP_009413211.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=397

 Score =   281 bits (720),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 147/363 (40%), Positives = 217/363 (60%), Gaps = 24/363 (7%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +P T+++GA ++GAVCLDGSPPAYHFS G G   +NWL++++GGGWC +         
Sbjct  31    FDVPMTLLEGAVDEGAVCLDGSPPAYHFSPGFGSGMNNWLVHMEGGGWCTN---------  81

Query  393   SVENCSSRMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEK  569
              V++C +R     GSS  MKPL F GI G ++N    FY WN+V +RYCDG SF GDV++
Sbjct  82    -VQDCLARRDTFRGSSKYMKPLSFSGILGNSQNSNPDFYNWNKVKIRYCDGSSFTGDVDE  140

Query  570   PDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGV  749
              DP TKLY+RGA+I+  V++EL+AKGM  A+N +  G SAGGL   +HCD+F    P G 
Sbjct  141   VDPATKLYFRGAKIWLAVIEELLAKGMNKAENALLSGCSAGGLASILHCDKFGDLLPAGA  200

Query  750   RVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLV  929
              VKCLSD+  F+  KD    +  KA +S+VV+ H   K+LP  CTS+M+P  CF P+ +V
Sbjct  201   TVKCLSDAGYFINAKDITGTESIKAYYSEVVSTHGSAKNLPSSCTSRMTPSMCFFPQYVV  260

Query  930   QYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQII  1088
               +++ LFI ++AYD++Q++N        P   +   K +    S   + ++Q F+ + +
Sbjct  261   PQMRTSLFILNAAYDAWQIKNILAPSAADPHKTWNDCKLDIKQCSSDQLQIMQGFRSEFL  320

Query  1089  SALPK--PSATKGFIVTSNFGHSFASNNYKKPMFADSKSKS---IESGFYNWFFDKHPIN  1253
             +AL     S+ +G  + S + H   S +    + ADS +     I     +WF+D+    
Sbjct  321   NALAALGNSSARGMFINSCYAHC-QSGSQDTWLAADSPALDNIPIGKAVGDWFYDRSAFR  379

Query  1254  LID  1262
              ID
Sbjct  380   KID  382



>ref|XP_009624845.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana tomentosiformis]
Length=390

 Score =   281 bits (720),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 161/405 (40%), Positives = 224/405 (55%), Gaps = 28/405 (7%)
 Frame = +3

Query  93    MAVSPRSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLD  272
             M +  RS     L IF L I +           +T++   + + KTI+  A  KGAVCLD
Sbjct  1     MMMVTRSFQLFVLFIFPLTIFITEC------AKVTQNPDVYNVTKTIVHSAVSKGAVCLD  54

Query  273   GSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNMK  452
             GSPPAYHF  G GE   NWL+ L GGGWC +          V++C +R   ++GSS  M 
Sbjct  55    GSPPAYHFDPGFGEGVGNWLVQLSGGGWCTN----------VKDCLNRSKSDVGSSSYMH  104

Query  453   PLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVD  629
             P  FKGIF  N++    FY WN+V VRYCDGGSF GDVE  DP T L++RGARIF  V++
Sbjct  105   PQPFKGIFSKNQSANPDFYNWNKVFVRYCDGGSFTGDVEYVDPATNLHFRGARIFTAVLE  164

Query  630   ELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHA  809
             EL+AKG+K+AKN I  G SAGG    ++CDRF +  P   RVKCL DS  F+  K+P   
Sbjct  165   ELLAKGLKNAKNAILAGSSAGGYPAILYCDRFRNLLPNTSRVKCLVDSGYFVHFKNPVLG  224

Query  810   KYFKAVFSDVVALHQPN--KSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQ  983
             + F++++  V  L      K+LP  CTSKM P  C   +N+ Q +K+P+FI  SA+D+  
Sbjct  225   RPFESIYKGVATLQLQGSAKTLPKSCTSKMKPELCLFAENIQQDIKTPIFISMSAFDNIM  284

Query  984   VQNTFPIDLYRAIKNGSSISPSDMALLQDFKKQIISALPK---PSATKGFIVTSNFGHSF  1154
              Q T    +Y  I+NG+  + S     Q+ +   +SA+PK   P     FI   +   S 
Sbjct  285   TQYTLGGTIYGCIQNGTCTA-SQNKTFQEMRSDFLSAIPKGNNPKLRGVFIDVVHHHTSL  343

Query  1155  ASNNY---KKPMFADSKSKSIESGFYNWFFDKHPINLIDPNTVPI  1280
                     +KP+   + +      F +W+FD++   LID + +P+
Sbjct  344   QKQTRWSPEKPIVVHNLAA--PKAFSDWYFDRNYTYLIDEHNLPL  386



>ref|XP_003547731.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
 ref|XP_006599118.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=398

 Score =   281 bits (720),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/362 (40%), Positives = 212/362 (59%), Gaps = 22/362 (6%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T+++ A+ KGAVCLDGSPPAYHF  G GE   NW+++++GGGWC +          V
Sbjct  27    VPLTLVENAESKGAVCLDGSPPAYHFDKGFGEGIDNWIVHIEGGGWCNN----------V  76

Query  399   ENCSSRMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPD  575
             E+C  R    LGSS  MK + F  I    + +   FY WNRV VRYCDG SF GDVE+ D
Sbjct  77    ESCLERKNTRLGSSKQMKDIYFSAILSNEQQFNPDFYNWNRVKVRYCDGSSFTGDVEEVD  136

Query  576   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRV  755
             P T L++RGARIF  V++EL+AKGMK+ KN I  G SAGGL   +HCD F +  P G  V
Sbjct  137   PTTNLHFRGARIFSAVMEELLAKGMKNVKNAILSGCSAGGLTTILHCDSFKALLPSGANV  196

Query  756   KCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  935
             KC+ D+  F+ V+D   A   +  +S+VV++H   K+LP  CTSK++P  CF P+ +  +
Sbjct  197   KCVPDAGYFVNVEDISGAHSIQEFYSEVVSIHGSAKNLPTSCTSKLNPALCFFPQYVASH  256

Query  936   VKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISA  1094
             + +P+F+ +SAYD +Q++N F      P + + + K N S+ S   ++ +Q FK +   A
Sbjct  257   ISTPIFVVNSAYDRWQIRNIFIPGSADPSNSWHSCKINISNCSTDQLSKIQGFKSEFERA  316

Query  1095  LPK--PSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
             L +   S +KG  + S + H  +     + K       + +I     +WF+ +   + +D
Sbjct  317   LSEVGDSPSKGMFIDSCYAHCQTELQETWLKSDSPQLANTTIAKAVGDWFYGRSSFHHVD  376

Query  1263  PN  1268
              N
Sbjct  377   CN  378



>ref|XP_002303225.2| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ABK93778.1| unknown [Populus trichocarpa]
 gb|ABK95483.1| unknown [Populus trichocarpa]
 gb|EEE78204.2| pectinacetylesterase family protein [Populus trichocarpa]
Length=394

 Score =   281 bits (720),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 153/399 (38%), Positives = 219/399 (55%), Gaps = 47/399 (12%)
 Frame = +3

Query  120   WICLLIFSL-VISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHF  296
             W+CL+++ L ++  + A+                IP TI+Q A  +GAVCLDGSPP YHF
Sbjct  9     WLCLIVYILTLLKTEGAS----------------IPMTIVQAAVARGAVCLDGSPPGYHF  52

Query  297   SSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNM-KPLIFKGI  473
               G G   +NWL++++GGGWC S          VE+C SR     GSS  M K + F GI
Sbjct  53    EKGSGSGINNWLVHMEGGGWCES----------VESCVSRRDTYKGSSLKMEKTMGFSGI  102

Query  474   FGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGM  650
              G  +     FY WNR+ +RYCDG SF GDVE  DP TKLY+RG RI+Q V+D+L+AKGM
Sbjct  103   LGSKQAANPDFYNWNRIKIRYCDGSSFTGDVEAVDPKTKLYFRGERIWQAVIDDLLAKGM  162

Query  651   KDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVF  830
             ++A+N I  G SAGGL   +HCD+F S  P   RVKC+SD+  F+   D       ++ F
Sbjct  163   RNARNAILSGCSAGGLAAILHCDKFQSLLPASARVKCVSDAGYFIHGTDISGGSRIESFF  222

Query  831   SDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF---P  1001
               VV  H   K LP  CTSK  P  CF P+ + Q +++PLFI +SAYDS+Q++N      
Sbjct  223   GQVVKTHGSAKHLPASCTSKTRPELCFFPQYVAQAMRTPLFIINSAYDSWQIKNILAPTA  282

Query  1002  IDLYRAIKNG----SSISPSDMALLQDFKKQIISALP---KPSATKGFIVTSNFGHSFAS  1160
             +D  +  KN        S + +  +Q+++ Q + A+      S+++G  + S + H  + 
Sbjct  283   VDSKKEWKNCKLDLKKCSATQLQTVQNYRTQFLKAVNIGLGSSSSRGLWINSCYAHCQSG  342

Query  1161  N-----NYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
             +       K P+  + K   I     +WF+D+     ID
Sbjct  343   SVSTWLADKSPVVGNVK---IGKAVGDWFYDRSAFEKID  378



>ref|XP_009797876.1| PREDICTED: protein notum homolog isoform X2 [Nicotiana sylvestris]
Length=388

 Score =   281 bits (719),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 158/403 (39%), Positives = 223/403 (55%), Gaps = 26/403 (6%)
 Frame = +3

Query  93    MAVSPRSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLD  272
             M +  RS     L IF+L I +           +T++   + I KTII  A  KGAVCLD
Sbjct  1     MMMVTRSFQLFVLFIFTLTIVITEC------AKVTQNPDVYNITKTIIHSAVSKGAVCLD  54

Query  273   GSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNMK  452
             GSPPAYHF  G G+   NWL+ L GGGWC +          V+ C  R   +LGSS  M 
Sbjct  55    GSPPAYHFDPGFGDGVGNWLVQLSGGGWCTN----------VKECLDRAKSDLGSSNYMN  104

Query  453   PLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVD  629
             P  F+G F  N++    FY WN+V VRYCDGGSF GDVE  DP TKL++RGARIF VV++
Sbjct  105   PQEFQGFFSKNQSANPEFYNWNKVFVRYCDGGSFTGDVEYVDPATKLHFRGARIFTVVLE  164

Query  630   ELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHA  809
             EL+AKG+K+AKN I  G SAGG    ++CD F +  P   RVKCL DS  F+  K+    
Sbjct  165   ELLAKGLKNAKNAILAGSSAGGYPAMLYCDGFRNSLPNTSRVKCLVDSGYFVHFKNTVLG  224

Query  810   KYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQ  989
             + F++++  +  L    K+LP  CTSKM P  C   +N+ Q +K+P+FI  SA+D+   Q
Sbjct  225   RPFESIYKGIATLQGSAKTLPKSCTSKMKPELCLFAENIQQDIKTPIFISMSAFDNIMTQ  284

Query  990   NTFPIDLYRAIKNGSSISPSDMALLQDFKKQIISALPKPSATK--GFIVTSNFGHSFASN  1163
              T    +Y  I+ G+  + S    LQ+ +   ++A+PK +  K  G  +     H+    
Sbjct  285   YTLGGGIYGCIQEGTCTA-SQNKTLQEMRSDFLNAIPKGNNPKLRGVFIDVVHHHTSLQK  343

Query  1164  NYK----KPMFADSKSKSIESGFYNWFFDKHPINLIDPNTVPI  1280
               +    KP+   + +      F +W+FD++   LID  ++P+
Sbjct  344   QTRWSPVKPIVVHNLAA--PKAFADWYFDRNYTYLIDERSLPL  384



>ref|XP_010056132.1| PREDICTED: protein notum homolog isoform X3 [Eucalyptus grandis]
 gb|KCW72716.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
 gb|KCW72717.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=439

 Score =   283 bits (723),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 144/360 (40%), Positives = 214/360 (59%), Gaps = 27/360 (8%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +Q A  KGAVCLDGSPPAYHF+ G G  A+NWL+  +GGGWC +          V  C
Sbjct  30    TYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQFEGGGWCNN----------VTTC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              +R    LGSS  M K + F GI   N ++   FY WNR+ VRYCDG SF GDVE  DP 
Sbjct  80    LARRDTRLGSSKEMVKEVAFSGILSNNHSFNPDFYNWNRIKVRYCDGASFTGDVEAVDPA  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             TKL++RGAR F  ++++L++KGM DA+N I  G SAGGL   +HCDRF +  P    VKC
Sbjct  140   TKLHFRGARAFVAIIEDLLSKGMSDAENAILSGCSAGGLTSILHCDRFRALMPTSATVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             ++D+  F+  KD   A++ +  +S+VVA H   K+LP  CTS++ P  CF P+N+V+ ++
Sbjct  200   VADAGYFINAKDISGAQHIETFYSEVVATHGSAKNLPTSCTSRLRPGLCFFPQNVVKQIQ  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +PLFI ++AYD++Q++N        P   + + K + ++ S   + ++QDF++Q + AL 
Sbjct  260   TPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDINNCSLDQLQIMQDFRQQFLDALS  319

Query  1101  K--PSATKGFIVTSNFGHSFASNNYKKPMFADSKSKSIESGFY----NWFFDKHPINLID  1262
             +   S ++G  + S + H    +  ++    D     IE+       +W++D+ P   ID
Sbjct  320   RVGTSPSRGIFIDSCYAH--CQSEMQETWLRDDSPVLIETSIAKAVGDWYYDRRPFQKID  377



>gb|KHN27509.1| Protein notum like [Glycine soja]
Length=398

 Score =   281 bits (719),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 144/362 (40%), Positives = 212/362 (59%), Gaps = 22/362 (6%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T+++ A+ KGAVCLDGSPPAYHF  G GE   NW+++++GGGWC +          V
Sbjct  27    VPLTLVENAESKGAVCLDGSPPAYHFDKGFGEGIDNWIVHIEGGGWCNN----------V  76

Query  399   ENCSSRMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPD  575
             E+C  R    LGSS  MK + F  I    + +   FY WNRV VRYCDG SF GDVE+ D
Sbjct  77    ESCLERKNTRLGSSKQMKDIYFSAILSNEQQFNPDFYNWNRVKVRYCDGSSFTGDVEEVD  136

Query  576   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRV  755
             P T L++RGARIF  V++EL+AKGMK+ KN I  G SAGGL   +HCD F +  P G  V
Sbjct  137   PTTNLHFRGARIFSAVMEELLAKGMKNVKNAILSGCSAGGLTTILHCDSFKALLPSGANV  196

Query  756   KCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  935
             KC+ D+  F+ V+D   A   +  +S+VV++H   K+LP  CTSK++P  CF P+ +  +
Sbjct  197   KCVPDAGYFVNVEDISGAHSIQEFYSEVVSIHGSAKNLPTSCTSKLNPALCFFPQYVASH  256

Query  936   VKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISA  1094
             + +P+F+ +SAYD +Q++N F      P + + + K N S+ S   ++ +Q FK +   A
Sbjct  257   ISTPIFVVNSAYDRWQIRNIFIPGSADPSNSWHSCKINISNCSTDQLSKIQGFKSEFERA  316

Query  1095  LPK--PSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
             L +   S +KG  + S + H  +     + K       + +I     +WF+ +   + +D
Sbjct  317   LSEVGDSPSKGVFIDSCYAHCQTELQETWLKSDSPQLANTTIAKAVGDWFYGRSSFHHVD  376

Query  1263  PN  1268
              N
Sbjct  377   CN  378



>ref|XP_010056129.1| PREDICTED: protein notum homolog isoform X1 [Eucalyptus grandis]
 ref|XP_010056130.1| PREDICTED: protein notum homolog isoform X1 [Eucalyptus grandis]
Length=445

 Score =   283 bits (723),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 144/360 (40%), Positives = 213/360 (59%), Gaps = 27/360 (8%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +Q A  KGAVCLDGSPPAYHF+ G G  A+NWL+  +GGGWC +          V  C
Sbjct  36    TYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQFEGGGWCNN----------VTTC  85

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              +R    LGSS  M K + F GI   N ++   FY WNR+ VRYCDG SF GDVE  DP 
Sbjct  86    LARRDTRLGSSKEMVKEVAFSGILSNNHSFNPDFYNWNRIKVRYCDGASFTGDVEAVDPA  145

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             TKL++RGAR F  ++++L++KGM DA+N I  G SAGGL   +HCDRF +  P    VKC
Sbjct  146   TKLHFRGARAFVAIIEDLLSKGMSDAENAILSGCSAGGLTSILHCDRFRALMPTSATVKC  205

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             ++D+  F+  KD   A++ +  +S+VVA H   K+LP  CTS++ P  CF P+N+V+ ++
Sbjct  206   VADAGYFINAKDISGAQHIETFYSEVVATHGSAKNLPTSCTSRLRPGLCFFPQNVVKQIQ  265

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +PLFI ++AYD++Q++N        P   + + K + ++ S   + ++QDF++Q + AL 
Sbjct  266   TPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDINNCSLDQLQIMQDFRQQFLDALS  325

Query  1101  K--PSATKGFIVTSNFGHSFASNNYKKPMFADSK----SKSIESGFYNWFFDKHPINLID  1262
             +   S ++G  + S + H    +  ++    D        SI     +W++D+ P   ID
Sbjct  326   RVGTSPSRGIFIDSCYAH--CQSEMQETWLRDDSPVLIETSIAKAVGDWYYDRRPFQKID  383



>ref|XP_006573492.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=400

 Score =   281 bits (719),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 148/361 (41%), Positives = 212/361 (59%), Gaps = 23/361 (6%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P TI+Q A  KGAVCLDGSPPAYHF  G G   +NWL+  +GGGWC +          V
Sbjct  27    VPITIVQNAVAKGAVCLDGSPPAYHFDKGFGSGINNWLVAFEGGGWCNN----------V  76

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
               C +R    LGSS  M K + F GI      +   FY WNR+ VRYCDG SF GDVE  
Sbjct  77    TTCLARKTNRLGSSKQMAKQIAFSGILNNRAMFNPDFYNWNRIKVRYCDGSSFTGDVEAV  136

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +PVTKL++RGARIF  V+++L+AKGMK+A+N I  G SAGGL   +HCDRF +  P+G R
Sbjct  137   NPVTKLHFRGARIFNAVMEDLLAKGMKNARNAIISGCSAGGLTSVLHCDRFRALLPRGAR  196

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKCLSD+  F+  KD    ++ +  FS VV  H   +SLP  CTS++S   CF P+ LV 
Sbjct  197   VKCLSDAGYFINAKDVLGEQHIEQYFSQVVVTHGSARSLPQSCTSRLSAKLCFFPQYLVS  256

Query  933   YVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIIS  1091
              + +P+F  ++AYDS+Q++N        P   + + K + ++ SP  + L+Q F+ + + 
Sbjct  257   RITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLR  316

Query  1092  ALP--KPSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLI  1259
             A+     S++KG  + S + H  +     + +    + K  +I     +WF+++ P + I
Sbjct  317   AITVLGNSSSKGMFIDSCYAHCQTEMQETWLRSDSPELKKTTIAKAVADWFYERRPFHQI  376

Query  1260  D  1262
             D
Sbjct  377   D  377



>gb|KHN27511.1| Protein notum like [Glycine soja]
Length=398

 Score =   281 bits (719),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 148/362 (41%), Positives = 216/362 (60%), Gaps = 22/362 (6%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T+++ ++ KGAVCLDGSPPAYHF  G G+  +NW+++++GGGWC  N+  S LD   
Sbjct  27    VPLTLVKNSETKGAVCLDGSPPAYHFDKGFGKGINNWIVHIEGGGWC--NNVTSCLD---  81

Query  399   ENCSSRMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPD  575
                  R    LGSS +M  + F  I    + +   FY WNRV VRYCDG SF GDVE+ D
Sbjct  82    -----RKNTTLGSSNHMSDISFYAILSNQQQFNPDFYNWNRVKVRYCDGSSFTGDVEEVD  136

Query  576   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRV  755
             P T L++RGARIF  V++EL+AKGMK+AKN I  G SAGGL   +HCD F +  P    V
Sbjct  137   PTTNLHFRGARIFSAVMEELLAKGMKNAKNAILSGCSAGGLTTILHCDSFKALLPSRANV  196

Query  756   KCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  935
             KC+ D+  F+ V+D   A  F+  +S+VV++H   K+LP  CTSK++P  CF P+ +  +
Sbjct  197   KCVPDAGYFVNVEDISGAHSFQEFYSEVVSIHGSAKNLPTSCTSKLNPALCFFPQYVASH  256

Query  936   VKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISA  1094
             + +P+F+ +SAYD +Q+ N F      P + + + K N S+ SP  ++ LQ FK +   A
Sbjct  257   ISTPIFVVNSAYDWWQIGNIFVPSSADPSNSWHSCKLNLSNCSPDQLSKLQGFKSEFQRA  316

Query  1095  LPK--PSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
             L +   S +KG  + S + H  +     + K       +K+I     +WF+ + P + ID
Sbjct  317   LSEVGDSPSKGMFIDSCYAHCQTETQETWFKSGSQLLANKTIAKAVGDWFYGRSPFHHID  376

Query  1263  PN  1268
              N
Sbjct  377   CN  378



>ref|XP_010056131.1| PREDICTED: protein notum homolog isoform X2 [Eucalyptus grandis]
Length=448

 Score =   283 bits (723),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 144/360 (40%), Positives = 214/360 (59%), Gaps = 27/360 (8%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +Q A  KGAVCLDGSPPAYHF+ G G  A+NWL+  +GGGWC +          V  C
Sbjct  39    TYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQFEGGGWCNN----------VTTC  88

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              +R    LGSS  M K + F GI   N ++   FY WNR+ VRYCDG SF GDVE  DP 
Sbjct  89    LARRDTRLGSSKEMVKEVAFSGILSNNHSFNPDFYNWNRIKVRYCDGASFTGDVEAVDPA  148

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             TKL++RGAR F  ++++L++KGM DA+N I  G SAGGL   +HCDRF +  P    VKC
Sbjct  149   TKLHFRGARAFVAIIEDLLSKGMSDAENAILSGCSAGGLTSILHCDRFRALMPTSATVKC  208

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             ++D+  F+  KD   A++ +  +S+VVA H   K+LP  CTS++ P  CF P+N+V+ ++
Sbjct  209   VADAGYFINAKDISGAQHIETFYSEVVATHGSAKNLPTSCTSRLRPGLCFFPQNVVKQIQ  268

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +PLFI ++AYD++Q++N        P   + + K + ++ S   + ++QDF++Q + AL 
Sbjct  269   TPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDINNCSLDQLQIMQDFRQQFLDALS  328

Query  1101  K--PSATKGFIVTSNFGHSFASNNYKKPMFADSKSKSIESGFY----NWFFDKHPINLID  1262
             +   S ++G  + S + H    +  ++    D     IE+       +W++D+ P   ID
Sbjct  329   RVGTSPSRGIFIDSCYAH--CQSEMQETWLRDDSPVLIETSIAKAVGDWYYDRRPFQKID  386



>ref|XP_009607289.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=399

 Score =   281 bits (718),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 146/392 (37%), Positives = 222/392 (57%), Gaps = 21/392 (5%)
 Frame = +3

Query  123   ICLLI--FSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHF  296
             +C+LI   +++I++         + I + Y    + KT++  A  KGAVCLDGSPPAYHF
Sbjct  10    VCVLICFLAIIINIDACVKENATSDIDQGYY---VEKTVVHNAVSKGAVCLDGSPPAYHF  66

Query  297   SSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNMKPLIFKGIF  476
               G G+    WL++L GG WC +          VE C +R   + GSS  MKP  F GI+
Sbjct  67    EPGFGDGVGKWLVHLSGGAWCTT----------VEECLNRSKSDFGSSKYMKPWWFIGIY  116

Query  477   GMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMK  653
                ++    FY WN+V VRYCDGG+F G+ E  DP T L++RGARIF+ V+++++AKG+K
Sbjct  117   SKTQSVNPDFYNWNKVFVRYCDGGAFTGNAEYVDPATNLHFRGARIFKAVMEDVLAKGLK  176

Query  654   DAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFS  833
             +A++ + +G SA G    ++CDRF    P   RVKC+ D+  F+ VKDP  A+ F  ++ 
Sbjct  177   NAQSALLIGSSAAGYPAMLYCDRFHKLLPNTPRVKCMVDAGYFIHVKDPHQARNFTQMYK  236

Query  834   DVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFPIDLY  1013
              +V LH   K+LP  C SKM P  CF P+N+   +K+PL+I  SA+D FQ+ NT   D  
Sbjct  237   AIVNLHGSAKTLPKSCISKMKPEMCFFPENMQHKIKTPLYIAMSAFDKFQI-NTTIYDGV  295

Query  1014  RAIKNGSSISPSDMALLQDFKKQIISALPK---PSATKGFIVTSNFGHSFASNNYKKPMF  1184
                  G + + ++  L +DF+ + ++ALPK   P     FI   N  H+     +     
Sbjct  296   NTCIEGGNCTATENKLFRDFRLEFLNALPKGNNPKLRGAFIDARNH-HTQVQGWWSPKNV  354

Query  1185  ADSKSKSIESGFYNWFFDKHPINLIDPNTVPI  1280
                K+ ++   F +W++D++   +ID   +PI
Sbjct  355   TTVKNLNLMKAFGDWYYDRNYTYVIDERDLPI  386



>ref|XP_004150551.1| PREDICTED: protein notum homolog [Cucumis sativus]
Length=539

 Score =   285 bits (728),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 154/359 (43%), Positives = 207/359 (58%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +Q A  KGAVCLDGSPPAYHFS G G   +NWLI L+GGGWC +          V  C
Sbjct  30    TYVQDAVIKGAVCLDGSPPAYHFSDGFGSGINNWLIQLEGGGWCNN----------VTTC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
               R    LGSS  M   L F GI      +   FY WNR+ VRYCDG SF GDVE  D  
Sbjct  80    LQRRDTRLGSSKKMVTQLAFSGILSNKPQFNPDFYNWNRIKVRYCDGSSFTGDVEAVDSA  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGAR+F+ ++D L+AKGMK+AKN I  G SAGGL   +HCD F S  P   +VKC
Sbjct  140   TNLHFRGARVFRAIIDNLLAKGMKNAKNAILSGCSAGGLSSILHCDNFKSLLPPTTKVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  F+  KD   A++ +  +SDVV  H   K+LP+ CTSKM P  CF P+N+VQ ++
Sbjct  200   LSDAGYFINAKDVSGAQHIEGFYSDVVTTHGSAKNLPISCTSKMKPEMCFFPQNVVQLIQ  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +P+F+ ++AYDS+Q++N        P   +   K +  + SP  +  +QDF+ Q +SAL 
Sbjct  260   TPIFLVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPIQLRTMQDFRVQFLSALN  319

Query  1101  --KPSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                 S ++G  + S + H   +   +  +  DS      +I     +WFFD+ P   ID
Sbjct  320   GVGSSLSRGLFIDSCYAHC-QTEMQETWLRTDSPVLSKTTIAKAVGDWFFDRAPFQKID  377



>gb|EPS71696.1| hypothetical protein M569_03061, partial [Genlisea aurea]
Length=395

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 150/370 (41%), Positives = 209/370 (56%), Gaps = 41/370 (11%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T + GA EKGAVCLDGSPPAYH   G G  A++WL++++GGGWC +          V  C
Sbjct  21    TYVDGAVEKGAVCLDGSPPAYHLDLGSGAGANSWLVHVEGGGWCNN----------VTTC  70

Query  408   SSRMGRELGSSFNMKPLI-FKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              +R    LGSS  M   I F GIF     +   FY WNRV VRYCDG SF GDVE  DP 
Sbjct  71    LARRDTRLGSSRRMATQIAFSGIFSNRPQFNPDFYNWNRVKVRYCDGASFTGDVEAVDPA  130

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             TKLYYRGAR+   V+++L+AKGMK+A+N +  G SAGGL   +HCD F +  P G RVKC
Sbjct  131   TKLYYRGARVLGAVIEDLLAKGMKNAENAVLSGCSAGGLTSILHCDAFKALLPVGTRVKC  190

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
              +D+  F+  +D   A +    ++DV   H   K+LP  CTS++ P  CF P+N+ Q ++
Sbjct  191   FADAGFFINARDVSGAAHINDFYNDVATTHGSAKNLPQGCTSRLKPGLCFFPQNVAQEIR  250

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIKNG-SSISPSDMALLQDFKKQII----  1088
             +PLFI ++AYDS+Q++N        P   +   K   +  S S +  +QDF+ Q +    
Sbjct  251   TPLFIVNAAYDSWQIKNILAPGVADPHGTWHDCKTDITKCSKSQLQTMQDFRTQFLKSLN  310

Query  1089  ----SALPKPSATKGFIVTSNFGHS--------FASNNYKKPMFADSKSKSIESGFYNWF  1232
                 S+L    ++KG+ + S + H         F S++   P+  D   K+I     +WF
Sbjct  311   DGVGSSLTSTPSSKGYFINSCYAHCQTEMQETWFRSDS---PLLND---KTIAEAIGDWF  364

Query  1233  FDKHPINLID  1262
             FD++    ID
Sbjct  365   FDRNSFQHID  374



>ref|XP_006587655.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
Length=453

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 151/364 (41%), Positives = 215/364 (59%), Gaps = 26/364 (7%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P TI+Q A  KGAVCLDGSPPAYHF  G G   +NWL+  +GGGWC +          V
Sbjct  27    VPITIVQNAVAKGAVCLDGSPPAYHFDRGFGSGINNWLVAFEGGGWCNN----------V  76

Query  399   ENCSSRMGRELGSSFNMKPLI-FKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
               C +R    LGSS  M  LI F GI    E +   FY WNR+ VRYCDG SF GDVE  
Sbjct  77    TTCLARKTNRLGSSKQMAKLIAFSGILNNREMFNPDFYNWNRIKVRYCDGSSFTGDVEAV  136

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNV---IFVGGSAGGLGVFVHCDRFTSRFPK  743
             +PVTKL++RG RIF  V+++L+AKGMK+A+NV   I  G SAGGL   +HCDRF +  P+
Sbjct  137   NPVTKLHFRGGRIFNAVMEDLLAKGMKNARNVREAIISGCSAGGLTSVLHCDRFRALLPR  196

Query  744   GVRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKN  923
             G RVKCLSD+  F+  KD    ++ +  FS VVA H   ++LP  CTS++SP  CF P+ 
Sbjct  197   GARVKCLSDAGYFINGKDVLGEQHIEQYFSQVVATHGSARNLPQSCTSRLSPRLCFFPQY  256

Query  924   LVQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQ  1082
             LV  + +P+F  ++AYDS+Q++N        P   + + K + ++ SP  + L+Q F+ +
Sbjct  257   LVSRITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTE  316

Query  1083  IISALP--KPSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPI  1250
              + A+     S++KG  + S + H  +     + +    + K  +I     +WF+++ P 
Sbjct  317   FLRAITVLGNSSSKGMFIDSCYAHCQTEMQETWLRSDSPELKKTTIAKAVADWFYERRPF  376

Query  1251  NLID  1262
             + ID
Sbjct  377   HQID  380



>ref|XP_006573491.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
Length=447

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 148/361 (41%), Positives = 212/361 (59%), Gaps = 23/361 (6%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P TI+Q A  KGAVCLDGSPPAYHF  G G   +NWL+  +GGGWC +          V
Sbjct  27    VPITIVQNAVAKGAVCLDGSPPAYHFDKGFGSGINNWLVAFEGGGWCNN----------V  76

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
               C +R    LGSS  M K + F GI      +   FY WNR+ VRYCDG SF GDVE  
Sbjct  77    TTCLARKTNRLGSSKQMAKQIAFSGILNNRAMFNPDFYNWNRIKVRYCDGSSFTGDVEAV  136

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +PVTKL++RGARIF  V+++L+AKGMK+A+N I  G SAGGL   +HCDRF +  P+G R
Sbjct  137   NPVTKLHFRGARIFNAVMEDLLAKGMKNARNAIISGCSAGGLTSVLHCDRFRALLPRGAR  196

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKCLSD+  F+  KD    ++ +  FS VV  H   +SLP  CTS++S   CF P+ LV 
Sbjct  197   VKCLSDAGYFINAKDVLGEQHIEQYFSQVVVTHGSARSLPQSCTSRLSAKLCFFPQYLVS  256

Query  933   YVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIIS  1091
              + +P+F  ++AYDS+Q++N        P   + + K + ++ SP  + L+Q F+ + + 
Sbjct  257   RITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLR  316

Query  1092  ALP--KPSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLI  1259
             A+     S++KG  + S + H  +     + +    + K  +I     +WF+++ P + I
Sbjct  317   AITVLGNSSSKGMFIDSCYAHCQTEMQETWLRSDSPELKKTTIAKAVADWFYERRPFHQI  376

Query  1260  D  1262
             D
Sbjct  377   D  377



>gb|KHN41756.1| Protein notum like [Glycine soja]
Length=449

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 148/361 (41%), Positives = 212/361 (59%), Gaps = 23/361 (6%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P TI+Q A  KGAVCLDGSPPAYHF  G G   +NWL+  +GGGWC +          V
Sbjct  27    VPITIVQNAVAKGAVCLDGSPPAYHFDKGFGSGINNWLVAFEGGGWCNN----------V  76

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
               C +R    LGSS  M K + F GI      +   FY WNR+ VRYCDG SF GDVE  
Sbjct  77    TTCLARKTNRLGSSKQMAKQIAFSGILNNRAMFNPDFYNWNRIKVRYCDGSSFTGDVEAV  136

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +PVTKL++RGARIF  V+++L+AKGMK+A+N I  G SAGGL   +HCDRF +  P+G R
Sbjct  137   NPVTKLHFRGARIFNAVMEDLLAKGMKNARNAIISGCSAGGLTSVLHCDRFRALLPRGAR  196

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKCLSD+  F+  KD    ++ +  FS VV  H   +SLP  CTS++S   CF P+ LV 
Sbjct  197   VKCLSDAGYFINAKDVLGEQHIEQYFSQVVVTHGSARSLPQSCTSRLSAKLCFFPQYLVS  256

Query  933   YVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIIS  1091
              + +P+F  ++AYDS+Q++N        P   + + K + ++ SP  + L+Q F+ + + 
Sbjct  257   RITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLR  316

Query  1092  ALP--KPSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLI  1259
             A+     S++KG  + S + H  +     + +    + K  +I     +WF+++ P + I
Sbjct  317   AITVLGNSSSKGMFIDSCYAHCQTEMQETWLRSDSPELKKTTIAKAVADWFYERRPFHQI  376

Query  1260  D  1262
             D
Sbjct  377   D  377



>ref|XP_003548585.1| PREDICTED: protein notum homolog [Glycine max]
Length=398

 Score =   280 bits (715),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 148/362 (41%), Positives = 215/362 (59%), Gaps = 22/362 (6%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T+++ ++ KGAVCLDGSPPAYHF  G G+  +NW+++++GGGWC  N+  S LD   
Sbjct  27    VPLTLVKNSETKGAVCLDGSPPAYHFDKGFGKGINNWIVHIEGGGWC--NNVTSCLD---  81

Query  399   ENCSSRMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPD  575
                  R    LGSS +M  + F  I    + +   FY WNRV VRYCDG SF GDVE+ D
Sbjct  82    -----RKNTTLGSSNHMSDISFYAILSNQQQFNPDFYNWNRVKVRYCDGSSFTGDVEEVD  136

Query  576   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRV  755
             P T L++RGARIF  V++EL+AKGMK+AKN I  G SAGGL   +HCD F +  P    V
Sbjct  137   PTTNLHFRGARIFSAVMEELLAKGMKNAKNAILSGCSAGGLTTILHCDSFKALLPSRANV  196

Query  756   KCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  935
             KC+ D+  F+ V+D   A  F+  +S+VV++H   K+LP  CTSK +P  CF P+ +  +
Sbjct  197   KCVPDAGYFVNVEDISGAHSFQEFYSEVVSIHGSAKNLPTSCTSKHNPALCFFPQYVASH  256

Query  936   VKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISA  1094
             + +P+F+ +SAYD +Q+ N F      P + + + K N S+ SP  ++ LQ FK +   A
Sbjct  257   ISTPIFVVNSAYDWWQIGNIFVPSSADPSNSWHSCKLNLSNCSPDQLSKLQGFKSEFQRA  316

Query  1095  LPK--PSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
             L +   S +KG  + S + H  +     + K       +K+I     +WF+ + P + ID
Sbjct  317   LSEVGDSPSKGMFIDSCYAHCQTETQETWFKSGSQLLANKTIAKAVGDWFYGRSPFHHID  376

Query  1263  PN  1268
              N
Sbjct  377   CN  378



>ref|XP_010327577.1| PREDICTED: uncharacterized protein LOC101244626 [Solanum lycopersicum]
Length=398

 Score =   279 bits (714),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 149/366 (41%), Positives = 208/366 (57%), Gaps = 29/366 (8%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
              ++  TI++ A  KGAVCLDG+PPAYH   G G   ++W+I L+GGGWC +         
Sbjct  21    LLVNITILESAVAKGAVCLDGTPPAYHLDRGSGSGVNSWVISLEGGGWCQN---------  71

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              V +C +R    LGSS  M   L F G+   +  +   F+ WNRV VRYCDGGSF GDVE
Sbjct  72    -VTSCLTRKNTRLGSSAKMDHQLPFSGMMSNDPKFNPEFHSWNRVSVRYCDGGSFTGDVE  130

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               DP T+L+YRGARIF+ +++EL+A+GMK ++N I  G SAGGL   +HCD F    P  
Sbjct  131   AIDPATRLHYRGARIFKAIMEELLAQGMKKSQNAILSGCSAGGLATILHCDNFRMLLPNN  190

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
             V+VKC SD+  F+   D     Y +  F+DVV LH   KSLP  CTSK+ P  CF P+N+
Sbjct  191   VKVKCFSDAGYFIHRNDISGKPYIEQYFNDVVTLHGSAKSLPSSCTSKLKPGLCFFPENV  250

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
              Q +K+PLFI ++AYD +QV+N        P   + + K N  + +P+ + +LQ F+K  
Sbjct  251   AQQIKTPLFIINAAYDHWQVRNILVAPGSDPKGAWTSCKANIKNCTPNQLKILQGFRKDF  310

Query  1086  ISALP--KPSATKGFIVTSNFGHSFASNN-----YKKPMFADSKSKSIESGFYNWFFDKH  1244
             + AL    PS+T+G+ + S F H  +           P   +   K+I     +WF +  
Sbjct  311   LKALDGLGPSSTRGYYINSCFSHCQSQQQAYWFGLNSPRLFN---KTIAEAVRDWFLETD  367

Query  1245  PINLID  1262
                 ID
Sbjct  368   QYRHID  373



>ref|XP_003547822.1| PREDICTED: protein notum homolog [Glycine max]
 gb|KHN26082.1| Protein notum like [Glycine soja]
Length=398

 Score =   279 bits (714),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 146/366 (40%), Positives = 215/366 (59%), Gaps = 28/366 (8%)
 Frame = +3

Query  216   IIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLS  395
             ++P T+++ A+ KGAVCLDGSPPAYHF +G  E   NW+++++GGGWC +          
Sbjct  26    LVPLTLVKNAESKGAVCLDGSPPAYHFDNGFEEGIKNWIVHIEGGGWCNN----------  75

Query  396   VENCSSRMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
             VE+C  R    LGSS  M+ L F  I    + Y   FY WNRV VRYCDG SF GDVE+ 
Sbjct  76    VESCLYRKDSRLGSSKQMEDLYFSAILSNEQEYNPDFYNWNRVKVRYCDGSSFTGDVEEV  135

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             D  T L++RGARIF  V++EL+AKG++ A+N I  G SAGGL   +HCDRF +  P    
Sbjct  136   DQTTNLHFRGARIFSAVMEELLAKGLEKAENAILSGCSAGGLTTILHCDRFKNLLPSEAN  195

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+ D+  F+ V+D     + +  +S+VV+ H   K+LP  CTSK SP  CF P+ +  
Sbjct  196   VKCVPDAGYFVNVEDISGTHFIEKFYSEVVSTHGSAKNLPSSCTSKFSPELCFFPQYVAS  255

Query  933   YVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIIS  1091
             ++ +P+F+ ++AYDS+Q+QN F      P D + + K + S+ SP  ++ +QDFK +   
Sbjct  256   HISTPIFVVNAAYDSWQIQNIFVPGSADPSDSWHSCKLDISNCSPDQLSKMQDFKSEFEK  315

Query  1092  ALP--KPSATKGFIVTSNFGHSFASNN---YK--KPMFADSKSKSIESGFYNWFFDKHPI  1250
             A+     S++KG  + S + H    +    YK   P  A++   +I     +WF+ +   
Sbjct  316   AVSVVGDSSSKGMFIDSCYAHCQTESQETWYKSDSPQLANT---TIAKAVGDWFYGRSSF  372

Query  1251  NLIDPN  1268
               +D N
Sbjct  373   RHVDCN  378



>ref|XP_007156332.1| hypothetical protein PHAVU_003G277600g [Phaseolus vulgaris]
 gb|ESW28326.1| hypothetical protein PHAVU_003G277600g [Phaseolus vulgaris]
Length=399

 Score =   279 bits (713),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/364 (39%), Positives = 212/364 (58%), Gaps = 23/364 (6%)
 Frame = +3

Query  216   IIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLS  395
             ++P T+++ A  KGAVCLDGSPPAYHF  G GE  +NW+++++GGGWC   D        
Sbjct  26    LVPLTLVENALSKGAVCLDGSPPAYHFDKGDGEGINNWIVHMEGGGWCKDAD--------  77

Query  396   VENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEK  569
               +C  R    LGSS  M + L F GI      Y   FY W+RV +RYCDG SF GDVE+
Sbjct  78    --DCLGRKDTRLGSSKQMVEDLYFSGILSNEREYNPDFYNWDRVKIRYCDGSSFTGDVEE  135

Query  570   PDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGV  749
              DP   LY+RGARIF  V+++L+AKGM+ A+N I  G SAGGL   +HCD F +  P   
Sbjct  136   VDPTNNLYFRGARIFSAVMEDLLAKGMEKAENAILSGCSAGGLTTILHCDNFKALLPSKA  195

Query  750   RVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLV  929
              VKC+ D+  F+ V+D   A++ +  +S VV+ H   K+LP  CTSK+S   CF P+ + 
Sbjct  196   TVKCVPDAGYFINVEDISGARFIEDYYSKVVSTHGSAKNLPTSCTSKLSSGLCFFPQYVA  255

Query  930   QYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQII  1088
              ++ +P+FI +SAYDS+Q++N        P D + + K + +  SP  ++++Q FKK+  
Sbjct  256   SHISTPIFIVNSAYDSWQIRNILAPGAADPSDNWHSCKLDLAKCSPDQLSIVQGFKKEFE  315

Query  1089  SALP--KPSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINL  1256
              A+     S++ G  + S + H  + +   + K       + +I     NWF+D+ P + 
Sbjct  316   KAVSVVGDSSSNGMFINSCYDHCQTESQETWSKSDSPHLANTTISKAVGNWFYDRSPFHH  375

Query  1257  IDPN  1268
             +D N
Sbjct  376   VDCN  379



>ref|XP_002519911.1| pectin acetylesterase, putative [Ricinus communis]
 gb|EEF42515.1| pectin acetylesterase, putative [Ricinus communis]
Length=399

 Score =   279 bits (713),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 147/359 (41%), Positives = 211/359 (59%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  KGAVCLDGSPPAYH   G G   ++WL++ +GGGWC +          +  C
Sbjct  30    TYVKNAVAKGAVCLDGSPPAYHLDKGFGTGINSWLVHFEGGGWCNN----------ITTC  79

Query  408   SSRMGRELGSSFNMKPLI-FKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR    LGSS  M P I F GI      Y   FY WNRV +RYCDG SF GDV+  +P 
Sbjct  80    LSRKNTRLGSSKQMGPQIAFSGIMSNRRRYNPDFYNWNRVKIRYCDGSSFTGDVQAVNPA  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGARI+  V++EL+AKGMK+A+N +  G SAGGL   +HCD F +  P G  VKC
Sbjct  140   TNLHFRGARIWLAVIEELLAKGMKNAENALLSGCSAGGLASILHCDGFRALLPMGTNVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  F+  +D   A + +  F++VV+LH   K+LP+ CTS++ P  CF P+ LVQ ++
Sbjct  200   LSDAGYFINARDVSGAAHIQTYFNEVVSLHGSAKNLPLSCTSRLKPALCFFPQYLVQQIR  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +PLFI ++AYDS+Q++N        P   + + K + ++ SP  +  +QDF+ + +SAL 
Sbjct  260   TPLFILNAAYDSWQIKNILAPGVADPRGSWNSCKLDINNCSPIQLKTMQDFRMRFLSALY  319

Query  1101  KP--SATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
             +   S++KG  + S + H   +   +    ADS       I     +WF+D+ P   ID
Sbjct  320   RSANSSSKGLYIDSCYAHC-QTETQETWFMADSPVLSKTKIAKAVGDWFYDRIPFQKID  377



>ref|XP_006365947.1| PREDICTED: uncharacterized protein LOC102601254 [Solanum tuberosum]
Length=401

 Score =   279 bits (713),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 155/399 (39%), Positives = 223/399 (56%), Gaps = 17/399 (4%)
 Frame = +3

Query  99    VSPRSNDWICLLIFSLVISVQYANVNPIPTPITEDYLD--FIIPKTIIQGADEKGAVCLD  272
             +S RS   +CLLI SL IS +  +     +   E   D  + + KTI+Q +  KGAVCLD
Sbjct  1     MSTRSVQLVCLLICSLAIS-KTDSTKANESLKQEKGADHAYFVDKTIVQNSVSKGAVCLD  59

Query  273   GSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNMK  452
             GSPPAYH   G G    NW+I L GG WC +            +C +R   +LGSS  M 
Sbjct  60    GSPPAYHLDRGFGHGLRNWIILLSGGAWCRN----------TTDCLNRSKTDLGSSTLML  109

Query  453   PLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVD  629
             P IF GIF  ++     FY WN+V VRYCDGG+F GD+E  DP T L++RGARIF  +++
Sbjct  110   PFIFLGIFSKSKRENPDFYNWNKVFVRYCDGGAFTGDIENVDPATNLHFRGARIFDAIIE  169

Query  630   ELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHA  809
             +L+AKG+KDAKN I  GGSA G    ++CD F S   K  RVKCL D+  F+ VK+P  A
Sbjct  170   DLLAKGLKDAKNAILSGGSANGYPAMLYCDHFRSLLHKAHRVKCLVDAGYFIRVKNPLLA  229

Query  810   KYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQ  989
               F+++F DVV LH   K LP  CTS+M P  CF  +N+ + +K+P F   SA+DS+QV 
Sbjct  230   NVFESIFRDVVTLHGSTKVLPKSCTSRMKPELCFFLENIQRDIKTPFFTVMSAFDSYQVN  289

Query  990   NTFPIDLYRAIKNGSSISPSDMALLQDFKKQIISALPKPS--ATKGFIVTSNFGHSFASN  1163
             +    D+   I+   + + S     ++ + + + ALPK +    +G  + S   H+    
Sbjct  290   SIIGSDIGEYIQ-ARNCTESQNNAFKELRSEFLRALPKANDPKQRGAFIDSFNRHTQLEL  348

Query  1164  NYKKPMFADSKSKSIESGFYNWFFDKHPINLIDPNTVPI  1280
              + K       + +    F +W++D+    +ID + +P+
Sbjct  349   WWNKINATPVYNLTTIKVFGDWYYDRKYSYVIDEHDLPL  387



>ref|XP_006652763.1| PREDICTED: protein notum homolog [Oryza brachyantha]
Length=383

 Score =   278 bits (711),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 142/356 (40%), Positives = 206/356 (58%), Gaps = 23/356 (6%)
 Frame = +3

Query  234   IQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSS  413
             ++ A  KGAVCLDGSPP YHFS G G  A+NWL++++GGGWC ++          + CS 
Sbjct  23    LKSAVSKGAVCLDGSPPVYHFSPGSGPGANNWLVHMEGGGWCRNS----------QECSV  72

Query  414   RMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKL  590
             R G   GSS  M+PL F GI G ++ Y   FY WNRV +RYCDG SF GDVE  +  T L
Sbjct  73    RKGNFRGSSKFMRPLSFSGILGGSQKYNPDFYNWNRVKIRYCDGSSFTGDVETVETSTNL  132

Query  591   YYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSD  770
             +YRGAR++  +++EL++ GM  A+N +  G SAGGL   +HCD+F    P   +VKC SD
Sbjct  133   HYRGARVWNAIIEELLSMGMSKAQNALLSGCSAGGLSAILHCDKFRDMLPATAKVKCFSD  192

Query  771   SSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPL  950
             +  F+  KD     + +  + ++V LH+  K+LPV CTSKMSP  CF P+N+V  +++PL
Sbjct  193   AGYFIDGKDITGNNFVRTFYKEIVNLHESAKNLPVSCTSKMSPDMCFFPQNVVPTLRTPL  252

Query  951   FIFHSAYDSFQVQNTFPIDLYRAIKNGS-------SISPSDMALLQDFKKQIISALPKPS  1109
             FI ++AYDS+Q++N          K  +       S S S + +LQ+F+ + ++ALPKP 
Sbjct  253   FILNAAYDSWQIKNVLAPSAADKKKTWAQCKLDIKSCSSSQLTILQNFRAEFLAALPKPG  312

Query  1110  A---TKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
                 T    + S   H  S + + + +      +   I     +WF+D+     ID
Sbjct  313   QSPPTMSMFIDSCHAHCQSGSQDTWLEEDSPKVEKTQIGRAVGDWFYDREVSRRID  368



>gb|KDP28066.1| hypothetical protein JCGZ_19474 [Jatropha curcas]
Length=395

 Score =   278 bits (711),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 148/365 (41%), Positives = 212/365 (58%), Gaps = 30/365 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             IP TI++ A  +GAVCLDGSPPAYHF  G G  A+NW+++++GGGWC            +
Sbjct  28    IPITIVETAKTRGAVCLDGSPPAYHFDKGYGSGANNWIVHMEGGGWCDD----------I  77

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
             E+C  R     GSS  M K + F GI G  +     FY WNR+ ++YCDG SF GDVE  
Sbjct  78    ESCLERRDTYKGSSLKMEKTMGFSGILGSKQAANPDFYNWNRIKIKYCDGSSFTGDVEAV  137

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP TKLY+RG RI++ V+D+L+AKGM++A+N I  G SAGGL   +HCD+F S  P   +
Sbjct  138   DPKTKLYFRGERIWRAVIDDLLAKGMRNAQNAILSGCSAGGLASILHCDKFRSLLPASAK  197

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD       +  +  VV LH   K+LP  CTS+M P  CF P+N+ Q
Sbjct  198   VKCVSDAGYFIHGKDIAGGYEIENFYGRVVRLHGSAKNLPTSCTSRMRPELCFFPQNVAQ  257

Query  933   YVKSPLFIFHSAYDSFQVQNTF---PIDLYRAIKNGSS----ISPSDMALLQDFKKQIIS  1091
              +++PLF+ +SAYDS+Q++N      +D   + K+  +     S S +  +QDF+ Q I+
Sbjct  258   TMQTPLFVINSAYDSWQIKNILAPSAVDKKGSFKSCKTDLKKCSASQLQTVQDFRLQFIN  317

Query  1092  ALPKPSATK---GFIVTSNFGHSFASN-----NYKKPMFADSKSKSIESGFYNWFFDKHP  1247
             AL    A K   G  + S   H  + +     + K P+ +++K   I     +WF+D+  
Sbjct  318   ALNSGVANKPANGMFINSCHAHCQSGSVSTWFDAKSPVLSNTK---IGKAVGDWFYDRAS  374

Query  1248  INLID  1262
                ID
Sbjct  375   FKKID  379



>ref|XP_010911666.1| PREDICTED: protein notum homolog [Elaeis guineensis]
Length=388

 Score =   278 bits (710),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 148/391 (38%), Positives = 213/391 (54%), Gaps = 36/391 (9%)
 Frame = +3

Query  120   WICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHFS  299
             WI L++  + ++V+                 F +P T++Q A  KGAVCLDGSPPAYHF+
Sbjct  9     WIYLIVLLISLTVE----------------GFDVPLTLVQDAVAKGAVCLDGSPPAYHFA  52

Query  300   SGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNMKPLIFKGIFG  479
              G G    NWL++++GGGWC +          VE C  R     GSS  M+ L F GI G
Sbjct  53    PGFGSGVDNWLVHMEGGGWCSN----------VEECKQRTKNFRGSSKYMEQLSFSGILG  102

Query  480   MNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKD  656
               +  +  FY WN+V +RYCDG SF GD+E  +P T L++RGAR+++ ++DEL+AKGM  
Sbjct  103   NKQTSSPDFYNWNKVKIRYCDGSSFTGDIEAVNPATNLHFRGARVWRAIMDELLAKGMNK  162

Query  657   AKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFSD  836
             A+N +  G SAGGL   +HCD F    P G  VKC SD+  F+  KD    +  K  +S 
Sbjct  163   AQNALLSGCSAGGLASILHCDSFRDLLPAGATVKCFSDAGYFIDAKDVSGKESIKDFYSQ  222

Query  837   VVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF------  998
             VV +H   K+LP  CTS   P  CF P+ +VQ +++PLFI ++AYD++Q++N        
Sbjct  223   VVTIHGSAKNLPSSCTSSFPPSMCFFPQYVVQSMRTPLFILNAAYDAWQIKNILAPSPSD  282

Query  999   PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALPKPSATKGFIVTSNFGH--SFASNNY  1169
             P  ++   K +    S S + +LQDF+ + + ALP  S + G  + S + H  S A   +
Sbjct  283   PSKVWGECKLDIKKCSSSQLQVLQDFRSEFLHALPANSPSTGLFIDSCYSHCQSGAQETW  342

Query  1170  KKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
                        SI     +WF+ +  I  ID
Sbjct  343   LSSNSPAIDKMSIAKAVGDWFYGRSAIQKID  373



>ref|XP_011082149.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
 ref|XP_011082150.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
 ref|XP_011082151.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
Length=398

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/358 (40%), Positives = 209/358 (58%), Gaps = 23/358 (6%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +  T ++ A  KGAVCLDGSPPAYH   G G   +NWL++++GGGWC +         
Sbjct  24    FYVDITYVRSAVAKGAVCLDGSPPAYHLDRGYGTGINNWLVHIEGGGWCNN---------  74

Query  393   SVENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              V  C +R    LGSS + +K L F GI     N+   FY WNRV VRYCDG SF GDVE
Sbjct  75    -VTTCLARKNNRLGSSKYMVKQLAFSGILNNKANFNPDFYNWNRVKVRYCDGASFTGDVE  133

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               +PVTKL+YRGAR+F  V+++L+AKGMK+A+N +  G SAGGL   +HCD F +  P G
Sbjct  134   AVNPVTKLHYRGARVFLAVMEDLLAKGMKNAENAVLSGCSAGGLAAILHCDSFKALLPMG  193

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKC SD+  F+  KD   A++ +A + DVV+ H   K+LP  CTS+M P  CF P+ +
Sbjct  194   TKVKCFSDAGYFINTKDVSGAQHIEAFYHDVVSTHGSAKNLPRSCTSRMKPSLCFFPQYV  253

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIKNG-SSISPSDMALLQDFKKQI  1085
              + +++PLFI ++AYDS+Q++N        P   +   K   +  S + +  +Q F+ + 
Sbjct  254   AREIRTPLFIINAAYDSWQIKNILAPGVADPHGTWHNCKTDINKCSATQLQTMQGFRLEF  313

Query  1086  ISAL--PKPSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHP  1247
             I AL     S ++G+ + S + H  +     + +       +K+I     +WF+D+ P
Sbjct  314   IRALYGLGVSTSRGYFINSCYAHCQTEMQETWYRSDSPKLNNKTIAKAVGDWFYDRSP  371



>ref|XP_003547821.1| PREDICTED: protein notum homolog [Glycine max]
 gb|KHN26083.1| Protein notum like [Glycine soja]
Length=398

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/365 (39%), Positives = 213/365 (58%), Gaps = 26/365 (7%)
 Frame = +3

Query  216   IIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLS  395
             ++P  +++ A+ KGAVCLDGSPPAYHF  G GE  ++W+++++GGGWC +          
Sbjct  26    LVPLILVENAESKGAVCLDGSPPAYHFDKGFGEGINSWIVHIEGGGWCNN----------  75

Query  396   VENCSSRMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
             +E+C  R    LGSS  M+ + F GI    + +   FY WNRV VRYCDG SF GDVE+ 
Sbjct  76    IESCLDRKDTRLGSSKQMEDIYFSGILSNEQQFNPDFYNWNRVKVRYCDGSSFTGDVEEV  135

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP T L++RGARIF  V++EL+AKG++ A+N I  G SAGGL   +HCD F +  P    
Sbjct  136   DPTTNLHFRGARIFSAVIEELLAKGLERAENAILSGCSAGGLTTILHCDSFKTFLPSRAN  195

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+ D+  F+ V+D   A + +  +S+VV+ H   K+LP  CTSK+SP  CF P+ +  
Sbjct  196   VKCVPDAGYFVNVEDISGAHFIQQYYSEVVSTHGSAKNLPTSCTSKLSPTLCFFPQYVAS  255

Query  933   YVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIIS  1091
             ++ +P+F+ +SAYDS+Q++  F      P D + + K N S+ SP  ++ LQ FK +   
Sbjct  256   HISTPIFVVNSAYDSWQIRYIFVPGSADPSDSWNSCKVNMSNCSPDQLSKLQGFKSEFER  315

Query  1092  ALPK--PSATKGFIVTSNFGHSFASNNYKKPMFADSKSK----SIESGFYNWFFDKHPIN  1253
             AL +   S +KG  + S + H       ++  F     K    +I     +WF+ +    
Sbjct  316   ALSEVGDSPSKGMFIDSCYAH--CQTEPQETWFKTDSPKLANTTIAKAVADWFYGRSSFR  373

Query  1254  LIDPN  1268
              +D N
Sbjct  374   HVDCN  378



>ref|XP_006878664.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda]
 gb|ERM94809.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda]
Length=398

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/365 (40%), Positives = 207/365 (57%), Gaps = 27/365 (7%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +  T +  A  KGAVCLDGSPPAYH   G G   +NWL++++GGGWC +         
Sbjct  24    FFVDITYVTTAVAKGAVCLDGSPPAYHLDKGSGSGINNWLVHVEGGGWCSN---------  74

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              V  C SR    LGSS  M K L F G+ G   +    FY WNRV VRYCDG SF GDVE
Sbjct  75    -VTTCFSRKNTRLGSSNQMVKQLAFSGLLGNKASMNPDFYNWNRVKVRYCDGASFTGDVE  133

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
             + DP TKL++RG RI+  V+++L+AKGM++A+N I  G SAGGL   +HCD F +  P G
Sbjct  134   EVDPATKLHFRGGRIWLAVIEDLLAKGMRNAENAILSGCSAGGLTSILHCDSFRALLPIG  193

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKC++D+  F+  KD   A + ++ F DVV LH   K+LP  CTS++ P  CF P+ +
Sbjct  194   AKVKCVADAGYFINAKDVSQADHIQSFFDDVVTLHDSAKNLPQSCTSRLKPSLCFFPQYM  253

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
              Q +++P F+ ++AYDS+QV+NT       P   +   K +    + S +  LQDF+ + 
Sbjct  254   AQGIRTPFFLLNAAYDSWQVKNTLAPGVADPHGTWHNCKLDIKKCTASQLQTLQDFRLEF  313

Query  1086  ISALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADSK----SKSIESGFYNWFFDKHP  1247
             +SAL     S + G  + S + H    +  ++    D        SI     +WF+D+ P
Sbjct  314   LSALKGVGSSPSIGMFINSCYAH--CQSEVQETWLRDDSPVLGGTSIAKAVGDWFYDRSP  371

Query  1248  INLID  1262
                ID
Sbjct  372   FQKID  376



>ref|XP_003580427.1| PREDICTED: uncharacterized protein LOC100827238 isoform X2 [Brachypodium 
distachyon]
Length=391

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/355 (41%), Positives = 205/355 (58%), Gaps = 22/355 (6%)
 Frame = +3

Query  234   IQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSS  413
             ++ A  KGAVCLDGSPP YHFS G G  A+NW+++++GGGWC ++          E CS 
Sbjct  32    LKSAVAKGAVCLDGSPPVYHFSPGSGSGANNWVVHMEGGGWCKTS----------EECSI  81

Query  414   RMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKL  590
             R G   GSS  MKPL F GI G ++ +   FY WNRV VRYCDG SF GDVE  +  T L
Sbjct  82    RKGNFRGSSKYMKPLSFSGILGGSDKFNPDFYNWNRVKVRYCDGSSFTGDVEAVETSTNL  141

Query  591   YYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSD  770
             +YRG R++Q ++ +L+ +GM  A+N +  G SAGGL   +HCDRF+   P   +VKC SD
Sbjct  142   HYRGNRVWQAIIQDLLDRGMSKAQNALLSGCSAGGLAAILHCDRFSDLLPASAKVKCFSD  201

Query  771   SSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPL  950
             +  F    D     Y +  + D+V LH   KSLP  CTSK SP  CF P+ ++  +++PL
Sbjct  202   AGYFFDGTDITGNNYVRKSYKDIVNLHGSAKSLPSSCTSKRSPELCFFPQYVIPTLRTPL  261

Query  951   FIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALPKP-  1106
             FI ++AYD++Q++N        P   +   K +  S S S +  LQ+F+K  ++ALP+P 
Sbjct  262   FILNAAYDTWQIRNILAPNAADPKKTWAKCKLDIKSCSSSQLVTLQNFRKDFLAALPQPG  321

Query  1107  -SATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
              S + G  + S F H  S A + +        +   I     +WF+++H   LID
Sbjct  322   QSPSLGIFIDSCFAHCQSGAQDTWIGEGSPSIQKMRIGKAVGDWFYNRHVSQLID  376



>ref|XP_009797875.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana sylvestris]
Length=390

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 158/405 (39%), Positives = 223/405 (55%), Gaps = 28/405 (7%)
 Frame = +3

Query  93    MAVSPRSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLD  272
             M +  RS     L IF+L I +           +T++   + I KTII  A  KGAVCLD
Sbjct  1     MMMVTRSFQLFVLFIFTLTIVITEC------AKVTQNPDVYNITKTIIHSAVSKGAVCLD  54

Query  273   GSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNMK  452
             GSPPAYHF  G G+   NWL+ L GGGWC +          V+ C  R   +LGSS  M 
Sbjct  55    GSPPAYHFDPGFGDGVGNWLVQLSGGGWCTN----------VKECLDRAKSDLGSSNYMN  104

Query  453   PLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVD  629
             P  F+G F  N++    FY WN+V VRYCDGGSF GDVE  DP TKL++RGARIF VV++
Sbjct  105   PQEFQGFFSKNQSANPEFYNWNKVFVRYCDGGSFTGDVEYVDPATKLHFRGARIFTVVLE  164

Query  630   ELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHA  809
             EL+AKG+K+AKN I  G SAGG    ++CD F +  P   RVKCL DS  F+  K+    
Sbjct  165   ELLAKGLKNAKNAILAGSSAGGYPAMLYCDGFRNSLPNTSRVKCLVDSGYFVHFKNTVLG  224

Query  810   KYFKAVFSDVVALHQPN--KSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQ  983
             + F++++  +  L      K+LP  CTSKM P  C   +N+ Q +K+P+FI  SA+D+  
Sbjct  225   RPFESIYKGIATLQLQGSAKTLPKSCTSKMKPELCLFAENIQQDIKTPIFISMSAFDNIM  284

Query  984   VQNTFPIDLYRAIKNGSSISPSDMALLQDFKKQIISALPKPSATK--GFIVTSNFGHSFA  1157
              Q T    +Y  I+ G+  + S    LQ+ +   ++A+PK +  K  G  +     H+  
Sbjct  285   TQYTLGGGIYGCIQEGTCTA-SQNKTLQEMRSDFLNAIPKGNNPKLRGVFIDVVHHHTSL  343

Query  1158  SNNYK----KPMFADSKSKSIESGFYNWFFDKHPINLIDPNTVPI  1280
                 +    KP+   + +      F +W+FD++   LID  ++P+
Sbjct  344   QKQTRWSPVKPIVVHNLAA--PKAFADWYFDRNYTYLIDERSLPL  386



>ref|XP_010240371.1| PREDICTED: uncharacterized protein LOC100827238 isoform X1 [Brachypodium 
distachyon]
Length=404

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/355 (41%), Positives = 205/355 (58%), Gaps = 22/355 (6%)
 Frame = +3

Query  234   IQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSS  413
             ++ A  KGAVCLDGSPP YHFS G G  A+NW+++++GGGWC ++          E CS 
Sbjct  45    LKSAVAKGAVCLDGSPPVYHFSPGSGSGANNWVVHMEGGGWCKTS----------EECSI  94

Query  414   RMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKL  590
             R G   GSS  MKPL F GI G ++ +   FY WNRV VRYCDG SF GDVE  +  T L
Sbjct  95    RKGNFRGSSKYMKPLSFSGILGGSDKFNPDFYNWNRVKVRYCDGSSFTGDVEAVETSTNL  154

Query  591   YYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSD  770
             +YRG R++Q ++ +L+ +GM  A+N +  G SAGGL   +HCDRF+   P   +VKC SD
Sbjct  155   HYRGNRVWQAIIQDLLDRGMSKAQNALLSGCSAGGLAAILHCDRFSDLLPASAKVKCFSD  214

Query  771   SSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPL  950
             +  F    D     Y +  + D+V LH   KSLP  CTSK SP  CF P+ ++  +++PL
Sbjct  215   AGYFFDGTDITGNNYVRKSYKDIVNLHGSAKSLPSSCTSKRSPELCFFPQYVIPTLRTPL  274

Query  951   FIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALPKP-  1106
             FI ++AYD++Q++N        P   +   K +  S S S +  LQ+F+K  ++ALP+P 
Sbjct  275   FILNAAYDTWQIRNILAPNAADPKKTWAKCKLDIKSCSSSQLVTLQNFRKDFLAALPQPG  334

Query  1107  -SATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
              S + G  + S F H  S A + +        +   I     +WF+++H   LID
Sbjct  335   QSPSLGIFIDSCFAHCQSGAQDTWIGEGSPSIQKMRIGKAVGDWFYNRHVSQLID  389



>ref|XP_010439718.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 154/396 (39%), Positives = 220/396 (56%), Gaps = 40/396 (10%)
 Frame = +3

Query  117   DWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHF  296
              W+ LL+ SLVI              TE      +  T ++ A  KGAVCLDGSPPAYH 
Sbjct  6     QWLVLLVCSLVIMK------------TEG---LFVNITYVRNAVAKGAVCLDGSPPAYHL  50

Query  297   SSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNM-KPLIFKGI  473
               G G   ++WLI L+GGGWC +          V NC SRM   LGSS  M + L F  I
Sbjct  51    DRGSGTGVNSWLIQLEGGGWCNN----------VTNCLSRMHTRLGSSKKMVENLAFSAI  100

Query  474   FGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGM  650
                 + Y   FY WNRV VRYCDG SF GDV+  +P T L++RGARI+  V+ EL+AKGM
Sbjct  101   LSNKKQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVMQELLAKGM  160

Query  651   KDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVF  830
             ++A+N +  G SAGGL   +HCD F +  P G RVKCLSD+  FL  +D    +Y K  F
Sbjct  161   RNAENAVLSGCSAGGLASLMHCDSFRALLPMGSRVKCLSDAGFFLNTRDVSGVQYIKQYF  220

Query  831   SDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF----  998
              DVV LH   K+LP  CTS+++P  CF P+ + + +++PLFI ++AYDS+Q++N      
Sbjct  221   QDVVTLHGSAKNLPRSCTSRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRA  280

Query  999   --PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALPK--PSATKGFIVTSNFGHSFASN  1163
               P   +++ + +  +  PS + ++QDF+ + +SA+     S+++G  + S + H   + 
Sbjct  281   ADPYGKWQSCQLDIKNCHPSQLKVMQDFRLEFLSAVISLGRSSSRGMFIDSCYTHC-QTE  339

Query  1164  NYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                   + DS      +I     +W +D+     ID
Sbjct  340   TQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKID  375



>gb|EYU29131.1| hypothetical protein MIMGU_mgv1a007782mg [Erythranthe guttata]
Length=394

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/366 (40%), Positives = 209/366 (57%), Gaps = 29/366 (8%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +  T ++ A  KGAVCLDGS PAYHF  G G   +NWL++++GGGWC  N+A +    
Sbjct  20    FFVDITYVESAVAKGAVCLDGSAPAYHFDKGSGAGINNWLVHIEGGGWC--NNATT----  73

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
                 C +R    LGSS  M K + F GIF     +   FY WNR+ VRYCDG SF GDVE
Sbjct  74    ----CLARRNGRLGSSKQMAKQIAFSGIFSNKPQFNPDFYNWNRLKVRYCDGASFTGDVE  129

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               DP TKLYYRGAR+F  V+++L+AKGMK+A+N I  G SAGGL   ++CDRF S  P  
Sbjct  130   AVDPATKLYYRGARVFVAVIEDLLAKGMKNAENAILSGCSAGGLTSILNCDRFKSLLPIS  189

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
               VKC +D+  F+  KD   A++ +  ++DVV  H   K L   CTSKM P  CF P+N+
Sbjct  190   TNVKCFADAGFFINAKDVSGAQHIEQFYNDVVTTHGSAKHLAQSCTSKMKPSLCFFPENM  249

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIKNG-SSISPSDMALLQDFKKQI  1085
             VQ +++P+F+ ++AYDS+Q++N        P  L+   K      S + +  +Q+++ + 
Sbjct  250   VQAIQTPIFVVNAAYDSWQIKNILAPGVADPHGLWHNCKTDIKKCSTTQLQTMQEYRLEF  309

Query  1086  ISALP--KPSATKGFIVTSNFGHSFASNNYK-----KPMFADSKSKSIESGFYNWFFDKH  1244
             + AL     + +KG+ + S + H              PM     +K+I     +WF+++ 
Sbjct  310   LKALSGLMSAKSKGYFINSCYAHCQTETQETWSTNISPML---NNKTIAKAVGDWFYERS  366

Query  1245  PINLID  1262
             P   ID
Sbjct  367   PFEKID  372



>ref|XP_004509558.1| PREDICTED: protein notum homolog [Cicer arietinum]
Length=397

 Score =   276 bits (706),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 146/362 (40%), Positives = 213/362 (59%), Gaps = 25/362 (7%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T ++ A  KGAVCLDGSPP +HF  G G+  +NW+++++GGGWC +          V
Sbjct  25    VPMTRLENAVSKGAVCLDGSPPTFHFDEGHGDGVNNWIVHIEGGGWCHN----------V  74

Query  399   ENCSSRMGRELGSSFNMKPL-IFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
             ++C  R    LGSS +MK    F G    N+ +   FY WNRV VRYCDG SF GDVE+ 
Sbjct  75    QDCLGRKNSRLGSSDHMKEKSYFSGYLSNNQQFNPDFYNWNRVKVRYCDGSSFTGDVEEV  134

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP TKL++RGARIF  V++EL+A+GM  AKN I  G SAGGL   +HCD F +  P G R
Sbjct  135   DPTTKLHFRGARIFSAVMEELLARGMVHAKNAILSGCSAGGLTSILHCDGFKALLPNGAR  194

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+ VKD    ++ +  F  VV  H   K+LP  CTS +SP  CF P+ +  
Sbjct  195   VKCVSDAGYFVNVKDISGEQFIEEYFRQVVETHGSAKNLPTSCTSTLSPGLCFFPQYMAS  254

Query  933   YVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIIS  1091
              +K+P+FI ++AYDS+Q++N        P   +R+ K N  + SP  + ++QD++ Q + 
Sbjct  255   GIKTPIFIVNAAYDSWQIKNILAPGAADPNGQWRSCKTNLINCSPKQLNIMQDYRSQFLK  314

Query  1092  ALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINL  1256
             AL     S++ G  + S + H   +   +  + +DS    +K+I     +WF+++     
Sbjct  315   ALSVVGNSSSNGMFIDSCYIHC-QTEPQETWLQSDSPTVANKTIAGAVADWFYERSASRE  373

Query  1257  ID  1262
             ID
Sbjct  374   ID  375



>ref|XP_010449357.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   276 bits (705),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 154/396 (39%), Positives = 220/396 (56%), Gaps = 40/396 (10%)
 Frame = +3

Query  117   DWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHF  296
              W+ LL+ SLVI              TE      +  T ++ A  KGAVCLDGSPPAYH 
Sbjct  6     QWLVLLVCSLVIMK------------TEG---LFVNITYVRNAVAKGAVCLDGSPPAYHL  50

Query  297   SSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNM-KPLIFKGI  473
               G G   ++WLI L+GGGWC +          V NC SRM   LGSS  M + L F  I
Sbjct  51    HRGSGTGVNSWLIQLEGGGWCNN----------VTNCLSRMHTRLGSSKKMVENLAFSAI  100

Query  474   FGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGM  650
                 + Y   FY WNRV VRYCDG SF GDV+  +P T L++RGARI+  V+ EL+AKGM
Sbjct  101   LSNKKQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVMQELLAKGM  160

Query  651   KDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVF  830
             ++A+N +  G SAGGL   +HCD F +  P G RVKCLSD+  FL  +D    +Y K  F
Sbjct  161   RNAENAVLSGCSAGGLASLMHCDSFRALLPMGSRVKCLSDAGFFLNTRDVSGVQYIKQYF  220

Query  831   SDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF----  998
              DVV LH   K+LP  CTS+++P  CF P+ + + +++PLFI ++AYDS+Q++N      
Sbjct  221   QDVVTLHGSAKNLPRSCTSRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRA  280

Query  999   --PIDLYRAIK-NGSSISPSDMALLQDFKKQIISAL--PKPSATKGFIVTSNFGHSFASN  1163
               P   +++ + +  +  PS + ++QDF+ + +SA+     S+++G  + S + H   + 
Sbjct  281   ADPYGKWQSCQLDIKNCHPSQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHC-QTE  339

Query  1164  NYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                   + DS      +I     +W +D+     ID
Sbjct  340   TQTSWFWQDSPILNRTTIAKAVGDWVYDRKLFQKID  375



>dbj|BAJ97261.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00807.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=393

 Score =   275 bits (704),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 147/355 (41%), Positives = 202/355 (57%), Gaps = 22/355 (6%)
 Frame = +3

Query  234   IQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSS  413
             ++ A  KGAVCLDGSPP YHFS G G  A NW+++++GGGWC +           E C+ 
Sbjct  34    VKSAVAKGAVCLDGSPPVYHFSPGSGSGADNWVVHMEGGGWCKT----------PEECAV  83

Query  414   RMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKL  590
             R G   GSS  MKPL F GI G ++ Y   FY WNRV VRYCDG SF GDVE+ D  T L
Sbjct  84    RKGNFRGSSKYMKPLSFSGILGGSQQYNPDFYNWNRVKVRYCDGSSFTGDVEEVDSSTNL  143

Query  591   YYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSD  770
             +YRGAR++  ++++L+ +GM  AKN I  G SAGGL   +HCD+F    P    VKC+SD
Sbjct  144   HYRGARVWDAIIEDLLNRGMSKAKNAILSGCSAGGLAAILHCDKFNDLLPPSASVKCVSD  203

Query  771   SSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPL  950
             +  F+   D    K+ +  F +VV LH   K+LP  CTS+ SP  CF P++++  +K+PL
Sbjct  204   AGYFIDGTDITGNKFVRTSFKNVVNLHGSVKNLPSSCTSRTSPELCFFPQHVLPTLKTPL  263

Query  951   FIFHSAYDSFQVQNTFPIDLYRAIKNGS-------SISPSDMALLQDFKKQIISALPKP-  1106
             FI ++AYDS+Q++N          K  +         S S +  LQ F+ + +SALPKP 
Sbjct  264   FILNAAYDSWQIRNILVPSAADKKKEWAKCKLDIKGCSSSQLVTLQHFRDEFLSALPKPG  323

Query  1107  -SATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
              S + G  + S F H  S A +++        +   I     +WFFD+     ID
Sbjct  324   QSPSVGMFIDSCFAHCQSGAQDSWNADGSPSLQKTKIGKAVGDWFFDRAVSQRID  378



>ref|XP_010644665.1| PREDICTED: uncharacterized protein LOC100245856 [Vitis vinifera]
 emb|CBI29219.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 153/400 (38%), Positives = 218/400 (55%), Gaps = 42/400 (11%)
 Frame = +3

Query  108   RSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPA  287
             R+  W+ +L FSL++              TE    F +  T +  A  KGAVCLDGSPPA
Sbjct  5     RTGHWLSILAFSLILLK------------TEG---FYVGITYVDSAVAKGAVCLDGSPPA  49

Query  288   YHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNM-KPLIF  464
             YH   G G   +NWL++++GGGWC  N+A          C +R    LGSS  M K + F
Sbjct  50    YHMDKGFGAGINNWLVHIEGGGWC--NNA--------STCLARRDNRLGSSKQMVKQIAF  99

Query  465   KGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMA  641
              GI    + +   FY WN++ VRYCDG SF GDVE  DP T L+YRGAR+F  V+++LMA
Sbjct  100   SGILSNKQKFNPDFYNWNKIKVRYCDGASFTGDVEAVDPKTNLHYRGARVFLAVIEDLMA  159

Query  642   KGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFK  821
             KGMK+A N +  G SAGGL   +HCD+F +  P   +VKC +D+  F+  KD   A + +
Sbjct  160   KGMKNAANAVLSGCSAGGLTAILHCDKFRALLPVSTKVKCFADAGYFINAKDVSGAAHIE  219

Query  822   AVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF-  998
               +S+VVA H   K+LP  CTS + P  CF P+N+ Q +K+PLFI ++AYDS+Q++N   
Sbjct  220   GFYSEVVATHGSAKNLPPSCTSSLRPGLCFFPQNMAQQIKTPLFIINAAYDSWQIKNILA  279

Query  999   -----PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALPK--PSATKGFIVTSNFGHSF  1154
                  P   +   K +    S S +  +QDF+ Q +SA+     S +KG  + S + H  
Sbjct  280   PGVADPHGTWHYCKLDIKDCSSSQLEAMQDFRVQFLSAIKGLIGSPSKGMFINSCYAH--  337

Query  1155  ASNNYKKPMFADSK----SKSIESGFYNWFFDKHPINLID  1262
                  ++    D        +I     +W++D+ P   ID
Sbjct  338   CQTEMQETWLRDDSPVLGKTTIAKAVGDWYYDRSPFQKID  377



>ref|XP_007158098.1| hypothetical protein PHAVU_002G123900g [Phaseolus vulgaris]
 gb|ESW30092.1| hypothetical protein PHAVU_002G123900g [Phaseolus vulgaris]
Length=400

 Score =   275 bits (704),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 151/398 (38%), Positives = 222/398 (56%), Gaps = 38/398 (10%)
 Frame = +3

Query  108   RSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPA  287
             R   W+ LL+ +L+  +  A+  PI               T +Q A  KGAVCLDGSPP 
Sbjct  5     RIRQWLNLLVCALLSLMAEASYVPI---------------TYLQNAVAKGAVCLDGSPPG  49

Query  288   YHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNM-KPLIF  464
             YHF  G G   +NWL+  +GGGWC +          V  C SR    LGSS  M K + F
Sbjct  50    YHFDRGSGTGINNWLVAFEGGGWCNN----------VTTCLSRKTNHLGSSKQMAKQIAF  99

Query  465   KGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMA  641
              GI      +   FY WNR+ VRYCDG SF GDVE  +PVTKL++RGARIF  V+++L+A
Sbjct  100   SGIMSNRPMFNPDFYNWNRIKVRYCDGSSFTGDVEAVNPVTKLHFRGARIFAAVMEDLLA  159

Query  642   KGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFK  821
             KGMK+A+N I  G SAGGL   +HCDRF +  P+  RVKC+SD+  F+  +D   A + +
Sbjct  160   KGMKNARNAIISGCSAGGLTAVLHCDRFKALLPREARVKCVSDAGYFINARDVTGAYHIQ  219

Query  822   AVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF-  998
               FS VVA H   ++LP  CTS+++P  CF P+ LV ++ +P+F  ++AYDS+Q++N   
Sbjct  220   QYFSQVVATHGSARNLPQSCTSRLTPKLCFFPQYLVSHITTPIFFVNAAYDSWQIKNILA  279

Query  999   -----PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP--KPSATKGFIVTSNFGH--  1148
                  P   + + K + ++ SP  + L+Q F+ + + AL     S+ KG  + S + H  
Sbjct  280   PGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLRALTVLGNSSYKGMFIDSCYAHCQ  339

Query  1149  SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
             +     + +    + +  +I     +WF+++   + ID
Sbjct  340   TEMQETWLRNDSPELEKTTIAKAVADWFYERRTFHQID  377



>ref|XP_009771151.1| PREDICTED: uncharacterized protein LOC104221730 [Nicotiana sylvestris]
Length=402

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/359 (42%), Positives = 207/359 (58%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +Q A  KGAVCLDGSPPAYHF  G G   +NW I L+GG WC  N+A +        C
Sbjct  30    TYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWFIQLEGGAWC--NNATT--------C  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR    LGSS  M K + F GI      +   FY WNR+ +RYCDG SF GDVE  DP 
Sbjct  80    LSRTKTRLGSSKLMVKTVSFSGILSNKAKFNPDFYNWNRIRIRYCDGSSFTGDVEAVDPR  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             TK+YYRGARIF  V+++ +AKGMK+A+N I  G SAG L   +HCDRF    P G +VKC
Sbjct  140   TKVYYRGARIFSAVMEDFLAKGMKNAQNAILAGCSAGSLAAILHCDRFKGLLPPGAKVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  F+  K    A + +  +SDVV  H   K+LP  CTS++ P  CF P+N+ Q +K
Sbjct  200   LSDAGFFINAKTISGASHIEQFYSDVVNTHGSAKNLPQSCTSRLKPGLCFFPQNVAQQIK  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +PLF+ ++AYDS+Q++N        P   +R  K +    S + +  +Q ++ + + AL 
Sbjct  260   TPLFLVNAAYDSWQIKNILAPGVADPRGTWRNCKLDILKCSSAQLETMQGYRNEFLKALN  319

Query  1101  --KPSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                PS+T+G+ + S + H   +   +  +  DS    S +I     +WF+D++    ID
Sbjct  320   GLGPSSTRGYYINSCYAHC-QTGTQETWLRDDSPRLASTTIAKAVGDWFYDRNRFQEID  377



>ref|XP_002519912.1| pectin acetylesterase, putative [Ricinus communis]
 gb|EEF42516.1| pectin acetylesterase, putative [Ricinus communis]
Length=452

 Score =   276 bits (707),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/365 (40%), Positives = 211/365 (58%), Gaps = 30/365 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             IP TI++ A  +GAVCLDGSPPAYH+  G G  A+NW+++++GGGWC            +
Sbjct  85    IPITIVETAKARGAVCLDGSPPAYHYDKGYGTGANNWIVHMEGGGWCDD----------L  134

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
             E+CS R     GSS  M K + F GI G  ++    FY WNR+ ++YCDG SF GDVE  
Sbjct  135   ESCSQRKDTYKGSSLKMEKTMGFSGILGGKQSANPDFYNWNRIKIKYCDGSSFTGDVEVV  194

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             D  T L++RG RI+Q V+D+L+AKGM++A+N I  G SAGGL   +HCD+F S  P   R
Sbjct  195   DAKTNLHFRGERIWQAVIDDLLAKGMRNAQNAILSGCSAGGLAAILHCDKFRSLLPASAR  254

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD    ++ +  F  VV LH   KSLP  CT+KM P  CF P+ + Q
Sbjct  255   VKCVSDAGFFIHGKDVAGGRHIENFFGSVVRLHGSAKSLPASCTAKMRPELCFFPQYVAQ  314

Query  933   YVKSPLFIFHSAYDSFQVQNTF---PIDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ +SAYDS+Q++N      +D   + K+        S + +  +QDF+ Q I 
Sbjct  315   TMRTPLFLINSAYDSWQIKNVLAPSAVDKKGSWKSCKLDLKKCSAAQLQTVQDFRTQFIG  374

Query  1092  ALPKPSATK---GFIVTSNFGHSFASN-----NYKKPMFADSKSKSIESGFYNWFFDKHP  1247
             AL      K   G+ + S + H  + +       K P+ +++K   I     +WF+D+  
Sbjct  375   ALSGGVTNKPANGYFINSCYAHCQSGSLATWLADKSPVVSNTK---IGKAVGDWFYDRAT  431

Query  1248  INLID  1262
                ID
Sbjct  432   FQKID  436



>ref|XP_009108426.1| PREDICTED: protein notum homolog [Brassica rapa]
 emb|CDX76482.1| BnaA08g09180D [Brassica napus]
Length=391

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 151/364 (41%), Positives = 209/364 (57%), Gaps = 29/364 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  399   ENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
              +CS+R     GSS F  K   F GI G  +N    FY WNR+ VRYCDG SF G+VE  
Sbjct  74    ASCSARKNTMKGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGNVEAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +P  KL++RGAR+++ V+D+LMAKGMK+A+N I  G SAG L   +HCD F +  P   R
Sbjct  134   NPANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPPTAR  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+   D     Y +  +S VVALH   KSLPV CTSKM P  CF P+N+V 
Sbjct  194   VKCVSDAGYFIHGTDISGGSYIQTYYSKVVALHGSAKSLPVSCTSKMKPELCFFPQNVVP  253

Query  933   YVKSPLFIFHSAYDSFQVQNTF---PIDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +  KN        + + +  +Q F+ Q++ 
Sbjct  254   SMRTPLFVINAAFDSWQIKNVLAPTAVDKRKEWKNCKLDLKKCTAAQLKTVQGFRDQMMR  313

Query  1092  ALPKPSAT--KGFIVTSNFGH----SFAS-NNYKKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL    +T  +G  + S   H    S AS +  K P  A+SK   I     NWF+ +   
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQVANSK---ISQAVGNWFYGRSAF  370

Query  1251  NLID  1262
               ID
Sbjct  371   QKID  374



>ref|XP_010434420.1| PREDICTED: protein notum homolog [Camelina sativa]
 ref|XP_010434421.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 153/396 (39%), Positives = 220/396 (56%), Gaps = 40/396 (10%)
 Frame = +3

Query  117   DWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHF  296
              W+ LL+ SLV+              TE      +  T ++ A  KGAVCLDGSPPAYH 
Sbjct  6     QWLVLLVCSLVMMK------------TEG---LFVNITYVRNAVAKGAVCLDGSPPAYHL  50

Query  297   SSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNM-KPLIFKGI  473
               G G   ++WLI L+GGGWC +          V NC SRM   LGSS  M + L F  I
Sbjct  51    DRGSGTGINSWLIQLEGGGWCNN----------VTNCLSRMHTRLGSSKKMVENLAFSAI  100

Query  474   FGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGM  650
                 + Y   FY WNRV VRYCDG SF GDV+  +P T L++RGARI+  V+ EL+AKGM
Sbjct  101   LSNKKQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVMQELLAKGM  160

Query  651   KDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVF  830
             ++A+N +  G SAGGL   +HCD F +  P G RVKCLSD+  FL  +D    +Y K  F
Sbjct  161   RNAENAVLSGCSAGGLASLMHCDSFRALLPMGSRVKCLSDAGFFLNTRDVSGVQYIKQYF  220

Query  831   SDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF----  998
              DVV LH   K+LP  CTS+++P  CF P+ + + +++PLFI ++AYDS+Q++N      
Sbjct  221   QDVVTLHGSAKNLPRSCTSRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRA  280

Query  999   --PIDLYRAIK-NGSSISPSDMALLQDFKKQIISAL--PKPSATKGFIVTSNFGHSFASN  1163
               P   +++ + +  +  PS + ++QDF+ + +SA+     S+++G  + S + H   + 
Sbjct  281   ADPYGKWQSCQLDIKNCHPSQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHC-QTE  339

Query  1164  NYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                   + DS      +I     +W +D+     ID
Sbjct  340   TQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKID  375



>gb|EYU29130.1| hypothetical protein MIMGU_mgv1a007782mg [Erythranthe guttata]
Length=395

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 145/366 (40%), Positives = 208/366 (57%), Gaps = 28/366 (8%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +  T ++ A  KGAVCLDGS PAYHF  G G   +NWL++++GGGWC  N+A +    
Sbjct  20    FFVDITYVESAVAKGAVCLDGSAPAYHFDKGSGAGINNWLVHIEGGGWC--NNATT----  73

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
                 C +R    LGSS  M K + F GIF     +   FY WNR+ VRYCDG SF GDVE
Sbjct  74    ----CLARRNGRLGSSKQMAKQIAFSGIFSNKPQFNPDFYNWNRLKVRYCDGASFTGDVE  129

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               DP TKLYYRGAR+F  V+++L+AKGMK+A+N I  G SAGGL   ++CDRF S  P  
Sbjct  130   AVDPATKLYYRGARVFVAVIEDLLAKGMKNAENAILSGCSAGGLTSILNCDRFKSLLPIS  189

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
               VKC +D+  F+  KD   A++ +  ++DVV  H   K L   CTSKM P  CF P+N+
Sbjct  190   TNVKCFADAGFFINAKDVSGAQHIEQFYNDVVTTHGSAKHLAQSCTSKMKPSLCFFPENM  249

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIKNG-SSISPSDMALLQDFKKQI  1085
             VQ +++P+F+ ++AYDS+Q++N        P  L+   K      S + +  +Q+++ + 
Sbjct  250   VQAIQTPIFVVNAAYDSWQIKNILAPGVADPHGLWHNCKTDIKKCSTTQLQTMQEYRLEF  309

Query  1086  ISALP--KPSATKGFIVTSNFGHSFASNNYK-----KPMFADSKSKSIESGFYNWFFDKH  1244
             + AL     + +KG+ + S + H              PM   +   +I     +WF+++ 
Sbjct  310   LKALSGLMSAKSKGYFINSCYAHCQTETQETWSTNISPML--NNKVTIAKAVGDWFYERS  367

Query  1245  PINLID  1262
             P   ID
Sbjct  368   PFEKID  373



>emb|CDY09287.1| BnaC03g63170D [Brassica napus]
Length=391

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 151/364 (41%), Positives = 209/364 (57%), Gaps = 29/364 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  399   ENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
              +CS+R     GSS F  K   F GI G  +N    FY WNR+ VRYCDG SF G+VE  
Sbjct  74    ASCSARKNTMKGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGNVEAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +P  KL++RGAR+++ V+D+LMAKGMK+A+N I  G SAG L   +HCD F +  P   R
Sbjct  134   NPANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPPTAR  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+   D     Y +  +S VVALH   KSLPV CTSKM P  CF P+N+V 
Sbjct  194   VKCVSDAGYFIHGTDISGGSYIQTYYSKVVALHGSAKSLPVSCTSKMKPELCFFPQNVVP  253

Query  933   YVKSPLFIFHSAYDSFQVQNTF---PIDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +  KN        + + +  +Q F+ Q++ 
Sbjct  254   SMRTPLFVINAAFDSWQIKNVLAPTAVDKRKEWKNCKHDLKKCTAAQLKTVQGFRDQMMR  313

Query  1092  ALPKPSAT--KGFIVTSNFGH----SFAS-NNYKKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL    +T  +G  + S   H    S AS +  K P  A+SK   I     NWF+ +   
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQVANSK---ISQAVGNWFYGRSAF  370

Query  1251  NLID  1262
               ID
Sbjct  371   QKID  374



>ref|XP_006471634.1| PREDICTED: uncharacterized protein LOC102628021 [Citrus sinensis]
 gb|KDO40413.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=399

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 148/402 (37%), Positives = 225/402 (56%), Gaps = 40/402 (10%)
 Frame = +3

Query  99    VSPRSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGS  278
             V+ R   W+ LL+ +L++             +  D   F +  T ++ A  KGAVCLDGS
Sbjct  2     VAARMGQWLNLLVCALIL-------------LKAD--GFNVGITYVENAVVKGAVCLDGS  46

Query  279   PPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNM-KP  455
             PPAYHF  G G   +NWL++++GGGWC +          V  C  R    LGSS  M K 
Sbjct  47    PPAYHFDKGFGAGINNWLVHIEGGGWCNN----------VTTCLERKKTRLGSSKQMVKV  96

Query  456   LIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDE  632
             + F G+    + +   FY WNR+ VRYCDG SF GDVE  +P   L++RGAR+FQ V+++
Sbjct  97    VAFSGMLSNKQKFNPDFYNWNRIKVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMED  156

Query  633   LMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAK  812
             LMAKGMK+A+N +  G SAGGL   +HCD F + FP G +VKC +D+  F+  KD   A 
Sbjct  157   LMAKGMKNAQNAVLSGCSAGGLTSILHCDNFRALFPVGTKVKCFADAGYFINAKDVSGAS  216

Query  813   YFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQN  992
             + +  ++ VVA H   K LP  CTS++SP  CF P+ + + + +PLFI ++AYDS+Q++N
Sbjct  217   HIEQFYAQVVATHGSAKHLPASCTSRLSPGLCFFPQYMARQITTPLFIINAAYDSWQIKN  276

Query  993   TF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALPKP--SATKGFIVTSNFG  1145
                     P   + + K + ++ SP+ +  +Q F+ Q ++AL     S+++G  + + + 
Sbjct  277   ILAPGVADPHGTWHSCKLDINNCSPTQLQTMQSFRTQFLNALAGLGISSSRGMFIDACYA  336

Query  1146  HSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
             H   +   +  +  DS      SI     +W++D+ P   ID
Sbjct  337   HC-QTEMQETWLRTDSPVLGKMSIAKAVGDWYYDRSPFQKID  377



>ref|XP_006494119.1| PREDICTED: protein notum homolog isoform X1 [Citrus sinensis]
 ref|XP_006494120.1| PREDICTED: protein notum homolog isoform X2 [Citrus sinensis]
Length=392

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 149/365 (41%), Positives = 213/365 (58%), Gaps = 27/365 (7%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +  T ++ A  KGAVCLDGSPPAYHF  G G   +NWL+++ GG WC +         
Sbjct  27    FNVSITYVEDAVAKGAVCLDGSPPAYHFDKGFGAGINNWLVHIDGGAWCNN---------  77

Query  393   SVENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              V +CS+R     GSS + +K   F GI    +N+   FY WNRV VRYCDG SF GDVE
Sbjct  78    -VADCSNRRDSSYGSSKYMVKEANFTGILSNEQNFNPDFYDWNRVKVRYCDGASFTGDVE  136

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               +P T L++RGAR+F+ V+++L+AKGMK+A+N I  G SAGGL   +HCD F + FP  
Sbjct  137   AVNPETNLHFRGARVFEAVMEDLLAKGMKNAQNAILTGCSAGGLTSILHCDNFRALFPVD  196

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              RVKC +D+  F+ VKD   A +    +  VVALH   K LP  CTS++SP  CF P+N+
Sbjct  197   TRVKCFADAGYFVNVKDVSGASHIVEFYKQVVALHGSAKHLPASCTSRLSPGLCFFPQNV  256

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
                VK+PLFI +SAYDS+Q+ N        P   + + K +  + S + +  +Q F+ Q 
Sbjct  257   AGQVKTPLFIINSAYDSWQITNILVPDDADPKGTWSSCKVDIKTCSSTQLQTMQGFRVQF  316

Query  1086  ISALPK--PSATKGFIVTSNFGHSFASNNYKKP-MFADS---KSKSIESGFYNWFFDKHP  1247
             ++AL +   S+++G ++ S + H      Y++  + ADS       I     +W++D+ P
Sbjct  317   LNALAELGNSSSRGMLIDSCYTH--CRTEYQEAWLSADSPVLDKTPIAKAVGDWYYDRSP  374

Query  1248  INLID  1262
                ID
Sbjct  375   FQKID  379



>ref|XP_009627060.1| PREDICTED: uncharacterized protein LOC104117690 [Nicotiana tomentosiformis]
 ref|XP_009627061.1| PREDICTED: uncharacterized protein LOC104117690 [Nicotiana tomentosiformis]
Length=402

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 149/359 (42%), Positives = 207/359 (58%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +Q A  KGAVCLDGSPPAYHF  G G   +NW I L+GG WC  N+A +        C
Sbjct  30    TYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWFIQLEGGAWC--NNATT--------C  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR    LGSS  M K + F GI      +   FY WNR+ +RYCDG SF GDVE  DP 
Sbjct  80    LSRTKTRLGSSKLMVKTVSFSGILSNKAKFNPDFYNWNRIRIRYCDGSSFTGDVEAVDPK  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             TK+YYRGARIF  V+++ +AKGMK+A+N I  G SAG L   +HCDRF    P G +VKC
Sbjct  140   TKVYYRGARIFSAVMEDFLAKGMKNAQNAILAGCSAGSLAAILHCDRFKGLLPPGAKVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  F+  K    A + +  +SDVV  H   K+LP  CTS++ P  CF P+N+ Q +K
Sbjct  200   LSDAGFFINAKTISGAPHIEQFYSDVVNTHGSAKNLPQSCTSRLKPGLCFFPQNVAQQIK  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +PLF+ ++AYDS+Q++N        P   +R  K +    S + +  +Q ++ + + AL 
Sbjct  260   TPLFLVNAAYDSWQIKNILAPGVADPRGTWRNCKLDILKCSSAQLETMQGYRTEFLKALN  319

Query  1101  --KPSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                PS+T+G+ + S + H   +   +  +  DS    S +I     +WF+D++    ID
Sbjct  320   GLGPSSTRGYYINSCYAHC-QTGTQETWLRDDSPRLASTTIAKAVGDWFYDRNQFQEID  377



>gb|KDO40410.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=437

 Score =   275 bits (704),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 151/406 (37%), Positives = 228/406 (56%), Gaps = 41/406 (10%)
 Frame = +3

Query  87    LRMAVSPRSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVC  266
             LRM V+ R   W+ LL+ +L++             +  D   F +  T ++ A  KGAVC
Sbjct  37    LRM-VAARMGQWLNLLVCALIL-------------LKAD--GFNVGITYVENAVVKGAVC  80

Query  267   LDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFN  446
             LDGSPPAYHF  G G   +NWL++++GGGWC +          V  C  R    LGSS  
Sbjct  81    LDGSPPAYHFDKGFGAGINNWLVHIEGGGWCNN----------VTTCLERKKTRLGSSKQ  130

Query  447   M-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQV  620
             M K + F G+    + +   FY WNR+ VRYCDG SF GDVE  +P   L++RGAR+FQ 
Sbjct  131   MVKVVAFSGMLSNKQKFNPDFYNWNRIKVRYCDGASFTGDVEAVNPANNLHFRGARVFQA  190

Query  621   VVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDP  800
             V+++LMAKGMK+A+N +  G SAGGL   +HCD F + FP G +VKC +D+  F+  KD 
Sbjct  191   VMEDLMAKGMKNAQNAVLSGCSAGGLTSILHCDNFRALFPVGTKVKCFADAGYFINAKDV  250

Query  801   EHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSF  980
               A + +  ++ VVA H   K LP  CTS++SP  CF P+ + + + +PLFI ++AYDS+
Sbjct  251   SGASHIEQFYAQVVATHGSAKHLPASCTSRLSPGLCFFPQYMARQITTPLFIINAAYDSW  310

Query  981   QVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALPKP--SATKGFIVT  1133
             Q++N        P   + + K + ++ SP+ +  +Q F+ Q ++AL     S+++G  + 
Sbjct  311   QIKNILAPGVADPHGTWHSCKLDINNCSPTQLQTMQSFRTQFLNALAGLGISSSRGMFID  370

Query  1134  SNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
             + + H   +   +  +  DS      SI     +W++D+ P   ID
Sbjct  371   ACYAHC-QTEMQETWLRTDSPVLGKMSIAKAVGDWYYDRSPFQKID  415



>ref|XP_006432881.1| hypothetical protein CICLE_v10001426mg [Citrus clementina]
 gb|ESR46121.1| hypothetical protein CICLE_v10001426mg [Citrus clementina]
Length=392

 Score =   274 bits (700),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 148/364 (41%), Positives = 212/364 (58%), Gaps = 25/364 (7%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +  T ++ A  KGAVCLDGSPPAYHF  G G   +NWL+++ GG WC +         
Sbjct  27    FNVSITYVEDAVAKGAVCLDGSPPAYHFDKGFGAGINNWLVHIDGGAWCNN---------  77

Query  393   SVENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              V +CS+R     GSS + +K   F GI    + +   FY WNRV VRYCDG SF GDVE
Sbjct  78    -VADCSNRRDSSHGSSKYMVKEANFTGILSNEQKFNPDFYDWNRVKVRYCDGASFTGDVE  136

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               +P T L++RGAR+F+ V+++L+AKGMK+A+N I  G SAGGL   +HCD F + FP  
Sbjct  137   AVNPETNLHFRGARVFEAVMEDLLAKGMKNAQNAILTGCSAGGLTSILHCDNFRALFPVN  196

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              RVKC +D+  F+ VKD   A + +  +  VVALH   K LP  CTS++SP  CF P+N+
Sbjct  197   TRVKCFADAGYFVNVKDVSGASHIEEFYKQVVALHGSAKHLPASCTSRLSPGLCFFPQNV  256

Query  927   VQYVKSPLFIFHSAYDSFQVQNTFPID-------LYRAIKNGSSISPSDMALLQDFKKQI  1085
                VK+PLFI +SAYDS+Q++N    D         R  K+  + S + +  +Q F+ Q 
Sbjct  257   AGQVKTPLFIINSAYDSWQIRNILVPDNADPKGTWRRCKKDIKTCSSTQLQTMQGFRVQF  316

Query  1086  ISALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPI  1250
             ++AL     S+++G ++ S + H   +   +  + ADS       I     +W++D++P 
Sbjct  317   LNALAGLGNSSSRGMLIDSCYTHC-RTVFQEAWLSADSPVLDKTPIAKAVGDWYYDRNPF  375

Query  1251  NLID  1262
               ID
Sbjct  376   QKID  379



>gb|KDP28068.1| hypothetical protein JCGZ_19476 [Jatropha curcas]
Length=400

 Score =   274 bits (700),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 149/360 (41%), Positives = 214/360 (59%), Gaps = 27/360 (8%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  KGAVCLDGSPPAYH   G G   +NWL++ +GGGWC +          V  C
Sbjct  31    TYVRNAVAKGAVCLDGSPPAYHLDKGFGTGINNWLVHFEGGGWCNN----------VTTC  80

Query  408   SSRMGRELGSSFNMKPLI-FKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR    LGSS  M   I F GI      +   FY WNRV +RYCDG SF GDV+K +P 
Sbjct  81    LSRKNTRLGSSKQMATQIAFSGILNNRRQFNPDFYNWNRVKIRYCDGSSFTGDVQKVNPA  140

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGARI+  VV++L+AKGMK+A+N +  G SAGGL   +HCD F +  P G  VKC
Sbjct  141   TNLHFRGARIWLAVVEDLLAKGMKNAENALLSGCSAGGLASILHCDSFQALLPMGTNVKC  200

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  F+ V+D   A + +  F++VV+LH   K+LP+ CTS++ P  CF P+ +VQ ++
Sbjct  201   LSDAGYFINVRDVSGAPHIQNYFNEVVSLHGSAKNLPLSCTSRLKPALCFFPQYVVQQIR  260

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +PLFI ++AYDS+Q++N        P   ++  K + S+ S   +  +QDF+ Q ++AL 
Sbjct  261   TPLFILNAAYDSWQIKNILAPGVADPHGAWKGCKLDISNCSLLQLKTMQDFRLQFLNALY  320

Query  1101  K--PSATKGFIVTSNFGHSFASNNYKKPMFADS----KSKSIESGFYNWFFDKHPINLID  1262
             +   S+++G  + S + H   S   +    ADS    +SK I     +WF+D+  +  ID
Sbjct  321   RSTTSSSRGLYIDSCYIHC-QSETQETWFMADSPVLGRSK-IAKAVGDWFYDRISVQKID  378



>ref|XP_010942974.1| PREDICTED: protein notum homolog [Elaeis guineensis]
Length=391

 Score =   273 bits (699),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/361 (40%), Positives = 207/361 (57%), Gaps = 22/361 (6%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +P T++Q A  KGAVCLDGSPPAYHF+ G G   +NWL++++GGGWC +         
Sbjct  27    FDVPLTLVQSAVAKGAVCLDGSPPAYHFTPGFGSGVNNWLVHMEGGGWCRN---------  77

Query  393   SVENCSSRMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEK  569
              VE C  R     GSS  MK L F GI G  +     FY WN+V +RYCDG SF GDVE 
Sbjct  78    -VEECKERTKNFRGSSKYMKQLSFSGILGNKQKLNPDFYNWNKVKIRYCDGSSFTGDVEA  136

Query  570   PDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGV  749
              DP T L++RGAR+++ ++D+L+AKGM  A+N +  G SAGGL   +HCD F    P G 
Sbjct  137   VDPATNLHFRGARVWRAIMDDLLAKGMSKAQNALLSGCSAGGLASILHCDSFRDLLPAGA  196

Query  750   RVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLV  929
             RVKC SD+  F+  KD    +  +  ++ VVA H   K+LP  CTS+  P  CF P+ +V
Sbjct  197   RVKCFSDAGYFINAKDVSGKESIRDFYNQVVATHGSAKNLPSSCTSRFPPSMCFFPQYVV  256

Query  930   QYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQII  1088
             Q +++PLFI ++AYD++Q++N        P   +   K +    S S + ++Q F+ + +
Sbjct  257   QSMRTPLFILNAAYDAWQIKNILAPSPSDPRKFWGECKLDIKKCSSSQLQVMQGFRSEFL  316

Query  1089  SALPKPSATKGFIVTSNFGHSFASNNYKKPMFADSKSKS---IESGFYNWFFDKHPINLI  1259
              ALP  S + G  + S + H   S   +  + +DS + +   I     +W+F +  +  I
Sbjct  317   RALPANSPSIGMFIDSCYSHC-QSGAQETWLSSDSPAINKMPIAKAVGDWYFGRTAMKKI  375

Query  1260  D  1262
             D
Sbjct  376   D  376



>ref|XP_007209217.1| hypothetical protein PRUPE_ppa006718mg [Prunus persica]
 gb|EMJ10416.1| hypothetical protein PRUPE_ppa006718mg [Prunus persica]
 gb|AIA21744.1| pectin acetylesterase [Prunus persica]
Length=398

 Score =   273 bits (699),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 143/359 (40%), Positives = 212/359 (59%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T+++ A  KGAVCLDGS PAYHF  G G   +NWL++++GGGWC S          VE C
Sbjct  30    TLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHVEGGGWCNS----------VETC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
               R     GSS  M K + F G+ G  + +   FY WNR+ VRYCDG SF GDVE  +P 
Sbjct  80    LDRKNTYRGSSNKMEKSMSFSGVLGNKQKFNPDFYNWNRIKVRYCDGSSFTGDVEAVNPA  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGAR+F+ ++D+L+AKGMK+A++ +  G SAGGL   ++CD F S  P G +VKC
Sbjct  140   TNLHFRGARVFRAIIDDLLAKGMKNAQSALLSGCSAGGLASILNCDNFRSLLPVGTKVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             L+D+  F+  K    ++  +A +S+VVALH   K+LP  CTSK+SP  CF P+N+V   +
Sbjct  200   LADAGYFINAKTVSGSQQIQAFYSEVVALHGSAKNLPASCTSKLSPGLCFFPQNVVPVTR  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +P+F+ ++AYDS+Q++N        P   ++  K +  + SPS +  +Q+++ Q + AL 
Sbjct  260   TPIFLVNAAYDSWQIKNILAPGIADPKGAWKKCKLDIKNCSPSQLQTMQEYRLQFLGALS  319

Query  1101  KPSA--TKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
               S+  T G  + S + H       +  + ADS      +I     +W+ D+ P   ID
Sbjct  320   HASSSTTHGLFIDSCYAHCQIGTQ-ETWLAADSPVLSKTTIGKAVGDWYTDRTPFQKID  377



>ref|XP_006432880.1| hypothetical protein CICLE_v10001467mg [Citrus clementina]
 ref|XP_006471635.1| PREDICTED: protein notum homolog isoform X1 [Citrus sinensis]
 ref|XP_006471636.1| PREDICTED: protein notum homolog isoform X2 [Citrus sinensis]
 gb|ESR46120.1| hypothetical protein CICLE_v10001467mg [Citrus clementina]
 gb|KDO40407.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
 gb|KDO40408.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
Length=386

 Score =   273 bits (698),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 154/396 (39%), Positives = 219/396 (55%), Gaps = 41/396 (10%)
 Frame = +3

Query  120   WICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHFS  299
             W  LL+ +L++    A  N              +  T ++ A  KGAVCLDGSPPAYHF 
Sbjct  4     WFNLLVCALIVLKAQAGFN--------------VSITYVENAVAKGAVCLDGSPPAYHFD  49

Query  300   SGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNM-KPLIFKGIF  476
              G G   +NWL+++ GG WC +          VE+CS R     GSS +M K   F GI 
Sbjct  50    KGFGAGINNWLVHIDGGAWCNN----------VEDCSKRRDSSYGSSKHMVKEANFTGIL  99

Query  477   GMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMK  653
                + +   FY WNRV VRYCDG SF GDVE  +P T L++RGAR+F+ V+++L+AKGMK
Sbjct  100   SNEQKFNPDFYDWNRVRVRYCDGASFTGDVEAVNPETNLHFRGARVFEAVMEDLLAKGMK  159

Query  654   DAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFS  833
             +A+N I  G SAGGL   +HCD F + FP   RVKC +D+  F+  KD     + +  + 
Sbjct  160   NAQNAILTGCSAGGLTSILHCDNFRALFPVDTRVKCFADAGYFVNAKDVSGESHIEEFYK  219

Query  834   DVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF-----  998
              VVALH   K LP  CTS++SP  CF P+N+   +K+PLFI +SAYDS+Q+ N       
Sbjct  220   QVVALHGSAKHLPASCTSRLSPGLCFFPENVAGQIKTPLFIINSAYDSWQISNILVPEDA  279

Query  999   -PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP--KPSATKGFIVTSNFGHSFASNN  1166
              P   + + K +  + S + +  +Q F+ Q ++AL     S+++G  V S + H     +
Sbjct  280   DPKGAWSSCKVDIKTCSSTQLQTMQGFRVQFLNALAGLGNSSSRGMFVDSCYTH--CRTD  337

Query  1167  YKKPMF-ADS---KSKSIESGFYNWFFDKHPINLID  1262
             Y++  F ADS       I     +W++D+ P   ID
Sbjct  338   YQETWFSADSPVLDKTPIAKAVGDWYYDRSPFQKID  373



>gb|KCW72726.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=373

 Score =   272 bits (696),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 152/390 (39%), Positives = 220/390 (56%), Gaps = 39/390 (10%)
 Frame = +3

Query  108   RSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPA  287
             R   W+C+ I S+ I ++    N              +  T +Q A  KGAVCLDGSPPA
Sbjct  5     RLRTWLCV-ILSIQILIKSEAFN--------------VGITYVQNAVAKGAVCLDGSPPA  49

Query  288   YHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNM-KPLIF  464
             YHF  G G  A+NWLI  +GG WC +          V  C +R    LGSS  M K L F
Sbjct  50    YHFDKGVGAGANNWLILFEGGAWCNN----------VTTCLARRDTRLGSSKQMVKELSF  99

Query  465   KGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMA  641
              GI    + +   FY WN++ VRYCDG SF GDVE  +P T L++RGAR F  +V++LM+
Sbjct  100   SGILSNKQKFNPDFYNWNKIKVRYCDGASFTGDVEAVNPATNLHFRGARAFVAIVEDLMS  159

Query  642   KGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFK  821
             KGM +A+N I  G SAGGL   ++CDRF +  P   +VKCL+D+  F+  KD   A + +
Sbjct  160   KGMSNAQNAILAGCSAGGLTAILNCDRFRALVPARTKVKCLADAGYFINAKDVSGASHIE  219

Query  822   AVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFP  1001
               +S+VVA H   K+LP  CTSKM P  CF P+N+V  +++PLFI ++AYDS+Q++N   
Sbjct  220   NFYSEVVATHGSAKNLPTSCTSKMKPGLCFFPQNVVPQIQTPLFIINAAYDSWQIKNILA  279

Query  1002  IDL------YRAIK-NGSSISPSDMALLQDFKKQIISALPK--PSATKGFIVTSNFGHSF  1154
               +      +R+ K +    SP+ + ++QDF+ + + AL     S ++G  + S + H  
Sbjct  280   PGVADRHGTWRSCKLDIKKCSPNQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCYAHCQ  339

Query  1155  ASNNYKKPMFADSK--SKSIESGFYNWFFD  1238
             A    +  +  DS   +K++ + F+N F D
Sbjct  340   AGTQ-ETWLRNDSPVVAKTVMTTFFNIFHD  368



>ref|XP_009132797.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=397

 Score =   273 bits (698),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 142/359 (40%), Positives = 211/359 (59%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  +GAVCLDGSPPAYH   G G   ++WLI L+GGGWC +          V NC
Sbjct  28    TFVRNAVARGAVCLDGSPPAYHLHRGSGTGINSWLIQLEGGGWCNN----------VTNC  77

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SRM   LGSS  M + L F  I    + Y   FY WNRV VRYCDG SF GDV+  +P 
Sbjct  78    LSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPA  137

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGAR++  V+ EL+AKGM++A+N +  G SAGGL   +HCD F +  P G +VKC
Sbjct  138   TNLHFRGARVWLAVMQELLAKGMRNAENAVLSGCSAGGLASLMHCDSFRALLPMGTKVKC  197

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  FL  +D   A+Y K+ F DVVALH   K+LP  CTS+++P  CF P+ + + ++
Sbjct  198   LSDAGFFLNTRDVSGAQYIKSYFKDVVALHGSAKNLPRTCTSRLTPAMCFFPQYVARQIR  257

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISAL-  1097
             +P+FI ++AYDS+Q++N        P   +++ + +  +  P+ + ++QDF+ + +SA+ 
Sbjct  258   TPVFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCQPNQLKVMQDFRLEFLSAVI  317

Query  1098  -PKPSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                 S+++G  + S + H   +       + DS      +I     +W +D+     ID
Sbjct  318   GLGRSSSRGMFIDSCYTHC-QTETQTSWFWQDSPILNRTTIAKAVGDWVYDRKLFQKID  375



>ref|XP_010942975.1| PREDICTED: protein notum homolog isoform X1 [Elaeis guineensis]
 ref|XP_010942976.1| PREDICTED: protein notum homolog isoform X1 [Elaeis guineensis]
Length=397

 Score =   273 bits (698),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 144/364 (40%), Positives = 212/364 (58%), Gaps = 25/364 (7%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             + +  T ++ A  KGAVCLDGSPPAYH S G G   +NWL++++GGGWC +         
Sbjct  25    YFVDITYVESALAKGAVCLDGSPPAYHLSPGFGSGVNNWLVHIEGGGWCNN---------  75

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              V  C +R    LGSS +M K + F GI    + +   FY WN+V VRYCDG SF GDVE
Sbjct  76    -VTTCLARKNSRLGSSRHMAKQIAFSGILNNRQTFNPDFYNWNKVKVRYCDGSSFTGDVE  134

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
             + +P T L+YRGAR++  V+++L+AKGM  AKN +  G SAGGL   +HCD F +  P G
Sbjct  135   RVNPATNLHYRGARVWLAVMEDLLAKGMSKAKNALLSGCSAGGLTSILHCDNFRAILPLG  194

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              R KCLSD+  F+ +KD   A++ KA F+DVV  H   ++LP  CTS+++P  CF P+N+
Sbjct  195   TRAKCLSDAGYFIDMKDVTGAEHIKAFFNDVVTTHGSAQNLPSSCTSRLTPSMCFFPQNM  254

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
             VQ + +PLFI ++AYDS+Q++N        P   +   K +    S   + ++Q F+ + 
Sbjct  255   VQQIHTPLFILNAAYDSWQIRNILVPGVADPHGTWHYCKLDIQQCSSPQLQIMQGFRTEF  314

Query  1086  ISALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPI  1250
             ++AL     S++ G  + S + H   S   +  + +DS   +   I     +WF+D+   
Sbjct  315   LNALAGFGRSSSTGMFINSCYAHC-QSEMQETWLSSDSPVLEKMPIAKAVGDWFYDRIAF  373

Query  1251  NLID  1262
               ID
Sbjct  374   QKID  377



>ref|XP_006413980.1| hypothetical protein EUTSA_v10025385mg [Eutrema salsugineum]
 gb|ESQ55433.1| hypothetical protein EUTSA_v10025385mg [Eutrema salsugineum]
Length=397

 Score =   273 bits (697),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 151/398 (38%), Positives = 220/398 (55%), Gaps = 46/398 (12%)
 Frame = +3

Query  120   WICLLIFSLVI---SVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAY  290
             W+ LL+ SLVI      Y N+                  T ++ A  KGAVCLDGSPPAY
Sbjct  7     WVFLLVCSLVILETEALYVNI------------------TFVRNAVAKGAVCLDGSPPAY  48

Query  291   HFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNM-KPLIFK  467
             H   G G   ++WLI L+GGGWC +          V NC SRM   LGSS  M + L F 
Sbjct  49    HLDRGFGTGINSWLIQLEGGGWCNN----------VTNCVSRMHTRLGSSKRMVEKLAFS  98

Query  468   GIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAK  644
              I      Y   FY WNRV VRYCDG SF GDV+  +P T L++RGAR++  V+ EL+AK
Sbjct  99    AILSNKRQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHFRGARVWLAVMQELLAK  158

Query  645   GMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKA  824
             GM +A+N +  G SAGGL   +HCD F +  P G +VKCLSD+  FL  +D   A+Y K+
Sbjct  159   GMINAENAVLSGCSAGGLATLMHCDSFRALLPMGAKVKCLSDAGFFLNTRDVAGAQYIKS  218

Query  825   VFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF--  998
              F+DVV LH   K+LP  CTS+++P  CF P+ + + +++PLFI ++AYDS+Q++N    
Sbjct  219   YFNDVVTLHGSAKNLPRSCTSRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAP  278

Query  999   ----PIDLYRAIK-NGSSISPSDMALLQDFKKQIISAL--PKPSATKGFIVTSNFGHSFA  1157
                 P   +++ + +  +  P+ + ++QDF+ + + A+     S+++G  + S + H   
Sbjct  279   RAADPYGKWQSCQLDIKNCQPNQLKVMQDFRLEFLRAVIGLGRSSSRGMFIDSCYTHC-Q  337

Query  1158  SNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
             +       + DS      +I     +W +D+     ID
Sbjct  338   TETQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKID  375



>ref|NP_193677.2| putative pectinacetylesterase [Arabidopsis thaliana]
 gb|AAT70429.1| At4g19420 [Arabidopsis thaliana]
 gb|AAU45212.1| At4g19420 [Arabidopsis thaliana]
 gb|AEE84180.1| putative pectinacetylesterase [Arabidopsis thaliana]
Length=397

 Score =   273 bits (697),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 144/359 (40%), Positives = 207/359 (58%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  KGAVCLDGSPPAYH   G G   ++WLI L+GGGWC +          V NC
Sbjct  28    TFVRNAVAKGAVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCNN----------VTNC  77

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SRM   LGSS  M + L F  I    + Y   FY WNRV VRYCDG SF GDVE  +P 
Sbjct  78    VSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVKVRYCDGASFTGDVEAVNPA  137

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGAR++  V+ EL+AKGM +A+N +  G SAGGL   +HCD F +  P G +VKC
Sbjct  138   TNLHFRGARVWLAVMQELLAKGMINAENAVLSGCSAGGLASLMHCDSFRALLPMGTKVKC  197

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  FL  +D    +Y K  F DVV LH   K+LP  CTS+++P  CF P+ + + ++
Sbjct  198   LSDAGFFLNTRDVSGVQYIKTYFEDVVTLHGSAKNLPRSCTSRLTPAMCFFPQYVARQIR  257

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISAL-  1097
             +PLFI ++AYDS+Q++N        P   +++ + +  +  PS + ++QDF+ + +SA+ 
Sbjct  258   TPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCHPSQIKVMQDFRLEFLSAVI  317

Query  1098  -PKPSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                 S+++G  + S + H   +       + DS      +I     +W +D+     ID
Sbjct  318   GLGRSSSRGMFIDSCYTHC-QTETQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKID  375



>gb|KCW72718.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
 gb|KCW72719.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=403

 Score =   273 bits (697),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 139/352 (39%), Positives = 209/352 (59%), Gaps = 27/352 (8%)
 Frame = +3

Query  252   KGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGREL  431
             + AVCLDGSPPAYHF+ G G  A+NWL+  +GGGWC +          V  C +R    L
Sbjct  2     RPAVCLDGSPPAYHFNKGLGTGANNWLVQFEGGGWCNN----------VTTCLARRDTRL  51

Query  432   GSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGA  605
             GSS  M K + F GI   N ++   FY WNR+ VRYCDG SF GDVE  DP TKL++RGA
Sbjct  52    GSSKEMVKEVAFSGILSNNHSFNPDFYNWNRIKVRYCDGASFTGDVEAVDPATKLHFRGA  111

Query  606   RIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFL  785
             R F  ++++L++KGM DA+N I  G SAGGL   +HCDRF +  P    VKC++D+  F+
Sbjct  112   RAFVAIIEDLLSKGMSDAENAILSGCSAGGLTSILHCDRFRALMPTSATVKCVADAGYFI  171

Query  786   IVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHS  965
               KD   A++ +  +S+VVA H   K+LP  CTS++ P  CF P+N+V+ +++PLFI ++
Sbjct  172   NAKDISGAQHIETFYSEVVATHGSAKNLPTSCTSRLRPGLCFFPQNVVKQIQTPLFILNA  231

Query  966   AYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALPK--PSATK  1118
             AYD++Q++N        P   + + K + ++ S   + ++QDF++Q + AL +   S ++
Sbjct  232   AYDAWQIKNILAPGVADPHGTWHSCKLDINNCSLDQLQIMQDFRQQFLDALSRVGTSPSR  291

Query  1119  GFIVTSNFGHSFASNNYKKPMFADSKSKSIESGFY----NWFFDKHPINLID  1262
             G  + S + H    +  ++    D     IE+       +W++D+ P   ID
Sbjct  292   GIFIDSCYAH--CQSEMQETWLRDDSPVLIETSIAKAVGDWYYDRRPFQKID  341



>ref|XP_007040900.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOY25401.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=399

 Score =   273 bits (697),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 146/365 (40%), Positives = 213/365 (58%), Gaps = 37/365 (10%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +Q A  KGAVCLDGSPPAYHF  G G   +NWL++++GGGWC            VE C
Sbjct  31    TYLQSAVAKGAVCLDGSPPAYHFDPGSGAGVNNWLVHMEGGGWCED----------VERC  80

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR   +LGSS  M K   F G+    +     FY WNR+ VRYCDG SF GDVE P  V
Sbjct  81    LSRRNTDLGSSEQMVKQFGFSGLLSSQQKSNPDFYNWNRIKVRYCDGSSFTGDVEAP--V  138

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
               L++RG RI++ ++++L+AKGM++AKN I  G SAGGL   +HCDRF +  P   +VKC
Sbjct  139   NNLFFRGNRIWEAIIEDLLAKGMRNAKNAILSGCSAGGLASILHCDRFRALLPAATKVKC  198

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMS--PFECFQPKNLVQY  935
             +SD+  F+  KD    ++ +  +S V  LH   KSLP  CTS+MS  P  CF P+ +VQ 
Sbjct  199   ISDAGFFIHAKDVSGGQHIENFYSQVAKLHGSVKSLPASCTSRMSMKPELCFFPQYVVQT  258

Query  936   VKSPLFIFHSAYDSFQVQNTF---PIDLYRAIKNG----SSISPSDMALLQDFKKQIISA  1094
             +++P+F  ++AYDS+Q++N       D  +A K+        +P  + ++QDF+ Q +SA
Sbjct  259   MQTPIFFINAAYDSWQIKNILAPTAADSGKAWKSCKLDLKKCTPGQLKIIQDFRAQFLSA  318

Query  1095  LPKP--SATKGFIVTSNFGH-------SFASNNYKKPMFADSKSKSIESGFYNWFFDKHP  1247
             L     S+++G  + S + H       +++SNN   P   ++K   I     +W++++ P
Sbjct  319   LTGAGNSSSRGMFIDSCYAHCQAGKQITWSSNN--SPAVGNTK---IAKAVGDWYYERSP  373

Query  1248  INLID  1262
             +  ID
Sbjct  374   VQKID  378



>ref|XP_006359968.1| PREDICTED: protein notum homolog, partial [Solanum tuberosum]
Length=369

 Score =   271 bits (694),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 145/362 (40%), Positives = 208/362 (57%), Gaps = 23/362 (6%)
 Frame = +3

Query  216   IIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLS  395
             ++  TI+Q A  KGAVCLDGSPPAYH   G G   +NW+I ++GGGWC +          
Sbjct  8     LVNLTILQTAVAKGAVCLDGSPPAYHLDRGSGTGVNNWVISVEGGGWCQN----------  57

Query  396   VENCSSRMGRELGSSFNMK-PLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEK  569
             V  C  R   + GSS  M+  + F G+    + +   FY WNRV VRYCDGGSF GDVE 
Sbjct  58    VAQCLLRKNSKYGSSAKMENQVFFSGMLSNEQKFNPEFYNWNRVFVRYCDGGSFTGDVEA  117

Query  570   PDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGV  749
              DP T L+YRGARIF+ +++EL+A+GM  ++N I  G SAGGL   +HCD F    P  V
Sbjct  118   IDPGTGLHYRGARIFKAIMEELLAQGMNKSENAILSGCSAGGLTTILHCDNFRILLPSSV  177

Query  750   RVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLV  929
             +VKC SD+  F+ ++D     + +  F+DVV LH   ++LP  CTSK+ P  CF P+N+ 
Sbjct  178   KVKCFSDAGYFVNIEDISGKLFIQQFFNDVVTLHGSVRNLPPSCTSKLKPSLCFFPQNVA  237

Query  930   QYVKSPLFIFHSAYDSFQVQN------TFPIDLYRAI-KNGSSISPSDMALLQDFKKQII  1088
             Q +++PLFI +SAYDS+QV+N      T P   + +   N  + +P  + +LQ F+   +
Sbjct  238   QQIQTPLFIINSAYDSWQVRNILVPRGTDPKGAWNSCGANIKTCTPDQLKVLQGFRLNFL  297

Query  1089  SALP--KPSATKGFIVTSNFGHSFASN--NYKKPMFADSKSKSIESGFYNWFFDKHPINL  1256
              AL    PS+T+G+ + S F H       ++  P      +K+I     +W  +++    
Sbjct  298   KALEGLGPSSTRGYYINSCFAHCQTQKQASWFGPNSPRLFNKTIAEAVGDWVLERNQFRQ  357

Query  1257  ID  1262
             ID
Sbjct  358   ID  359



>emb|CDX78933.1| BnaA01g10000D [Brassica napus]
Length=452

 Score =   274 bits (701),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/359 (40%), Positives = 211/359 (59%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  +GAVCLDGSPPAYH   G G   ++WLI L+GGGWC +          V NC
Sbjct  83    TFVRNAVARGAVCLDGSPPAYHLHRGSGTGINSWLIQLEGGGWCNN----------VTNC  132

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SRM   LGSS  M + L F  I    + Y   FY WNRV VRYCDG SF GDV+  +P 
Sbjct  133   LSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPA  192

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGAR++  V+ EL+AKGM++A+N +  G SAGGL   +HCD F +  P G +VKC
Sbjct  193   TNLHFRGARVWLAVMQELLAKGMRNAENAVLSGCSAGGLASLMHCDSFRALLPMGTKVKC  252

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  FL  +D   A+Y K+ F DVVALH   K+LP  CTS+++P  CF P+ + + ++
Sbjct  253   LSDAGFFLNTRDVSGAQYIKSYFKDVVALHGSAKNLPRTCTSRLTPAMCFFPQYVARQIR  312

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISAL-  1097
             +P+FI ++AYDS+Q++N        P   +++ + +  +  P+ + ++QDF+ + +SA+ 
Sbjct  313   TPVFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCQPNQLKVMQDFRLEFLSAVI  372

Query  1098  -PKPSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                 S+++G  + S + H   +       + DS      +I     +W +D+     ID
Sbjct  373   GLGRSSSRGMFIDSCYTHC-QTETQTSWFWQDSPILNRTTIAKAVGDWVYDRKLFQKID  430



>ref|XP_009797415.1| PREDICTED: uncharacterized protein LOC104243851 [Nicotiana sylvestris]
Length=388

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 143/363 (39%), Positives = 205/363 (56%), Gaps = 23/363 (6%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
              ++  TI++ A  KG VCLDG+PPAYH   G G    NW+I ++GGGWC +         
Sbjct  21    LLVNITILESAVAKGGVCLDGTPPAYHLDRGSGTGLDNWVISIEGGGWCQN---------  71

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              + +C  R    LGSS  M K + F GI   +  +   FY WNRV VRYCDGGSF GDVE
Sbjct  72    -ITHCLQRKNSRLGSSAKMGKQVAFSGIMSNDPKFNPEFYNWNRVSVRYCDGGSFTGDVE  130

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               DP T L+YRGARIF+ ++ +L+A+GM   +N I  G SAGGL   +HCD F +  PK 
Sbjct  131   AVDPATGLHYRGARIFEAIMADLLAQGMSTVENAILSGCSAGGLASILHCDNFRALLPKT  190

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              RVKC SD+  F+ +KD     Y +  F+DVV LH   K+LP  CTSK++P  CF P+N+
Sbjct  191   ARVKCFSDAGYFVNLKDISGEAYIEEYFNDVVTLHGSAKNLPPSCTSKLNPSLCFFPQNV  250

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
                +++PLFI ++AYD +QV+N        P   +   K +  + + S++ +LQ F+   
Sbjct  251   AHQIQTPLFIINAAYDHWQVRNILVPSTADPTGAWTNCKADMRNCTLSELQVLQGFRLNF  310

Query  1086  ISALP--KPSATKGFIVTSNFGHSFASNN--YKKPMFADSKSKSIESGFYNWFFDKHPIN  1253
             +  L    PS+T+G+ + S F H        +  P      +K+I     +WF++++   
Sbjct  311   LKVLEGLGPSSTRGYYINSCFSHCQTQQQAYWFGPNSPRLFNKTIAEATGDWFWERNQFQ  370

Query  1254  LID  1262
              ID
Sbjct  371   EID  373



>ref|XP_004509522.1| PREDICTED: uncharacterized protein LOC101493258 isoform X1 [Cicer 
arietinum]
 ref|XP_004509523.1| PREDICTED: uncharacterized protein LOC101493258 isoform X2 [Cicer 
arietinum]
Length=400

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/362 (40%), Positives = 208/362 (57%), Gaps = 25/362 (7%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDGSPPAYHF  G G    NW+++ +GGGWC +          V
Sbjct  28    VPITYVQSAVAKGAVCLDGSPPAYHFDKGVGAGIDNWIVHFEGGGWCNN----------V  77

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
               C  R    LGSS  M K L F G F   + +   FY WNR+ VRYCDG SF GDVE  
Sbjct  78    STCLDRRDTRLGSSKKMDKQLSFSGFFSNGKKFNPDFYDWNRIKVRYCDGASFTGDVEAV  137

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP T L++RGARIF  V+++L+AKGMK+AKN I  G SAGGL   + CDRF +  P   +
Sbjct  138   DPATNLHFRGARIFVAVIEDLLAKGMKNAKNAILSGCSAGGLTSILQCDRFKTLLPAAAK  197

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+ VK    A++ +  +S VV  H   K+LP  CTS++SP  CF P+N+  
Sbjct  198   VKCVSDAGYFINVKAVSGAQHIEQFYSQVVQTHGSAKNLPQSCTSRLSPGLCFFPQNVAA  257

Query  933   YVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIIS  1091
              +K+P+F  ++AYDS+Q++N        P   +R  K + ++ SP+ +  +Q F+ Q + 
Sbjct  258   QIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDINNCSPNQLTTMQGFRTQFLQ  317

Query  1092  ALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINL  1256
             A+     S +KG  +   + H   +   +  M +DS    + +I     +W++D+   + 
Sbjct  318   AISGLSNSPSKGLFIDGCYAHC-QTGMQETWMRSDSPVLANTTIAKAVGDWYYDRKTFHQ  376

Query  1257  ID  1262
             ID
Sbjct  377   ID  378



>ref|XP_010056136.1| PREDICTED: protein notum homolog [Eucalyptus grandis]
 gb|KCW72724.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
 gb|KCW72725.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=399

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 146/366 (40%), Positives = 209/366 (57%), Gaps = 29/366 (8%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +  T +Q A  KGAVCLDGSPPAYHF  G G  A+NWLI  +GG WC +         
Sbjct  25    FNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWLILFEGGAWCNN---------  75

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              V  C +R    LGSS  M K L F GI    + +   FY WN++ VRYCDG SF GDVE
Sbjct  76    -VTTCLARRDTRLGSSKQMVKELSFSGILSNKQKFNPDFYNWNKIKVRYCDGASFTGDVE  134

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               +P T L++RGAR F  +V++LM+KGM +A+N I  G SAGGL   ++CDRF +  P  
Sbjct  135   AVNPATNLHFRGARAFVAIVEDLMSKGMSNAQNAILAGCSAGGLTAILNCDRFRALVPAR  194

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKCL+D+  F+  KD   A + +  +S+VVA H   K+LP  CTSKM P  CF P+N+
Sbjct  195   TKVKCLADAGYFINAKDVSGASHIENFYSEVVATHGSAKNLPTSCTSKMKPGLCFFPQNV  254

Query  927   VQYVKSPLFIFHSAYDSFQVQNTFPIDL------YRAIK-NGSSISPSDMALLQDFKKQI  1085
             V  +++PLFI ++AYDS+Q++N     +      +R+ K +    SP+ + ++QDF+ + 
Sbjct  255   VPQIQTPLFIINAAYDSWQIKNILAPGVADRHGTWRSCKLDIKKCSPNQLKIMQDFRLEF  314

Query  1086  ISALPK--PSATKGFIVTSNFGHSFASNNYK-----KPMFADSKSKSIESGFYNWFFDKH  1244
             + AL     S ++G  + S + H  A           P+ A +   SI     +W++++ 
Sbjct  315   LRALSAVGTSPSRGMFIDSCYAHCQAGTQETWLRNDSPVVAKT---SIAKAVGDWYYERL  371

Query  1245  PINLID  1262
                 ID
Sbjct  372   TFQKID  377



>ref|XP_009350399.1| PREDICTED: protein notum homolog [Pyrus x bretschneideri]
Length=398

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 143/361 (40%), Positives = 208/361 (58%), Gaps = 29/361 (8%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T+++ A  KGAVCLDGS PAYHF  G G   +NWL++++GGGWC S          V  C
Sbjct  30    TLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHIEGGGWCNS----------VATC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
               R     GSS  M K + F G+ G  +     FY WNR+ VRYCDG SF GDVE  DP 
Sbjct  80    LDRKNNYRGSSTKMEKTMSFSGVLGNKQQTNPDFYNWNRIKVRYCDGSSFTGDVEAVDPA  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGAR+F+ ++D+L+AKGMK+A+  +  G SAGGL   +HCD F S  P G +VKC
Sbjct  140   TNLHFRGARVFRAIIDDLLAKGMKNAQTALLSGCSAGGLASILHCDNFHSLLPVGTKVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             L+D+  F+  K    ++Y +  +S+VVALH   K+LP  CTS+MSP  CF P+N+V   +
Sbjct  200   LADAGYFINAKTLSGSQYIQTFYSEVVALHGSAKNLPASCTSRMSPGLCFFPQNVVPQTR  259

Query  942   SPLFIFHSAYDSFQVQNTFP---IDLYRAIKNG----SSISPSDMALLQDFKKQIISALP  1100
             +P+F  ++AYDS+Q++N       D   A KN      + SPS +  +Q+++ Q ++A+ 
Sbjct  260   TPIFFVNAAYDSWQIKNILAPGVADPKGAWKNCKLSIKNCSPSQLQTMQEYRLQFLNAIA  319

Query  1101  KP--SATKGFIVTSNFGHSFASNN-----YKKPMFADSKSKSIESGFYNWFFDKHPINLI  1259
                 S++ G  + S + H              PM + +   +I     +W++D+ P   I
Sbjct  320   GASSSSSNGLFIDSCYAHCQIGTQETWLATDSPMLSKT---TIAKAVGDWYYDRTPFKNI  376

Query  1260  D  1262
             D
Sbjct  377   D  377



>ref|XP_010677538.1| PREDICTED: protein notum homolog isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=389

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/366 (40%), Positives = 211/366 (58%), Gaps = 29/366 (8%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +P T +Q A  KG VCLDGSPPAYHF  G G    NWLI+++GG WC  N+A + L+ 
Sbjct  22    FQVPITYVQDAVAKGGVCLDGSPPAYHFDKGFGAGIHNWLIHMEGGAWC--NNATTCLE-  78

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
                    R    LGSS  M K   F GI      Y+  FY WNR+ VRYCDG SF GDVE
Sbjct  79    -------RTKTRLGSSKLMTKQYTFSGILSNQAKYSPDFYNWNRIKVRYCDGSSFTGDVE  131

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               DP  K+YYRGAR+++ ++D+L+AKGMK+A+N I  G SAGGLG  + CD F +  P G
Sbjct  132   AVDPKAKVYYRGARLWRAIMDDLLAKGMKNAENAILAGCSAGGLGAILQCDNFRALLPSG  191

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKCLSD+  F+  KD     + + VF+DVV  H   K+LP  CTSK  P  CF P+  
Sbjct  192   AKVKCLSDAGFFINAKDISGVSHIQEVFADVVTTHGSAKNLPPSCTSKFDPKLCFFPEYA  251

Query  927   VQYVKSPLFIFHSAYDSFQVQNTFPIDLYRAIKNGS---------SISPSDMALLQDFKK  1079
              + +++PLF+ ++AYD++Q++NT    +  A ++G+           S S + ++  F++
Sbjct  252   ARGIQTPLFLLNAAYDAWQIKNTLAPGV--ADRHGTWHDCKSDIIKCSNSQIQIMHGFRQ  309

Query  1080  QIISALPK--PSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKH  1244
               ++AL     S ++GF + S + H   S   +  +  DS    + +I     +WF+D+ 
Sbjct  310   DFLAALSSLGNSNSRGFYINSCYSHC-QSGTQETWLRDDSPLLDNTTICKAVGDWFYDRK  368

Query  1245  PINLID  1262
             P   ID
Sbjct  369   PFQKID  374



>ref|XP_010056135.1| PREDICTED: protein notum homolog [Eucalyptus grandis]
Length=392

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 151/401 (38%), Positives = 222/401 (55%), Gaps = 44/401 (11%)
 Frame = +3

Query  108   RSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPA  287
             R   W+C+ I S+ I ++   +N              +  T +Q A  KGAVCLDGSPPA
Sbjct  5     RLRTWLCV-ILSIQILLKSEAIN--------------VSITYVQNAVAKGAVCLDGSPPA  49

Query  288   YHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNM-KPLIF  464
             YHF  G G  A+NWLI+++GGGWC +          V  C +R    +GSS  M K L F
Sbjct  50    YHFDKGVGAGANNWLIFVEGGGWCNN----------VTTCLARRDTRVGSSKQMVKELSF  99

Query  465   KGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMA  641
              GI    + +   FY WN++ VRYCDG SF GDVE  +P T L++RGAR F  +V++LM+
Sbjct  100   SGILSNKQKFNPDFYNWNKIKVRYCDGASFTGDVEAVNPATNLHFRGARAFVAIVEDLMS  159

Query  642   KGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFK  821
             KGM +A+N I  G SAGGL   ++CDRF +  P   +VKCL+D+  F+  KD   A + +
Sbjct  160   KGMSNAQNAILSGCSAGGLAAILNCDRFRALMPARTKVKCLADAGYFINAKDVSGASHIE  219

Query  822   AVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF-  998
               +S+VVA H   K+LP  CTSKM P  CF P+N+V  +++PLFI ++AYD++Q++N   
Sbjct  220   NFYSEVVATHGSAKNLPTSCTSKMKPGLCFFPQNVVPQIQTPLFIINAAYDAWQIKNILA  279

Query  999   -----PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALPK--PSATKGFIVTSNFGHSF  1154
                  P   + + K +    SP+ + ++QDF+ + + AL     S ++G  + S   H  
Sbjct  280   PGVADPHGTWNSCKLDIKKCSPNQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCNTHCQ  339

Query  1155  ASNNYK-----KPMFADSKSKSIESGFYNWFFDKHPINLID  1262
             A           P+ A +   SI     +W++++     ID
Sbjct  340   AGTEATWLRNDSPIVAKT---SIAKAVGDWYYERITSQKID  377



>ref|XP_009794297.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=402

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 150/360 (42%), Positives = 209/360 (58%), Gaps = 27/360 (8%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +     K AVCLDGSPPAYH   G G   ++WLI ++GGGWC +          V  C
Sbjct  30    TYLLSGVAKEAVCLDGSPPAYHHDKGFGTGVNSWLIQMEGGGWCNN----------VTTC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR    LGSS  M K L F GI      +   FY WNRV VRYCDG SF GDV+  +P+
Sbjct  80    LSRKNTRLGSSKQMVKQLAFSGILSNKPQFNPDFYNWNRVKVRYCDGSSFTGDVQAVNPI  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGAR+F  V+++L+AKGMK+A+N I  G SAGGL   +HCD F +  P G +VKC
Sbjct  140   TNLHFRGARVFLAVMEDLLAKGMKNAENAILSGCSAGGLTSILHCDSFKALLPMGAKVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
              SD+  F+ VKD   A + +  F DVV LH   K+LP  CTS++ P  CF P+N+ Q+V+
Sbjct  200   FSDAGYFINVKDISGAPHIEEFFGDVVRLHGSAKNLPPSCTSRLKPNLCFFPQNVAQHVR  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +PLF+ ++AYDS+Q++N        P  ++R  K +    S   +  +Q F+   + AL 
Sbjct  260   TPLFLVNAAYDSWQIKNILAPSVADPRGVWRNCKLDILRCSSRQLQTMQGFRLGFLRALY  319

Query  1101  K--PSATKGFIVTSNFGHSFASNNYKKPMF-ADS---KSKSIESGFYNWFFDKHPINLID  1262
                PS+++G+ + S + H       ++  F ADS    +K+I     +WFFDK+P   ID
Sbjct  320   ALGPSSSRGYFINSCYAH--CQTEVQETWFRADSPKLANKTIAKALGDWFFDKNPFQKID  377



>emb|CDX99378.1| BnaC01g11740D [Brassica napus]
Length=391

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 150/364 (41%), Positives = 209/364 (57%), Gaps = 29/364 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  399   ENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
              +C  R G   GSS F  K   F GI G  +N    FY WNR+ VRYCDG SF G+VE  
Sbjct  74    ASCIKRKGTMKGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGNVEAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +P  KL++RGAR+++ V+D+LMAKGMK+A+N I  G SAG L   +HCD F +  P+  R
Sbjct  134   NPANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAR  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ +S VVALH   KSLPV CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPVSCTSKMKPELCFFPQYVVP  253

Query  933   YVKSPLFIFHSAYDSFQVQNTFP---IDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +   N        S + +  +Q F+ Q++ 
Sbjct  254   SMRTPLFVINAAFDSWQIKNVLAPTGVDKRKEWANCKLDLKKCSAAQLKTVQGFRDQMMR  313

Query  1092  ALPKPSAT--KGFIVTSNFGH----SFAS-NNYKKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL    +T  +G  + S   H    S AS +  K P  A++K   I     NWF+ +   
Sbjct  314   ALSPIHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQVANTK---ISKAVGNWFYGRSAF  370

Query  1251  NLID  1262
               ID
Sbjct  371   QKID  374



>ref|XP_008808358.1| PREDICTED: protein notum homolog [Phoenix dactylifera]
Length=397

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/366 (39%), Positives = 211/366 (58%), Gaps = 29/366 (8%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             + +  T ++ A  KGAVCLDGSPPAYH S G G   +NWL++++GGGWC +         
Sbjct  25    YFVDITYVESAVAKGAVCLDGSPPAYHLSPGFGSGVNNWLVHIEGGGWCNN---------  75

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              V  C +R    LGSS  M K + F GI    + +   FY WN+V VRYCDG SF GDV+
Sbjct  76    -VTTCLARKSTRLGSSRQMVKQIAFSGILNNRQTFNPDFYNWNKVKVRYCDGSSFTGDVK  134

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
             + +P T L+YRGAR++  V+++L+A+GM  A+N    G SAGGL   +HCD F +  P G
Sbjct  135   RVNPTTNLHYRGARVWLAVMEDLLARGMSKAENAFLSGCSAGGLTSILHCDNFRALLPLG  194

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              RVKCLSD+  F+ +KD    ++ KA F+DVV  H   ++LP  CTS+++P  CF P+N+
Sbjct  195   TRVKCLSDAGYFINLKDITGTEHIKAFFNDVVTTHGSAQNLPSSCTSRLTPSMCFFPQNM  254

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
             VQ +++PLFI ++AYDS+Q++N        P   +   K +    S S + ++Q F+ Q 
Sbjct  255   VQKIRTPLFILNAAYDSWQIKNILVPGVADPHGTWHDCKLDIQQCSSSQLQIMQGFRTQF  314

Query  1086  ISALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADSKSKSIE-----SGFYNWFFDKH  1244
             ++AL     S++ G  + S + H     +  +  +  S S  +E         +WF+D+ 
Sbjct  315   LNALAGFGSSSSTGMFINSCYAH---CQSEMQETWLSSNSPVLEKIPIAKAVGDWFYDRI  371

Query  1245  PINLID  1262
                 ID
Sbjct  372   AFQKID  377



>ref|XP_009592441.1| PREDICTED: uncharacterized protein LOC104089292 [Nicotiana tomentosiformis]
Length=394

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/363 (39%), Positives = 206/363 (57%), Gaps = 23/363 (6%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
              ++  TI++ A   GAVCLDG+PPAYH   G G   +NW+I ++GGGWC +         
Sbjct  23    LLVNITILESAVATGAVCLDGTPPAYHLDRGSGTGLNNWVISIEGGGWCQN---------  73

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              + +C  R    LGSS  M K + F GI   +  +   FY WNRV VRYCDGGSF GDVE
Sbjct  74    -ITHCLERKNSRLGSSAKMGKQVAFSGIMSNDPKFNPEFYNWNRVSVRYCDGGSFTGDVE  132

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               DP T L+YRGARIF+ ++ +L+++GM  A+N I  G SAGGL   +HCD F +  PK 
Sbjct  133   AVDPATGLHYRGARIFKAIMADLLSQGMSTAENAILSGCSAGGLASILHCDNFRALLPKS  192

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              RVKC SD+  F+ +KD     Y +  F+DVV LH   K+LP  CTSK+ P  CF P+N+
Sbjct  193   ARVKCFSDAGYFVNLKDISGEAYIEEYFNDVVTLHGSAKNLPPSCTSKLKPSLCFFPQNV  252

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
                +++PLFI ++AYD +QV+N        P   +   K +  + + S++ +LQ F+   
Sbjct  253   AHQLQTPLFIINAAYDHWQVRNILVPSTADPTGAWTNCKADMRNCTLSELKVLQGFRLNF  312

Query  1086  ISALP--KPSATKGFIVTSNFGHSFASNN--YKKPMFADSKSKSIESGFYNWFFDKHPIN  1253
             +  L    PS+T+G+ + S F H        +  P      +K+I     +WF++++   
Sbjct  313   LKVLEGLGPSSTRGYYINSCFSHCQTQQQAYWFGPNSPRLFNKTIAEATGDWFWERNQFQ  372

Query  1254  LID  1262
              ID
Sbjct  373   EID  375



>emb|CDX99377.1| BnaC01g11750D [Brassica napus]
Length=452

 Score =   273 bits (699),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/359 (40%), Positives = 211/359 (59%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  +GAVCLDGSPPAYH   G G   ++WLI L+GGGWC +          V NC
Sbjct  83    TFVRNAVARGAVCLDGSPPAYHLHRGSGTGINSWLIQLEGGGWCNN----------VTNC  132

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SRM   LGSS  M + L F  I    + Y   FY WNRV VRYCDG SF GDV+  +P 
Sbjct  133   LSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPA  192

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGAR++  V+ EL+AKGM++A+N +  G SAGGL   +HCD F +  P G +VKC
Sbjct  193   TNLHFRGARVWLAVMQELLAKGMRNAENAVLSGCSAGGLASLMHCDSFRALLPMGTKVKC  252

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  FL  +D   A+Y K+ F DVVALH   K+LP  CTS+++P  CF P+ + + ++
Sbjct  253   LSDAGFFLNTRDVSGAQYIKSYFKDVVALHGSAKNLPRTCTSRLTPAMCFFPQYVARQIR  312

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISAL-  1097
             +P+FI ++AYDS+Q++N        P   +++ + +  +  P+ + ++QDF+ + +SA+ 
Sbjct  313   TPVFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCQPNQLKVMQDFRLEFLSAVI  372

Query  1098  -PKPSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                 S+++G  + S + H   +       + DS      +I     +W +D+     ID
Sbjct  373   GLGRSSSRGMFIDSCYTHC-QTETQTSWFWQDSPILNRTTIAKAVGDWVYDRKLFQKID  430



>gb|KCW72723.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/366 (40%), Positives = 209/366 (57%), Gaps = 29/366 (8%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +  T +Q A  KGAVCLDGSPPAYHF  G G  A+NWLI  +GG WC +         
Sbjct  25    FNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWLILFEGGAWCNN---------  75

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              V  C +R    LGSS  M K L F GI    + +   FY WN++ VRYCDG SF GDVE
Sbjct  76    -VTTCLARRDTRLGSSKQMVKELSFSGILSNKQKFNPDFYNWNKIKVRYCDGASFTGDVE  134

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               +P T L++RGAR F  +V++LM+KGM +A+N I  G SAGGL   ++CDRF +  P  
Sbjct  135   AVNPATNLHFRGARAFVAIVEDLMSKGMSNAQNAILAGCSAGGLTAILNCDRFRALVPAR  194

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKCL+D+  F+  KD   A + +  +S+VVA H   K+LP  CTSKM P  CF P+N+
Sbjct  195   TKVKCLADAGYFINAKDVSGASHIENFYSEVVATHGSAKNLPTSCTSKMKPGLCFFPQNV  254

Query  927   VQYVKSPLFIFHSAYDSFQVQNTFPIDL------YRAIK-NGSSISPSDMALLQDFKKQI  1085
             V  +++PLFI ++AYDS+Q++N     +      +R+ K +    SP+ + ++QDF+ + 
Sbjct  255   VPQIQTPLFIINAAYDSWQIKNILAPGVADRHGTWRSCKLDIKKCSPNQLKIMQDFRLEF  314

Query  1086  ISALPK--PSATKGFIVTSNFGHSFASNNYK-----KPMFADSKSKSIESGFYNWFFDKH  1244
             + AL     S ++G  + S + H  A           P+ A +   SI     +W++++ 
Sbjct  315   LRALSAVGTSPSRGMFIDSCYAHCQAGTQETWLRNDSPVVAKT---SIAKAVGDWYYERI  371

Query  1245  PINLID  1262
                 ID
Sbjct  372   TSQKID  377



>ref|XP_010536220.1| PREDICTED: protein notum homolog isoform X1 [Tarenaya hassleriana]
Length=399

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/358 (39%), Positives = 211/358 (59%), Gaps = 23/358 (6%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +Q A  KGAVCLDGSPPAYH   G G   +NWLI L+GGGWC +          V NC
Sbjct  30    TYVQKAVAKGAVCLDGSPPAYHLDRGSGTGINNWLIQLEGGGWCNN----------VTNC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              +RM   LGSS  M K + F  I      Y   FY WNRV +RYCDG SF GDV+  DP 
Sbjct  80    VARMRTHLGSSKQMAKQIAFSAILSNRRQYNPDFYNWNRVKIRYCDGSSFTGDVQTVDPD  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RG R++  V+++L+AKGM++A+N +  G SAGGL   +HCD F +  P G +VKC
Sbjct  140   TNLHFRGGRVWLAVMEDLLAKGMRNAENAVLSGCSAGGLASMLHCDSFRALLPMGSKVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             +SD+  F+  +D   A+Y +  F DVV LH   K+LP+ CTS+++P  CF P+ + Q+++
Sbjct  200   ISDAGFFVNTRDVSGAEYIREYFKDVVTLHGSAKNLPLSCTSRLNPALCFFPQYVAQHIR  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISAL-  1097
             +PLF+ ++AYDS+Q++N        P   +++ + +  +  P+ + ++QDF+ + +SA+ 
Sbjct  260   TPLFVLNAAYDSWQIKNILAPRAADPNGKWQSCQLDIKNCQPNQLKVMQDFRLEFLSAVI  319

Query  1098  -PKPSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
                 S+++G  + S + H  + +  ++  P        +I     +W +D+     ID
Sbjct  320   GLGKSSSRGMFIDSCYAHCQTESQTSWFWPDSPRLDRVTIAKAVGDWVYDRTLFQKID  377



>ref|XP_010434425.1| PREDICTED: uncharacterized protein LOC104718381 isoform X2 [Camelina 
sativa]
Length=379

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 148/364 (41%), Positives = 210/364 (58%), Gaps = 29/364 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  399   ENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
              +C  R G   GSS F  K   F GI G  ++    FY WNR+ VRYCDG SF G+V   
Sbjct  74    ASCIERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +P  KL++RGAR+++ VVD+LMAKGMK+A+N I  G SAG L   +HCD F +  P+  R
Sbjct  134   NPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAR  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ +S VVALH   KSLP+ CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKMKPELCFFPQYVVP  253

Query  933   YVKSPLFIFHSAYDSFQVQNTF---PIDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
             ++++PLF+ ++A+DS+Q++N      +D  +  KN        S + +  +Q F+ Q++ 
Sbjct  254   FMRTPLFVINAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCSAAQLKTVQGFRDQMMR  313

Query  1092  ALPKPSAT--KGFIVTSNFGH----SFAS-NNYKKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL    +T  +G  + S   H    S AS +  K P  A+++   I     NWF+ +   
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQVANTR---IAKAVGNWFYGRSAF  370

Query  1251  NLID  1262
               ID
Sbjct  371   QKID  374



>ref|XP_002867938.1| pectinacetylesterase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44197.1| pectinacetylesterase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=380

 Score =   271 bits (692),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/359 (40%), Positives = 208/359 (58%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  KGAVCLDGSPPAYH   G G   ++WLI L+GGGWC +          V NC
Sbjct  11    TYVRNAVAKGAVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCNN----------VTNC  60

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SRM   LGSS  M + L F  I    + Y   FY WNRV VRYCDG SF GDV+  +P 
Sbjct  61    VSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPA  120

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGAR++  V+ EL+AKGM +A+N +  G SAGGL   +HCD F +  P G +VKC
Sbjct  121   TNLHFRGARVWLAVMQELLAKGMINAENAVLSGCSAGGLASLMHCDSFRALLPMGTKVKC  180

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  FL  +D    +Y K+ F DVV LH   K+LP  CTS+++P  CF P+ + + ++
Sbjct  181   LSDAGFFLNTRDVSGVQYIKSYFEDVVTLHGSAKNLPRSCTSRLTPAMCFFPQYVARQIR  240

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISAL-  1097
             +PLFI ++AYDS+Q++N        P   +++ + +  +  PS + ++QDF+ + +SA+ 
Sbjct  241   TPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCHPSQIKVMQDFRLEFLSAVI  300

Query  1098  -PKPSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                 S+++G  + S + H   +       + DS      +I     +W +D+     ID
Sbjct  301   GLGRSSSRGMFIDSCYTHC-QTETQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKID  358



>ref|XP_010248193.1| PREDICTED: uncharacterized protein LOC104591101 [Nelumbo nucifera]
Length=394

 Score =   271 bits (693),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 151/369 (41%), Positives = 207/369 (56%), Gaps = 25/369 (7%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             + +  T +  A  KGAVCLDGSPPAYH + G G   +NWLI L+GG WC  N+A +    
Sbjct  25    YFVGITYVDNAVAKGAVCLDGSPPAYHMAPGFGSGVNNWLILLEGGAWC--NNATT----  78

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
                 C +R    LGSS  M K L F G     E +   F+ WN+V VRYCDG SF GDVE
Sbjct  79    ----CLARKNTRLGSSKEMVKQLSFSGFLSDKEKFNPDFFNWNKVKVRYCDGSSFTGDVE  134

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               DP T LYYRG RIF  VVD+L+ KGMK+A+N +  G SAGGL V +HCD+F    P+ 
Sbjct  135   AVDPATNLYYRGQRIFNAVVDDLLEKGMKNAQNALLSGCSAGGLSVILHCDKFRELLPQS  194

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKC++D+  F+  K     +Y K  FSDVV  HQ  K+LP  CTSK     CF P+N+
Sbjct  195   TKVKCMADAGFFINAKTIAGTEYIKEFFSDVVTTHQSAKNLPASCTSKGDXTLCFFPQNV  254

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
                V +PLFI ++AYDS+QV+N        P   +   K + +  S + +  +Q F+K+ 
Sbjct  255   APQVTTPLFILNAAYDSYQVKNILAPGIADPHGTWHDCKLDITKCSDTQLQAIQGFRKEF  314

Query  1086  ISALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPI  1250
             ++A+   + S TKG  + S + H   S   +  +  DS    + SI     +W+FD+  +
Sbjct  315   LNAIKGVEGSPTKGLFINSCYSHC-QSGMQETWLREDSPVLDNMSISKAVGDWYFDRGTV  373

Query  1251  NLIDPNTVP  1277
               I+    P
Sbjct  374   QKIEQCEYP  382



>gb|KDP28067.1| hypothetical protein JCGZ_19475 [Jatropha curcas]
Length=394

 Score =   271 bits (693),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 144/365 (39%), Positives = 207/365 (57%), Gaps = 30/365 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             IP  +I+ A  KGAVCLDGS PAYHF  G+G   +NW+++++GGGWC            +
Sbjct  27    IPIVLIENAKAKGAVCLDGSAPAYHFQKGEGTGINNWIVHMEGGGWCDD----------I  76

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNE-NYTTFYKWNRVVVRYCDGGSFAGDVEKP  572
             E+C +R     GSS  M K + F GI G  + +   FY WNR+ +RYCDG SF GDVE+ 
Sbjct  77    ESCLARRNTYKGSSSKMNKTMGFSGILGSKQVSNPDFYNWNRIKIRYCDGSSFTGDVEEV  136

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP T LY+RG R++Q V+DEL+AKGM +A+N I  G SAGGL   +HCD+F S  P    
Sbjct  137   DPKTNLYFRGERVWQAVIDELLAKGMNNAQNAILSGCSAGGLAAILHCDKFKSFLPATAT  196

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD       +  F  +V  H   K+LP  CTSKM P  CF P+N+ Q
Sbjct  197   VKCVSDAGYFIHGKDIAGGYEIENFFGRIVTTHGSAKNLPASCTSKMKPELCFFPENVAQ  256

Query  933   YVKSPLFIFHSAYDSFQVQNTFP------IDLYRAIK-NGSSISPSDMALLQDFKKQIIS  1091
              +++PLF+ +SAYD +Q++N            +++ K + +   P+ +  +QDF+ Q I+
Sbjct  257   TMQTPLFVINSAYDFWQLKNVLAPSAADRKGTFKSCKLDLTKCKPAQLETVQDFRTQFIN  316

Query  1092  ALPKPSATK---GFIVTSNFGHSFASN-----NYKKPMFADSKSKSIESGFYNWFFDKHP  1247
             AL      K   G+ + S + H    +       K P+  D++   I     +W+FD+ P
Sbjct  317   ALNIGLGNKTVNGYFIDSCYAHCQTGSPLVWLAEKSPVLNDTR---IAKAVGDWYFDRAP  373

Query  1248  INLID  1262
                ID
Sbjct  374   FQKID  378



>ref|XP_009132784.1| PREDICTED: uncharacterized protein LOC103857370 [Brassica rapa]
Length=391

 Score =   271 bits (693),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 149/364 (41%), Positives = 209/364 (57%), Gaps = 29/364 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  399   ENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
              +C  R G   GSS F  K   F GI G  +N    FY WNR+ VRYCDG SF G+VE  
Sbjct  74    ASCIKRKGTMKGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGNVEAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +P  KL++RGAR+++ V+D+LMAKGMK+A+N I  G SAG L   +HCD F +  P+  R
Sbjct  134   NPANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAR  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ +S VVALH   KSLP+ CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKMKPELCFFPQYVVP  253

Query  933   YVKSPLFIFHSAYDSFQVQNTFP---IDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +   N        S + +  +Q F+ Q++ 
Sbjct  254   SMRTPLFVINAAFDSWQIKNVLAPTGVDKRKEWANCKLDLKKCSAAQLRTVQGFRDQMMR  313

Query  1092  ALPKPSAT--KGFIVTSNFGH----SFAS-NNYKKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL    +T  +G  + S   H    S AS +  K P  A++K   I     NWF+ +   
Sbjct  314   ALSPIHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQVANTK---ISKAVGNWFYGRSAF  370

Query  1251  NLID  1262
               ID
Sbjct  371   QKID  374



>ref|XP_006599203.1| PREDICTED: uncharacterized protein LOC100781246 isoform X1 [Glycine 
max]
 ref|XP_006599204.1| PREDICTED: uncharacterized protein LOC100781246 isoform X2 [Glycine 
max]
 ref|XP_006599205.1| PREDICTED: uncharacterized protein LOC100781246 isoform X3 [Glycine 
max]
Length=399

 Score =   271 bits (693),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/363 (40%), Positives = 210/363 (58%), Gaps = 33/363 (9%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  KGAVCLDGSPPAYHF  G G   +NW+++ +GGGWC +          V  C
Sbjct  30    TFVENAVAKGAVCLDGSPPAYHFHKGSGAGINNWIVHFEGGGWCNN----------VTTC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR    LGSS  M   L F G F  ++ +   FY WNR+ VRYCDG SF GDVE  DP 
Sbjct  80    LSRRDTRLGSSKKMDTSLSFSGFFSNSKKFNPDFYDWNRIKVRYCDGSSFTGDVEAVDPK  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGAR+F VVV++L+AKGMK+A+N I  G SAGGL   ++CDRF S  P   +VKC
Sbjct  140   TNLHFRGARVFAVVVEDLLAKGMKNAQNAIISGCSAGGLASILNCDRFKSLLPATTKVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             L+D+  F+ VKD   A+  +  +S VV  H   K+LP  CTS++ P  CF P+N+V  + 
Sbjct  200   LADAGFFINVKDVSGAQRIEEFYSQVVQTHGSAKNLPTSCTSRLRPGLCFFPQNVVSQIS  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +P+F  ++AYDS+Q++N        P   +R  K +  + SP+ ++++Q F+   + A  
Sbjct  260   TPIFFVNAAYDSWQIKNILAPGAADPRGQWRECKLDIKNCSPNQLSVMQGFRTDFLRAFS  319

Query  1101  --KPSATKGFIVTSNFGH-------SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPIN  1253
                 +A+KG  +   + H       ++  N+   P+ A +   SI     +WF+D+ P  
Sbjct  320   VVGNAASKGHFIDGCYAHCQTGIQETWLRND--SPVVAKT---SIAKAVGDWFYDRRPFR  374

Query  1254  LID  1262
              ID
Sbjct  375   EID  377



>ref|XP_010449359.1| PREDICTED: uncharacterized protein LOC104731629 [Camelina sativa]
Length=391

 Score =   271 bits (692),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 148/364 (41%), Positives = 210/364 (58%), Gaps = 29/364 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  399   ENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
              +C  R G   GSS F  K   F GI G  ++    FY WNR+ VRYCDG SF G+V   
Sbjct  74    ASCIERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +P  KL++RGAR+++ VVD+LMAKGMK+A+N I  G SAG L   +HCD F +  P+  R
Sbjct  134   NPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAR  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ +S VVALH   KSLP+ CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKMKPELCFFPQYVVP  253

Query  933   YVKSPLFIFHSAYDSFQVQNTF---PIDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
             ++++PLF+ ++A+DS+Q++N      +D  +  KN        S + +  +Q F+ Q++ 
Sbjct  254   FMRTPLFVINAAFDSWQIKNVLAPTAVDKRKEWKNCKLDLKKCSAAQLKTVQGFRDQMMR  313

Query  1092  ALPKPSAT--KGFIVTSNFGH----SFAS-NNYKKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL    +T  +G  + S   H    S AS +  K P  A+++   I     NWF+ +   
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQVANTR---ISKAVGNWFYGRSAF  370

Query  1251  NLID  1262
               ID
Sbjct  371   QKID  374



>emb|CDX78932.1| BnaA01g09990D [Brassica napus]
Length=391

 Score =   271 bits (692),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 149/364 (41%), Positives = 209/364 (57%), Gaps = 29/364 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  399   ENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
              +C  R G   GSS F  K   F GI G  +N    FY WNR+ VRYCDG SF G+VE  
Sbjct  74    ASCIKRKGTMKGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGNVEAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +P  KL++RGAR+++ V+D+LMAKGMK+A+N I  G SAG L   +HCD F +  P+  R
Sbjct  134   NPANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAR  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ +S VVALH   KSLP+ CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKMKPELCFFPQYVVP  253

Query  933   YVKSPLFIFHSAYDSFQVQNTF---PIDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +   N        S + +  +Q F+ Q++ 
Sbjct  254   SMRTPLFVINAAFDSWQIKNVLVPTGVDKRKEWANCKLDLKKCSAAQLRTVQGFRDQMMR  313

Query  1092  ALPKPSAT--KGFIVTSNFGH----SFAS-NNYKKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL    +T  +G  + S   H    S AS +  K P  A++K   I     NWF+ +   
Sbjct  314   ALSPIHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQVANTK---ISKAVGNWFYGRSAF  370

Query  1251  NLID  1262
               ID
Sbjct  371   QKID  374



>gb|ACF05806.1| PAE [Litchi chinensis]
Length=399

 Score =   271 bits (693),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 145/403 (36%), Positives = 223/403 (55%), Gaps = 42/403 (10%)
 Frame = +3

Query  99    VSPRSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGS  278
             V  R + W+ LL+  L++             +  +  D  I  T ++ A  KGAVCLDGS
Sbjct  2     VDARWSPWLSLLVCGLIL-------------LKTEGFDVGI--TYVENAVAKGAVCLDGS  46

Query  279   PPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNM-KP  455
             PPAYH   G G   +NWL++++GGGWC +          V  C SR    LGSS  M K 
Sbjct  47    PPAYHLDKGFGAGINNWLVHIEGGGWCNN----------VTTCLSRKNTRLGSSKKMVKV  96

Query  456   LIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDE  632
             + F G+    + +   FY WNR+ VRYCDG SF GDVE  +P T L++RGAR+F  ++++
Sbjct  97    VAFSGMLSNKQKFNPDFYNWNRIKVRYCDGASFTGDVEAVNPATNLHFRGARVFLAIIED  156

Query  633   LMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAK  812
             L+AKGMK+AKN +  G SAGGL   +HCD+F +  P   +VKC +D+  F+  KD   A+
Sbjct  157   LLAKGMKNAKNAVLSGCSAGGLTSILHCDKFQTLLPTSTKVKCFADAGYFINTKDVSGAQ  216

Query  813   YFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQN  992
             + +A +++VVA H   K+LP  CTS++ P  CF P+ + + +++PLFI ++AYDS+Q++N
Sbjct  217   HIEAFYNEVVATHGSAKNLPASCTSRLKPGLCFFPQYMARQIQTPLFIINAAYDSWQIKN  276

Query  993   TF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP--KPSATKGFIVTSNFG  1145
                     P   + + K + ++ SP+ +  +Q F+ Q + AL     S +KG  + S + 
Sbjct  277   ILAPGVADPHGTWHSCKLDINNCSPNQLQTMQSFRLQFLDALSGLGNSTSKGLFIDSCYA  336

Query  1146  HSFASNNYKKPMFADSK----SKSIESGFYNWFFDKHPINLID  1262
             H       ++    D        +I     +W++D+ P   ID
Sbjct  337   H--CQTEMQETWLRDDSPVLGKTTIAKAVGDWYYDRSPFQKID  377



>emb|CDY09289.1| BnaC03g63190D [Brassica napus]
Length=397

 Score =   271 bits (692),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 148/397 (37%), Positives = 221/397 (56%), Gaps = 40/397 (10%)
 Frame = +3

Query  114   NDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYH  293
             N W+ L++ SL I                     ++  T ++ A  KGAVCLDGSPPAYH
Sbjct  5     NQWLVLVVCSLAILKAEG---------------LLVNITFVRNAVAKGAVCLDGSPPAYH  49

Query  294   FSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNM-KPLIFKG  470
                G G   ++WLI L+GGGWC +          V NC SRM  +LGSS  M + L F  
Sbjct  50    LDRGSGTGINSWLIQLEGGGWCHN----------VTNCISRMHTKLGSSKKMVENLAFSA  99

Query  471   IFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKG  647
             I    E     FY WNRV VRYCDG SF GDV+  +P T L++RGAR++  V+ EL+AKG
Sbjct  100   ILSNKEQRNPDFYNWNRVKVRYCDGSSFTGDVKTVNPATNLHFRGARVWLAVMRELLAKG  159

Query  648   MKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAV  827
             M++A+N +  G SAGGL   +HCD F +  P G  VKCLSD+  FL  +D   A+Y K+ 
Sbjct  160   MRNAENAVLSGCSAGGLASLMHCDSFRALLPMGTNVKCLSDAGFFLNTRDVSGAQYIKSY  219

Query  828   FSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF---  998
             F+DVV LH   K+LP  CTS+++P  CF P+ + + +++P+F+ ++AYDS+Q++N     
Sbjct  220   FNDVVTLHGSAKNLPRSCTSRLTPAMCFFPQYVARQIRTPVFVLNAAYDSWQIKNILAPR  279

Query  999   ---PIDLYRAIK-NGSSISPSDMALLQDFKKQIISAL--PKPSATKGFIVTSNFGHSFAS  1160
                P   +++ + +  +   S + ++QDF+ + +SA+     SA++G  + S + H   +
Sbjct  280   AADPDGKWQSCQLDIKNCQRSQLKVMQDFRLEFLSAVIGLGRSASRGMFIDSCYTHC-QT  338

Query  1161  NNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                    + DS      +I     +W +D++    ID
Sbjct  339   ETQTSWFWQDSPILNRTTIAKAVGDWVYDRNLFQKID  375



>ref|XP_009388128.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=393

 Score =   271 bits (692),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/319 (45%), Positives = 200/319 (63%), Gaps = 19/319 (6%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T++  A  KGAVCLDGSPPAYHFS G G  A+NWL++++GGGWC +          V
Sbjct  30    VPMTLLHSAVAKGAVCLDGSPPAYHFSPGSGSGANNWLVHMEGGGWCRN----------V  79

Query  399   ENCSSRMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPD  575
             E C  R     GSS +MKPL F GI G ++ Y   FY WNRV +RYCDG SF GDVE+ D
Sbjct  80    EECLERKNNFRGSSNHMKPLSFSGILGKSKKYNPDFYNWNRVKIRYCDGSSFTGDVERVD  139

Query  576   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRV  755
             P T L+YRGAR++  ++++L+AKGM  A+N +  G SAGGL   +HCD+F S  P   +V
Sbjct  140   PATNLHYRGARVWLAIMEDLLAKGMNKAENALLSGCSAGGLASILHCDKFRSLLPASAKV  199

Query  756   KCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  935
             KC SD+  F+  KD       +++++DVV LH   K+LP  CTS +SP  CF P+N+V  
Sbjct  200   KCFSDAGYFIDGKDITGTTSIRSLYNDVVNLHGSGKNLPSSCTSSLSPSLCFFPQNVVPK  259

Query  936   VKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISA  1094
             + +PLFI ++AYD++Q++NT       P   + A K N +S S   +  +QDF+ + + A
Sbjct  260   MSTPLFILNAAYDAWQIKNTLAPSSADPHKSWNACKLNITSCSSDQLEKMQDFRSEFLRA  319

Query  1095  LPKP-SATKGFIVTSNFGH  1148
             LP   +++ G  + S + H
Sbjct  320   LPASGNSSTGMFIISCYAH  338



>ref|XP_010434424.1| PREDICTED: uncharacterized protein LOC104718381 isoform X1 [Camelina 
sativa]
Length=391

 Score =   271 bits (692),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 148/364 (41%), Positives = 210/364 (58%), Gaps = 29/364 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  399   ENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
              +C  R G   GSS F  K   F GI G  ++    FY WNR+ VRYCDG SF G+V   
Sbjct  74    ASCIERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +P  KL++RGAR+++ VVD+LMAKGMK+A+N I  G SAG L   +HCD F +  P+  R
Sbjct  134   NPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAR  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ +S VVALH   KSLP+ CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKMKPELCFFPQYVVP  253

Query  933   YVKSPLFIFHSAYDSFQVQNTF---PIDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
             ++++PLF+ ++A+DS+Q++N      +D  +  KN        S + +  +Q F+ Q++ 
Sbjct  254   FMRTPLFVINAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCSAAQLKTVQGFRDQMMR  313

Query  1092  ALPKPSAT--KGFIVTSNFGH----SFAS-NNYKKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL    +T  +G  + S   H    S AS +  K P  A+++   I     NWF+ +   
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQVANTR---IAKAVGNWFYGRSAF  370

Query  1251  NLID  1262
               ID
Sbjct  371   QKID  374



>ref|XP_010536189.1| PREDICTED: uncharacterized protein LOC104811235 isoform X1 [Tarenaya 
hassleriana]
Length=391

 Score =   271 bits (692),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 147/369 (40%), Positives = 214/369 (58%), Gaps = 29/369 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +  A  +GAVCLDGSPPAYHF  G G   +NW+++++GGGWC  ND        +
Sbjct  24    VPITYLNSAVARGAVCLDGSPPAYHFDKGFGSGVNNWIVHMEGGGWC--ND--------I  73

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
              +CS R     GSS  M K   F GI G  ++    FY WNR+ VRYCDG SF GDVE  
Sbjct  74    ASCSERKNTMKGSSKLMNKDFGFSGILGSQQSTNPDFYNWNRIKVRYCDGSSFTGDVEAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +P  KL++RGAR+++ V+D+LMAKGM  A+N I  G SAG L   +HCD+F +  P+  +
Sbjct  134   NPSNKLFFRGARVWRAVIDDLMAKGMNKAQNAILSGCSAGALAAILHCDQFHAILPRTAK  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ +S VVALH   K+LPV CTS+M P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDITGGSYIESYYSKVVALHGSAKTLPVSCTSRMKPELCFFPQYVVP  253

Query  933   YVKSPLFIFHSAYDSFQVQNTF---PIDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +  K+        +P+ +  +Q F+ QI+ 
Sbjct  254   SMRTPLFVVNAAFDSWQIKNVLAPSAVDKRKEWKDCKLDLKKCTPAQLRTVQGFRDQILR  313

Query  1092  ALP--KPSATKGFIVTSNFGH----SFAS-NNYKKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL     + ++G  + S   H    S AS +  K P   ++K   I     +WF+D+ P 
Sbjct  314   ALAPVHSTTSRGLFLDSCHAHCQGGSAASWSGSKGPSVGNTK---IAKAVGDWFYDRSPF  370

Query  1251  NLIDPNTVP  1277
                D  T P
Sbjct  371   QKTDCPTYP  379



>gb|KHN41567.1| Protein notum like [Glycine soja]
Length=399

 Score =   271 bits (692),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 146/363 (40%), Positives = 210/363 (58%), Gaps = 33/363 (9%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  KGAVCLDGSPPAYHF+ G G   +NW+++ +GGGWC +          V  C
Sbjct  30    TFVENAVAKGAVCLDGSPPAYHFNKGSGAGINNWIVHFEGGGWCNN----------VTTC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR    LGSS  M   L F G F  ++ +   FY WNR+ VRYCDG SF GDVE  DP 
Sbjct  80    LSRRDTRLGSSKKMDTSLSFSGFFSNSKKFNPDFYDWNRIKVRYCDGSSFTGDVEAVDPK  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGAR+F VVV++L+AKGMK+A+N I  G SAGGL   ++CDRF S  P   +VKC
Sbjct  140   TNLHFRGARVFAVVVEDLLAKGMKNAQNAIISGCSAGGLASILNCDRFKSLLPATTKVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             L+D+  F+ VKD   A+  +  +S VV  H   K+LP  CTS++ P  CF P+N+V  + 
Sbjct  200   LADAGFFINVKDVSGAQRIEEFYSQVVQTHGSAKNLPTSCTSRLRPGLCFFPQNVVSQIS  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +P+F  ++AYDS+Q++N        P   +R  K +  + SP+ ++++Q F+   + A  
Sbjct  260   TPIFFVNAAYDSWQIKNILAPGAADPHGQWRECKLDIKNCSPNQLSVMQGFRTDFLRAFS  319

Query  1101  --KPSATKGFIVTSNFGH-------SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPIN  1253
                  A+KG  +   + H       ++  N+   P+ A +   SI     +WF+D+ P  
Sbjct  320   VVGNGASKGHFIDGCYAHCQTGIQETWLRND--SPVVAKT---SIAKAVGDWFYDRRPFR  374

Query  1254  LID  1262
              ID
Sbjct  375   EID  377



>gb|EEC77932.1| hypothetical protein OsI_17271 [Oryza sativa Indica Group]
Length=530

 Score =   275 bits (702),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 158/434 (36%), Positives = 227/434 (52%), Gaps = 41/434 (9%)
 Frame = +3

Query  18    PFHSRLRGDL------IS*LTLEANNPESLRMAVSPRSNDWICLLIFSLVISVQYANVNP  179
             P HSR  G +      +S   + A  P +  MA S  S +W+      LV+ +  A    
Sbjct  104   PDHSRGGGLMGYSFGGVSAQLIAAATPTAGGMAAS--SGEWLSRAAMVLVLGLVVA----  157

Query  180   IPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWC  359
               +      +D +  K+ +      GAVCLDGSPP YHFS G G  A+NWL++++GGGWC
Sbjct  158   --SSAKAGDVDMVFLKSAV----STGAVCLDGSPPVYHFSPGSGSGANNWLVHMEGGGWC  211

Query  360   MSNDAYSTLDLSVENCSSRMGRELGSSFNMKPLIFKGIFGMNE-NYTTFYKWNRVVVRYC  536
              +           + CS R G   GSS  M+PL F GI G N+ N   FY WNR+ VRYC
Sbjct  212   RN----------AQECSVRQGNFRGSSKFMRPLSFSGIIGGNQRNNPDFYNWNRIKVRYC  261

Query  537   DGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHC  716
             DG SF GDVE  +  T L++RGAR++  ++++L+AKGM  A+N +  G SAGGL   +HC
Sbjct  262   DGSSFTGDVETVETSTNLHFRGARVWNAIIEDLLAKGMSKAQNALLSGCSAGGLAAILHC  321

Query  717   DRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMS  896
             D+F    P    VKC SD+  F+  KD     + +  + DVV LH   K+LP  CTSKMS
Sbjct  322   DQFRDLLPATANVKCFSDAGFFVDGKDITGNDFVRTFYKDVVNLHGSAKNLPSSCTSKMS  381

Query  897   PFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFPIDLYRAIKNG-------SSISPSDM  1055
             P  CF P+N+V  +++PLFI ++AYD++Q++N          K         ++ S S +
Sbjct  382   PDLCFFPQNVVPTLRTPLFILNAAYDAWQIKNVLAPSAADKKKTWAKCKLDITACSSSQL  441

Query  1056  ALLQDFKKQIISALPKPS---ATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGF  1220
               LQ+F+   ++ALPKP    A     + S + H  S + + +        +   I    
Sbjct  442   TTLQNFRTDFLAALPKPEQSPANLSIFIDSCYAHCQSGSQDTWLAQGSPVVEKTQIGKAV  501

Query  1221  YNWFFDKHPINLID  1262
              +WF D+     ID
Sbjct  502   GDWFHDREVSRRID  515



>emb|CAD41867.2| OSJNBa0041A02.14 [Oryza sativa Japonica Group]
 emb|CAH67867.1| B0403H10-OSIGBa0105A11.19 [Oryza sativa Indica Group]
Length=396

 Score =   270 bits (691),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 141/356 (40%), Positives = 199/356 (56%), Gaps = 23/356 (6%)
 Frame = +3

Query  234   IQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSS  413
             ++ A   GAVCLDGSPP YHFS G G  A+NWL++++GGGWC +           + CS 
Sbjct  36    LKSAVSTGAVCLDGSPPVYHFSPGSGSGANNWLVHMEGGGWCRN----------AQECSV  85

Query  414   RMGRELGSSFNMKPLIFKGIFGMNE-NYTTFYKWNRVVVRYCDGGSFAGDVEKPDPVTKL  590
             R G   GSS  M+PL F GI G N+ N   FY WNR+ VRYCDG SF GDVE  +  T L
Sbjct  86    RQGNFRGSSKFMRPLSFSGIIGGNQRNNPDFYNWNRIKVRYCDGSSFTGDVETVETSTNL  145

Query  591   YYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSD  770
             ++RGAR++  ++++L+AKGM  A+N +  G SAGGL   +HCD+F    P    VKC SD
Sbjct  146   HFRGARVWNAIIEDLLAKGMSKAQNALLSGCSAGGLAAILHCDQFRDLLPATANVKCFSD  205

Query  771   SSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPL  950
             +  F+  KD     + +  + DVV LH   K+LP  CTSKMSP  CF P+N+V  +++PL
Sbjct  206   AGFFVDGKDITGNDFVRTFYKDVVNLHGSAKNLPSSCTSKMSPDLCFFPQNVVPTLRTPL  265

Query  951   FIFHSAYDSFQVQNTFPIDLYRAIKNG-------SSISPSDMALLQDFKKQIISALPKPS  1109
             FI ++AYD++Q++N          K         ++ S S +  LQ+F+   ++ALPKP 
Sbjct  266   FILNAAYDAWQIKNVLAPSAADKKKTWAKCKLDITACSSSQLTTLQNFRTDFLAALPKPE  325

Query  1110  ---ATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
                A     + S + H  S + + +        +   I     +WF D+     ID
Sbjct  326   QSPANLSIFIDSCYAHCQSGSQDTWLAQGSPVVEKTQIGKAVGDWFHDREVSRRID  381



>ref|XP_006368062.1| PREDICTED: protein notum homolog, partial [Solanum tuberosum]
Length=329

 Score =   268 bits (685),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 139/319 (44%), Positives = 192/319 (60%), Gaps = 21/319 (7%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
              ++  TI++ A  KGAVCLDG+PPAYH   G G   +NW+I L+GGGWC +         
Sbjct  21    LLVNITILESAVAKGAVCLDGTPPAYHLDRGSGPGVNNWVISLEGGGWCQN---------  71

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              V  C +R    LGSS  M   L F G+   + N+   FY WNRV VRYCDGGSF GDVE
Sbjct  72    -VTLCLTRKNTRLGSSAKMDHQLPFSGMMSNDPNFNPEFYNWNRVSVRYCDGGSFTGDVE  130

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               DP T L+YRGARIF+ +++EL+A+GM  ++N I  G SAGGL   +HCD F +  P  
Sbjct  131   AIDPGTGLHYRGARIFKAIMEELLAQGMNTSQNAILSGCSAGGLATILHCDNFRTLLPNN  190

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKC SD+  F+ + D     Y +  F+DVV LH   K+LP  CTSK+ P  CF P+N+
Sbjct  191   AKVKCFSDAGYFIHLNDISGKPYIEHYFNDVVTLHGSAKNLPPSCTSKLKPGLCFFPENV  250

Query  927   VQYVKSPLFIFHSAYDSFQVQN------TFPIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
              Q +K+PLFI ++AYD +QV+N      T P   + + K N  + +P  + +LQ F++  
Sbjct  251   AQQIKTPLFIINAAYDHWQVRNILVAPGTDPKGAWTSCKANIKNCTPYQLTVLQGFREDF  310

Query  1086  ISALP--KPSATKGFIVTS  1136
             + AL     S+T+G+ + S
Sbjct  311   LKALEGIGRSSTRGYYINS  329



>gb|EYU37455.1| hypothetical protein MIMGU_mgv1a007934mg [Erythranthe guttata]
Length=390

 Score =   270 bits (690),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 148/354 (42%), Positives = 202/354 (57%), Gaps = 29/354 (8%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +Q A  KGAVCLDGSPPAYH   G G   +NWL+ ++GGGWC +          V  C
Sbjct  24    TYVQTAVAKGAVCLDGSPPAYHLDRGFGAGVNNWLVQIEGGGWCNN----------VTTC  73

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              +R    LGSS  M K L F  I      +   FY WNRV +RYCDG SF GDVE  DPV
Sbjct  74    LARKTNRLGSSKQMIKQLAFSAILSDKPQFNPDFYNWNRVKIRYCDGSSFTGDVEAVDPV  133

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             TKLYYRGAR+F  V++EL+AKGMK+A+N +  G SAGGL   +HCD F +  P   +VKC
Sbjct  134   TKLYYRGARVFVAVMEELLAKGMKNAQNAVLSGCSAGGLASILHCDSFKALLPVRTKVKC  193

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
              SD+  F+  KD   A + +A F+DVV  H   K+LP+ CTSKM P  CF P+ + + ++
Sbjct  194   FSDAGYFINTKDISAADHIEAYFNDVVTTHGSAKNLPISCTSKMKPSLCFFPQYVSKEIR  253

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIKNG-SSISPSDMALLQDFK----KQII  1088
             +PLF+ ++AYDS+Q++N        P  ++   K   +  S   +  +Q F+    K I 
Sbjct  254   TPLFVINAAYDSWQIKNILAPGVADPHGIWHDCKTDITKCSTDQLRTMQGFRLEFLKAIS  313

Query  1089  SALPKPSATKGFIVTSNFGHSFASNNYKKPMFA-DS---KSKSIESGFYNWFFD  1238
             S L     T+G+ + S + H       ++  FA DS    +K+I     +WF+D
Sbjct  314   SGLGPLINTRGYFINSCYAH--CQTEMQENWFAIDSPKLNNKTIAKAVGDWFYD  365



>ref|NP_001053773.1| Os04g0602500 [Oryza sativa Japonica Group]
 dbj|BAF15687.1| Os04g0602500 [Oryza sativa Japonica Group]
 dbj|BAG93730.1| unnamed protein product [Oryza sativa Japonica Group]
Length=466

 Score =   272 bits (696),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 149/406 (37%), Positives = 217/406 (53%), Gaps = 33/406 (8%)
 Frame = +3

Query  84    SLRMAVSPRSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAV  263
             S  +A++  S +W+      LV+ +  A      +      +D +  K+ +      GAV
Sbjct  66    SSTLAMAASSGEWLSRAAMVLVLGLVVA------SSAKAGDVDMVFLKSAV----STGAV  115

Query  264   CLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSF  443
             CLDGSPP YHFS G G  A+NWL++++GGGWC +           + CS R G   GSS 
Sbjct  116   CLDGSPPVYHFSPGSGSGANNWLVHMEGGGWCRN----------AQECSVRQGNFRGSSK  165

Query  444   NMKPLIFKGIFGMNE-NYTTFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQV  620
              M+PL F GI G N+ N   FY WNR+ VRYCDG SF GDVE  +  T L++RGAR++  
Sbjct  166   FMRPLSFSGIIGGNQRNNPDFYNWNRIKVRYCDGSSFTGDVETVETSTNLHFRGARVWNA  225

Query  621   VVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDP  800
             ++++L+AKGM  A+N +  G SAGGL   +HCD+F    P    VKC SD+  F+  KD 
Sbjct  226   IIEDLLAKGMSKAQNALLSGCSAGGLAAILHCDQFRDLLPATANVKCFSDAGFFVDGKDI  285

Query  801   EHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSF  980
                 + +  + DVV LH   K+LP  CTSKMSP  CF P+N+V  +++PLFI ++AYD++
Sbjct  286   TGNDFVRTFYKDVVNLHGSAKNLPSSCTSKMSPDLCFFPQNVVPTLRTPLFILNAAYDAW  345

Query  981   QVQNTFPIDLYRAIKNG-------SSISPSDMALLQDFKKQIISALPKPS---ATKGFIV  1130
             Q++N          K         ++ S S +  LQ+F+   ++ALPKP    A     +
Sbjct  346   QIKNVLAPSAADKKKTWAKCKLDITACSSSQLTTLQNFRTDFLAALPKPEQSPANLSIFI  405

Query  1131  TSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
              S + H  S + + +        +   I     +WF D+     ID
Sbjct  406   DSCYAHCQSGSQDTWLAQGSPVVEKTQIGKAVGDWFHDREVSRRID  451



>ref|XP_004953590.1| PREDICTED: protein notum homolog isoform X1 [Setaria italica]
Length=401

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 149/369 (40%), Positives = 208/369 (56%), Gaps = 35/369 (9%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
              ++  T ++ A  KGAVCLDGS PAYH + G G   ++WL++ +GGGWC +         
Sbjct  29    LLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSGVNSWLVHFEGGGWCSN---------  79

Query  393   SVENCSSRMGRELGSSFNMKPLI-FKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              V  C  R    LGSS  M   I F GI     +Y   FY WN+V VRYCDG SF GDVE
Sbjct  80    -VTTCLQRKRTRLGSSKEMATQIAFSGILSDTPDYNPDFYNWNKVKVRYCDGSSFTGDVE  138

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
             + DP TKL+YRGARI+Q V+++L+AKGM  A+N +  G SAGGL   +HCDRF    P G
Sbjct  139   EVDPTTKLHYRGARIWQAVMEDLLAKGMDKAENALISGCSAGGLTSILHCDRFHDLLPLG  198

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              RVKCLSD+  F+  KD     Y  A F+DVV  H   K+LP  CTS + P  CF P N 
Sbjct  199   ARVKCLSDAGFFINEKDVAGVGYIAAFFNDVVTTHGSAKNLPSSCTSILPPGVCFFPSNE  258

Query  927   VQYVKSPLFIFHSAYDSFQVQNTFPIDL------YRAIKNG-SSISPSDMALLQDFKKQI  1085
             V+ +++PLFI ++AYD +QV+N     +      + + K+     S + + +LQ F+   
Sbjct  259   VKQIQTPLFILNAAYDYWQVRNILVPGVADRRGTWHSCKHDIDQCSAAQLRVLQGFRDDF  318

Query  1086  ISALPKP--SATKGFIVTSNFGHS--------FASNNYKKPMFADSKSKSIESGFYNWFF  1235
             + A+ +   S ++G  + S F H         F+S++   PM  ++   +I +   +WFF
Sbjct  319   LKAVAEQGNSTSRGLFINSCFVHCQSEIQELWFSSDS---PMLGNT---TIAAAVGDWFF  372

Query  1236  DKHPINLID  1262
             D+ P   ID
Sbjct  373   DRSPFQKID  381



>ref|XP_009108427.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=397

 Score =   270 bits (689),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 142/364 (39%), Positives = 212/364 (58%), Gaps = 25/364 (7%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
              ++  T ++ A  KGAVCLDGSPPAYH   G G   ++WLI L+GGGWC +         
Sbjct  23    LLVNITFVRNAVAKGAVCLDGSPPAYHIDRGSGTGINSWLIQLEGGGWCHN---------  73

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              V NC SRM  +LGSS  M + L F  I    E     FY WNRV VRYCDG SF GDV+
Sbjct  74    -VTNCISRMHTKLGSSKKMVENLAFSAILSNKEQRNPDFYNWNRVKVRYCDGSSFTGDVK  132

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               +P T L++RGAR++  V+ EL+AKGM++A+N +  G SAGGL   +HCD F +  P G
Sbjct  133   TVNPATNLHFRGARVWLAVMQELLAKGMRNAENAVLSGCSAGGLASLMHCDSFRALLPMG  192

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
               VKCLSD+  FL  +D   A+Y K+ F+DVV LH   K+LP  CTS+++P  CF P+ +
Sbjct  193   TNVKCLSDAGFFLNTRDVSGAQYIKSYFNDVVTLHGSAKNLPRSCTSRLNPAMCFFPQYV  252

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
              + +++P+F+ ++AYDS+Q++N        P   +++ + +  +   S + ++QDF+ + 
Sbjct  253   ARQIRTPVFVLNAAYDSWQIKNILAPRAADPEGKWQSCQLDIKNCQRSQLKVMQDFRLEF  312

Query  1086  ISAL--PKPSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPI  1250
             +SA+     SA++G  + S + H   +       + DS      +I     +W +D++  
Sbjct  313   LSAVIGLGRSASRGMFIDSCYTHC-QTETQTSWFWQDSPILNRTTIAKAVGDWVYDRNLF  371

Query  1251  NLID  1262
               ID
Sbjct  372   QKID  375



>emb|CDP15690.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/365 (38%), Positives = 208/365 (57%), Gaps = 27/365 (7%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +  T ++ A  KGAVCLDGSPPAYH   G G   ++WL++++GGGWC +         
Sbjct  25    FFVDITYVESAVAKGAVCLDGSPPAYHLDRGFGAGINSWLVHIEGGGWCNN---------  75

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              V  C  R    LGSS  M K L F GI      +   FY WNRV VRYCDG SF GDVE
Sbjct  76    -VTTCLDRKNTRLGSSKQMAKQLAFSGILANKPKFNPDFYNWNRVKVRYCDGSSFTGDVE  134

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               +P T L+YRGAR+F  V+++L+AKGM++A++ +  G SAGGL   +HCD F +  P G
Sbjct  135   AVNPATNLHYRGARVFVAVIEDLLAKGMRNAESAVLSGCSAGGLTSILHCDSFKALLPLG  194

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKC +D+  F+  KD    ++ +A ++DVV  H   K+LP  CTS+M P  CF P+ +
Sbjct  195   TKVKCFADAGYFINAKDVSGVQHIEAFYNDVVNTHGSAKNLPATCTSRMKPGLCFFPQYM  254

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
              Q +++PLFI ++AYDS+Q++N        P  L+   K + +  S S + ++Q F+ + 
Sbjct  255   AQEIRTPLFITNAAYDSWQIKNILAPGVADPHGLWHNCKLDITRCSASQLQIIQGFRLEF  314

Query  1086  ISALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADS----KSKSIESGFYNWFFDKHP  1247
             +SA+     S+++G+ +   + H       ++    D       K+I     +WF+D+ P
Sbjct  315   LSAVNGLGTSSSRGYFINGCYAH--CQTEMQETWLRDDSPRLNDKTIAKAVGDWFYDRSP  372

Query  1248  INLID  1262
                ID
Sbjct  373   FQTID  377



>ref|XP_010439720.1| PREDICTED: uncharacterized protein LOC104723107 [Camelina sativa]
Length=391

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/364 (41%), Positives = 209/364 (57%), Gaps = 29/364 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  399   ENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
              +C  R G   GSS F  K   F GI G  ++    FY WNR+ VRYCDG SF G+V   
Sbjct  74    ASCIERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +P  KL++RGAR+++ VVD+LMAKGMK+A+N I  G SAG L   +HCD F +  P+  R
Sbjct  134   NPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAR  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ +S VVALH   KSLP+ CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKMKPELCFFPQYVVP  253

Query  933   YVKSPLFIFHSAYDSFQVQNTF---PIDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +  KN        S + +  +Q F+ Q++ 
Sbjct  254   SMRTPLFVINAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCSAAQLKTVQGFRDQMMR  313

Query  1092  ALPKPSAT--KGFIVTSNFGH----SFAS-NNYKKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL    +T  +G  + S   H    S AS +  K P  A+++   I     NWF+ +   
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQVANTR---ISKAVGNWFYGRSAF  370

Query  1251  NLID  1262
               ID
Sbjct  371   QKID  374



>gb|AFK37852.1| unknown [Lotus japonicus]
Length=399

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/365 (38%), Positives = 208/365 (57%), Gaps = 29/365 (8%)
 Frame = +3

Query  216   IIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLS  395
             I+P   ++ A  KGAVCLDG+PPAYHF  G GE  +NW+++L+GGGWC +          
Sbjct  26    IVPLIRLEKAVSKGAVCLDGTPPAYHFDEGSGEGVNNWIVFLEGGGWCNN----------  75

Query  396   VENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEK  569
             V +C  R     GSS  M +P  F G    N+ +   FY WNR++VRYCDG SF GDVE+
Sbjct  76    VTDCLLRKDTRRGSSDQMTEPRFFNGFLSENQKFNPDFYNWNRILVRYCDGASFTGDVEE  135

Query  570   PDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGV  749
              DP T L++RGAR+F  V++EL+AKGM++A+N I  G SAGGL   + CD F S  P   
Sbjct  136   VDPATNLHFRGARVFVAVIEELLAKGMQNAENAILSGCSAGGLATILQCDHFKSLLPAEA  195

Query  750   RVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLV  929
             +VKC+ D+  F+ VKD    +Y +  +++VVA H   K+LP  CTS+ SP  CF P+ + 
Sbjct  196   KVKCVPDAGYFINVKDTSGTQYIEEYYNEVVATHGSAKNLPPSCTSRRSPGLCFFPQYVA  255

Query  930   QYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQII  1088
               + +P+F  ++AYD++Q+ N F      P  ++   K + ++ SP  +  +Q F+ + I
Sbjct  256   SEISTPIFYVNAAYDTWQIHNIFARGSADPHGIWHNCKLDINNCSPDQLTAIQGFRTEFI  315

Query  1089  SAL--PKPSATKGFIVTSNFGHSFASNNYK-----KPMFADSKSKSIESGFYNWFFDKHP  1247
              AL   + S ++G  + S + H              P  A++K   +     +WF+++ P
Sbjct  316   KALSVTENSRSEGMFIDSCYVHCQTETQESWLSSDSPQLANTK---LGKAVGDWFYERSP  372

Query  1248  INLID  1262
                ID
Sbjct  373   FQKID  377



>ref|XP_010529277.1| PREDICTED: protein notum homolog [Tarenaya hassleriana]
Length=401

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/359 (39%), Positives = 207/359 (58%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  KGAVCLDGSPPAYH   G G   +NWLI L+GGGWC +          V NC
Sbjct  30    TYVKTAMAKGAVCLDGSPPAYHLDKGSGTGINNWLIQLEGGGWCNN----------VTNC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              +RM   LGSS  M K + F  I    + Y   FY WNRV +RYCDG SF GDV+  DP 
Sbjct  80    IARMHTRLGSSKQMAKQIAFSAILSNRKQYNPDFYNWNRVKIRYCDGSSFTGDVQTVDPA  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGAR++  V+++L+AKGM +A+N +  G SAGGL   +HCD F +  P G +VKC
Sbjct  140   TNLHFRGARVWLAVMEDLLAKGMINAENAVLSGCSAGGLASMLHCDSFRALLPMGTKVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  F+  +D    +Y +  F DVV LH   K+LP  CTSK++P  CF P+ + + ++
Sbjct  200   LSDAGFFVNTRDVSGVQYIRQYFKDVVTLHGSAKNLPPSCTSKLNPALCFFPQYVARRIR  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +PLF+ ++AYDS+Q++N        P   +++ + +  +  P+ + ++QDF+ Q +SA+ 
Sbjct  260   TPLFLLNAAYDSWQIKNILAPRAADPNGKWQSCELDIKNCQPNQIKVMQDFRLQFLSAVT  319

Query  1101  --KPSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                 S ++G  + S + H   +       + DS      +I     +W +D+     ID
Sbjct  320   GLGKSPSRGMFIVSCYTHC-QTETQTSWFWTDSPRLNRTTIARAVGDWVYDRKLFQKID  377



>gb|KCW72722.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 146/366 (40%), Positives = 208/366 (57%), Gaps = 29/366 (8%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +  T +Q A  KGAVCLDGSPPAYHF  G G  A+NWLI  +GG WC +         
Sbjct  25    FNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWLILFEGGAWCNN---------  75

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              V  C +R    LGSS  M K L F GI    + +   FY WN++ VRYCDG SF GDVE
Sbjct  76    -VTTCLARRDTRLGSSKQMVKELSFSGILSNKQKFNPDFYNWNKIKVRYCDGASFTGDVE  134

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               +P T L++RGAR F  +V++LM+KGM +A+N I  G SAGGL   ++CDRF +  P  
Sbjct  135   AVNPATNLHFRGARAFVAIVEDLMSKGMSNAQNAILAGCSAGGLTAILNCDRFRALVPAR  194

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKCL+D+  F+  KD   A + +  +S+VVA H   K+LP  CTSKM P  CF P+N+
Sbjct  195   TKVKCLADAGYFINAKDVSGASHIENFYSEVVATHGSAKNLPTSCTSKMKPGLCFFPQNV  254

Query  927   VQYVKSPLFIFHSAYDSFQVQNTFPIDL------YRAIK-NGSSISPSDMALLQDFKKQI  1085
             V  +++PLFI ++AYDS+Q++N     +      +R+ K +    SP+ + ++QDF+ + 
Sbjct  255   VPQIQTPLFIINAAYDSWQIKNILAPGVADRHGTWRSCKLDIKKCSPNQLKIMQDFRLEF  314

Query  1086  ISALPK--PSATKGFIVTSNFGHSFASNNYK-----KPMFADSKSKSIESGFYNWFFDKH  1244
             + AL     S ++G  + S   H  A           P+ A +   SI     +W++++ 
Sbjct  315   LRALSAVGTSPSRGMFIDSCNTHCQAGTEATWLRNDSPIVAKT---SIAKAVGDWYYERI  371

Query  1245  PINLID  1262
                 ID
Sbjct  372   TSQKID  377



>ref|XP_008355284.1| PREDICTED: uncharacterized protein LOC103418943 [Malus domestica]
Length=398

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 142/361 (39%), Positives = 208/361 (58%), Gaps = 29/361 (8%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T+++ A  KGAVCLDGS PAYHF  G G   +NWL++++GGGWC S          V  C
Sbjct  30    TLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHVEGGGWCNS----------VATC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
               R     GSS  M K + F G+ G  +     FY WNR+ VRYCDG SF GDVE  DP 
Sbjct  80    LDRKNNYRGSSTKMEKTMSFSGVLGNKQQTNPDFYNWNRIKVRYCDGSSFTGDVEAVDPA  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGAR+F+ ++D+L+AKGMK+A+  +  G SAGGL   ++CD F S  P G +VKC
Sbjct  140   TNLHFRGARVFRAIIDDLLAKGMKNAQTALLSGCSAGGLASILNCDNFHSLLPVGTKVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             L+D+  F+  K    ++Y +  +S+VVALH   K+LP  CTS+MSP  CF P+N+V   +
Sbjct  200   LADAGYFINAKTVSGSQYIQTFYSEVVALHGSAKNLPASCTSRMSPGLCFFPQNVVPQTR  259

Query  942   SPLFIFHSAYDSFQVQNTFP---IDLYRAIKNG----SSISPSDMALLQDFKKQIISALP  1100
             +P+F  ++AYDS+Q++N       D   A KN      + SPS +  +Q+++ Q ++A+ 
Sbjct  260   TPIFFVNAAYDSWQIKNILAPGVADPKGAWKNCKLSIKNCSPSQLQTMQEYRLQFLNAVA  319

Query  1101  KP--SATKGFIVTSNFGHSFASNN-----YKKPMFADSKSKSIESGFYNWFFDKHPINLI  1259
                 S++ G  + S + H              PM + +   +I     +W++D+ P   I
Sbjct  320   GASSSSSNGLFIDSCYAHCQIGTQETWLATDSPMLSKT---TIAKAVGDWYYDRTPFKNI  376

Query  1260  D  1262
             D
Sbjct  377   D  377



>ref|XP_008378614.1| PREDICTED: uncharacterized protein LOC103441693 [Malus domestica]
 ref|XP_008347801.1| PREDICTED: uncharacterized protein LOC103410927 [Malus domestica]
Length=393

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/359 (39%), Positives = 207/359 (58%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T+++ A  KGAVCLDGS PAYHF  G G   +NWL+Y +GGGWC +          V  C
Sbjct  30    TLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVYFEGGGWCNT----------VATC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
               R    LGSS  M K ++F G+    +     FY WNR+ VRYCDG SF GDVE  DP 
Sbjct  80    LDRSNYSLGSSTKMEKTMLFSGVLSNKQKTNPDFYNWNRIKVRYCDGSSFTGDVEAVDPA  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGAR+F+ ++D+L+AKGMK+A++ +  G SAGGL   +HCD F S  P   +VKC
Sbjct  140   TNLHFRGARVFRAIMDDLLAKGMKNAQSALLSGCSAGGLASILHCDNFRSLLPVDAKVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             + D+  F+  +    + Y +A +S+VVALH   K+LP  CTS+MSP  CF P+N+V   +
Sbjct  200   VPDAGYFINARTVSGSPYIQAFYSEVVALHGSAKNLPASCTSRMSPGLCFFPQNVVPLTR  259

Query  942   SPLFIFHSAYDSFQVQNTFPIDL------YRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +P+F  ++AYD +Q+QN    D+      ++  K N  + SPS +  +Q+F+ Q +  + 
Sbjct  260   TPIFFVNAAYDWWQIQNILAPDVADPEGAWKKCKLNIKNCSPSQLQTMQEFRLQFLKTIT  319

Query  1101  KP--SATKGFIVTSNFGHSFASNNYKKPMFADSK---SKSIESGFYNWFFDKHPINLID  1262
                 S++ G+ + S + H       +  + ADS      +I     +W++D  P   ID
Sbjct  320   GASNSSSHGWFIHSCYAHCQIEMQ-ETWLAADSPMLCKTTIAEAVGDWYYDLTPFRKID  377



>ref|XP_009616254.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=404

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 149/360 (41%), Positives = 208/360 (58%), Gaps = 27/360 (8%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +     KGAVCLDGS PAYH   G G   ++WLI ++GGGWC +          V  C
Sbjct  32    TYLLSGMAKGAVCLDGSSPAYHHDKGFGTGVNSWLIQMEGGGWCNN----------VTTC  81

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR    LGSS  M K L F GI      +   FY WNRV VRYCDG SF GDV+  +P+
Sbjct  82    LSRKNTRLGSSKQMVKQLAFSGILSNKPQFNPDFYNWNRVKVRYCDGSSFTGDVQAVNPI  141

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGAR+F  V+++L+AKGMK+A+N I  G SAGGL   +HCD F +  P G +VKC
Sbjct  142   TNLHFRGARVFLAVMEDLLAKGMKNAENAILSGCSAGGLTSILHCDSFKALLPMGAKVKC  201

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
              SD+  F+ VKD   A + +  F DVV LH   K+LP  CTS++ P  CF P+N+ Q+V+
Sbjct  202   FSDAGYFINVKDISGAPHIEEFFGDVVRLHGSAKNLPPSCTSRLKPNLCFFPQNVAQHVR  261

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +PLF+ ++AYDS+Q++N        P  ++R  K +    S   +  +Q F+   + AL 
Sbjct  262   TPLFLVNAAYDSWQIKNILAPSVADPRGVWRNCKLDILRCSSRQLQTMQGFRLGFLRALI  321

Query  1101  K--PSATKGFIVTSNFGHSFASNNYKKPMF-ADS---KSKSIESGFYNWFFDKHPINLID  1262
                PS+++G+ + S + H       ++  F ADS    +K+I     +WFFDK+    ID
Sbjct  322   TLGPSSSRGYFINSCYAH--CQTEVQETWFRADSPKLANKTIAIALGDWFFDKNSFQKID  379



>ref|XP_010325632.1| PREDICTED: protein notum homolog isoform X1 [Solanum lycopersicum]
Length=402

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/358 (40%), Positives = 207/358 (58%), Gaps = 23/358 (6%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +     KGAVCLDGSPPAYH   G G   ++WLI ++GGGWC +          V  C
Sbjct  30    TYVLSGVAKGAVCLDGSPPAYHHDKGFGTGVNSWLIQMEGGGWCNN----------VTTC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR    LGSS  M + L F GI      +   FY WNRV V YCDG SF GDV++ +P+
Sbjct  80    LSRKNTRLGSSKQMVENLAFSGILSNKPQFNPDFYNWNRVKVGYCDGSSFTGDVQEVNPI  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             TKL++RGAR+F  V++EL+AKGMK+A+N I  G SAGGL   +HCD F +  P G +VKC
Sbjct  140   TKLHFRGARVFLAVMEELLAKGMKNAENAILSGCSAGGLTSILHCDSFKALLPMGAKVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
              SD+  F+ VKD   A + +  F DVV+LH   K+LP  CTS++ P  CF P+N+ Q+V+
Sbjct  200   FSDAGYFIDVKDISGAPHIEEYFRDVVSLHGSAKNLPPVCTSRLKPDLCFFPQNVAQHVR  259

Query  942   SPLFIFHSAYDSFQVQNTFPIDL---YRAIKNGS----SISPSDMALLQDFKKQIISALP  1100
             +PLF+ ++AYDS+Q++N    D+   Y    N        S   + ++  ++   + AL 
Sbjct  260   TPLFLVNAAYDSWQIKNILAPDVADPYGVWLNCKLDILKCSSRQLQIMHGYRLLFLRALN  319

Query  1101  K--PSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
                PS+++G+ + S + H  +     + +       +K+I     +WF+DK+P   ID
Sbjct  320   ALGPSSSRGYFINSCYAHCQTEVQETWYRADSPKLANKTIAKALGDWFYDKNPFQKID  377



>ref|NP_567585.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 gb|AAK96722.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 gb|AAL47339.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 gb|AAM64921.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 dbj|BAF00825.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 gb|AEE84177.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=391

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 149/364 (41%), Positives = 210/364 (58%), Gaps = 29/364 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  399   ENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
              +C+ R G   GSS F  K   F GI G  ++    FY WNR+ VRYCDG SF G+VE  
Sbjct  74    ASCNERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVEAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +P  KL++RGAR+++ VVD+LMAKGMK+A+N I  G SAG L   +HCD F +  P+   
Sbjct  134   NPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAS  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ +S VVALH   KSLPV CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDITGGSYIQSYYSKVVALHGSAKSLPVSCTSKMKPELCFFPQYVVP  253

Query  933   YVKSPLFIFHSAYDSFQVQNTF---PIDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +  KN        S + +  +Q F+ Q++ 
Sbjct  254   SMRTPLFVINAAFDSWQIKNVLAPTAVDKGKEWKNCKLDLKKCSAAQLKTVQGFRDQMMR  313

Query  1092  ALPKPSAT--KGFIVTSNFGH----SFAS-NNYKKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL    +T  +G  + S   H    S AS +  K P  A+++   I     NWF+ +   
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGDKGPQVANTR---IAKAVGNWFYGRSAF  370

Query  1251  NLID  1262
               ID
Sbjct  371   QKID  374



>ref|XP_010677539.1| PREDICTED: protein notum homolog isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=388

 Score =   268 bits (686),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 148/366 (40%), Positives = 211/366 (58%), Gaps = 30/366 (8%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +P T +Q A  KG VCLDGSPPAYHF  G G    NWLI+++GG WC  N+A + L+ 
Sbjct  22    FQVPITYVQDAVAKGGVCLDGSPPAYHFDKGFGAGIHNWLIHMEGGAWC--NNATTCLE-  78

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
                    R    LGSS  M K   F GI      Y+  FY WNR+ VRYCDG SF GDVE
Sbjct  79    -------RTKTRLGSSKLMTKQYTFSGILSNQAKYSPDFYNWNRIKVRYCDGSSFTGDVE  131

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               DP  K+YYRGAR+++ ++D+L+AKGMK+A+N I  G SAGGLG  + CD F +  P G
Sbjct  132   AVDPA-KVYYRGARLWRAIMDDLLAKGMKNAENAILAGCSAGGLGAILQCDNFRALLPSG  190

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKCLSD+  F+  KD     + + VF+DVV  H   K+LP  CTSK  P  CF P+  
Sbjct  191   AKVKCLSDAGFFINAKDISGVSHIQEVFADVVTTHGSAKNLPPSCTSKFDPKLCFFPEYA  250

Query  927   VQYVKSPLFIFHSAYDSFQVQNTFPIDLYRAIKNGS---------SISPSDMALLQDFKK  1079
              + +++PLF+ ++AYD++Q++NT    +  A ++G+           S S + ++  F++
Sbjct  251   ARGIQTPLFLLNAAYDAWQIKNTLAPGV--ADRHGTWHDCKSDIIKCSNSQIQIMHGFRQ  308

Query  1080  QIISALPK--PSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKH  1244
               ++AL     S ++GF + S + H   S   +  +  DS    + +I     +WF+D+ 
Sbjct  309   DFLAALSSLGNSNSRGFYINSCYSHC-QSGTQETWLRDDSPLLDNTTICKAVGDWFYDRK  367

Query  1245  PINLID  1262
             P   ID
Sbjct  368   PFQKID  373



>ref|XP_010235850.1| PREDICTED: protein notum homolog isoform X1 [Brachypodium distachyon]
 ref|XP_010235851.1| PREDICTED: protein notum homolog isoform X1 [Brachypodium distachyon]
Length=395

 Score =   268 bits (686),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 149/363 (41%), Positives = 207/363 (57%), Gaps = 25/363 (7%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +  T +  A  KGAVCLDGS PAYH + G G    +WL++ +GGGWC +         
Sbjct  27    FFVDITYVDSAVAKGAVCLDGSAPAYHLARGFGSGVDSWLVHFEGGGWCSN---------  77

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              V  C  R    LGSS  M K + F GI     ++   FY WN+V VRYCDG SF GD E
Sbjct  78    -VTTCLERKNTRLGSSKEMAKQVAFSGILSNTPDHNPDFYNWNKVRVRYCDGSSFTGDKE  136

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
             + DP TKL+YRGAR++Q V+++L+AKGM  A+N +  G SAGGL   +HCDRF  R P  
Sbjct  137   EVDPTTKLHYRGARVWQAVMEDLLAKGMDRAENALISGCSAGGLTSVLHCDRFRDRMPVE  196

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
               VKCLSD+  F+ VKD    K+    F+DVV  H   K+LP  CTSK+ P  C  P+N 
Sbjct  197   ANVKCLSDAGFFIDVKDIAGEKHAADFFNDVVTTHGSAKNLPSSCTSKLPPGMCLFPQNE  256

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF----PIDLYRAIKNG-SSISPSDMALLQDFKKQIIS  1091
             V+ +++PLFI ++AYDS+QV+N          +R+ K+  +  S   +  LQ F+   + 
Sbjct  257   VKQIQTPLFILNAAYDSWQVRNILVPGGSDPHWRSCKHDINQCSEKQLKTLQGFRDDFLK  316

Query  1092  ALPK--PSATKGFIVTSNFGHSFASNNYKKPMFA-DS---KSKSIESGFYNWFFDKHPIN  1253
             AL +   S+++G  + S F H    +  ++  FA DS    +K I +   +WF+D+ P  
Sbjct  317   ALEEQGSSSSRGLFINSCFAH--CQSEIQEIWFAPDSPVLGNKKIANAIGDWFYDRSPFQ  374

Query  1254  LID  1262
              ID
Sbjct  375   EID  377



>gb|KCW72721.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   268 bits (685),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 145/366 (40%), Positives = 207/366 (57%), Gaps = 29/366 (8%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +  T +Q A  KGAVCLDGSPPAYHF  G G  A+NWLI  +GG WC +         
Sbjct  25    FNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWLILFEGGAWCNN---------  75

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              V  C +R    LGSS  M K L F GI    + +   FY WN++ VRYCDG SF GDVE
Sbjct  76    -VTTCLARRDTRLGSSKQMVKELSFSGILSNKQKFNPDFYNWNKIKVRYCDGASFTGDVE  134

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               +P T L++RGAR F  +V++LM+KGM +A+N I  G SAGGL   ++CDRF +  P  
Sbjct  135   AVNPATNLHFRGARAFVAIVEDLMSKGMSNAQNAILSGCSAGGLAAILNCDRFRALMPAR  194

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKCL+D+  F+  KD   A + +  +S+VVA H   K+LP  CTSKM P  CF P+N+
Sbjct  195   TKVKCLADAGYFINAKDVSGASHIENFYSEVVATHGSAKNLPTSCTSKMKPGLCFFPQNV  254

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
             V  +++PLFI ++AYD++Q++N        P   + + K +    SP+ + ++QDF+ + 
Sbjct  255   VPQIQTPLFIINAAYDAWQIKNILAPGVADPHGTWNSCKLDIKKCSPNQLKIMQDFRLEF  314

Query  1086  ISALPK--PSATKGFIVTSNFGHSFASNNYK-----KPMFADSKSKSIESGFYNWFFDKH  1244
             + AL     S ++G  + S   H  A           P+ A +   SI     +W++++ 
Sbjct  315   LRALSAVGTSPSRGMFIDSCNTHCQAGTEATWLRNDSPIVAKT---SIAKAVGDWYYERI  371

Query  1245  PINLID  1262
                 ID
Sbjct  372   TSQKID  377



>ref|XP_002867940.1| hypothetical protein ARALYDRAFT_492921 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44199.1| hypothetical protein ARALYDRAFT_492921 [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   268 bits (685),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 148/364 (41%), Positives = 210/364 (58%), Gaps = 29/364 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  399   ENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
              +C+ R G   GSS F  K   F GI G  ++    FY WNR+ VRYCDG SF G+VE  
Sbjct  74    ASCNERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVEAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +P  KL++RGAR+++ V+D+LMAKGMK+A+N I  G SAG L   +HCD F +  P+   
Sbjct  134   NPANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAS  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ +S VVALH   KSLPV CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDITGGSYIESYYSKVVALHGSAKSLPVSCTSKMKPELCFFPQYVVP  253

Query  933   YVKSPLFIFHSAYDSFQVQNTF---PIDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +  KN        S + +  +Q F+ Q++ 
Sbjct  254   SMRTPLFVINAAFDSWQIKNVLAPTAVDKGKQWKNCKLDLKKCSAAQLKTVQGFRDQMMR  313

Query  1092  ALPKPSAT--KGFIVTSNFGH----SFAS-NNYKKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL    +T  +G  + S   H    S AS +  K P  A+++   I     NWF+ +   
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGDKGPQVANTR---IAKAVGNWFYGRSAF  370

Query  1251  NLID  1262
               ID
Sbjct  371   QKID  374



>ref|XP_004300392.1| PREDICTED: protein notum homolog [Fragaria vesca subsp. vesca]
Length=394

 Score =   268 bits (684),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 141/359 (39%), Positives = 207/359 (58%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T++Q A  KGAVCLDGSPPAYHF  G G   +NWL++++GGGWC            VE+C
Sbjct  30    TLVQSAVAKGAVCLDGSPPAYHFDKGFGAGINNWLVHIEGGGWCKD----------VESC  79

Query  408   SSRMGRELGSSFNMKPLI-FKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
               R     GSS +M+  I F G+ G  E     FY WNR+ VRYCDG SF GDVE  +P 
Sbjct  80    VERTKNFRGSSKHMEKTISFSGVLGKKETLNPDFYNWNRIKVRYCDGSSFTGDVEAVNPA  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RG R+F  V+D+L+AKGM +AKN +  G SAGGL   + CD F S  P G  VKC
Sbjct  140   TNLHFRGGRVFLAVIDDLLAKGMMNAKNALLSGCSAGGLASILQCDNFRSLLPAGTNVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             L+D+  F+  K    ++  +A +S VVALH   K LP  CTS+++P  CF P+N+V  ++
Sbjct  200   LADAGYFINAKSISGSQQIEAFYSQVVALHGSAKHLPASCTSRLNPGLCFFPQNVVPTLR  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIKNG-SSISPSDMALLQDFKKQIISALP  1100
             +P+F+ ++AYDS+Q++N        P   +++ K G  + SP+ +  +QD++   ++ L 
Sbjct  260   TPIFLVNAAYDSWQIKNILAPSAADPKGSWKSCKMGIKNCSPAQIQTMQDYRTTFLNVLN  319

Query  1101  K--PSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                 S + G  + S + H       +  + ADS      +I     +W++++ P   ID
Sbjct  320   GGLTSPSHGAFIDSCYAHCQIGTQ-ETWLAADSPVVGKTTIAKAVGDWYYNRSPSKKID  377



>ref|XP_004244767.2| PREDICTED: protein notum homolog [Solanum lycopersicum]
Length=387

 Score =   268 bits (684),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 144/366 (39%), Positives = 218/366 (60%), Gaps = 16/366 (4%)
 Frame = +3

Query  195   TEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDA  374
             T +Y ++ + KTI++ A  KGAVCLDGSPPAY+   G GE A +W+I+L GGGWC     
Sbjct  33    TYNYDEYFVGKTIVKNAVSKGAVCLDGSPPAYYMDRGFGEGAQSWMIHLSGGGWCRD---  89

Query  375   YSTLDLSVENCSSRMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSF  551
                    V +C +R     GSS  M P  F+G F  N+      + WN+V+V YCDGG+F
Sbjct  90    -------VRDCQNRSTTSFGSSKYMVPFKFRGHFSNNKIANPDLFNWNKVMVAYCDGGAF  142

Query  552   AGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTS  731
              GDVE  DP T L++RGARIF  V+++L+++G+ DAKN + +G SAG     ++CDRF+ 
Sbjct  143   TGDVETVDPGTNLHFRGARIFSAVMEDLLSRGLNDAKNALLIGSSAGAYPAMLYCDRFSK  202

Query  732   RFPKGVRVKCLSDSSLFLIV-KDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFEC  908
               P   R+KCL+DS  F+ V K+ +  K F++++ ++V LH   K+LP  CTS+M P  C
Sbjct  203   LLPNTPRLKCLTDSGYFIDVNKNLQKGKGFESIYKELVTLHGSAKALPKSCTSRMKPELC  262

Query  909   FQPKNLVQYVKSPLFIFHSAYDSFQVQNTFPIDLYRAIKNGSSISPSDMALLQDFKKQII  1088
             F P+N+ QY+K+PL+   S +D  QV  +   D Y AIK  ++ S +    L++ + +++
Sbjct  263   FFPQNVQQYIKTPLYTIMSPFDIVQVGTSLG-DYYNAIKQ-NNCSANQKKNLRELRLELL  320

Query  1089  SALPKPSATK--GFIVTSNFGHSFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
             S LP  S TK  G  + S F H+   + +     +   + ++   F +W+FD+    LID
Sbjct  321   SKLPNASDTKSRGAFIDSQFHHTRLQSYWNPQNVSVVNNVTMIKAFGDWYFDRQYYYLID  380

Query  1263  PNTVPI  1280
              + +PI
Sbjct  381   KHDLPI  386



>ref|XP_008808368.1| PREDICTED: uncharacterized protein LOC103720446 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008808369.1| PREDICTED: uncharacterized protein LOC103720446 isoform X2 [Phoenix 
dactylifera]
Length=396

 Score =   268 bits (684),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 138/360 (38%), Positives = 203/360 (56%), Gaps = 20/360 (6%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +P T++Q A  KGAVCLDGSPPAYHF+ G G   +NWL++++GGGWC +         
Sbjct  27    FDVPLTLVQSAVAKGAVCLDGSPPAYHFAPGFGSGVNNWLVHMEGGGWCRN---------  77

Query  393   SVENCSSRMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEK  569
              VE C  R     GSS  MK L F GI G  +N    FY WN+V +RYCDG SF GD+E 
Sbjct  78    -VEECKERTKNFRGSSKYMKQLSFSGILGKKQNLNPDFYNWNKVKIRYCDGSSFTGDIEA  136

Query  570   PDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGV  749
              +P T L++RGAR+++ ++D+L+AK M  A+N +  G SAGGL   +HCD F    P G 
Sbjct  137   VNPATNLHFRGARVWRAIIDDLLAKRMNKAQNALLSGCSAGGLASILHCDSFRDLVPAGA  196

Query  750   RVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLV  929
             RVKC SD+  F+  KD    +  K  ++ V   H   K+LP  CTS+  P  CF P+ +V
Sbjct  197   RVKCFSDAGYFINGKDVSGKESIKDFYNQVATTHGSAKNLPSSCTSRFPPSMCFFPQYVV  256

Query  930   QYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQII  1088
             Q +++PLFI ++AYD++Q++N        P  ++   K +    S + + ++Q F+ + +
Sbjct  257   QSMRTPLFILNAAYDAWQIKNILAPSPSDPRKVWGECKLDIKKCSSNQLQVMQGFRSEFM  316

Query  1089  SALPKPSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
              ALP  S++ G  + S + H  S A   + +          I     +W+F +  +  ID
Sbjct  317   RALPANSSSIGMFIDSCYSHCQSGAQETWLRSDSPVIDKMPIAKAVGDWYFGRTSMRKID  376



>ref|XP_011082152.1| PREDICTED: protein notum homolog isoform X2 [Sesamum indicum]
Length=378

 Score =   267 bits (683),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 137/342 (40%), Positives = 200/342 (58%), Gaps = 23/342 (7%)
 Frame = +3

Query  261   VCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSS  440
             VCLDGSPPAYH   G G   +NWL++++GGGWC +          V  C +R    LGSS
Sbjct  20    VCLDGSPPAYHLDRGYGTGINNWLVHIEGGGWCNN----------VTTCLARKNNRLGSS  69

Query  441   -FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIF  614
              + +K L F GI     N+   FY WNRV VRYCDG SF GDVE  +PVTKL+YRGAR+F
Sbjct  70    KYMVKQLAFSGILNNKANFNPDFYNWNRVKVRYCDGASFTGDVEAVNPVTKLHYRGARVF  129

Query  615   QVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVK  794
               V+++L+AKGMK+A+N +  G SAGGL   +HCD F +  P G +VKC SD+  F+  K
Sbjct  130   LAVMEDLLAKGMKNAENAVLSGCSAGGLAAILHCDSFKALLPMGTKVKCFSDAGYFINTK  189

Query  795   DPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYD  974
             D   A++ +A + DVV+ H   K+LP  CTS+M P  CF P+ + + +++PLFI ++AYD
Sbjct  190   DVSGAQHIEAFYHDVVSTHGSAKNLPRSCTSRMKPSLCFFPQYVAREIRTPLFIINAAYD  249

Query  975   SFQVQNTF------PIDLYRAIKNG-SSISPSDMALLQDFKKQIISAL--PKPSATKGFI  1127
             S+Q++N        P   +   K   +  S + +  +Q F+ + I AL     S ++G+ 
Sbjct  250   SWQIKNILAPGVADPHGTWHNCKTDINKCSATQLQTMQGFRLEFIRALYGLGVSTSRGYF  309

Query  1128  VTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHP  1247
             + S + H  +     + +       +K+I     +WF+D+ P
Sbjct  310   INSCYAHCQTEMQETWYRSDSPKLNNKTIAKAVGDWFYDRSP  351



>ref|XP_008808367.1| PREDICTED: uncharacterized protein LOC103720446 isoform X1 [Phoenix 
dactylifera]
Length=399

 Score =   268 bits (684),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 138/360 (38%), Positives = 203/360 (56%), Gaps = 20/360 (6%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +P T++Q A  KGAVCLDGSPPAYHF+ G G   +NWL++++GGGWC +         
Sbjct  30    FDVPLTLVQSAVAKGAVCLDGSPPAYHFAPGFGSGVNNWLVHMEGGGWCRN---------  80

Query  393   SVENCSSRMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEK  569
              VE C  R     GSS  MK L F GI G  +N    FY WN+V +RYCDG SF GD+E 
Sbjct  81    -VEECKERTKNFRGSSKYMKQLSFSGILGKKQNLNPDFYNWNKVKIRYCDGSSFTGDIEA  139

Query  570   PDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGV  749
              +P T L++RGAR+++ ++D+L+AK M  A+N +  G SAGGL   +HCD F    P G 
Sbjct  140   VNPATNLHFRGARVWRAIIDDLLAKRMNKAQNALLSGCSAGGLASILHCDSFRDLVPAGA  199

Query  750   RVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLV  929
             RVKC SD+  F+  KD    +  K  ++ V   H   K+LP  CTS+  P  CF P+ +V
Sbjct  200   RVKCFSDAGYFINGKDVSGKESIKDFYNQVATTHGSAKNLPSSCTSRFPPSMCFFPQYVV  259

Query  930   QYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQII  1088
             Q +++PLFI ++AYD++Q++N        P  ++   K +    S + + ++Q F+ + +
Sbjct  260   QSMRTPLFILNAAYDAWQIKNILAPSPSDPRKVWGECKLDIKKCSSNQLQVMQGFRSEFM  319

Query  1089  SALPKPSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
              ALP  S++ G  + S + H  S A   + +          I     +W+F +  +  ID
Sbjct  320   RALPANSSSIGMFIDSCYSHCQSGAQETWLRSDSPVIDKMPIAKAVGDWYFGRTSMRKID  379



>ref|XP_010676220.1| PREDICTED: uncharacterized protein LOC104892094 [Beta vulgaris 
subsp. vulgaris]
Length=439

 Score =   269 bits (687),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 138/360 (38%), Positives = 209/360 (58%), Gaps = 27/360 (8%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  KGAVCLDGS PAYH   G G   ++WL++++GGGWC +          +  C
Sbjct  30    TKVRSAVAKGAVCLDGSAPAYHLHRGHGTGINSWLVHVEGGGWCNN----------ITTC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
               R    LGSS+ M K L F GI   N  +   FY WNRV +RYCDG SF G+VE  +P+
Sbjct  80    LERKYSHLGSSWKMDKQLAFSGILSNNPMFNPDFYNWNRVKIRYCDGASFTGNVEAVNPI  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             TKL++RGARI+  V+++L+ KGM++AKN I  G SAGGL   +HCD F +  P G RVKC
Sbjct  140   TKLHFRGARIWHAVIEDLLLKGMRNAKNAILSGCSAGGLTSILHCDSFRALLPVGARVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  F+ VKD   A +  + F+ +V LH   KSLP  CT  + P  CF P+ + +  +
Sbjct  200   LSDAGYFINVKDVSGASHVASYFNQIVNLHGSAKSLPASCTRSLKPVMCFFPQYMAKRTR  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +PLFI ++AYDS+Q++N        P  L+   K +  + S + ++++QDF+ + ++A+ 
Sbjct  260   TPLFILNAAYDSWQIKNILAPVVADPRGLWSDCKIDIKNCSTNQLSVMQDFRSEFLNAIS  319

Query  1101  K--PSATKGFIVTSNFGHSFASNNYKKPMFADS----KSKSIESGFYNWFFDKHPINLID  1262
             K   S ++G  + S + H       ++  F+         +I     +WF+++  + +ID
Sbjct  320   KLGKSPSRGLFINSCYAH--CQTEMQETWFSHHSPVLHKTTIAKAVGDWFYNRRQLQMID  377



>ref|XP_002865253.1| pectin acetylesterase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41512.1| pectin acetylesterase [Arabidopsis lyrata subsp. lyrata]
Length=391

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/368 (38%), Positives = 207/368 (56%), Gaps = 29/368 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T ++ A  KGAVCLDGS PAYHF  G G  A+NW+++++GGGWC            +
Sbjct  24    VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGANNWIVHMEGGGWCTD----------I  73

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
               C  R     GSS  M K   F GI G  ++    FY WNR+ VRYCDG SF GD+E  
Sbjct  74    ATCVQRKSTMKGSSKLMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP  KL++RGAR+++ V+D+LMAKGM +A+N I  G SAG L   +HCD+F S  PK  +
Sbjct  134   DPTNKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDQFKSILPKTAK  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ ++ VVA H   KSLPV CTS M P  CF P+ + Q
Sbjct  194   VKCVSDAGYFIHGKDITGGSYIQSYYAKVVATHGSAKSLPVSCTSSMKPELCFFPQYVAQ  253

Query  933   YVKSPLFIFHSAYDSFQVQNTFP---IDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +A K         + + +  +Q ++ Q+++
Sbjct  254   TLQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTVQGYRDQVLA  313

Query  1092  ALP--KPSATKGFIVTSNFGHSFASNNYK-----KPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL   +   T G  + S   H    +         P  A++K   +     +WFF++   
Sbjct  314   ALAPVRSDTTSGLFLDSCHAHCQGGSAATWSGDGGPTVANTK---MAKAVGDWFFERSTF  370

Query  1251  NLIDPNTV  1274
               ID +++
Sbjct  371   QNIDCSSL  378



>ref|XP_010244169.1| PREDICTED: protein notum homolog [Nelumbo nucifera]
Length=401

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/375 (39%), Positives = 209/375 (56%), Gaps = 25/375 (7%)
 Frame = +3

Query  180   IPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWC  359
             I T +T     F +  T +Q A  KGAVCLDGSPPAYH S G G   +NWL++ +GG WC
Sbjct  17    IWTLVTLGANGFNVGITYLQSAVAKGAVCLDGSPPAYHMSPGFGAGVNNWLVFFEGGSWC  76

Query  360   MSNDAYSTLDLSVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRY  533
              +          V +C +R    LGSS  M K + F GI    E +   FY WN++ VRY
Sbjct  77    NN----------VTSCLARKNTRLGSSKQMTKEVSFSGILSNKEKFNPDFYNWNKIKVRY  126

Query  534   CDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVH  713
             CDG SF GDVE  +P T L++RG RIF  V+++L+AKGMK+AKN +  G SAGGL   +H
Sbjct  127   CDGSSFTGDVEAVNPATNLHFRGQRIFLAVIEDLLAKGMKNAKNALLTGCSAGGLTAILH  186

Query  714   CDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKM  893
             CDRF +  P   +VKC++D+  F+  K      + +A ++DVVA HQ  K+LP  CTS+ 
Sbjct  187   CDRFRTLLPASTKVKCMADAGFFINAKSVAGTSHIQAFYNDVVATHQSAKNLPASCTSRF  246

Query  894   SPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSD  1052
             +P  CF P+ +   + +PLFI ++AYDS+QV+N        P   +   K + +  S S 
Sbjct  247   NPGLCFFPQYVAPQISTPLFILNAAYDSWQVKNILAPGVADPHGTWHDCKLDITKCSSSQ  306

Query  1053  MALLQDFKKQIISALPK--PSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESG  1217
             + ++Q F+ + +S L +   S TK   + S + H   +   +  +  DS      SI   
Sbjct  307   LQIMQGFRMEFLSTLTRLMGSPTKALFINSCYSHC-QTGTQETWLRDDSPVLDKTSISKA  365

Query  1218  FYNWFFDKHPINLID  1262
               +W+FD+     ID
Sbjct  366   VGDWYFDRSGFQKID  380



>ref|XP_006283887.1| hypothetical protein CARUB_v10005004mg [Capsella rubella]
 gb|EOA16785.1| hypothetical protein CARUB_v10005004mg [Capsella rubella]
Length=391

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 147/364 (40%), Positives = 210/364 (58%), Gaps = 29/364 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  399   ENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
              +C +R     GSS F  K   F GI G  ++    FY WNR+ VRYCDG SF G+V   
Sbjct  74    ASCLARKNTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +P  KL++RGAR+++ VVD+LMAKGMK+A+N I  G SAG L   +HCD F +  P+  R
Sbjct  134   NPSNKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAR  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ +S VVALH   KSLP+ CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPLSCTSKMKPELCFFPQYVVP  253

Query  933   YVKSPLFIFHSAYDSFQVQNTF---PIDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +  KN        S + +  +Q F+ Q++ 
Sbjct  254   SMRTPLFVINAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCSAAQLRTVQGFRDQMMR  313

Query  1092  ALPKPSAT--KGFIVTSNFGH----SFAS-NNYKKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL    +T  +G  + S   H    S AS +  K P  A+++   I +   NWF+ +   
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQVANTR---IATAVGNWFYGRSAF  370

Query  1251  NLID  1262
               ID
Sbjct  371   QKID  374



>ref|XP_007040902.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOY25403.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=401

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/361 (40%), Positives = 206/361 (57%), Gaps = 23/361 (6%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDGSPPAYH+  G G   ++WLI L+GGGWC +          V
Sbjct  27    VPITYVQSAVAKGAVCLDGSPPAYHWDRGYGTGINSWLIQLEGGGWCNN----------V  76

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
              +C  R    LGSS  M K + F GI      +   FY WNRV VRYCDG SF GDV   
Sbjct  77    TSCLVRKNTHLGSSKRMVKQIPFSGILNNKHQFNPDFYNWNRVKVRYCDGSSFTGDVAAV  136

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +PVT L++RGAR++  V+++L+AKGM++A+N +  G SAGGL   +HCD F +  P G +
Sbjct  137   NPVTNLHFRGARVWLAVMEDLLAKGMRNAENAVLSGCSAGGLASILHCDSFPALLPMGTK  196

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKCLSD+  F+  KD     Y +A F+ +VA H   K+L   CTS+M P  CF P+ + Q
Sbjct  197   VKCLSDAGYFINAKDVSGGHYIEAFFNQLVATHGSAKNLLPSCTSRMRPGLCFFPEYMAQ  256

Query  933   YVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIIS  1091
              +++PLF  ++AYDS+Q++N        P   + + K +  +  PS +  +QDF+ Q + 
Sbjct  257   QIQTPLFFINAAYDSWQIRNILAPGIADPRGYWESCKLDIKNCLPSQIKTMQDFRLQFLV  316

Query  1092  ALPK--PSATKGFIVTSNFGHSFASNN--YKKPMFADSKSKSIESGFYNWFFDKHPINLI  1259
             AL +   S+++G  + S + H        +  P        SI     +WF+D++P   I
Sbjct  317   ALLRLGKSSSRGMFIDSCYAHCQTEMQGLWLMPDSPLLNKTSIAKAVGDWFYDRNPFQKI  376

Query  1260  D  1262
             D
Sbjct  377   D  377



>gb|EYU37453.1| hypothetical protein MIMGU_mgv1a007583mg [Erythranthe guttata]
Length=403

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 148/397 (37%), Positives = 219/397 (55%), Gaps = 33/397 (8%)
 Frame = +3

Query  111   SNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAY  290
             ++ W+ LLI  + +S    NV              ++  T++  A EKGAVCLDGSP  Y
Sbjct  10    ADHWLKLLICVIALSSTKVNVRA----------SEMVNITLLSNAVEKGAVCLDGSPAGY  59

Query  291   HFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRE--LGSSFNMKPLIF  464
             H++ G G+ A++W+IYL GGGWC             ++C  R+     L S+ N+    F
Sbjct  60    HYAKGYGDGANSWMIYLPGGGWCGRK----------QSCIDRVKYSPMLSSTKNITQENF  109

Query  465   KGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMA  641
               I   N+     FY WNRV +RYCDG SF GDV+K DP T L+ RG+RIF  V+DEL++
Sbjct  110   GAILSPNKTSNPDFYNWNRVFIRYCDGSSFMGDVKKVDPETNLHKRGSRIFTSVIDELLS  169

Query  642   KGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFK  821
             KG+KDAKNV+  G SAGGL   ++CDRF +  P    VKC+SDS  F+  K+  +A   +
Sbjct  170   KGLKDAKNVMLTGNSAGGLATILNCDRFRALVPNANMVKCVSDSGFFIHAKNLPNAAGRE  229

Query  822   AVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF-  998
               FS VV  H  +K LP  CTS+M P  CF P+NLV ++K+PLF+ +S +D FQ+Q    
Sbjct  230   RTFSRVVHFHGISKFLPKSCTSRMKPGLCFFPENLVAHIKTPLFLLNSDFDKFQIQVNLK  289

Query  999   --PID---LYRAIKNGSSISPSDMALLQDFKKQIISALP--KPSATKGFIVTSNFGHSF-  1154
               P+D        +N ++ +P  + +++DF+   +  L     + ++G  + S + H F 
Sbjct  290   PHPVDNPGWVNCTRNITTCTPPQLQIIKDFRNTFLETLKGVGNNPSRGLFINSCYIHDFL  349

Query  1155  -ASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
                  Y  P      +K+I     +W+F++  + LID
Sbjct  350   YLMGRYNSPDSPKLHNKTIAQAIGDWYFNRSSVRLID  386



>ref|XP_006361594.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=518

 Score =   270 bits (691),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 147/351 (42%), Positives = 203/351 (58%), Gaps = 23/351 (7%)
 Frame = +3

Query  249   EKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRE  428
              +  VCLDG+PPAY++  G GE A+NW+IY +GG WC     Y+ +D     C +R   E
Sbjct  171   RRALVCLDGTPPAYYYEKGHGEGANNWIIYFRGGEWC-----YNVMD-----CLARATTE  220

Query  429   LGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRG  602
              GSS +  K   F GI   N+     FY WNRV+V YCDG SF GDVE  DP+T L++RG
Sbjct  221   RGSSKYAPKQRSFYGILSNNKTINPDFYNWNRVMVIYCDGSSFTGDVEIVDPITNLHFRG  280

Query  603   ARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLF  782
             ARIF  +++  + KGMK+AKN I  GGSAGGL   +HCDRF +  P   RVKCL+D S F
Sbjct  281   ARIFLALIENFLEKGMKNAKNAILSGGSAGGLPALIHCDRFKALLPNSARVKCLADGSYF  340

Query  783   LIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFH  962
             L  K  +   +   V   ++ LH     LP  CTSKM+P  C  P+   Q +K+P FI +
Sbjct  341   LHRKHKKEMSFMDTVNEGLIKLHHSANMLPSSCTSKMNPSLCLFPQYFQQGIKTPFFIVN  400

Query  963   SAYDSFQVQNTFP---IDLYRAIKNGSSISPSDMALLQDFKKQIISALPKP--SATKGFI  1127
             S +D+FQ+  TFP    DL+      ++ S S +  LQDFK+  ++ALPK   S+++G  
Sbjct  401   SMFDTFQINKTFPGYYEDLF-----SNTCSASLVKTLQDFKQDFLNALPKQSNSSSRGMF  455

Query  1128  VTSNFGHSFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLIDPNTVPI  1280
             + S   HS  ++      F+   +KSI   F +W+FD+    LID   +P+
Sbjct  456   IDSCLIHSQITSGVGWNGFS-VHNKSIAKAFSDWYFDRSHEQLIDKPDLPL  505



>ref|NP_001151183.1| LOC100284816 precursor [Zea mays]
 gb|ACG41900.1| carboxylic ester hydrolase [Zea mays]
Length=398

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 146/365 (40%), Positives = 205/365 (56%), Gaps = 27/365 (7%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F++  T ++ A  KGAVCLDGS PAYH + G G   ++WL++ +GGGWC +         
Sbjct  26    FLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSGENSWLVHFEGGGWCNN---------  76

Query  393   SVENCSSRMGRELGSSFNMKPLI-FKGIFGMN-ENYTTFYKWNRVVVRYCDGGSFAGDVE  566
              V  C  R    LGSS  M   I F GI     ++   FY WN+V VRYCDG SF GDVE
Sbjct  77    -VTTCLQRKRTRLGSSKEMATQIAFSGILSDTPDDNPDFYNWNKVKVRYCDGSSFTGDVE  135

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
             + DP TKL+YRGARI+Q V+D+L+AKGM  A+N +  G SAGGL   +HCDRF    P  
Sbjct  136   EVDPATKLHYRGARIWQAVMDDLLAKGMDKAENALISGCSAGGLTSILHCDRFHDLLPPA  195

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              RVKCLSD+  F+  KD     Y  A F+DVV  H   K+LP  CTS + P  CF P+N 
Sbjct  196   ARVKCLSDAGFFINEKDVAGVGYIAAFFNDVVTTHGSAKNLPPSCTSTLPPGTCFFPQNE  255

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIKNG-SSISPSDMALLQDFKKQI  1085
             V+ +++PLFI ++AYDS+QV+N        P   + + K+     S S + +LQ F+   
Sbjct  256   VKQIQTPLFILNAAYDSWQVRNILVPGVADPHGKWHSCKHDIDQCSASQLRVLQGFRGDF  315

Query  1086  ISALPK--PSATKGFIVTSNFGHSFASNNYKKPMFADSK----SKSIESGFYNWFFDKHP  1247
             +  + +   S ++G  + S F H    +  ++  F+       + ++ +   +WFFD+  
Sbjct  316   LKEVAELGNSDSRGLFINSCFVH--CQSEIQELWFSSDSPVLGNTTVANAVGDWFFDRSS  373

Query  1248  INLID  1262
                ID
Sbjct  374   FQKID  378



>gb|EEE61621.1| hypothetical protein OsJ_16047 [Oryza sativa Japonica Group]
Length=670

 Score =   274 bits (700),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 158/434 (36%), Positives = 227/434 (52%), Gaps = 41/434 (9%)
 Frame = +3

Query  18    PFHSRLRGDL------IS*LTLEANNPESLRMAVSPRSNDWICLLIFSLVISVQYANVNP  179
             P HSR  G +      +S   + A  P +  MA S  S +W+      LV+ +  A    
Sbjct  244   PDHSRGGGLMGYSFGGVSAQLIAAATPTAGGMAAS--SGEWLSRAAMVLVLGLVVA----  297

Query  180   IPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWC  359
               +      +D +  K+ +      GAVCLDGSPP YHFS G G  A+NWL++++GGGWC
Sbjct  298   --SSAKAGDVDMVFLKSAV----STGAVCLDGSPPVYHFSPGSGSGANNWLVHMEGGGWC  351

Query  360   MSNDAYSTLDLSVENCSSRMGRELGSSFNMKPLIFKGIFGMNE-NYTTFYKWNRVVVRYC  536
              +           + CS R G   GSS  M+PL F GI G N+ N   FY WNR+ VRYC
Sbjct  352   RN----------AQECSVRQGNFRGSSKFMRPLSFSGIIGGNQRNNPDFYNWNRIKVRYC  401

Query  537   DGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHC  716
             DG SF GDVE  +  T L++RGAR++  ++++L+AKGM  A+N +  G SAGGL   +HC
Sbjct  402   DGSSFTGDVETVETSTNLHFRGARVWNAIIEDLLAKGMSKAQNALLSGCSAGGLAAILHC  461

Query  717   DRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMS  896
             D+F    P    VKC SD+  F+  KD     + +  + DVV LH   K+LP  CTSKMS
Sbjct  462   DQFRDLLPATANVKCFSDAGFFVDGKDITGNDFVRTFYKDVVNLHGSAKNLPSSCTSKMS  521

Query  897   PFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFPIDLYRAIKNG-------SSISPSDM  1055
             P  CF P+N+V  +++PLFI ++AYD++Q++N          K         ++ S S +
Sbjct  522   PDLCFFPQNVVPTLRTPLFILNAAYDAWQIKNVLAPSAADKKKTWAKCKLDITACSSSQV  581

Query  1056  ALLQDFKKQIISALPKPS---ATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGF  1220
               LQ+F+   ++ALPKP    A     + S + H  S + + +        +   I    
Sbjct  582   TTLQNFRTDFLAALPKPEQSPANLSIFIDSCYAHCQSGSQDTWLAQGSPVVEKTQIGKAV  641

Query  1221  YNWFFDKHPINLID  1262
              +WF D+     ID
Sbjct  642   GDWFHDREVSRRID  655



>emb|CAA67728.1| pectinacetylesterase precursor [Vigna radiata var. radiata]
Length=399

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 142/359 (40%), Positives = 205/359 (57%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  KGAVCLDGSPPAYHF  G G   +NW+++ +GGGWC +          V +C
Sbjct  30    TFVENAVAKGAVCLDGSPPAYHFHKGSGAGINNWIVHFEGGGWCNN----------VTSC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR    LGSS  M   L F G F  ++ +   FY WNR+ VRYCDG SF GDVE  DP 
Sbjct  80    LSRRDTRLGSSKKMDTQLSFSGFFSNSKKFNPDFYDWNRIKVRYCDGSSFTGDVEAVDPA  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RG+R+F  VVD+L+AKGMK+A+N I  G SAGGL   ++CDRF S  P+  +VKC
Sbjct  140   TNLHFRGSRVFAAVVDDLLAKGMKNAQNAIISGCSAGGLAAILNCDRFKSLLPRTTKVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             L+D+  F+ VKD   A+  +  +S VV  H   K+LP  CTS++ P  CF P+N+V  + 
Sbjct  200   LADAGYFINVKDVSGAQRIEEFYSQVVQTHGSAKNLPASCTSRLRPGLCFFPQNVVSQIS  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +P+F  ++AYDS+Q++N        P   +R  K +    S + ++ +Q F+   + A  
Sbjct  260   TPIFFVNAAYDSWQIKNILAPGAADPHGTWRECKLDIKKCSSNQLSAMQVFRTDFLRAFG  319

Query  1101  K--PSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                 S +KG  +   + H   +   +  +  DS    S +I     +W++D+ P   ID
Sbjct  320   AVGNSPSKGHFIDGCYAHC-QTGTQETWLRNDSPVLGSTTIAKAVGDWYYDRKPFKQID  377



>ref|XP_006385137.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 ref|XP_006385139.1| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ERP62934.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62936.1| pectinacetylesterase family protein [Populus trichocarpa]
Length=399

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 142/359 (40%), Positives = 214/359 (60%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  KGAVCLDGSPPAYH+  G G   ++WLI+ +GGGWC +          V +C
Sbjct  30    TYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNN----------VTSC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR    LGSS  M + + F GI      +   FY WNRV +RYCDG SF GDV+  +P 
Sbjct  80    LSRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPA  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGARI+  V+++L+ KG+K+A+N +  G SAGGL   +HCD F +    G +VKC
Sbjct  140   TNLHFRGARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALLRMGTKVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  F+ VKD   A + +  F+++V LH   K+LP+ CTS + P  CF P+ +   V+
Sbjct  200   LSDAGYFIKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSVLKPSFCFFPQYVAPQVR  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +PLFI ++AYDS+Q++N        P+ ++++ K + ++ SP  +  +QDF+ Q ++AL 
Sbjct  260   TPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALN  319

Query  1101  KP--SATKGFIVTSNFGHSFASNNYKKPMFADSK---SKSIESGFYNWFFDKHPINLID  1262
             K   S+++G  + S + H   +   +K    DS     K I     +WF+D++P   ID
Sbjct  320   KSTNSSSRGLYIDSCYAHC-QTETQEKWFMEDSPVLGKKKIAKAVGDWFYDRNPFQKID  377



>gb|ACG39759.1| carboxylic ester hydrolase [Zea mays]
Length=398

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 148/369 (40%), Positives = 207/369 (56%), Gaps = 35/369 (9%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F++  T ++ A  KGAVCLDGS PAYH + G G    +WL++ +GGGWC +         
Sbjct  26    FLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSGEKSWLVHFEGGGWCNN---------  76

Query  393   SVENCSSRMGRELGSSFNMKPLI-FKGIFGMN-ENYTTFYKWNRVVVRYCDGGSFAGDVE  566
              V  C  R    LGSS  M   I F GI     ++   FY WN+V VRYCDG SF GDVE
Sbjct  77    -VTTCLQRKRTRLGSSKEMATQIAFSGILSDTPDDNPDFYNWNKVKVRYCDGSSFTGDVE  135

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
             + DP TKL+YRGARI+Q V+D+L+AKGM  A+N +  G SAGGL   +HCDRF    P  
Sbjct  136   EVDPATKLHYRGARIWQAVMDDLLAKGMDKAENALISGCSAGGLTSILHCDRFHDLLPPA  195

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              RVKCLSD+  F+  KD     Y  A F+DVV  H   K+LP  CTS + P  CF P+N 
Sbjct  196   ARVKCLSDAGFFINEKDVAGVGYIAAFFNDVVTTHGSAKNLPPSCTSTLPPGTCFFPQNE  255

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIKNG-SSISPSDMALLQDFKKQI  1085
             V+ +++PLFI ++AYDS+QV+N        P   + + K+     S S + +LQ F+   
Sbjct  256   VKQIQTPLFILNAAYDSWQVRNILVPGVADPHGKWHSCKHDIDQCSASQLRVLQGFRGDF  315

Query  1086  ISALPK--PSATKGFIVTSNFGHS--------FASNNYKKPMFADSKSKSIESGFYNWFF  1235
             +  + +   S ++G  + S F H         F+S++   P+  ++   ++ +   +WFF
Sbjct  316   LKEVAELGNSDSRGLFINSCFVHCQSEIQELWFSSDS---PVLGNT---TVANAVGDWFF  369

Query  1236  DKHPINLID  1262
             D+     ID
Sbjct  370   DRSSFQKID  378



>ref|XP_003628995.1| Notum-like protein [Medicago truncatula]
Length=396

 Score =   266 bits (679),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 145/362 (40%), Positives = 205/362 (57%), Gaps = 25/362 (7%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDGSPPAYHF  G      NW+++ +GGGWC  N+A + LD   
Sbjct  31    VPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWC--NNATTCLD---  85

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
                  R+   LGSS  M K L F G F   + +   FY WNR+ VRYCDG SF GDVE  
Sbjct  86    -----RIDTRLGSSKKMDKTLSFSGFFSSGKKFNPDFYNWNRIKVRYCDGSSFTGDVEAV  140

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP T L+YRG RIF  V+++L+AKGMK+AKN I  G SAGGL   + CDRF +  P   +
Sbjct  141   DPKTNLHYRGGRIFVAVIEDLLAKGMKNAKNAILSGCSAGGLTSILQCDRFRTLLPAAAK  200

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+ VK    A + +  +S VV  H   K+LP  CTS++SP  CF P+N+  
Sbjct  201   VKCVSDAGYFINVKAVSGASHIEQFYSQVVQTHGSAKNLPSSCTSRLSPGLCFFPQNVAA  260

Query  933   YVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIIS  1091
              +K+P+F  ++AYDS+Q++N        P   +R  K +  S S + ++ +Q F+ + + 
Sbjct  261   QIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIKSCSANQLSTMQGFRTEFLK  320

Query  1092  ALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINL  1256
             A+     S +KG  +   + H   +   +  M  DS      +I     +W++D+     
Sbjct  321   AISVVSNSPSKGMFIDGCYSHC-QTGMQETWMRTDSPVLAKTTIAKAVGDWYYDRSTFQQ  379

Query  1257  ID  1262
             ID
Sbjct  380   ID  381



>ref|XP_011028483.1| PREDICTED: uncharacterized protein LOC105128479 isoform X3 [Populus 
euphratica]
 ref|XP_011028484.1| PREDICTED: uncharacterized protein LOC105128479 isoform X3 [Populus 
euphratica]
Length=427

 Score =   267 bits (682),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 141/359 (39%), Positives = 213/359 (59%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  KGAVCLDGSPPAYH+  G G   ++WLI+ +GGGWC +          V +C
Sbjct  30    TYVKSAVAKGAVCLDGSPPAYHWDKGSGTGINSWLIHFEGGGWCNN----------VTSC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR    LGSS  M + + F GI      +   FY WNRV +RYCDG SF GDV+  +P 
Sbjct  80    LSRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPA  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGARI+  V+++L+ KG+K+A+N +  G SAGGL   +HCD F +    G +VKC
Sbjct  140   TNLHFRGARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALLRMGTKVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  F+ VKD   A + +  F+++V LH   K+LP+ CTS + P  CF P+ +   V+
Sbjct  200   LSDAGYFIKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSMLKPSFCFFPQYVAPQVR  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +PLFI ++AYDS+Q++N        P+ ++++ K + ++ SP  +  +QDF+ Q ++AL 
Sbjct  260   TPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALK  319

Query  1101  KP--SATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                 S+++G  + S + H   +   +K    DS     K I     +WF+D++P   ID
Sbjct  320   TSTNSSSRGLYIDSCYAHC-QTETQEKWFMEDSPVLGKKKIAKAVGDWFYDRNPFQKID  377



>gb|ABK24433.1| unknown [Picea sitchensis]
Length=399

 Score =   266 bits (679),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 140/365 (38%), Positives = 213/365 (58%), Gaps = 28/365 (8%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F++  T+++ A  KGAVCLDGSPP YH S G G   +NWL++ +GG WC +         
Sbjct  29    FLVDLTLVEDAVAKGAVCLDGSPPGYHLSRGFGSGVNNWLVHFEGGSWCNN---------  79

Query  393   SVENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              V  CS+R    LGSS + +K + F G+ G N+     FY WNR+ VRYCDG SF GDVE
Sbjct  80    -VTTCSARTKTRLGSSKYMIKQVDFSGLLGNNKARNPDFYNWNRIKVRYCDGASFTGDVE  138

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               +PV KLY+RG R+F+ V+ +LMAKGM +A+  +  G SAGGL   +HCD F +  PK 
Sbjct  139   AVNPVDKLYFRGQRVFKAVIGDLMAKGMINAQQAVISGCSAGGLTSILHCDNFRALMPKT  198

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKCL+D+  F+ VKD   A + ++ F++V  L Q  K+LP+ CT K+   +CF P+ L
Sbjct  199   TKVKCLADAGFFIDVKDVSGAYHIRSFFNEVATLQQSVKNLPLACTEKLGT-QCFFPQYL  257

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
             + Y+++PLF+ ++ YDS+Q++N        P  L+   K +    SP+ +  +Q F+ ++
Sbjct  258   LPYIQTPLFLLNAGYDSWQIKNIVAPGVADPHGLWHNCKLDIKKCSPNQLETMQGFRLEM  317

Query  1086  ISALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADSKSK----SIESGFYNWFFDKHP  1247
             ++AL   + SA+ G  + S + H    +  ++   A+   K    SI     NW+F +  
Sbjct  318   LNALKIFQNSASGGMFINSCYAH--CQSEMQETWLANDSPKLNGLSIAEAVQNWYFGQGI  375

Query  1248  INLID  1262
             +   D
Sbjct  376   VKETD  380



>gb|KEH20327.1| pectinacetylesterase family protein [Medicago truncatula]
Length=393

 Score =   266 bits (679),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 145/362 (40%), Positives = 205/362 (57%), Gaps = 25/362 (7%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDGSPPAYHF  G      NW+++ +GGGWC  N+A + LD   
Sbjct  28    VPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWC--NNATTCLD---  82

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
                  R+   LGSS  M K L F G F   + +   FY WNR+ VRYCDG SF GDVE  
Sbjct  83    -----RIDTRLGSSKKMDKTLSFSGFFSSGKKFNPDFYNWNRIKVRYCDGSSFTGDVEAV  137

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP T L+YRG RIF  V+++L+AKGMK+AKN I  G SAGGL   + CDRF +  P   +
Sbjct  138   DPKTNLHYRGGRIFVAVIEDLLAKGMKNAKNAILSGCSAGGLTSILQCDRFRTLLPAAAK  197

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+ VK    A + +  +S VV  H   K+LP  CTS++SP  CF P+N+  
Sbjct  198   VKCVSDAGYFINVKAVSGASHIEQFYSQVVQTHGSAKNLPSSCTSRLSPGLCFFPQNVAA  257

Query  933   YVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIIS  1091
              +K+P+F  ++AYDS+Q++N        P   +R  K +  S S + ++ +Q F+ + + 
Sbjct  258   QIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIKSCSANQLSTMQGFRTEFLK  317

Query  1092  ALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINL  1256
             A+     S +KG  +   + H   +   +  M  DS      +I     +W++D+     
Sbjct  318   AISVVSNSPSKGMFIDGCYSHC-QTGMQETWMRTDSPVLAKTTIAKAVGDWYYDRSTFQQ  376

Query  1257  ID  1262
             ID
Sbjct  377   ID  378



>gb|ABK24994.1| unknown [Picea sitchensis]
Length=399

 Score =   266 bits (679),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 140/365 (38%), Positives = 213/365 (58%), Gaps = 28/365 (8%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F++  T+++ A  KGAVCLDGSPP YH S G G   +NWL++ +GG WC +         
Sbjct  29    FLVDLTLVEDAVAKGAVCLDGSPPGYHLSRGFGSGVNNWLVHFEGGSWCNN---------  79

Query  393   SVENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVE  566
              V  CS+R    LGSS + +K + F G+ G N+     FY WNR+ VRYCDG SF GDVE
Sbjct  80    -VTTCSARTKTRLGSSKYMIKQVDFSGLLGNNKARNPDFYNWNRIKVRYCDGASFTGDVE  138

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               +PV KLY+RG R+F+ V+ +LMAKGM +A+  +  G SAGGL   +HCD F +  PK 
Sbjct  139   AVNPVDKLYFRGQRVFKAVIGDLMAKGMINAQQAVISGCSAGGLTSILHCDNFRALMPKT  198

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKCL+D+  F+ VKD   A + ++ F++V  L Q  K+LP+ CT K+   +CF P+ L
Sbjct  199   TKVKCLADAGFFIDVKDVSGAYHIRSFFNEVATLQQSVKNLPLACTEKLGT-QCFFPQYL  257

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
             + Y+++PLF+ ++ YDS+Q++N        P  L+   K +    SP+ +  +Q F+ ++
Sbjct  258   LPYIQTPLFLLNAGYDSWQIKNIVAPGVADPHGLWHNCKLDIKKCSPNQLETMQGFRLEM  317

Query  1086  ISALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADSKSK----SIESGFYNWFFDKHP  1247
             ++AL   + SA+ G  + S + H    +  ++   A+   K    SI     NW+F +  
Sbjct  318   LNALKIFQNSASGGMFINSCYAH--CQSEMQETWLANDSPKLNGLSIAEAVQNWYFGQGI  375

Query  1248  INLID  1262
             +   D
Sbjct  376   VKETD  380



>ref|XP_006413981.1| hypothetical protein EUTSA_v10024796mg [Eutrema salsugineum]
 gb|ESQ55434.1| hypothetical protein EUTSA_v10024796mg [Eutrema salsugineum]
Length=564

 Score =   271 bits (692),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 149/362 (41%), Positives = 213/362 (59%), Gaps = 27/362 (7%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGINNWIVHMEGGGWCTD----------V  73

Query  399   ENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
              +C  R G   GSS F  K   F GI G  +N    FY WNR+ VRYCDG SF G+VE  
Sbjct  74    ASCIKRKGTMKGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGNVEAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +P  KL++RGAR+++ V+D+LMAKGMK+A+N I  G SAG L   +HCD F +  P+  R
Sbjct  134   NPANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAR  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ +S VVALH   KSLP+ CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPLSCTSKMRPELCFFPQYVVP  253

Query  933   YVKSPLFIFHSAYDSFQVQNTF---PIDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
             ++++PLF+ ++A+DS+Q++N      +D  +  K         S + +  +Q F+ Q++ 
Sbjct  254   FMRTPLFVINAAFDSWQIKNVLAPTAVDKRKEWKTCKLDLKKCSAAQLKTVQGFRDQMMR  313

Query  1092  ALPKPSAT--KGFIVTSNFGH----SFAS-NNYKKPMFADSK-SKSIESGFYNWFFDKHP  1247
             AL    +T  +G  + S   H    S AS +  K P  A++K +K++ + FY   F   P
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQVANTKIAKAVGNWFYGRIFTFIP  373

Query  1248  IN  1253
             I+
Sbjct  374   IS  375



>ref|XP_006385138.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62935.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=402

 Score =   266 bits (679),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 142/359 (40%), Positives = 214/359 (60%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  KGAVCLDGSPPAYH+  G G   ++WLI+ +GGGWC +          V +C
Sbjct  33    TYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNN----------VTSC  82

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR    LGSS  M + + F GI      +   FY WNRV +RYCDG SF GDV+  +P 
Sbjct  83    LSRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPA  142

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGARI+  V+++L+ KG+K+A+N +  G SAGGL   +HCD F +    G +VKC
Sbjct  143   TNLHFRGARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALLRMGTKVKC  202

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  F+ VKD   A + +  F+++V LH   K+LP+ CTS + P  CF P+ +   V+
Sbjct  203   LSDAGYFIKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSVLKPSFCFFPQYVAPQVR  262

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +PLFI ++AYDS+Q++N        P+ ++++ K + ++ SP  +  +QDF+ Q ++AL 
Sbjct  263   TPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALN  322

Query  1101  KP--SATKGFIVTSNFGHSFASNNYKKPMFADSK---SKSIESGFYNWFFDKHPINLID  1262
             K   S+++G  + S + H   +   +K    DS     K I     +WF+D++P   ID
Sbjct  323   KSTNSSSRGLYIDSCYAHC-QTETQEKWFMEDSPVLGKKKIAKAVGDWFYDRNPFQKID  380



>ref|NP_974575.2| putative pectinacetylesterase [Arabidopsis thaliana]
 gb|AEE84179.1| putative pectinacetylesterase [Arabidopsis thaliana]
Length=365

 Score =   264 bits (675),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 140/349 (40%), Positives = 201/349 (58%), Gaps = 25/349 (7%)
 Frame = +3

Query  258   AVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGS  437
             AVCLDGSPPAYH   G G   ++WLI L+GGGWC +          V NC SRM   LGS
Sbjct  6     AVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCNN----------VTNCVSRMHTRLGS  55

Query  438   SFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARI  611
             S  M + L F  I    + Y   FY WNRV VRYCDG SF GDVE  +P T L++RGAR+
Sbjct  56    SKKMVENLAFSAILSNKKQYNPDFYNWNRVKVRYCDGASFTGDVEAVNPATNLHFRGARV  115

Query  612   FQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIV  791
             +  V+ EL+AKGM +A+N +  G SAGGL   +HCD F +  P G +VKCLSD+  FL  
Sbjct  116   WLAVMQELLAKGMINAENAVLSGCSAGGLASLMHCDSFRALLPMGTKVKCLSDAGFFLNT  175

Query  792   KDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAY  971
             +D    +Y K  F DVV LH   K+LP  CTS+++P  CF P+ + + +++PLFI ++AY
Sbjct  176   RDVSGVQYIKTYFEDVVTLHGSAKNLPRSCTSRLTPAMCFFPQYVARQIRTPLFILNAAY  235

Query  972   DSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISAL--PKPSATKGF  1124
             DS+Q++N        P   +++ + +  +  PS + ++QDF+ + +SA+     S+++G 
Sbjct  236   DSWQIKNILAPRAADPYGKWQSCQLDIKNCHPSQIKVMQDFRLEFLSAVIGLGRSSSRGM  295

Query  1125  IVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
              + S + H   +       + DS      +I     +W +D+     ID
Sbjct  296   FIDSCYTHC-QTETQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKID  343



>ref|XP_004244443.1| PREDICTED: uncharacterized protein LOC101251798 [Solanum lycopersicum]
Length=392

 Score =   265 bits (677),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 139/358 (39%), Positives = 203/358 (57%), Gaps = 23/358 (6%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +Q A  KGAVCLDGSPPAYHF  G G   +NW I L+GG WC  N+A + L    E  
Sbjct  30    TYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWFIQLEGGAWC--NNATTCL----ERT  83

Query  408   SSRMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVT  584
              +R+G    S   +K + F GI      +   FY WNR+ +RYCDG SF GDV   DP T
Sbjct  84    KTRLG---SSKLMVKTVSFSGILSNKAKFNPDFYNWNRIRIRYCDGSSFTGDVAAADPRT  140

Query  585   KLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCL  764
             K++YRGARIF  V+D+ +AKGMK+A+N I  G SAG L   +HCDRF    P G +VKCL
Sbjct  141   KVFYRGARIFSAVMDDFLAKGMKNAQNAILAGCSAGSLAAILHCDRFKGLLPSGAKVKCL  200

Query  765   SDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKS  944
             SD+  F+  +      + +  +S+VV  H   K+LP  CTS++ P  CF P+N+ Q +++
Sbjct  201   SDAGFFINTQTISGTSHIEKFYSEVVNTHGSAKNLPQSCTSRLKPGLCFFPQNVAQQIQT  260

Query  945   PLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALPK  1103
             PLF+ ++AYDS+Q++N        P   +R  K +    S + +  +Q F+ + + AL  
Sbjct  261   PLFLVNAAYDSWQIKNILAPGVADPHGTWRNCKLDILKCSSAQLQTMQAFRSEFLKALNS  320

Query  1104  --PSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
               PS+T+G+ + S + H   +   +  +  DS      +I     +W++++     ID
Sbjct  321   LGPSSTRGYYINSCYAHC-QTGTQETWLRDDSPVLSGTTIAKAVGDWYYERKRFQEID  377



>ref|XP_008347803.1| PREDICTED: uncharacterized protein LOC103410929 [Malus domestica]
Length=401

 Score =   265 bits (677),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 144/363 (40%), Positives = 211/363 (58%), Gaps = 27/363 (7%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +  T+++ A  KGAVCLDGS  AYHF  G G   +NWL++++GGGWC +          V
Sbjct  30    VALTLVENAVAKGAVCLDGSAXAYHFDKGFGAGINNWLVHVEGGGWCNT----------V  79

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYTT--FYKWNRVVVRYCDGGSFAGDVEK  569
             E+C  R     GSS  M K + F G+ G N+  T   FY WNR+ VRYCDG SF GDVE 
Sbjct  80    EDCLDRKSNYRGSSTKMEKTMSFSGVLG-NKPKTNPDFYNWNRIKVRYCDGSSFTGDVEA  138

Query  570   PDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGV  749
              DP T L++RGAR+F+ ++D L+AKGMK+A+N +  G SAGGL   +HCD F S  P G 
Sbjct  139   VDPATNLHFRGARVFRAIIDXLLAKGMKNAQNALLSGCSAGGLTSILHCDNFRSLLPVGT  198

Query  750   RVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLV  929
             +VKCL+D+  F+  K    +++ +  +S+VVALH   K+LP  CTS+MSP  CF P+N+V
Sbjct  199   KVKCLADAGYFINAKSLSGSZHIQGFYSEVVALHGSAKNLPASCTSRMSPGLCFFPQNVV  258

Query  930   QYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQII  1088
                 +P+F+ ++AYDS+Q++N        P   ++  K N  + SPS +  LQ+++ Q +
Sbjct  259   PQTXTPIFLVNAAYDSWQIKNILAPGVADPKGAWKKCKLNIKNCSPSQLQTLQEYRLQFL  318

Query  1089  S--ALPKPSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPIN  1253
                A    S++ G  + S F H       +  + ADS      +I +   +W++D+    
Sbjct  319   KTIAXSSTSSSHGAFIDSCFAHCQIGTQ-ETWLAADSPMLSKTTIANAVGDWYYDRTAFK  377

Query  1254  LID  1262
               D
Sbjct  378   KFD  380



>ref|XP_006385134.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62931.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=430

 Score =   266 bits (680),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 142/359 (40%), Positives = 214/359 (60%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  KGAVCLDGSPPAYH+  G G   ++WLI+ +GGGWC +          V +C
Sbjct  33    TYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNN----------VTSC  82

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR    LGSS  M + + F GI      +   FY WNRV +RYCDG SF GDV+  +P 
Sbjct  83    LSRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPA  142

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGARI+  V+++L+ KG+K+A+N +  G SAGGL   +HCD F +    G +VKC
Sbjct  143   TNLHFRGARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALLRMGTKVKC  202

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  F+ VKD   A + +  F+++V LH   K+LP+ CTS + P  CF P+ +   V+
Sbjct  203   LSDAGYFIKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSVLKPSFCFFPQYVAPQVR  262

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +PLFI ++AYDS+Q++N        P+ ++++ K + ++ SP  +  +QDF+ Q ++AL 
Sbjct  263   TPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALN  322

Query  1101  KP--SATKGFIVTSNFGHSFASNNYKKPMFADSK---SKSIESGFYNWFFDKHPINLID  1262
             K   S+++G  + S + H   +   +K    DS     K I     +WF+D++P   ID
Sbjct  323   KSTNSSSRGLYIDSCYAHC-QTETQEKWFMEDSPVLGKKKIAKAVGDWFYDRNPFQKID  380



>ref|XP_010244170.1| PREDICTED: uncharacterized protein LOC104588061 [Nelumbo nucifera]
Length=399

 Score =   265 bits (677),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 148/402 (37%), Positives = 222/402 (55%), Gaps = 40/402 (10%)
 Frame = +3

Query  99    VSPRSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGS  278
             ++ R+  WI +L+ +LV +++   VN              +  T ++ A  KGAVCLDGS
Sbjct  2     INVRAVAWINILLCALV-ALKVNGVN--------------VGITYVETAVAKGAVCLDGS  46

Query  279   PPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNM-KP  455
             PPAYH   G G   +NWL++++GGGWC +          V  C +R    LGSS  M   
Sbjct  47    PPAYHLDKGFGSGINNWLVHIEGGGWCNN----------VTTCLARKNTRLGSSKQMLTE  96

Query  456   LIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDE  632
             + F GI    + +   FY WNRV VRYCDG SF GDVE  DP T L+YRGAR++  V+++
Sbjct  97    IAFSGILSNKQQFNPDFYNWNRVKVRYCDGASFTGDVEAVDPTTNLHYRGARVWLAVIED  156

Query  633   LMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAK  812
             L+ KGMK+A+  +  G SAGGL   +HCD F +  P GV+VKCL+D+  F+  KD    +
Sbjct  157   LLEKGMKNAEYALLSGCSAGGLTSILHCDSFRALLPMGVKVKCLADAGYFINAKDVSGTE  216

Query  813   YFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQN  992
             + +A + DVV  H  +K+LP  CTS M P  CF P+ + Q +++PLF+ ++AYDS+Q++N
Sbjct  217   HIQAFYDDVVTTHGSSKNLPASCTSTMKPSMCFFPQYMEQGIRTPLFLLNAAYDSWQIKN  276

Query  993   TF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP--KPSATKGFIVTSNFG  1145
                     P   +   K +  + SPS +  +Q F+ + ++AL     S+ +G  + S + 
Sbjct  277   ILAPGVADPHGYWHNCKLDIKNCSPSQIQTMQGFRVEFLNALSGLGNSSPRGMFINSCYA  336

Query  1146  HSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
             H   S   +  +  DS       I     +W++D+ P   ID
Sbjct  337   HC-QSEMQETWLRDDSPVLDKTPIAKAVGDWYYDRSPFQKID  377



>gb|AET03471.2| pectinacetylesterase family protein [Medicago truncatula]
Length=424

 Score =   266 bits (679),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 145/362 (40%), Positives = 205/362 (57%), Gaps = 25/362 (7%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDGSPPAYHF  G      NW+++ +GGGWC  N+A + LD   
Sbjct  59    VPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWC--NNATTCLD---  113

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
                  R+   LGSS  M K L F G F   + +   FY WNR+ VRYCDG SF GDVE  
Sbjct  114   -----RIDTRLGSSKKMDKTLSFSGFFSSGKKFNPDFYNWNRIKVRYCDGSSFTGDVEAV  168

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP T L+YRG RIF  V+++L+AKGMK+AKN I  G SAGGL   + CDRF +  P   +
Sbjct  169   DPKTNLHYRGGRIFVAVIEDLLAKGMKNAKNAILSGCSAGGLTSILQCDRFRTLLPAAAK  228

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+ VK    A + +  +S VV  H   K+LP  CTS++SP  CF P+N+  
Sbjct  229   VKCVSDAGYFINVKAVSGASHIEQFYSQVVQTHGSAKNLPSSCTSRLSPGLCFFPQNVAA  288

Query  933   YVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIIS  1091
              +K+P+F  ++AYDS+Q++N        P   +R  K +  S S + ++ +Q F+ + + 
Sbjct  289   QIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIKSCSANQLSTMQGFRTEFLK  348

Query  1092  ALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINL  1256
             A+     S +KG  +   + H   +   +  M  DS      +I     +W++D+     
Sbjct  349   AISVVSNSPSKGMFIDGCYSHC-QTGMQETWMRTDSPVLAKTTIAKAVGDWYYDRSTFQQ  407

Query  1257  ID  1262
             ID
Sbjct  408   ID  409



>gb|AAM65412.1| pectin acetylesterase [Arabidopsis thaliana]
Length=391

 Score =   265 bits (676),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 136/368 (37%), Positives = 207/368 (56%), Gaps = 29/368 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T ++ A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            +
Sbjct  24    VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTD----------I  73

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
               C  R     GSS  M K   F GI G  ++    FY WNR+ VRYCDG SF GD+E  
Sbjct  74    ATCVQRKSTMKGSSKLMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP  KL++RGAR+++ V+D+LMAKGM +A+N I  G SAG L   +HCD+F S  PK  +
Sbjct  134   DPANKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDQFKSTLPKTAK  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ ++ VVA H   KSLP  CTS M P  CF P+ + +
Sbjct  194   VKCVSDAGYFIHGKDITGGSYIQSYYAKVVATHGSAKSLPASCTSSMKPELCFFPQYVAK  253

Query  933   YVKSPLFIFHSAYDSFQVQNTFP---IDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +A K         + + +  +Q ++ Q+++
Sbjct  254   TLQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTVQGYRDQVLA  313

Query  1092  ALP--KPSATKGFIVTSNFGHSFASNNY-----KKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL   + + T G  + S   H    +       K P  A++K   +     +WFF++   
Sbjct  314   ALAPVQSATTNGLFLDSCHAHCQGGSAATWSGDKGPTVANTK---MAKAVGDWFFERSTF  370

Query  1251  NLIDPNTV  1274
               +D +++
Sbjct  371   QNVDCSSL  378



>ref|XP_004300391.1| PREDICTED: protein notum homolog [Fragaria vesca subsp. vesca]
Length=399

 Score =   265 bits (677),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 145/359 (40%), Positives = 206/359 (57%), Gaps = 24/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             TI+Q A  KGAVCLDGSPPAYH+  G G   +NWL++++GGGWC +          V NC
Sbjct  30    TILQTAVAKGAVCLDGSPPAYHWDKGFGSGLNNWLVHIEGGGWCHN----------VTNC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
               R    LGSS  M K + F GI    ++    FY WNR+ VRYCDG SF GDV   DP 
Sbjct  80    LGRKNTRLGSSKKMLKEIPFSGILSNRQSLNPGFYNWNRIKVRYCDGSSFTGDVAAVDPA  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRF-PKGVRVK  758
             T LY+RGAR+F+ V+ +L+AKGM  A N +  G SAGGL   +HCD F + F P G +VK
Sbjct  140   TGLYFRGARVFRAVMADLLAKGMGKAVNAVLSGCSAGGLTSILHCDNFRALFLPSGTKVK  199

Query  759   CLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYV  938
             C+SD+  F+ VKD   A++ +  F+D+V  H   K+LP  CTSK+ P  CF P+ +V  +
Sbjct  200   CVSDAGYFINVKDISGAQHVQEYFTDIVTTHGSAKNLPPSCTSKLRPDLCFFPQYVVPQI  259

Query  939   KSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISAL  1097
             ++P+F  ++AYDS+Q++N        P   +R  K +  + SP+ +  +Q+F+ Q +SA+
Sbjct  260   RTPIFYVNAAYDSWQIKNIVVPGVADPHGTWRNCKLDIKNCSPTQLKTMQNFRLQFLSAI  319

Query  1098  P--KPSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
                  SA KG  + S + H  +     +  P        +I     +WF+D+     ID
Sbjct  320   GGVSNSAVKGMFIDSCYLHCQTELQETWSMPNSPLLNKTTIARAVGDWFYDRTSFQKID  378



>ref|XP_004970861.1| PREDICTED: protein notum homolog [Setaria italica]
Length=418

 Score =   265 bits (678),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 137/367 (37%), Positives = 202/367 (55%), Gaps = 21/367 (6%)
 Frame = +3

Query  183   PTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCM  362
             P  +  D    ++  T++ GA EKGAVCLDGSPPAYH   G G  + +W+++LQGG WC 
Sbjct  42    PVAVAADSSPGLVELTLVAGAQEKGAVCLDGSPPAYHLQRGSGSGSQSWIVFLQGGAWCS  101

Query  363   SNDAYSTLDLSVENCSSRMGRELGSSFNMKPLIFKGIFGMNE-NYTTFYKWNRVVVRYCD  539
             SN        + E CS R     GSS  M+P+ F G+F   +     FY WN+  VRYCD
Sbjct  102   SN--------TTETCSGRKMTAYGSSKFMEPITFDGVFNDQQPQNPDFYNWNKAFVRYCD  153

Query  540   GGSFAGDVE-KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHC  716
             G SF+G+ E + +  TKLY+RG RI++ V+ ELM KGM  AK  +  G SAGGL   +HC
Sbjct  154   GASFSGNAEGEAEDGTKLYFRGLRIWEAVIAELMGKGMDTAKQALLAGCSAGGLATLLHC  213

Query  717   DRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMS  896
             D F ++FP+ V VKC+ D   FL  KD    +  ++VF+ VV L   ++ LP +C +K  
Sbjct  214   DNFRAKFPQEVSVKCVPDGGFFLDAKDLSGERSMRSVFNGVVQLQNVSEVLPKDCLAKKD  273

Query  897   PFECFQPKNLVQYVKSPLFIFHSAYDSFQVQN------TFPIDLYRAIK-NGSSISPSDM  1055
             P +CF P  L++ + +P FI +S YDS+Q+QN      ++P D +   + N  + S   +
Sbjct  274   PTDCFFPAELIKSISTPTFIVNSEYDSWQIQNVVAPVGSYPGDTWSNCRDNIGNCSSKQI  333

Query  1056  ALLQDFKKQIISALPKPSATK--GFIVTSNFGHSFASNN--YKKPMFADSKSKSIESGFY  1223
              +L  F++++I  L      +  G  + S F H     N  +  P      +K+I     
Sbjct  334   DVLHGFRRKLIHELKAAEGKREWGLFIDSCFTHCQTQWNGSWHSPTSPRLDNKTIAEAVG  393

Query  1224  NWFFDKH  1244
             +W+F + 
Sbjct  394   DWYFGRR  400



>ref|XP_010266380.1| PREDICTED: uncharacterized protein LOC104603915 isoform X1 [Nelumbo 
nucifera]
Length=412

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 151/404 (37%), Positives = 221/404 (55%), Gaps = 28/404 (7%)
 Frame = +3

Query  93    MAVSPRSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLD  272
             M   P+S    C++I++   ++ Y     I T IT     F +  T ++ +  KGAVCLD
Sbjct  1     MLAPPQSPTSFCIMIYTRSAALLYL---LICTLITMKANGFFVGITYVENSIAKGAVCLD  57

Query  273   GSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNM-  449
             GSPPAYH   G G   +NWL++L+GGGWC +          V  C +      GSS  M 
Sbjct  58    GSPPAYHMDKGFGSGINNWLVHLEGGGWCSN----------VTICLAHKDTRHGSSKKMA  107

Query  450   KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVV  626
             K + F GI    EN+   FY WN++ VRYCDG SF GDVE  DP   LY RG R++Q V+
Sbjct  108   KQIAFSGILSNKENFNPDFYNWNKIKVRYCDGSSFTGDVEAIDPANNLYLRGERVWQAVM  167

Query  627   DELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEH  806
             ++L+ KGMK+AK  +  G S+GGL   +HCDRF    P   +VKCLSD+  F+  KD   
Sbjct  168   EDLLEKGMKNAKYALLSGCSSGGLAAILHCDRFRELLPVDAKVKCLSDAGYFINAKDVSG  227

Query  807   AKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQV  986
               + +A+++DVV  HQ  K+LPV CTS+  P  CF P+N+VQ + + LFI ++AYDS+Q+
Sbjct  228   KDHIQAIYNDVVTTHQSAKNLPVSCTSRTEPSLCFFPQNVVQDMYTQLFILNAAYDSWQI  287

Query  987   QNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALPK--PSATKGFIVTSN  1139
             +NT       P   +   K +  + S S +  +Q F+ + ++++ +   S+ KG  + S 
Sbjct  288   KNTLAPGVADPHGHWHYCKLDIKNCSSSQLQTMQGFRSEFLNSVGELMSSSMKGMFINSC  347

Query  1140  FGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
             + H   S   +  + ADS       I     +W+ D+     ID
Sbjct  348   YAHC-QSEVQETWLRADSPVLDKTPIAKAVGDWYNDRSDFKKID  390



>ref|XP_006280604.1| hypothetical protein CARUB_v10026563mg [Capsella rubella]
 gb|EOA13502.1| hypothetical protein CARUB_v10026563mg [Capsella rubella]
Length=391

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/368 (38%), Positives = 205/368 (56%), Gaps = 29/368 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T ++ A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            +
Sbjct  24    VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTD----------I  73

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
               C  R     GSS  M K   F GI G  ++    FY WNR+ VRYCDG SF GD+E  
Sbjct  74    ATCVQRKSTMKGSSKLMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP  KL++RGAR+++ V+D+LMAKGM +A+N I  G SAG L   +HCD+F S  PK  +
Sbjct  134   DPTNKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDQFKSILPKTAK  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ +  VVA H   KSLP  CTS M P  CF P+ + +
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIQSYYGKVVATHGSAKSLPASCTSTMKPELCFFPQYVAK  253

Query  933   YVKSPLFIFHSAYDSFQVQNTFP---IDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +A K         + S +  +Q ++ Q+++
Sbjct  254   TLQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTASQLQTVQGYRDQVLA  313

Query  1092  ALP--KPSATKGFIVTSNFGHSFASNNY-----KKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL   +   T G  + S   H    +       K P  A++K   +     +WFF++   
Sbjct  314   ALAPVRADTTSGLFLDSCHAHCQGGSAATWSGDKGPTVANTK---MAKAVGDWFFERSTF  370

Query  1251  NLIDPNTV  1274
               ID +++
Sbjct  371   QNIDCSSL  378



>ref|NP_199341.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 dbj|BAB10249.1| pectin acetylesterase [Arabidopsis thaliana]
 gb|AAL15296.1| AT5g45280/K9E15_6 [Arabidopsis thaliana]
 gb|AED95226.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=391

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/368 (37%), Positives = 207/368 (56%), Gaps = 29/368 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T ++ A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            +
Sbjct  24    VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTD----------I  73

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
               C  R     GSS  M K   F GI G  ++    FY WNR+ VRYCDG SF GD+E  
Sbjct  74    ATCVQRKSTMKGSSKLMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP  KL++RGAR+++ V+D+LMAKGM +A+N I  G SAG L   +HCD+F S  PK  +
Sbjct  134   DPTHKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDQFKSTLPKTAK  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ ++ VVA H   KSLP  CTS M P  CF P+ + +
Sbjct  194   VKCVSDAGYFIHGKDITGGSYIQSYYAKVVATHGSAKSLPASCTSSMKPDLCFFPQYVAK  253

Query  933   YVKSPLFIFHSAYDSFQVQNTFP---IDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +A K         + + +  +Q ++ Q+++
Sbjct  254   TLQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTVQGYRDQVLA  313

Query  1092  ALP--KPSATKGFIVTSNFGHSFASNNY-----KKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL   + + T G  + S   H    +       K P  A++K   +     +WFF++   
Sbjct  314   ALAPVRSATTNGLFLDSCHAHCQGGSAATWSGDKGPTVANTK---MAKAVGDWFFERSTF  370

Query  1251  NLIDPNTV  1274
               +D +++
Sbjct  371   QNVDCSSL  378



>gb|AAP72959.1| pectin acetylesterase [Lactuca sativa]
Length=395

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 153/408 (38%), Positives = 221/408 (54%), Gaps = 49/408 (12%)
 Frame = +3

Query  99    VSPRSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGS  278
             +S R + W+C+ +           V  +    TE Y    +  T +  A  KGAVCLDGS
Sbjct  2     MSERGDRWLCIFL-----------VCTLSLLCTEAY---DVGLTFLNSAVAKGAVCLDGS  47

Query  279   PPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNM-KP  455
              PAYH   G G    NWL++ +GGGWC  N+A         NC +R    LGSS  M   
Sbjct  48    APAYHIDKGFGAGIDNWLVFFEGGGWC--NNA--------TNCLTRRDTRLGSSKKMLTT  97

Query  456   LIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDE  632
               F G+F     Y   FY WNR+ VRYCDG SF GDVE  DP TKLYYRGARIF+ VVD+
Sbjct  98    ETFSGMFHNKAKYNPDFYDWNRIKVRYCDGASFTGDVEAVDPNTKLYYRGARIFRAVVDD  157

Query  633   LMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAK  812
             L+AKGMK+AKN I  G SAGGL   + CD F S+ P   +VKCLSD+  F+  K      
Sbjct  158   LLAKGMKNAKNAILAGCSAGGLTSILQCDNFRSQLPATTKVKCLSDAGFFINAKTIIGQS  217

Query  813   YFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQN  992
             + +  ++DVV  H   K L   C +KMSP  CF P+N+VQ++K+P+F+ ++AYDS+QV+N
Sbjct  218   HIEGFYADVVRTHGSAKVLSPACLAKMSPGLCFFPQNMVQFIKTPIFLINAAYDSWQVKN  277

Query  993   TFPIDL------YRAIK-NGSSISPSDMALLQDFKKQIISAL----PKPSATKGFIVTSN  1139
                  +      +R  K + +  S + + +LQ ++ + + AL       S ++G  + S 
Sbjct  278   ILAPGVADRKGTWRECKLDITKCSSAQLNVLQGYRLEFLKALNGFGNGNSPSRGMFINSC  337

Query  1140  FGH-------SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
             + H       ++  N+   P+  ++   +I     +W+++++    ID
Sbjct  338   YSHCQTGIQETWLRND--SPLLGNT---TIAKAVGDWYYERNTFQKID  380



>ref|XP_006361581.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=387

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/359 (38%), Positives = 206/359 (57%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +Q A  KGAVCLDGSPPAYHF  G G   +NWLI L+GG WC  N+A +        C
Sbjct  30    TYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWLIQLEGGAWC--NNATT--------C  79

Query  408   SSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              +R    LGSS   +K + F GI      +   FY WNR+ ++YCDG SF GDV   DP 
Sbjct  80    LARTKTRLGSSKLMLKTVSFSGILSNKAEFNPDFYNWNRIRIKYCDGSSFTGDVAAADPK  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             TK++YRGARIF  V+++ +AKGMK+A+N I  G SAG L   +HCDRF    P G +VKC
Sbjct  140   TKVFYRGARIFSAVMEDFLAKGMKNAQNAILAGCSAGSLAAILHCDRFKGLLPPGAKVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  F+  +      + +  +S+VV  H   K+LP  CTS++ P  CF P+N+ Q+++
Sbjct  200   LSDAGFFINTQTISGTSHIEQFYSEVVNTHGSVKNLPQSCTSRLKPGLCFFPQNVAQHIQ  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +PLF+ ++AYDS+Q+++        P   +R  K +  + S + +  +Q F+ + + AL 
Sbjct  260   TPLFLVNAAYDSWQIKHILAPEVADPHGTWRNCKLDILNCSSTQLQTMQAFRSEFLKALN  319

Query  1101  K--PSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                PS+T+G+ + S + H   +   +  +  DS      +I     +W++++     ID
Sbjct  320   SLGPSSTRGYYINSCYAHC-QTGTQETWLMDDSLVLSGTTIAKAVGDWYYERKRFQEID  377



>gb|KDO40409.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
Length=372

 Score =   263 bits (673),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/350 (41%), Positives = 202/350 (58%), Gaps = 27/350 (8%)
 Frame = +3

Query  258   AVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGS  437
             AVCLDGSPPAYHF  G G   +NWL+++ GG WC +          VE+CS R     GS
Sbjct  22    AVCLDGSPPAYHFDKGFGAGINNWLVHIDGGAWCNN----------VEDCSKRRDSSYGS  71

Query  438   SFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARI  611
             S +M K   F GI    + +   FY WNRV VRYCDG SF GDVE  +P T L++RGAR+
Sbjct  72    SKHMVKEANFTGILSNEQKFNPDFYDWNRVRVRYCDGASFTGDVEAVNPETNLHFRGARV  131

Query  612   FQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIV  791
             F+ V+++L+AKGMK+A+N I  G SAGGL   +HCD F + FP   RVKC +D+  F+  
Sbjct  132   FEAVMEDLLAKGMKNAQNAILTGCSAGGLTSILHCDNFRALFPVDTRVKCFADAGYFVNA  191

Query  792   KDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAY  971
             KD     + +  +  VVALH   K LP  CTS++SP  CF P+N+   +K+PLFI +SAY
Sbjct  192   KDVSGESHIEEFYKQVVALHGSAKHLPASCTSRLSPGLCFFPENVAGQIKTPLFIINSAY  251

Query  972   DSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP--KPSATKGF  1124
             DS+Q+ N        P   + + K +  + S + +  +Q F+ Q ++AL     S+++G 
Sbjct  252   DSWQISNILVPEDADPKGAWSSCKVDIKTCSSTQLQTMQGFRVQFLNALAGLGNSSSRGM  311

Query  1125  IVTSNFGHSFASNNYKKPMF-ADS---KSKSIESGFYNWFFDKHPINLID  1262
              V S + H     +Y++  F ADS       I     +W++D+ P   ID
Sbjct  312   FVDSCYTH--CRTDYQETWFSADSPVLDKTPIAKAVGDWYYDRSPFQKID  359



>ref|XP_006363883.1| PREDICTED: uncharacterized protein LOC102589191 [Solanum tuberosum]
Length=476

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 145/369 (39%), Positives = 210/369 (57%), Gaps = 31/369 (8%)
 Frame = +3

Query  210   DFIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLD  389
             D  +  TI++ A  +GAVCLDGSPPAYH   G G    NW+IYL GGGWC S        
Sbjct  5     DLNVNITILESATAQGAVCLDGSPPAYHLHRGHGTGLDNWIIYLDGGGWCES--------  56

Query  390   LSVENCSSRMGRELGSSFNM-KPLIFKGIF-GMNENYTTFYKWNRVVVRYCDGGSFAGDV  563
               +  C  R    LGS+  M +   F GI    ++    F+ WNRV V+YCDG SF GDV
Sbjct  57    --IPECLYRTTTYLGSTKKMGQQAFFSGILHNTSKQNPEFHNWNRVRVKYCDGSSFTGDV  114

Query  564   EKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPK  743
             E+  P  KLY+RGARIF+ ++++L +KGMK+A+N I  G SAGGL   ++CD+F    P+
Sbjct  115   EQVHPENKLYFRGARIFKAIMEDLSSKGMKNAENAILSGTSAGGLATILNCDKFKCLLPE  174

Query  744   GVRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKN  923
               RVKC++D+S F+  K      + + ++ ++V LH+  K+LP  CTS M P  CF P+N
Sbjct  175   NARVKCVADASFFINGKSIYGTSFTQEMYQNIVNLHESAKNLPPACTSAMEPSLCFFPEN  234

Query  924   LVQYVKSPLFIFHSAYDSFQVQNTFP---IDLYRA----IKNGSSISPSDMALLQDFK--  1076
             ++ YV++PLFI +S YDS+Q+ NT     +D   A    IK+ SS + S + ++Q F   
Sbjct  235   VMPYVQTPLFIINSIYDSWQINNTLVPPYLDKQHAWKACIKSISSCTSSQLIIIQAFGVE  294

Query  1077  -KQIISALPKPSATKGFIVTSNFGHSFASNNYKKPMFADSKS-----KSIESGFYNWFFD  1238
               +    LP P +T+G+ +TS + H         P +  + S     K+I     +W+F+
Sbjct  295   FSKTFEGLP-PCSTRGYFLTSCYSHGGIR---LTPYWLKTSSLTLFNKTIAEAVADWYFE  350

Query  1239  KHPINLIDP  1265
             +  I   DP
Sbjct  351   REGIQYTDP  359



>gb|KHG23648.1| Notum [Gossypium arboreum]
Length=395

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 142/363 (39%), Positives = 206/363 (57%), Gaps = 32/363 (9%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDG+PPAYH+  G G   ++WLI L+GGGWC +          V
Sbjct  28    VPITYVQSAVAKGAVCLDGTPPAYHWDKGYGTGINSWLIQLEGGGWCNN----------V  77

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYTTFYKWNRVVVRYCDGGSFAGDVEKPD  575
              +C  R    LGSS  M K + F GI     N   FY WNR+ VRYCDG SF GDV   +
Sbjct  78    SSCLVRKNTHLGSSKRMVKQIPFSGIL----NNKHFYNWNRIKVRYCDGSSFTGDVAAVN  133

Query  576   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRV  755
             PV  L++RGAR++  V+++L++KGM++A+N I  G SAGGL   +HCD F +  P G +V
Sbjct  134   PVANLHFRGARVWLAVMEDLLSKGMRNAENAILSGCSAGGLASILHCDSFRALLPMGTKV  193

Query  756   KCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  935
             KC+SD+  F+  +D     Y +  F  +VA H   K+L   CTS+M P  CF P+ + Q 
Sbjct  194   KCISDAGYFINTRDVSGGHYIQTFFDQLVATHGSAKNLLPSCTSRMKPGLCFFPQYIAQQ  253

Query  936   VKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISA  1094
             +++PLFI ++AYDS+Q++N        P   + + K +  +  PS + ++QDF+ Q + A
Sbjct  254   IRTPLFIINAAYDSWQIRNILAPGIADPHGHWESCKLDIKNCLPSQIKVMQDFRLQFLVA  313

Query  1095  LPK--PSATKGFIVTSNFGHSFASNN-----YKKPMFADSKSKSIESGFYNWFFDKHPIN  1253
             L +   SA++G  + S F H              P+   +K   I     +WF+D++P  
Sbjct  314   LLRLGKSASRGMFIDSCFAHCQTEMQELWFMQDSPLLNKTK---IGKAVGDWFYDRNPFQ  370

Query  1254  LID  1262
              ID
Sbjct  371   KID  373



>ref|NP_001190770.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 gb|AEE84178.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=517

 Score =   268 bits (684),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 147/361 (41%), Positives = 210/361 (58%), Gaps = 29/361 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  399   ENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
              +C+ R G   GSS F  K   F GI G  ++    FY WNR+ VRYCDG SF G+VE  
Sbjct  74    ASCNERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVEAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +P  KL++RGAR+++ VVD+LMAKGMK+A+N I  G SAG L   +HCD F +  P+   
Sbjct  134   NPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAS  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ +S VVALH   KSLPV CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDITGGSYIQSYYSKVVALHGSAKSLPVSCTSKMKPELCFFPQYVVP  253

Query  933   YVKSPLFIFHSAYDSFQVQNTF---PIDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +  KN        S + +  +Q F+ Q++ 
Sbjct  254   SMRTPLFVINAAFDSWQIKNVLAPTAVDKGKEWKNCKLDLKKCSAAQLKTVQGFRDQMMR  313

Query  1092  ALPKPSAT--KGFIVTSNFGH----SFAS-NNYKKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL    +T  +G  + S   H    S AS +  K P  A+++   I     NWF+ +  +
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGDKGPQVANTR---IAKAVGNWFYGRTSM  370

Query  1251  N  1253
             +
Sbjct  371   D  371



>ref|XP_008365238.1| PREDICTED: uncharacterized protein LOC103428882 [Malus domestica]
Length=311

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/290 (45%), Positives = 183/290 (63%), Gaps = 21/290 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T+++ A  KGAVCLDGS PAYHF  G G   +NWL++++GGGWC +          VE+C
Sbjct  30    TLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHVEGGGWCNT----------VEDC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYTT--FYKWNRVVVRYCDGGSFAGDVEKPDP  578
               R     GSS  M K + F G+ G N+  T   FY WNR+ VRYCDG SF GDVE  DP
Sbjct  80    LDRKSNYRGSSTKMEKTMSFSGVLG-NKPKTNPDFYNWNRIKVRYCDGSSFTGDVEAVDP  138

Query  579   VTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVK  758
              T L++RGAR+F+ ++D L+AKGMK+A+N +  G SAGGL   +HCD F S  P G +VK
Sbjct  139   ATNLHFRGARVFRAIIDXLLAKGMKNAQNALLSGCSAGGLTSILHCDNFRSLLPVGTKVK  198

Query  759   CLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYV  938
             CL+D+  F+  K    +++ +  +S+VVALH   K+LP  CTS+MSP  CF P+N+V   
Sbjct  199   CLADAGYFINAKSLSGSZHIQGFYSEVVALHGSAKNLPASCTSRMSPGLCFFPQNVVPQT  258

Query  939   KSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQ  1067
             ++P+F+ ++AYDS+Q++N        P   ++  K N  + SPS +  LQ
Sbjct  259   RTPIFLVNAAYDSWQIKNILAPGVADPKGAWKKCKLNIKNCSPSQLQTLQ  308



>ref|XP_008808370.1| PREDICTED: uncharacterized protein LOC103720446 isoform X3 [Phoenix 
dactylifera]
Length=401

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/365 (38%), Positives = 205/365 (56%), Gaps = 28/365 (8%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             F +P T++Q A  KGAVCLDGSPPAYHF+ G G   +NWL++++GGGWC +         
Sbjct  30    FDVPLTLVQSAVAKGAVCLDGSPPAYHFAPGFGSGVNNWLVHMEGGGWCRN---------  80

Query  393   SVENCSSRMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEK  569
              VE C  R     GSS  MK L F GI G  +N    FY WN+V +RYCDG SF GD+E 
Sbjct  81    -VEECKERTKNFRGSSKYMKQLSFSGILGKKQNLNPDFYNWNKVKIRYCDGSSFTGDIEA  139

Query  570   PDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGV  749
              +P T L++RGAR+++ ++D+L+AK M  A+N +  G SAGGL   +HCD F    P G 
Sbjct  140   VNPATNLHFRGARVWRAIIDDLLAKRMNKAQNALLSGCSAGGLASILHCDSFRDLVPAGA  199

Query  750   RVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLV  929
             RVKC SD+  F+  KD    +  K  ++ V   H   K+LP  CTS+  P  CF P+ +V
Sbjct  200   RVKCFSDAGYFINGKDVSGKESIKDFYNQVATTHGSAKNLPSSCTSRFPPSMCFFPQYVV  259

Query  930   QYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQII  1088
             Q +++PLFI ++AYD++Q++N        P  ++   K +    S + + ++Q F+ Q +
Sbjct  260   QSMRTPLFILNAAYDAWQIKNILAPSPSDPRKVWGECKLDIKKCSSNQLQVMQGFRTQFL  319

Query  1089  SALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADSKSKSIE-----SGFYNWFFDKHP  1247
             +AL     S++ G  + S + H     +  +  +  S S  +E         +WF+D+  
Sbjct  320   NALAGFGSSSSTGMFINSCYAH---CQSEMQETWLSSNSPVLEKIPIAKAVGDWFYDRIA  376

Query  1248  INLID  1262
                ID
Sbjct  377   FQKID  381



>ref|XP_009398466.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398467.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398468.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398469.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=395

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/361 (40%), Positives = 209/361 (58%), Gaps = 30/361 (8%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  KGAVCLDGSPPAYH S G G   +NWL++L+GGGWC +          +  C
Sbjct  29    TYVESAIPKGAVCLDGSPPAYHLSPGFGSGVNNWLVHLEGGGWCNN----------ITTC  78

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              +R    LGSS  M K L F GI    +++   FY WN+V VRYCDG SF GDVE+ DP 
Sbjct  79    LARKNTRLGSSGQMAKQLAFSGILSNTQSFNPDFYNWNKVKVRYCDGSSFTGDVERVDPA  138

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L+YRGAR++  V++EL+A+GM  A+N +  G SAGGL   +HCD F +  P   +VKC
Sbjct  139   TNLHYRGARVWLAVMEELLARGMSKAENALLSGCSAGGLASILHCDSFRNLLPASAKVKC  198

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  F+ VKD   A++ KA ++DVV  H   K+LP+ CTS + P  CF P+ + Q ++
Sbjct  199   LSDAGYFINVKDISGAEHIKAFYNDVVTTHGSAKNLPL-CTSMIEPGMCFFPQYMAQEIE  257

Query  942   SPLFIFHSAYDSFQVQNTFPIDLYRAIKNGS---------SISPSDMALLQDFKKQIISA  1094
             SPLFI ++AYDS+Q++N     +  A ++GS           S + + ++Q+F+ + ++A
Sbjct  258   SPLFILNAAYDSWQIKNILVPTV--ADRHGSWHNCKLDIKLCSSAQLQIMQEFRLEFLNA  315

Query  1095  ---LPKPSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLI  1259
                L  PS ++G  + S + H  S     +  P         I     +WF+++     I
Sbjct  316   VNGLGTPS-SRGLFINSCYAHCQSEMQETWLLPNSPMLDKIPIAEAVGDWFYNRSAFQKI  374

Query  1260  D  1262
             D
Sbjct  375   D  375



>gb|ACJ85294.1| unknown [Medicago truncatula]
 gb|AFK37076.1| unknown [Medicago truncatula]
Length=393

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 142/361 (39%), Positives = 203/361 (56%), Gaps = 23/361 (6%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDGSPPAYHF  G      NW+++ +GGGWC  N+A + LD   
Sbjct  28    VPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWC--NNATTCLD---  82

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
                  R+   LG S  M K L F G F   + +   FY WNR+ VRYCDG SF GDVE  
Sbjct  83    -----RIDTRLGPSKKMDKTLSFSGFFSSGKKFNPDFYNWNRIKVRYCDGSSFTGDVEAV  137

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP T L+YRG RIF  V+++L+AKGMK+AKN I  G SAGGL   + CDRF +  P   +
Sbjct  138   DPKTNLHYRGGRIFVAVIEDLLAKGMKNAKNAILSGCSAGGLTSILQCDRFRTLLPAAAK  197

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+ VK    A + +  +S VV  H   K+LP  CTS++SP  CF P+N+  
Sbjct  198   VKCVSDAGYFINVKAVSGASHIEQFYSQVVQTHGSAKNLPSSCTSRLSPGLCFFPQNVAA  257

Query  933   YVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIIS  1091
              +K+P+F  ++AYDS+Q++N        P   +R  K +  S S + ++ +Q F+ + + 
Sbjct  258   QIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIKSCSANQLSTMQGFRTEFLK  317

Query  1092  ALP--KPSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLI  1259
             A+     S +KG  +   + H  +     + +  F      +I     +W++D+     I
Sbjct  318   AISVVSNSPSKGMFIDGCYSHRQTGMQETWMRTDFPVLAKTTIAKAVGDWYYDRSTFQQI  377

Query  1260  D  1262
             D
Sbjct  378   D  378



>ref|XP_008373438.1| PREDICTED: protein notum homolog isoform X1 [Malus domestica]
Length=466

 Score =   266 bits (679),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 152/407 (37%), Positives = 214/407 (53%), Gaps = 40/407 (10%)
 Frame = +3

Query  84    SLRMAVSPRSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAV  263
             S R     R   W+ +L    V +V       +P  IT            +  A  KGAV
Sbjct  25    SYRQMAGARLGQWLSVL----VCAVMLLKAAALPVGIT-----------YVHSAVAKGAV  69

Query  264   CLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSF  443
             CLDGSPPAYH   G G   +NWL++++GGGWC +          +  C  R    LGSS 
Sbjct  70    CLDGSPPAYHLDKGYGSGINNWLVHIEGGGWCNN----------ITTCLVRKNNRLGSSK  119

Query  444   NM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQ  617
              M K + F GI      +   FY WNRV VRYCDG SF GDV   +  T L++RGARIF+
Sbjct  120   KMLKEIAFSGILNSRHIFNPDFYNWNRVKVRYCDGASFTGDVAAVNLATGLFFRGARIFR  179

Query  618   VVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKD  797
              V++EL+AKGM  AKN I  G SAGGL   +HCD F +  P G +VKC+SD+  F+  KD
Sbjct  180   AVIEELLAKGMGKAKNAILSGCSAGGLASILHCDNFHALLPVGAKVKCVSDAGYFINAKD  239

Query  798   PEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDS  977
                A++ +  FS VVA H   K+LP  CTSK+SP  CF P+     +++P+F  ++AYDS
Sbjct  240   VSGARHVEQFFSQVVATHGSAKNLPPSCTSKLSPGLCFFPQYFASQIRTPMFYVNAAYDS  299

Query  978   FQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALPKPSA--TKGFIV  1130
             +Q++N        P   ++  K + +   P+ +  +QDF+ Q +SA+   S   +KG  +
Sbjct  300   WQIKNILAPGVADPHGTWQNCKLDITHCKPTQLKTMQDFRAQFLSAIGGVSGSRSKGMFI  359

Query  1131  TSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
              S + H   +   +  +  DS      +I     +WF+D+ P   ID
Sbjct  360   DSCYAHC-QTELQETWLMPDSPVLNKTTIAKAVGDWFYDRTPFQKID  405



>ref|XP_006398195.1| hypothetical protein EUTSA_v10000914mg [Eutrema salsugineum]
 gb|ESQ39648.1| hypothetical protein EUTSA_v10000914mg [Eutrema salsugineum]
Length=391

 Score =   263 bits (672),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/364 (37%), Positives = 203/364 (56%), Gaps = 29/364 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T ++ A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            +
Sbjct  24    VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTD----------I  73

Query  399   ENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
               C  R     GSS F  K   F GI G  ++    FY WNR+ VRYCDG SF GD+E  
Sbjct  74    ATCVKRKSTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP  KL++RGAR+++ V+D+LMAKGM +A+N I  G SAG L   +HCD F S  PK  +
Sbjct  134   DPTNKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDEFKSIIPKTAK  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ +  VVA H   KSLPV CTS M P  CF P+ +V+
Sbjct  194   VKCVSDAGFFIHGKDISGGSYIESYYGKVVATHGSAKSLPVSCTSSMKPELCFFPQYVVK  253

Query  933   YVKSPLFIFHSAYDSFQVQNTFP---IDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +  K         + + +  +Q ++ Q+++
Sbjct  254   TMQTPLFVINAAFDSWQIKNVLAPTSVDKRKEWKTCKLDLKKCTAAQLQTVQGYRDQMLA  313

Query  1092  ALP--KPSATKGFIVTSNFGHSFAS-----NNYKKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL   + + T+G  + S   H         +  + P   D+K   +     +WF+++   
Sbjct  314   ALAPVRATTTRGLFLDSCHAHCQGGSAATWSGAQGPQVGDTK---MAKAVGDWFYERSTF  370

Query  1251  NLID  1262
               +D
Sbjct  371   QNVD  374



>ref|XP_010325697.1| PREDICTED: uncharacterized protein LOC101260962 [Solanum lycopersicum]
Length=608

 Score =   269 bits (688),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 141/360 (39%), Positives = 210/360 (58%), Gaps = 25/360 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T++  A  +GAVCLDGSPPAYH   G G    +W+IYL GGGWC +          + +C
Sbjct  252   TVLHSATAQGAVCLDGSPPAYHLDRGHGTGLHSWVIYLDGGGWCNN----------ISDC  301

Query  408   SSRMGRELGSSFNMKPLIFKG--IFGMNENYTTFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              +R  + LGSS  MK   F G  +   ++    F+ WNRV V+YCDG SF GDVE+ +P 
Sbjct  302   LNRSTKFLGSSTKMKRQSFFGGILHNTSKENPEFHNWNRVRVKYCDGASFTGDVEQINPE  361

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
              KLY+RGARIF+ ++++L  KGMK+A+N I  G SAGGL   ++CD+F S  P   RVKC
Sbjct  362   NKLYFRGARIFKAIMEDLWCKGMKNAENAILTGTSAGGLATILNCDKFKSLLPGSARVKC  421

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             ++ +  F+  K      + + ++ ++V+LH   K+LP  CTS M P  CF P+N+V Y++
Sbjct  422   VASAGFFIDGKTITGTSHIQEMYEEIVSLHGSAKNLPSACTSAMEPSLCFFPQNVVSYIQ  481

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRA-IKNGSSISPSDMALLQDFKKQ---IIS  1091
             +PLFI +S YDS+Q+ NT       P   ++  IKN SS + S + +++ F  +   I  
Sbjct  482   TPLFIINSVYDSWQINNTLVPSYLDPQHAWKGCIKNISSCTSSQLIIIRAFGVEFLKIFG  541

Query  1092  ALPKPSATKGFIVTSNFGHS--FASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLIDP  1265
             ALP P  T+G+ +TS + H    +++ +         SK+I     +W+F++     IDP
Sbjct  542   ALP-PCFTRGYFLTSCYSHGDILSTSYWYNTTSPRLLSKTIAEAVGDWYFERAGFQHIDP  600



>ref|XP_010494620.1| PREDICTED: uncharacterized protein LOC104771742 [Camelina sativa]
Length=391

 Score =   263 bits (672),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 136/368 (37%), Positives = 206/368 (56%), Gaps = 29/368 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T ++ A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            +
Sbjct  24    VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTD----------I  73

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
               C  R     GSS  M K   F GI G  ++    FY WNR+ VRYCDG SF GD+E  
Sbjct  74    ATCVQRKSTMKGSSKLMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP  KL++RGAR+++ V+D+LMAKGM +A+N I  G SAG L   +HCD+F S  PK  +
Sbjct  134   DPANKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDQFKSILPKTAK  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ +  VVA H   KSLP  CTS M P  CF P+ + +
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIQSYYGKVVATHGSAKSLPASCTSTMKPELCFFPQYVAK  253

Query  933   YVKSPLFIFHSAYDSFQVQNTFP---IDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +A K         + + +  +Q ++ Q+++
Sbjct  254   TLQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTVQGYRDQVLA  313

Query  1092  ALP--KPSATKGFIVTSNFGHSFASNNY-----KKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL   + + T G  + S   H    +       K P  A++K   +     +WF+++   
Sbjct  314   ALAPVRAATTSGLFLDSCHAHCQGGSAATWSGDKGPTVANTK---MAKAVGDWFYERSTF  370

Query  1251  NLIDPNTV  1274
               ID +++
Sbjct  371   QNIDCSSL  378



>ref|XP_007209211.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 ref|XP_007209212.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 gb|EMJ10410.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 gb|EMJ10411.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
Length=400

 Score =   263 bits (673),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 141/359 (39%), Positives = 203/359 (57%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +  A  KGAVCLDGSPPAYH   G G   +NWL++++GGGWC +          V NC
Sbjct  30    TYVHSAIAKGAVCLDGSPPAYHHDKGFGSGINNWLVHIEGGGWCNN----------VTNC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
               R    LGSS  M K + F GI    + +   FY WNR+ VRYCDG SF GDV   +P 
Sbjct  80    LGRKNTRLGSSKQMLKAIAFSGILSNRKMFNPDFYNWNRIKVRYCDGASFTGDVAAVNPA  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T LY+RGARIF+ V+++L+AKGM +A+N I  G SAGGL   +HCD F +  P G  VKC
Sbjct  140   TGLYFRGARIFRAVIEDLLAKGMGNAQNAILSGCSAGGLTSILHCDNFHALLPAGTNVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             +SD+  F+ VKD   A++ + +FS VV  H   ++LP  CTSK+ P  CF P+ +   ++
Sbjct  200   VSDAGYFINVKDVSGAQHIEELFSQVVETHGSARNLPPSCTSKLRPGLCFFPQYMASQIQ  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             + +F  ++AYDS+Q++N        P   +   K +  + SP+ +  +QDF+ Q +SA+ 
Sbjct  260   TRIFFVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPTQLKAMQDFRVQFLSAVG  319

Query  1101  KPSAT--KGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
               +    KG  + S + H   +   +  + ADS      +I     +WF+ + P   ID
Sbjct  320   GMTGCPLKGMFIDSCYAHC-QTEMQETWLMADSPVLNKTTIAQAVGDWFYGRTPFQKID  377



>ref|XP_011028482.1| PREDICTED: uncharacterized protein LOC105128479 isoform X2 [Populus 
euphratica]
Length=481

 Score =   266 bits (679),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 141/359 (39%), Positives = 213/359 (59%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  KGAVCLDGSPPAYH+  G G   ++WLI+ +GGGWC +          V +C
Sbjct  112   TYVKSAVAKGAVCLDGSPPAYHWDKGSGTGINSWLIHFEGGGWCNN----------VTSC  161

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR    LGSS  M + + F GI      +   FY WNRV +RYCDG SF GDV+  +P 
Sbjct  162   LSRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPA  221

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGARI+  V+++L+ KG+K+A+N +  G SAGGL   +HCD F +    G +VKC
Sbjct  222   TNLHFRGARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALLRMGTKVKC  281

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  F+ VKD   A + +  F+++V LH   K+LP+ CTS + P  CF P+ +   V+
Sbjct  282   LSDAGYFIKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSMLKPSFCFFPQYVAPQVR  341

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +PLFI ++AYDS+Q++N        P+ ++++ K + ++ SP  +  +QDF+ Q ++AL 
Sbjct  342   TPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALK  401

Query  1101  KP--SATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                 S+++G  + S + H   +   +K    DS     K I     +WF+D++P   ID
Sbjct  402   TSTNSSSRGLYIDSCYAHC-QTETQEKWFMEDSPVLGKKKIAKAVGDWFYDRNPFQKID  459



>ref|XP_010441760.1| PREDICTED: uncharacterized protein LOC104724893 [Camelina sativa]
Length=391

 Score =   263 bits (671),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 136/368 (37%), Positives = 206/368 (56%), Gaps = 29/368 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T ++ A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            +
Sbjct  24    VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTD----------I  73

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
               C  R     GSS  M K   F GI G  ++    FY WNR+ VRYCDG SF GD+E  
Sbjct  74    ATCVQRKSTMKGSSKLMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP  KL++RGAR+++ V+D+LMAKGM +A+N I  G SAG L   +HCD+F S  PK  +
Sbjct  134   DPANKLFFRGARVWRAVIDDLMAKGMNNAQNAILSGCSAGALAAILHCDQFKSILPKTAK  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ +  VVA H   KSLP  CTS M P  CF P+ + +
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIQSYYGKVVATHGSAKSLPASCTSTMKPELCFFPQYVAK  253

Query  933   YVKSPLFIFHSAYDSFQVQNTFP---IDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +A K         + + +  +Q ++ Q+++
Sbjct  254   ALQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTVQGYRDQVLA  313

Query  1092  ALP--KPSATKGFIVTSNFGHSFASNNY-----KKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL   + + T G  + S   H    +       K P  A++K   +     +WF+++   
Sbjct  314   ALAPVRAATTSGLFLDSCHAHCQGGSAATWSGDKGPTVANTK---MAKAVGDWFYERSTF  370

Query  1251  NLIDPNTV  1274
               ID +++
Sbjct  371   QNIDCSSL  378



>ref|XP_011028479.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
 ref|XP_011028480.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
 ref|XP_011028481.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
Length=509

 Score =   266 bits (680),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 141/359 (39%), Positives = 213/359 (59%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  KGAVCLDGSPPAYH+  G G   ++WLI+ +GGGWC +          V +C
Sbjct  112   TYVKSAVAKGAVCLDGSPPAYHWDKGSGTGINSWLIHFEGGGWCNN----------VTSC  161

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR    LGSS  M + + F GI      +   FY WNRV +RYCDG SF GDV+  +P 
Sbjct  162   LSRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPA  221

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGARI+  V+++L+ KG+K+A+N +  G SAGGL   +HCD F +    G +VKC
Sbjct  222   TNLHFRGARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALLRMGTKVKC  281

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  F+ VKD   A + +  F+++V LH   K+LP+ CTS + P  CF P+ +   V+
Sbjct  282   LSDAGYFIKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSMLKPSFCFFPQYVAPQVR  341

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +PLFI ++AYDS+Q++N        P+ ++++ K + ++ SP  +  +QDF+ Q ++AL 
Sbjct  342   TPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALK  401

Query  1101  KP--SATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                 S+++G  + S + H   +   +K    DS     K I     +WF+D++P   ID
Sbjct  402   TSTNSSSRGLYIDSCYAHC-QTETQEKWFMEDSPVLGKKKIAKAVGDWFYDRNPFQKID  459



>ref|XP_010481611.1| PREDICTED: uncharacterized protein LOC104760390 [Camelina sativa]
Length=391

 Score =   263 bits (671),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 136/367 (37%), Positives = 206/367 (56%), Gaps = 29/367 (8%)
 Frame = +3

Query  222   PKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVE  401
             P T ++ A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            + 
Sbjct  25    PITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTD----------IA  74

Query  402   NCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPD  575
              C  R     GSS  M K   F GI G  ++    FY WNR+ VRYCDG SF GD+E  D
Sbjct  75    TCVQRKSTMKGSSKLMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVD  134

Query  576   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRV  755
             P  KL++RGAR+++ V+D+LMAKGM++A+N I  G SAG L   +HCD+F S  PK  +V
Sbjct  135   PANKLFFRGARVWRAVIDDLMAKGMRNAQNAILSGCSAGALAAILHCDQFKSILPKTAKV  194

Query  756   KCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  935
             KC+SD+  F+  KD     Y ++ +  VVA H   KSLP  CTS M P  CF P+ + + 
Sbjct  195   KCVSDAGYFIHGKDISGGSYIQSYYGKVVATHGSAKSLPASCTSTMKPELCFFPQYVAKT  254

Query  936   VKSPLFIFHSAYDSFQVQNTFP---IDLYRAIKNG----SSISPSDMALLQDFKKQIISA  1094
             +++PLF+ ++A+DS+Q++N      +D  +A K         + + +  +Q ++ Q+++A
Sbjct  255   LQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTVQGYRDQVLAA  314

Query  1095  LP--KPSATKGFIVTSNFGHSFASNNY-----KKPMFADSKSKSIESGFYNWFFDKHPIN  1253
             L   + + T G  + S   H    +       K P  A++K   +     +WF+++    
Sbjct  315   LAPVRAATTSGLFLDSCHAHCQGGSAATWSGDKGPTVANTK---MAKAVGDWFYERSTFQ  371

Query  1254  LIDPNTV  1274
              ID +++
Sbjct  372   NIDCSSL  378



>ref|XP_007156330.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
 gb|ESW28324.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
Length=397

 Score =   263 bits (671),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 140/359 (39%), Positives = 207/359 (58%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  KGAVCLDGS PAYHF  G G   +NW+++ +GGGWC +          V +C
Sbjct  28    TFVENAVAKGAVCLDGSAPAYHFHKGSGAGINNWIVHFEGGGWCNN----------VTSC  77

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYTT-FYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR    LGSS  M   L F G F  ++ +   FY WNR+ VRYCDG SF GDVE  DP 
Sbjct  78    LSRRDTRLGSSKKMDTQLSFSGFFSNSKKFNQDFYDWNRIKVRYCDGSSFTGDVEAVDPR  137

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGAR+F  VV++L+AKGMK+A+N I  G SAGGL   ++CDRF +  P+  +VKC
Sbjct  138   TNLHFRGARVFAAVVEDLLAKGMKNAQNAIISGCSAGGLAAILNCDRFKALLPRTTKVKC  197

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             L+D+  F+ VKD   A+  +  +S VV  H   K+LP  CTS++ P  CF P+N+V  + 
Sbjct  198   LADAGYFINVKDVSGAQRIEEFYSQVVQTHGSAKNLPSSCTSRLKPGLCFFPQNVVSQIS  257

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +P+F  ++AYDS+Q++N        P   +R  K +  + SP+ ++++Q F+   + A  
Sbjct  258   TPIFFVNAAYDSWQIKNILAPGAADPHGQWRECKLDIKNCSPNQLSVMQVFRTDFLRAFG  317

Query  1101  K--PSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                 S +KG  +   + H   +   +  +  DS    + +I     +WF+D+   + ID
Sbjct  318   AVGNSPSKGHFIDGCYAHC-QTGTQETWLRNDSPVLGNTTIARAVGDWFYDRRAFHQID  375



>gb|AFK45147.1| unknown [Lotus japonicus]
Length=394

 Score =   262 bits (670),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 141/362 (39%), Positives = 205/362 (57%), Gaps = 25/362 (7%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +Q A  KGAVCLDGSPPAYHF  G G   +NW+++ +GG WC +          V
Sbjct  27    VPTTFVQSAVAKGAVCLDGSPPAYHFHKGFGAGINNWIVHFEGGAWCNN----------V  76

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
               C +R    LGSS  M + L F G F   + +   FY WNR+ VRYCDG SF GDVE  
Sbjct  77    TTCLARRDTRLGSSKKMSQTLSFSGFFSNGQKFNPDFYNWNRIKVRYCDGSSFTGDVEAV  136

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP T L++RG RIF  VV++L+A GMK+A+N I  G SAGGL   + CDRF S  P   +
Sbjct  137   DPKTNLHFRGGRIFVAVVEDLLANGMKNAQNAILSGCSAGGLTSILQCDRFRSLIPAAAK  196

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKCLSD+  F+ +KD   A + + ++S VV  H   K+LP  CTS++ P  CF P+N+  
Sbjct  197   VKCLSDAGYFINLKDVSGAAHIEQLYSQVVETHGSAKNLPASCTSRLRPGLCFFPQNVAG  256

Query  933   YVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIIS  1091
              +K+P+   ++AYDS+QV+N        P   +R  K +    S + + ++Q F+ + + 
Sbjct  257   QIKTPISFVNAAYDSYQVKNILAPGVADPHGTWRDCKLDIKKCSSNQLTVMQGFRTEFLK  316

Query  1092  ALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINL  1256
             A+   + S +KG  V   + H   +   +  M +DS    + +I     +WF+++   + 
Sbjct  317   AISVVENSPSKGMFVDGCYSHC-QTGMQETWMRSDSPVLANTTIAKAVGDWFYERRSFSQ  375

Query  1257  ID  1262
             ID
Sbjct  376   ID  377



>ref|XP_008373439.1| PREDICTED: protein notum homolog isoform X2 [Malus domestica]
 ref|XP_008373440.1| PREDICTED: protein notum homolog isoform X2 [Malus domestica]
Length=438

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 143/359 (40%), Positives = 201/359 (56%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +  A  KGAVCLDGSPPAYH   G G   +NWL++++GGGWC +          +  C
Sbjct  30    TYVHSAVAKGAVCLDGSPPAYHLDKGYGSGINNWLVHIEGGGWCNN----------ITTC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
               R    LGSS  M K + F GI      +   FY WNRV VRYCDG SF GDV   +  
Sbjct  80    LVRKNNRLGSSKKMLKEIAFSGILNSRHIFNPDFYNWNRVKVRYCDGASFTGDVAAVNLA  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGARIF+ V++EL+AKGM  AKN I  G SAGGL   +HCD F +  P G +VKC
Sbjct  140   TGLFFRGARIFRAVIEELLAKGMGKAKNAILSGCSAGGLASILHCDNFHALLPVGAKVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             +SD+  F+  KD   A++ +  FS VVA H   K+LP  CTSK+SP  CF P+     ++
Sbjct  200   VSDAGYFINAKDVSGARHVEQFFSQVVATHGSAKNLPPSCTSKLSPGLCFFPQYFASQIR  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +P+F  ++AYDS+Q++N        P   ++  K + +   P+ +  +QDF+ Q +SA+ 
Sbjct  260   TPMFYVNAAYDSWQIKNILAPGVADPHGTWQNCKLDITHCKPTQLKTMQDFRAQFLSAIG  319

Query  1101  KPSA--TKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
               S   +KG  + S + H   +   +  +  DS      +I     +WF+D+ P   ID
Sbjct  320   GVSGSRSKGMFIDSCYAHC-QTELQETWLMPDSPVLNKTTIAKAVGDWFYDRTPFQKID  377



>ref|XP_007156331.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
 gb|ESW28325.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
Length=417

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 140/359 (39%), Positives = 207/359 (58%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  KGAVCLDGS PAYHF  G G   +NW+++ +GGGWC +          V +C
Sbjct  48    TFVENAVAKGAVCLDGSAPAYHFHKGSGAGINNWIVHFEGGGWCNN----------VTSC  97

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYTT-FYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR    LGSS  M   L F G F  ++ +   FY WNR+ VRYCDG SF GDVE  DP 
Sbjct  98    LSRRDTRLGSSKKMDTQLSFSGFFSNSKKFNQDFYDWNRIKVRYCDGSSFTGDVEAVDPR  157

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGAR+F  VV++L+AKGMK+A+N I  G SAGGL   ++CDRF +  P+  +VKC
Sbjct  158   TNLHFRGARVFAAVVEDLLAKGMKNAQNAIISGCSAGGLAAILNCDRFKALLPRTTKVKC  217

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             L+D+  F+ VKD   A+  +  +S VV  H   K+LP  CTS++ P  CF P+N+V  + 
Sbjct  218   LADAGYFINVKDVSGAQRIEEFYSQVVQTHGSAKNLPSSCTSRLKPGLCFFPQNVVSQIS  277

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +P+F  ++AYDS+Q++N        P   +R  K +  + SP+ ++++Q F+   + A  
Sbjct  278   TPIFFVNAAYDSWQIKNILAPGAADPHGQWRECKLDIKNCSPNQLSVMQVFRTDFLRAFG  337

Query  1101  K--PSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
                 S +KG  +   + H   +   +  +  DS    + +I     +WF+D+   + ID
Sbjct  338   AVGNSPSKGHFIDGCYAHC-QTGTQETWLRNDSPVLGNTTIARAVGDWFYDRRAFHQID  395



>ref|XP_006363875.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=402

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 140/358 (39%), Positives = 204/358 (57%), Gaps = 23/358 (6%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +     KGAVCLDGSPPAYH   G G   ++WLI ++GGGWC +          +  C
Sbjct  30    TYVLSGVAKGAVCLDGSPPAYHHDKGFGTGVNSWLIQMEGGGWCNN----------ISTC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR    LGSS  M + L F GI      +   FY WNRV V YCDG SF GDV+  +P+
Sbjct  80    LSRKNTRLGSSKQMVENLAFSGILSNLPQFNPDFYNWNRVKVGYCDGSSFTGDVQAVNPI  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGAR+F  V+++L+AKGMK+A+N I  G SAGGL   +HCD F +  P G +VKC
Sbjct  140   TNLHFRGARVFLAVMEDLLAKGMKNAENAILSGCSAGGLTSILHCDSFKALLPMGAKVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
              SD+  F+  KD   A + +  F DVV+LH   K+LP  CTS++ P  CF P+N+ Q+V+
Sbjct  200   FSDAGYFIDAKDISGAPHIEEYFRDVVSLHGSAKNLPPVCTSRLKPDLCFFPQNVAQHVR  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +PLF+ ++AYDS+Q++N        P   +   K +    S   + ++  ++   + AL 
Sbjct  260   TPLFLVNAAYDSWQIKNILAPGVADPYGFWLNCKLDILKCSSRQLQIMHGYRLLFLRALN  319

Query  1101  K--PSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
                PS+++G+ + S F H  +     + +       +K+I     +WF+DK+P   ID
Sbjct  320   ALGPSSSRGYFINSCFAHCQTEVQETWYRADSPKLANKTIAKALGDWFYDKNPFQKID  377



>ref|XP_007051327.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOX95484.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=458

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/366 (39%), Positives = 204/366 (56%), Gaps = 31/366 (8%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
              ++P T+IQGA  KGAVCLDG+PP YH   G G  +++WLI+L+GGGWC +         
Sbjct  51    LMVPLTLIQGAASKGAVCLDGTPPGYHLDRGFGSGSNSWLIHLEGGGWCNN---------  101

Query  393   SVENCSSRMGRELGSS-FNMKPLIFKGIFGMN-ENYTTFYKWNRVVVRYCDGGSFAGDVE  566
              +  C  R     GSS F  K   F GI     E    FY WNRV +RYCDG SFAG  E
Sbjct  102   -IRTCVFRKTTRRGSSKFMAKQTNFTGILSNKAEENPDFYNWNRVKLRYCDGASFAG--E  158

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               +   +LY+RG RI+   ++ELMAKGM++A+  +  G SAGGL   +HCD F   FPK 
Sbjct  159   GQNEANQLYFRGQRIWSAAMEELMAKGMQNAEQALLSGCSAGGLASILHCDEFKDLFPKT  218

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKCLSD+ +FL   +       + ++  VV L    K+LP  CTS+M P  CF P+NL
Sbjct  219   TKVKCLSDAGMFLDATNVAGGHSLRDMYGGVVTLQGVQKNLPNTCTSQMDPTSCFFPQNL  278

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
             V  +++PLF+ ++AYD++QVQ +       P   +R  K + S  + + M  LQDF+ Q+
Sbjct  279   VANIRTPLFLLNAAYDAWQVQESLIPSSADPHGSWRECKMDRSHCNSTQMQFLQDFRSQM  338

Query  1086  ISALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADSKS-----KSIESGFYNWFFDKH  1244
             ++A+     S   G  + S F H     + ++  + ++ S     K++     +WFFD+ 
Sbjct  339   LNAINVFSKSNQNGLFINSCFAH---CQSERQDTWYENDSPRIGNKAVAVSVGDWFFDRT  395

Query  1245  PINLID  1262
              +  ID
Sbjct  396   AVKAID  401



>gb|KHG30410.1| Protein notum [Gossypium arboreum]
Length=410

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 145/363 (40%), Positives = 200/363 (55%), Gaps = 25/363 (7%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
              I+P T+IQGA  KGAVCLDG+ P YH   G G  A++W+I+L+GGGWC +         
Sbjct  45    LIVPLTLIQGAASKGAVCLDGTLPGYHLHRGFGSGANSWVIHLEGGGWCNT---------  95

Query  393   SVENCSSRMGRELGSS-FNMKPLIFKGIFGMN-ENYTTFYKWNRVVVRYCDGGSFAGDVE  566
              +  C  R     GSS F  K +IF GI     E    FY WNRV VRYCDG SFAG  E
Sbjct  96    -IRTCVFRKTTRRGSSKFMEKSIIFTGILSNKAEENPDFYNWNRVRVRYCDGASFAG--E  152

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               +   KLY+RG RI+   ++ELMAKGM++A   +  G SAGGL   +HCD F + FP+ 
Sbjct  153   GQNEANKLYFRGQRIWLAAMEELMAKGMQNANQALLSGCSAGGLASILHCDEFKNLFPET  212

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKCLSD+ LFL   +       + ++  VV L    K+LP  CTS+  P  CF P+NL
Sbjct  213   TKVKCLSDAGLFLDATNVAGGHNLRDMYEGVVTLQGVQKNLPSTCTSQKDPTSCFFPQNL  272

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
             V  VK+P+F+ ++AYD++QV  +       P  L+RA K N S  +   +   QDF+ Q+
Sbjct  273   VSNVKTPMFLLNAAYDAWQVDQSLIPSLADPHGLWRACKTNRSHCNSLQIQFFQDFRNQM  332

Query  1086  ISALP--KPSATKGFIVTSNFGH--SFASNNYKKPMFADSKSKSIESGFYNWFFDKHPIN  1253
             ++A+     S   G  + S F H  S   + + +       +K I     +WFFD+  + 
Sbjct  333   LNAVKIFSESNQNGLFINSCFAHCQSERQDTWYENDSPRIGNKGIAVSVGDWFFDRTAVK  392

Query  1254  LID  1262
              ID
Sbjct  393   AID  395



>gb|AGT16732.1| carboxylic ester hydrolase [Saccharum hybrid cultivar R570]
Length=398

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 151/397 (38%), Positives = 213/397 (54%), Gaps = 44/397 (11%)
 Frame = +3

Query  120   WICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHFS  299
             W C L+ +L +             +  D L  ++  T ++ A  KGAVCLDGS PAYH +
Sbjct  10    WCCALVCALAL-------------VAADGL--LVDITYVESAVAKGAVCLDGSAPAYHLA  54

Query  300   SGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNMKPLI-FKGIF  476
              G G   ++WL++ +GGGWC +          V  C  R    LGSS  M   I F GI 
Sbjct  55    RGSGSGENSWLVHFEGGGWCNN----------VTTCLQRKRTRLGSSKEMVTQIAFSGIL  104

Query  477   GMN-ENYTTFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMK  653
                 +    FY WN+V VRYCDG SF GDVE+ D  TKL+YRGARI+Q V+++L+AKGM 
Sbjct  105   SDTPDGNPDFYNWNKVKVRYCDGSSFTGDVEEVDLTTKLHYRGARIWQAVMEDLLAKGMG  164

Query  654   DAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFS  833
              A+N +  G SAGGL   +HCDRF    P   RVKCLSD+  F+  KD     Y  A F+
Sbjct  165   KAENALISGCSAGGLTSILHCDRFHDLLPPAARVKCLSDAGFFINEKDVAGVGYIAAFFN  224

Query  834   DVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF-----  998
             DVVA H   K+LP  CT  + P  CF P+N V+ +++PLFI ++AYDS+QV+N       
Sbjct  225   DVVATHGSAKNLPPSCTLMLPPGMCFFPQNEVKQIQTPLFILNAAYDSWQVRNILVPGVA  284

Query  999   -PIDLYRAIKNG-SSISPSDMALLQDFKKQIISALPKP--SATKGFIVTSNFGHSFASN-  1163
              P   + + K+     S S + +LQ F+   +  + +   S ++G  + S F H  + + 
Sbjct  285   DPHGQWHSCKHDIGQCSASQLRVLQGFRGDFLKEVSEQWISDSRGLFINSCFVHCQSESQ  344

Query  1164  ----NYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
                 +   PM  ++   +I +   +WFFD+     ID
Sbjct  345   ELWLSSDSPMLGNT---TIANAVGDWFFDRSTFQKID  378



>emb|CDY67801.1| BnaAnng25210D, partial [Brassica napus]
Length=383

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 138/349 (40%), Positives = 204/349 (58%), Gaps = 25/349 (7%)
 Frame = +3

Query  258   AVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGS  437
             AVCLDGSPPAYH   G G   ++WLI L+GGGWC +          V NC SRM  +LGS
Sbjct  24    AVCLDGSPPAYHIDRGSGTGINSWLIQLEGGGWCHN----------VTNCISRMHTKLGS  73

Query  438   SFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARI  611
             S  M + L F  I    E     FY WNRV VRYCDG SF GDV+  +P T L++RGAR+
Sbjct  74    SKKMVENLAFSAILSNKEQRNPDFYNWNRVKVRYCDGSSFTGDVKTVNPATNLHFRGARV  133

Query  612   FQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIV  791
             +  V+ EL+AKGM++A+N +  G SAGGL   +HCD F +  P G  VKCLSD+  FL  
Sbjct  134   WLAVMQELLAKGMRNAENAVLSGCSAGGLASLMHCDSFRALLPMGTNVKCLSDAGFFLNT  193

Query  792   KDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAY  971
             +D   A+Y K+ F+DVV LH   K+LP  CTS+++P  CF P+ + + +++P+F+ ++AY
Sbjct  194   RDVSGAQYIKSYFNDVVTLHGSAKNLPRSCTSRLTPAMCFFPQYVARQIRTPVFVLNAAY  253

Query  972   DSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISAL--PKPSATKGF  1124
             DS+Q++N        P   +++ + +  +   S + ++QDF+ + +SA+     SA++G 
Sbjct  254   DSWQIKNILAPRAADPEGKWQSCQLDIKNCQRSQLKVMQDFRLEFLSAVIGLGRSASRGM  313

Query  1125  IVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
              + S + H   +       + DS      +I     +W +D++    ID
Sbjct  314   FIDSCYTHC-QTETQTSWFWQDSPILNRTTIAKAVGDWVYDRNLFQKID  361



>ref|XP_008673121.1| PREDICTED: uncharacterized protein LOC100382269 isoform X1 [Zea 
mays]
Length=422

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 144/373 (39%), Positives = 205/373 (55%), Gaps = 26/373 (7%)
 Frame = +3

Query  171   VNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGG  350
              +P P+P        ++  T++ GA EKGAVCLDGSPP YH   G G  + +W++YLQGG
Sbjct  46    TDPSPSPE-------LVELTLLTGAREKGAVCLDGSPPGYHLQRGFGSGSHSWIVYLQGG  98

Query  351   GWCMSNDAYSTLDLSVENCSSRMGRELGSSFNMKPLIFKGIFGMNE-NYTTFYKWNRVVV  527
              WC SN    T D   E CS R     GSS  M  + F GIF   +     FY WN+V V
Sbjct  99    AWCSSN----TTD--TETCSERKMTAYGSSKLMGAVTFDGIFRNQQPQNPDFYNWNKVYV  152

Query  528   RYCDGGSFAGDVE-KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGV  704
             RYCDG SF+GD E +    TKL++RG+RI+  VVDELM KGM  A+  +  G SAGGL  
Sbjct  153   RYCDGASFSGDAEGEAQDGTKLFFRGSRIWDAVVDELMGKGMDAAEQALLAGCSAGGLAT  212

Query  705   FVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECT  884
              +HCD F +RFP+ V VKCL D   FL +KD    ++ ++VFS VV L   +  LP  C 
Sbjct  213   LLHCDDFRARFPQEVPVKCLPDGGFFLDIKDLSGERHMRSVFSGVVQLQNVSGVLPKRCL  272

Query  885   SKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQN------TFPIDLYRAIK-NGSSIS  1043
             +K  P ECF P  L++ + +P FI +S YDS+Q+ N      ++  D + + + N  + S
Sbjct  273   AKKDPAECFFPAELIKSISTPTFIVNSEYDSWQIANVVAPDGSYTGDAWTSCRDNIRNCS  332

Query  1044  PSDMALLQDFKKQIISALPKPSATK--GFIVTSNFGH--SFASNNYKKPMFADSKSKSIE  1211
                M +L  F+ ++I  L      +  G  V S F H  + +S+ +  P      ++++ 
Sbjct  333   SEQMDVLHGFRAELIRELKVAEGEREWGLFVDSCFTHCQTQSSDWWHSPTSPRLGNQTVA  392

Query  1212  SGFYNWFFDKHPI  1250
                 +W+F +  +
Sbjct  393   EAVGDWYFGRRRV  405



>emb|CDY26383.1| BnaA02g23870D [Brassica napus]
Length=391

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/364 (37%), Positives = 205/364 (56%), Gaps = 29/364 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T ++ A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            +
Sbjct  24    VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTD----------I  73

Query  399   ENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
               C  R     GSS F  K   F GI G  ++    FY WNR+ VRYCDG SF GD+E  
Sbjct  74    ATCVKRKTTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP  KL++RGAR+++ V+D+LMAKGM +A+N I  G SAG L   +HCD+F S  P   +
Sbjct  134   DPTNKLFFRGARVWRAVIDDLMAKGMNNAQNAILSGCSAGALAAILHCDQFKSILPTTAK  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ +S VV+ H   KSLP  CTS M P  CF P+ +V+
Sbjct  194   VKCVSDAGFFIHGKDISGGSYIESYYSKVVSTHGSAKSLPASCTSSMKPELCFFPQYVVK  253

Query  933   YVKSPLFIFHSAYDSFQVQNTFP---IDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +  K+        + + +  +Q+++ Q+++
Sbjct  254   TMQTPLFVINAAFDSWQIKNVLAPTSVDKRKEWKDCKLDLKKCTAAQLQTVQEYRDQMLA  313

Query  1092  ALP--KPSATKGFIVTSNFGHSFAS-----NNYKKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL   + + T+G  + S   H         +  + P   ++K   +     +WF+++   
Sbjct  314   ALAPVRATTTRGLFLDSCHAHCQGGSAATWSGAQGPQVGNTK---MAKAVGDWFYERSTF  370

Query  1251  NLID  1262
               ID
Sbjct  371   QNID  374



>ref|XP_003518126.1| PREDICTED: protein notum homolog [Glycine max]
 gb|KHN00252.1| Protein notum like [Glycine soja]
Length=419

 Score =   261 bits (667),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 141/365 (39%), Positives = 202/365 (55%), Gaps = 29/365 (8%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
              ++  T+IQGAD KGAVCLDG+ P YH   G G  A +WLI+L+GGGWC +         
Sbjct  52    LMVDLTLIQGADSKGAVCLDGTVPGYHLDRGFGSGADSWLIHLEGGGWCNT---------  102

Query  393   SVENCSSRMGRELGSSFNMKPLI-FKGIFGMN-ENYTTFYKWNRVVVRYCDGGSFAGDVE  566
              + NC  R     GSS  M+  I F GI     E    F+ WNRV +RYCDG SF+GD E
Sbjct  103   -IRNCVYRKNTRRGSSKYMENQIPFTGILSNKPEENPDFFNWNRVKLRYCDGASFSGDSE  161

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               D   +L +RG +I+   ++ELM+KGM+ A   +  G SAGGL   +HCD F S FPK 
Sbjct  162   --DESAQLQFRGQKIWLAAMEELMSKGMQKADQALLSGCSAGGLASIIHCDEFRSLFPKS  219

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKCLSD   FL V D    +  + +F  VV L +  K+LP  C  ++ P  CF P+N+
Sbjct  220   SKVKCLSDGGFFLDVMDVSGGRTLRTLFGGVVQLQELQKNLPKSCLDQLDPTSCFFPQNM  279

Query  927   VQYVKSPLFIFHSAYDSFQVQNTFP------IDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
             +++V++PLF+ ++AYD +QVQ +        +  +   K N ++ S S M  LQDF+ Q+
Sbjct  280   IEHVETPLFLLNAAYDVWQVQASLAPPSADRLGSWNECKSNHANCSSSQMQFLQDFRNQM  339

Query  1086  ISALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADS----KSKSIESGFYNWFFDKHP  1247
             +S +     S+  G  + S F H    +  ++  FAD     + K I     +W+FD+  
Sbjct  340   LSDIKDFSSSSQTGLFINSCFAH--CQSERQETWFADDSPLIEDKPIAVAIGDWYFDREV  397

Query  1248  INLID  1262
             +  ID
Sbjct  398   VKAID  402



>ref|XP_010266381.1| PREDICTED: uncharacterized protein LOC104603915 isoform X2 [Nelumbo 
nucifera]
Length=399

 Score =   260 bits (665),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 145/375 (39%), Positives = 208/375 (55%), Gaps = 25/375 (7%)
 Frame = +3

Query  180   IPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWC  359
             I T IT     F +  T ++ +  KGAVCLDGSPPAYH   G G   +NWL++L+GGGWC
Sbjct  14    ICTLITMKANGFFVGITYVENSIAKGAVCLDGSPPAYHMDKGFGSGINNWLVHLEGGGWC  73

Query  360   MSNDAYSTLDLSVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRY  533
              +          V  C +      GSS  M K + F GI    EN+   FY WN++ VRY
Sbjct  74    SN----------VTICLAHKDTRHGSSKKMAKQIAFSGILSNKENFNPDFYNWNKIKVRY  123

Query  534   CDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVH  713
             CDG SF GDVE  DP   LY RG R++Q V+++L+ KGMK+AK  +  G S+GGL   +H
Sbjct  124   CDGSSFTGDVEAIDPANNLYLRGERVWQAVMEDLLEKGMKNAKYALLSGCSSGGLAAILH  183

Query  714   CDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKM  893
             CDRF    P   +VKCLSD+  F+  KD     + +A+++DVV  HQ  K+LPV CTS+ 
Sbjct  184   CDRFRELLPVDAKVKCLSDAGYFINAKDVSGKDHIQAIYNDVVTTHQSAKNLPVSCTSRT  243

Query  894   SPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSD  1052
              P  CF P+N+VQ + + LFI ++AYDS+Q++NT       P   +   K +  + S S 
Sbjct  244   EPSLCFFPQNVVQDMYTQLFILNAAYDSWQIKNTLAPGVADPHGHWHYCKLDIKNCSSSQ  303

Query  1053  MALLQDFKKQIISALPK--PSATKGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESG  1217
             +  +Q F+ + ++++ +   S+ KG  + S + H   S   +  + ADS       I   
Sbjct  304   LQTMQGFRSEFLNSVGELMSSSMKGMFINSCYAHC-QSEVQETWLRADSPVLDKTPIAKA  362

Query  1218  FYNWFFDKHPINLID  1262
               +W+ D+     ID
Sbjct  363   VGDWYNDRSDFKKID  377



>gb|EYU37448.1| hypothetical protein MIMGU_mgv1a007102mg [Erythranthe guttata]
Length=419

 Score =   261 bits (667),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 141/369 (38%), Positives = 207/369 (56%), Gaps = 26/369 (7%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             I  T +  A EKGAVCLDG+PPAY+ S G G+ A NWL+YL+GG WC S           
Sbjct  35    INITYVNSAVEKGAVCLDGTPPAYYHSVGFGDGADNWLVYLEGGAWCNS----------T  84

Query  399   ENCSSRMGRELGSSFNMKPLI--FKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEK  569
             E C  R+  +  +S + +P I    GIF +N+ +   FY WN+V++ YCDG SF GDVE+
Sbjct  85    ETCLERVKIKWLASTSTRPAIRYVSGIFTVNQTFNQAFYNWNKVIIVYCDGASFTGDVEE  144

Query  570   PDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGV  749
              DP T L+YRGARIF+ V+D+L+AKGMK+AKN +  G SAGGL   ++CDRF S  P   
Sbjct  145   VDPTTNLHYRGARIFRAVIDDLLAKGMKNAKNAVLTGSSAGGLATILNCDRFRSLVPHAT  204

Query  750   RVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLV  929
             RVKC+SDS  F+  K+   A   +A F+ V  LH   K+LP  C SKM+P  C  P+ ++
Sbjct  205   RVKCISDSGFFIHSKNMPGANEREAYFTQVAELHGMAKALPQSCASKMNPGLCLFPEYVI  264

Query  930   QYVKSPLFIFHSAYDSFQVQNTFP-------IDLYRAIKNGSSISPSDMALLQDFKKQII  1088
             + +++PLFI  S +D +Q++                   N +  + S + +++D +   +
Sbjct  265   KDMQTPLFILDSLFDLYQIKEMLAPFVGGCKEQWDDCTTNLTLCTSSQLQIMKDHRTAFL  324

Query  1089  SALPK-PSATKGFIVTSNFGHSFA--SNNYKKPMFADS--KSKSIESGFYNWFFDKHPIN  1253
               L +  S + G  V + F H+     + ++    A +    K+IE    +W++D+    
Sbjct  325   ETLQEVESPSLGIFVHTCFLHTHVLDKDGWRCSFVARNVLAKKTIEEAIDDWYYDRSSFQ  384

Query  1254  LIDP-NTVP  1277
              ID   TVP
Sbjct  385   QIDTYTTVP  393



>ref|XP_010536210.1| PREDICTED: uncharacterized protein LOC104811251 [Tarenaya hassleriana]
Length=391

 Score =   259 bits (663),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 145/369 (39%), Positives = 207/369 (56%), Gaps = 29/369 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T +  A  KGAVCLDGSPPAYHF  G G   +NW+++++GGGWC  ND        +
Sbjct  24    VPITYLDSAVAKGAVCLDGSPPAYHFDKGSGSGVNNWIVHMEGGGWC--ND--------I  73

Query  399   ENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
              +CS R     GSS F  K   F GI G  ++    FY WNR+ VRYCDG SF GDVE  
Sbjct  74    ASCSERKNTMKGSSKFMNKDFGFSGILGSKQSSNPDFYNWNRIKVRYCDGSSFTGDVEAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +P  KL++RGAR+++ V+D+LMAKGM  A+N I  G SAG L   +HCD+F +  P    
Sbjct  134   NPSNKLFFRGARVWRAVIDDLMAKGMNKAQNAILSGCSAGALAAILHCDQFRAILPSSAN  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ +S VVALH   K LP  CTS   P  CF P+ +  
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIESYYSKVVALHGSAKGLPESCTSTTKPELCFFPQYVAP  253

Query  933   YVKSPLFIFHSAYDSFQVQNTF---PIDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +  KN        + + +  +Q F+ Q+++
Sbjct  254   SMRTPLFVVNAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCTAAQLQTVQGFRDQMLN  313

Query  1092  ALP--KPSATKGFIVTSNFGH----SFAS-NNYKKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL   +  A+ G  + S   H    S AS +  + P   D+K   I     +WF D+ P 
Sbjct  314   ALAPVQSMASGGLFLDSCHAHCQGGSAASWSGSQGPSVDDTK---IAKAVGDWFNDRSPF  370

Query  1251  NLIDPNTVP  1277
               +D  T P
Sbjct  371   KKMDCPTYP  379



>ref|XP_006444639.1| hypothetical protein CICLE_v10020385mg [Citrus clementina]
 gb|ESR57879.1| hypothetical protein CICLE_v10020385mg [Citrus clementina]
 gb|KDO86753.1| hypothetical protein CISIN_1g014548mg [Citrus sinensis]
Length=410

 Score =   260 bits (665),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 139/365 (38%), Positives = 203/365 (56%), Gaps = 29/365 (8%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
              ++P T+IQGAD KGAVCLDG+ P YH   G G  A++WLI+L+GGGWC +         
Sbjct  45    LMVPLTLIQGADSKGAVCLDGTLPGYHIHRGSGSGANSWLIHLEGGGWCNT---------  95

Query  393   SVENCSSRMGRELGSS-FNMKPLIFKGIFGMN-ENYTTFYKWNRVVVRYCDGGSFAGDVE  566
              + NC  R     GS+ F  K L F GI     E    F+ WNRV +RYCDG SF+GD +
Sbjct  96    -IRNCVYRKTTRRGSAKFMEKQLPFTGILSNKAEENPDFFNWNRVKLRYCDGASFSGDSQ  154

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
                   +LY+RG RI+   + +LMAKGM++A   +  G SAGGL   +HCD F   FPK 
Sbjct  155   NEG--AQLYFRGQRIWLTAMQDLMAKGMQNADQALLSGCSAGGLASILHCDEFRDLFPKT  212

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKCLSD+ +FL   D       + +F+ VV+L +  K+LP+ CTS++ P  CF P+NL
Sbjct  213   TKVKCLSDAGMFLDAVDVSGGHTLRNMFAGVVSLQEVQKNLPITCTSQLDPTSCFFPQNL  272

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
             V  +K+P+F+ ++AYD++QVQ +       P   +   K + +  + S +   QDF+ Q+
Sbjct  273   VANIKTPMFLLNAAYDAWQVQASLAPPTADPHGYWSDCKSDHAHCNSSQIQFFQDFRNQM  332

Query  1086  ISALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADSK----SKSIESGFYNWFFDKHP  1247
             ++A+     S   G  + S F H    +  +   +AD       K I     +W+FD+  
Sbjct  333   LNAVEVFSKSNENGLFINSCFAH--CQSERQDTWYADDSPRIGDKGIAKSVGDWYFDRAA  390

Query  1248  INLID  1262
             +  ID
Sbjct  391   LKAID  395



>ref|XP_010266384.1| PREDICTED: uncharacterized protein LOC104603916 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010266385.1| PREDICTED: uncharacterized protein LOC104603916 isoform X2 [Nelumbo 
nucifera]
Length=391

 Score =   259 bits (662),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 139/362 (38%), Positives = 206/362 (57%), Gaps = 32/362 (9%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T I+ +  KGAVCLDGSPPAYH   G G   +NWL++++GGGWC +          V  C
Sbjct  28    TYIKSSVAKGAVCLDGSPPAYHLDKGFGSGINNWLVHIEGGGWCTN----------VTTC  77

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
               R    LGSS  M   + F GI   N+ +   FY WNR+ VRYCDG SF GD+EK DPV
Sbjct  78    LFRKNTHLGSSKKMVTEIAFSGILSNNKQFNPDFYNWNRIKVRYCDGASFTGDLEKVDPV  137

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L+YRGARI+  V+++L+ KGMK+A+  +  G SAGGL   +HCD F +    G +VKC
Sbjct  138   TNLHYRGARIWLAVIEDLLKKGMKNAEYALLSGCSAGGLASILHCDSFHALLSIGTKVKC  197

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             L+D+  F+ +K+    ++ K+ F+DVV  H   K+LP  CTS M P  CF P+ +V  ++
Sbjct  198   LADAGYFVNLKEISGREHIKSYFNDVVTTHGSVKNLPTYCTSTMKPSMCFFPQYIVHGIR  257

Query  942   SPLFIFHSAYDSFQVQNT----------FPIDLYRAIKNGSSISPSDMALLQDFKKQIIS  1091
             +PLF+ ++AYDS+Q++N           + +     IKN SSI    +  +Q F+ + +S
Sbjct  258   TPLFLLNAAYDSWQIRNILVPGVADPHGYWLSCKLDIKNCSSI---QLQTMQGFRMEFLS  314

Query  1092  A-LPKPSATKGFIVTSNFGHSFASNNYKKPMFADSK----SKSIESGFYNWFFDKHPINL  1256
             A L + S+++G  + S + H    +  ++    D      +  I     +W++D+     
Sbjct  315   ALLGQRSSSRGMFINSCYAH--CQSEMQETWLQDDSPVLDNTPIAKAVGDWYYDRRSFQK  372

Query  1257  ID  1262
             ID
Sbjct  373   ID  374



>emb|CDX87799.1| BnaC02g31500D [Brassica napus]
Length=391

 Score =   259 bits (662),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 133/364 (37%), Positives = 203/364 (56%), Gaps = 29/364 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T ++ A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            +
Sbjct  24    VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTD----------I  73

Query  399   ENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
               C  R     GSS F  K   F GI G  ++    FY WNR+ VRYCDG SF GD+E  
Sbjct  74    ATCVKRKTTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP  KL++RGAR+++ V+D+LMAKGM +A+N I  G SAG L   +HCD F S  P   +
Sbjct  134   DPTNKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDEFKSILPTTAK  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ +S VV+ H   KSLP  CTS M P  CF P+ +V+
Sbjct  194   VKCVSDAGFFIHGKDISGGSYIESYYSKVVSTHGSAKSLPASCTSSMKPELCFFPQYVVK  253

Query  933   YVKSPLFIFHSAYDSFQVQNTFP---IDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +  K+        + + +  +Q ++ Q+++
Sbjct  254   TMQTPLFVINAAFDSWQIKNVLAPTSVDKRKEWKDCKLDLKKCTAAQLQTVQGYRDQMLA  313

Query  1092  ALP--KPSATKGFIVTSNFGHSFAS-----NNYKKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL   + + T+G  + S   H         +  + P   ++K   +     +WF+++   
Sbjct  314   ALAPVRATTTRGLFLDSCHAHCQGGSAATWSGAQGPQVGNTK---MAKAVGDWFYERSTF  370

Query  1251  NLID  1262
               ID
Sbjct  371   QNID  374



>ref|XP_009128780.1| PREDICTED: uncharacterized protein LOC103853624 [Brassica rapa]
Length=391

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 133/364 (37%), Positives = 204/364 (56%), Gaps = 29/364 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T ++ A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            +
Sbjct  24    VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTD----------I  73

Query  399   ENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
               C  R     GSS F  K   F GI G  ++    FY WNR+ VRYCDG SF GD+E  
Sbjct  74    ATCVKRKTTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAV  133

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             DP  KL++RGAR+++ V+D+LMAKGM +A+N I  G SAG L   +HCD+F S  P   +
Sbjct  134   DPTNKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDQFKSILPTTAK  193

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKC+SD+  F+  KD     Y ++ +S VV+ H   KSLP  CTS M P  CF P+ +V+
Sbjct  194   VKCVSDAGFFIHGKDISGGSYIESYYSKVVSTHGSAKSLPASCTSSMKPELCFFPQYVVK  253

Query  933   YVKSPLFIFHSAYDSFQVQNTFP---IDLYRAIKNG----SSISPSDMALLQDFKKQIIS  1091
              +++PLF+ ++A+DS+Q++N      +D  +  K+        + + +  +Q ++ Q+++
Sbjct  254   TMQTPLFVINAAFDSWQIKNVLAPTSVDKRKEWKDCKLDLKKCTAAQLQTVQGYRDQMLA  313

Query  1092  ALP--KPSATKGFIVTSNFGHSFAS-----NNYKKPMFADSKSKSIESGFYNWFFDKHPI  1250
             AL   + + T+G  + S   H         +  + P   ++K   +     +WF+++   
Sbjct  314   ALAPVQATTTRGLFLDSCHAHCQGGSAATWSGAQGPQVGNTK---MAKAVGDWFYERSTF  370

Query  1251  NLID  1262
               ID
Sbjct  371   QNID  374



>gb|KDP28360.1| hypothetical protein JCGZ_14131 [Jatropha curcas]
Length=459

 Score =   261 bits (668),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 146/365 (40%), Positives = 202/365 (55%), Gaps = 29/365 (8%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
              ++  T++ GAD KGAVCLDG+ P YH   G G   ++WLI L+GGGWC +         
Sbjct  53    LMVDLTLVDGADSKGAVCLDGTLPGYHLHRGVGSGQNSWLIQLEGGGWCNT---------  103

Query  393   SVENCSSRMGRELGSS-FNMKPLIFKGIFGMN-ENYTTFYKWNRVVVRYCDGGSFAGDVE  566
              V NC  R     GSS F  K L F GI     E    F+ WNRV +RYCDG SF+GD +
Sbjct  104   -VRNCVYRKTTRRGSSKFMQKQLPFTGILSNKVEENPDFFNWNRVKLRYCDGASFSGDGQ  162

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               +   +LY+RG RI+ V ++ LMA+GM++A   +  G SAGGL   +HCD F   FP+ 
Sbjct  163   --NEAKQLYFRGQRIWSVAMENLMAEGMQNATQALLSGCSAGGLASILHCDEFRDLFPQT  220

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKCLSD+ LFL   D    +  + ++  VV+L    K+LP  CTS + P  CF P+NL
Sbjct  221   TKVKCLSDAGLFLDSVDISGNRTLRNMYEGVVSLQNVQKNLPSTCTSNLDPTSCFFPQNL  280

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
             +  +K+PLFI ++AYDS+QVQ +       P   ++  K N +  S S +  LQDF+ Q+
Sbjct  281   IANIKTPLFILNAAYDSWQVQESIVPPSADPQGSWKECKQNHAECSSSQIQFLQDFRNQM  340

Query  1086  ISALP--KPSATKGFIVTSNFGHSFASNNYKKPMFA-DS---KSKSIESGFYNWFFDKHP  1247
             + AL     SA  G  + S F H    +  +   FA DS   K K I     +W+FD+  
Sbjct  341   LEALSVFSMSAQNGLFINSCFAH--CQSERQDTWFAVDSPLLKKKRIAESVGDWYFDRVD  398

Query  1248  INLID  1262
             +  ID
Sbjct  399   VKAID  403



>ref|XP_009407792.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=431

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 148/404 (37%), Positives = 218/404 (54%), Gaps = 44/404 (11%)
 Frame = +3

Query  78    PESLRMAVSPRSNDWICLLI--FSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADE  251
             P + RM V  +S  W+C LI    L+  +Q    N              +P T+++GA  
Sbjct  29    PLNFRM-VGVKSGTWVCPLICLLYLLAFLQVEGDN--------------VPMTLLKGAVA  73

Query  252   KGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGREL  431
             +GAVCLDGSP AY+ + G G  A+NWL++++GGGWC +          V +C  R G   
Sbjct  74    EGAVCLDGSPAAYNLAPGSGSGANNWLLFVEGGGWCST----------VNDCVVRKGNFR  123

Query  432   GSSFNMKPLIFKGIFG-MNENYTTFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGAR  608
             GSS +M P+ F G+ G + +    FY WNRV +RYCDG SF GD+EK DP T LY+RGAR
Sbjct  124   GSSNHMPPVSFSGMLGGVQQRNPDFYNWNRVKIRYCDGASFTGDIEKVDPATGLYFRGAR  183

Query  609   IFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLI  788
             +++ ++ +L+A+GM  A+  +  G SAGGL   +HCD F S  P    VKC SD+  F+ 
Sbjct  184   VWRAIMKDLLARGMNKAQKALLGGCSAGGLTTILHCDSFRSLLPASATVKCFSDAGYFID  243

Query  789   VKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSA  968
              KD   A   ++ +SDVV LH    +LP  CTS++   +CF P N+V  +K+PLFI ++A
Sbjct  244   AKDISGADSIQSFYSDVVNLHGSANNLPSSCTSRLPANKCFFPLNVVATMKTPLFILNAA  303

Query  969   YDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALPKP--SATKG  1121
             YD +Q++N        P + +   K +    S   +  LQ F+   ++ALP    SAT  
Sbjct  304   YDQWQIKNILVPPSADPNNAWGDCKLDIKKCSSDQLQTLQGFRTTFLNALPGAGSSATGL  363

Query  1122  FIVTSNFGHSFASNNYKKPMFADSKSK----SIESGFYNWFFDK  1241
             FI++    H+   +      FA    +     I     +W+F +
Sbjct  364   FILSC---HTHCQSGDADTWFAADSPRIDNTPIGKAVGDWYFGR  404



>ref|XP_004512351.1| PREDICTED: protein notum homolog isoform X3 [Cicer arietinum]
Length=448

 Score =   261 bits (666),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 142/367 (39%), Positives = 210/367 (57%), Gaps = 35/367 (10%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P + +  A  KGAVCLDGSPPAYHF  G G   ++WL+  +GGGWC +          +
Sbjct  29    VPISYVHNAVIKGAVCLDGSPPAYHFDKGFGTGINSWLVQFEGGGWCNN----------I  78

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
               C  R    LGSS  M K + F GI      +   FY WNR+ VRYCDG SF GDVE  
Sbjct  79    TTCLGRKMNRLGSSKQMAKQIAFSGILNNRRLFNPDFYNWNRIKVRYCDGSSFTGDVEIV  138

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +PVTKL++RGAR+F  V++EL+AKGMK+AKN I  G SAGGL   +HCDRF +  P+G +
Sbjct  139   NPVTKLHFRGARVFNAVMEELLAKGMKNAKNAIISGCSAGGLTSILHCDRFRALLPQGAK  198

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKCLSD+  F+  +D    ++ +  FS VV  H    +LP  CTS+++P  CF P+ +V 
Sbjct  199   VKCLSDAGYFINARDVSGTQHIEQFFSQVVTTHGSANNLPRSCTSRLNPKLCFFPQYVVS  258

Query  933   YVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIIS  1091
              + +P+F  ++AYDS+Q++N        P   + + K + ++ S + + L+Q F+ + + 
Sbjct  259   QITTPIFFVNAAYDSWQIKNILAPGVADPHGHWHSCKMDINNCSSNQLDLMQGFRTEFLR  318

Query  1092  ALP--KPSATKGFIVTSNFGHS--------FASNNYKKPMFADSKSKSIESGFYNWFFDK  1241
             AL     S +KG  + S + H         F S++   P+ A +   +I     +WF+++
Sbjct  319   ALTVLGNSPSKGMFIDSCYAHCQTEMQETWFRSDS---PLLAKT---TIAKAVADWFYER  372

Query  1242  HPINLID  1262
                + ID
Sbjct  373   RLFHQID  379



>ref|XP_008227765.1| PREDICTED: protein notum homolog isoform X2 [Prunus mume]
Length=431

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 144/377 (38%), Positives = 210/377 (56%), Gaps = 30/377 (8%)
 Frame = +3

Query  180   IPTPI-TEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGW  356
             +PT   T+  L+ ++P T+I  A  KGAVCLDG+ P YH   G G  A++WLI L+GGGW
Sbjct  54    LPTQTQTQPPLNLMVPLTLIDSAASKGAVCLDGTLPGYHLHPGYGSGANSWLIQLEGGGW  113

Query  357   CMSNDAYSTLDLSVENCSSRMGRELGSS-FNMKPLIFKGIFGMN-ENYTTFYKWNRVVVR  530
             C S          + NC  R     GSS F  K L F GI     E    F+ WNRV +R
Sbjct  114   CNS----------IRNCVYRKTTRRGSSKFMEKQLPFTGILSNKAEENPDFFNWNRVKLR  163

Query  531   YCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFV  710
             YCDG SF+GD +  +   +L++RG RI+   ++ELM+KGM+ A   +  G SAGGL   +
Sbjct  164   YCDGASFSGDSQ--NEAAQLHFRGQRIWLAAMEELMSKGMQKADQALLSGCSAGGLASIL  221

Query  711   HCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSK  890
             HCD F   FP+  RVKCLSD+ +FL   D       K +++ VV+L +  K+LP  C   
Sbjct  222   HCDEFQDLFPETTRVKCLSDAGMFLDAIDVSGGHTLKNLYAGVVSLQEVQKNLPKTCIDH  281

Query  891   MSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIKNGSSI-SPS  1049
             + P  CF P+NLV  VK+P+F+ ++AYD++QVQ +       P  L+ A K+  ++ + S
Sbjct  282   LDPTSCFFPQNLVANVKTPMFLLNAAYDAWQVQASLAPPSADPRGLWGACKSNHALCNSS  341

Query  1050  DMALLQDFKKQIISALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADSK----SKSIE  1211
              +  LQDF+ Q+++A+     S   G  + S F H    +  +   FAD      +++I 
Sbjct  342   QIQFLQDFRNQMLNAVRDFSMSTKNGLFINSCFAH--CQSERQDTWFADDSPVLGNRAIA  399

Query  1212  SGFYNWFFDKHPINLID  1262
                 +W+FD+ P+  ID
Sbjct  400   LSVGDWYFDRLPVKAID  416



>ref|XP_008238012.1| PREDICTED: protein notum homolog isoform X2 [Prunus mume]
Length=400

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 140/359 (39%), Positives = 201/359 (56%), Gaps = 25/359 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T +  A  KGAVCLDGSPPAYH   G G   +NWL++++GGGWC +          V  C
Sbjct  30    TYVHSAIAKGAVCLDGSPPAYHHDKGFGSGINNWLVHIEGGGWCNN----------VTTC  79

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
               R    LGSS  M K + F GI    + +   FY WNR+ VRYCDG SF GDV   +P 
Sbjct  80    LGRKNTRLGSSKQMLKAIAFSGILSNRKMFNPDFYNWNRIKVRYCDGASFTGDVAAVNPA  139

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T LY+RGARIF+ V+++L+AKGM +A+N I  G SAGGL   +HCD F +  P G  VKC
Sbjct  140   TGLYFRGARIFRAVIEDLLAKGMGNAQNAILSGCSAGGLTSILHCDNFHALLPVGTNVKC  199

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             +SD+  F+ VKD   A++ +  FS VV  H   ++LP  CTSK+ P  CF P+ +   ++
Sbjct  200   VSDAGYFINVKDVSGAQHIEEFFSQVVETHGSARNLPPSCTSKLRPGLCFFPQYMASQIR  259

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             + +F  ++AYDS+Q++N        P   +   K +  + SP+ +  +QDF+ Q +SA+ 
Sbjct  260   TRIFFVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPTQLKAMQDFRVQFLSAIG  319

Query  1101  KPSAT--KGFIVTSNFGHSFASNNYKKPMFADS---KSKSIESGFYNWFFDKHPINLID  1262
               +    KG  + S + H   +   +  + ADS      +I     +WF+ + P   ID
Sbjct  320   GMTGCPLKGMFIDSCYAHC-QTELQETWLMADSPVLNKTTIAQAVGDWFYGRTPFQKID  377



>ref|XP_010235852.1| PREDICTED: protein notum homolog isoform X2 [Brachypodium distachyon]
Length=353

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 142/347 (41%), Positives = 199/347 (57%), Gaps = 25/347 (7%)
 Frame = +3

Query  261   VCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSS  440
             +CLDGS PAYH + G G    +WL++ +GGGWC +          V  C  R    LGSS
Sbjct  1     MCLDGSAPAYHLARGFGSGVDSWLVHFEGGGWCSN----------VTTCLERKNTRLGSS  50

Query  441   FNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIF  614
               M K + F GI     ++   FY WN+V VRYCDG SF GD E+ DP TKL+YRGAR++
Sbjct  51    KEMAKQVAFSGILSNTPDHNPDFYNWNKVRVRYCDGSSFTGDKEEVDPTTKLHYRGARVW  110

Query  615   QVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVK  794
             Q V+++L+AKGM  A+N +  G SAGGL   +HCDRF  R P    VKCLSD+  F+ VK
Sbjct  111   QAVMEDLLAKGMDRAENALISGCSAGGLTSVLHCDRFRDRMPVEANVKCLSDAGFFIDVK  170

Query  795   DPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYD  974
             D    K+    F+DVV  H   K+LP  CTSK+ P  C  P+N V+ +++PLFI ++AYD
Sbjct  171   DIAGEKHAADFFNDVVTTHGSAKNLPSSCTSKLPPGMCLFPQNEVKQIQTPLFILNAAYD  230

Query  975   SFQVQNTF----PIDLYRAIKNG-SSISPSDMALLQDFKKQIISALPK--PSATKGFIVT  1133
             S+QV+N          +R+ K+  +  S   +  LQ F+   + AL +   S+++G  + 
Sbjct  231   SWQVRNILVPGGSDPHWRSCKHDINQCSEKQLKTLQGFRDDFLKALEEQGSSSSRGLFIN  290

Query  1134  SNFGHSFASNNYKKPMFA-DS---KSKSIESGFYNWFFDKHPINLID  1262
             S F H    +  ++  FA DS    +K I +   +WF+D+ P   ID
Sbjct  291   SCFAH--CQSEIQEIWFAPDSPVLGNKKIANAIGDWFYDRSPFQEID  335



>ref|XP_006492439.1| PREDICTED: protein notum homolog [Citrus sinensis]
Length=454

 Score =   260 bits (665),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/365 (38%), Positives = 203/365 (56%), Gaps = 29/365 (8%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
              ++P T+IQGAD KGAVCLDG+ P YH   G G  A++WLI+L+GGGWC +         
Sbjct  45    LMVPLTLIQGADSKGAVCLDGTLPGYHIHRGSGSGANSWLIHLEGGGWCNT---------  95

Query  393   SVENCSSRMGRELGSS-FNMKPLIFKGIFGMN-ENYTTFYKWNRVVVRYCDGGSFAGDVE  566
              + NC  R     GS+ F  K L F GI     E    F+ WNRV +RYCDG SF+GD +
Sbjct  96    -IRNCVYRKTTRRGSAKFMEKQLPFTGILSNKAEENPDFFNWNRVKLRYCDGASFSGDSQ  154

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
                   +LY+RG RI+   + +LMAKGM++A   +  G SAGGL   +HCD F   FPK 
Sbjct  155   NEG--AQLYFRGQRIWLTAMQDLMAKGMQNADQALLSGCSAGGLASILHCDEFRDLFPKT  212

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKCLSD+ +FL   D       + +F+ VV+L +  K+LP+ CTS++ P  CF P+NL
Sbjct  213   TKVKCLSDAGMFLDAVDVSGGHTLRNMFAGVVSLQEVQKNLPITCTSQLDPTSCFFPQNL  272

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
             V  +K+P+F+ ++AYD++QVQ +       P   +   K + +  + S +   QDF+ Q+
Sbjct  273   VANIKTPMFLLNAAYDAWQVQASLAPPTADPHGYWSDCKSDHAHCNSSQIQFFQDFRNQM  332

Query  1086  ISALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADSK----SKSIESGFYNWFFDKHP  1247
             ++A+     S   G  + S F H    +  +   +AD       K I     +W+FD+  
Sbjct  333   LNAVEVFSKSNENGLFINSCFAH--CQSERQDTWYADDSPRIGDKGIAKSVGDWYFDRAA  390

Query  1248  INLID  1262
             +  ID
Sbjct  391   LKAID  395



>dbj|BAD94756.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
Length=285

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/262 (47%), Positives = 168/262 (64%), Gaps = 12/262 (5%)
 Frame = +3

Query  219  IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
            +P T +Q A  KGAVCLDGS PAYHF  G G   +NW+++++GGGWC            V
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  399  ENCSSRMGRELGSS-FNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
             +C+ R G   GSS F  K   F GI G  ++    FY WNR+ VRYCDG SF G+VE  
Sbjct  74   ASCNERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVEAV  133

Query  573  DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
            +P  KL++RGAR+++ VVD+LMAKGMK+A+N I  G SAG L   +HCD F +  P+   
Sbjct  134  NPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAS  193

Query  753  VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
            VKC+SD+  F+  KD     Y ++ +S VVALH   KSLPV CTSKM P  CF P+ +V 
Sbjct  194  VKCVSDAGYFIHGKDITGGSYIQSYYSKVVALHGSAKSLPVSCTSKMKPELCFFPQYVVP  253

Query  933  YVKSPLFIFHSAYDSFQVQNTF  998
             +++PLF+ ++A+DS+Q++N  
Sbjct  254  SMRTPLFVINAAFDSWQIKNVL  275



>gb|KDO40416.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
 gb|KDO40417.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=324

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/337 (40%), Positives = 197/337 (58%), Gaps = 35/337 (10%)
 Frame = +3

Query  99    VSPRSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGS  278
             V+ R   W+ LL+ +L++             +  D   F +  T ++ A  KGAVCLDGS
Sbjct  2     VAARMGQWLNLLVCALIL-------------LKAD--GFNVGITYVENAVVKGAVCLDGS  46

Query  279   PPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNM-KP  455
             PPAYHF  G G   +NWL++++GGGWC +          V  C  R    LGSS  M K 
Sbjct  47    PPAYHFDKGFGAGINNWLVHIEGGGWCNN----------VTTCLERKKTRLGSSKQMVKV  96

Query  456   LIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDE  632
             + F G+    + +   FY WNR+ VRYCDG SF GDVE  +P   L++RGAR+FQ V+++
Sbjct  97    VAFSGMLSNKQKFNPDFYNWNRIKVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMED  156

Query  633   LMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAK  812
             LMAKGMK+A+N +  G SAGGL   +HCD F + FP G +VKC +D+  F+  KD   A 
Sbjct  157   LMAKGMKNAQNAVLSGCSAGGLTSILHCDNFRALFPVGTKVKCFADAGYFINAKDVSGAS  216

Query  813   YFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQN  992
             + +  ++ VVA H   K LP  CTS++SP  CF P+ + + + +PLFI ++AYDS+Q++N
Sbjct  217   HIEQFYAQVVATHGSAKHLPASCTSRLSPGLCFFPQYMARQITTPLFIINAAYDSWQIKN  276

Query  993   TF------PIDLYRAIK-NGSSISPSDMALLQ-DFKK  1079
                     P   + + K + ++ SP+ +  +Q +F+K
Sbjct  277   ILAPGVADPHGTWHSCKLDINNCSPTQLQTMQSNFQK  313



>ref|XP_003561153.1| PREDICTED: protein notum homolog [Brachypodium distachyon]
Length=388

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/351 (39%), Positives = 200/351 (57%), Gaps = 23/351 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T++ GA EKGAVCLDGSPPAY    G G    NWL+YL+GGGWC +          +E+C
Sbjct  24    TLLAGATEKGAVCLDGSPPAYQLDRGFGSGRYNWLVYLEGGGWCDT----------IESC  73

Query  408   SSRMGRELGSSFNMKPLIFKGIFGMNENYTT-FYKWNRVVVRYCDGGSFAGDVEKPDP-V  581
             S      LGSS  ++ +   GIF  +    + FY WN+V +RYCDG SF+GD E  D   
Sbjct  74    SKHKKSGLGSSNLIEAVQLPGIFSNDHRQNSDFYNWNKVFIRYCDGASFSGDAEGEDQDG  133

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             TKL++RG RI++ V+DELM KG+ +AK  +  G S+GGL V +HCD F++RFP+ V VKC
Sbjct  134   TKLFFRGLRIWEAVIDELMEKGLANAKQALLAGCSSGGLAVLLHCDNFSARFPQTVPVKC  193

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
              SD+  FL +KD    ++ ++VFS VV L    K LP +C +K  P +CF P  +++ + 
Sbjct  194   FSDAGFFLDIKDISGERFIRSVFSGVVHLQNVRKVLPKDCLAKKEPTDCFFPAEVIKSIN  253

Query  942   SPLFIFHSAYDSFQVQN------TFPIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +P FI +S YDS+Q+QN      T P   +   K N    +P+ +  L  F++ +++ L 
Sbjct  254   TPTFILNSGYDSWQIQNVLVPDETSPEKSWLTCKANIRECNPTQIEALHGFRETLVNDLK  313

Query  1101  --KPSATKGFIVTSNFGHSFA--SNNYKKPMFADSKSKSIESGFYNWFFDK  1241
               +     G  + S F H       ++  P+    ++KSI     +W F +
Sbjct  314   VVQDKEDWGLFIDSCFTHCQTPFRISWDSPISPRLQNKSIAEAVGDWHFGR  364



>ref|XP_009408703.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=398

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 145/395 (37%), Positives = 210/395 (53%), Gaps = 39/395 (10%)
 Frame = +3

Query  99    VSPRSNDWICLLI--FSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLD  272
             V  +S  W+C LI    L+  +Q    N              +P T+++ A  +GAVCLD
Sbjct  2     VGVKSGTWVCPLICLLYLLAFLQVEGDN--------------VPMTLLKSAVAEGAVCLD  47

Query  273   GSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNMK  452
             GSP AY+ + G G  A+NWL++++GGGWC +          V +C  R G   GSS +M 
Sbjct  48    GSPAAYNLAPGSGSGANNWLLFVEGGGWCST----------VNDCVERKGNFRGSSNHMP  97

Query  453   PLIFKGIFG-MNENYTTFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVD  629
             P+ F G+ G + E    FY WNRV +RYCDG SF GD+EK DP T LY+RGAR+++ ++ 
Sbjct  98    PVSFSGMLGGVQERNPDFYNWNRVKIRYCDGASFTGDIEKVDPATGLYFRGARVWRAIMK  157

Query  630   ELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHA  809
             +L+A+GM  A+N I  G SAGGL   +HCD F S  P    VKC SD+  F+  KD   A
Sbjct  158   DLLARGMNKAQNAILGGCSAGGLTTILHCDSFRSLLPANATVKCFSDAGYFIDAKDISGA  217

Query  810   KYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQ  989
                 + +SDV+ LH    +LP  CTS +   +CF P+N+V  +K+PLFI ++AYD +Q++
Sbjct  218   DSILSFYSDVINLHASANNLPSSCTSSLPANKCFFPQNVVATMKTPLFILNAAYDQWQIR  277

Query  990   NTFPIDLYRAIKNGSS-------ISPSDMALLQDFKKQIISALPKP-SATKGFIVTSNFG  1145
             N    +     K            S   +  LQ F+   ++ALP   S++ G  + S   
Sbjct  278   NILVPNSADTNKTWGDCKLDIKKCSSDQLQTLQGFRTTFLNALPGAGSSSTGMFILSCHT  337

Query  1146  HSFASNNYKKPMFADS---KSKSIESGFYNWFFDK  1241
             H   S +      ADS    +  I     +W+F +
Sbjct  338   HC-QSGDADTWFAADSPRIDNTPIGKAVGDWYFGR  371



>ref|XP_008227764.1| PREDICTED: protein notum homolog isoform X1 [Prunus mume]
Length=475

 Score =   261 bits (666),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 144/377 (38%), Positives = 210/377 (56%), Gaps = 30/377 (8%)
 Frame = +3

Query  180   IPTPI-TEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGW  356
             +PT   T+  L+ ++P T+I  A  KGAVCLDG+ P YH   G G  A++WLI L+GGGW
Sbjct  54    LPTQTQTQPPLNLMVPLTLIDSAASKGAVCLDGTLPGYHLHPGYGSGANSWLIQLEGGGW  113

Query  357   CMSNDAYSTLDLSVENCSSRMGRELGSS-FNMKPLIFKGIFGMN-ENYTTFYKWNRVVVR  530
             C S          + NC  R     GSS F  K L F GI     E    F+ WNRV +R
Sbjct  114   CNS----------IRNCVYRKTTRRGSSKFMEKQLPFTGILSNKAEENPDFFNWNRVKLR  163

Query  531   YCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFV  710
             YCDG SF+GD +  +   +L++RG RI+   ++ELM+KGM+ A   +  G SAGGL   +
Sbjct  164   YCDGASFSGDSQ--NEAAQLHFRGQRIWLAAMEELMSKGMQKADQALLSGCSAGGLASIL  221

Query  711   HCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSK  890
             HCD F   FP+  RVKCLSD+ +FL   D       K +++ VV+L +  K+LP  C   
Sbjct  222   HCDEFQDLFPETTRVKCLSDAGMFLDAIDVSGGHTLKNLYAGVVSLQEVQKNLPKTCIDH  281

Query  891   MSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIKNGSSI-SPS  1049
             + P  CF P+NLV  VK+P+F+ ++AYD++QVQ +       P  L+ A K+  ++ + S
Sbjct  282   LDPTSCFFPQNLVANVKTPMFLLNAAYDAWQVQASLAPPSADPRGLWGACKSNHALCNSS  341

Query  1050  DMALLQDFKKQIISALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADSK----SKSIE  1211
              +  LQDF+ Q+++A+     S   G  + S F H    +  +   FAD      +++I 
Sbjct  342   QIQFLQDFRNQMLNAVRDFSMSTKNGLFINSCFAH--CQSERQDTWFADDSPVLGNRAIA  399

Query  1212  SGFYNWFFDKHPINLID  1262
                 +W+FD+ P+  ID
Sbjct  400   LSVGDWYFDRLPVKAID  416



>ref|XP_010266383.1| PREDICTED: uncharacterized protein LOC104603916 isoform X1 [Nelumbo 
nucifera]
Length=434

 Score =   259 bits (663),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 139/362 (38%), Positives = 206/362 (57%), Gaps = 32/362 (9%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T I+ +  KGAVCLDGSPPAYH   G G   +NWL++++GGGWC +          V  C
Sbjct  71    TYIKSSVAKGAVCLDGSPPAYHLDKGFGSGINNWLVHIEGGGWCTN----------VTTC  120

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
               R    LGSS  M   + F GI   N+ +   FY WNR+ VRYCDG SF GD+EK DPV
Sbjct  121   LFRKNTHLGSSKKMVTEIAFSGILSNNKQFNPDFYNWNRIKVRYCDGASFTGDLEKVDPV  180

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L+YRGARI+  V+++L+ KGMK+A+  +  G SAGGL   +HCD F +    G +VKC
Sbjct  181   TNLHYRGARIWLAVIEDLLKKGMKNAEYALLSGCSAGGLASILHCDSFHALLSIGTKVKC  240

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             L+D+  F+ +K+    ++ K+ F+DVV  H   K+LP  CTS M P  CF P+ +V  ++
Sbjct  241   LADAGYFVNLKEISGREHIKSYFNDVVTTHGSVKNLPTYCTSTMKPSMCFFPQYIVHGIR  300

Query  942   SPLFIFHSAYDSFQVQNT----------FPIDLYRAIKNGSSISPSDMALLQDFKKQIIS  1091
             +PLF+ ++AYDS+Q++N           + +     IKN SSI    +  +Q F+ + +S
Sbjct  301   TPLFLLNAAYDSWQIRNILVPGVADPHGYWLSCKLDIKNCSSI---QLQTMQGFRMEFLS  357

Query  1092  A-LPKPSATKGFIVTSNFGHSFASNNYKKPMFADSK----SKSIESGFYNWFFDKHPINL  1256
             A L + S+++G  + S + H    +  ++    D      +  I     +W++D+     
Sbjct  358   ALLGQRSSSRGMFINSCYAH--CQSEMQETWLQDDSPVLDNTPIAKAVGDWYYDRRSFQK  415

Query  1257  ID  1262
             ID
Sbjct  416   ID  417



>gb|KHG13045.1| Protein notum [Gossypium arboreum]
Length=460

 Score =   260 bits (664),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 142/365 (39%), Positives = 203/365 (56%), Gaps = 29/365 (8%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
              +IP T+IQGA  KGAVCLDG+PP YH   G G  +++WLI L+GGGWC +         
Sbjct  51    LMIPLTLIQGAASKGAVCLDGTPPGYHLDRGFGSGSNSWLIQLEGGGWCNT---------  101

Query  393   SVENCSSRMGRELGSS-FNMKPLIFKGIFGMN-ENYTTFYKWNRVVVRYCDGGSFAGDVE  566
              + +C  R     GSS F  K L F GI     E    FY WNRV +RYCDG SF+G  E
Sbjct  102   -IRSCVFRKTTRRGSSKFMEKRLNFTGILSNKAEENPDFYNWNRVKLRYCDGASFSG--E  158

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
               +   +LY+RG RI+   ++ELMAKGM++A+  +  G SAGGL   +HCD F   F   
Sbjct  159   GQNEANQLYFRGQRIWSTAMEELMAKGMRNAEQALLSGCSAGGLASILHCDEFKDLFLST  218

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNL  926
              +VKCLSD+ LFL   +       + ++  +V L    K+LP  CTS+M P  CF P+NL
Sbjct  219   TKVKCLSDAGLFLDATNMAGGHTLRDMYRGMVTLQGVQKNLPNTCTSQMDPTSCFFPQNL  278

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
             +  +++PLF+ ++AYD++QVQ +       P   +R  K + S  + S M  LQDF+ Q+
Sbjct  279   IANIQTPLFLLNAAYDAWQVQESLIPSSADPHGFWRDCKMDHSHCNSSQMLFLQDFRNQM  338

Query  1086  ISALPKPSAT--KGFIVTSNFGHSFASNNYKKPMFADSK----SKSIESGFYNWFFDKHP  1247
             +SA+   S +   G  + S F H    +  +   +A+      +K+I +   +WFFD+  
Sbjct  339   LSAINSFSMSNQNGLFINSCFAH--CQSERQDTWYANDSPRIGNKAIAASVGDWFFDRTA  396

Query  1248  INLID  1262
                ID
Sbjct  397   TKAID  401



>ref|XP_004512349.1| PREDICTED: protein notum homolog isoform X1 [Cicer arietinum]
 ref|XP_004512350.1| PREDICTED: protein notum homolog isoform X2 [Cicer arietinum]
Length=487

 Score =   261 bits (666),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 142/367 (39%), Positives = 210/367 (57%), Gaps = 35/367 (10%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P + +  A  KGAVCLDGSPPAYHF  G G   ++WL+  +GGGWC +          +
Sbjct  68    VPISYVHNAVIKGAVCLDGSPPAYHFDKGFGTGINSWLVQFEGGGWCNN----------I  117

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
               C  R    LGSS  M K + F GI      +   FY WNR+ VRYCDG SF GDVE  
Sbjct  118   TTCLGRKMNRLGSSKQMAKQIAFSGILNNRRLFNPDFYNWNRIKVRYCDGSSFTGDVEIV  177

Query  573   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
             +PVTKL++RGAR+F  V++EL+AKGMK+AKN I  G SAGGL   +HCDRF +  P+G +
Sbjct  178   NPVTKLHFRGARVFNAVMEELLAKGMKNAKNAIISGCSAGGLTSILHCDRFRALLPQGAK  237

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
             VKCLSD+  F+  +D    ++ +  FS VV  H    +LP  CTS+++P  CF P+ +V 
Sbjct  238   VKCLSDAGYFINARDVSGTQHIEQFFSQVVTTHGSANNLPRSCTSRLNPKLCFFPQYVVS  297

Query  933   YVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIIS  1091
              + +P+F  ++AYDS+Q++N        P   + + K + ++ S + + L+Q F+ + + 
Sbjct  298   QITTPIFFVNAAYDSWQIKNILAPGVADPHGHWHSCKMDINNCSSNQLDLMQGFRTEFLR  357

Query  1092  ALP--KPSATKGFIVTSNFGHS--------FASNNYKKPMFADSKSKSIESGFYNWFFDK  1241
             AL     S +KG  + S + H         F S++   P+ A +   +I     +WF+++
Sbjct  358   ALTVLGNSPSKGMFIDSCYAHCQTEMQETWFRSDS---PLLAKT---TIAKAVADWFYER  411

Query  1242  HPINLID  1262
                + ID
Sbjct  412   RLFHQID  418



>ref|XP_007221559.1| hypothetical protein PRUPE_ppa006038mg [Prunus persica]
 gb|EMJ22758.1| hypothetical protein PRUPE_ppa006038mg [Prunus persica]
Length=431

 Score =   258 bits (659),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 143/377 (38%), Positives = 209/377 (55%), Gaps = 30/377 (8%)
 Frame = +3

Query  180   IPTPI-TEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGW  356
             +PT   T+  L+ ++P T+I  A  KGAVCLDG+ P YH   G G  A++WLI L+GGGW
Sbjct  54    LPTQTQTQPPLNLMVPLTLIDSAASKGAVCLDGTLPGYHLHPGYGSGANSWLIQLEGGGW  113

Query  357   CMSNDAYSTLDLSVENCSSRMGRELGSS-FNMKPLIFKGIFGMN-ENYTTFYKWNRVVVR  530
             C S          + NC  R     GSS F  K L F GI     E    F+ WNRV +R
Sbjct  114   CNS----------IRNCVYRKTTRRGSSKFMEKQLPFTGILSNKAEENPDFFNWNRVKLR  163

Query  531   YCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFV  710
             YCDG SF+GD +  +   +L++RG RI+   ++ELM+KGM+ A   +  G SAGGL   +
Sbjct  164   YCDGASFSGDSQ--NEAAQLHFRGQRIWLAAMEELMSKGMQKADQALLSGCSAGGLASIL  221

Query  711   HCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSK  890
             HCD F   FP+  RVKCLSD+ +FL   D       K +++ VV+L +  K+LP  C   
Sbjct  222   HCDEFQDLFPETTRVKCLSDAGMFLDAIDVSGGHTLKNLYAGVVSLQEVEKNLPKTCIDH  281

Query  891   MSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIKNGSSI-SPS  1049
             + P  CF P+NLV  VK+P+F+ ++AYD++QVQ +       P  L+ A K+  ++ + S
Sbjct  282   LDPTSCFFPQNLVANVKTPMFLLNAAYDAWQVQASLAPPSADPRGLWGACKSNHALCNSS  341

Query  1050  DMALLQDFKKQIISALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADSK----SKSIE  1211
              +   QDF+ Q+++A+     S   G  + S F H    +  +   FAD      +++I 
Sbjct  342   QIQFFQDFRNQMLNAVRDFSVSTKNGLFINSCFAH--CQSERQDTWFADDSPVLGNRAIA  399

Query  1212  SGFYNWFFDKHPINLID  1262
                 +W+FD+ P+  ID
Sbjct  400   LSVGDWYFDRLPVKAID  416



>ref|XP_009612887.1| PREDICTED: uncharacterized protein LOC104106115 [Nicotiana tomentosiformis]
Length=389

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 144/358 (40%), Positives = 202/358 (56%), Gaps = 23/358 (6%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             TI+  A  +GAVCLDGSPPAYH   G G   S+W+I + GG WC S          + +C
Sbjct  31    TILNSAIAEGAVCLDGSPPAYHLDKGYGSGLSSWIIVMDGGAWCQS----------IPDC  80

Query  408   SSRMGRELGSSFNMKP-LIFKGIFGMN-ENYTTFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR   ELGSS  MK    F GI   N +N   FY WNRV V+YCDG SF GD+E+ DP 
Sbjct  81    LSRSTTELGSSKQMKNGSRFAGILYNNPQNNPDFYNWNRVRVKYCDGSSFTGDIEQVDPD  140

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
              KL++RGARIF+ ++ +L +KGM++A+N I  G SAGGL   ++CD+F S  P   +VKC
Sbjct  141   NKLFFRGARIFKAIMKDLWSKGMQNAENAILSGVSAGGLATILNCDKFKSLLPNDAKVKC  200

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             ++D+  F+  K        + ++  VV LH   K+LP  CTS M P  CF P+N+V YV+
Sbjct  201   VADAGFFINGKTISGTSDIQEMYQRVVTLHGSAKNLPPSCTSAMEPSLCFFPQNVVPYVE  260

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIKNG-SSISPSDMALLQDFKKQIISALP  1100
             +PLFI +S YDS+Q++N        P  ++   K   S+ + S   ++Q F  + + A  
Sbjct  261   TPLFIINSHYDSWQIENILVPKYLDPQHVWDDCKKQISNCTFSQRLIIQVFGVEFLKAFE  320

Query  1101  --KPSATKGFIVTSNFGHS--FASNNYKKPMFADSKSKSIESGFYNWFFDKHPINLID  1262
                PS T+G+ +TS   H    ++N +  P       K+I     +WFFD+     ID
Sbjct  321   GLDPSFTRGYFITSCHIHGAIMSTNFWLSPTSPRLLHKTIGEAVGDWFFDRAGFQYID  378



>ref|XP_002454426.1| hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
 gb|EES07402.1| hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
Length=398

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 144/364 (40%), Positives = 200/364 (55%), Gaps = 27/364 (7%)
 Frame = +3

Query  216   IIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLS  395
             ++  T ++ A  KGAVCLDGS PAYH + G G   ++WL++ +GGGWC +          
Sbjct  27    LVDITYVESAVAKGAVCLDGSAPAYHLARGSGSGENSWLVHFEGGGWCNN----------  76

Query  396   VENCSSRMGRELGSSFNMKPLI-FKGIFGMN-ENYTTFYKWNRVVVRYCDGGSFAGDVEK  569
             V  C  R    LGSS  M   I F GI     +    FY WN+V VRYCDG SF GDVE+
Sbjct  77    VTTCLQRKRTRLGSSKEMATQIAFSGILSDTPDGNPDFYNWNKVKVRYCDGSSFTGDVEE  136

Query  570   PDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGV  749
              DP TKL++RGARI+Q V+++L+AKGM  A+N +  G SAGGL   +HCDRF    P   
Sbjct  137   VDPTTKLHFRGARIWQAVMEDLLAKGMDKAENALISGCSAGGLTSILHCDRFHDLLPLAA  196

Query  750   RVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLV  929
             RVKCLSD+  F+  KD     Y  A F+DVV  H    +LP  CTS + P  CF PKN V
Sbjct  197   RVKCLSDAGFFINEKDVAGVGYIAAFFNDVVTTHGSANNLPPSCTSMLPPGMCFFPKNEV  256

Query  930   QYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIKNG-SSISPSDMALLQDFKKQII  1088
             + + +PLFI ++AYDS+QV+N        P   + + K+     S S + +LQ F+   +
Sbjct  257   KQIHTPLFILNAAYDSWQVRNILVPGVADPHGKWHSCKHDIGQCSASQLRVLQGFRGDFL  316

Query  1089  SALPKP--SATKGFIVTSNFGHSFASNNYKKPMFADSKSK----SIESGFYNWFFDKHPI  1250
               + +   S ++G  + S F H    +  ++  F+    K    +I +   +WFF +   
Sbjct  317   KEVSEQANSDSRGLFINSCFVH--CQSESQELWFSSDSPKLGNTTIANAVGDWFFGRSSF  374

Query  1251  NLID  1262
               ID
Sbjct  375   QKID  378



>ref|XP_004248530.1| PREDICTED: protein notum homolog isoform X2 [Solanum lycopersicum]
Length=413

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 145/375 (39%), Positives = 202/375 (54%), Gaps = 36/375 (10%)
 Frame = +3

Query  183   PTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCM  362
             PTP+       +I  T+IQGA  KGAVCLDG+ P YH   G G  A++WLI L+GGGWC 
Sbjct  45    PTPL-------LIALTLIQGAAAKGAVCLDGTLPGYHIHPGSGSGANSWLIQLEGGGWCN  97

Query  363   SNDAYSTLDLSVENCSSRMGRELGSS-FNMKPLIFKGIFGMN-ENYTTFYKWNRVVVRYC  536
             +          V NC  R     GSS F  K + F GI     E    F+ WNRV VRYC
Sbjct  98    T----------VRNCVFRKTTRRGSSKFMEKQIQFTGILSNKAEENPDFFNWNRVKVRYC  147

Query  537   DGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHC  716
             DG SF GD E  D   +L +RG RI++  + ELM+KGM++A+  +  G SAGGL   +HC
Sbjct  148   DGASFTGDSENKD--AQLQFRGQRIWEAAMAELMSKGMQNAQQALLSGCSAGGLASILHC  205

Query  717   DRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMS  896
             D F + FP   +VKCLSD+ LF+   D       + VF  VV++    K LP  CT+K+ 
Sbjct  206   DEFRTLFPSSTKVKCLSDAGLFMDATDVSGGHALRDVFKGVVSVQGLQKMLPSNCTNKLD  265

Query  897   PFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIKNG-SSISPSDM  1055
             P  CF P+NL+  +K+PLF+ ++AYD +Q+Q++       P  L+   K      S S +
Sbjct  266   PTSCFFPQNLIGNIKTPLFLLNAAYDFWQIQSSLAPPVADPHGLWHDCKRDYKKCSASQI  325

Query  1056  ALLQDFKKQIISALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADSK----SKSIESG  1217
               LQDF+  +++A+     S   G  + S F H    +  +   FAD      +K+I   
Sbjct  326   QFLQDFRNDMLNAIKGFGASTQSGLFINSCFAH--CQSERQDTWFADDSPLIDNKTIALA  383

Query  1218  FYNWFFDKHPINLID  1262
               +W+FD+  +  ID
Sbjct  384   VGDWYFDREGMKAID  398



>ref|XP_008667853.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF86109.1| unknown [Zea mays]
 gb|ACG43470.1| pectinacetylesterase precursor [Zea mays]
 tpg|DAA36174.1| TPA: pectinacetylesterase isoform 1 [Zea mays]
 tpg|DAA36175.1| TPA: pectinacetylesterase isoform 2 [Zea mays]
Length=397

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 143/363 (39%), Positives = 198/363 (55%), Gaps = 28/363 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +    ++ A  KGAVCLDGSPP YHFS G G  A+NW+++++GGGWC + D         
Sbjct  33    VEMVFLKAAVAKGAVCLDGSPPVYHFSPGSGSGANNWVVHMEGGGWCRNPD---------  83

Query  399   ENCSSRMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPD  575
               C+ R G   GSS  MKPL F GI G N+     FY WNRV +RYCDG SF GDVE  D
Sbjct  84    -ECAVRKGNFRGSSKFMKPLSFSGILGGNQKSNPDFYNWNRVKIRYCDGSSFTGDVEAVD  142

Query  576   PVTKLYYRGARIFQVVVDELMA-KGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
                 L YRG R+++ V+D+L+  +GM  A+N +  G SAGGL   +HCDRF   FP   +
Sbjct  143   TAKDLRYRGFRVWRAVIDDLLTVRGMSKAQNALLSGCSAGGLAAILHCDRFHDLFPAKTK  202

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTS--KMSPFECFQPKNL  926
             VKC SD+  F   KD     Y ++++  VV LH   K+LP  CTS  K SP  C  P+ +
Sbjct  203   VKCFSDAGYFFDGKDISGNFYARSIYKSVVNLHGSAKNLPASCTSKPKQSPELCMFPQYV  262

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
             V  +++PLFI ++AYDS+QV+N        P   +   K +  S S S +  LQ+F+   
Sbjct  263   VPTMRTPLFILNAAYDSWQVKNVLAPSPADPKKTWAQCKLDIKSCSASQLTTLQNFRTDF  322

Query  1086  ISALPKPSATKGFIVTSNFGHSFASNNYKKPMFADS----KSKSIESGFYNWFFDKHPIN  1253
             ++ALPK  +   FI + N   +   +  +    AD         I     +W++D+    
Sbjct  323   LAALPKTQSVGMFIDSCN---AHCQSGSQDTWLADGSPTVNKTQIGKAVGDWYYDREVPR  379

Query  1254  LID  1262
              ID
Sbjct  380   QID  382



>ref|XP_010544918.1| PREDICTED: protein notum homolog isoform X2 [Tarenaya hassleriana]
Length=421

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 144/363 (40%), Positives = 200/363 (55%), Gaps = 29/363 (8%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T+IQGAD KGAVCLDG+ P YH   G G  A NWLI L+GGGWC +           
Sbjct  58    VPLTLIQGADSKGAVCLDGTLPGYHLHLGSGSGAKNWLIQLEGGGWCNNR----------  107

Query  399   ENCSSRMGRELGSSFNM-KPLIFKGIFG--MNENYTTFYKWNRVVVRYCDGGSFAGDVEK  569
              +C  R     GSS  M K L F GI     +EN   F+ WNRV +RYCDG SF GD + 
Sbjct  108   RSCVFRKTTRRGSSKYMEKVLPFTGILSDKPDEN-PDFFNWNRVKLRYCDGASFTGDSQ-  165

Query  570   PDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGV  749
              D  + LYYRG RI+QV ++EL++KGM+ A+  +  G SAGGL   +HCD F    P   
Sbjct  166   -DESSGLYYRGQRIWQVAMEELLSKGMQKAEQALLSGCSAGGLASILHCDEFRELLPSTT  224

Query  750   RVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLV  929
             +VKCLSD+ +FL   D    +  + +F  VV L    K LP  CT+ + P  CF P+NL+
Sbjct  225   KVKCLSDAGMFLDAVDVSGGRSLRNMFQGVVTLQNLEKELPSICTNHLDPTSCFFPQNLI  284

Query  930   QYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQII  1088
               +K+P+F+ ++AYD++QVQ +       P  L++A K + S  + S +   QDF+ Q++
Sbjct  285   SGIKTPMFLLNAAYDAWQVQESLAPPSADPGGLWKACKSDHSHCNSSQIQFFQDFRNQMV  344

Query  1089  SALP--KPSATKGFIVTSNFGHSFASNNYKKPMFADSKS---KSIESGFYNWFFDKHPIN  1253
             + +     SA  G  + S F H   S        ADS S   K +     +W++D+  + 
Sbjct  345   NVVKSFSESAENGLFINSCFAHC-QSERQDTWFAADSPSMEGKRVAESVGDWYYDRATVK  403

Query  1254  LID  1262
              ID
Sbjct  404   AID  406



>tpg|DAA36173.1| TPA: hypothetical protein ZEAMMB73_990456 [Zea mays]
Length=370

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/318 (43%), Positives = 184/318 (58%), Gaps = 21/318 (7%)
 Frame = +3

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +    ++ A  KGAVCLDGSPP YHFS G G  A+NW+++++GGGWC + D         
Sbjct  33    VEMVFLKAAVAKGAVCLDGSPPVYHFSPGSGSGANNWVVHMEGGGWCRNPD---------  83

Query  399   ENCSSRMGRELGSSFNMKPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPD  575
               C+ R G   GSS  MKPL F GI G N+     FY WNRV +RYCDG SF GDVE  D
Sbjct  84    -ECAVRKGNFRGSSKFMKPLSFSGILGGNQKSNPDFYNWNRVKIRYCDGSSFTGDVEAVD  142

Query  576   PVTKLYYRGARIFQVVVDELMA-KGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
                 L YRG R+++ V+D+L+  +GM  A+N +  G SAGGL   +HCDRF   FP   +
Sbjct  143   TAKDLRYRGFRVWRAVIDDLLTVRGMSKAQNALLSGCSAGGLAAILHCDRFHDLFPAKTK  202

Query  753   VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTS--KMSPFECFQPKNL  926
             VKC SD+  F   KD     Y ++++  VV LH   K+LP  CTS  K SP  C  P+ +
Sbjct  203   VKCFSDAGYFFDGKDISGNFYARSIYKSVVNLHGSAKNLPASCTSKPKQSPELCMFPQYV  262

Query  927   VQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQI  1085
             V  +++PLFI ++AYDS+QV+N        P   +   K +  S S S +  LQ+F+   
Sbjct  263   VPTMRTPLFILNAAYDSWQVKNVLAPSPADPKKTWAQCKLDIKSCSASQLTTLQNFRTDF  322

Query  1086  ISALPKPSATKGFIVTSN  1139
             ++ALPK  +   FI + N
Sbjct  323   LAALPKTQSVGMFIDSCN  340



>ref|XP_009407790.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=431

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/384 (37%), Positives = 213/384 (55%), Gaps = 36/384 (9%)
 Frame = +3

Query  45    LIS*LTLEANNPESLRMAVSPRSNDWICLLI--FSLVISVQYANVNPIPTPITEDYLDFI  218
             LI+   + + +P + RM V  +S  W+C LI    L+  +Q    N              
Sbjct  18    LIAKRFVRSASPLNFRM-VGVKSGTWVCPLICLLYLLAFLQVEGDN--------------  62

Query  219   IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
             +P T+++GA  +GAVCLDGS PAY+ + G G  A+NWL++++GGGWC +          V
Sbjct  63    VPMTVLKGAVAEGAVCLDGSAPAYNLAPGSGSGANNWLVFVEGGGWCST----------V  112

Query  399   ENCSSRMGRELGSSFNMKPLIFKGIFG-MNENYTTFYKWNRVVVRYCDGGSFAGDVEKPD  575
             E C +R     GSS +M P  F G+ G + ++   FY WNRV +RYCDG SF GD+EK D
Sbjct  113   EECLARKNTFRGSSDHMPPQSFSGMLGGVQQSNPDFYNWNRVKIRYCDGASFTGDIEKVD  172

Query  576   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRV  755
             P T L++RGAR+++ ++ +L+AKGM  A+  +  G SAGGL   +HCD F S  P    V
Sbjct  173   PATGLHFRGARVWRAIMKDLLAKGMNKAQKALLGGCSAGGLTTILHCDNFRSLLPATATV  232

Query  756   KCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  935
             KC SD+  F+  KD   A   ++ + DVV LH    +LP  CTS++   +CF P+N+V  
Sbjct  233   KCFSDAGYFIDAKDISGADAIQSFYGDVVKLHGSANNLPSSCTSRLPANKCFFPQNVVAT  292

Query  936   VKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISA  1094
             +K+PLFI ++AYD +Q+ +        P + +   K +    S   +  LQ F+   ++A
Sbjct  293   LKTPLFILNAAYDQWQIDHILVPSSADPKNTWGDCKLDIKKCSSDQLQKLQGFRTTFLNA  352

Query  1095  LPKP-SATKGFIVTSNFGHSFASN  1163
             LP   S++ G  + S   H  + +
Sbjct  353   LPGAGSSSTGLFILSCHTHCLSGD  376



>ref|XP_006432878.1| hypothetical protein CICLE_v100013712mg, partial [Citrus clementina]
 gb|ESR46118.1| hypothetical protein CICLE_v100013712mg, partial [Citrus clementina]
Length=276

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/297 (42%), Positives = 177/297 (60%), Gaps = 27/297 (9%)
 Frame = +3

Query  99   VSPRSNDWICLLIFSLVISVQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGS  278
            V+ R   W+ LL+ +L++             +  D   F +  T ++ A  KGAVCLDGS
Sbjct  2    VAARMGQWLNLLVCALIL-------------LKAD--GFNVGITYVENAVVKGAVCLDGS  46

Query  279  PPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNM-KP  455
            PPAYHF  G G   +NWL++++GGGWC +          V  C  R    LGSS  M K 
Sbjct  47   PPAYHFDKGFGAGINNWLVHIEGGGWCNN----------VTTCLERKKTRLGSSKQMVKV  96

Query  456  LIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDE  632
            + F G+    + +   FY WNR+ VRYCDG SF GDVE  +P   L++RGAR+FQ V+++
Sbjct  97   VAFSGMLSNKQKFNPDFYNWNRIKVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMED  156

Query  633  LMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAK  812
            LMAKGMK+A+N +  G SAGGL   +HCD F + FP G +VKC +D+  F+  KD   A 
Sbjct  157  LMAKGMKNAQNAVLSGCSAGGLTSILHCDNFRALFPVGTKVKCFADAGYFINAKDVSGAS  216

Query  813  YFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQ  983
            + +  ++ VVA H   K LP  CTS++SP  CF P+ + + + +PLFI ++AYDS+Q
Sbjct  217  HIEQFYAQVVATHGSAKHLPASCTSRLSPGLCFFPQYMARQITTPLFIINAAYDSWQ  273



>ref|XP_004509524.1| PREDICTED: uncharacterized protein LOC101493258 isoform X3 [Cicer 
arietinum]
Length=303

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/259 (48%), Positives = 163/259 (63%), Gaps = 12/259 (5%)
 Frame = +3

Query  219  IPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSV  398
            +P T +Q A  KGAVCLDGSPPAYHF  G G    NW+++ +GGGWC +          V
Sbjct  28   VPITYVQSAVAKGAVCLDGSPPAYHFDKGVGAGIDNWIVHFEGGGWCNN----------V  77

Query  399  ENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKP  572
              C  R    LGSS  M K L F G F   + +   FY WNR+ VRYCDG SF GDVE  
Sbjct  78   STCLDRRDTRLGSSKKMDKQLSFSGFFSNGKKFNPDFYDWNRIKVRYCDGASFTGDVEAV  137

Query  573  DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVR  752
            DP T L++RGARIF  V+++L+AKGMK+AKN I  G SAGGL   + CDRF +  P   +
Sbjct  138  DPATNLHFRGARIFVAVIEDLLAKGMKNAKNAILSGCSAGGLTSILQCDRFKTLLPAAAK  197

Query  753  VKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  932
            VKC+SD+  F+ VK    A++ +  +S VV  H   K+LP  CTS++SP  CF P+N+  
Sbjct  198  VKCVSDAGYFINVKAVSGAQHIEQFYSQVVQTHGSAKNLPQSCTSRLSPGLCFFPQNVAA  257

Query  933  YVKSPLFIFHSAYDSFQVQ  989
             +K+P+F  ++AYDS+QV+
Sbjct  258  QIKTPIFFVNAAYDSWQVR  276



>gb|EMT14315.1| hypothetical protein F775_08483 [Aegilops tauschii]
Length=400

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 145/362 (40%), Positives = 199/362 (55%), Gaps = 31/362 (9%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
             + +  T ++ A  KGAVCLDGSPPAYH + G G  AS+WL++ +GGGWC +         
Sbjct  26    YFVDITYVESAVAKGAVCLDGSPPAYHLARGSGSGASSWLVHFEGGGWCNN---------  76

Query  393   SVENCSSRMGRELGSSFNM-KPLIFKGIFGMNENYT--TFYKWNRVVVRYCDGGSFAGDV  563
              V  C  R    LGSS  M K + F GI      Y    FY WN+V VRYCDG SF G+ 
Sbjct  77    -VTTCLQRSHTRLGSSKEMAKQVAFSGILSNAPEYNPVDFYNWNKVRVRYCDGSSFTGNK  135

Query  564   EKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPK  743
             E+ DP T L+YRGAR++Q V+++L+AKGM  A+N +  G SAGGL   +HCDRF    P 
Sbjct  136   EEVDPRTNLHYRGARVWQAVMEDLLAKGMNKAENALISGCSAGGLTSILHCDRFHRLLPA  195

Query  744   GVRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKN  923
                VKCLSD+  F+ VKD     +  A FSDVV  H   K+LP  CTSK+    C  P+N
Sbjct  196   AANVKCLSDAGFFINVKDIAGVNHAAAFFSDVVKTHGSVKNLPSLCTSKLPAGMCLFPQN  255

Query  924   LVQYVKSPLFIFHSAYDSFQVQNTF----PIDLYRAIKNG-SSISPSDMALLQD-----F  1073
              V+ +++PLFI ++AYDS+QV+N          +R+ K+     S   + +LQD     F
Sbjct  256   EVKQIQTPLFILNAAYDSWQVRNILVPGGSDPRWRSCKHDIKQCSAKQLKILQDGADAGF  315

Query  1074  KKQIISALPKP--SATKGFIVTSNFGHSFASNNYKKPMFADSK----SKSIESGFYNWFF  1235
             +   + A+     S T+G  + S F H    +  ++  FA        K I S   +WF+
Sbjct  316   RDHFLEAIEAQGDSPTRGLFINSCFAH--CQSEIQEIWFAPGSPVLGDKRIASAVGDWFY  373

Query  1236  DK  1241
              +
Sbjct  374   GR  375



>ref|XP_006385136.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62933.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=391

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/318 (41%), Positives = 197/318 (62%), Gaps = 21/318 (7%)
 Frame = +3

Query  228   TIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENC  407
             T ++ A  KGAVCLDGSPPAYH+  G G   ++WLI+ +GGGWC +          V +C
Sbjct  33    TYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNN----------VTSC  82

Query  408   SSRMGRELGSSFNM-KPLIFKGIFGMNENYT-TFYKWNRVVVRYCDGGSFAGDVEKPDPV  581
              SR    LGSS  M + + F GI      +   FY WNRV +RYCDG SF GDV+  +P 
Sbjct  83    LSRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPA  142

Query  582   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKC  761
             T L++RGARI+  V+++L+ KG+K+A+N +  G SAGGL   +HCD F +    G +VKC
Sbjct  143   TNLHFRGARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALLRMGTKVKC  202

Query  762   LSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  941
             LSD+  F+ VKD   A + +  F+++V LH   K+LP+ CTS + P  CF P+ +   V+
Sbjct  203   LSDAGYFIKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSVLKPSFCFFPQYVAPQVR  262

Query  942   SPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALP  1100
             +PLFI ++AYDS+Q++N        P+ ++++ K + ++ SP  +  +QDF+ Q ++AL 
Sbjct  263   TPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALN  322

Query  1101  KP--SATKGFIVTSNFGH  1148
             K   S+++G  + S + H
Sbjct  323   KSTNSSSRGLYIDSCYAH  340



>gb|ADE77373.1| unknown [Picea sitchensis]
Length=411

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/364 (38%), Positives = 203/364 (56%), Gaps = 24/364 (7%)
 Frame = +3

Query  213   FIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDL  392
              ++  T++  A  KGAVCLDGSPPAYH   G G  A+ WL++++GGGWC     Y  L  
Sbjct  45    LLVNITVLNNAVFKGAVCLDGSPPAYHLHRGFGSGANRWLVHMEGGGWC-----YDML--  97

Query  393   SVENCSSRMGRELGSSFNMKPLI-FKGIFG-MNENYTTFYKWNRVVVRYCDGGSFAGDVE  566
                +CS R    LGSS  M   I F GI   +      FY WNRV+VRYCDG SF GDVE
Sbjct  98    ---SCSGRAASPLGSSLYMGDTIAFTGILSDVRSQNPDFYSWNRVMVRYCDGSSFTGDVE  154

Query  567   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKG  746
             + DP+TK+++RG RI+Q V+++L+AKGM  A+  +  G SAGG+  F+HCDRF    P  
Sbjct  155   EVDPITKVHFRGQRIWQAVMEDLLAKGMYKARQALLTGCSAGGVTTFIHCDRFNDLLPGS  214

Query  747   VRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQPNKSLPVECTSKMSPFE-CFQPKN  923
              +VKC+ D+  F+   D       + +   +V LH  +K LPV CTS+M P   CF P+ 
Sbjct  215   AKVKCMPDAGFFIDSNDISGGNQQRFLVDQMVTLHGSSKHLPVACTSEMIPSSLCFFPQY  274

Query  924   LVQYVKSPLFIFHSAYDSFQVQNTF------PIDLYRAIK-NGSSISPSDMALLQDFKKQ  1082
             L+Q++++PL + +SAYD  Q++         P + +R  K N +  +P  + ++++F   
Sbjct  275   LLQWIRTPLLVVNSAYDPLQIRFILVPAAADPNNYWRNCKMNITRCAPWQLRVMEEFTDY  334

Query  1083  IISALP--KPSATKGFIVTSNFGHSFASNN--YKKPMFADSKSKSIESGFYNWFFDKHPI  1250
             +ISAL     S T G  + S + H   +    +  P      SK+I     +W+F +  +
Sbjct  335   MISALTPVSNSRTGGLFINSCYAHCQTNVQALWHSPSSPRLYSKTIAEAAGDWYFGRSVV  394

Query  1251  NLID  1262
               ID
Sbjct  395   KYID  398



>ref|XP_004304922.1| PREDICTED: protein notum homolog [Fragaria vesca subsp. vesca]
Length=399

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 148/401 (37%), Positives = 225/401 (56%), Gaps = 36/401 (9%)
 Frame = +3

Query  120   WICLLIFSLVIS-----VQYANVNPIPTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPP  284
             W+C++I +   +     VQY++     T I  + L  ++  T+IQGAD KGAVCLDG+ P
Sbjct  6     WVCIVIATFFSNWVDGFVQYSHEGDPKTEIINNTL--MVSLTLIQGADAKGAVCLDGTLP  63

Query  285   AYHFSSGKGEDASNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSSFNMKPLI-  461
             AY+F  G G    NWL++ QGGGWC +          + +C +R   +LGSS  M P   
Sbjct  64    AYYFHRGHGSGKKNWLVHFQGGGWCGN----------ITDCVARKKTQLGSSNLMLPETG  113

Query  462   FKGIFGMN-ENYTTFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELM  638
             F GI     E    F+ WNRV++  CDG SF+GD E  +   +L +RG RI+   +++LM
Sbjct  114   FTGILSYKAEENPDFFNWNRVMLPSCDGASFSGDSENKE--AQLQFRGHRIWLAAMEKLM  171

Query  639   AKGMKDAKNVIFVGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYF  818
             + GM+ AK  +  G SAGGL   +HCD+F   F +  +VKCLSD+  FL   D      F
Sbjct  172   SLGMRHAKKALISGCSAGGLTSILHCDKFRGLFRRSTKVKCLSDAGFFLDSVDITGEPTF  231

Query  819   KAVFSDVVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF  998
             +  FS+VV+L    ++LP  CTS + P  CF P+NL+  +K+PLFI +SAYDSFQ Q + 
Sbjct  232   RNFFSNVVSLQAVKENLPHFCTSHLDPTSCFFPQNLLAGIKTPLFILNSAYDSFQFQFSL  291

Query  999   ------PIDLYRAIK-NGSSISPSDMALLQDFKKQIISALPKPSATK--GFIVTSNFGHS  1151
                   P  L+ + K N ++ SPS + +LQ F+ +++ AL   S +K  G  + S + H 
Sbjct  292   VPASADPNGLWNSCKLNVTNCSPSQLHILQGFRSRMLHALKPFSKSKQNGMFINSCYAH-  350

Query  1152  FASNNYKKPMFADSKS----KSIESGFYNWFFDKHPINLID  1262
                + ++   +A + +    K+I     +W+FD+  + ++D
Sbjct  351   -CQSQFQLTWYAANSTIIGNKTISQSIGDWYFDRAEVKVVD  390



>ref|XP_010045528.1| PREDICTED: protein notum homolog [Eucalyptus grandis]
 gb|KCW88626.1| hypothetical protein EUGRSUZ_A00994 [Eucalyptus grandis]
Length=423

 Score =   256 bits (655),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 147/389 (38%), Positives = 207/389 (53%), Gaps = 37/389 (10%)
 Frame = +3

Query  144   LVISVQYANVNPI-PTPITEDYLDFIIPKTIIQGADEKGAVCLDGSPPAYHFSSGKGEDA  320
             L+  V+   V+P  P P+       ++  T+I+GA  KGAVCLDG+ P YH   G G  A
Sbjct  40    LLSYVESDAVSPAAPQPV-------LVGLTLIEGAAAKGAVCLDGTLPGYHLHPGSGSGA  92

Query  321   SNWLIYLQGGGWCMSNDAYSTLDLSVENCSSRMGRELGSS-FNMKPLIFKGIFGMN-ENY  494
             ++WL++L+GGGWC +          V NC  R     GSS F  K L F GI     E  
Sbjct  93    NSWLVHLEGGGWCNT----------VRNCVYRKTTRRGSSKFMEKQLPFTGILSNKPEEN  142

Query  495   TTFYKWNRVVVRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIF  674
               F+ WNRV +RYCDG SF G  +  D   KLY+RG +I+   +DELM+KGMK+A   + 
Sbjct  143   PDFFNWNRVKIRYCDGASFNGAGQ--DEAAKLYFRGQQIWLAAIDELMSKGMKNADQALL  200

Query  675   VGGSAGGLGVFVHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPEHAKYFKAVFSDVVALHQ  854
              G SAGGL   +HCD F S FPK  +VKCLSD+ +FL   D    +  + +F+ VV L  
Sbjct  201   SGCSAGGLASILHCDEFGSLFPKTTKVKCLSDAGMFLDAVDVSGGRALRNMFNGVVTLQD  260

Query  855   PNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF------PIDLYR  1016
               ++LP  CTS + P  CF P+NLV  +K+PLF+ ++AYD++QVQ +       P   + 
Sbjct  261   VKENLPSTCTSHLDPTSCFFPQNLVANIKTPLFLLNAAYDAWQVQESLAPRSADPQGTWS  320

Query  1017  AIK-NGSSISPSDMALLQDFKKQIISALP--KPSATKGFIVTSNFGHSFASNNYKKPMFA  1187
               K N    + S +   QDF+ Q++ A+     S   G  + S F H    +  +   FA
Sbjct  321   ECKMNHERCNSSQIEFFQDFRNQMLEAVHTFSRSDQNGLFINSCFAH--CQSERQDTWFA  378

Query  1188  DSK----SKSIESGFYNWFFDKHPINLID  1262
                    +K +     +WFFD+  +  ID
Sbjct  379   SDSPLIGNKGVAESVGDWFFDRETVKAID  407



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3768748596378