BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25515_g1_i4 len=1420 path=[1:0-42 44:43-75 7187:76-95 101:96-180
186:181-250 256:251-262 9551:263-272 9561:273-273 9562:274-292
298:293-322 328:323-353 2952:354-554 560:555-670 676:671-688
694:689-718 7018:719-758 764:759-816 9362:817-849 855:850-915
9723:916-928 9736:929-929 9737:930-934 9049:935-956 8755:957-983
1048:984-1009 1074:1010-1016 1081:1017-1040 8837:1041-1060
1125:1061-1085 1150:1086-1172 1237:1173-1189 1254:1190-1214
1279:1215-1225 1290:1226-1281 1346:1282-1290 1355:1291-1314
6661:1315-1338 1407:1339-1419]

Length=1420
                                                                      Score     E

ref|XP_009799834.1|  PREDICTED: protein notum homolog                   294   5e-91   
ref|XP_006355154.1|  PREDICTED: protein notum homolog                   290   2e-89   
ref|XP_009600038.1|  PREDICTED: protein notum homolog                   286   3e-88   
ref|XP_009605804.1|  PREDICTED: protein notum homolog                   285   1e-87   
ref|XP_010318089.1|  PREDICTED: protein notum homolog                   281   6e-86   
ref|XP_009601364.1|  PREDICTED: protein notum homolog                   277   1e-84   
ref|XP_010314003.1|  PREDICTED: protein notum homolog isoform X1        277   2e-84   
ref|XP_009590663.1|  PREDICTED: protein notum homolog isoform X1        277   2e-84   
ref|XP_010314004.1|  PREDICTED: protein notum homolog isoform X2        276   3e-84   
ref|XP_009589914.1|  PREDICTED: uncharacterized protein LOC104087...    276   4e-84   
ref|XP_009624847.1|  PREDICTED: protein notum homolog isoform X2        276   5e-84   
ref|XP_009779347.1|  PREDICTED: protein notum homolog isoform X1        276   5e-84   
ref|XP_009589915.1|  PREDICTED: uncharacterized protein LOC104087...    276   6e-84   
ref|XP_009784099.1|  PREDICTED: protein notum homolog                   275   1e-83   
ref|XP_009803843.1|  PREDICTED: uncharacterized protein LOC104249167    272   1e-82   
ref|XP_009624845.1|  PREDICTED: protein notum homolog isoform X1        271   3e-82   
ref|XP_009778395.1|  PREDICTED: protein notum homolog                   271   3e-82   
gb|EYU29129.1|  hypothetical protein MIMGU_mgv1a023759mg                271   3e-82   
ref|XP_009797876.1|  PREDICTED: protein notum homolog isoform X2        271   5e-82   
ref|XP_009607289.1|  PREDICTED: protein notum homolog                   270   2e-81   
ref|XP_008451860.1|  PREDICTED: protein notum homolog isoform X1        269   2e-81   
ref|XP_008451861.1|  PREDICTED: protein notum homolog isoform X2        269   3e-81   
ref|XP_011073252.1|  PREDICTED: protein notum homolog isoform X2        268   7e-81   
ref|XP_006365947.1|  PREDICTED: uncharacterized protein LOC102601254    267   2e-80   
ref|XP_009797875.1|  PREDICTED: protein notum homolog isoform X1        266   3e-80   
ref|XP_011073171.1|  PREDICTED: protein notum homolog isoform X1        267   3e-80   
ref|XP_003628996.1|  Carboxylic ester hydrolase                         266   3e-80   
gb|EPS71696.1|  hypothetical protein M569_03061                         266   4e-80   
ref|XP_006587657.1|  PREDICTED: protein notum homolog isoform X3        265   8e-80   
ref|XP_006573492.1|  PREDICTED: protein notum homolog isoform X2        265   1e-79   
ref|XP_004172255.1|  PREDICTED: protein notum homolog                   265   1e-79   
gb|KHN27511.1|  Protein notum like                                      265   1e-79   
ref|XP_003613922.1|  Notum-like protein                                 264   2e-79   
ref|XP_006587656.1|  PREDICTED: protein notum homolog isoform X2        265   2e-79   
ref|XP_006573491.1|  PREDICTED: protein notum homolog isoform X1        265   2e-79   
gb|KHN41756.1|  Protein notum like                                      265   3e-79   
ref|XP_011012520.1|  PREDICTED: protein notum homolog                   263   4e-79   
ref|XP_003548585.1|  PREDICTED: protein notum homolog                   263   4e-79   
ref|NP_001047850.1|  Os02g0702400                                       263   5e-79   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009397056.1|  PREDICTED: protein notum homolog                   263   6e-79   
ref|XP_010327577.1|  PREDICTED: uncharacterized protein LOC101244626    262   1e-78   
ref|XP_004150551.1|  PREDICTED: protein notum homolog                   265   2e-78   
ref|XP_002519911.1|  pectin acetylesterase, putative                    261   2e-78   Ricinus communis
ref|XP_002303225.2|  pectinacetylesterase family protein                261   3e-78   Populus trichocarpa [western balsam poplar]
ref|XP_004244682.2|  PREDICTED: uncharacterized protein LOC101248898    260   4e-78   
ref|XP_009771151.1|  PREDICTED: uncharacterized protein LOC104221730    260   6e-78   
ref|XP_003547731.1|  PREDICTED: protein notum homolog isoform X1        260   6e-78   
ref|XP_006385133.1|  pectinacetylesterase family protein                260   7e-78   
ref|XP_009413211.1|  PREDICTED: protein notum homolog                   260   8e-78   
ref|XP_009627060.1|  PREDICTED: uncharacterized protein LOC104117690    260   8e-78   
gb|KCW72720.1|  hypothetical protein EUGRSUZ_E01169                     261   8e-78   
ref|XP_006587655.1|  PREDICTED: protein notum homolog isoform X1        261   8e-78   
gb|KHN27509.1|  Protein notum like                                      259   9e-78   
ref|XP_011028476.1|  PREDICTED: protein notum homolog                   259   1e-77   
ref|XP_010056129.1|  PREDICTED: protein notum homolog isoform X1        260   2e-77   
ref|XP_010056132.1|  PREDICTED: protein notum homolog isoform X3        260   2e-77   
ref|XP_010942975.1|  PREDICTED: protein notum homolog isoform X1        258   2e-77   
ref|XP_010911666.1|  PREDICTED: protein notum homolog                   258   3e-77   
ref|XP_010056131.1|  PREDICTED: protein notum homolog isoform X2        260   3e-77   
gb|KDP28068.1|  hypothetical protein JCGZ_19476                         258   3e-77   
ref|XP_003547821.1|  PREDICTED: protein notum homolog                   258   5e-77   
ref|XP_003547822.1|  PREDICTED: protein notum homolog                   258   5e-77   
gb|EYU29131.1|  hypothetical protein MIMGU_mgv1a007782mg                258   5e-77   
gb|ADR82372.1|  pectin acetylesterase                                   258   5e-77   
ref|XP_011082149.1|  PREDICTED: protein notum homolog isoform X1        257   7e-77   
ref|XP_009794297.1|  PREDICTED: protein notum homolog                   257   8e-77   
ref|XP_006471634.1|  PREDICTED: uncharacterized protein LOC102628021    257   8e-77   
ref|XP_006652763.1|  PREDICTED: protein notum homolog                   256   1e-76   
ref|XP_006878664.1|  hypothetical protein AMTR_s00011p00266820          257   1e-76   
ref|XP_007156332.1|  hypothetical protein PHAVU_003G277600g             256   1e-76   
ref|XP_007158098.1|  hypothetical protein PHAVU_002G123900g             256   2e-76   
gb|KDO40410.1|  hypothetical protein CISIN_1g013734mg                   257   2e-76   
ref|XP_008797987.1|  PREDICTED: protein notum homolog isoform X1        256   2e-76   
ref|XP_010644665.1|  PREDICTED: uncharacterized protein LOC100245856    256   2e-76   
gb|KDP28066.1|  hypothetical protein JCGZ_19474                         256   3e-76   
ref|XP_009797415.1|  PREDICTED: uncharacterized protein LOC104243851    256   3e-76   
ref|XP_010325632.1|  PREDICTED: protein notum homolog isoform X1        256   3e-76   
ref|XP_004509558.1|  PREDICTED: protein notum homolog                   255   6e-76   
ref|XP_004244767.2|  PREDICTED: protein notum homolog                   254   8e-76   
ref|XP_009592441.1|  PREDICTED: uncharacterized protein LOC104089292    254   1e-75   
ref|XP_008808358.1|  PREDICTED: protein notum homolog                   254   1e-75   
ref|XP_006432881.1|  hypothetical protein CICLE_v10001426mg             254   1e-75   
ref|XP_003580427.1|  PREDICTED: uncharacterized protein LOC100827...    254   1e-75   
ref|XP_010439718.1|  PREDICTED: protein notum homolog                   254   2e-75   
ref|XP_004953590.1|  PREDICTED: protein notum homolog isoform X1        254   2e-75   
ref|XP_010449357.1|  PREDICTED: protein notum homolog                   254   2e-75   
ref|XP_010676220.1|  PREDICTED: uncharacterized protein LOC104892094    255   2e-75   
ref|XP_010240371.1|  PREDICTED: uncharacterized protein LOC100827...    253   2e-75   
ref|XP_009616254.1|  PREDICTED: protein notum homolog                   253   3e-75   
gb|EYU29130.1|  hypothetical protein MIMGU_mgv1a007782mg                253   3e-75   
gb|ACF05806.1|  PAE                                                     253   4e-75   Litchi chinensis [litchi]
ref|XP_006359968.1|  PREDICTED: protein notum homolog                   252   4e-75   
ref|XP_010942974.1|  PREDICTED: protein notum homolog                   253   4e-75   
gb|KCW72718.1|  hypothetical protein EUGRSUZ_E01169                     253   5e-75   
ref|XP_007209217.1|  hypothetical protein PRUPE_ppa006718mg             252   6e-75   
ref|XP_002865253.1|  pectin acetylesterase                              252   6e-75   
ref|XP_006385137.1|  hypothetical protein POPTR_0004s24220g             252   7e-75   
ref|XP_009108426.1|  PREDICTED: protein notum homolog                   252   7e-75   
ref|XP_011028483.1|  PREDICTED: uncharacterized protein LOC105128...    253   8e-75   
emb|CDY09287.1|  BnaC03g63170D                                          251   9e-75   
ref|XP_010434420.1|  PREDICTED: protein notum homolog                   252   1e-74   
ref|XP_006385138.1|  hypothetical protein POPTR_0004s24220g             252   1e-74   
ref|XP_006361581.1|  PREDICTED: protein notum homolog                   251   1e-74   
ref|XP_002519912.1|  pectin acetylesterase, putative                    253   1e-74   Ricinus communis
gb|EYU37455.1|  hypothetical protein MIMGU_mgv1a007934mg                251   1e-74   
ref|XP_006432880.1|  hypothetical protein CICLE_v10001467mg             251   1e-74   
ref|XP_007040900.1|  Pectinacetylesterase family protein                251   2e-74   
ref|XP_006385134.1|  hypothetical protein POPTR_0004s24220g             252   2e-74   
ref|XP_009350399.1|  PREDICTED: protein notum homolog                   251   2e-74   
ref|XP_010536189.1|  PREDICTED: uncharacterized protein LOC104811...    250   3e-74   
ref|XP_009132797.1|  PREDICTED: protein notum homolog                   251   3e-74   
ref|XP_004244443.1|  PREDICTED: uncharacterized protein LOC101251798    250   3e-74   
emb|CDX99377.1|  BnaC01g11750D                                          252   3e-74   
ref|XP_006494119.1|  PREDICTED: protein notum homolog isoform X1        250   3e-74   
gb|KCW72726.1|  hypothetical protein EUGRSUZ_E01170                     249   3e-74   
emb|CDX78933.1|  BnaA01g10000D                                          252   3e-74   
ref|XP_010248193.1|  PREDICTED: uncharacterized protein LOC104591101    250   3e-74   
ref|XP_004509522.1|  PREDICTED: uncharacterized protein LOC101493...    250   3e-74   
gb|EYU37453.1|  hypothetical protein MIMGU_mgv1a007583mg                250   6e-74   
gb|KDP28067.1|  hypothetical protein JCGZ_19475                         249   6e-74   
ref|XP_010434425.1|  PREDICTED: uncharacterized protein LOC104718...    249   6e-74   
gb|EEC77932.1|  hypothetical protein OsI_17271                          253   6e-74   Oryza sativa Indica Group [Indian rice]
ref|XP_009388128.1|  PREDICTED: protein notum homolog                   249   6e-74   
ref|XP_008378614.1|  PREDICTED: uncharacterized protein LOC103441693    249   6e-74   
emb|CDP15690.1|  unnamed protein product                                249   7e-74   
ref|XP_011082152.1|  PREDICTED: protein notum homolog isoform X2        249   8e-74   
ref|XP_010677538.1|  PREDICTED: protein notum homolog isoform X1        249   8e-74   
ref|XP_010449359.1|  PREDICTED: uncharacterized protein LOC104731629    249   9e-74   
ref|NP_567585.1|  pectinacetylesterase family protein                   249   9e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010235850.1|  PREDICTED: protein notum homolog isoform X1        249   9e-74   
ref|XP_006599203.1|  PREDICTED: uncharacterized protein LOC100781...    249   1e-73   
ref|XP_010434424.1|  PREDICTED: uncharacterized protein LOC104718...    249   1e-73   
gb|KHN41567.1|  Protein notum like                                      249   1e-73   
ref|XP_006363883.1|  PREDICTED: uncharacterized protein LOC102589191    251   1e-73   
ref|XP_008373438.1|  PREDICTED: protein notum homolog isoform X1        251   1e-73   
ref|XP_010536220.1|  PREDICTED: protein notum homolog isoform X1        249   1e-73   
emb|CAA67728.1|  pectinacetylesterase precursor                         249   1e-73   Vigna radiata var. radiata [golden gram]
ref|NP_193677.2|  putative pectinacetylesterase                         249   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006368062.1|  PREDICTED: protein notum homolog                   246   1e-73   
dbj|BAJ97261.1|  predicted protein                                      248   2e-73   
ref|XP_006363875.1|  PREDICTED: protein notum homolog                   249   2e-73   
ref|XP_002867940.1|  hypothetical protein ARALYDRAFT_492921             248   2e-73   
gb|AAM65412.1|  pectin acetylesterase                                   248   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011028482.1|  PREDICTED: uncharacterized protein LOC105128...    251   2e-73   
emb|CDY09289.1|  BnaC03g63190D                                          248   2e-73   
ref|XP_011028479.1|  PREDICTED: uncharacterized protein LOC105128...    251   2e-73   
ref|XP_006413980.1|  hypothetical protein EUTSA_v10025385mg             248   3e-73   
ref|XP_010439720.1|  PREDICTED: uncharacterized protein LOC104723107    248   3e-73   
ref|NP_199341.1|  pectinacetylesterase family protein                   248   3e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280604.1|  hypothetical protein CARUB_v10026563mg             248   3e-73   
ref|XP_008373439.1|  PREDICTED: protein notum homolog isoform X2        249   3e-73   
ref|XP_008355284.1|  PREDICTED: uncharacterized protein LOC103418943    248   4e-73   
emb|CDX99378.1|  BnaC01g11740D                                          247   4e-73   
gb|ABK24433.1|  unknown                                                 248   4e-73   Picea sitchensis
ref|XP_006283887.1|  hypothetical protein CARUB_v10005004mg             247   5e-73   
ref|XP_010244170.1|  PREDICTED: uncharacterized protein LOC104588061    247   5e-73   
gb|KCW72723.1|  hypothetical protein EUGRSUZ_E01170                     247   5e-73   
ref|XP_010529277.1|  PREDICTED: protein notum homolog                   247   5e-73   
gb|ABK24994.1|  unknown                                                 247   5e-73   Picea sitchensis
emb|CAD41867.2|  OSJNBa0041A02.14                                       247   5e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006398195.1|  hypothetical protein EUTSA_v10000914mg             247   5e-73   
ref|XP_010056136.1|  PREDICTED: protein notum homolog                   247   6e-73   
ref|XP_004300392.1|  PREDICTED: protein notum homolog                   247   6e-73   
ref|NP_001053773.1|  Os04g0602500                                       249   6e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010494620.1|  PREDICTED: uncharacterized protein LOC104771742    247   6e-73   
emb|CDY26383.1|  BnaA02g23870D                                          247   7e-73   
ref|XP_009132784.1|  PREDICTED: uncharacterized protein LOC103857370    247   7e-73   
ref|XP_009398466.1|  PREDICTED: protein notum homolog                   246   8e-73   
ref|XP_007209211.1|  hypothetical protein PRUPE_ppa006668mg             247   9e-73   
ref|NP_001151183.1|  LOC100284816 precursor                             246   9e-73   Zea mays [maize]
ref|XP_010441760.1|  PREDICTED: uncharacterized protein LOC104724893    246   1e-72   
emb|CDX78932.1|  BnaA01g09990D                                          246   1e-72   
ref|XP_002867938.1|  pectinacetylesterase family protein                246   1e-72   
ref|XP_010481611.1|  PREDICTED: uncharacterized protein LOC104760390    246   1e-72   
gb|ACG39759.1|  carboxylic ester hydrolase                              246   1e-72   Zea mays [maize]
ref|XP_009108427.1|  PREDICTED: protein notum homolog                   246   2e-72   
gb|EEE61621.1|  hypothetical protein OsJ_16047                          253   2e-72   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008808368.1|  PREDICTED: uncharacterized protein LOC103720...    246   2e-72   
ref|XP_008808367.1|  PREDICTED: uncharacterized protein LOC103720...    246   2e-72   
ref|XP_008238012.1|  PREDICTED: protein notum homolog isoform X2        246   2e-72   
ref|XP_010677539.1|  PREDICTED: protein notum homolog isoform X2        245   2e-72   
ref|XP_009128780.1|  PREDICTED: uncharacterized protein LOC103853624    245   3e-72   
gb|KEH20327.1|  pectinacetylesterase family protein                     245   3e-72   
emb|CDX87799.1|  BnaC02g31500D                                          245   3e-72   
ref|XP_003628995.1|  Notum-like protein                                 245   4e-72   
gb|EYU37448.1|  hypothetical protein MIMGU_mgv1a007102mg                246   4e-72   
ref|XP_010266384.1|  PREDICTED: uncharacterized protein LOC104603...    245   4e-72   
gb|KCW72722.1|  hypothetical protein EUGRSUZ_E01170                     244   5e-72   
gb|KDO40409.1|  hypothetical protein CISIN_1g016608mg                   244   5e-72   
gb|AET03471.2|  pectinacetylesterase family protein                     245   7e-72   
ref|XP_007040902.1|  Pectinacetylesterase family protein                244   7e-72   
ref|XP_007156330.1|  hypothetical protein PHAVU_003G277500g             244   7e-72   
ref|XP_010056135.1|  PREDICTED: protein notum homolog                   244   7e-72   
gb|AFK37852.1|  unknown                                                 244   8e-72   
ref|NP_001190770.1|  pectinacetylesterase family protein                248   8e-72   
gb|AAP72959.1|  pectin acetylesterase                                   244   9e-72   Lactuca sativa [cultivated lettuce]
ref|XP_008347803.1|  PREDICTED: uncharacterized protein LOC103410929    244   1e-71   
ref|XP_007051327.1|  Pectinacetylesterase family protein                246   1e-71   
ref|XP_010244169.1|  PREDICTED: protein notum homolog                   244   1e-71   
ref|XP_007156331.1|  hypothetical protein PHAVU_003G277500g             244   1e-71   
ref|XP_004512351.1|  PREDICTED: protein notum homolog isoform X3        245   1e-71   
ref|XP_010266383.1|  PREDICTED: uncharacterized protein LOC104603...    244   2e-71   
gb|AGT16732.1|  carboxylic ester hydrolase                              243   2e-71   
ref|XP_009408703.1|  PREDICTED: protein notum homolog                   243   2e-71   
gb|KDO40416.1|  hypothetical protein CISIN_1g013734mg                   240   3e-71   
gb|ACJ85294.1|  unknown                                                 243   3e-71   Medicago truncatula
ref|XP_006385136.1|  hypothetical protein POPTR_0004s24220g             242   4e-71   
ref|XP_009407792.1|  PREDICTED: protein notum homolog                   243   4e-71   
gb|AFK45147.1|  unknown                                                 242   4e-71   
ref|XP_009407790.1|  PREDICTED: protein notum homolog                   243   5e-71   
ref|XP_010325697.1|  PREDICTED: uncharacterized protein LOC101260962    248   5e-71   
ref|XP_008808370.1|  PREDICTED: uncharacterized protein LOC103720...    242   5e-71   
ref|XP_004512349.1|  PREDICTED: protein notum homolog isoform X1        244   6e-71   
ref|XP_010235852.1|  PREDICTED: protein notum homolog isoform X2        240   6e-71   
ref|XP_008673121.1|  PREDICTED: uncharacterized protein LOC100382...    242   7e-71   
ref|XP_002454426.1|  hypothetical protein SORBIDRAFT_04g030720          241   8e-71   Sorghum bicolor [broomcorn]
gb|KCW72721.1|  hypothetical protein EUGRSUZ_E01170                     241   9e-71   
dbj|BAD94756.1|  putative pectinacetylesterase protein                  238   1e-70   Arabidopsis thaliana [mouse-ear cress]
gb|KHG23648.1|  Notum                                                   241   1e-70   
ref|XP_006413981.1|  hypothetical protein EUTSA_v10024796mg             246   1e-70   
ref|XP_008365238.1|  PREDICTED: uncharacterized protein LOC103428882    238   1e-70   
ref|XP_002280816.3|  PREDICTED: protein notum homolog                   241   1e-70   Vitis vinifera
ref|XP_010536210.1|  PREDICTED: uncharacterized protein LOC104811251    241   1e-70   
ref|XP_008238011.1|  PREDICTED: protein notum homolog isoform X1        241   1e-70   
ref|XP_006432878.1|  hypothetical protein CICLE_v100013712mg            237   2e-70   
ref|XP_004970864.1|  PREDICTED: protein notum homolog isoform X1        241   2e-70   
ref|XP_004300391.1|  PREDICTED: protein notum homolog                   240   2e-70   
ref|XP_004953591.1|  PREDICTED: protein notum homolog isoform X2        238   2e-70   
ref|XP_002280865.3|  PREDICTED: protein notum homolog                   240   3e-70   Vitis vinifera
ref|NP_974575.2|  putative pectinacetylesterase                         239   4e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007163258.1|  hypothetical protein PHAVU_001G219200g             240   4e-70   
ref|XP_004304922.1|  PREDICTED: protein notum homolog                   239   9e-70   
ref|XP_007163257.1|  hypothetical protein PHAVU_001G219200g             240   1e-69   
ref|XP_006361594.1|  PREDICTED: protein notum homolog                   242   1e-69   
gb|KHG30410.1|  Protein notum                                           239   1e-69   
ref|XP_010325633.1|  PREDICTED: uncharacterized protein LOC101257...    238   1e-69   
ref|XP_009610135.1|  PREDICTED: protein notum homolog                   239   2e-69   
ref|XP_009759657.1|  PREDICTED: uncharacterized protein LOC104212153    239   2e-69   
ref|XP_008227765.1|  PREDICTED: protein notum homolog isoform X2        239   2e-69   
emb|CBI37039.3|  unnamed protein product                                237   2e-69   
ref|XP_003561153.1|  PREDICTED: protein notum homolog                   237   2e-69   
ref|XP_010266380.1|  PREDICTED: uncharacterized protein LOC104603...    238   3e-69   
ref|XP_008227764.1|  PREDICTED: protein notum homolog isoform X1        239   3e-69   
ref|XP_004970861.1|  PREDICTED: protein notum homolog                   238   4e-69   
ref|XP_003609911.1|  Pectin acetylesterase                              238   5e-69   
ref|XP_011074219.1|  PREDICTED: protein notum homolog                   236   5e-69   
ref|XP_007205243.1|  hypothetical protein PRUPE_ppa006114mg             237   6e-69   
ref|XP_009142580.1|  PREDICTED: protein notum homolog                   237   6e-69   
ref|XP_008656990.1|  PREDICTED: protein notum homolog isoform X2        237   7e-69   
gb|EMT14315.1|  hypothetical protein F775_08483                         236   7e-69   
emb|CBI37040.3|  unnamed protein product                                239   8e-69   
emb|CDY41569.1|  BnaC04g00530D                                          237   9e-69   
ref|XP_004248530.1|  PREDICTED: protein notum homolog isoform X2        236   9e-69   
ref|XP_008246335.1|  PREDICTED: uncharacterized protein LOC103344...    236   9e-69   
ref|XP_007221559.1|  hypothetical protein PRUPE_ppa006038mg             237   9e-69   
ref|NP_851135.1|  pectinacetylesterase family protein                   235   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004970862.1|  PREDICTED: protein notum homolog                   236   1e-68   
ref|XP_003518126.1|  PREDICTED: protein notum homolog                   236   1e-68   
gb|KDP28360.1|  hypothetical protein JCGZ_14131                         237   1e-68   
ref|XP_003536006.1|  PREDICTED: uncharacterized protein LOC100810716    236   1e-68   
ref|XP_006351092.1|  PREDICTED: protein notum homolog                   233   2e-68   
ref|XP_010045528.1|  PREDICTED: protein notum homolog                   236   2e-68   
ref|XP_009590664.1|  PREDICTED: uncharacterized protein LOC104087...    234   2e-68   
ref|XP_006604768.1|  PREDICTED: protein notum homolog isoform X2        236   2e-68   
ref|XP_003626089.1|  Pectin acetylesterase                              236   2e-68   
ref|XP_011074218.1|  PREDICTED: protein notum homolog                   234   3e-68   
gb|ADE77373.1|  unknown                                                 235   3e-68   
gb|KHG13045.1|  Protein notum                                           236   3e-68   
ref|XP_010266381.1|  PREDICTED: uncharacterized protein LOC104603...    234   3e-68   
emb|CDY67801.1|  BnaAnng25210D                                          234   4e-68   
ref|XP_010544918.1|  PREDICTED: protein notum homolog isoform X2        235   4e-68   
ref|XP_008246333.1|  PREDICTED: uncharacterized protein LOC103344...    235   4e-68   
ref|XP_002458902.1|  hypothetical protein SORBIDRAFT_03g042380          233   4e-68   Sorghum bicolor [broomcorn]
ref|XP_009353455.1|  PREDICTED: protein notum homolog                   235   4e-68   
ref|XP_006444639.1|  hypothetical protein CICLE_v10020385mg             235   4e-68   
ref|XP_003626088.1|  Pectin acetylesterase                              236   4e-68   
gb|EYU37452.1|  hypothetical protein MIMGU_mgv1a007583mg                232   5e-68   
ref|XP_008810598.1|  PREDICTED: protein notum homolog                   235   5e-68   
ref|XP_003554582.1|  PREDICTED: protein notum homolog isoform X1        236   5e-68   
gb|KHN43400.1|  Protein notum like                                      236   6e-68   
ref|XP_006397884.1|  hypothetical protein EUTSA_v10001449mg             235   6e-68   
ref|XP_004509524.1|  PREDICTED: uncharacterized protein LOC101493...    231   6e-68   
ref|XP_009779872.1|  PREDICTED: protein notum homolog                   234   7e-68   
ref|XP_010111521.1|  hypothetical protein L484_021346                   233   8e-68   
gb|ABR16604.1|  unknown                                                 235   8e-68   
ref|XP_002880274.1|  hypothetical protein ARALYDRAFT_483863             234   9e-68   
gb|AFK42918.1|  unknown                                                 234   1e-67   
ref|XP_008656989.1|  PREDICTED: protein notum homolog isoform X1        234   1e-67   
ref|XP_004970868.1|  PREDICTED: protein notum homolog isoform X5        231   1e-67   
ref|XP_010544917.1|  PREDICTED: protein notum homolog isoform X1        235   1e-67   
ref|XP_006492439.1|  PREDICTED: protein notum homolog                   234   1e-67   
ref|XP_010327277.1|  PREDICTED: protein notum homolog isoform X1        233   2e-67   
ref|XP_006367726.1|  PREDICTED: uncharacterized protein LOC102600035    232   2e-67   
ref|XP_008667853.1|  PREDICTED: hypothetical protein isoform X1         232   3e-67   
ref|XP_004251486.1|  PREDICTED: uncharacterized protein LOC101264402    232   4e-67   
ref|XP_010266386.1|  PREDICTED: uncharacterized protein LOC104603...    230   6e-67   
ref|XP_002515160.1|  pectin acetylesterase, putative                    232   6e-67   
emb|CBI39680.3|  unnamed protein product                                230   6e-67   
ref|XP_008363956.1|  PREDICTED: protein notum homolog                   231   6e-67   
dbj|BAJ89162.1|  predicted protein                                      232   7e-67   
ref|XP_002275616.1|  PREDICTED: protein notum homolog isoform X1        232   7e-67   
gb|KHG26188.1|  Protein notum                                           231   7e-67   
gb|AFK45877.1|  unknown                                                 232   7e-67   
emb|CBI26039.3|  unnamed protein product                                230   7e-67   
ref|XP_008360208.1|  PREDICTED: protein notum homolog isoform X3        232   9e-67   
ref|XP_010054028.1|  PREDICTED: uncharacterized protein LOC104442...    231   1e-66   
ref|XP_006338904.1|  PREDICTED: protein notum homolog isoform X1        231   1e-66   
ref|XP_006423958.1|  hypothetical protein CICLE_v10028674mg             230   1e-66   
ref|XP_010233620.1|  PREDICTED: protein notum homolog                   230   1e-66   
ref|XP_007154511.1|  hypothetical protein PHAVU_003G124700g             231   1e-66   
tpg|DAA36173.1|  TPA: hypothetical protein ZEAMMB73_990456              229   1e-66   
emb|CAN62190.1|  hypothetical protein VITISV_020113                     231   1e-66   
ref|XP_002279030.1|  PREDICTED: protein notum homolog                   231   2e-66   
ref|XP_011082153.1|  PREDICTED: protein notum homolog                   230   2e-66   
ref|XP_009335553.1|  PREDICTED: uncharacterized protein LOC103928...    230   2e-66   
ref|XP_004508066.1|  PREDICTED: protein notum homolog                   231   2e-66   
ref|XP_004970866.1|  PREDICTED: protein notum homolog isoform X3        228   2e-66   
ref|XP_006385140.1|  hypothetical protein POPTR_0004s24220g             228   2e-66   
ref|NP_182216.1|  pectinacetylesterase-like protein                     230   2e-66   
ref|XP_006646555.1|  PREDICTED: protein notum homolog                   230   3e-66   
ref|XP_009776988.1|  PREDICTED: uncharacterized protein LOC104226...    229   3e-66   
ref|XP_006480336.1|  PREDICTED: protein notum homolog                   230   3e-66   
ref|XP_003565180.2|  PREDICTED: uncharacterized protein LOC100841...    233   4e-66   
ref|XP_010694126.1|  PREDICTED: protein notum homolog                   229   4e-66   
ref|XP_003551008.1|  PREDICTED: protein notum homolog                   229   4e-66   
ref|XP_004304921.1|  PREDICTED: protein notum homolog                   229   4e-66   
ref|XP_006359967.1|  PREDICTED: protein notum homolog                   229   5e-66   
ref|XP_004970863.1|  PREDICTED: protein notum homolog                   230   5e-66   
gb|KHG23649.1|  Notum                                                   228   5e-66   
ref|XP_010999345.1|  PREDICTED: protein notum homolog isoform X2        229   5e-66   
gb|AFK38038.1|  unknown                                                 229   6e-66   
ref|XP_009776987.1|  PREDICTED: uncharacterized protein LOC104226...    229   6e-66   
ref|XP_004495849.1|  PREDICTED: protein notum homolog isoform X1        229   6e-66   
ref|XP_004494487.1|  PREDICTED: protein notum homolog isoform X3        229   6e-66   
tpg|DAA36176.1|  TPA: pectinacetylesterase                              232   7e-66   
ref|XP_009619780.1|  PREDICTED: uncharacterized protein LOC104111729    228   7e-66   
ref|XP_006378039.1|  hypothetical protein POPTR_0010s00700g             229   7e-66   
gb|KHN14241.1|  Protein notum like                                      229   7e-66   
gb|KHG09455.1|  Protein notum                                           228   9e-66   
ref|XP_010240825.1|  PREDICTED: protein notum homolog                   228   1e-65   
ref|XP_004494486.1|  PREDICTED: protein notum homolog isoform X2        229   1e-65   
gb|KHN14181.1|  Protein notum like                                      228   1e-65   
emb|CDM87215.1|  unnamed protein product                                229   1e-65   
gb|EEC71940.1|  hypothetical protein OsI_04754                          227   2e-65   
gb|EMS61917.1|  hypothetical protein TRIUR3_01659                       228   2e-65   
ref|XP_004494485.1|  PREDICTED: protein notum homolog isoform X1        229   2e-65   
ref|XP_006604776.1|  PREDICTED: protein notum homolog isoform X1        228   2e-65   
ref|XP_003555771.1|  PREDICTED: uncharacterized protein LOC100793403    228   2e-65   
ref|XP_009382363.1|  PREDICTED: protein notum homolog isoform X3        228   2e-65   
gb|EMT09212.1|  hypothetical protein F775_13462                         228   2e-65   
gb|KHN14201.1|  Protein notum like                                      228   3e-65   
ref|XP_010546781.1|  PREDICTED: protein notum homolog                   228   3e-65   
ref|XP_006293476.1|  hypothetical protein CARUB_v10023292mg             228   3e-65   
ref|XP_004968122.1|  PREDICTED: protein notum homolog isoform X1        228   3e-65   
ref|XP_009589853.1|  PREDICTED: uncharacterized protein LOC104087...    226   3e-65   
ref|XP_003521640.1|  PREDICTED: protein notum homolog                   228   3e-65   
ref|XP_009335552.1|  PREDICTED: protein notum homolog isoform X1        227   4e-65   
ref|XP_008388414.1|  PREDICTED: protein notum homolog                   227   4e-65   
ref|XP_007222071.1|  hypothetical protein PRUPE_ppa007506mg             226   4e-65   
ref|XP_007031285.1|  Pectinacetylesterase family protein                228   4e-65   
ref|XP_011039993.1|  PREDICTED: uncharacterized protein LOC105136378    228   5e-65   
ref|XP_008222318.1|  PREDICTED: protein notum homolog                   227   5e-65   
gb|KDO40412.1|  hypothetical protein CISIN_1g013734mg                   226   5e-65   
gb|KHN45022.1|  Protein notum like                                      226   7e-65   
gb|KEH43170.1|  pectinacetylesterase family protein                     226   7e-65   
dbj|BAJ95183.1|  predicted protein                                      226   7e-65   
ref|XP_008246334.1|  PREDICTED: protein notum homolog isoform X2        226   8e-65   
ref|XP_009763242.1|  PREDICTED: protein notum homolog isoform X1        225   9e-65   
ref|XP_003521625.1|  PREDICTED: protein notum homolog isoformX1         226   1e-64   
ref|XP_009612887.1|  PREDICTED: uncharacterized protein LOC104106115    225   1e-64   
ref|XP_010070108.1|  PREDICTED: protein notum homolog                   226   1e-64   
gb|KDO86754.1|  hypothetical protein CISIN_1g014548mg                   226   1e-64   
ref|XP_010507953.1|  PREDICTED: protein notum homolog                   226   1e-64   
ref|XP_010506713.1|  PREDICTED: protein notum homolog isoform X1        226   1e-64   
ref|XP_006363510.1|  PREDICTED: uncharacterized protein LOC102583822    225   1e-64   
ref|XP_007145083.1|  hypothetical protein PHAVU_007G208200g             226   1e-64   
ref|XP_003542396.2|  PREDICTED: protein notum homolog isoform X1        226   1e-64   
ref|XP_006593985.1|  PREDICTED: protein notum homolog isoform X2        226   1e-64   
ref|NP_001152013.1|  carboxylic ester hydrolase precursor               226   1e-64   
ref|XP_002320250.2|  hypothetical protein POPTR_0014s10650g             227   1e-64   
ref|XP_007145058.1|  hypothetical protein PHAVU_007G206300g             226   1e-64   
ref|XP_010518382.1|  PREDICTED: protein notum homolog isoform X1        226   2e-64   
ref|XP_006593986.1|  PREDICTED: protein notum homolog isoform X3        226   2e-64   
gb|EYU19373.1|  hypothetical protein MIMGU_mgv1a006907mg                226   2e-64   
gb|EYU37449.1|  hypothetical protein MIMGU_mgv1a011392mg                221   2e-64   
ref|XP_009359821.1|  PREDICTED: protein notum homolog                   226   2e-64   
tpg|DAA54427.1|  TPA: carboxylic ester hydrolase                        225   2e-64   
ref|XP_006577186.1|  PREDICTED: protein notum homolog isoform X2        226   2e-64   
ref|XP_002318919.2|  hypothetical protein POPTR_0013s00280g             225   2e-64   
ref|XP_002271673.1|  PREDICTED: uncharacterized protein LOC100247...    224   2e-64   
ref|XP_002512590.1|  pectin acetylesterase, putative                    225   3e-64   
ref|XP_008388417.1|  PREDICTED: uncharacterized protein LOC103450...    224   3e-64   
tpg|DAA56406.1|  TPA: hypothetical protein ZEAMMB73_392919              226   3e-64   
ref|XP_008238015.1|  PREDICTED: protein notum homolog isoform X5        221   3e-64   
ref|XP_009603747.1|  PREDICTED: protein notum homolog isoform X1        224   3e-64   
gb|EMT15342.1|  hypothetical protein F775_17167                         224   4e-64   
ref|XP_008369575.1|  PREDICTED: protein notum homolog isoform X2        225   4e-64   
emb|CDY19761.1|  BnaA09g04140D                                          224   4e-64   
ref|XP_011074200.1|  PREDICTED: protein notum homolog                   224   4e-64   
ref|XP_010255386.1|  PREDICTED: uncharacterized protein LOC104596068    224   4e-64   
ref|XP_010914803.1|  PREDICTED: protein notum homolog isoform X1        224   5e-64   
ref|XP_009600844.1|  PREDICTED: protein notum homolog                   224   6e-64   
ref|XP_002455557.1|  hypothetical protein SORBIDRAFT_03g013080          224   6e-64   
gb|EYU19372.1|  hypothetical protein MIMGU_mgv1a006907mg                222   8e-64   
ref|XP_010914805.1|  PREDICTED: protein notum homolog                   223   8e-64   
ref|XP_009805042.1|  PREDICTED: protein notum homolog                   224   9e-64   
ref|XP_003536008.1|  PREDICTED: protein notum homolog isoform X1        224   9e-64   
ref|XP_011023896.1|  PREDICTED: protein notum homolog                   223   9e-64   
ref|XP_002447050.1|  hypothetical protein SORBIDRAFT_06g027560          223   1e-63   
ref|XP_010524828.1|  PREDICTED: protein notum homolog                   223   1e-63   
ref|XP_010671868.1|  PREDICTED: protein notum homolog                   223   1e-63   
ref|XP_007154510.1|  hypothetical protein PHAVU_003G124700g             224   1e-63   
gb|EMT00867.1|  hypothetical protein F775_21765                         226   1e-63   
gb|EMS59699.1|  hypothetical protein TRIUR3_12152                       222   1e-63   
ref|XP_008238014.1|  PREDICTED: protein notum homolog isoform X4        220   1e-63   
ref|NP_850878.2|  pectinacetylesterase family protein                   223   1e-63   
gb|EPS71965.1|  hypothetical protein M569_02793                         222   2e-63   
ref|XP_009151150.1|  PREDICTED: protein notum homolog                   223   2e-63   
ref|XP_008360206.1|  PREDICTED: protein notum homolog isoform X1        224   2e-63   
dbj|BAH19826.1|  AT5G26670                                              223   2e-63   
ref|XP_010674458.1|  PREDICTED: protein notum homolog                   221   2e-63   
ref|XP_008238013.1|  PREDICTED: protein notum homolog isoform X3        220   2e-63   
dbj|BAJ90066.1|  predicted protein                                      222   2e-63   
ref|XP_006358515.1|  PREDICTED: protein notum homolog                   223   2e-63   
ref|XP_010999344.1|  PREDICTED: protein notum homolog isoform X1        223   2e-63   
ref|XP_004296984.1|  PREDICTED: protein notum homolog                   223   2e-63   
emb|CDX80575.1|  BnaC07g28690D                                          223   2e-63   
ref|XP_009794027.1|  PREDICTED: uncharacterized protein LOC104240572    222   2e-63   
emb|CDY32190.1|  BnaCnng06990D                                          222   2e-63   
ref|XP_004494501.1|  PREDICTED: uncharacterized protein LOC101497...    223   3e-63   
ref|XP_006408013.1|  hypothetical protein EUTSA_v10020818mg             222   3e-63   
ref|XP_003565721.1|  PREDICTED: protein notum homolog                   222   3e-63   
ref|XP_009771487.1|  PREDICTED: protein notum homolog                   221   3e-63   
emb|CDX87039.1|  BnaC09g03540D                                          222   3e-63   
ref|XP_009626489.1|  PREDICTED: protein notum homolog isoform X1        221   3e-63   
ref|XP_010043350.1|  PREDICTED: protein notum homolog                   222   4e-63   
ref|XP_007163281.1|  hypothetical protein PHAVU_001G221400g             222   4e-63   
ref|XP_006394896.1|  hypothetical protein EUTSA_v10004301mg             222   4e-63   
ref|XP_011087572.1|  PREDICTED: protein notum homolog isoform X1        222   4e-63   
gb|EAY76796.1|  hypothetical protein OsI_04753                          221   5e-63   
ref|XP_004288665.1|  PREDICTED: protein notum homolog                   223   5e-63   
ref|XP_010054026.1|  PREDICTED: uncharacterized protein LOC104442...    222   5e-63   
dbj|BAD87540.1|  putative pectinacetylesterase precursor                221   5e-63   
gb|KFK26428.1|  hypothetical protein AALP_AA8G247000                    221   5e-63   
gb|KFK37453.1|  hypothetical protein AALP_AA4G259200                    221   6e-63   
ref|XP_006402417.1|  hypothetical protein EUTSA_v10005997mg             221   7e-63   
ref|XP_009111712.1|  PREDICTED: protein notum homolog                   221   7e-63   
ref|XP_010421519.1|  PREDICTED: protein notum homolog                   221   7e-63   
ref|XP_008450496.1|  PREDICTED: protein notum homolog                   221   8e-63   
gb|KCW85365.1|  hypothetical protein EUGRSUZ_B02195                     222   9e-63   
dbj|BAD87541.1|  putative pectinacetylesterase precursor                220   1e-62   
ref|NP_001141895.1|  uncharacterized protein LOC100274042 precursor     221   1e-62   
ref|XP_010511331.1|  PREDICTED: protein notum homolog                   221   1e-62   
ref|XP_011039058.1|  PREDICTED: protein notum homolog isoform X1        221   1e-62   
ref|XP_002461086.1|  hypothetical protein SORBIDRAFT_02g040470          220   1e-62   
gb|ABG34283.1|  pectin acetylesterase                                   218   1e-62   
ref|XP_010942978.1|  PREDICTED: uncharacterized protein LOC105060...    219   1e-62   
ref|XP_006382250.1|  hypothetical protein POPTR_0005s00330g             220   1e-62   
ref|XP_006658006.1|  PREDICTED: protein notum homolog                   220   2e-62   
ref|XP_008807933.1|  PREDICTED: protein notum homolog                   220   2e-62   
ref|XP_004302322.1|  PREDICTED: protein notum homolog                   220   2e-62   
ref|XP_004230372.1|  PREDICTED: protein notum homolog                   220   2e-62   
ref|XP_002315478.2|  hypothetical protein POPTR_0010s00700g             221   2e-62   
ref|XP_006840405.1|  hypothetical protein AMTR_s00045p00148030          221   2e-62   
ref|XP_009138739.1|  PREDICTED: protein notum homolog isoform X2        220   2e-62   
gb|KFK35390.1|  hypothetical protein AALP_AA5G279000                    220   2e-62   
ref|XP_009768293.1|  PREDICTED: protein notum homolog                   220   2e-62   
ref|XP_004135578.1|  PREDICTED: protein notum homolog                   220   2e-62   
dbj|BAK01215.1|  predicted protein                                      220   3e-62   
ref|XP_009366012.1|  PREDICTED: protein notum homolog                   219   3e-62   
ref|XP_008363955.1|  PREDICTED: protein notum homolog                   219   3e-62   
ref|NP_001060382.1|  Os07g0634600                                       219   3e-62   
ref|XP_009116880.1|  PREDICTED: protein notum homolog                   219   3e-62   
ref|XP_006286504.1|  hypothetical protein CARUB_v10001019mg             219   3e-62   
ref|XP_010662730.1|  PREDICTED: uncharacterized protein LOC100247...    218   3e-62   
ref|XP_004246219.1|  PREDICTED: protein notum homolog                   219   3e-62   
emb|CDY66251.1|  BnaC04g52030D                                          218   4e-62   
ref|XP_006407678.1|  hypothetical protein EUTSA_v10020789mg             219   4e-62   
ref|XP_010094916.1|  hypothetical protein L484_022666                   219   4e-62   
ref|XP_009589854.1|  PREDICTED: uncharacterized protein LOC104087...    215   5e-62   
ref|XP_010455015.1|  PREDICTED: protein notum homolog                   219   5e-62   
gb|KDO86755.1|  hypothetical protein CISIN_1g014548mg                   216   5e-62   
ref|XP_009399871.1|  PREDICTED: uncharacterized protein LOC103984154    219   5e-62   
ref|NP_191765.2|  pectinacetylesterase family protein                   219   6e-62   
emb|CDY58759.1|  BnaA04g27440D                                          220   6e-62   
gb|KFK38001.1|  hypothetical protein AALP_AA3G057300                    219   6e-62   
ref|XP_006297778.1|  hypothetical protein CARUB_v10013814mg             219   6e-62   
ref|XP_010914807.1|  PREDICTED: protein notum homolog isoform X1        218   6e-62   
ref|XP_009138738.1|  PREDICTED: protein notum homolog isoform X1        220   7e-62   
gb|AFK35535.1|  unknown                                                 219   7e-62   
ref|XP_003567618.1|  PREDICTED: uncharacterized protein LOC100841630    219   7e-62   
dbj|BAJ85221.1|  predicted protein                                      219   7e-62   
ref|XP_011092213.1|  PREDICTED: protein notum homolog                   219   7e-62   
gb|KDP23324.1|  hypothetical protein JCGZ_23157                         218   8e-62   
ref|XP_006646554.1|  PREDICTED: protein notum homolog                   217   8e-62   
ref|XP_010489689.1|  PREDICTED: protein notum homolog                   218   9e-62   
ref|XP_003566691.2|  PREDICTED: uncharacterized protein LOC100837473    219   9e-62   
ref|XP_002459181.1|  hypothetical protein SORBIDRAFT_03g047440          219   9e-62   
ref|XP_002876658.1|  pectinacetylesterase family protein                218   9e-62   
ref|XP_010464149.1|  PREDICTED: protein notum homolog                   218   9e-62   



>ref|XP_009799834.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=392

 Score =   294 bits (752),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 162/399 (41%), Positives = 234/399 (59%), Gaps = 25/399 (6%)
 Frame = +1

Query  109   MAVSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLL-IPKTIIPGADEKGAVCLD  285
             M ++ R     CL++ SL I         I T    DLD   + KTI+  A  KGAVCLD
Sbjct  1     MVMATRCLQLFCLIVCSLAI---------IKTESATDLDFYEVKKTIVKNAVSKGAVCLD  51

Query  286   GSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMK-RELGSTFNM  462
             GSPPAYHF PG  E   NW + LAGG WCTS          VE+C  R++  ++GST  M
Sbjct  52    GSPPAYHFEPGFGEGVGNWFVQLAGGAWCTS----------VETCKERIRDNKVGSTTIM  101

Query  463   APFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVV  639
              PF F+GI+  N +    FY WN+V++RYCDGG+F GDVE  DP T L++RGARIF+ VV
Sbjct  102   GPFTFQGIYSKNQSANPDFYNWNKVLVRYCDGGAFTGDVEYVDPATNLHFRGARIFEAVV  161

Query  640   DELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPER  819
             ++++AKG+K+AKN I AG SAGG   +++CD F S  P   RVKC  D   F+  K+ ++
Sbjct  162   EDVLAKGLKNAKNAILAGSSAGGYPAMLYCDHFRSLLPNTPRVKCFVDGGYFIHAKNQKQ  221

Query  820   AKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQV  999
             A+ F+ +++ +V LH   K+LP  CTSKM P  C  P+N+ Q +K PLFI  SA+D FQ+
Sbjct  222   ARGFEEIYNGLVTLHGSGKTLPKSCTSKMKPLLCLFPENMQQNIKIPLFIAMSAFDIFQI  281

Query  1000  QNTFSMDLYRAIKNRSSISPTDMALLQDFKKQIISALPKPSATK--GFIVTSNFGHSFAS  1173
               T   +L+  I+N +  +  + A  ++F+ + +S LPKP+  K  G  + S   H+   
Sbjct  282   NTTVEPNLHDVIENGTCTTSQNKA-FREFRSEFLSTLPKPNNPKMRGVFIDSVNHHTSLL  340

Query  1174  ADYKKRMFADSKSKTIEDGFYNWFFDKHPINLIDPNNVP  1290
               +         + ++   F +W+FD+    +ID +++P
Sbjct  341   TRWSPENATMINNLSLPKAFGDWYFDRKYWYVIDEHDLP  379



>ref|XP_006355154.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=409

 Score =   290 bits (743),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 161/387 (42%), Positives = 230/387 (59%), Gaps = 16/387 (4%)
 Frame = +1

Query  139   ICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPG  318
             +CL I SL I     ++    TP + D    + KTI+  A  KGAVCLDGSPPAYHF PG
Sbjct  9     LCLFICSLAIINTVSSTKENVTPYL-DEAYHVSKTIVKNAVSKGAVCLDGSPPAYHFEPG  67

Query  319   KDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPFVFKGIFGIN  498
               + A  WL+ L+GG WC +          VE+C  R K E GS+  M  + F G+F  N
Sbjct  68    FGDGAQTWLVQLSGGEWCRT----------VEACLERSKSEFGSSNLMNSWWFTGMFSKN  117

Query  499   ATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAK  675
              +   +FY WN+V IRYCDGG F GDVE  DP TKL++RGARIF+ V+DEL+ KG+K AK
Sbjct  118   QSGNPEFYNWNKVFIRYCDGGGFTGDVEYVDPATKLHFRGARIFKAVMDELLEKGLKTAK  177

Query  676   NVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIV  855
             + +  G SAGG   +++CD F +  P   RVKC++D+  F+  K+P RA  F  +++ +V
Sbjct  178   SALLGGSSAGGFPAMLYCDYFRTLLPNTPRVKCMNDAGYFINAKEPFRAN-FTELYTALV  236

Query  856   ALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFSMDLYRAI  1035
              LH   K+LP ECTSKMSP  CF P+N+ QYVK+PLFI  SAYD +Q+ N+ ++ +   I
Sbjct  237   TLHGSAKALPKECTSKMSPELCFFPENMQQYVKTPLFIASSAYDKYQINNSIAVGINTCI  296

Query  1036  KNRSSISPTDMALLQDFKKQIISALPKPS--ATKGFIVTSNFGHSFASADYKKRMFADSK  1209
              + +  + T+   L +F+ + ++ALPKP+    KG  + S   HS     +         
Sbjct  297   GSSNCTATTNQTFL-EFRSRFLNALPKPTNPKLKGVFIDSFNHHSQVQFWWSPFNITTIN  355

Query  1210  SKTIEDGFYNWFFDKHPINLIDPNNVP  1290
             + T+   F +WF+D++   +I  + +P
Sbjct  356   NLTLSKAFADWFYDRNYTYVIHEHELP  382



>ref|XP_009600038.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=370

 Score =   286 bits (731),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 151/344 (44%), Positives = 214/344 (62%), Gaps = 23/344 (7%)
 Frame = +1

Query  109   MAVSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLL-IPKTIIPGADEKGAVCLD  285
             M ++ RS    CL++ SL I         I T    DLD   + KTI+  A  KGAVCLD
Sbjct  1     MVMATRSLQLFCLIVCSLAI---------IKTESATDLDFYEVKKTIVKNAVSKGAVCLD  51

Query  286   GSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMK-RELGSTFNM  462
             GSPPAYHF PG  E   NW + L+GG WCTS          VE+C  R +  ++GST  M
Sbjct  52    GSPPAYHFEPGFGEGVENWFVQLSGGAWCTS----------VEACKDRSRDNKVGSTTTM  101

Query  463   APFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVV  639
              P+ F+GI+  N +    FY WN+V++RYCDGG+F GDVE  DP T L++RGARIF+ V+
Sbjct  102   GPYTFQGIYSKNQSANPDFYNWNKVLVRYCDGGAFTGDVEYVDPATNLHFRGARIFEAVM  161

Query  640   DELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPER  819
             ++++AKG+K+AKN I AG SAGG   +++CDRF S  P   RVKC  D+  F+  K+ ++
Sbjct  162   EDVLAKGLKNAKNAILAGSSAGGYPAMLYCDRFRSLLPNTPRVKCFVDAGYFIHAKNQKQ  221

Query  820   AKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQV  999
             A+ F+ +++ +V LH   K+LP  CTSKM P  CF P+++ Q +K+PLFI  SA+D FQ+
Sbjct  222   ARGFEDIYNTLVTLHGSAKTLPKSCTSKMKPLLCFFPESMQQNIKTPLFIAMSAFDIFQI  281

Query  1000  QNTFSMDLYRAIKNRSSISPTDMALLQDFKKQIISALPKPSATK  1131
               T    L+  I+N +  +  + A  ++F+ + +S LPKP+  K
Sbjct  282   NTTVEPHLHDVIENGTCTTSQNKA-FREFRSEFLSTLPKPNNPK  324



>ref|XP_009605804.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=385

 Score =   285 bits (730),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 159/399 (40%), Positives = 238/399 (60%), Gaps = 25/399 (6%)
 Frame = +1

Query  109   MAVSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLL-IPKTIIPGADEKGAVCLD  285
             M ++ R+    CLL+ SL I         I +   +DL    + KTI+  A  KGAVCLD
Sbjct  1     MVMATRTLHLFCLLVCSLAI---------IKSECAKDLGSYNVTKTILKNAVSKGAVCLD  51

Query  286   GSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRM-KRELGSTFNM  462
             GSPPAYHF PG  +   NW++ L+GG WCT+          V+ C  R+  + +GST   
Sbjct  52    GSPPAYHFEPGFGKGIGNWIVQLSGGAWCTN----------VKECQDRIWDKNVGSTNFT  101

Query  463   APFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVV  639
               + F+GI+  N+T    FY WN+V +RYCDGG+F GDVE  D VT L++RGARIF+  +
Sbjct  102   DSWNFQGIYSENSTANPDFYNWNKVFVRYCDGGAFTGDVEYVDHVTNLHFRGARIFEAAM  161

Query  640   DELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPER  819
             +EL+AKG+K+AKN I AG SAGG   +++CD F S  P  +RVKCL DS  F+  K+P +
Sbjct  162   EELLAKGLKNAKNAILAGSSAGGYPTMLYCDHFRSLLPNTLRVKCLVDSGYFIHAKNPMQ  221

Query  820   AKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQV  999
             A+ F+ +++ ++ LH   K+LP  CTSKM+P  CF P+N+ Q++K+PLFI  SA+D +Q+
Sbjct  222   ARGFEKIYNSLLTLHGSTKALPKSCTSKMNPLLCFFPENMQQHIKTPLFIAMSAFDYYQM  281

Query  1000  QNTFSMDLYRAIKNRSSISPTDMALLQDFKKQIISALPKPSATK--GFIVTSNFGHSFAS  1173
             + T   +  R ++NR+     + A  ++F+ + +SALPK +  K  G  + S   HS  S
Sbjct  282   KTTIDPNADRCVENRTCTERQNKA-FREFRSEFLSALPKSNNPKLRGVFIDSVIHHSALS  340

Query  1174  ADYKKRMFADSKSKTIEDGFYNWFFDKHPINLIDPNNVP  1290
               +         + +    F +W+FD+    +ID +++P
Sbjct  341   YRWTLENAIMINNLSAPKAFADWYFDRKYWYVIDKHDLP  379



>ref|XP_010318089.1| PREDICTED: protein notum homolog [Solanum lycopersicum]
Length=407

 Score =   281 bits (719),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 160/389 (41%), Positives = 226/389 (58%), Gaps = 23/389 (6%)
 Frame = +1

Query  139   ICLLIFSLVI--SVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFS  312
             +CL I SL I  +V   N N +P          + KTI+  A  KGAVCLDGSPPAYHF 
Sbjct  11    LCLSICSLAIINTVSSANENYLPEA------YHVSKTIVKNAVAKGAVCLDGSPPAYHFE  64

Query  313   PGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPFVFKGIFG  492
             PG  + A  WL+ L+GG WC            VE+C  R K +LGS+  M  + F G+F 
Sbjct  65    PGFGDGAETWLVQLSGGEWCRD----------VEACLDRSKSDLGSSNVMGSWWFTGMFS  114

Query  493   INATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKD  669
              N +   +FY WN+V IRYCDGG F GDVE  DP TKL++RGARIF+ V+DEL+ KG+K 
Sbjct  115   KNQSGNPEFYNWNKVFIRYCDGGGFTGDVEYVDPATKLHFRGARIFKAVLDELLEKGLKT  174

Query  670   AKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSD  849
             AK+ + +G SAGG   ++HCD F +  P   RVKC++D+  F+  K+P     F  +++ 
Sbjct  175   AKSALLSGSSAGGFPAMLHCDYFRTLLPNTPRVKCMNDAGYFINPKEPFLTN-FTELYTS  233

Query  850   IVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFSMDLYR  1029
             +V LH   K+LP ECTSKMSP  CF P+N+ QYVK+PLFI  SAYD +Q+ ++ +  +  
Sbjct  234   LVTLHGSAKALPKECTSKMSPELCFFPENMQQYVKTPLFIASSAYDKYQINSSIANGINT  293

Query  1030  AIKNRSSISPTDMALLQDFKKQIISALPKPS--ATKGFIVTSNFGHSFASADYKKRMFAD  1203
              I   +  + T+   L+ F+ + ++ALPKP+    KG  + S   HS     +       
Sbjct  294   CIGYANCTAATNQTFLE-FRSRFLNALPKPTNPKLKGVFIDSFNHHSQVQYWWSPINITT  352

Query  1204  SKSKTIEDGFYNWFFDKHPINLIDPNNVP  1290
               + TI     +WF+D++   +I  + +P
Sbjct  353   INNLTISKALADWFYDRNYTYVIHEHELP  381



>ref|XP_009601364.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=392

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 160/385 (42%), Positives = 220/385 (57%), Gaps = 28/385 (7%)
 Frame = +1

Query  136   WICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSP  315
             W   +IF L+ SV  V +  +P  +         KT++  A  KGAVCLDGSP AYH+  
Sbjct  8     WYQWIIFLLICSVMKVKAEVLPNKV--------AKTLVQDAFSKGAVCLDGSPAAYHYDK  59

Query  316   GKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPFVFKGIFGI  495
             G  +  +NW+++L GGGWC            VE C  R     G + +M    F G+   
Sbjct  60    GYGDGVNNWVVWLEGGGWCKR----------VEDCGRRFNYSNGFSNHMDSKSFYGLLSN  109

Query  496   NATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDA  672
             + T   +FY W+R++IRYCDG S+ GDVE  D  T  +YRGARIFQ +++EL+AKGMK+A
Sbjct  110   SKTSNPEFYNWHRIMIRYCDGSSYTGDVELVDKATNQHYRGARIFQAIMEELLAKGMKNA  169

Query  673   KNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDI  852
             KN I +G SAGGLG + HCDRF S  P  VRVKCLSD + FL+  D +RAK  ++ +  +
Sbjct  170   KNAILSGCSAGGLGTMFHCDRFRSLLPSTVRVKCLSDGAYFLLDNDFKRAKILESTYRGV  229

Query  853   VALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF-----SM  1017
             V LH   K LP  CTS+M+P  CF P+++ Q +K+PLFI +SAYDS+Q+ +T        
Sbjct  230   VNLHNSAKMLPPSCTSRMNPTSCFFPQHIQQDIKTPLFILNSAYDSWQIVDTVIPFADRQ  289

Query  1018  DLYRAI-KNRSSISPTDMALLQDFKKQIISALPK--PSATKGFIVTSNFGHSFASADYKK  1188
             D      KN S  SP    +LQ F  + +SALPK    + +G  + S   H     D+  
Sbjct  290   DFAENCKKNLSKCSPDQQKMLQGFGAEFLSALPKSYSPSQRGMYINSCLMHCQTDHDWSW  349

Query  1189  RMFAD-SKSKTIEDGFYNWFFDKHP  1260
                +D   +KTI   F +WFF++ P
Sbjct  350   NSNSDLLNNKTIAKVFGDWFFERDP  374



>ref|XP_010314003.1| PREDICTED: protein notum homolog isoform X1 [Solanum lycopersicum]
Length=404

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 157/402 (39%), Positives = 227/402 (56%), Gaps = 20/402 (5%)
 Frame = +1

Query  109   MAVSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQ----DLDLLIPKTIIPGADEKGAV  276
             + +S RS   +CLLI SL IS    +S      + Q    D    +  TI+  A  KGAV
Sbjct  2     LTMSTRSVRLVCLLICSLAISKS--DSTKANELLKQEKHADHAYFVDITIVQNAVSKGAV  59

Query  277   CLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTF  456
             CLDGSPPAYH  PG      NW+I L+GG WC +             C +R K +LGS+ 
Sbjct  60    CLDGSPPAYHLDPGFGHGVRNWIILLSGGAWCRN----------TTDCLNRSKTDLGSST  109

Query  457   NMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQV  633
              M PF+F GIF  + T    FY WN+V +RYCDGG+F GD+E  DP T L++RGARIF  
Sbjct  110   LMLPFIFLGIFSKSKTENPDFYNWNKVFVRYCDGGAFTGDIENVDPATNLHFRGARIFDA  169

Query  634   VVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDP  813
             ++++L+AKG+KDAKN I +GGSA G   +++CD F S  PK  RVKCL D+  F+ VK+P
Sbjct  170   IIEDLLAKGLKDAKNAILSGGSANGYPAMLYCDHFHSLLPKAHRVKCLVDAGYFIRVKNP  229

Query  814   ERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSF  993
                  F+++F D+V LH   K LP  CTS+M P  CF P+N+ + +K+P F   SA+DS+
Sbjct  230   LLTNVFESIFKDVVTLHGSTKVLPKSCTSRMKPELCFFPENIQRDIKTPFFTVMSAFDSY  289

Query  994   QVQNTFSMDLYRAIKNRSSISPTDMALLQDFKKQIISALPKPS--ATKGFIVTSNFGHSF  1167
             QV +    D+   I+ R+     + A  ++ + + + ALPK +    +G  + S   H+ 
Sbjct  290   QVNSIIGFDIGEYIQARNCTENQNNA-FKELRSEFLRALPKANDPKQRGVFIDSFNRHTQ  348

Query  1168  ASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLIDPNNVPF  1293
                 + K       + T    F +W++D+    +ID +++P 
Sbjct  349   LELWWNKINATPVNNLTTIKVFGDWYYDRKYSYVIDEHDLPL  390



>ref|XP_009590663.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana tomentosiformis]
Length=401

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 158/399 (40%), Positives = 228/399 (57%), Gaps = 18/399 (5%)
 Frame = +1

Query  115   VSPRSNDWICLLIFSLVI---SVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLD  285
             ++ RS   +CLLI S  I   +   VN +      I D    +  TI+  A  KGAVCLD
Sbjct  1     MATRSVQLVCLLICSQAIIKTASAKVNESFKQEKGI-DHAYFVDTTIVQNALSKGAVCLD  59

Query  286   GSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMA  465
             GSPPAYH   G      NW+I L+GG WC +          +  C +R K +LGS+ +M 
Sbjct  60    GSPPAYHLDRGFGHGVRNWIILLSGGAWCRN----------ITDCLNRSKTDLGSSKHMT  109

Query  466   PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVD  642
             PF+F GIF  + +    FY WN+V +RYCDGG F GD+E  DP T L++RGARIF  V++
Sbjct  110   PFIFLGIFSKSKSENPDFYNWNKVFVRYCDGGGFTGDIESIDPATNLHFRGARIFDAVIE  169

Query  643   ELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERA  822
             +L+AKG+KDAKN I +GGSA G   +++CDRF +   K  RVKCL D+  F+ VK+P  A
Sbjct  170   DLLAKGLKDAKNAILSGGSANGYPAVLYCDRFHNLLHKAHRVKCLVDAGYFIHVKNPRLA  229

Query  823   KYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQ  1002
               F+++F D+V LH   K LP  CTSKM P  CF P+N+ Q +K+P F   SA+DS+QV 
Sbjct  230   NVFESLFRDVVTLHGSTKVLPKSCTSKMKPELCFFPENIQQDIKTPFFTVMSAFDSYQVD  289

Query  1003  NTFSMDLYRAIKNRSSISPTDMALLQDFKKQIISALPKPS--ATKGFIVTSNFGHSFASA  1176
             N    D+   I+ R+     +    ++ + + +SALPKP+    +G  + S   H+    
Sbjct  290   NIIGSDIGDCIRARNCTESQNND-FKELRSEFLSALPKPNDPKQRGAFIDSFNRHTQLEL  348

Query  1177  DYKKRMFADSKSKTIEDGFYNWFFDKHPINLIDPNNVPF  1293
              + K       + T  + F +W++D+    +ID +++P 
Sbjct  349   WWNKVNATPINNLTTIEVFGDWYYDRKYSYVIDDHDLPL  387



>ref|XP_010314004.1| PREDICTED: protein notum homolog isoform X2 [Solanum lycopersicum]
Length=401

 Score =   276 bits (707),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 157/400 (39%), Positives = 226/400 (57%), Gaps = 20/400 (5%)
 Frame = +1

Query  115   VSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQ----DLDLLIPKTIIPGADEKGAVCL  282
             +S RS   +CLLI SL IS    +S      + Q    D    +  TI+  A  KGAVCL
Sbjct  1     MSTRSVRLVCLLICSLAISKS--DSTKANELLKQEKHADHAYFVDITIVQNAVSKGAVCL  58

Query  283   DGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNM  462
             DGSPPAYH  PG      NW+I L+GG WC +             C +R K +LGS+  M
Sbjct  59    DGSPPAYHLDPGFGHGVRNWIILLSGGAWCRN----------TTDCLNRSKTDLGSSTLM  108

Query  463   APFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVV  639
              PF+F GIF  + T    FY WN+V +RYCDGG+F GD+E  DP T L++RGARIF  ++
Sbjct  109   LPFIFLGIFSKSKTENPDFYNWNKVFVRYCDGGAFTGDIENVDPATNLHFRGARIFDAII  168

Query  640   DELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPER  819
             ++L+AKG+KDAKN I +GGSA G   +++CD F S  PK  RVKCL D+  F+ VK+P  
Sbjct  169   EDLLAKGLKDAKNAILSGGSANGYPAMLYCDHFHSLLPKAHRVKCLVDAGYFIRVKNPLL  228

Query  820   AKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQV  999
                F+++F D+V LH   K LP  CTS+M P  CF P+N+ + +K+P F   SA+DS+QV
Sbjct  229   TNVFESIFKDVVTLHGSTKVLPKSCTSRMKPELCFFPENIQRDIKTPFFTVMSAFDSYQV  288

Query  1000  QNTFSMDLYRAIKNRSSISPTDMALLQDFKKQIISALPKPS--ATKGFIVTSNFGHSFAS  1173
              +    D+   I+ R+     + A  ++ + + + ALPK +    +G  + S   H+   
Sbjct  289   NSIIGFDIGEYIQARNCTENQNNA-FKELRSEFLRALPKANDPKQRGVFIDSFNRHTQLE  347

Query  1174  ADYKKRMFADSKSKTIEDGFYNWFFDKHPINLIDPNNVPF  1293
               + K       + T    F +W++D+    +ID +++P 
Sbjct  348   LWWNKINATPVNNLTTIKVFGDWYYDRKYSYVIDEHDLPL  387



>ref|XP_009589914.1| PREDICTED: uncharacterized protein LOC104087209 isoform X1 [Nicotiana 
tomentosiformis]
Length=400

 Score =   276 bits (707),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 169/407 (42%), Positives = 232/407 (57%), Gaps = 30/407 (7%)
 Frame = +1

Query  103   LRMAVSPRSNDWICLLIFSLVI----SVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKG  270
             +R ++       +CLLIFSL++    +V  VN        + DL      TI+  A  KG
Sbjct  1     MRRSMEHTKLQCLCLLIFSLLVLNGKTVLGVNQTSNENLGMVDL------TILESAVSKG  54

Query  271   AVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGS  450
             AVCLDGSPPA+++  G  E A+NW+IY  GG WC           +V  C +R K E GS
Sbjct  55    AVCLDGSPPAFYYDKGHGEGANNWIIYFRGGEWC----------YNVIDCLNRTKTEKGS  104

Query  451   TFNMAP--FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGAR  621
             +  +AP    F GI   N T    FY WNRV++ YCDG SF GDVE  DPVT L++RGAR
Sbjct  105   S-KLAPKQRSFYGILSNNKTLNPDFYNWNRVMVIYCDGASFTGDVEIVDPVTNLHFRGAR  163

Query  622   IFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLI  801
             IF  +++  +AKGMKDAKN I AGGSAGGL  L+HCDRF +  P   RVKCL+D S FL 
Sbjct  164   IFHALIEHFLAKGMKDAKNAILAGGSAGGLPALLHCDRFRALLPNSARVKCLADGSYFLH  223

Query  802   VKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSA  981
              K+ +   +   V   ++ LH   K LP  C SKM P  C  P+   Q +++P FI +S 
Sbjct  224   KKNMKEIPFMDIVNEGLITLHHSAKMLPSSCISKMRPSLCLFPQYFQQEIQTPFFIVNSM  283

Query  982   YDSFQVQNTFSMDLYRAIKNRSSISPTDMALLQDFKKQIISALPKP---SATKGFIVTSN  1152
             +D+FQ+  TF +  Y  + N ++ S T +  LQDFK++ +SALPK    S+++G  + S 
Sbjct  284   FDTFQINKTF-LGYYEDLNN-NTCSATLVKTLQDFKQEFLSALPKQSDCSSSRGMFIDSC  341

Query  1153  FGHSFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLIDPNNVPF  1293
               HS   +      F    +KTI + F +W+FD+  + LID  ++P 
Sbjct  342   LIHSQILSGVGWNGFT-VHNKTIAEAFSDWYFDRSSVQLIDTPDLPL  387



>ref|XP_009624847.1| PREDICTED: protein notum homolog isoform X2 [Nicotiana tomentosiformis]
Length=388

 Score =   276 bits (705),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 161/402 (40%), Positives = 228/402 (57%), Gaps = 25/402 (6%)
 Frame = +1

Query  109   MAVSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLL-IPKTIIPGADEKGAVCLD  285
             M +  RS     L IF L I +           + Q+ D+  + KTI+  A  KGAVCLD
Sbjct  1     MMMVTRSFQLFVLFIFPLTIFITEC------AKVTQNPDVYNVTKTIVHSAVSKGAVCLD  54

Query  286   GSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMA  465
             GSPPAYHF PG  E   NWL+ L+GGGWCT+          V+ C +R K ++GS+  M 
Sbjct  55    GSPPAYHFDPGFGEGVGNWLVQLSGGGWCTN----------VKDCLNRSKSDVGSSSYMH  104

Query  466   PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVD  642
             P  FKGIF  N +    FY WN+V +RYCDGGSF GDVE  DP T L++RGARIF  V++
Sbjct  105   PQPFKGIFSKNQSANPDFYNWNKVFVRYCDGGSFTGDVEYVDPATNLHFRGARIFTAVLE  164

Query  643   ELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERA  822
             EL+AKG+K+AKN I AG SAGG   +++CDRF +  P   RVKCL DS  F+  K+P   
Sbjct  165   ELLAKGLKNAKNAILAGSSAGGYPAILYCDRFRNLLPNTSRVKCLVDSGYFVHFKNPVLG  224

Query  823   KYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQ  1002
             + F++++  +  L    K+LP  CTSKM P  C   +N+ Q +K+P+FI  SA+D+   Q
Sbjct  225   RPFESIYKGVATLQGSAKTLPKSCTSKMKPELCLFAENIQQDIKTPIFISMSAFDNIMTQ  284

Query  1003  NTFSMDLYRAIKNRSSISPTDMALLQDFKKQIISALPKPSATKGFIVTSNFGHSFASADY  1182
              T    +Y  I+N  + + +     Q+ +   +SA+PK +  K   V  +  H   S   
Sbjct  285   YTLGGTIYGCIQN-GTCTASQNKTFQEMRSDFLSAIPKGNNPKLRGVFIDVVHHHTSLQK  343

Query  1183  KKRMFADSKSKTIED-----GFYNWFFDKHPINLIDPNNVPF  1293
             + R ++  K   + +      F +W+FD++   LID +N+P 
Sbjct  344   QTR-WSPEKPIVVHNLAAPKAFSDWYFDRNYTYLIDEHNLPL  384



>ref|XP_009779347.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana sylvestris]
Length=386

 Score =   276 bits (705),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 157/397 (40%), Positives = 233/397 (59%), Gaps = 25/397 (6%)
 Frame = +1

Query  115   VSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLL-IPKTIIPGADEKGAVCLDGS  291
             ++ R+    C L+ SL I         I +   +DL    + KTI+  A  KGAVCLDGS
Sbjct  1     MAARTLHLFCFLVCSLAI---------IKSECAKDLGSYNVTKTILKNAVSKGAVCLDGS  51

Query  292   PPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSR-MKRELGSTFNMAP  468
             PPAYHF PG  +   NW++ L+GG WCT+          V  C  R + + +GST     
Sbjct  52    PPAYHFEPGFGKGVGNWIVQLSGGAWCTN----------VTECQDRILDKNVGSTNFTDS  101

Query  469   FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDE  645
             + F+GI+  N T    FY WN+V +RYCDGG+F GDVE  D VT L++RGARIF+ V+++
Sbjct  102   WTFQGIYSENPTANPDFYNWNKVFVRYCDGGAFTGDVEYVDHVTNLHFRGARIFEAVMED  161

Query  646   LMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAK  825
             L+AKG+K+AKN I AG SAGG   +++CD F S  P   RVKCL DS  F+ VK+P +A 
Sbjct  162   LLAKGLKNAKNAILAGSSAGGYPTMLYCDHFRSLLPNTPRVKCLVDSGYFIHVKNPMQAS  221

Query  826   YFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQN  1005
              F+ +++ ++ LH   K+LP  CTSKM+P  CF P+N+ Q++K+PLFI  SA+D +Q++ 
Sbjct  222   GFEKIYNSLLTLHGSTKALPKSCTSKMNPPLCFFPENMQQHIKTPLFIAMSAFDYYQIKT  281

Query  1006  TFSMDLYRAIKNRSSISPTDMALLQDFKKQIISALPKPSATK--GFIVTSNFGHSFASAD  1179
             T   +  R ++NR+     + A  ++F+ + +SALP  +  K  G  + S   HS  S  
Sbjct  282   TIDPNADRCVENRTCTECQNKA-FREFRSEFLSALPISNNPKLRGVFIDSVIHHSALSYR  340

Query  1180  YKKRMFADSKSKTIEDGFYNWFFDKHPINLIDPNNVP  1290
             +         + +    F +W+FD+    +ID +++P
Sbjct  341   WTPENAILINNLSAPKAFADWYFDRKYWYVIDKHDLP  377



>ref|XP_009589915.1| PREDICTED: uncharacterized protein LOC104087209 isoform X2 [Nicotiana 
tomentosiformis]
Length=399

 Score =   276 bits (705),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 168/395 (43%), Positives = 228/395 (58%), Gaps = 30/395 (8%)
 Frame = +1

Query  139   ICLLIFSLVI----SVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYH  306
             +CLLIFSL++    +V  VN        + DL      TI+  A  KGAVCLDGSPPA++
Sbjct  12    LCLLIFSLLVLNGKTVLGVNQTSNENLGMVDL------TILESAVSKGAVCLDGSPPAFY  65

Query  307   FSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAP--FVFK  480
             +  G  E A+NW+IY  GG WC           +V  C +R K E GS+  +AP    F 
Sbjct  66    YDKGHGEGANNWIIYFRGGEWC----------YNVIDCLNRTKTEKGSS-KLAPKQRSFY  114

Query  481   GIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAK  657
             GI   N T    FY WNRV++ YCDG SF GDVE  DPVT L++RGARIF  +++  +AK
Sbjct  115   GILSNNKTLNPDFYNWNRVMVIYCDGASFTGDVEIVDPVTNLHFRGARIFHALIEHFLAK  174

Query  658   GMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKA  837
             GMKDAKN I AGGSAGGL  L+HCDRF +  P   RVKCL+D S FL  K+ +   +   
Sbjct  175   GMKDAKNAILAGGSAGGLPALLHCDRFRALLPNSARVKCLADGSYFLHKKNMKEIPFMDI  234

Query  838   VFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFSM  1017
             V   ++ LH   K LP  C SKM P  C  P+   Q +++P FI +S +D+FQ+  TF +
Sbjct  235   VNEGLITLHHSAKMLPSSCISKMRPSLCLFPQYFQQEIQTPFFIVNSMFDTFQINKTF-L  293

Query  1018  DLYRAIKNRSSISPTDMALLQDFKKQIISALPKP---SATKGFIVTSNFGHSFASADYKK  1188
               Y  + N ++ S T +  LQDFK++ +SALPK    S+++G  + S   HS   +    
Sbjct  294   GYYEDLNN-NTCSATLVKTLQDFKQEFLSALPKQSDCSSSRGMFIDSCLIHSQILSGVGW  352

Query  1189  RMFADSKSKTIEDGFYNWFFDKHPINLIDPNNVPF  1293
               F    +KTI + F +W+FD+  + LID  ++P 
Sbjct  353   NGFT-VHNKTIAEAFSDWYFDRSSVQLIDTPDLPL  386



>ref|XP_009784099.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=392

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 159/385 (41%), Positives = 217/385 (56%), Gaps = 28/385 (7%)
 Frame = +1

Query  136   WICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSP  315
             W   +I  L+ SV  V +  IP  +         KT++  A  KGAVCLDGSP AYH+  
Sbjct  8     WYQWIIVLLICSVMKVKAEVIPNKV--------AKTLVQDAFSKGAVCLDGSPAAYHYDQ  59

Query  316   GKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPFVFKGIFGI  495
             G  +  +NW+++L GGGWC S          VE C  R     GS+ ++    F G+   
Sbjct  60    GSGDGVNNWIVWLEGGGWCRS----------VEDCGQRFNYSNGSSNHIDSKSFYGLLSN  109

Query  496   NATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDA  672
             + T    FY W+R++IRYCDG S+ GDVE  D VT  +YRGARIFQ ++DEL+AKGMK+A
Sbjct  110   SKTSNPDFYNWHRIMIRYCDGSSYTGDVELVDKVTNQHYRGARIFQAIMDELLAKGMKNA  169

Query  673   KNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDI  852
              N I +G SAGGLG + HCDRF S  P   RVKCLSD + FL+  D +R    ++ +  +
Sbjct  170   TNAILSGCSAGGLGTMFHCDRFRSLLPSTARVKCLSDGAYFLLDNDFKRVNILESTYDGV  229

Query  853   VALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF-----SM  1017
             V LH   K LP  CTS+M+P  CF P+++ + +K+PLFI +SAYDS+Q+ +T        
Sbjct  230   VNLHNSAKVLPPSCTSRMNPASCFFPQHIQEDIKTPLFILNSAYDSWQIVDTVIPFADRQ  289

Query  1018  DLYRAI-KNRSSISPTDMALLQDFKKQIISALPK--PSATKGFIVTSNFGHSFASADYKK  1188
             D      KN S  SP    LLQ F  + +SALPK    + +G  + S   H     D+  
Sbjct  290   DFAENCKKNLSKCSPHQQKLLQGFGAEFLSALPKSYSPSQRGMYINSCLMHCQTDHDWSW  349

Query  1189  RMFAD-SKSKTIEDGFYNWFFDKHP  1260
                +D   +KTI   F +WFF++ P
Sbjct  350   NSNSDLLNNKTIAKVFGDWFFERDP  374



>ref|XP_009803843.1| PREDICTED: uncharacterized protein LOC104249167 [Nicotiana sylvestris]
 ref|XP_009803844.1| PREDICTED: uncharacterized protein LOC104249167 [Nicotiana sylvestris]
Length=396

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 164/393 (42%), Positives = 224/393 (57%), Gaps = 26/393 (7%)
 Frame = +1

Query  139   ICLLIFSLVI--SVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFS  312
             +CLLI SL++      +  N      +  +D+    TI+  A  KGAVCLDGSPPA+++ 
Sbjct  9     LCLLICSLIVLNGKTVLGGNQTSNENLGMVDI----TILESAVSKGAVCLDGSPPAFYYD  64

Query  313   PGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAP--FVFKGI  486
              G  E A+NW+IY  GG WC           +V  C +R K E GS+  +AP    F GI
Sbjct  65    KGHGEGANNWIIYFRGGEWC----------YNVLDCLNRTKTEKGSS-KLAPKQRSFYGI  113

Query  487   FGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGM  663
              G N T    FY WNRV++ YCDG SF GDVE  DPVT L++RGAR+F  +++  +  GM
Sbjct  114   LGNNKTENPDFYNWNRVMVIYCDGSSFTGDVEIVDPVTNLHFRGARVFHALIEHFLVIGM  173

Query  664   KDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVF  843
             KDAKN I +GGSAGGL  L+HCDRF +  P   RVKCL+D S FL  K+ +   +   V 
Sbjct  174   KDAKNAILSGGSAGGLPALLHCDRFRALLPNSARVKCLADGSYFLHKKNMKEIPFMDIVN  233

Query  844   SDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFSMDL  1023
               ++ LH   K LP  CTSKM P  C  P+   Q +++P FI +S +D+FQ+  TF    
Sbjct  234   EGLITLHHSAKMLPSSCTSKMRPSLCLFPQYFQQEIQTPFFIVNSMFDTFQINKTFPG--  291

Query  1024  YRAIKNRSSISPTDMALLQDFKKQIISALPKP---SATKGFIVTSNFGHSFASADYKKRM  1194
             Y    N ++ S T +  LQDFK++ +SALPK    S+++G  + S   HS   +      
Sbjct  292   YYEDLNNNTCSATLVKTLQDFKQEFLSALPKQSNCSSSRGMFIDSCLIHSQILSGVGWNG  351

Query  1195  FADSKSKTIEDGFYNWFFDKHPINLIDPNNVPF  1293
             F    +KTI + F NW+FD  P+ LID  ++P 
Sbjct  352   FT-VHNKTIAEAFSNWYFDLSPVQLIDTPDMPL  383



>ref|XP_009624845.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana tomentosiformis]
Length=390

 Score =   271 bits (693),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 161/404 (40%), Positives = 228/404 (56%), Gaps = 27/404 (7%)
 Frame = +1

Query  109   MAVSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLL-IPKTIIPGADEKGAVCLD  285
             M +  RS     L IF L I +           + Q+ D+  + KTI+  A  KGAVCLD
Sbjct  1     MMMVTRSFQLFVLFIFPLTIFITEC------AKVTQNPDVYNVTKTIVHSAVSKGAVCLD  54

Query  286   GSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMA  465
             GSPPAYHF PG  E   NWL+ L+GGGWCT+          V+ C +R K ++GS+  M 
Sbjct  55    GSPPAYHFDPGFGEGVGNWLVQLSGGGWCTN----------VKDCLNRSKSDVGSSSYMH  104

Query  466   PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVD  642
             P  FKGIF  N +    FY WN+V +RYCDGGSF GDVE  DP T L++RGARIF  V++
Sbjct  105   PQPFKGIFSKNQSANPDFYNWNKVFVRYCDGGSFTGDVEYVDPATNLHFRGARIFTAVLE  164

Query  643   ELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERA  822
             EL+AKG+K+AKN I AG SAGG   +++CDRF +  P   RVKCL DS  F+  K+P   
Sbjct  165   ELLAKGLKNAKNAILAGSSAGGYPAILYCDRFRNLLPNTSRVKCLVDSGYFVHFKNPVLG  224

Query  823   KYFKAVFSDIVALHQPN--KSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQ  996
             + F++++  +  L      K+LP  CTSKM P  C   +N+ Q +K+P+FI  SA+D+  
Sbjct  225   RPFESIYKGVATLQLQGSAKTLPKSCTSKMKPELCLFAENIQQDIKTPIFISMSAFDNIM  284

Query  997   VQNTFSMDLYRAIKNRSSISPTDMALLQDFKKQIISALPKPSATKGFIVTSNFGHSFASA  1176
              Q T    +Y  I+N  + + +     Q+ +   +SA+PK +  K   V  +  H   S 
Sbjct  285   TQYTLGGTIYGCIQN-GTCTASQNKTFQEMRSDFLSAIPKGNNPKLRGVFIDVVHHHTSL  343

Query  1177  DYKKRMFADSKSKTIED-----GFYNWFFDKHPINLIDPNNVPF  1293
               + R ++  K   + +      F +W+FD++   LID +N+P 
Sbjct  344   QKQTR-WSPEKPIVVHNLAAPKAFSDWYFDRNYTYLIDEHNLPL  386



>ref|XP_009778395.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=397

 Score =   271 bits (693),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 141/389 (36%), Positives = 227/389 (58%), Gaps = 18/389 (5%)
 Frame = +1

Query  139   ICLLI--FSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFS  312
             +C+LI   +++I+++        + I  D    + KT++  A  KGAVCLDGSPPAYHF 
Sbjct  10    VCVLICFLAIIINIEACVKENATSYI--DQGYYVEKTVVHNAVSKGAVCLDGSPPAYHFE  67

Query  313   PGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPFVFKGIFG  492
             PG  +    WL++L+GG WCT+          VE C +R K + GS+  M P+ F+GI+ 
Sbjct  68    PGFGDGVGKWLVHLSGGAWCTT----------VEECLNRSKSDFGSSNYMKPWWFQGIYS  117

Query  493   INATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKD  669
                +    FY WN+V +RYCDGG+F G+ E  DP T L++RGARIF+ V+++++AKG+K+
Sbjct  118   KTQSVNPDFYNWNKVFVRYCDGGAFTGNAEYVDPATNLHFRGARIFKAVMEDVLAKGLKN  177

Query  670   AKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSD  849
             A++ +  G SA G   +++CDRF    P   RVKC+ D+  F+ VKDP +A+ F  ++  
Sbjct  178   AQSALLIGSSAAGYPAMLYCDRFRKLLPNTPRVKCMVDAGYFIHVKDPHQARNFTEMYKA  237

Query  850   IVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFSMDLYR  1029
             IV LH   K+LP  CT KM P  CF P+N+   +K+PL+I  SA+D FQ+  T    +  
Sbjct  238   IVNLHGSAKTLPKSCTKKMKPEMCFFPENMQHKIKTPLYIAMSAFDKFQINTTIYDGINI  297

Query  1030  AIKNRSSISPTDMALLQDFKKQIISALPKPSATK--GFIVTSNFGHSFASADYKKRMFAD  1203
              I+   + + T+  L ++F+ + ++ALPK +  K  G  + +   H+     +  +    
Sbjct  298   CIEG-GNCTATENKLFREFRLEFLNALPKANNPKLRGAFIDARNHHTQVQGWWSPKNVTT  356

Query  1204  SKSKTIEDGFYNWFFDKHPINLIDPNNVP  1290
              K+  +   F +W++D++   +ID  ++P
Sbjct  357   VKNLNLMKAFADWYYDRNYTYVIDERDLP  385



>gb|EYU29129.1| hypothetical protein MIMGU_mgv1a023759mg [Erythranthe guttata]
Length=384

 Score =   271 bits (692),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 148/358 (41%), Positives = 206/358 (58%), Gaps = 23/358 (6%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYH   G  +  +NWLI+L GGGWC +          V +C
Sbjct  15    TYVESAVAKGAVCLDGSPPAYHLDKGSGDGTNNWLIHLEGGGWCNN----------VTTC  64

Query  421   SSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              SR    LGS+ +M+   +F GI   +  F   FY WNRV++RYCDG SF GD+E  DP 
Sbjct  65    ISRANGHLGSSKHMSNRTMFFGIANNDPQFNPDFYNWNRVVVRYCDGASFTGDIEAVDPA  124

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T LYYRGAR+F  V+++L+ KGMK+AKNVI  G SAGGL  ++HCDRF    P G  VKC
Sbjct  125   TNLYYRGARVFVAVMEDLLDKGMKNAKNVILTGCSAGGLASMLHCDRFKDLLPMGTNVKC  184

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             ++D+  FL VKD    + F+   +D+V  H   K+LP+ CTSKM P  CF P+ +VQ ++
Sbjct  185   MADAGFFLNVKDVSGNRRFEDFINDVVETHGSAKNLPLSCTSKMKPGLCFFPQQVVQEIQ  244

Query  955   SPLFIFHSAYDSFQVQNTFSMDL-------YRAIKNRSSISPTDMALLQDFKKQIISALP  1113
             +PLFI ++AYD++Q++N  +  +       Y    +  + S   +  L  F+K+ ++   
Sbjct  245   TPLFIVNAAYDAWQIKNVLAPAIADPSGIWYNCTTDIRNCSTAQLQTLHGFRKEFLNEFS  304

Query  1114  K--PSATKGFIVTSNFGHSFASAD--YKKRMFADSKSKTIEDGFYNWFFDKHPINLID  1275
                 S T+G+ + S F H        + K       +KTI     +WFFD+ P   ID
Sbjct  305   AIGTSITRGYFINSCFAHCQTEMQITWFKPNSPKLNNKTIAKAVGDWFFDRSPFQTID  362



>ref|XP_009797876.1| PREDICTED: protein notum homolog isoform X2 [Nicotiana sylvestris]
Length=388

 Score =   271 bits (692),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 160/402 (40%), Positives = 227/402 (56%), Gaps = 25/402 (6%)
 Frame = +1

Query  109   MAVSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLL-IPKTIIPGADEKGAVCLD  285
             M +  RS     L IF+L I +           + Q+ D+  I KTII  A  KGAVCLD
Sbjct  1     MMMVTRSFQLFVLFIFTLTIVITEC------AKVTQNPDVYNITKTIIHSAVSKGAVCLD  54

Query  286   GSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMA  465
             GSPPAYHF PG  +   NWL+ L+GGGWCT+          V+ C  R K +LGS+  M 
Sbjct  55    GSPPAYHFDPGFGDGVGNWLVQLSGGGWCTN----------VKECLDRAKSDLGSSNYMN  104

Query  466   PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVD  642
             P  F+G F  N +   +FY WN+V +RYCDGGSF GDVE  DP TKL++RGARIF VV++
Sbjct  105   PQEFQGFFSKNQSANPEFYNWNKVFVRYCDGGSFTGDVEYVDPATKLHFRGARIFTVVLE  164

Query  643   ELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERA  822
             EL+AKG+K+AKN I AG SAGG   +++CD F +  P   RVKCL DS  F+  K+    
Sbjct  165   ELLAKGLKNAKNAILAGSSAGGYPAMLYCDGFRNSLPNTSRVKCLVDSGYFVHFKNTVLG  224

Query  823   KYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQ  1002
             + F++++  I  L    K+LP  CTSKM P  C   +N+ Q +K+P+FI  SA+D+   Q
Sbjct  225   RPFESIYKGIATLQGSAKTLPKSCTSKMKPELCLFAENIQQDIKTPIFISMSAFDNIMTQ  284

Query  1003  NTFSMDLYRAIKNRSSISPTDMALLQDFKKQIISALPKPSATKGFIVTSNFGHSFASADY  1182
              T    +Y  I+   + + +    LQ+ +   ++A+PK +  K   V  +  H   S   
Sbjct  285   YTLGGGIYGCIQ-EGTCTASQNKTLQEMRSDFLNAIPKGNNPKLRGVFIDVVHHHTSLQK  343

Query  1183  KKRMFADSKSKTIED-----GFYNWFFDKHPINLIDPNNVPF  1293
             + R ++  K   + +      F +W+FD++   LID  ++P 
Sbjct  344   QTR-WSPVKPIVVHNLAAPKAFADWYFDRNYTYLIDERSLPL  384



>ref|XP_009607289.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=399

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/390 (37%), Positives = 224/390 (57%), Gaps = 20/390 (5%)
 Frame = +1

Query  139   ICLLI--FSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFS  312
             +C+LI   +++I++         + I  D    + KT++  A  KGAVCLDGSPPAYHF 
Sbjct  10    VCVLICFLAIIINIDACVKENATSDI--DQGYYVEKTVVHNAVSKGAVCLDGSPPAYHFE  67

Query  313   PGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPFVFKGIFG  492
             PG  +    WL++L+GG WCT+          VE C +R K + GS+  M P+ F GI+ 
Sbjct  68    PGFGDGVGKWLVHLSGGAWCTT----------VEECLNRSKSDFGSSKYMKPWWFIGIYS  117

Query  493   INATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKD  669
                +    FY WN+V +RYCDGG+F G+ E  DP T L++RGARIF+ V+++++AKG+K+
Sbjct  118   KTQSVNPDFYNWNKVFVRYCDGGAFTGNAEYVDPATNLHFRGARIFKAVMEDVLAKGLKN  177

Query  670   AKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSD  849
             A++ +  G SA G   +++CDRF    P   RVKC+ D+  F+ VKDP +A+ F  ++  
Sbjct  178   AQSALLIGSSAAGYPAMLYCDRFHKLLPNTPRVKCMVDAGYFIHVKDPHQARNFTQMYKA  237

Query  850   IVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFSMDLYR  1029
             IV LH   K+LP  C SKM P  CF P+N+   +K+PL+I  SA+D FQ+  T    +  
Sbjct  238   IVNLHGSAKTLPKSCISKMKPEMCFFPENMQHKIKTPLYIAMSAFDKFQINTTIYDGVNT  297

Query  1030  AIKNRSSISPTDMALLQDFKKQIISALPK---PSATKGFIVTSNFGHSFASADYKKRMFA  1200
              I+   + + T+  L +DF+ + ++ALPK   P     FI   N  H+     +  +   
Sbjct  298   CIEG-GNCTATENKLFRDFRLEFLNALPKGNNPKLRGAFIDARNH-HTQVQGWWSPKNVT  355

Query  1201  DSKSKTIEDGFYNWFFDKHPINLIDPNNVP  1290
               K+  +   F +W++D++   +ID  ++P
Sbjct  356   TVKNLNLMKAFGDWYYDRNYTYVIDERDLP  385



>ref|XP_008451860.1| PREDICTED: protein notum homolog isoform X1 [Cucumis melo]
Length=401

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 151/359 (42%), Positives = 211/359 (59%), Gaps = 25/359 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYHFS G     +NWLI L GGGWC +          V +C
Sbjct  33    TYVQDAGIKGAVCLDGSPPAYHFSDGFGSGINNWLIQLEGGGWCNN----------VTTC  82

Query  421   SSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
               R    LGS+  M     F GI      F   FY WNR+ +RYCDG SF GDVE  DP 
Sbjct  83    LQRRDTRLGSSKKMVTQLAFSGILSNKPQFNPDFYNWNRIKVRYCDGSSFTGDVEAVDPA  142

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L++RGAR+F+ ++D L+AKGMK+AKN I +G SAGGL  ++HCD F S  P   +VKC
Sbjct  143   TNLHFRGARVFRAIIDNLLAKGMKNAKNAILSGCSAGGLSSILHCDNFKSLLPPTTKVKC  202

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             LSD+  F+  KD   A++ +  +SD+V  H   K+LP+ CTSKM P  CF P+N+VQ ++
Sbjct  203   LSDAGYFINAKDVSGAQHIEGFYSDVVTTHGSAKNLPISCTSKMKPEMCFFPQNVVQLIQ  262

Query  955   SPLFIFHSAYDSFQVQNTFSMDL-------YRAIKNRSSISPTDMALLQDFKKQIISALP  1113
             +P+F+ ++AYDS+Q++N  +  +       +    +  + SP  + ++QDF+ Q +SAL 
Sbjct  263   TPIFLVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPIQLRIMQDFRVQFLSALT  322

Query  1114  --KPSATKGFIVTSNFGHSFASADYKKRMFADSK--SKT-IEDGFYNWFFDKHPINLID  1275
                 S ++G  + S + H   +   +  + +DS   SKT I     +WFFD+ P   ID
Sbjct  323   GVGSSLSRGLFIDSCYAHC-QTEMQETWLRSDSPMLSKTPIAKAVGDWFFDRAPFQKID  380



>ref|XP_008451861.1| PREDICTED: protein notum homolog isoform X2 [Cucumis melo]
Length=398

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 151/359 (42%), Positives = 211/359 (59%), Gaps = 25/359 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYHFS G     +NWLI L GGGWC +          V +C
Sbjct  30    TYVQDAGIKGAVCLDGSPPAYHFSDGFGSGINNWLIQLEGGGWCNN----------VTTC  79

Query  421   SSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
               R    LGS+  M     F GI      F   FY WNR+ +RYCDG SF GDVE  DP 
Sbjct  80    LQRRDTRLGSSKKMVTQLAFSGILSNKPQFNPDFYNWNRIKVRYCDGSSFTGDVEAVDPA  139

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L++RGAR+F+ ++D L+AKGMK+AKN I +G SAGGL  ++HCD F S  P   +VKC
Sbjct  140   TNLHFRGARVFRAIIDNLLAKGMKNAKNAILSGCSAGGLSSILHCDNFKSLLPPTTKVKC  199

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             LSD+  F+  KD   A++ +  +SD+V  H   K+LP+ CTSKM P  CF P+N+VQ ++
Sbjct  200   LSDAGYFINAKDVSGAQHIEGFYSDVVTTHGSAKNLPISCTSKMKPEMCFFPQNVVQLIQ  259

Query  955   SPLFIFHSAYDSFQVQNTFSMDL-------YRAIKNRSSISPTDMALLQDFKKQIISALP  1113
             +P+F+ ++AYDS+Q++N  +  +       +    +  + SP  + ++QDF+ Q +SAL 
Sbjct  260   TPIFLVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPIQLRIMQDFRVQFLSALT  319

Query  1114  --KPSATKGFIVTSNFGHSFASADYKKRMFADSK--SKT-IEDGFYNWFFDKHPINLID  1275
                 S ++G  + S + H   +   +  + +DS   SKT I     +WFFD+ P   ID
Sbjct  320   GVGSSLSRGLFIDSCYAHC-QTEMQETWLRSDSPMLSKTPIAKAVGDWFFDRAPFQKID  377



>ref|XP_011073252.1| PREDICTED: protein notum homolog isoform X2 [Sesamum indicum]
Length=398

 Score =   268 bits (684),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 148/371 (40%), Positives = 214/371 (58%), Gaps = 27/371 (7%)
 Frame = +1

Query  208   IIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDT  387
             +++     +  T +  A  KGAVCLDGSPPAYH   G     +NWL+++ GGGWC +   
Sbjct  18    VLRTESFFVDITYVQSAVAKGAVCLDGSPPAYHIDKGSGAGINNWLVHVEGGGWCNN---  74

Query  388   YSTHDLSVESCSSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGS  561
                    V +C +R K  LGS+  MA    F GIF     F   FY WNR+ +RYCDG S
Sbjct  75    -------VTTCLARTKTRLGSSKLMAKQIAFSGIFSNKPQFNPDFYNWNRIKVRYCDGAS  127

Query  562   FAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFT  741
             F GDVE  DP TKLYYRGAR+F  V+++L+AKGMK+A+N I +G SAGGL  ++HCD F 
Sbjct  128   FTGDVEVVDPATKLYYRGARVFVAVIEDLLAKGMKNAENAILSGCSAGGLTSILHCDNFK  187

Query  742   SRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFEC  921
             +  P G +VKC SD+  F+  KD   A + +  ++D+V  H   K+LP  CTS+M P  C
Sbjct  188   ALLPVGTKVKCFSDAGFFINAKDVSGAPHIQDFYNDVVTTHGSAKNLPQSCTSRMKPSLC  247

Query  922   FQPKNLVQYVKSPLFIFHSAYDSFQVQNTFS------MDLYRAIKNR-SSISPTDMALLQ  1080
             F P+N+ Q +++PLFI ++AYDS+Q++N  +        L+   K      S T +  +Q
Sbjct  248   FFPQNMAQGIRTPLFIVNAAYDSWQIKNILAPGVADPHGLWHDCKTDIVKCSTTQLQTMQ  307

Query  1081  DFKKQIISALP--KPSATKGFIVTSNFGHSFASADYKKRMF-ADSK---SKTIEDGFYNW  1242
             +F+ Q ++AL     S ++G+ +   + H     + ++  F  DS    +KTI     +W
Sbjct  308   EFRLQFLNALSGLGSSTSRGYFINGCYAH--CQTEMQETWFRGDSPLLYNKTIAKAVGDW  365

Query  1243  FFDKHPINLID  1275
             F+D+ P   ID
Sbjct  366   FYDRSPFQKID  376



>ref|XP_006365947.1| PREDICTED: uncharacterized protein LOC102601254 [Solanum tuberosum]
Length=401

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 154/400 (39%), Positives = 224/400 (56%), Gaps = 20/400 (5%)
 Frame = +1

Query  115   VSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQ----DLDLLIPKTIIPGADEKGAVCL  282
             +S RS   +CLLI SL IS    +S      + Q    D    + KTI+  +  KGAVCL
Sbjct  1     MSTRSVQLVCLLICSLAIS--KTDSTKANESLKQEKGADHAYFVDKTIVQNSVSKGAVCL  58

Query  283   DGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNM  462
             DGSPPAYH   G      NW+I L+GG WC +             C +R K +LGS+  M
Sbjct  59    DGSPPAYHLDRGFGHGLRNWIILLSGGAWCRN----------TTDCLNRSKTDLGSSTLM  108

Query  463   APFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVV  639
              PF+F GIF  +      FY WN+V +RYCDGG+F GD+E  DP T L++RGARIF  ++
Sbjct  109   LPFIFLGIFSKSKRENPDFYNWNKVFVRYCDGGAFTGDIENVDPATNLHFRGARIFDAII  168

Query  640   DELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPER  819
             ++L+AKG+KDAKN I +GGSA G   +++CD F S   K  RVKCL D+  F+ VK+P  
Sbjct  169   EDLLAKGLKDAKNAILSGGSANGYPAMLYCDHFRSLLHKAHRVKCLVDAGYFIRVKNPLL  228

Query  820   AKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQV  999
             A  F+++F D+V LH   K LP  CTS+M P  CF  +N+ + +K+P F   SA+DS+QV
Sbjct  229   ANVFESIFRDVVTLHGSTKVLPKSCTSRMKPELCFFLENIQRDIKTPFFTVMSAFDSYQV  288

Query  1000  QNTFSMDLYRAIKNRSSISPTDMALLQDFKKQIISALPKPS--ATKGFIVTSNFGHSFAS  1173
              +    D+   I+ R+     + A  ++ + + + ALPK +    +G  + S   H+   
Sbjct  289   NSIIGSDIGEYIQARNCTESQNNA-FKELRSEFLRALPKANDPKQRGAFIDSFNRHTQLE  347

Query  1174  ADYKKRMFADSKSKTIEDGFYNWFFDKHPINLIDPNNVPF  1293
               + K       + T    F +W++D+    +ID +++P 
Sbjct  348   LWWNKINATPVYNLTTIKVFGDWYYDRKYSYVIDEHDLPL  387



>ref|XP_009797875.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana sylvestris]
Length=390

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 160/404 (40%), Positives = 227/404 (56%), Gaps = 27/404 (7%)
 Frame = +1

Query  109   MAVSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLL-IPKTIIPGADEKGAVCLD  285
             M +  RS     L IF+L I +           + Q+ D+  I KTII  A  KGAVCLD
Sbjct  1     MMMVTRSFQLFVLFIFTLTIVITEC------AKVTQNPDVYNITKTIIHSAVSKGAVCLD  54

Query  286   GSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMA  465
             GSPPAYHF PG  +   NWL+ L+GGGWCT+          V+ C  R K +LGS+  M 
Sbjct  55    GSPPAYHFDPGFGDGVGNWLVQLSGGGWCTN----------VKECLDRAKSDLGSSNYMN  104

Query  466   PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVD  642
             P  F+G F  N +   +FY WN+V +RYCDGGSF GDVE  DP TKL++RGARIF VV++
Sbjct  105   PQEFQGFFSKNQSANPEFYNWNKVFVRYCDGGSFTGDVEYVDPATKLHFRGARIFTVVLE  164

Query  643   ELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERA  822
             EL+AKG+K+AKN I AG SAGG   +++CD F +  P   RVKCL DS  F+  K+    
Sbjct  165   ELLAKGLKNAKNAILAGSSAGGYPAMLYCDGFRNSLPNTSRVKCLVDSGYFVHFKNTVLG  224

Query  823   KYFKAVFSDIVALHQPN--KSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQ  996
             + F++++  I  L      K+LP  CTSKM P  C   +N+ Q +K+P+FI  SA+D+  
Sbjct  225   RPFESIYKGIATLQLQGSAKTLPKSCTSKMKPELCLFAENIQQDIKTPIFISMSAFDNIM  284

Query  997   VQNTFSMDLYRAIKNRSSISPTDMALLQDFKKQIISALPKPSATKGFIVTSNFGHSFASA  1176
              Q T    +Y  I+   + + +    LQ+ +   ++A+PK +  K   V  +  H   S 
Sbjct  285   TQYTLGGGIYGCIQ-EGTCTASQNKTLQEMRSDFLNAIPKGNNPKLRGVFIDVVHHHTSL  343

Query  1177  DYKKRMFADSKSKTIED-----GFYNWFFDKHPINLIDPNNVPF  1293
               + R ++  K   + +      F +W+FD++   LID  ++P 
Sbjct  344   QKQTR-WSPVKPIVVHNLAAPKAFADWYFDRNYTYLIDERSLPL  386



>ref|XP_011073171.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
Length=422

 Score =   267 bits (682),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 148/371 (40%), Positives = 214/371 (58%), Gaps = 27/371 (7%)
 Frame = +1

Query  208   IIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDT  387
             +++     +  T +  A  KGAVCLDGSPPAYH   G     +NWL+++ GGGWC +   
Sbjct  42    VLRTESFFVDITYVQSAVAKGAVCLDGSPPAYHIDKGSGAGINNWLVHVEGGGWCNN---  98

Query  388   YSTHDLSVESCSSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGS  561
                    V +C +R K  LGS+  MA    F GIF     F   FY WNR+ +RYCDG S
Sbjct  99    -------VTTCLARTKTRLGSSKLMAKQIAFSGIFSNKPQFNPDFYNWNRIKVRYCDGAS  151

Query  562   FAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFT  741
             F GDVE  DP TKLYYRGAR+F  V+++L+AKGMK+A+N I +G SAGGL  ++HCD F 
Sbjct  152   FTGDVEVVDPATKLYYRGARVFVAVIEDLLAKGMKNAENAILSGCSAGGLTSILHCDNFK  211

Query  742   SRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFEC  921
             +  P G +VKC SD+  F+  KD   A + +  ++D+V  H   K+LP  CTS+M P  C
Sbjct  212   ALLPVGTKVKCFSDAGFFINAKDVSGAPHIQDFYNDVVTTHGSAKNLPQSCTSRMKPSLC  271

Query  922   FQPKNLVQYVKSPLFIFHSAYDSFQVQNTFS------MDLYRAIKNR-SSISPTDMALLQ  1080
             F P+N+ Q +++PLFI ++AYDS+Q++N  +        L+   K      S T +  +Q
Sbjct  272   FFPQNMAQGIRTPLFIVNAAYDSWQIKNILAPGVADPHGLWHDCKTDIVKCSTTQLQTMQ  331

Query  1081  DFKKQIISALP--KPSATKGFIVTSNFGHSFASADYKKRMF-ADSK---SKTIEDGFYNW  1242
             +F+ Q ++AL     S ++G+ +   + H     + ++  F  DS    +KTI     +W
Sbjct  332   EFRLQFLNALSGLGSSTSRGYFINGCYAH--CQTEMQETWFRGDSPLLYNKTIAKAVGDW  389

Query  1243  FFDKHPINLID  1275
             F+D+ P   ID
Sbjct  390   FYDRSPFQKID  400



>ref|XP_003628996.1| Carboxylic ester hydrolase [Medicago truncatula]
 gb|AET03472.1| pectinacetylesterase family protein [Medicago truncatula]
Length=406

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 152/363 (42%), Positives = 213/363 (59%), Gaps = 27/363 (7%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGSPPAYHF  G DE A+NW++++ GGGWC  N TY       
Sbjct  27    VPLTRLESAVSKGAVCLDGSPPAYHFDQGHDEGANNWIVHIEGGGWC-HNVTY-------  78

Query  412   ESCSSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKP  585
               C  R    LGS+  M     F G    N  +   FY WNRV +RYCDG SF GDVE+ 
Sbjct  79    --CLYRRDSRLGSSHEMEEQTYFSGYLSDNQQYNPDFYNWNRVKVRYCDGSSFTGDVEEV  136

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             DP TKLYYRGARIF  V++EL+AKGM  A+N I +G SAGGL  ++HCD F + FP   R
Sbjct  137   DPTTKLYYRGARIFSAVMEELLAKGMDHAENAILSGCSAGGLTTILHCDGFRALFPNETR  196

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+ V D     Y +  +S +VA H   KSLP  CTS +SP  CF P+ +  
Sbjct  197   VKCVSDAGYFVNVNDISGDHYIEDYYSQVVATHGSEKSLPSSCTSMLSPGLCFFPQYMAS  256

Query  946   YVKSPLFIFHSAYDSFQVQNTFSM------DLYRAIK-NRSSISPTDMALLQDFKKQIIS  1104
              +++P+FI ++AYDS+Q++N  +         +R+ K N ++ SP  + ++QD++ Q + 
Sbjct  257   SIQTPIFIVNAAYDSWQIKNILAPGDADPDGQWRSCKTNLNNCSPEQLNIMQDYRTQFLE  316

Query  1105  ALP--KPSATKGFIVTSNFGHSFASADYKKRMF-ADS---KSKTIEDGFYNWFFDKHPIN  1266
             AL     S + G  + S + H     + ++  F +DS    +KT+     +WF+++ P  
Sbjct  317   ALSPISNSPSNGMFIDSCYVH--CQTEPQETWFKSDSPMVGNKTVAKAVGDWFYERSPSR  374

Query  1267  LID  1275
              ID
Sbjct  375   EID  377



>gb|EPS71696.1| hypothetical protein M569_03061, partial [Genlisea aurea]
Length=395

 Score =   266 bits (679),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 144/366 (39%), Positives = 212/366 (58%), Gaps = 33/366 (9%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T + GA EKGAVCLDGSPPAYH   G    A++WL+++ GGGWC +          V +C
Sbjct  21    TYVDGAVEKGAVCLDGSPPAYHLDLGSGAGANSWLVHVEGGGWCNN----------VTTC  70

Query  421   SSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              +R    LGS+  MA    F GIF     F   FY WNRV +RYCDG SF GDVE  DP 
Sbjct  71    LARRDTRLGSSRRMATQIAFSGIFSNRPQFNPDFYNWNRVKVRYCDGASFTGDVEAVDPA  130

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             TKLYYRGAR+   V+++L+AKGMK+A+N + +G SAGGL  ++HCD F +  P G RVKC
Sbjct  131   TKLYYRGARVLGAVIEDLLAKGMKNAENAVLSGCSAGGLTSILHCDAFKALLPVGTRVKC  190

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
              +D+  F+  +D   A +    ++D+   H   K+LP  CTS++ P  CF P+N+ Q ++
Sbjct  191   FADAGFFINARDVSGAAHINDFYNDVATTHGSAKNLPQGCTSRLKPGLCFFPQNVAQEIR  250

Query  955   SPLFIFHSAYDSFQVQNTFSMDL-------YRAIKNRSSISPTDMALLQDFKKQII----  1101
             +PLFI ++AYDS+Q++N  +  +       +    + +  S + +  +QDF+ Q +    
Sbjct  251   TPLFIVNAAYDSWQIKNILAPGVADPHGTWHDCKTDITKCSKSQLQTMQDFRTQFLKSLN  310

Query  1102  ----SALPKPSATKGFIVTSNFGHSFASADYKKRMF-ADS---KSKTIEDGFYNWFFDKH  1257
                 S+L    ++KG+ + S + H     + ++  F +DS     KTI +   +WFFD++
Sbjct  311   DGVGSSLTSTPSSKGYFINSCYAH--CQTEMQETWFRSDSPLLNDKTIAEAIGDWFFDRN  368

Query  1258  PINLID  1275
                 ID
Sbjct  369   SFQHID  374



>ref|XP_006587657.1| PREDICTED: protein notum homolog isoform X3 [Glycine max]
 gb|KHN11801.1| Protein notum like [Glycine soja]
Length=400

 Score =   265 bits (677),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 146/362 (40%), Positives = 215/362 (59%), Gaps = 25/362 (7%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P TI+  A  KGAVCLDGSPPAYHF  G     +NWL+   GGGWC +          V
Sbjct  27    VPITIVQNAVAKGAVCLDGSPPAYHFDRGFGSGINNWLVAFEGGGWCNN----------V  76

Query  412   ESCSSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKP  585
              +C +R    LGS+  MA  + F GI      F   FY WNR+ +RYCDG SF GDVE  
Sbjct  77    TTCLARKTNRLGSSKQMAKLIAFSGILNNREMFNPDFYNWNRIKVRYCDGSSFTGDVEAV  136

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +PVTKL++RG RIF  V+++L+AKGMK+A+N I +G SAGGL  ++HCDRF +  P+G R
Sbjct  137   NPVTKLHFRGGRIFNAVMEDLLAKGMKNARNAIISGCSAGGLTSVLHCDRFRALLPRGAR  196

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKCLSD+  F+  KD    ++ +  FS +VA H   ++LP  CTS++SP  CF P+ LV 
Sbjct  197   VKCLSDAGYFINGKDVLGEQHIEQYFSQVVATHGSARNLPQSCTSRLSPRLCFFPQYLVS  256

Query  946   YVKSPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQIIS  1104
              + +P+F  ++AYDS+Q++N  +  +      + + K + ++ SP  + L+Q F+ + + 
Sbjct  257   RITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLR  316

Query  1105  ALP--KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINL  1269
             A+     S++KG  + S + H       +  + +DS   K  TI     +WF+++ P + 
Sbjct  317   AITVLGNSSSKGMFIDSCYAHCQTEMQ-ETWLRSDSPELKKTTIAKAVADWFYERRPFHQ  375

Query  1270  ID  1275
             ID
Sbjct  376   ID  377



>ref|XP_006573492.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=400

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 147/362 (41%), Positives = 214/362 (59%), Gaps = 25/362 (7%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P TI+  A  KGAVCLDGSPPAYHF  G     +NWL+   GGGWC +          V
Sbjct  27    VPITIVQNAVAKGAVCLDGSPPAYHFDKGFGSGINNWLVAFEGGGWCNN----------V  76

Query  412   ESCSSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKP  585
              +C +R    LGS+  MA    F GI    A F   FY WNR+ +RYCDG SF GDVE  
Sbjct  77    TTCLARKTNRLGSSKQMAKQIAFSGILNNRAMFNPDFYNWNRIKVRYCDGSSFTGDVEAV  136

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +PVTKL++RGARIF  V+++L+AKGMK+A+N I +G SAGGL  ++HCDRF +  P+G R
Sbjct  137   NPVTKLHFRGARIFNAVMEDLLAKGMKNARNAIISGCSAGGLTSVLHCDRFRALLPRGAR  196

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKCLSD+  F+  KD    ++ +  FS +V  H   +SLP  CTS++S   CF P+ LV 
Sbjct  197   VKCLSDAGYFINAKDVLGEQHIEQYFSQVVVTHGSARSLPQSCTSRLSAKLCFFPQYLVS  256

Query  946   YVKSPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQIIS  1104
              + +P+F  ++AYDS+Q++N  +  +      + + K + ++ SP  + L+Q F+ + + 
Sbjct  257   RITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLR  316

Query  1105  ALP--KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINL  1269
             A+     S++KG  + S + H       +  + +DS   K  TI     +WF+++ P + 
Sbjct  317   AITVLGNSSSKGMFIDSCYAHCQTEMQ-ETWLRSDSPELKKTTIAKAVADWFYERRPFHQ  375

Query  1270  ID  1275
             ID
Sbjct  376   ID  377



>ref|XP_004172255.1| PREDICTED: protein notum homolog [Cucumis sativus]
 gb|KGN53459.1| hypothetical protein Csa_4G056500 [Cucumis sativus]
Length=398

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 206/359 (57%), Gaps = 25/359 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYHFS G     +NWLI L GGGWC +          V +C
Sbjct  30    TYVQDAVIKGAVCLDGSPPAYHFSDGFGSGINNWLIQLEGGGWCNN----------VTTC  79

Query  421   SSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
               R    LGS+  M     F GI      F   FY WNR+ +RYCDG SF GDVE  D  
Sbjct  80    LQRRDTRLGSSKKMVTQLAFSGILSNKPQFNPDFYNWNRIKVRYCDGSSFTGDVEAVDSA  139

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L++RGAR+F+ ++D L+AKGMK+AKN I +G SAGGL  ++HCD F S  P   +VKC
Sbjct  140   TNLHFRGARVFRAIIDNLLAKGMKNAKNAILSGCSAGGLSSILHCDNFKSLLPPTTKVKC  199

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             LSD+  F+  KD   A++ +  +SD+V  H   K+LP+ CTSKM P  CF P+N+VQ ++
Sbjct  200   LSDAGYFINAKDVSGAQHIEGFYSDVVTTHGSAKNLPISCTSKMKPEMCFFPQNVVQLIQ  259

Query  955   SPLFIFHSAYDSFQVQNTFSMDL-------YRAIKNRSSISPTDMALLQDFKKQIISALP  1113
             +P+F+ ++AYDS+Q++N  +  +       +    +  + SP  +  +QDF+ Q +SAL 
Sbjct  260   TPIFLVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPIQLRTMQDFRVQFLSALN  319

Query  1114  --KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
                 S ++G  + S + H   +   +  +  DS      TI     +WFFD+ P   ID
Sbjct  320   GVGSSLSRGLFIDSCYAHC-QTEMQETWLRTDSPVLSKTTIAKAVGDWFFDRAPFQKID  377



>gb|KHN27511.1| Protein notum like [Glycine soja]
Length=398

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/364 (40%), Positives = 211/364 (58%), Gaps = 26/364 (7%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T++  ++ KGAVCLDGSPPAYHF  G  +  +NW++++ GGGWC +          V
Sbjct  27    VPLTLVKNSETKGAVCLDGSPPAYHFDKGFGKGINNWIVHIEGGGWCNN----------V  76

Query  412   ESCSSRMKRELGSTFNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPD  588
              SC  R    LGS+ +M+   F  I      F   FY WNRV +RYCDG SF GDVE+ D
Sbjct  77    TSCLDRKNTTLGSSNHMSDISFYAILSNQQQFNPDFYNWNRVKVRYCDGSSFTGDVEEVD  136

Query  589   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRV  768
             P T L++RGARIF  V++EL+AKGMK+AKN I +G SAGGL  ++HCD F +  P    V
Sbjct  137   PTTNLHFRGARIFSAVMEELLAKGMKNAKNAILSGCSAGGLTTILHCDSFKALLPSRANV  196

Query  769   KCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  948
             KC+ D+  F+ V+D   A  F+  +S++V++H   K+LP  CTSK++P  CF P+ +  +
Sbjct  197   KCVPDAGYFVNVEDISGAHSFQEFYSEVVSIHGSAKNLPTSCTSKLNPALCFFPQYVASH  256

Query  949   VKSPLFIFHSAYDSFQVQNTF-------SMDLYRAIKNRSSISPTDMALLQDFKKQIISA  1107
             + +P+F+ +SAYD +Q+ N F       S   +    N S+ SP  ++ LQ FK +   A
Sbjct  257   ISTPIFVVNSAYDWWQIGNIFVPSSADPSNSWHSCKLNLSNCSPDQLSKLQGFKSEFQRA  316

Query  1108  LPK--PSATKGFIVTSNFGHSFASADYKKRMFADSK----SKTIEDGFYNWFFDKHPINL  1269
             L +   S +KG  + S + H     + ++  F        +KTI     +WF+ + P + 
Sbjct  317   LSEVGDSPSKGMFIDSCYAH--CQTETQETWFKSGSQLLANKTIAKAVGDWFYGRSPFHH  374

Query  1270  IDPN  1281
             ID N
Sbjct  375   IDCN  378



>ref|XP_003613922.1| Notum-like protein [Medicago truncatula]
 gb|AES96880.1| pectinacetylesterase family protein [Medicago truncatula]
Length=394

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 150/359 (42%), Positives = 213/359 (59%), Gaps = 21/359 (6%)
 Frame = +1

Query  229   LIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLS  408
              +P TI+  A  KGAVCLDGSPPAY+F  G  + +++WL+++ GGGWC +          
Sbjct  28    FVPTTIVQNAVAKGAVCLDGSPPAYNFDKGYGKGSNSWLVHMEGGGWCHN----------  77

Query  409   VESCSSRMKRELGSTFNM-APFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEK  582
             V +C  RM   LGS+  M     F GI      F   FY WNR+ IRYCDG SF GDVE 
Sbjct  78    VTNCLGRMTTRLGSSKQMNKTLAFSGILNDKKQFNPDFYNWNRIKIRYCDGSSFTGDVEA  137

Query  583   PDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGV  762
              DPVTKL++RGARIF+ V++EL+AKGMK A+N I +G SAGGL  L+HCDRF +  PKG 
Sbjct  138   VDPVTKLHFRGARIFEAVMEELLAKGMKKAQNAILSGCSAGGLTSLLHCDRFRALLPKGS  197

Query  763   RVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLV  942
              VKC+SD+  F+  KD   A +F+  F+ IV LH   K+LP  CTSK+ P  CF P+N V
Sbjct  198   NVKCISDAGYFINAKDISGAPHFEEYFNQIVTLHGSVKNLPGSCTSKLKPELCFFPQNFV  257

Query  943   QYVKSPLFIFHSAYDSFQVQNTFSMDL--YRAIK-NRSSISPTDMALLQDFKKQIISALP  1113
               + +P+F+ +S  DS+Q++N  + D   ++  K + +  +P  +  +Q F+K+ + AL 
Sbjct  258   SQITTPIFVVNSPIDSYQIKNILAPDADDWKNCKLDITKCTPAQLNQVQGFRKEFLRALA  317

Query  1114  --KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
                 S++ G  + S + H       +  +F  S    + TI     +WF+D+ P + ID
Sbjct  318   PIGNSSSVGTFIDSCYLHCQTELQ-EFWLFNGSPLLANTTIAKSVADWFYDRRPFHQID  375



>ref|XP_006587656.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=450

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 146/362 (40%), Positives = 215/362 (59%), Gaps = 25/362 (7%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P TI+  A  KGAVCLDGSPPAYHF  G     +NWL+   GGGWC +          V
Sbjct  27    VPITIVQNAVAKGAVCLDGSPPAYHFDRGFGSGINNWLVAFEGGGWCNN----------V  76

Query  412   ESCSSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKP  585
              +C +R    LGS+  MA  + F GI      F   FY WNR+ +RYCDG SF GDVE  
Sbjct  77    TTCLARKTNRLGSSKQMAKLIAFSGILNNREMFNPDFYNWNRIKVRYCDGSSFTGDVEAV  136

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +PVTKL++RG RIF  V+++L+AKGMK+A+N I +G SAGGL  ++HCDRF +  P+G R
Sbjct  137   NPVTKLHFRGGRIFNAVMEDLLAKGMKNARNAIISGCSAGGLTSVLHCDRFRALLPRGAR  196

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKCLSD+  F+  KD    ++ +  FS +VA H   ++LP  CTS++SP  CF P+ LV 
Sbjct  197   VKCLSDAGYFINGKDVLGEQHIEQYFSQVVATHGSARNLPQSCTSRLSPRLCFFPQYLVS  256

Query  946   YVKSPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQIIS  1104
              + +P+F  ++AYDS+Q++N  +  +      + + K + ++ SP  + L+Q F+ + + 
Sbjct  257   RITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLR  316

Query  1105  ALP--KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINL  1269
             A+     S++KG  + S + H       +  + +DS   K  TI     +WF+++ P + 
Sbjct  317   AITVLGNSSSKGMFIDSCYAHCQTEMQ-ETWLRSDSPELKKTTIAKAVADWFYERRPFHQ  375

Query  1270  ID  1275
             ID
Sbjct  376   ID  377



>ref|XP_006573491.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
Length=447

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 147/362 (41%), Positives = 214/362 (59%), Gaps = 25/362 (7%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P TI+  A  KGAVCLDGSPPAYHF  G     +NWL+   GGGWC +          V
Sbjct  27    VPITIVQNAVAKGAVCLDGSPPAYHFDKGFGSGINNWLVAFEGGGWCNN----------V  76

Query  412   ESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKP  585
              +C +R    LGS+  MA    F GI    A F   FY WNR+ +RYCDG SF GDVE  
Sbjct  77    TTCLARKTNRLGSSKQMAKQIAFSGILNNRAMFNPDFYNWNRIKVRYCDGSSFTGDVEAV  136

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +PVTKL++RGARIF  V+++L+AKGMK+A+N I +G SAGGL  ++HCDRF +  P+G R
Sbjct  137   NPVTKLHFRGARIFNAVMEDLLAKGMKNARNAIISGCSAGGLTSVLHCDRFRALLPRGAR  196

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKCLSD+  F+  KD    ++ +  FS +V  H   +SLP  CTS++S   CF P+ LV 
Sbjct  197   VKCLSDAGYFINAKDVLGEQHIEQYFSQVVVTHGSARSLPQSCTSRLSAKLCFFPQYLVS  256

Query  946   YVKSPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQIIS  1104
              + +P+F  ++AYDS+Q++N  +  +      + + K + ++ SP  + L+Q F+ + + 
Sbjct  257   RITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLR  316

Query  1105  ALP--KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINL  1269
             A+     S++KG  + S + H       +  + +DS   K  TI     +WF+++ P + 
Sbjct  317   AITVLGNSSSKGMFIDSCYAHCQTEMQ-ETWLRSDSPELKKTTIAKAVADWFYERRPFHQ  375

Query  1270  ID  1275
             ID
Sbjct  376   ID  377



>gb|KHN41756.1| Protein notum like [Glycine soja]
Length=449

 Score =   265 bits (678),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 147/362 (41%), Positives = 214/362 (59%), Gaps = 25/362 (7%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P TI+  A  KGAVCLDGSPPAYHF  G     +NWL+   GGGWC +          V
Sbjct  27    VPITIVQNAVAKGAVCLDGSPPAYHFDKGFGSGINNWLVAFEGGGWCNN----------V  76

Query  412   ESCSSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKP  585
              +C +R    LGS+  MA    F GI    A F   FY WNR+ +RYCDG SF GDVE  
Sbjct  77    TTCLARKTNRLGSSKQMAKQIAFSGILNNRAMFNPDFYNWNRIKVRYCDGSSFTGDVEAV  136

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +PVTKL++RGARIF  V+++L+AKGMK+A+N I +G SAGGL  ++HCDRF +  P+G R
Sbjct  137   NPVTKLHFRGARIFNAVMEDLLAKGMKNARNAIISGCSAGGLTSVLHCDRFRALLPRGAR  196

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKCLSD+  F+  KD    ++ +  FS +V  H   +SLP  CTS++S   CF P+ LV 
Sbjct  197   VKCLSDAGYFINAKDVLGEQHIEQYFSQVVVTHGSARSLPQSCTSRLSAKLCFFPQYLVS  256

Query  946   YVKSPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQIIS  1104
              + +P+F  ++AYDS+Q++N  +  +      + + K + ++ SP  + L+Q F+ + + 
Sbjct  257   RITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLR  316

Query  1105  ALP--KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINL  1269
             A+     S++KG  + S + H       +  + +DS   K  TI     +WF+++ P + 
Sbjct  317   AITVLGNSSSKGMFIDSCYAHCQTEMQ-ETWLRSDSPELKKTTIAKAVADWFYERRPFHQ  375

Query  1270  ID  1275
             ID
Sbjct  376   ID  377



>ref|XP_011012520.1| PREDICTED: protein notum homolog [Populus euphratica]
Length=394

 Score =   263 bits (672),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 150/396 (38%), Positives = 215/396 (54%), Gaps = 42/396 (11%)
 Frame = +1

Query  136   WICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSP  315
             W+CL++++L +              ++     IP TI+  A  +GAVCLDGSPP YHF  
Sbjct  9     WLCLIVYTLTL--------------LKTEGASIPMTIVQTAVARGAVCLDGSPPGYHFEK  54

Query  316   GKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPFV-FKGIFG  492
             G     +NWL+++ GGGWC S          VESC SR     GS+  M   + F GI G
Sbjct  55    GSGSGINNWLVHMEGGGWCES----------VESCVSRRDTYKGSSLKMEKTMGFSGILG  104

Query  493   I-NATFTKFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKD  669
                A    FY WNR+ IRYCDG SF GDVE  DP TKLY+RG RI+Q V+D+L+AKGM++
Sbjct  105   SKQAANPDFYNWNRIKIRYCDGSSFTGDVEAVDPKTKLYFRGERIWQAVIDDLLAKGMRN  164

Query  670   AKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSD  849
             A+N I +G SAGGL  ++HCD+F S  P   RVKC+SD+  F+   D       ++ F  
Sbjct  165   ARNAILSGCSAGGLAAILHCDKFQSLLPASARVKCVSDAGYFIHGTDISGGSRIESFFGQ  224

Query  850   IVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF---SMD  1020
             +V  H   K+LP  CTSK  P  CF P+ + Q +++PLFI +SAYDS+Q++N     ++D
Sbjct  225   VVKTHGSAKNLPASCTSKTRPELCFFPQYVAQTMRTPLFIINSAYDSWQIKNILAPTAVD  284

Query  1021  LYRAIKN----RSSISPTDMALLQDFKKQIISALPK---PSATKGFIVTSNFGHSFASAD  1179
               +  KN        S T +  +Q+++ Q + A+      S+++G  + S + H    + 
Sbjct  285   SKKEWKNCKLDLKKCSATQLQTVQNYRTQFLKAVNTGLGSSSSRGLWINSCYAH--CQSG  342

Query  1180  YKKRMFADSK----SKTIEDGFYNWFFDKHPINLID  1275
                   AD      +  I     +WF+D+     ID
Sbjct  343   SVSTWLADKSPVVGNAKIGKAVGDWFYDRSAFEKID  378



>ref|XP_003548585.1| PREDICTED: protein notum homolog [Glycine max]
Length=398

 Score =   263 bits (673),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 144/364 (40%), Positives = 210/364 (58%), Gaps = 26/364 (7%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T++  ++ KGAVCLDGSPPAYHF  G  +  +NW++++ GGGWC +          V
Sbjct  27    VPLTLVKNSETKGAVCLDGSPPAYHFDKGFGKGINNWIVHIEGGGWCNN----------V  76

Query  412   ESCSSRMKRELGSTFNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPD  588
              SC  R    LGS+ +M+   F  I      F   FY WNRV +RYCDG SF GDVE+ D
Sbjct  77    TSCLDRKNTTLGSSNHMSDISFYAILSNQQQFNPDFYNWNRVKVRYCDGSSFTGDVEEVD  136

Query  589   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRV  768
             P T L++RGARIF  V++EL+AKGMK+AKN I +G SAGGL  ++HCD F +  P    V
Sbjct  137   PTTNLHFRGARIFSAVMEELLAKGMKNAKNAILSGCSAGGLTTILHCDSFKALLPSRANV  196

Query  769   KCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  948
             KC+ D+  F+ V+D   A  F+  +S++V++H   K+LP  CTSK +P  CF P+ +  +
Sbjct  197   KCVPDAGYFVNVEDISGAHSFQEFYSEVVSIHGSAKNLPTSCTSKHNPALCFFPQYVASH  256

Query  949   VKSPLFIFHSAYDSFQVQNTF-------SMDLYRAIKNRSSISPTDMALLQDFKKQIISA  1107
             + +P+F+ +SAYD +Q+ N F       S   +    N S+ SP  ++ LQ FK +   A
Sbjct  257   ISTPIFVVNSAYDWWQIGNIFVPSSADPSNSWHSCKLNLSNCSPDQLSKLQGFKSEFQRA  316

Query  1108  LPK--PSATKGFIVTSNFGHSFASADYKKRMFADSK----SKTIEDGFYNWFFDKHPINL  1269
             L +   S +KG  + S + H     + ++  F        +KTI     +WF+ + P + 
Sbjct  317   LSEVGDSPSKGMFIDSCYAH--CQTETQETWFKSGSQLLANKTIAKAVGDWFYGRSPFHH  374

Query  1270  IDPN  1281
             ID N
Sbjct  375   IDCN  378



>ref|NP_001047850.1| Os02g0702400 [Oryza sativa Japonica Group]
 dbj|BAD07550.1| putative pectin acetylesterase [Oryza sativa Japonica Group]
 dbj|BAD08059.1| putative pectin acetylesterase [Oryza sativa Japonica Group]
 dbj|BAF09764.1| Os02g0702400 [Oryza sativa Japonica Group]
 dbj|BAG91018.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57637.1| hypothetical protein OsJ_08062 [Oryza sativa Japonica Group]
Length=397

 Score =   263 bits (672),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 153/398 (38%), Positives = 225/398 (57%), Gaps = 37/398 (9%)
 Frame = +1

Query  127   SNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYH  306
             +N  +CL   +LV ++ +         +  D D  +  T +  A  KGAVCLDGSPPAYH
Sbjct  2     ANGGVCLSCSALVCALVF---------LTVDGDF-VDITYVASAVAKGAVCLDGSPPAYH  51

Query  307   FSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMA-PFVFKG  483
              + G     ++WL++  GGGWC++          V +C  R +  LGS+  MA    F G
Sbjct  52    LARGFGSGVNSWLVHFEGGGWCSN----------VTTCLQRKRTRLGSSKQMAKQIAFSG  101

Query  484   IFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKG  660
             I      +   FY WN+V +RYCDG SF GDVEK DP TKL+YRGAR++Q V+D+L+AKG
Sbjct  102   ILSNTPDYNPDFYNWNKVKVRYCDGSSFTGDVEKVDPATKLHYRGARVWQAVMDDLLAKG  161

Query  661   MKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAV  840
             M  A N + +G SAGGL  ++HCDRF   FP   +VKCLSD+  F+  KD    +Y  A 
Sbjct  162   MNSANNALISGCSAGGLTSILHCDRFRDLFPVDTKVKCLSDAGFFINEKDIAGVEYIVAF  221

Query  841   FSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFSMD  1020
             F+ +   H   K+LP  CTS++SP  CF P+N V+ +++PLFI ++AYDS+QV+N     
Sbjct  222   FNGVATTHGSAKNLPSACTSRLSPGMCFFPQNEVKQIQTPLFILNAAYDSWQVRNILVPG  281

Query  1021  L------YRAIKNRSSISP-TDMALLQDFKKQIISALPKPS--ATKGFIVTSNFGHSFAS  1173
                    + + K+     P + + +LQ F+   + AL +    +T+G  + S F H    
Sbjct  282   FADPHGKWHSCKHDIDQCPASQLQILQGFRDDFLKALKEQGTPSTRGLFINSCFVH--CQ  339

Query  1174  ADYKKRMFADS----KSKTIEDGFYNWFFDKHPINLID  1275
             ++ ++  FA      ++KTI D   +WF+D++P   ID
Sbjct  340   SETQETWFASGSPMLETKTIADAVGDWFYDRNPFQKID  377



>ref|XP_009397056.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009397057.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=393

 Score =   263 bits (671),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 143/360 (40%), Positives = 210/360 (58%), Gaps = 23/360 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T++  A  KGAVCLDGSPPAYHFSPG    A+NWL+++ GGGWC +          V
Sbjct  30    VPMTLLHSAVAKGAVCLDGSPPAYHFSPGSGSGANNWLVHMEGGGWCRN----------V  79

Query  412   ESCSSRMKRELGSTFNMAPFVFKGIFGINA-TFTKFYKWNRVIIRYCDGGSFAGDVEKPD  588
             E C  R     GS+ +M P  F GI G +  +   FY WNR+ IRYCDG SF GDVE+ D
Sbjct  80    EECLERKNNFRGSSNHMKPLSFSGILGNSKKSNPDFYNWNRIKIRYCDGSSFTGDVERVD  139

Query  589   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRV  768
             P T L+YRGAR++  ++++L+ KGM  A+N + +G SAGGL  ++HCD+F S  P   +V
Sbjct  140   PATNLHYRGARVWLAIMEDLLLKGMNRAENALLSGCSAGGLASILHCDKFRSLLPASAKV  199

Query  769   KCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  948
             KC SD+  F+  KD       +++++D+V LH   K+LP  CTS++SP  CF P+N+V  
Sbjct  200   KCFSDAGYFIDGKDISGTTSVRSLYNDVVNLHGSGKNLPSSCTSRLSPSMCFFPQNVVPK  259

Query  949   VKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQIISA  1107
             + +PLFI ++AYD++Q++NT +         + A K N  S S   +  +Q+F+ + + A
Sbjct  260   MSTPLFILNAAYDAWQIKNTLAPSSADPRKSWNACKLNIKSCSSDQLEKMQEFRSEFLRA  319

Query  1108  LPKP-SATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
             LP   + + G  + S + H   S      + ADS       I     +WF+ +  +  ID
Sbjct  320   LPASGNPSTGMFIISCYAHC-QSGSQDTWLGADSPMIDKMPIAKAVGDWFYGRSVVRKID  378



>ref|XP_010327577.1| PREDICTED: uncharacterized protein LOC101244626 [Solanum lycopersicum]
Length=398

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 149/367 (41%), Positives = 209/367 (57%), Gaps = 31/367 (8%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             LL+  TI+  A  KGAVCLDG+PPAYH   G     ++W+I L GGGWC +         
Sbjct  21    LLVNITILESAVAKGAVCLDGTPPAYHLDRGSGSGVNSWVISLEGGGWCQN---------  71

Query  406   SVESCSSRMKRELGSTFNM-APFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V SC +R    LGS+  M     F G+   +  F  +F+ WNRV +RYCDGGSF GDVE
Sbjct  72    -VTSCLTRKNTRLGSSAKMDHQLPFSGMMSNDPKFNPEFHSWNRVSVRYCDGGSFTGDVE  130

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               DP T+L+YRGARIF+ +++EL+A+GMK ++N I +G SAGGL  ++HCD F    P  
Sbjct  131   AIDPATRLHYRGARIFKAIMEELLAQGMKKSQNAILSGCSAGGLATILHCDNFRMLLPNN  190

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
             V+VKC SD+  F+   D     Y +  F+D+V LH   KSLP  CTSK+ P  CF P+N+
Sbjct  191   VKVKCFSDAGYFIHRNDISGKPYIEQYFNDVVTLHGSAKSLPSSCTSKLKPGLCFFPENV  250

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFSM------DLYRAIK-NRSSISPTDMALLQDFKKQI  1098
              Q +K+PLFI ++AYD +QV+N            + + K N  + +P  + +LQ F+K  
Sbjct  251   AQQIKTPLFIINAAYDHWQVRNILVAPGSDPKGAWTSCKANIKNCTPNQLKILQGFRKDF  310

Query  1099  ISALP--KPSATKGFIVTSNFGHSFASADY------KKRMFADSKSKTIEDGFYNWFFDK  1254
             + AL    PS+T+G+ + S F H  +            R+F    +KTI +   +WF + 
Sbjct  311   LKALDGLGPSSTRGYYINSCFSHCQSQQQAYWFGLNSPRLF----NKTIAEAVRDWFLET  366

Query  1255  HPINLID  1275
                  ID
Sbjct  367   DQYRHID  373



>ref|XP_004150551.1| PREDICTED: protein notum homolog [Cucumis sativus]
Length=539

 Score =   265 bits (678),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 206/359 (57%), Gaps = 25/359 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYHFS G     +NWLI L GGGWC +          V +C
Sbjct  30    TYVQDAVIKGAVCLDGSPPAYHFSDGFGSGINNWLIQLEGGGWCNN----------VTTC  79

Query  421   SSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
               R    LGS+  M     F GI      F   FY WNR+ +RYCDG SF GDVE  D  
Sbjct  80    LQRRDTRLGSSKKMVTQLAFSGILSNKPQFNPDFYNWNRIKVRYCDGSSFTGDVEAVDSA  139

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L++RGAR+F+ ++D L+AKGMK+AKN I +G SAGGL  ++HCD F S  P   +VKC
Sbjct  140   TNLHFRGARVFRAIIDNLLAKGMKNAKNAILSGCSAGGLSSILHCDNFKSLLPPTTKVKC  199

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             LSD+  F+  KD   A++ +  +SD+V  H   K+LP+ CTSKM P  CF P+N+VQ ++
Sbjct  200   LSDAGYFINAKDVSGAQHIEGFYSDVVTTHGSAKNLPISCTSKMKPEMCFFPQNVVQLIQ  259

Query  955   SPLFIFHSAYDSFQVQNTFSMDL-------YRAIKNRSSISPTDMALLQDFKKQIISALP  1113
             +P+F+ ++AYDS+Q++N  +  +       +    +  + SP  +  +QDF+ Q +SAL 
Sbjct  260   TPIFLVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPIQLRTMQDFRVQFLSALN  319

Query  1114  --KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
                 S ++G  + S + H   +   +  +  DS      TI     +WFFD+ P   ID
Sbjct  320   GVGSSLSRGLFIDSCYAHC-QTEMQETWLRTDSPVLSKTTIAKAVGDWFFDRAPFQKID  377



>ref|XP_002519911.1| pectin acetylesterase, putative [Ricinus communis]
 gb|EEF42515.1| pectin acetylesterase, putative [Ricinus communis]
Length=399

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 146/364 (40%), Positives = 216/364 (59%), Gaps = 25/364 (7%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             L +  T +  A  KGAVCLDGSPPAYH   G     ++WL++  GGGWC +         
Sbjct  25    LFVEITYVKNAVAKGAVCLDGSPPAYHLDKGFGTGINSWLVHFEGGGWCNN---------  75

Query  406   SVESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              + +C SR    LGS+  M P   F GI      +   FY WNRV IRYCDG SF GDV+
Sbjct  76    -ITTCLSRKNTRLGSSKQMGPQIAFSGIMSNRRRYNPDFYNWNRVKIRYCDGSSFTGDVQ  134

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               +P T L++RGARI+  V++EL+AKGMK+A+N + +G SAGGL  ++HCD F +  P G
Sbjct  135   AVNPATNLHFRGARIWLAVIEELLAKGMKNAENALLSGCSAGGLASILHCDGFRALLPMG  194

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
               VKCLSD+  F+  +D   A + +  F+++V+LH   K+LP+ CTS++ P  CF P+ L
Sbjct  195   TNVKCLSDAGYFINARDVSGAAHIQTYFNEVVSLHGSAKNLPLSCTSRLKPALCFFPQYL  254

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQI  1098
             VQ +++PLFI ++AYDS+Q++N  +  +      + + K + ++ SP  +  +QDF+ + 
Sbjct  255   VQQIRTPLFILNAAYDSWQIKNILAPGVADPRGSWNSCKLDINNCSPIQLKTMQDFRMRF  314

Query  1099  ISALPKP--SATKGFIVTSNFGHSFASADYKKRMFADSK--SKT-IEDGFYNWFFDKHPI  1263
             +SAL +   S++KG  + S + H   +   +    ADS   SKT I     +WF+D+ P 
Sbjct  315   LSALYRSANSSSKGLYIDSCYAHC-QTETQETWFMADSPVLSKTKIAKAVGDWFYDRIPF  373

Query  1264  NLID  1275
               ID
Sbjct  374   QKID  377



>ref|XP_002303225.2| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ABK93778.1| unknown [Populus trichocarpa]
 gb|ABK95483.1| unknown [Populus trichocarpa]
 gb|EEE78204.2| pectinacetylesterase family protein [Populus trichocarpa]
Length=394

 Score =   261 bits (667),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 150/396 (38%), Positives = 213/396 (54%), Gaps = 42/396 (11%)
 Frame = +1

Query  136   WICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSP  315
             W+CL+++ L +              ++     IP TI+  A  +GAVCLDGSPP YHF  
Sbjct  9     WLCLIVYILTL--------------LKTEGASIPMTIVQAAVARGAVCLDGSPPGYHFEK  54

Query  316   GKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPFV-FKGIFG  492
             G     +NWL+++ GGGWC S          VESC SR     GS+  M   + F GI G
Sbjct  55    GSGSGINNWLVHMEGGGWCES----------VESCVSRRDTYKGSSLKMEKTMGFSGILG  104

Query  493   I-NATFTKFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKD  669
                A    FY WNR+ IRYCDG SF GDVE  DP TKLY+RG RI+Q V+D+L+AKGM++
Sbjct  105   SKQAANPDFYNWNRIKIRYCDGSSFTGDVEAVDPKTKLYFRGERIWQAVIDDLLAKGMRN  164

Query  670   AKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSD  849
             A+N I +G SAGGL  ++HCD+F S  P   RVKC+SD+  F+   D       ++ F  
Sbjct  165   ARNAILSGCSAGGLAAILHCDKFQSLLPASARVKCVSDAGYFIHGTDISGGSRIESFFGQ  224

Query  850   IVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF---SMD  1020
             +V  H   K LP  CTSK  P  CF P+ + Q +++PLFI +SAYDS+Q++N     ++D
Sbjct  225   VVKTHGSAKHLPASCTSKTRPELCFFPQYVAQAMRTPLFIINSAYDSWQIKNILAPTAVD  284

Query  1021  LYRAIKN----RSSISPTDMALLQDFKKQIISALP---KPSATKGFIVTSNFGHSFASAD  1179
               +  KN        S T +  +Q+++ Q + A+      S+++G  + S + H    + 
Sbjct  285   SKKEWKNCKLDLKKCSATQLQTVQNYRTQFLKAVNIGLGSSSSRGLWINSCYAH--CQSG  342

Query  1180  YKKRMFADSK----SKTIEDGFYNWFFDKHPINLID  1275
                   AD      +  I     +WF+D+     ID
Sbjct  343   SVSTWLADKSPVVGNVKIGKAVGDWFYDRSAFEKID  378



>ref|XP_004244682.2| PREDICTED: uncharacterized protein LOC101248898 [Solanum lycopersicum]
Length=390

 Score =   260 bits (665),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 155/389 (40%), Positives = 218/389 (56%), Gaps = 25/389 (6%)
 Frame = +1

Query  139   ICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPG  318
             +CL+IF L++    V        +I + + ++  TI+  A  KGAVCLDG+PPAY++  G
Sbjct  10    LCLVIFCLIMLNDKV--------VIGEGETMVNLTILESAVSKGAVCLDGTPPAYYYEKG  61

Query  319   KDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGST-FNMAPFVFKGIFGI  495
               E A+NW+IY  GG WC           +V  C +R   E GS+ + +    F GI   
Sbjct  62    YGEGANNWIIYFRGGEWC----------YNVIDCVARTTTEKGSSKYALKQRSFYGILSN  111

Query  496   NATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDA  672
             N T    FY WNRV++ YCDG SF GDVE  DP+ KL++RGARIF  +++  + KGMK+A
Sbjct  112   NKTINPDFYNWNRVMVIYCDGSSFTGDVELVDPINKLHFRGARIFLALIENFLEKGMKNA  171

Query  673   KNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDI  852
             KN I +GGSAGGL  L+HCDRF +  P   RVKCL+D S FL  +  +   +   V   +
Sbjct  172   KNAILSGGSAGGLPALIHCDRFKALLPNSARVKCLADGSYFLHREQMKEMAFMDTVNEGL  231

Query  853   VALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFSMDLYRA  1032
             + LH     LP  CTSKM+P  C  P+   + +K+P FI +S +D+FQ+  TF       
Sbjct  232   IKLHHSTNMLPSSCTSKMNPSLCLFPQYFQEGIKTPFFIVNSMFDTFQINKTFPGYYENL  291

Query  1033  IKNRSSISPTDMALLQDFKKQIISALPKP--SATKGFIVTSNFGHSFASADYKKRMFADS  1206
               N  S S   +  LQDFK+  I+ALPK   S+++G  + S   HS  ++      F+  
Sbjct  292   FSNTCSTSL--VKTLQDFKQDFINALPKQSNSSSRGMFIDSCLIHSQITSGVGWNGFS-V  348

Query  1207  KSKTIEDGFYNWFFDKHPINLIDPNNVPF  1293
              +KTI   F +W+FDK    LID  ++P 
Sbjct  349   YNKTIAKTFSDWYFDKSHEQLIDKPDLPL  377



>ref|XP_009771151.1| PREDICTED: uncharacterized protein LOC104221730 [Nicotiana sylvestris]
Length=402

 Score =   260 bits (665),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 149/359 (42%), Positives = 204/359 (57%), Gaps = 25/359 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYHF  G     +NW I L GG WC +  T          C
Sbjct  30    TYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWFIQLEGGAWCNNATT----------C  79

Query  421   SSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              SR K  LGS+  M   V F GI    A F   FY WNR+ IRYCDG SF GDVE  DP 
Sbjct  80    LSRTKTRLGSSKLMVKTVSFSGILSNKAKFNPDFYNWNRIRIRYCDGSSFTGDVEAVDPR  139

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             TK+YYRGARIF  V+++ +AKGMK+A+N I AG SAG L  ++HCDRF    P G +VKC
Sbjct  140   TKVYYRGARIFSAVMEDFLAKGMKNAQNAILAGCSAGSLAAILHCDRFKGLLPPGAKVKC  199

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             LSD+  F+  K    A + +  +SD+V  H   K+LP  CTS++ P  CF P+N+ Q +K
Sbjct  200   LSDAGFFINAKTISGASHIEQFYSDVVNTHGSAKNLPQSCTSRLKPGLCFFPQNVAQQIK  259

Query  955   SPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQIISALP  1113
             +PLF+ ++AYDS+Q++N  +         +R  K +    S   +  +Q ++ + + AL 
Sbjct  260   TPLFLVNAAYDSWQIKNILAPGVADPRGTWRNCKLDILKCSSAQLETMQGYRNEFLKALN  319

Query  1114  --KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
                PS+T+G+ + S + H   +   +  +  DS    S TI     +WF+D++    ID
Sbjct  320   GLGPSSTRGYYINSCYAHC-QTGTQETWLRDDSPRLASTTIAKAVGDWFYDRNRFQEID  377



>ref|XP_003547731.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
 ref|XP_006599118.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=398

 Score =   260 bits (664),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 142/363 (39%), Positives = 207/363 (57%), Gaps = 24/363 (7%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T++  A+ KGAVCLDGSPPAYHF  G  E   NW++++ GGGWC +          V
Sbjct  27    VPLTLVENAESKGAVCLDGSPPAYHFDKGFGEGIDNWIVHIEGGGWCNN----------V  76

Query  412   ESCSSRMKRELGSTFNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPD  588
             ESC  R    LGS+  M    F  I      F   FY WNRV +RYCDG SF GDVE+ D
Sbjct  77    ESCLERKNTRLGSSKQMKDIYFSAILSNEQQFNPDFYNWNRVKVRYCDGSSFTGDVEEVD  136

Query  589   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRV  768
             P T L++RGARIF  V++EL+AKGMK+ KN I +G SAGGL  ++HCD F +  P G  V
Sbjct  137   PTTNLHFRGARIFSAVMEELLAKGMKNVKNAILSGCSAGGLTTILHCDSFKALLPSGANV  196

Query  769   KCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  948
             KC+ D+  F+ V+D   A   +  +S++V++H   K+LP  CTSK++P  CF P+ +  +
Sbjct  197   KCVPDAGYFVNVEDISGAHSIQEFYSEVVSIHGSAKNLPTSCTSKLNPALCFFPQYVASH  256

Query  949   VKSPLFIFHSAYDSFQVQNTF-------SMDLYRAIKNRSSISPTDMALLQDFKKQIISA  1107
             + +P+F+ +SAYD +Q++N F       S   +    N S+ S   ++ +Q FK +   A
Sbjct  257   ISTPIFVVNSAYDRWQIRNIFIPGSADPSNSWHSCKINISNCSTDQLSKIQGFKSEFERA  316

Query  1108  LPK--PSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLI  1272
             L +   S +KG  + S + H       +  + +DS    + TI     +WF+ +   + +
Sbjct  317   LSEVGDSPSKGMFIDSCYAHCQTELQ-ETWLKSDSPQLANTTIAKAVGDWFYGRSSFHHV  375

Query  1273  DPN  1281
             D N
Sbjct  376   DCN  378



>ref|XP_006385133.1| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ERP62930.1| pectinacetylesterase family protein [Populus trichocarpa]
Length=394

 Score =   260 bits (664),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 153/402 (38%), Positives = 219/402 (54%), Gaps = 46/402 (11%)
 Frame = +1

Query  124   RSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAY  303
             R   W CL++  L++              ++     IP TI+  A   GAVCLDGSPP Y
Sbjct  5     RLGQWPCLVVCILIL--------------LKAEGASIPITIVETAVSSGAVCLDGSPPGY  50

Query  304   HFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPFV-FK  480
             HF  G      NWL+++ GGGWC S          VESC SR     GS+  M   + F 
Sbjct  51    HFDKGSGSGIDNWLVHMEGGGWCES----------VESCVSRRDTFRGSSSKMEKTMGFS  100

Query  481   GIFGI-NATFTKFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAK  657
             GI G   A    FY WNR+ +RYCDG SF GDVE  DP TKLY+RG R++Q V+DEL+AK
Sbjct  101   GILGSKQAANPDFYNWNRIKVRYCDGSSFTGDVEAVDPETKLYFRGERVWQAVIDELLAK  160

Query  658   GMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKA  837
             GM++A+N I +G SAGGL  ++HCD+F S  P   RVKC+SD+  F+   D       ++
Sbjct  161   GMQNARNAILSGCSAGGLAAILHCDKFQSLLPATARVKCVSDAGYFIHGTDISGGSRIES  220

Query  838   VFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF--  1011
              F  +V  H   K+LP  CTSKM+P  CF P+ + Q +++PLFI +SAYDS+Q++N    
Sbjct  221   FFGQVVKTHGSAKNLPASCTSKMNPELCFFPQYVAQTMRTPLFIINSAYDSWQIKNILAP  280

Query  1012  -SMDLYRAIK----NRSSISPTDMALLQDFKKQIISALPK---PSATKGFIVTSNFGHSF  1167
              ++D  +  K    +    S + +  +QD++ Q + A+      S+T+G  + S + H  
Sbjct  281   TAVDSKKEWKDCKLDLKKCSASQLQTVQDYRTQFLKAVDTGLGSSSTRGLWIDSCYAHCQ  340

Query  1168  ASA-----DYKKRMFADSK-SKTIEDGFYNWFFDKHPINLID  1275
             + +     + K     D+K  K + D    WF+D+  +  ID
Sbjct  341   SGSVSTWLNDKSPEVGDTKMGKAVGD----WFYDRSAMEKID  378



>ref|XP_009413211.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=397

 Score =   260 bits (664),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 145/364 (40%), Positives = 212/364 (58%), Gaps = 30/364 (8%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T++ GA ++GAVCLDGSPPAYHFSPG     +NWL+++ GGGWCT+          V
Sbjct  33    VPMTLLEGAVDEGAVCLDGSPPAYHFSPGFGSGMNNWLVHMEGGGWCTN----------V  82

Query  412   ESCSSRMKRELGSTFNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPD  588
             + C +R     GS+  M P  F GI G +      FY WN+V IRYCDG SF GDV++ D
Sbjct  83    QDCLARRDTFRGSSKYMKPLSFSGILGNSQNSNPDFYNWNKVKIRYCDGSSFTGDVDEVD  142

Query  589   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRV  768
             P TKLY+RGA+I+  V++EL+AKGM  A+N + +G SAGGL  ++HCD+F    P G  V
Sbjct  143   PATKLYFRGAKIWLAVIEELLAKGMNKAENALLSGCSAGGLASILHCDKFGDLLPAGATV  202

Query  769   KCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  948
             KCLSD+  F+  KD    +  KA +S++V+ H   K+LP  CTS+M+P  CF P+ +V  
Sbjct  203   KCLSDAGYFINAKDITGTESIKAYYSEVVSTHGSAKNLPSSCTSRMTPSMCFFPQYVVPQ  262

Query  949   VKSPLFIFHSAYDSFQVQNTFS----------MDLYRAIKNRSSISPTDMALLQDFKKQI  1098
             +++ LFI ++AYD++Q++N  +           D    IK  SS     + ++Q F+ + 
Sbjct  263   MRTSLFILNAAYDAWQIKNILAPSAADPHKTWNDCKLDIKQCSS---DQLQIMQGFRSEF  319

Query  1099  ISALPK--PSATKGFIVTSNFGHSFASADYKKRMFADSKSKT---IEDGFYNWFFDKHPI  1263
             ++AL     S+ +G  + S + H   S      + ADS +     I     +WF+D+   
Sbjct  320   LNALAALGNSSARGMFINSCYAHC-QSGSQDTWLAADSPALDNIPIGKAVGDWFYDRSAF  378

Query  1264  NLID  1275
               ID
Sbjct  379   RKID  382



>ref|XP_009627060.1| PREDICTED: uncharacterized protein LOC104117690 [Nicotiana tomentosiformis]
 ref|XP_009627061.1| PREDICTED: uncharacterized protein LOC104117690 [Nicotiana tomentosiformis]
Length=402

 Score =   260 bits (664),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 149/359 (42%), Positives = 204/359 (57%), Gaps = 25/359 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYHF  G     +NW I L GG WC +  T          C
Sbjct  30    TYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWFIQLEGGAWCNNATT----------C  79

Query  421   SSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              SR K  LGS+  M   V F GI    A F   FY WNR+ IRYCDG SF GDVE  DP 
Sbjct  80    LSRTKTRLGSSKLMVKTVSFSGILSNKAKFNPDFYNWNRIRIRYCDGSSFTGDVEAVDPK  139

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             TK+YYRGARIF  V+++ +AKGMK+A+N I AG SAG L  ++HCDRF    P G +VKC
Sbjct  140   TKVYYRGARIFSAVMEDFLAKGMKNAQNAILAGCSAGSLAAILHCDRFKGLLPPGAKVKC  199

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             LSD+  F+  K    A + +  +SD+V  H   K+LP  CTS++ P  CF P+N+ Q +K
Sbjct  200   LSDAGFFINAKTISGAPHIEQFYSDVVNTHGSAKNLPQSCTSRLKPGLCFFPQNVAQQIK  259

Query  955   SPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQIISALP  1113
             +PLF+ ++AYDS+Q++N  +         +R  K +    S   +  +Q ++ + + AL 
Sbjct  260   TPLFLVNAAYDSWQIKNILAPGVADPRGTWRNCKLDILKCSSAQLETMQGYRTEFLKALN  319

Query  1114  --KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
                PS+T+G+ + S + H   +   +  +  DS    S TI     +WF+D++    ID
Sbjct  320   GLGPSSTRGYYINSCYAHC-QTGTQETWLRDDSPRLASTTIAKAVGDWFYDRNQFQEID  377



>gb|KCW72720.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=420

 Score =   261 bits (666),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 139/360 (39%), Positives = 214/360 (59%), Gaps = 27/360 (8%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYHF+ G    A+NWL+   GGGWC +          V +C
Sbjct  39    TYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQFEGGGWCNN----------VTTC  88

Query  421   SSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              +R    LGS+  M   V F GI   N +F   FY WNR+ +RYCDG SF GDVE  DP 
Sbjct  89    LARRDTRLGSSKEMVKEVAFSGILSNNHSFNPDFYNWNRIKVRYCDGASFTGDVEAVDPA  148

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             TKL++RGAR F  ++++L++KGM DA+N I +G SAGGL  ++HCDRF +  P    VKC
Sbjct  149   TKLHFRGARAFVAIIEDLLSKGMSDAENAILSGCSAGGLTSILHCDRFRALMPTSATVKC  208

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             ++D+  F+  KD   A++ +  +S++VA H   K+LP  CTS++ P  CF P+N+V+ ++
Sbjct  209   VADAGYFINAKDISGAQHIETFYSEVVATHGSAKNLPTSCTSRLRPGLCFFPQNVVKQIQ  268

Query  955   SPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQIISALP  1113
             +PLFI ++AYD++Q++N  +  +      + + K + ++ S   + ++QDF++Q + AL 
Sbjct  269   TPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDINNCSLDQLQIMQDFRQQFLDALS  328

Query  1114  K--PSATKGFIVTSNFGHSFASADYKKRMFADSKSKTIEDGFY----NWFFDKHPINLID  1275
             +   S ++G  + S + H    ++ ++    D     IE        +W++D+ P   ID
Sbjct  329   RVGTSPSRGIFIDSCYAH--CQSEMQETWLRDDSPVLIETSIAKAVGDWYYDRRPFQKID  386



>ref|XP_006587655.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
Length=453

 Score =   261 bits (668),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 147/365 (40%), Positives = 216/365 (59%), Gaps = 28/365 (8%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P TI+  A  KGAVCLDGSPPAYHF  G     +NWL+   GGGWC +          V
Sbjct  27    VPITIVQNAVAKGAVCLDGSPPAYHFDRGFGSGINNWLVAFEGGGWCNN----------V  76

Query  412   ESCSSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKP  585
              +C +R    LGS+  MA  + F GI      F   FY WNR+ +RYCDG SF GDVE  
Sbjct  77    TTCLARKTNRLGSSKQMAKLIAFSGILNNREMFNPDFYNWNRIKVRYCDGSSFTGDVEAV  136

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNV---IFaggsagglgvlvHCDRFTSRFPK  756
             +PVTKL++RG RIF  V+++L+AKGMK+A+NV   I +G SAGGL  ++HCDRF +  P+
Sbjct  137   NPVTKLHFRGGRIFNAVMEDLLAKGMKNARNVREAIISGCSAGGLTSVLHCDRFRALLPR  196

Query  757   GVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKN  936
             G RVKCLSD+  F+  KD    ++ +  FS +VA H   ++LP  CTS++SP  CF P+ 
Sbjct  197   GARVKCLSDAGYFINGKDVLGEQHIEQYFSQVVATHGSARNLPQSCTSRLSPRLCFFPQY  256

Query  937   LVQYVKSPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQ  1095
             LV  + +P+F  ++AYDS+Q++N  +  +      + + K + ++ SP  + L+Q F+ +
Sbjct  257   LVSRITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTE  316

Query  1096  IISALP--KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHP  1260
              + A+     S++KG  + S + H       +  + +DS   K  TI     +WF+++ P
Sbjct  317   FLRAITVLGNSSSKGMFIDSCYAHCQTEMQ-ETWLRSDSPELKKTTIAKAVADWFYERRP  375

Query  1261  INLID  1275
              + ID
Sbjct  376   FHQID  380



>gb|KHN27509.1| Protein notum like [Glycine soja]
Length=398

 Score =   259 bits (663),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 142/363 (39%), Positives = 207/363 (57%), Gaps = 24/363 (7%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T++  A+ KGAVCLDGSPPAYHF  G  E   NW++++ GGGWC +          V
Sbjct  27    VPLTLVENAESKGAVCLDGSPPAYHFDKGFGEGIDNWIVHIEGGGWCNN----------V  76

Query  412   ESCSSRMKRELGSTFNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPD  588
             ESC  R    LGS+  M    F  I      F   FY WNRV +RYCDG SF GDVE+ D
Sbjct  77    ESCLERKNTRLGSSKQMKDIYFSAILSNEQQFNPDFYNWNRVKVRYCDGSSFTGDVEEVD  136

Query  589   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRV  768
             P T L++RGARIF  V++EL+AKGMK+ KN I +G SAGGL  ++HCD F +  P G  V
Sbjct  137   PTTNLHFRGARIFSAVMEELLAKGMKNVKNAILSGCSAGGLTTILHCDSFKALLPSGANV  196

Query  769   KCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  948
             KC+ D+  F+ V+D   A   +  +S++V++H   K+LP  CTSK++P  CF P+ +  +
Sbjct  197   KCVPDAGYFVNVEDISGAHSIQEFYSEVVSIHGSAKNLPTSCTSKLNPALCFFPQYVASH  256

Query  949   VKSPLFIFHSAYDSFQVQNTF-------SMDLYRAIKNRSSISPTDMALLQDFKKQIISA  1107
             + +P+F+ +SAYD +Q++N F       S   +    N S+ S   ++ +Q FK +   A
Sbjct  257   ISTPIFVVNSAYDRWQIRNIFIPGSADPSNSWHSCKINISNCSTDQLSKIQGFKSEFERA  316

Query  1108  LPK--PSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLI  1272
             L +   S +KG  + S + H       +  + +DS    + TI     +WF+ +   + +
Sbjct  317   LSEVGDSPSKGVFIDSCYAHCQTELQ-ETWLKSDSPQLANTTIAKAVGDWFYGRSSFHHV  375

Query  1273  DPN  1281
             D N
Sbjct  376   DCN  378



>ref|XP_011028476.1| PREDICTED: protein notum homolog [Populus euphratica]
 ref|XP_011028477.1| PREDICTED: protein notum homolog [Populus euphratica]
Length=394

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 153/402 (38%), Positives = 219/402 (54%), Gaps = 46/402 (11%)
 Frame = +1

Query  124   RSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAY  303
             R   W CL++  L++               +     IP TI+  A  +GAVCLDGSPP Y
Sbjct  5     RLGQWPCLVVCILIL--------------FKAEGASIPITIVETAVSRGAVCLDGSPPGY  50

Query  304   HFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPFV-FK  480
             HF  G      NWL+++ GGGWC S          VESC SR     GS+  M   + F 
Sbjct  51    HFDKGSGSGIDNWLVHMEGGGWCES----------VESCVSRRDTFRGSSSKMEKTMGFS  100

Query  481   GIFGI-NATFTKFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAK  657
             GI G   A    FY WNR+ +RYCDG SF GDVE  DP TKLY+RG R++Q V+DEL+AK
Sbjct  101   GILGSKQAANPDFYNWNRIKVRYCDGSSFTGDVEAVDPETKLYFRGERVWQAVIDELLAK  160

Query  658   GMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKA  837
             GM++A+N I +G SAGGL  ++HCD+F S  P   RVKC+SD+  F+   D       ++
Sbjct  161   GMQNARNAILSGCSAGGLAAILHCDKFQSLLPATARVKCVSDAGYFIHGTDISGGSRIES  220

Query  838   VFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF--  1011
              F  +V  H   K+LP  CTSKM+P  CF P+ + Q +++PLFI +SAYDS+Q++N    
Sbjct  221   FFGQVVKTHGSAKNLPASCTSKMNPELCFFPQYVAQTMRTPLFIINSAYDSWQIKNILAP  280

Query  1012  -SMDLYRAIK----NRSSISPTDMALLQDFKKQIISALPK---PSATKGFIVTSNFGHSF  1167
              ++D  +  K    +    S + +  +QD++ Q + A+      S+T+G  + S + H  
Sbjct  281   TAVDSKKEWKDCKLDLKKCSASQLQTVQDYRAQFLKAVNTGLGSSSTRGLWIDSCYAHCQ  340

Query  1168  ASA-----DYKKRMFADSK-SKTIEDGFYNWFFDKHPINLID  1275
             + +     + K     D+K  K + D    WF+D+  +  ID
Sbjct  341   SGSVSTWLNDKSPEVGDTKMGKAVGD----WFYDRSAMEKID  378



>ref|XP_010056129.1| PREDICTED: protein notum homolog isoform X1 [Eucalyptus grandis]
 ref|XP_010056130.1| PREDICTED: protein notum homolog isoform X1 [Eucalyptus grandis]
Length=445

 Score =   260 bits (665),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/360 (39%), Positives = 214/360 (59%), Gaps = 27/360 (8%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYHF+ G    A+NWL+   GGGWC +          V +C
Sbjct  36    TYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQFEGGGWCNN----------VTTC  85

Query  421   SSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              +R    LGS+  M   V F GI   N +F   FY WNR+ +RYCDG SF GDVE  DP 
Sbjct  86    LARRDTRLGSSKEMVKEVAFSGILSNNHSFNPDFYNWNRIKVRYCDGASFTGDVEAVDPA  145

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             TKL++RGAR F  ++++L++KGM DA+N I +G SAGGL  ++HCDRF +  P    VKC
Sbjct  146   TKLHFRGARAFVAIIEDLLSKGMSDAENAILSGCSAGGLTSILHCDRFRALMPTSATVKC  205

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             ++D+  F+  KD   A++ +  +S++VA H   K+LP  CTS++ P  CF P+N+V+ ++
Sbjct  206   VADAGYFINAKDISGAQHIETFYSEVVATHGSAKNLPTSCTSRLRPGLCFFPQNVVKQIQ  265

Query  955   SPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQIISALP  1113
             +PLFI ++AYD++Q++N  +  +      + + K + ++ S   + ++QDF++Q + AL 
Sbjct  266   TPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDINNCSLDQLQIMQDFRQQFLDALS  325

Query  1114  K--PSATKGFIVTSNFGHSFASADYKKRMFADSKSKTIEDGFY----NWFFDKHPINLID  1275
             +   S ++G  + S + H    ++ ++    D     IE        +W++D+ P   ID
Sbjct  326   RVGTSPSRGIFIDSCYAH--CQSEMQETWLRDDSPVLIETSIAKAVGDWYYDRRPFQKID  383



>ref|XP_010056132.1| PREDICTED: protein notum homolog isoform X3 [Eucalyptus grandis]
 gb|KCW72716.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
 gb|KCW72717.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=439

 Score =   260 bits (664),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/360 (39%), Positives = 214/360 (59%), Gaps = 27/360 (8%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYHF+ G    A+NWL+   GGGWC +          V +C
Sbjct  30    TYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQFEGGGWCNN----------VTTC  79

Query  421   SSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              +R    LGS+  M   V F GI   N +F   FY WNR+ +RYCDG SF GDVE  DP 
Sbjct  80    LARRDTRLGSSKEMVKEVAFSGILSNNHSFNPDFYNWNRIKVRYCDGASFTGDVEAVDPA  139

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             TKL++RGAR F  ++++L++KGM DA+N I +G SAGGL  ++HCDRF +  P    VKC
Sbjct  140   TKLHFRGARAFVAIIEDLLSKGMSDAENAILSGCSAGGLTSILHCDRFRALMPTSATVKC  199

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             ++D+  F+  KD   A++ +  +S++VA H   K+LP  CTS++ P  CF P+N+V+ ++
Sbjct  200   VADAGYFINAKDISGAQHIETFYSEVVATHGSAKNLPTSCTSRLRPGLCFFPQNVVKQIQ  259

Query  955   SPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQIISALP  1113
             +PLFI ++AYD++Q++N  +  +      + + K + ++ S   + ++QDF++Q + AL 
Sbjct  260   TPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDINNCSLDQLQIMQDFRQQFLDALS  319

Query  1114  K--PSATKGFIVTSNFGHSFASADYKKRMFADSKSKTIEDGFY----NWFFDKHPINLID  1275
             +   S ++G  + S + H    ++ ++    D     IE        +W++D+ P   ID
Sbjct  320   RVGTSPSRGIFIDSCYAH--CQSEMQETWLRDDSPVLIETSIAKAVGDWYYDRRPFQKID  377



>ref|XP_010942975.1| PREDICTED: protein notum homolog isoform X1 [Elaeis guineensis]
 ref|XP_010942976.1| PREDICTED: protein notum homolog isoform X1 [Elaeis guineensis]
Length=397

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/360 (40%), Positives = 211/360 (59%), Gaps = 27/360 (8%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYH SPG     +NWL+++ GGGWC +          V +C
Sbjct  30    TYVESALAKGAVCLDGSPPAYHLSPGFGSGVNNWLVHIEGGGWCNN----------VTTC  79

Query  421   SSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              +R    LGS+ +MA    F GI     TF   FY WN+V +RYCDG SF GDVE+ +P 
Sbjct  80    LARKNSRLGSSRHMAKQIAFSGILNNRQTFNPDFYNWNKVKVRYCDGSSFTGDVERVNPA  139

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L+YRGAR++  V+++L+AKGM  AKN + +G SAGGL  ++HCD F +  P G R KC
Sbjct  140   TNLHYRGARVWLAVMEDLLAKGMSKAKNALLSGCSAGGLTSILHCDNFRAILPLGTRAKC  199

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             LSD+  F+ +KD   A++ KA F+D+V  H   ++LP  CTS+++P  CF P+N+VQ + 
Sbjct  200   LSDAGYFIDMKDVTGAEHIKAFFNDVVTTHGSAQNLPSSCTSRLTPSMCFFPQNMVQQIH  259

Query  955   SPLFIFHSAYDSFQVQNTFSMDL--------YRAIKNRSSISPTDMALLQDFKKQIISAL  1110
             +PLFI ++AYDS+Q++N     +        Y  +  +   SP  + ++Q F+ + ++AL
Sbjct  260   TPLFILNAAYDSWQIRNILVPGVADPHGTWHYCKLDIQQCSSP-QLQIMQGFRTEFLNAL  318

Query  1111  P--KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
                  S++ G  + S + H   S   +  + +DS   +   I     +WF+D+     ID
Sbjct  319   AGFGRSSSTGMFINSCYAHC-QSEMQETWLSSDSPVLEKMPIAKAVGDWFYDRIAFQKID  377



>ref|XP_010911666.1| PREDICTED: protein notum homolog [Elaeis guineensis]
Length=388

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 140/361 (39%), Positives = 205/361 (57%), Gaps = 26/361 (7%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T++  A  KGAVCLDGSPPAYHF+PG      NWL+++ GGGWC++          V
Sbjct  26    VPLTLVQDAVAKGAVCLDGSPPAYHFAPGFGSGVDNWLVHMEGGGWCSN----------V  75

Query  412   ESCSSRMKRELGSTFNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPD  588
             E C  R K   GS+  M    F GI G   T +  FY WN+V IRYCDG SF GD+E  +
Sbjct  76    EECKQRTKNFRGSSKYMEQLSFSGILGNKQTSSPDFYNWNKVKIRYCDGSSFTGDIEAVN  135

Query  589   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRV  768
             P T L++RGAR+++ ++DEL+AKGM  A+N + +G SAGGL  ++HCD F    P G  V
Sbjct  136   PATNLHFRGARVWRAIMDELLAKGMNKAQNALLSGCSAGGLASILHCDSFRDLLPAGATV  195

Query  769   KCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  948
             KC SD+  F+  KD    +  K  +S +V +H   K+LP  CTS   P  CF P+ +VQ 
Sbjct  196   KCFSDAGYFIDAKDVSGKESIKDFYSQVVTIHGSAKNLPSSCTSSFPPSMCFFPQYVVQS  255

Query  949   VKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQIISA  1107
             +++PLFI ++AYD++Q++N  +        ++   K +    S + + +LQDF+ + + A
Sbjct  256   MRTPLFILNAAYDAWQIKNILAPSPSDPSKVWGECKLDIKKCSSSQLQVLQDFRSEFLHA  315

Query  1108  LPKPSATKGFIVTSNFGHSFASADYKKRMFADSKSKTIE-----DGFYNWFFDKHPINLI  1272
             LP  S + G  + S + H  + A   +  +  S S  I+         +WF+ +  I  I
Sbjct  316   LPANSPSTGLFIDSCYSHCQSGA---QETWLSSNSPAIDKMSIAKAVGDWFYGRSAIQKI  372

Query  1273  D  1275
             D
Sbjct  373   D  373



>ref|XP_010056131.1| PREDICTED: protein notum homolog isoform X2 [Eucalyptus grandis]
Length=448

 Score =   260 bits (664),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 139/360 (39%), Positives = 214/360 (59%), Gaps = 27/360 (8%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYHF+ G    A+NWL+   GGGWC +          V +C
Sbjct  39    TYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQFEGGGWCNN----------VTTC  88

Query  421   SSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              +R    LGS+  M   V F GI   N +F   FY WNR+ +RYCDG SF GDVE  DP 
Sbjct  89    LARRDTRLGSSKEMVKEVAFSGILSNNHSFNPDFYNWNRIKVRYCDGASFTGDVEAVDPA  148

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             TKL++RGAR F  ++++L++KGM DA+N I +G SAGGL  ++HCDRF +  P    VKC
Sbjct  149   TKLHFRGARAFVAIIEDLLSKGMSDAENAILSGCSAGGLTSILHCDRFRALMPTSATVKC  208

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             ++D+  F+  KD   A++ +  +S++VA H   K+LP  CTS++ P  CF P+N+V+ ++
Sbjct  209   VADAGYFINAKDISGAQHIETFYSEVVATHGSAKNLPTSCTSRLRPGLCFFPQNVVKQIQ  268

Query  955   SPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQIISALP  1113
             +PLFI ++AYD++Q++N  +  +      + + K + ++ S   + ++QDF++Q + AL 
Sbjct  269   TPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDINNCSLDQLQIMQDFRQQFLDALS  328

Query  1114  K--PSATKGFIVTSNFGHSFASADYKKRMFADSKSKTIEDGFY----NWFFDKHPINLID  1275
             +   S ++G  + S + H    ++ ++    D     IE        +W++D+ P   ID
Sbjct  329   RVGTSPSRGIFIDSCYAH--CQSEMQETWLRDDSPVLIETSIAKAVGDWYYDRRPFQKID  386



>gb|KDP28068.1| hypothetical protein JCGZ_19476 [Jatropha curcas]
Length=400

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 150/365 (41%), Positives = 217/365 (59%), Gaps = 27/365 (7%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             L +  T +  A  KGAVCLDGSPPAYH   G     +NWL++  GGGWC +         
Sbjct  26    LYVGITYVRNAVAKGAVCLDGSPPAYHLDKGFGTGINNWLVHFEGGGWCNN---------  76

Query  406   SVESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V +C SR    LGS+  MA    F GI      F   FY WNRV IRYCDG SF GDV+
Sbjct  77    -VTTCLSRKNTRLGSSKQMATQIAFSGILNNRRQFNPDFYNWNRVKIRYCDGSSFTGDVQ  135

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
             K +P T L++RGARI+  VV++L+AKGMK+A+N + +G SAGGL  ++HCD F +  P G
Sbjct  136   KVNPATNLHFRGARIWLAVVEDLLAKGMKNAENALLSGCSAGGLASILHCDSFQALLPMG  195

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
               VKCLSD+  F+ V+D   A + +  F+++V+LH   K+LP+ CTS++ P  CF P+ +
Sbjct  196   TNVKCLSDAGYFINVRDVSGAPHIQNYFNEVVSLHGSAKNLPLSCTSRLKPALCFFPQYV  255

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFS---MDLYRAIK----NRSSISPTDMALLQDFKKQI  1098
             VQ +++PLFI ++AYDS+Q++N  +    D + A K    + S+ S   +  +QDF+ Q 
Sbjct  256   VQQIRTPLFILNAAYDSWQIKNILAPGVADPHGAWKGCKLDISNCSLLQLKTMQDFRLQF  315

Query  1099  ISALPKP--SATKGFIVTSNFGHSFASADYKKRMFADS----KSKTIEDGFYNWFFDKHP  1260
             ++AL +   S+++G  + S + H   S   +    ADS    +SK I     +WF+D+  
Sbjct  316   LNALYRSTTSSSRGLYIDSCYIHC-QSETQETWFMADSPVLGRSK-IAKAVGDWFYDRIS  373

Query  1261  INLID  1275
             +  ID
Sbjct  374   VQKID  378



>ref|XP_003547821.1| PREDICTED: protein notum homolog [Glycine max]
 gb|KHN26083.1| Protein notum like [Glycine soja]
Length=398

 Score =   258 bits (659),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 142/365 (39%), Positives = 209/365 (57%), Gaps = 26/365 (7%)
 Frame = +1

Query  229   LIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLS  408
             L+P  ++  A+ KGAVCLDGSPPAYHF  G  E  ++W++++ GGGWC +          
Sbjct  26    LVPLILVENAESKGAVCLDGSPPAYHFDKGFGEGINSWIVHIEGGGWCNN----------  75

Query  409   VESCSSRMKRELGSTFNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKP  585
             +ESC  R    LGS+  M    F GI      F   FY WNRV +RYCDG SF GDVE+ 
Sbjct  76    IESCLDRKDTRLGSSKQMEDIYFSGILSNEQQFNPDFYNWNRVKVRYCDGSSFTGDVEEV  135

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             DP T L++RGARIF  V++EL+AKG++ A+N I +G SAGGL  ++HCD F +  P    
Sbjct  136   DPTTNLHFRGARIFSAVIEELLAKGLERAENAILSGCSAGGLTTILHCDSFKTFLPSRAN  195

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+ D+  F+ V+D   A + +  +S++V+ H   K+LP  CTSK+SP  CF P+ +  
Sbjct  196   VKCVPDAGYFVNVEDISGAHFIQQYYSEVVSTHGSAKNLPTSCTSKLSPTLCFFPQYVAS  255

Query  946   YVKSPLFIFHSAYDSFQVQNTF------SMDLYRAIK-NRSSISPTDMALLQDFKKQIIS  1104
             ++ +P+F+ +SAYDS+Q++  F        D + + K N S+ SP  ++ LQ FK +   
Sbjct  256   HISTPIFVVNSAYDSWQIRYIFVPGSADPSDSWNSCKVNMSNCSPDQLSKLQGFKSEFER  315

Query  1105  ALPK--PSATKGFIVTSNFGHSFASADYKKRMFADSKSK----TIEDGFYNWFFDKHPIN  1266
             AL +   S +KG  + S + H     + ++  F     K    TI     +WF+ +    
Sbjct  316   ALSEVGDSPSKGMFIDSCYAH--CQTEPQETWFKTDSPKLANTTIAKAVADWFYGRSSFR  373

Query  1267  LIDPN  1281
              +D N
Sbjct  374   HVDCN  378



>ref|XP_003547822.1| PREDICTED: protein notum homolog [Glycine max]
 gb|KHN26082.1| Protein notum like [Glycine soja]
Length=398

 Score =   258 bits (658),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 140/363 (39%), Positives = 209/363 (58%), Gaps = 22/363 (6%)
 Frame = +1

Query  229   LIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLS  408
             L+P T++  A+ KGAVCLDGSPPAYHF  G +E   NW++++ GGGWC +          
Sbjct  26    LVPLTLVKNAESKGAVCLDGSPPAYHFDNGFEEGIKNWIVHIEGGGWCNN----------  75

Query  409   VESCSSRMKRELGSTFNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKP  585
             VESC  R    LGS+  M    F  I      +   FY WNRV +RYCDG SF GDVE+ 
Sbjct  76    VESCLYRKDSRLGSSKQMEDLYFSAILSNEQEYNPDFYNWNRVKVRYCDGSSFTGDVEEV  135

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             D  T L++RGARIF  V++EL+AKG++ A+N I +G SAGGL  ++HCDRF +  P    
Sbjct  136   DQTTNLHFRGARIFSAVMEELLAKGLEKAENAILSGCSAGGLTTILHCDRFKNLLPSEAN  195

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+ D+  F+ V+D     + +  +S++V+ H   K+LP  CTSK SP  CF P+ +  
Sbjct  196   VKCVPDAGYFVNVEDISGTHFIEKFYSEVVSTHGSAKNLPSSCTSKFSPELCFFPQYVAS  255

Query  946   YVKSPLFIFHSAYDSFQVQNTF------SMDLYRAIK-NRSSISPTDMALLQDFKKQIIS  1104
             ++ +P+F+ ++AYDS+Q+QN F        D + + K + S+ SP  ++ +QDFK +   
Sbjct  256   HISTPIFVVNAAYDSWQIQNIFVPGSADPSDSWHSCKLDISNCSPDQLSKMQDFKSEFEK  315

Query  1105  ALP--KPSATKGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLI  1272
             A+     S++KG  + S + H  + +   + K       + TI     +WF+ +     +
Sbjct  316   AVSVVGDSSSKGMFIDSCYAHCQTESQETWYKSDSPQLANTTIAKAVGDWFYGRSSFRHV  375

Query  1273  DPN  1281
             D N
Sbjct  376   DCN  378



>gb|EYU29131.1| hypothetical protein MIMGU_mgv1a007782mg [Erythranthe guttata]
Length=394

 Score =   258 bits (658),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 140/358 (39%), Positives = 204/358 (57%), Gaps = 23/358 (6%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGS PAYHF  G     +NWL+++ GGGWC +  T          C
Sbjct  25    TYVESAVAKGAVCLDGSAPAYHFDKGSGAGINNWLVHIEGGGWCNNATT----------C  74

Query  421   SSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              +R    LGS+  MA    F GIF     F   FY WNR+ +RYCDG SF GDVE  DP 
Sbjct  75    LARRNGRLGSSKQMAKQIAFSGIFSNKPQFNPDFYNWNRLKVRYCDGASFTGDVEAVDPA  134

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             TKLYYRGAR+F  V+++L+AKGMK+A+N I +G SAGGL  +++CDRF S  P    VKC
Sbjct  135   TKLYYRGARVFVAVIEDLLAKGMKNAENAILSGCSAGGLTSILNCDRFKSLLPISTNVKC  194

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
              +D+  F+  KD   A++ +  ++D+V  H   K L   CTSKM P  CF P+N+VQ ++
Sbjct  195   FADAGFFINAKDVSGAQHIEQFYNDVVTTHGSAKHLAQSCTSKMKPSLCFFPENMVQAIQ  254

Query  955   SPLFIFHSAYDSFQVQNTFS------MDLYRAIKNR-SSISPTDMALLQDFKKQIISALP  1113
             +P+F+ ++AYDS+Q++N  +        L+   K      S T +  +Q+++ + + AL 
Sbjct  255   TPIFVVNAAYDSWQIKNILAPGVADPHGLWHNCKTDIKKCSTTQLQTMQEYRLEFLKALS  314

Query  1114  K--PSATKGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLID  1275
                 + +KG+ + S + H  +     +   +     +KTI     +WF+++ P   ID
Sbjct  315   GLMSAKSKGYFINSCYAHCQTETQETWSTNISPMLNNKTIAKAVGDWFYERSPFEKID  372



>gb|ADR82372.1| pectin acetylesterase [Populus trichocarpa]
Length=394

 Score =   258 bits (658),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 153/402 (38%), Positives = 218/402 (54%), Gaps = 46/402 (11%)
 Frame = +1

Query  124   RSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAY  303
             R   W CL++  L++              ++     IP TII  A   GAVCLDGS P Y
Sbjct  5     RLGQWPCLVVCILIL--------------LKAEGASIPITIIETAVSSGAVCLDGSQPGY  50

Query  304   HFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPFV-FK  480
             HF  G      NWL+++ GGGWC S          VESC SR     GS+  M   + F 
Sbjct  51    HFDKGSGSGIDNWLVHMEGGGWCES----------VESCVSRRDTFRGSSSKMEKTMGFS  100

Query  481   GIFGI-NATFTKFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAK  657
             GI G   A    FY WNR+ +RYCDG SF GDVE  DP TKLY+RG R++Q V+DEL+AK
Sbjct  101   GILGSKQAANPDFYNWNRIKVRYCDGSSFTGDVEAVDPETKLYFRGERVWQAVIDELLAK  160

Query  658   GMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKA  837
             GM++A+N I +G SAGGL  ++HCD+F S  P   RVKC+SD+  F+   D       ++
Sbjct  161   GMQNARNAILSGCSAGGLAAILHCDKFQSLLPATARVKCVSDAGYFIHGTDISGGSRIES  220

Query  838   VFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF--  1011
              F  +V  H   K+LP  CTSKM+P  CF P+ + Q +++PLFI +SAYDS+Q++N    
Sbjct  221   FFGQVVKTHGSAKNLPASCTSKMNPELCFFPQYVAQTMRTPLFIINSAYDSWQIKNILAP  280

Query  1012  -SMDLYRAIK----NRSSISPTDMALLQDFKKQIISALPK---PSATKGFIVTSNFGHSF  1167
              ++D  +  K    +    S + +  +QD++ Q + A+      S+T+G  + S + H  
Sbjct  281   TAVDSKKEWKDCKLDLKKCSASQLQTVQDYRTQFLKAVDTGLGSSSTRGLWIDSCYAHCQ  340

Query  1168  ASA-----DYKKRMFADSK-SKTIEDGFYNWFFDKHPINLID  1275
             + +     + K     D+K  K + D    WF+D+  +  ID
Sbjct  341   SGSVSTWLNDKSPEVGDTKMGKAVGD----WFYDRSAMEKID  378



>ref|XP_011082149.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
 ref|XP_011082150.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
 ref|XP_011082151.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
Length=398

 Score =   257 bits (657),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 139/366 (38%), Positives = 214/366 (58%), Gaps = 27/366 (7%)
 Frame = +1

Query  208   IIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDT  387
             +++     +  T +  A  KGAVCLDGSPPAYH   G     +NWL+++ GGGWC +   
Sbjct  18    VLRTESFYVDITYVRSAVAKGAVCLDGSPPAYHLDRGYGTGINNWLVHIEGGGWCNN---  74

Query  388   YSTHDLSVESCSSRMKRELGST-FNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGS  561
                    V +C +R    LGS+ + +    F GI    A F   FY WNRV +RYCDG S
Sbjct  75    -------VTTCLARKNNRLGSSKYMVKQLAFSGILNNKANFNPDFYNWNRVKVRYCDGAS  127

Query  562   FAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFT  741
             F GDVE  +PVTKL+YRGAR+F  V+++L+AKGMK+A+N + +G SAGGL  ++HCD F 
Sbjct  128   FTGDVEAVNPVTKLHYRGARVFLAVMEDLLAKGMKNAENAVLSGCSAGGLAAILHCDSFK  187

Query  742   SRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFEC  921
             +  P G +VKC SD+  F+  KD   A++ +A + D+V+ H   K+LP  CTS+M P  C
Sbjct  188   ALLPMGTKVKCFSDAGYFINTKDVSGAQHIEAFYHDVVSTHGSAKNLPRSCTSRMKPSLC  247

Query  922   FQPKNLVQYVKSPLFIFHSAYDSFQVQNTFSMDL-------YRAIKNRSSISPTDMALLQ  1080
             F P+ + + +++PLFI ++AYDS+Q++N  +  +       +    + +  S T +  +Q
Sbjct  248   FFPQYVAREIRTPLFIINAAYDSWQIKNILAPGVADPHGTWHNCKTDINKCSATQLQTMQ  307

Query  1081  DFKKQIISAL--PKPSATKGFIVTSNFGHSFASADYKKRMF-ADS---KSKTIEDGFYNW  1242
              F+ + I AL     S ++G+ + S + H     + ++  + +DS    +KTI     +W
Sbjct  308   GFRLEFIRALYGLGVSTSRGYFINSCYAH--CQTEMQETWYRSDSPKLNNKTIAKAVGDW  365

Query  1243  FFDKHP  1260
             F+D+ P
Sbjct  366   FYDRSP  371



>ref|XP_009794297.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=402

 Score =   257 bits (657),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 149/382 (39%), Positives = 219/382 (57%), Gaps = 27/382 (7%)
 Frame = +1

Query  175   QYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYL  354
             Q++ S    + I ++  L +  T +     K AVCLDGSPPAYH   G     ++WLI +
Sbjct  8     QWIYSLLTMSMIFRNEGLFVNITYLLSGVAKEAVCLDGSPPAYHHDKGFGTGVNSWLIQM  67

Query  355   AGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWN  528
              GGGWC +          V +C SR    LGS+  M     F GI      F   FY WN
Sbjct  68    EGGGWCNN----------VTTCLSRKNTRLGSSKQMVKQLAFSGILSNKPQFNPDFYNWN  117

Query  529   RVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagg  708
             RV +RYCDG SF GDV+  +P+T L++RGAR+F  V+++L+AKGMK+A+N I +G SAGG
Sbjct  118   RVKVRYCDGSSFTGDVQAVNPITNLHFRGARVFLAVMEDLLAKGMKNAENAILSGCSAGG  177

Query  709   lgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPV  888
             L  ++HCD F +  P G +VKC SD+  F+ VKD   A + +  F D+V LH   K+LP 
Sbjct  178   LTSILHCDSFKALLPMGAKVKCFSDAGYFINVKDISGAPHIEEFFGDVVRLHGSAKNLPP  237

Query  889   ECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRS  1047
              CTS++ P  CF P+N+ Q+V++PLF+ ++AYDS+Q++N  +        ++R  K +  
Sbjct  238   SCTSRLKPNLCFFPQNVAQHVRTPLFLVNAAYDSWQIKNILAPSVADPRGVWRNCKLDIL  297

Query  1048  SISPTDMALLQDFKKQIISAL--PKPSATKGFIVTSNFGHSFASADYKKRMF-ADS---K  1209
               S   +  +Q F+   + AL    PS+++G+ + S + H     + ++  F ADS    
Sbjct  298   RCSSRQLQTMQGFRLGFLRALYALGPSSSRGYFINSCYAH--CQTEVQETWFRADSPKLA  355

Query  1210  SKTIEDGFYNWFFDKHPINLID  1275
             +KTI     +WFFDK+P   ID
Sbjct  356   NKTIAKALGDWFFDKNPFQKID  377



>ref|XP_006471634.1| PREDICTED: uncharacterized protein LOC102628021 [Citrus sinensis]
 gb|KDO40413.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=399

 Score =   257 bits (657),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 143/401 (36%), Positives = 222/401 (55%), Gaps = 39/401 (10%)
 Frame = +1

Query  115   VSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSP  294
             V+ R   W+ LL+ +L++              ++     +  T +  A  KGAVCLDGSP
Sbjct  2     VAARMGQWLNLLVCALIL--------------LKADGFNVGITYVENAVVKGAVCLDGSP  47

Query  295   PAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPFV  474
             PAYHF  G     +NWL+++ GGGWC +          V +C  R K  LGS+  M   V
Sbjct  48    PAYHFDKGFGAGINNWLVHIEGGGWCNN----------VTTCLERKKTRLGSSKQMVKVV  97

Query  475   -FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDEL  648
              F G+      F   FY WNR+ +RYCDG SF GDVE  +P   L++RGAR+FQ V+++L
Sbjct  98    AFSGMLSNKQKFNPDFYNWNRIKVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMEDL  157

Query  649   MAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKY  828
             MAKGMK+A+N + +G SAGGL  ++HCD F + FP G +VKC +D+  F+  KD   A +
Sbjct  158   MAKGMKNAQNAVLSGCSAGGLTSILHCDNFRALFPVGTKVKCFADAGYFINAKDVSGASH  217

Query  829   FKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNT  1008
              +  ++ +VA H   K LP  CTS++SP  CF P+ + + + +PLFI ++AYDS+Q++N 
Sbjct  218   IEQFYAQVVATHGSAKHLPASCTSRLSPGLCFFPQYMARQITTPLFIINAAYDSWQIKNI  277

Query  1009  FS------MDLYRAIK-NRSSISPTDMALLQDFKKQIISALPKP--SATKGFIVTSNFGH  1161
              +         + + K + ++ SPT +  +Q F+ Q ++AL     S+++G  + + + H
Sbjct  278   LAPGVADPHGTWHSCKLDINNCSPTQLQTMQSFRTQFLNALAGLGISSSRGMFIDACYAH  337

Query  1162  SFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
                    +  +  DS      +I     +W++D+ P   ID
Sbjct  338   CQTEMQ-ETWLRTDSPVLGKMSIAKAVGDWYYDRSPFQKID  377



>ref|XP_006652763.1| PREDICTED: protein notum homolog [Oryza brachyantha]
Length=383

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 143/367 (39%), Positives = 208/367 (57%), Gaps = 29/367 (8%)
 Frame = +1

Query  217   DLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYST  396
             D+D++  K+ +     KGAVCLDGSPP YHFSPG    A+NWL+++ GGGWC ++     
Sbjct  17    DVDMVFLKSAV----SKGAVCLDGSPPVYHFSPGSGPGANNWLVHMEGGGWCRNS-----  67

Query  397   HDLSVESCSSRMKRELGSTFNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGD  573
                  + CS R     GS+  M P  F GI G +  +   FY WNRV IRYCDG SF GD
Sbjct  68    -----QECSVRKGNFRGSSKFMRPLSFSGILGGSQKYNPDFYNWNRVKIRYCDGSSFTGD  122

Query  574   VEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFP  753
             VE  +  T L+YRGAR++  +++EL++ GM  A+N + +G SAGGL  ++HCD+F    P
Sbjct  123   VETVETSTNLHYRGARVWNAIIEELLSMGMSKAQNALLSGCSAGGLSAILHCDKFRDMLP  182

Query  754   KGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPK  933
                +VKC SD+  F+  KD     + +  + +IV LH+  K+LPV CTSKMSP  CF P+
Sbjct  183   ATAKVKCFSDAGYFIDGKDITGNNFVRTFYKEIVNLHESAKNLPVSCTSKMSPDMCFFPQ  242

Query  934   NLVQYVKSPLFIFHSAYDSFQVQNTFSMDLYRAIKNRS-------SISPTDMALLQDFKK  1092
             N+V  +++PLFI ++AYDS+Q++N  +       K  +       S S + + +LQ+F+ 
Sbjct  243   NVVPTLRTPLFILNAAYDSWQIKNVLAPSAADKKKTWAQCKLDIKSCSSSQLTILQNFRA  302

Query  1093  QIISALPKPSA---TKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDK  1254
             + ++ALPKP     T    + S   H   S      +  DS   +   I     +WF+D+
Sbjct  303   EFLAALPKPGQSPPTMSMFIDSCHAHC-QSGSQDTWLEEDSPKVEKTQIGRAVGDWFYDR  361

Query  1255  HPINLID  1275
                  ID
Sbjct  362   EVSRRID  368



>ref|XP_006878664.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda]
 gb|ERM94809.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda]
Length=398

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/360 (38%), Positives = 208/360 (58%), Gaps = 27/360 (8%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYH   G     +NWL+++ GGGWC++          V +C
Sbjct  29    TYVTTAVAKGAVCLDGSPPAYHLDKGSGSGINNWLVHVEGGGWCSN----------VTTC  78

Query  421   SSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              SR    LGS+  M     F G+ G  A+    FY WNRV +RYCDG SF GDVE+ DP 
Sbjct  79    FSRKNTRLGSSNQMVKQLAFSGLLGNKASMNPDFYNWNRVKVRYCDGASFTGDVEEVDPA  138

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             TKL++RG RI+  V+++L+AKGM++A+N I +G SAGGL  ++HCD F +  P G +VKC
Sbjct  139   TKLHFRGGRIWLAVIEDLLAKGMRNAENAILSGCSAGGLTSILHCDSFRALLPIGAKVKC  198

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             ++D+  F+  KD  +A + ++ F D+V LH   K+LP  CTS++ P  CF P+ + Q ++
Sbjct  199   VADAGYFINAKDVSQADHIQSFFDDVVTLHDSAKNLPQSCTSRLKPSLCFFPQYMAQGIR  258

Query  955   SPLFIFHSAYDSFQVQNTFSMDL-------YRAIKNRSSISPTDMALLQDFKKQIISALP  1113
             +P F+ ++AYDS+QV+NT +  +       +    +    + + +  LQDF+ + +SAL 
Sbjct  259   TPFFLLNAAYDSWQVKNTLAPGVADPHGTWHNCKLDIKKCTASQLQTLQDFRLEFLSALK  318

Query  1114  --KPSATKGFIVTSNFGHSFASADYKKRMFADSK----SKTIEDGFYNWFFDKHPINLID  1275
                 S + G  + S + H    ++ ++    D        +I     +WF+D+ P   ID
Sbjct  319   GVGSSPSIGMFINSCYAH--CQSEVQETWLRDDSPVLGGTSIAKAVGDWFYDRSPFQKID  376



>ref|XP_007156332.1| hypothetical protein PHAVU_003G277600g [Phaseolus vulgaris]
 gb|ESW28326.1| hypothetical protein PHAVU_003G277600g [Phaseolus vulgaris]
Length=399

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 142/383 (37%), Positives = 216/383 (56%), Gaps = 23/383 (6%)
 Frame = +1

Query  172   VQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIY  351
             +Q++N       +++    L+P T++  A  KGAVCLDGSPPAYHF  G  E  +NW+++
Sbjct  7     IQWLNLVACVLLLLKAEGSLVPLTLVENALSKGAVCLDGSPPAYHFDKGDGEGINNWIVH  66

Query  352   LAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKW  525
             + GGGWC   D           C  R    LGS+  M     F GI      +   FY W
Sbjct  67    MEGGGWCKDAD----------DCLGRKDTRLGSSKQMVEDLYFSGILSNEREYNPDFYNW  116

Query  526   NRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsag  705
             +RV IRYCDG SF GDVE+ DP   LY+RGARIF  V+++L+AKGM+ A+N I +G SAG
Sbjct  117   DRVKIRYCDGSSFTGDVEEVDPTNNLYFRGARIFSAVMEDLLAKGMEKAENAILSGCSAG  176

Query  706   glgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLP  885
             GL  ++HCD F +  P    VKC+ D+  F+ V+D   A++ +  +S +V+ H   K+LP
Sbjct  177   GLTTILHCDNFKALLPSKATVKCVPDAGYFINVEDISGARFIEDYYSKVVSTHGSAKNLP  236

Query  886   VECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NR  1044
               CTSK+S   CF P+ +  ++ +P+FI +SAYDS+Q++N  +       D + + K + 
Sbjct  237   TSCTSKLSSGLCFFPQYVASHISTPIFIVNSAYDSWQIRNILAPGAADPSDNWHSCKLDL  296

Query  1045  SSISPTDMALLQDFKKQIISALP--KPSATKGFIVTSNFGH--SFASADYKKRMFADSKS  1212
             +  SP  ++++Q FKK+   A+     S++ G  + S + H  + +   + K       +
Sbjct  297   AKCSPDQLSIVQGFKKEFEKAVSVVGDSSSNGMFINSCYDHCQTESQETWSKSDSPHLAN  356

Query  1213  KTIEDGFYNWFFDKHPINLIDPN  1281
              TI     NWF+D+ P + +D N
Sbjct  357   TTISKAVGNWFYDRSPFHHVDCN  379



>ref|XP_007158098.1| hypothetical protein PHAVU_002G123900g [Phaseolus vulgaris]
 gb|ESW30092.1| hypothetical protein PHAVU_002G123900g [Phaseolus vulgaris]
Length=400

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 140/361 (39%), Positives = 210/361 (58%), Gaps = 23/361 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGSPP YHF  G     +NWL+   GGGWC +          V
Sbjct  27    VPITYLQNAVAKGAVCLDGSPPGYHFDRGSGTGINNWLVAFEGGGWCNN----------V  76

Query  412   ESCSSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKP  585
              +C SR    LGS+  MA    F GI      F   FY WNR+ +RYCDG SF GDVE  
Sbjct  77    TTCLSRKTNHLGSSKQMAKQIAFSGIMSNRPMFNPDFYNWNRIKVRYCDGSSFTGDVEAV  136

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +PVTKL++RGARIF  V+++L+AKGMK+A+N I +G SAGGL  ++HCDRF +  P+  R
Sbjct  137   NPVTKLHFRGARIFAAVMEDLLAKGMKNARNAIISGCSAGGLTAVLHCDRFKALLPREAR  196

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+  +D   A + +  FS +VA H   ++LP  CTS+++P  CF P+ LV 
Sbjct  197   VKCVSDAGYFINARDVTGAYHIQQYFSQVVATHGSARNLPQSCTSRLTPKLCFFPQYLVS  256

Query  946   YVKSPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQIIS  1104
             ++ +P+F  ++AYDS+Q++N  +  +      + + K + ++ SP  + L+Q F+ + + 
Sbjct  257   HITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLR  316

Query  1105  ALP--KPSATKGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLI  1272
             AL     S+ KG  + S + H  +     + +    + +  TI     +WF+++   + I
Sbjct  317   ALTVLGNSSYKGMFIDSCYAHCQTEMQETWLRNDSPELEKTTIAKAVADWFYERRTFHQI  376

Query  1273  D  1275
             D
Sbjct  377   D  377



>gb|KDO40410.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=437

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 146/405 (36%), Positives = 226/405 (56%), Gaps = 40/405 (10%)
 Frame = +1

Query  103   LRMAVSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCL  282
             LRM V+ R   W+ LL+ +L++              ++     +  T +  A  KGAVCL
Sbjct  37    LRM-VAARMGQWLNLLVCALIL--------------LKADGFNVGITYVENAVVKGAVCL  81

Query  283   DGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNM  462
             DGSPPAYHF  G     +NWL+++ GGGWC +          V +C  R K  LGS+  M
Sbjct  82    DGSPPAYHFDKGFGAGINNWLVHIEGGGWCNN----------VTTCLERKKTRLGSSKQM  131

Query  463   APFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVV  636
                V F G+      F   FY WNR+ +RYCDG SF GDVE  +P   L++RGAR+FQ V
Sbjct  132   VKVVAFSGMLSNKQKFNPDFYNWNRIKVRYCDGASFTGDVEAVNPANNLHFRGARVFQAV  191

Query  637   VDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPE  816
             +++LMAKGMK+A+N + +G SAGGL  ++HCD F + FP G +VKC +D+  F+  KD  
Sbjct  192   MEDLMAKGMKNAQNAVLSGCSAGGLTSILHCDNFRALFPVGTKVKCFADAGYFINAKDVS  251

Query  817   RAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQ  996
              A + +  ++ +VA H   K LP  CTS++SP  CF P+ + + + +PLFI ++AYDS+Q
Sbjct  252   GASHIEQFYAQVVATHGSAKHLPASCTSRLSPGLCFFPQYMARQITTPLFIINAAYDSWQ  311

Query  997   VQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQIISALPKP--SATKGFIVTS  1149
             ++N  +  +      + + K + ++ SPT +  +Q F+ Q ++AL     S+++G  + +
Sbjct  312   IKNILAPGVADPHGTWHSCKLDINNCSPTQLQTMQSFRTQFLNALAGLGISSSRGMFIDA  371

Query  1150  NFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
              + H       +  +  DS      +I     +W++D+ P   ID
Sbjct  372   CYAHCQTEMQ-ETWLRTDSPVLGKMSIAKAVGDWYYDRSPFQKID  415



>ref|XP_008797987.1| PREDICTED: protein notum homolog isoform X1 [Phoenix dactylifera]
Length=391

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 137/361 (38%), Positives = 204/361 (57%), Gaps = 26/361 (7%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T++  A  KGAVCLDGSPPAYHF+PG     +NWL+++ GGGWC++          V
Sbjct  29    VPLTLVQAAVAKGAVCLDGSPPAYHFAPGFGSGVNNWLVHMEGGGWCSN----------V  78

Query  412   ESCSSRMKRELGSTFNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPD  588
             E C  R     GS+  M    F GI G        FY WN+V IRYCDG SF GD+E  +
Sbjct  79    EECKERTGNFRGSSKYMKQLSFSGILGNQQNLNPDFYNWNKVKIRYCDGSSFTGDIEAVN  138

Query  589   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRV  768
             P T L++RGAR+++ ++DEL+AKGM  A+N + +G SAGGL  ++HCD F    P G RV
Sbjct  139   PATNLHFRGARVWRAIMDELLAKGMNKAQNALLSGCSAGGLASILHCDSFHDLLPAGARV  198

Query  769   KCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  948
             KC SD+  F+  KD    +  K  ++ +V  H   K+LP  CTS+  P  CF P+ +VQ 
Sbjct  199   KCFSDAGYFIDAKDVSGKETIKDFYNQVVTTHGSAKNLPSSCTSRFPPSLCFFPQYVVQN  258

Query  949   VKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQIISA  1107
             +++PLFI ++AYD++Q++N F+        ++   K +    S + +  LQ F+ + + A
Sbjct  259   MRTPLFILNAAYDAWQIKNIFAPSPSDPRKIWSECKLDIKKCSSSQLQALQGFRSEFLRA  318

Query  1108  LPKPSATKGFIVTSNFGHSFASADYKKRMFADSKSKTIE-----DGFYNWFFDKHPINLI  1272
             LP+ S + G  + S + H  + A   +  +  S S  I+         +WF+ +  +  I
Sbjct  319   LPRNSPSVGMFIDSCYSHCQSGA---QETWLSSNSPAIDRMSIAKAVGDWFYGRSAVQKI  375

Query  1273  D  1275
             D
Sbjct  376   D  376



>ref|XP_010644665.1| PREDICTED: uncharacterized protein LOC100245856 [Vitis vinifera]
 emb|CBI29219.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 143/399 (36%), Positives = 214/399 (54%), Gaps = 41/399 (10%)
 Frame = +1

Query  124   RSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAY  303
             R+  W+ +L FSL++              ++     +  T +  A  KGAVCLDGSPPAY
Sbjct  5     RTGHWLSILAFSLIL--------------LKTEGFYVGITYVDSAVAKGAVCLDGSPPAY  50

Query  304   HFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAP-FVFK  480
             H   G     +NWL+++ GGGWC +  T          C +R    LGS+  M     F 
Sbjct  51    HMDKGFGAGINNWLVHIEGGGWCNNAST----------CLARRDNRLGSSKQMVKQIAFS  100

Query  481   GIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAK  657
             GI      F   FY WN++ +RYCDG SF GDVE  DP T L+YRGAR+F  V+++LMAK
Sbjct  101   GILSNKQKFNPDFYNWNKIKVRYCDGASFTGDVEAVDPKTNLHYRGARVFLAVIEDLMAK  160

Query  658   GMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKA  837
             GMK+A N + +G SAGGL  ++HCD+F +  P   +VKC +D+  F+  KD   A + + 
Sbjct  161   GMKNAANAVLSGCSAGGLTAILHCDKFRALLPVSTKVKCFADAGYFINAKDVSGAAHIEG  220

Query  838   VFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFSM  1017
              +S++VA H   K+LP  CTS + P  CF P+N+ Q +K+PLFI ++AYDS+Q++N  + 
Sbjct  221   FYSEVVATHGSAKNLPPSCTSSLRPGLCFFPQNMAQQIKTPLFIINAAYDSWQIKNILAP  280

Query  1018  DL-------YRAIKNRSSISPTDMALLQDFKKQIISALPK--PSATKGFIVTSNFGHSFA  1170
              +       +    +    S + +  +QDF+ Q +SA+     S +KG  + S + H   
Sbjct  281   GVADPHGTWHYCKLDIKDCSSSQLEAMQDFRVQFLSAIKGLIGSPSKGMFINSCYAH--C  338

Query  1171  SADYKKRMFADSK----SKTIEDGFYNWFFDKHPINLID  1275
               + ++    D        TI     +W++D+ P   ID
Sbjct  339   QTEMQETWLRDDSPVLGKTTIAKAVGDWYYDRSPFQKID  377



>gb|KDP28066.1| hypothetical protein JCGZ_19474 [Jatropha curcas]
Length=395

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 146/365 (40%), Positives = 210/365 (58%), Gaps = 30/365 (8%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             IP TI+  A  +GAVCLDGSPPAYHF  G    A+NW++++ GGGWC            +
Sbjct  28    IPITIVETAKTRGAVCLDGSPPAYHFDKGYGSGANNWIVHMEGGGWCDD----------I  77

Query  412   ESCSSRMKRELGSTFNMAPFV-FKGIFGI-NATFTKFYKWNRVIIRYCDGGSFAGDVEKP  585
             ESC  R     GS+  M   + F GI G   A    FY WNR+ I+YCDG SF GDVE  
Sbjct  78    ESCLERRDTYKGSSLKMEKTMGFSGILGSKQAANPDFYNWNRIKIKYCDGSSFTGDVEAV  137

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             DP TKLY+RG RI++ V+D+L+AKGM++A+N I +G SAGGL  ++HCD+F S  P   +
Sbjct  138   DPKTKLYFRGERIWRAVIDDLLAKGMRNAQNAILSGCSAGGLASILHCDKFRSLLPASAK  197

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+  KD       +  +  +V LH   K+LP  CTS+M P  CF P+N+ Q
Sbjct  198   VKCVSDAGYFIHGKDIAGGYEIENFYGRVVRLHGSAKNLPTSCTSRMRPELCFFPQNVAQ  257

Query  946   YVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIKNRSS----ISPTDMALLQDFKKQIIS  1104
              +++PLF+ +SAYDS+Q++N     ++D   + K+  +     S + +  +QDF+ Q I+
Sbjct  258   TMQTPLFVINSAYDSWQIKNILAPSAVDKKGSFKSCKTDLKKCSASQLQTVQDFRLQFIN  317

Query  1105  ALPKPSATK---GFIVTSNFGHSFASA-----DYKKRMFADSKSKTIEDGFYNWFFDKHP  1260
             AL    A K   G  + S   H  + +     D K  + +++K   I     +WF+D+  
Sbjct  318   ALNSGVANKPANGMFINSCHAHCQSGSVSTWFDAKSPVLSNTK---IGKAVGDWFYDRAS  374

Query  1261  INLID  1275
                ID
Sbjct  375   FKKID  379



>ref|XP_009797415.1| PREDICTED: uncharacterized protein LOC104243851 [Nicotiana sylvestris]
Length=388

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 145/373 (39%), Positives = 210/373 (56%), Gaps = 31/373 (8%)
 Frame = +1

Query  208   IIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDT  387
             I +   LL+  TI+  A  KG VCLDG+PPAYH   G      NW+I + GGGWC +   
Sbjct  15    ICRTESLLVNITILESAVAKGGVCLDGTPPAYHLDRGSGTGLDNWVISIEGGGWCQN---  71

Query  388   YSTHDLSVESCSSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGS  561
                    +  C  R    LGS+  M   V F GI   +  F  +FY WNRV +RYCDGGS
Sbjct  72    -------ITHCLQRKNSRLGSSAKMGKQVAFSGIMSNDPKFNPEFYNWNRVSVRYCDGGS  124

Query  562   FAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFT  741
             F GDVE  DP T L+YRGARIF+ ++ +L+A+GM   +N I +G SAGGL  ++HCD F 
Sbjct  125   FTGDVEAVDPATGLHYRGARIFEAIMADLLAQGMSTVENAILSGCSAGGLASILHCDNFR  184

Query  742   SRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFEC  921
             +  PK  RVKC SD+  F+ +KD     Y +  F+D+V LH   K+LP  CTSK++P  C
Sbjct  185   ALLPKTARVKCFSDAGYFVNLKDISGEAYIEEYFNDVVTLHGSAKNLPPSCTSKLNPSLC  244

Query  922   FQPKNLVQYVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIKN----RSSISPTDMALLQ  1080
             F P+N+   +++PLFI ++AYD +QV+N     + D   A  N      + + +++ +LQ
Sbjct  245   FFPQNVAHQIQTPLFIINAAYDHWQVRNILVPSTADPTGAWTNCKADMRNCTLSELQVLQ  304

Query  1081  DFKKQIISALP--KPSATKGFIVTSNFGH------SFASADYKKRMFADSKSKTIEDGFY  1236
              F+   +  L    PS+T+G+ + S F H      ++       R+F    +KTI +   
Sbjct  305   GFRLNFLKVLEGLGPSSTRGYYINSCFSHCQTQQQAYWFGPNSPRLF----NKTIAEATG  360

Query  1237  NWFFDKHPINLID  1275
             +WF++++    ID
Sbjct  361   DWFWERNQFQEID  373



>ref|XP_010325632.1| PREDICTED: protein notum homolog isoform X1 [Solanum lycopersicum]
Length=402

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 145/365 (40%), Positives = 213/365 (58%), Gaps = 27/365 (7%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             L +  T +     KGAVCLDGSPPAYH   G     ++WLI + GGGWC +         
Sbjct  25    LFVNITYVLSGVAKGAVCLDGSPPAYHHDKGFGTGVNSWLIQMEGGGWCNN---------  75

Query  406   SVESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V +C SR    LGS+  M     F GI      F   FY WNRV + YCDG SF GDV+
Sbjct  76    -VTTCLSRKNTRLGSSKQMVENLAFSGILSNKPQFNPDFYNWNRVKVGYCDGSSFTGDVQ  134

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
             + +P+TKL++RGAR+F  V++EL+AKGMK+A+N I +G SAGGL  ++HCD F +  P G
Sbjct  135   EVNPITKLHFRGARVFLAVMEELLAKGMKNAENAILSGCSAGGLTSILHCDSFKALLPMG  194

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKC SD+  F+ VKD   A + +  F D+V+LH   K+LP  CTS++ P  CF P+N+
Sbjct  195   AKVKCFSDAGYFIDVKDISGAPHIEEYFRDVVSLHGSAKNLPPVCTSRLKPDLCFFPQNV  254

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFSMDL---YRAIKNRS----SISPTDMALLQDFKKQI  1098
              Q+V++PLF+ ++AYDS+Q++N  + D+   Y    N        S   + ++  ++   
Sbjct  255   AQHVRTPLFLVNAAYDSWQIKNILAPDVADPYGVWLNCKLDILKCSSRQLQIMHGYRLLF  314

Query  1099  ISALPK--PSATKGFIVTSNFGHSFASADYKKRMF-ADS---KSKTIEDGFYNWFFDKHP  1260
             + AL    PS+++G+ + S + H     + ++  + ADS    +KTI     +WF+DK+P
Sbjct  315   LRALNALGPSSSRGYFINSCYAH--CQTEVQETWYRADSPKLANKTIAKALGDWFYDKNP  372

Query  1261  INLID  1275
                ID
Sbjct  373   FQKID  377



>ref|XP_004509558.1| PREDICTED: protein notum homolog [Cicer arietinum]
Length=397

 Score =   255 bits (651),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 142/363 (39%), Positives = 209/363 (58%), Gaps = 25/363 (7%)
 Frame = +1

Query  229   LIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLS  408
              +P T +  A  KGAVCLDGSPP +HF  G  +  +NW++++ GGGWC +          
Sbjct  24    FVPMTRLENAVSKGAVCLDGSPPTFHFDEGHGDGVNNWIVHIEGGGWCHN----------  73

Query  409   VESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEK  582
             V+ C  R    LGS+ +M     F G    N  F   FY WNRV +RYCDG SF GDVE+
Sbjct  74    VQDCLGRKNSRLGSSDHMKEKSYFSGYLSNNQQFNPDFYNWNRVKVRYCDGSSFTGDVEE  133

Query  583   PDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGV  762
              DP TKL++RGARIF  V++EL+A+GM  AKN I +G SAGGL  ++HCD F +  P G 
Sbjct  134   VDPTTKLHFRGARIFSAVMEELLARGMVHAKNAILSGCSAGGLTSILHCDGFKALLPNGA  193

Query  763   RVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLV  942
             RVKC+SD+  F+ VKD    ++ +  F  +V  H   K+LP  CTS +SP  CF P+ + 
Sbjct  194   RVKCVSDAGYFVNVKDISGEQFIEEYFRQVVETHGSAKNLPTSCTSTLSPGLCFFPQYMA  253

Query  943   QYVKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQII  1101
               +K+P+FI ++AYDS+Q++N  +         +R+ K N  + SP  + ++QD++ Q +
Sbjct  254   SGIKTPIFIVNAAYDSWQIKNILAPGAADPNGQWRSCKTNLINCSPKQLNIMQDYRSQFL  313

Query  1102  SALP--KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPIN  1266
              AL     S++ G  + S + H   +   +  + +DS    +KTI     +WF+++    
Sbjct  314   KALSVVGNSSSNGMFIDSCYIHC-QTEPQETWLQSDSPTVANKTIAGAVADWFYERSASR  372

Query  1267  LID  1275
              ID
Sbjct  373   EID  375



>ref|XP_004244767.2| PREDICTED: protein notum homolog [Solanum lycopersicum]
Length=387

 Score =   254 bits (649),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 140/360 (39%), Positives = 214/360 (59%), Gaps = 16/360 (4%)
 Frame = +1

Query  223   DLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHD  402
             +  + KTI+  A  KGAVCLDGSPPAY+   G  E A +W+I+L+GGGWC          
Sbjct  38    EYFVGKTIVKNAVSKGAVCLDGSPPAYYMDRGFGEGAQSWMIHLSGGGWCRD--------  89

Query  403   LSVESCSSRMKRELGSTFNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
               V  C +R     GS+  M PF F+G F  N       + WN+V++ YCDGG+F GDVE
Sbjct  90    --VRDCQNRSTTSFGSSKYMVPFKFRGHFSNNKIANPDLFNWNKVMVAYCDGGAFTGDVE  147

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               DP T L++RGARIF  V+++L+++G+ DAKN +  G SAG    +++CDRF+   P  
Sbjct  148   TVDPGTNLHFRGARIFSAVMEDLLSRGLNDAKNALLIGSSAGAYPAMLYCDRFSKLLPNT  207

Query  760   VRVKCLSDSSLFLIV-KDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKN  936
              R+KCL+DS  F+ V K+ ++ K F++++ ++V LH   K+LP  CTS+M P  CF P+N
Sbjct  208   PRLKCLTDSGYFIDVNKNLQKGKGFESIYKELVTLHGSAKALPKSCTSRMKPELCFFPQN  267

Query  937   LVQYVKSPLFIFHSAYDSFQVQNTFSMDLYRAIKNRSSISPTDMALLQDFKKQIISALPK  1116
             + QY+K+PL+   S +D  QV  +   D Y AIK +++ S      L++ + +++S LP 
Sbjct  268   VQQYIKTPLYTIMSPFDIVQVGTSLG-DYYNAIK-QNNCSANQKKNLRELRLELLSKLPN  325

Query  1117  PSATK--GFIVTSNFGHSFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLIDPNNVP  1290
              S TK  G  + S F H+   + +  +  +   + T+   F +W+FD+    LID +++P
Sbjct  326   ASDTKSRGAFIDSQFHHTRLQSYWNPQNVSVVNNVTMIKAFGDWYFDRQYYYLIDKHDLP  385



>ref|XP_009592441.1| PREDICTED: uncharacterized protein LOC104089292 [Nicotiana tomentosiformis]
Length=394

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 144/367 (39%), Positives = 209/367 (57%), Gaps = 31/367 (8%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             LL+  TI+  A   GAVCLDG+PPAYH   G     +NW+I + GGGWC +         
Sbjct  23    LLVNITILESAVATGAVCLDGTPPAYHLDRGSGTGLNNWVISIEGGGWCQN---------  73

Query  406   SVESCSSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              +  C  R    LGS+  M   V F GI   +  F  +FY WNRV +RYCDGGSF GDVE
Sbjct  74    -ITHCLERKNSRLGSSAKMGKQVAFSGIMSNDPKFNPEFYNWNRVSVRYCDGGSFTGDVE  132

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               DP T L+YRGARIF+ ++ +L+++GM  A+N I +G SAGGL  ++HCD F +  PK 
Sbjct  133   AVDPATGLHYRGARIFKAIMADLLSQGMSTAENAILSGCSAGGLASILHCDNFRALLPKS  192

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              RVKC SD+  F+ +KD     Y +  F+D+V LH   K+LP  CTSK+ P  CF P+N+
Sbjct  193   ARVKCFSDAGYFVNLKDISGEAYIEEYFNDVVTLHGSAKNLPPSCTSKLKPSLCFFPQNV  252

Query  940   VQYVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIKN----RSSISPTDMALLQDFKKQI  1098
                +++PLFI ++AYD +QV+N     + D   A  N      + + +++ +LQ F+   
Sbjct  253   AHQLQTPLFIINAAYDHWQVRNILVPSTADPTGAWTNCKADMRNCTLSELKVLQGFRLNF  312

Query  1099  ISALP--KPSATKGFIVTSNFGH------SFASADYKKRMFADSKSKTIEDGFYNWFFDK  1254
             +  L    PS+T+G+ + S F H      ++       R+F    +KTI +   +WF+++
Sbjct  313   LKVLEGLGPSSTRGYYINSCFSHCQTQQQAYWFGPNSPRLF----NKTIAEATGDWFWER  368

Query  1255  HPINLID  1275
             +    ID
Sbjct  369   NQFQEID  375



>ref|XP_008808358.1| PREDICTED: protein notum homolog [Phoenix dactylifera]
Length=397

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 137/361 (38%), Positives = 207/361 (57%), Gaps = 29/361 (8%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYH SPG     +NWL+++ GGGWC +          V +C
Sbjct  30    TYVESAVAKGAVCLDGSPPAYHLSPGFGSGVNNWLVHIEGGGWCNN----------VTTC  79

Query  421   SSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              +R    LGS+  M     F GI     TF   FY WN+V +RYCDG SF GDV++ +P 
Sbjct  80    LARKSTRLGSSRQMVKQIAFSGILNNRQTFNPDFYNWNKVKVRYCDGSSFTGDVKRVNPT  139

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L+YRGAR++  V+++L+A+GM  A+N   +G SAGGL  ++HCD F +  P G RVKC
Sbjct  140   TNLHYRGARVWLAVMEDLLARGMSKAENAFLSGCSAGGLTSILHCDNFRALLPLGTRVKC  199

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             LSD+  F+ +KD    ++ KA F+D+V  H   ++LP  CTS+++P  CF P+N+VQ ++
Sbjct  200   LSDAGYFINLKDITGTEHIKAFFNDVVTTHGSAQNLPSSCTSRLTPSMCFFPQNMVQKIR  259

Query  955   SPLFIFHSAYDSFQVQNTFSMDL-------YRAIKNRSSISPTDMALLQDFKKQIISALP  1113
             +PLFI ++AYDS+Q++N     +       +    +    S + + ++Q F+ Q ++AL 
Sbjct  260   TPLFILNAAYDSWQIKNILVPGVADPHGTWHDCKLDIQQCSSSQLQIMQGFRTQFLNALA  319

Query  1114  --KPSATKGFIVTSNFGHSFASADYKKRMFADSKSKTIE-----DGFYNWFFDKHPINLI  1272
                 S++ G  + S + H  +     +  +  S S  +E         +WF+D+     I
Sbjct  320   GFGSSSSTGMFINSCYAHCQSEM---QETWLSSNSPVLEKIPIAKAVGDWFYDRIAFQKI  376

Query  1273  D  1275
             D
Sbjct  377   D  377



>ref|XP_006432881.1| hypothetical protein CICLE_v10001426mg [Citrus clementina]
 gb|ESR46121.1| hypothetical protein CICLE_v10001426mg [Citrus clementina]
Length=392

 Score =   254 bits (648),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 145/359 (40%), Positives = 205/359 (57%), Gaps = 25/359 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYHF  G     +NWL+++ GG WC +          V  C
Sbjct  32    TYVEDAVAKGAVCLDGSPPAYHFDKGFGAGINNWLVHIDGGAWCNN----------VADC  81

Query  421   SSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
             S+R     GS+  M     F GI      F   FY WNRV +RYCDG SF GDVE  +P 
Sbjct  82    SNRRDSSHGSSKYMVKEANFTGILSNEQKFNPDFYDWNRVKVRYCDGASFTGDVEAVNPE  141

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L++RGAR+F+ V+++L+AKGMK+A+N I  G SAGGL  ++HCD F + FP   RVKC
Sbjct  142   TNLHFRGARVFEAVMEDLLAKGMKNAQNAILTGCSAGGLTSILHCDNFRALFPVNTRVKC  201

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
              +D+  F+ VKD   A + +  +  +VALH   K LP  CTS++SP  CF P+N+   VK
Sbjct  202   FADAGYFVNVKDVSGASHIEEFYKQVVALHGSAKHLPASCTSRLSPGLCFFPQNVAGQVK  261

Query  955   SPLFIFHSAYDSFQVQNTFSMD-------LYRAIKNRSSISPTDMALLQDFKKQIISALP  1113
             +PLFI +SAYDS+Q++N    D         R  K+  + S T +  +Q F+ Q ++AL 
Sbjct  262   TPLFIINSAYDSWQIRNILVPDNADPKGTWRRCKKDIKTCSSTQLQTMQGFRVQFLNALA  321

Query  1114  --KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
                 S+++G ++ S + H   +   +  + ADS       I     +W++D++P   ID
Sbjct  322   GLGNSSSRGMLIDSCYTHC-RTVFQEAWLSADSPVLDKTPIAKAVGDWYYDRNPFQKID  379



>ref|XP_003580427.1| PREDICTED: uncharacterized protein LOC100827238 isoform X2 [Brachypodium 
distachyon]
Length=391

 Score =   254 bits (648),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 141/365 (39%), Positives = 206/365 (56%), Gaps = 26/365 (7%)
 Frame = +1

Query  217   DLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYST  396
             D++++  K+ +     KGAVCLDGSPP YHFSPG    A+NW++++ GGGWC ++     
Sbjct  26    DVEMVFLKSAV----AKGAVCLDGSPPVYHFSPGSGSGANNWVVHMEGGGWCKTS-----  76

Query  397   HDLSVESCSSRMKRELGSTFNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGD  573
                  E CS R     GS+  M P  F GI G +  F   FY WNRV +RYCDG SF GD
Sbjct  77    -----EECSIRKGNFRGSSKYMKPLSFSGILGGSDKFNPDFYNWNRVKVRYCDGSSFTGD  131

Query  574   VEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFP  753
             VE  +  T L+YRG R++Q ++ +L+ +GM  A+N + +G SAGGL  ++HCDRF+   P
Sbjct  132   VEAVETSTNLHYRGNRVWQAIIQDLLDRGMSKAQNALLSGCSAGGLAAILHCDRFSDLLP  191

Query  754   KGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPK  933
                +VKC SD+  F    D     Y +  + DIV LH   KSLP  CTSK SP  CF P+
Sbjct  192   ASAKVKCFSDAGYFFDGTDITGNNYVRKSYKDIVNLHGSAKSLPSSCTSKRSPELCFFPQ  251

Query  934   NLVQYVKSPLFIFHSAYDSFQVQNTFSMDLYRAIKNRS-------SISPTDMALLQDFKK  1092
              ++  +++PLFI ++AYD++Q++N  + +     K  +       S S + +  LQ+F+K
Sbjct  252   YVIPTLRTPLFILNAAYDTWQIRNILAPNAADPKKTWAKCKLDIKSCSSSQLVTLQNFRK  311

Query  1093  QIISALPKP--SATKGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHP  1260
               ++ALP+P  S + G  + S F H  S A   +        +   I     +WF+++H 
Sbjct  312   DFLAALPQPGQSPSLGIFIDSCFAHCQSGAQDTWIGEGSPSIQKMRIGKAVGDWFYNRHV  371

Query  1261  INLID  1275
               LID
Sbjct  372   SQLID  376



>ref|XP_010439718.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/398 (38%), Positives = 216/398 (54%), Gaps = 45/398 (11%)
 Frame = +1

Query  133   DWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFS  312
              W+ LL+ SLVI              ++   L +  T +  A  KGAVCLDGSPPAYH  
Sbjct  6     QWLVLLVCSLVI--------------MKTEGLFVNITYVRNAVAKGAVCLDGSPPAYHLD  51

Query  313   PGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAP-FVFKGIF  489
              G     ++WLI L GGGWC +          V +C SRM   LGS+  M     F  I 
Sbjct  52    RGSGTGVNSWLIQLEGGGWCNN----------VTNCLSRMHTRLGSSKKMVENLAFSAIL  101

Query  490   GINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMK  666
                  +   FY WNRV +RYCDG SF GDV+  +P T L++RGARI+  V+ EL+AKGM+
Sbjct  102   SNKKQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVMQELLAKGMR  161

Query  667   DAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFS  846
             +A+N + +G SAGGL  L+HCD F +  P G RVKCLSD+  FL  +D    +Y K  F 
Sbjct  162   NAENAVLSGCSAGGLASLMHCDSFRALLPMGSRVKCLSDAGFFLNTRDVSGVQYIKQYFQ  221

Query  847   DIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF---SM  1017
             D+V LH   K+LP  CTS+++P  CF P+ + + +++PLFI ++AYDS+Q++N     + 
Sbjct  222   DVVTLHGSAKNLPRSCTSRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAA  281

Query  1018  DLYRA-------IKNRSSISPTDMALLQDFKKQIISALPK--PSATKGFIVTSNFGHSFA  1170
             D Y         IKN     P+ + ++QDF+ + +SA+     S+++G  + S + H   
Sbjct  282   DPYGKWQSCQLDIKN---CHPSQLKVMQDFRLEFLSAVISLGRSSSRGMFIDSCYTHC-Q  337

Query  1171  SADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
             +       + DS      TI     +W +D+     ID
Sbjct  338   TETQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKID  375



>ref|XP_004953590.1| PREDICTED: protein notum homolog isoform X1 [Setaria italica]
Length=401

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 144/365 (39%), Positives = 205/365 (56%), Gaps = 27/365 (7%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             LL+  T +  A  KGAVCLDGS PAYH + G     ++WL++  GGGWC++         
Sbjct  29    LLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSGVNSWLVHFEGGGWCSN---------  79

Query  406   SVESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V +C  R +  LGS+  MA    F GI      +   FY WN+V +RYCDG SF GDVE
Sbjct  80    -VTTCLQRKRTRLGSSKEMATQIAFSGILSDTPDYNPDFYNWNKVKVRYCDGSSFTGDVE  138

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
             + DP TKL+YRGARI+Q V+++L+AKGM  A+N + +G SAGGL  ++HCDRF    P G
Sbjct  139   EVDPTTKLHYRGARIWQAVMEDLLAKGMDKAENALISGCSAGGLTSILHCDRFHDLLPLG  198

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              RVKCLSD+  F+  KD     Y  A F+D+V  H   K+LP  CTS + P  CF P N 
Sbjct  199   ARVKCLSDAGFFINEKDVAGVGYIAAFFNDVVTTHGSAKNLPSSCTSILPPGVCFFPSNE  258

Query  940   VQYVKSPLFIFHSAYDSFQVQNTF------SMDLYRAIKNR-SSISPTDMALLQDFKKQI  1098
             V+ +++PLFI ++AYD +QV+N            + + K+     S   + +LQ F+   
Sbjct  259   VKQIQTPLFILNAAYDYWQVRNILVPGVADRRGTWHSCKHDIDQCSAAQLRVLQGFRDDF  318

Query  1099  ISALPKP--SATKGFIVTSNFGHSFASADYKKRMFADSK----SKTIEDGFYNWFFDKHP  1260
             + A+ +   S ++G  + S F H    ++ ++  F+       + TI     +WFFD+ P
Sbjct  319   LKAVAEQGNSTSRGLFINSCFVH--CQSEIQELWFSSDSPMLGNTTIAAAVGDWFFDRSP  376

Query  1261  INLID  1275
                ID
Sbjct  377   FQKID  381



>ref|XP_010449357.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/398 (38%), Positives = 216/398 (54%), Gaps = 45/398 (11%)
 Frame = +1

Query  133   DWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFS  312
              W+ LL+ SLVI              ++   L +  T +  A  KGAVCLDGSPPAYH  
Sbjct  6     QWLVLLVCSLVI--------------MKTEGLFVNITYVRNAVAKGAVCLDGSPPAYHLH  51

Query  313   PGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAP-FVFKGIF  489
              G     ++WLI L GGGWC +          V +C SRM   LGS+  M     F  I 
Sbjct  52    RGSGTGVNSWLIQLEGGGWCNN----------VTNCLSRMHTRLGSSKKMVENLAFSAIL  101

Query  490   GINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMK  666
                  +   FY WNRV +RYCDG SF GDV+  +P T L++RGARI+  V+ EL+AKGM+
Sbjct  102   SNKKQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVMQELLAKGMR  161

Query  667   DAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFS  846
             +A+N + +G SAGGL  L+HCD F +  P G RVKCLSD+  FL  +D    +Y K  F 
Sbjct  162   NAENAVLSGCSAGGLASLMHCDSFRALLPMGSRVKCLSDAGFFLNTRDVSGVQYIKQYFQ  221

Query  847   DIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF---SM  1017
             D+V LH   K+LP  CTS+++P  CF P+ + + +++PLFI ++AYDS+Q++N     + 
Sbjct  222   DVVTLHGSAKNLPRSCTSRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAA  281

Query  1018  DLYRA-------IKNRSSISPTDMALLQDFKKQIISAL--PKPSATKGFIVTSNFGHSFA  1170
             D Y         IKN     P+ + ++QDF+ + +SA+     S+++G  + S + H   
Sbjct  282   DPYGKWQSCQLDIKN---CHPSQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHC-Q  337

Query  1171  SADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
             +       + DS      TI     +W +D+     ID
Sbjct  338   TETQTSWFWQDSPILNRTTIAKAVGDWVYDRKLFQKID  375



>ref|XP_010676220.1| PREDICTED: uncharacterized protein LOC104892094 [Beta vulgaris 
subsp. vulgaris]
Length=439

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 145/399 (36%), Positives = 217/399 (54%), Gaps = 47/399 (12%)
 Frame = +1

Query  133   DWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFS  312
              W+ LL+F +V                +   L +  T +  A  KGAVCLDGS PAYH  
Sbjct  8     QWMKLLVFMVVFQ--------------KSEGLYVGITKVRSAVAKGAVCLDGSAPAYHLH  53

Query  313   PGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNM-APFVFKGIF  489
              G     ++WL+++ GGGWC +          + +C  R    LGS++ M     F GI 
Sbjct  54    RGHGTGINSWLVHVEGGGWCNN----------ITTCLERKYSHLGSSWKMDKQLAFSGIL  103

Query  490   GINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMK  666
               N  F   FY WNRV IRYCDG SF G+VE  +P+TKL++RGARI+  V+++L+ KGM+
Sbjct  104   SNNPMFNPDFYNWNRVKIRYCDGASFTGNVEAVNPITKLHFRGARIWHAVIEDLLLKGMR  163

Query  667   DAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFS  846
             +AKN I +G SAGGL  ++HCD F +  P G RVKCLSD+  F+ VKD   A +  + F+
Sbjct  164   NAKNAILSGCSAGGLTSILHCDSFRALLPVGARVKCLSDAGYFINVKDVSGASHVASYFN  223

Query  847   DIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFS----  1014
              IV LH   KSLP  CT  + P  CF P+ + +  ++PLFI ++AYDS+Q++N  +    
Sbjct  224   QIVNLHGSAKSLPASCTRSLKPVMCFFPQYMAKRTRTPLFILNAAYDSWQIKNILAPVVA  283

Query  1015  ------MDLYRAIKNRSSISPTDMALLQDFKKQIISALPK--PSATKGFIVTSNFGHSFA  1170
                    D    IKN    S   ++++QDF+ + ++A+ K   S ++G  + S + H   
Sbjct  284   DPRGLWSDCKIDIKN---CSTNQLSVMQDFRSEFLNAISKLGKSPSRGLFINSCYAH--C  338

Query  1171  SADYKKRMFADS----KSKTIEDGFYNWFFDKHPINLID  1275
               + ++  F+         TI     +WF+++  + +ID
Sbjct  339   QTEMQETWFSHHSPVLHKTTIAKAVGDWFYNRRQLQMID  377



>ref|XP_010240371.1| PREDICTED: uncharacterized protein LOC100827238 isoform X1 [Brachypodium 
distachyon]
Length=404

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 141/365 (39%), Positives = 206/365 (56%), Gaps = 26/365 (7%)
 Frame = +1

Query  217   DLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYST  396
             D++++  K+ +     KGAVCLDGSPP YHFSPG    A+NW++++ GGGWC ++     
Sbjct  39    DVEMVFLKSAV----AKGAVCLDGSPPVYHFSPGSGSGANNWVVHMEGGGWCKTS-----  89

Query  397   HDLSVESCSSRMKRELGSTFNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGD  573
                  E CS R     GS+  M P  F GI G +  F   FY WNRV +RYCDG SF GD
Sbjct  90    -----EECSIRKGNFRGSSKYMKPLSFSGILGGSDKFNPDFYNWNRVKVRYCDGSSFTGD  144

Query  574   VEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFP  753
             VE  +  T L+YRG R++Q ++ +L+ +GM  A+N + +G SAGGL  ++HCDRF+   P
Sbjct  145   VEAVETSTNLHYRGNRVWQAIIQDLLDRGMSKAQNALLSGCSAGGLAAILHCDRFSDLLP  204

Query  754   KGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPK  933
                +VKC SD+  F    D     Y +  + DIV LH   KSLP  CTSK SP  CF P+
Sbjct  205   ASAKVKCFSDAGYFFDGTDITGNNYVRKSYKDIVNLHGSAKSLPSSCTSKRSPELCFFPQ  264

Query  934   NLVQYVKSPLFIFHSAYDSFQVQNTFSMDLYRAIKNRS-------SISPTDMALLQDFKK  1092
              ++  +++PLFI ++AYD++Q++N  + +     K  +       S S + +  LQ+F+K
Sbjct  265   YVIPTLRTPLFILNAAYDTWQIRNILAPNAADPKKTWAKCKLDIKSCSSSQLVTLQNFRK  324

Query  1093  QIISALPKP--SATKGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHP  1260
               ++ALP+P  S + G  + S F H  S A   +        +   I     +WF+++H 
Sbjct  325   DFLAALPQPGQSPSLGIFIDSCFAHCQSGAQDTWIGEGSPSIQKMRIGKAVGDWFYNRHV  384

Query  1261  INLID  1275
               LID
Sbjct  385   SQLID  389



>ref|XP_009616254.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=404

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 148/382 (39%), Positives = 217/382 (57%), Gaps = 27/382 (7%)
 Frame = +1

Query  175   QYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYL  354
             Q++ S    + I +   L +  T +     KGAVCLDGS PAYH   G     ++WLI +
Sbjct  10    QWIYSLLTLSMIFRTEGLFVNITYLLSGMAKGAVCLDGSSPAYHHDKGFGTGVNSWLIQM  69

Query  355   AGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWN  528
              GGGWC +          V +C SR    LGS+  M     F GI      F   FY WN
Sbjct  70    EGGGWCNN----------VTTCLSRKNTRLGSSKQMVKQLAFSGILSNKPQFNPDFYNWN  119

Query  529   RVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagg  708
             RV +RYCDG SF GDV+  +P+T L++RGAR+F  V+++L+AKGMK+A+N I +G SAGG
Sbjct  120   RVKVRYCDGSSFTGDVQAVNPITNLHFRGARVFLAVMEDLLAKGMKNAENAILSGCSAGG  179

Query  709   lgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPV  888
             L  ++HCD F +  P G +VKC SD+  F+ VKD   A + +  F D+V LH   K+LP 
Sbjct  180   LTSILHCDSFKALLPMGAKVKCFSDAGYFINVKDISGAPHIEEFFGDVVRLHGSAKNLPP  239

Query  889   ECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRS  1047
              CTS++ P  CF P+N+ Q+V++PLF+ ++AYDS+Q++N  +        ++R  K +  
Sbjct  240   SCTSRLKPNLCFFPQNVAQHVRTPLFLVNAAYDSWQIKNILAPSVADPRGVWRNCKLDIL  299

Query  1048  SISPTDMALLQDFKKQIISALPK--PSATKGFIVTSNFGHSFASADYKKRMF-ADS---K  1209
               S   +  +Q F+   + AL    PS+++G+ + S + H     + ++  F ADS    
Sbjct  300   RCSSRQLQTMQGFRLGFLRALITLGPSSSRGYFINSCYAH--CQTEVQETWFRADSPKLA  357

Query  1210  SKTIEDGFYNWFFDKHPINLID  1275
             +KTI     +WFFDK+    ID
Sbjct  358   NKTIAIALGDWFFDKNSFQKID  379



>gb|EYU29130.1| hypothetical protein MIMGU_mgv1a007782mg [Erythranthe guttata]
Length=395

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 140/359 (39%), Positives = 204/359 (57%), Gaps = 24/359 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGS PAYHF  G     +NWL+++ GGGWC +  T          C
Sbjct  25    TYVESAVAKGAVCLDGSAPAYHFDKGSGAGINNWLVHIEGGGWCNNATT----------C  74

Query  421   SSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              +R    LGS+  MA    F GIF     F   FY WNR+ +RYCDG SF GDVE  DP 
Sbjct  75    LARRNGRLGSSKQMAKQIAFSGIFSNKPQFNPDFYNWNRLKVRYCDGASFTGDVEAVDPA  134

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             TKLYYRGAR+F  V+++L+AKGMK+A+N I +G SAGGL  +++CDRF S  P    VKC
Sbjct  135   TKLYYRGARVFVAVIEDLLAKGMKNAENAILSGCSAGGLTSILNCDRFKSLLPISTNVKC  194

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
              +D+  F+  KD   A++ +  ++D+V  H   K L   CTSKM P  CF P+N+VQ ++
Sbjct  195   FADAGFFINAKDVSGAQHIEQFYNDVVTTHGSAKHLAQSCTSKMKPSLCFFPENMVQAIQ  254

Query  955   SPLFIFHSAYDSFQVQNTFS------MDLYRAIKNR-SSISPTDMALLQDFKKQIISALP  1113
             +P+F+ ++AYDS+Q++N  +        L+   K      S T +  +Q+++ + + AL 
Sbjct  255   TPIFVVNAAYDSWQIKNILAPGVADPHGLWHNCKTDIKKCSTTQLQTMQEYRLEFLKALS  314

Query  1114  K--PSATKGFIVTSNFGH--SFASADYKKRMFADSKSK-TIEDGFYNWFFDKHPINLID  1275
                 + +KG+ + S + H  +     +   +     +K TI     +WF+++ P   ID
Sbjct  315   GLMSAKSKGYFINSCYAHCQTETQETWSTNISPMLNNKVTIAKAVGDWFYERSPFEKID  373



>gb|ACF05806.1| PAE [Litchi chinensis]
Length=399

 Score =   253 bits (646),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 140/402 (35%), Positives = 221/402 (55%), Gaps = 41/402 (10%)
 Frame = +1

Query  115   VSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSP  294
             V  R + W+ LL+  L++              ++     +  T +  A  KGAVCLDGSP
Sbjct  2     VDARWSPWLSLLVCGLIL--------------LKTEGFDVGITYVENAVAKGAVCLDGSP  47

Query  295   PAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPFV  474
             PAYH   G     +NWL+++ GGGWC +          V +C SR    LGS+  M   V
Sbjct  48    PAYHLDKGFGAGINNWLVHIEGGGWCNN----------VTTCLSRKNTRLGSSKKMVKVV  97

Query  475   -FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDEL  648
              F G+      F   FY WNR+ +RYCDG SF GDVE  +P T L++RGAR+F  ++++L
Sbjct  98    AFSGMLSNKQKFNPDFYNWNRIKVRYCDGASFTGDVEAVNPATNLHFRGARVFLAIIEDL  157

Query  649   MAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKY  828
             +AKGMK+AKN + +G SAGGL  ++HCD+F +  P   +VKC +D+  F+  KD   A++
Sbjct  158   LAKGMKNAKNAVLSGCSAGGLTSILHCDKFQTLLPTSTKVKCFADAGYFINTKDVSGAQH  217

Query  829   FKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNT  1008
              +A ++++VA H   K+LP  CTS++ P  CF P+ + + +++PLFI ++AYDS+Q++N 
Sbjct  218   IEAFYNEVVATHGSAKNLPASCTSRLKPGLCFFPQYMARQIQTPLFIINAAYDSWQIKNI  277

Query  1009  FSMDL------YRAIK-NRSSISPTDMALLQDFKKQIISALP--KPSATKGFIVTSNFGH  1161
              +  +      + + K + ++ SP  +  +Q F+ Q + AL     S +KG  + S + H
Sbjct  278   LAPGVADPHGTWHSCKLDINNCSPNQLQTMQSFRLQFLDALSGLGNSTSKGLFIDSCYAH  337

Query  1162  SFASADYKKRMFADSK----SKTIEDGFYNWFFDKHPINLID  1275
                  + ++    D        TI     +W++D+ P   ID
Sbjct  338   --CQTEMQETWLRDDSPVLGKTTIAKAVGDWYYDRSPFQKID  377



>ref|XP_006359968.1| PREDICTED: protein notum homolog, partial [Solanum tuberosum]
Length=369

 Score =   252 bits (643),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 144/364 (40%), Positives = 205/364 (56%), Gaps = 27/364 (7%)
 Frame = +1

Query  229   LIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLS  408
             L+  TI+  A  KGAVCLDGSPPAYH   G     +NW+I + GGGWC +          
Sbjct  8     LVNLTILQTAVAKGAVCLDGSPPAYHLDRGSGTGVNNWVISVEGGGWCQN----------  57

Query  409   VESCSSRMKRELGSTFNMAPFVF-KGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEK  582
             V  C  R   + GS+  M   VF  G+      F  +FY WNRV +RYCDGGSF GDVE 
Sbjct  58    VAQCLLRKNSKYGSSAKMENQVFFSGMLSNEQKFNPEFYNWNRVFVRYCDGGSFTGDVEA  117

Query  583   PDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGV  762
              DP T L+YRGARIF+ +++EL+A+GM  ++N I +G SAGGL  ++HCD F    P  V
Sbjct  118   IDPGTGLHYRGARIFKAIMEELLAQGMNKSENAILSGCSAGGLTTILHCDNFRILLPSSV  177

Query  763   RVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLV  942
             +VKC SD+  F+ ++D     + +  F+D+V LH   ++LP  CTSK+ P  CF P+N+ 
Sbjct  178   KVKCFSDAGYFVNIEDISGKLFIQQFFNDVVTLHGSVRNLPPSCTSKLKPSLCFFPQNVA  237

Query  943   QYVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIK----NRSSISPTDMALLQDFKKQII  1101
             Q +++PLFI +SAYDS+QV+N       D   A      N  + +P  + +LQ F+   +
Sbjct  238   QQIQTPLFIINSAYDSWQVRNILVPRGTDPKGAWNSCGANIKTCTPDQLKVLQGFRLNFL  297

Query  1102  SALP--KPSATKGFIVTSNFGHSFASADYKKRMFADSK----SKTIEDGFYNWFFDKHPI  1263
              AL    PS+T+G+ + S F H       +   F  +     +KTI +   +W  +++  
Sbjct  298   KALEGLGPSSTRGYYINSCFAH--CQTQKQASWFGPNSPRLFNKTIAEAVGDWVLERNQF  355

Query  1264  NLID  1275
               ID
Sbjct  356   RQID  359



>ref|XP_010942974.1| PREDICTED: protein notum homolog [Elaeis guineensis]
Length=391

 Score =   253 bits (645),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 137/359 (38%), Positives = 204/359 (57%), Gaps = 22/359 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T++  A  KGAVCLDGSPPAYHF+PG     +NWL+++ GGGWC +          V
Sbjct  29    VPLTLVQSAVAKGAVCLDGSPPAYHFTPGFGSGVNNWLVHMEGGGWCRN----------V  78

Query  412   ESCSSRMKRELGSTFNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPD  588
             E C  R K   GS+  M    F GI G        FY WN+V IRYCDG SF GDVE  D
Sbjct  79    EECKERTKNFRGSSKYMKQLSFSGILGNKQKLNPDFYNWNKVKIRYCDGSSFTGDVEAVD  138

Query  589   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRV  768
             P T L++RGAR+++ ++D+L+AKGM  A+N + +G SAGGL  ++HCD F    P G RV
Sbjct  139   PATNLHFRGARVWRAIMDDLLAKGMSKAQNALLSGCSAGGLASILHCDSFRDLLPAGARV  198

Query  769   KCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  948
             KC SD+  F+  KD    +  +  ++ +VA H   K+LP  CTS+  P  CF P+ +VQ 
Sbjct  199   KCFSDAGYFINAKDVSGKESIRDFYNQVVATHGSAKNLPSSCTSRFPPSMCFFPQYVVQS  258

Query  949   VKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQIISA  1107
             +++PLFI ++AYD++Q++N  +         +   K +    S + + ++Q F+ + + A
Sbjct  259   MRTPLFILNAAYDAWQIKNILAPSPSDPRKFWGECKLDIKKCSSSQLQVMQGFRSEFLRA  318

Query  1108  LPKPSATKGFIVTSNFGHSFASADYKKRMFADSKSKT---IEDGFYNWFFDKHPINLID  1275
             LP  S + G  + S + H  + A  +  + +DS +     I     +W+F +  +  ID
Sbjct  319   LPANSPSIGMFIDSCYSHCQSGAQ-ETWLSSDSPAINKMPIAKAVGDWYFGRTAMKKID  376



>gb|KCW72718.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
 gb|KCW72719.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=403

 Score =   253 bits (645),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 135/350 (39%), Positives = 209/350 (60%), Gaps = 27/350 (8%)
 Frame = +1

Query  271   AVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGS  450
             AVCLDGSPPAYHF+ G    A+NWL+   GGGWC +          V +C +R    LGS
Sbjct  4     AVCLDGSPPAYHFNKGLGTGANNWLVQFEGGGWCNN----------VTTCLARRDTRLGS  53

Query  451   TFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARI  624
             +  M   V F GI   N +F   FY WNR+ +RYCDG SF GDVE  DP TKL++RGAR 
Sbjct  54    SKEMVKEVAFSGILSNNHSFNPDFYNWNRIKVRYCDGASFTGDVEAVDPATKLHFRGARA  113

Query  625   FQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIV  804
             F  ++++L++KGM DA+N I +G SAGGL  ++HCDRF +  P    VKC++D+  F+  
Sbjct  114   FVAIIEDLLSKGMSDAENAILSGCSAGGLTSILHCDRFRALMPTSATVKCVADAGYFINA  173

Query  805   KDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAY  984
             KD   A++ +  +S++VA H   K+LP  CTS++ P  CF P+N+V+ +++PLFI ++AY
Sbjct  174   KDISGAQHIETFYSEVVATHGSAKNLPTSCTSRLRPGLCFFPQNVVKQIQTPLFILNAAY  233

Query  985   DSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQIISALPK--PSATKGF  1137
             D++Q++N  +  +      + + K + ++ S   + ++QDF++Q + AL +   S ++G 
Sbjct  234   DAWQIKNILAPGVADPHGTWHSCKLDINNCSLDQLQIMQDFRQQFLDALSRVGTSPSRGI  293

Query  1138  IVTSNFGHSFASADYKKRMFADSKSKTIEDGFY----NWFFDKHPINLID  1275
              + S + H    ++ ++    D     IE        +W++D+ P   ID
Sbjct  294   FIDSCYAH--CQSEMQETWLRDDSPVLIETSIAKAVGDWYYDRRPFQKID  341



>ref|XP_007209217.1| hypothetical protein PRUPE_ppa006718mg [Prunus persica]
 gb|EMJ10416.1| hypothetical protein PRUPE_ppa006718mg [Prunus persica]
 gb|AIA21744.1| pectin acetylesterase [Prunus persica]
Length=398

 Score =   252 bits (644),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 138/359 (38%), Positives = 210/359 (58%), Gaps = 25/359 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T++  A  KGAVCLDGS PAYHF  G     +NWL+++ GGGWC S          VE+C
Sbjct  30    TLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHVEGGGWCNS----------VETC  79

Query  421   SSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
               R     GS+  M     F G+ G    F   FY WNR+ +RYCDG SF GDVE  +P 
Sbjct  80    LDRKNTYRGSSNKMEKSMSFSGVLGNKQKFNPDFYNWNRIKVRYCDGSSFTGDVEAVNPA  139

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L++RGAR+F+ ++D+L+AKGMK+A++ + +G SAGGL  +++CD F S  P G +VKC
Sbjct  140   TNLHFRGARVFRAIIDDLLAKGMKNAQSALLSGCSAGGLASILNCDNFRSLLPVGTKVKC  199

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             L+D+  F+  K    ++  +A +S++VALH   K+LP  CTSK+SP  CF P+N+V   +
Sbjct  200   LADAGYFINAKTVSGSQQIQAFYSEVVALHGSAKNLPASCTSKLSPGLCFFPQNVVPVTR  259

Query  955   SPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQIISALP  1113
             +P+F+ ++AYDS+Q++N  +  +      ++  K +  + SP+ +  +Q+++ Q + AL 
Sbjct  260   TPIFLVNAAYDSWQIKNILAPGIADPKGAWKKCKLDIKNCSPSQLQTMQEYRLQFLGALS  319

Query  1114  KPSA--TKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
               S+  T G  + S + H       +  + ADS      TI     +W+ D+ P   ID
Sbjct  320   HASSSTTHGLFIDSCYAHCQIGTQ-ETWLAADSPVLSKTTIGKAVGDWYTDRTPFQKID  377



>ref|XP_002865253.1| pectin acetylesterase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41512.1| pectin acetylesterase [Arabidopsis lyrata subsp. lyrata]
Length=391

 Score =   252 bits (644),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 134/364 (37%), Positives = 208/364 (57%), Gaps = 21/364 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G    A+NW++++ GGGWCT   T      ++
Sbjct  24    VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGANNWIVHMEGGGWCTDIATCVQRKSTM  83

Query  412   ESCSSRMKRELGSTFNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKPD  588
             +  S  M ++ G         F GI G   +T   FY WNR+ +RYCDG SF GD+E  D
Sbjct  84    KGSSKLMNKDFG---------FSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVD  134

Query  589   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRV  768
             P  KL++RGAR+++ V+D+LMAKGM +A+N I +G SAG L  ++HCD+F S  PK  +V
Sbjct  135   PTNKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDQFKSILPKTAKV  194

Query  769   KCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  948
             KC+SD+  F+  KD     Y ++ ++ +VA H   KSLPV CTS M P  CF P+ + Q 
Sbjct  195   KCVSDAGYFIHGKDITGGSYIQSYYAKVVATHGSAKSLPVSCTSSMKPELCFFPQYVAQT  254

Query  949   VKSPLFIFHSAYDSFQVQNTF---SMDLYRAIK----NRSSISPTDMALLQDFKKQIISA  1107
             +++PLF+ ++A+DS+Q++N     S+D  +A K    +    +   +  +Q ++ Q+++A
Sbjct  255   LQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTVQGYRDQVLAA  314

Query  1108  LP--KPSATKGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLID  1275
             L   +   T G  + S   H    ++A +         +  +     +WFF++     ID
Sbjct  315   LAPVRSDTTSGLFLDSCHAHCQGGSAATWSGDGGPTVANTKMAKAVGDWFFERSTFQNID  374

Query  1276  PNNV  1287
              +++
Sbjct  375   CSSL  378



>ref|XP_006385137.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 ref|XP_006385139.1| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ERP62934.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62936.1| pectinacetylesterase family protein [Populus trichocarpa]
Length=399

 Score =   252 bits (644),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 145/364 (40%), Positives = 214/364 (59%), Gaps = 25/364 (7%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             L +  T +  A  KGAVCLDGSPPAYH+  G     ++WLI+  GGGWC +         
Sbjct  25    LYVGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNN---------  75

Query  406   SVESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V SC SR K  LGS+  M     F GI      F   FY WNRV IRYCDG SF GDV+
Sbjct  76    -VTSCLSRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQ  134

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               +P T L++RGARI+  V+++L+ KG+K+A+N + +G SAGGL  ++HCD F +    G
Sbjct  135   AVNPATNLHFRGARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALLRMG  194

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKCLSD+  F+ VKD   A + +  F++IV LH   K+LP+ CTS + P  CF P+ +
Sbjct  195   TKVKCLSDAGYFIKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSVLKPSFCFFPQYV  254

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQI  1098
                V++PLFI ++AYDS+Q++N  +      + ++++ K + ++ SP  +  +QDF+ Q 
Sbjct  255   APQVRTPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQF  314

Query  1099  ISALPKP--SATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPI  1263
             ++AL K   S+++G  + S + H   +   +K    DS     K I     +WF+D++P 
Sbjct  315   LNALNKSTNSSSRGLYIDSCYAHC-QTETQEKWFMEDSPVLGKKKIAKAVGDWFYDRNPF  373

Query  1264  NLID  1275
               ID
Sbjct  374   QKID  377



>ref|XP_009108426.1| PREDICTED: protein notum homolog [Brassica rapa]
 emb|CDX76482.1| BnaA08g09180D [Brassica napus]
Length=391

 Score =   252 bits (643),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 141/361 (39%), Positives = 203/361 (56%), Gaps = 23/361 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT           V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  412   ESCSSRMKRELGST-FNMAPFVFKGIFGINA-TFTKFYKWNRVIIRYCDGGSFAGDVEKP  585
              SCS+R     GS+ F    F F GI G    T   FY WNR+ +RYCDG SF G+VE  
Sbjct  74    ASCSARKNTMKGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGNVEAV  133

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +P  KL++RGAR+++ V+D+LMAKGMK+A+N I +G SAG L  ++HCD F +  P   R
Sbjct  134   NPANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPPTAR  193

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+   D     Y +  +S +VALH   KSLPV CTSKM P  CF P+N+V 
Sbjct  194   VKCVSDAGYFIHGTDISGGSYIQTYYSKVVALHGSAKSLPVSCTSKMKPELCFFPQNVVP  253

Query  946   YVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIKN----RSSISPTDMALLQDFKKQIIS  1104
              +++PLF+ ++A+DS+Q++N     ++D  +  KN        +   +  +Q F+ Q++ 
Sbjct  254   SMRTPLFVINAAFDSWQIKNVLAPTAVDKRKEWKNCKLDLKKCTAAQLKTVQGFRDQMMR  313

Query  1105  ALPKPSAT--KGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLI  1272
             AL    +T  +G  + S   H    ++A +         +  I     NWF+ +     I
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQVANSKISQAVGNWFYGRSAFQKI  373

Query  1273  D  1275
             D
Sbjct  374   D  374



>ref|XP_011028483.1| PREDICTED: uncharacterized protein LOC105128479 isoform X3 [Populus 
euphratica]
 ref|XP_011028484.1| PREDICTED: uncharacterized protein LOC105128479 isoform X3 [Populus 
euphratica]
Length=427

 Score =   253 bits (646),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 144/364 (40%), Positives = 213/364 (59%), Gaps = 25/364 (7%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             L +  T +  A  KGAVCLDGSPPAYH+  G     ++WLI+  GGGWC +         
Sbjct  25    LYVGITYVKSAVAKGAVCLDGSPPAYHWDKGSGTGINSWLIHFEGGGWCNN---------  75

Query  406   SVESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V SC SR K  LGS+  M     F GI      F   FY WNRV IRYCDG SF GDV+
Sbjct  76    -VTSCLSRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQ  134

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               +P T L++RGARI+  V+++L+ KG+K+A+N + +G SAGGL  ++HCD F +    G
Sbjct  135   AVNPATNLHFRGARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALLRMG  194

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKCLSD+  F+ VKD   A + +  F++IV LH   K+LP+ CTS + P  CF P+ +
Sbjct  195   TKVKCLSDAGYFIKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSMLKPSFCFFPQYV  254

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQI  1098
                V++PLFI ++AYDS+Q++N  +      + ++++ K + ++ SP  +  +QDF+ Q 
Sbjct  255   APQVRTPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQF  314

Query  1099  ISALPKP--SATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPI  1263
             ++AL     S+++G  + S + H   +   +K    DS     K I     +WF+D++P 
Sbjct  315   LNALKTSTNSSSRGLYIDSCYAHC-QTETQEKWFMEDSPVLGKKKIAKAVGDWFYDRNPF  373

Query  1264  NLID  1275
               ID
Sbjct  374   QKID  377



>emb|CDY09287.1| BnaC03g63170D [Brassica napus]
Length=391

 Score =   251 bits (642),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 141/361 (39%), Positives = 203/361 (56%), Gaps = 23/361 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT           V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  412   ESCSSRMKRELGST-FNMAPFVFKGIFGINA-TFTKFYKWNRVIIRYCDGGSFAGDVEKP  585
              SCS+R     GS+ F    F F GI G    T   FY WNR+ +RYCDG SF G+VE  
Sbjct  74    ASCSARKNTMKGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGNVEAV  133

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +P  KL++RGAR+++ V+D+LMAKGMK+A+N I +G SAG L  ++HCD F +  P   R
Sbjct  134   NPANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPPTAR  193

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+   D     Y +  +S +VALH   KSLPV CTSKM P  CF P+N+V 
Sbjct  194   VKCVSDAGYFIHGTDISGGSYIQTYYSKVVALHGSAKSLPVSCTSKMKPELCFFPQNVVP  253

Query  946   YVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIKN----RSSISPTDMALLQDFKKQIIS  1104
              +++PLF+ ++A+DS+Q++N     ++D  +  KN        +   +  +Q F+ Q++ 
Sbjct  254   SMRTPLFVINAAFDSWQIKNVLAPTAVDKRKEWKNCKHDLKKCTAAQLKTVQGFRDQMMR  313

Query  1105  ALPKPSAT--KGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLI  1272
             AL    +T  +G  + S   H    ++A +         +  I     NWF+ +     I
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQVANSKISQAVGNWFYGRSAFQKI  373

Query  1273  D  1275
             D
Sbjct  374   D  374



>ref|XP_010434420.1| PREDICTED: protein notum homolog [Camelina sativa]
 ref|XP_010434421.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 150/398 (38%), Positives = 216/398 (54%), Gaps = 45/398 (11%)
 Frame = +1

Query  133   DWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFS  312
              W+ LL+ SLV+              ++   L +  T +  A  KGAVCLDGSPPAYH  
Sbjct  6     QWLVLLVCSLVM--------------MKTEGLFVNITYVRNAVAKGAVCLDGSPPAYHLD  51

Query  313   PGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAP-FVFKGIF  489
              G     ++WLI L GGGWC +          V +C SRM   LGS+  M     F  I 
Sbjct  52    RGSGTGINSWLIQLEGGGWCNN----------VTNCLSRMHTRLGSSKKMVENLAFSAIL  101

Query  490   GINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMK  666
                  +   FY WNRV +RYCDG SF GDV+  +P T L++RGARI+  V+ EL+AKGM+
Sbjct  102   SNKKQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVMQELLAKGMR  161

Query  667   DAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFS  846
             +A+N + +G SAGGL  L+HCD F +  P G RVKCLSD+  FL  +D    +Y K  F 
Sbjct  162   NAENAVLSGCSAGGLASLMHCDSFRALLPMGSRVKCLSDAGFFLNTRDVSGVQYIKQYFQ  221

Query  847   DIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF---SM  1017
             D+V LH   K+LP  CTS+++P  CF P+ + + +++PLFI ++AYDS+Q++N     + 
Sbjct  222   DVVTLHGSAKNLPRSCTSRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAA  281

Query  1018  DLYRA-------IKNRSSISPTDMALLQDFKKQIISAL--PKPSATKGFIVTSNFGHSFA  1170
             D Y         IKN     P+ + ++QDF+ + +SA+     S+++G  + S + H   
Sbjct  282   DPYGKWQSCQLDIKN---CHPSQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHC-Q  337

Query  1171  SADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
             +       + DS      TI     +W +D+     ID
Sbjct  338   TETQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKID  375



>ref|XP_006385138.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62935.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=402

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 145/364 (40%), Positives = 214/364 (59%), Gaps = 25/364 (7%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             L +  T +  A  KGAVCLDGSPPAYH+  G     ++WLI+  GGGWC +         
Sbjct  28    LYVGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNN---------  78

Query  406   SVESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V SC SR K  LGS+  M     F GI      F   FY WNRV IRYCDG SF GDV+
Sbjct  79    -VTSCLSRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQ  137

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               +P T L++RGARI+  V+++L+ KG+K+A+N + +G SAGGL  ++HCD F +    G
Sbjct  138   AVNPATNLHFRGARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALLRMG  197

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKCLSD+  F+ VKD   A + +  F++IV LH   K+LP+ CTS + P  CF P+ +
Sbjct  198   TKVKCLSDAGYFIKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSVLKPSFCFFPQYV  257

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQI  1098
                V++PLFI ++AYDS+Q++N  +      + ++++ K + ++ SP  +  +QDF+ Q 
Sbjct  258   APQVRTPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQF  317

Query  1099  ISALPKP--SATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPI  1263
             ++AL K   S+++G  + S + H   +   +K    DS     K I     +WF+D++P 
Sbjct  318   LNALNKSTNSSSRGLYIDSCYAHC-QTETQEKWFMEDSPVLGKKKIAKAVGDWFYDRNPF  376

Query  1264  NLID  1275
               ID
Sbjct  377   QKID  380



>ref|XP_006361581.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=387

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 140/359 (39%), Positives = 206/359 (57%), Gaps = 25/359 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYHF  G     +NWLI L GG WC +  T          C
Sbjct  30    TYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWLIQLEGGAWCNNATT----------C  79

Query  421   SSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              +R K  LGS+  M   V F GI    A F   FY WNR+ I+YCDG SF GDV   DP 
Sbjct  80    LARTKTRLGSSKLMLKTVSFSGILSNKAEFNPDFYNWNRIRIKYCDGSSFTGDVAAADPK  139

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             TK++YRGARIF  V+++ +AKGMK+A+N I AG SAG L  ++HCDRF    P G +VKC
Sbjct  140   TKVFYRGARIFSAVMEDFLAKGMKNAQNAILAGCSAGSLAAILHCDRFKGLLPPGAKVKC  199

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             LSD+  F+  +      + +  +S++V  H   K+LP  CTS++ P  CF P+N+ Q+++
Sbjct  200   LSDAGFFINTQTISGTSHIEQFYSEVVNTHGSVKNLPQSCTSRLKPGLCFFPQNVAQHIQ  259

Query  955   SPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQIISALP  1113
             +PLF+ ++AYDS+Q+++  + ++      +R  K +  + S T +  +Q F+ + + AL 
Sbjct  260   TPLFLVNAAYDSWQIKHILAPEVADPHGTWRNCKLDILNCSSTQLQTMQAFRSEFLKALN  319

Query  1114  K--PSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
                PS+T+G+ + S + H   +   +  +  DS      TI     +W++++     ID
Sbjct  320   SLGPSSTRGYYINSCYAHC-QTGTQETWLMDDSLVLSGTTIAKAVGDWYYERKRFQEID  377



>ref|XP_002519912.1| pectin acetylesterase, putative [Ricinus communis]
 gb|EEF42516.1| pectin acetylesterase, putative [Ricinus communis]
Length=452

 Score =   253 bits (647),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 146/366 (40%), Positives = 210/366 (57%), Gaps = 32/366 (9%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             IP TI+  A  +GAVCLDGSPPAYH+  G    A+NW++++ GGGWC            +
Sbjct  85    IPITIVETAKARGAVCLDGSPPAYHYDKGYGTGANNWIVHMEGGGWCDD----------L  134

Query  412   ESCSSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKP  585
             ESCS R     GS+  M   + F GI G   +    FY WNR+ I+YCDG SF GDVE  
Sbjct  135   ESCSQRKDTYKGSSLKMEKTMGFSGILGGKQSANPDFYNWNRIKIKYCDGSSFTGDVEVV  194

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             D  T L++RG RI+Q V+D+L+AKGM++A+N I +G SAGGL  ++HCD+F S  P   R
Sbjct  195   DAKTNLHFRGERIWQAVIDDLLAKGMRNAQNAILSGCSAGGLAAILHCDKFRSLLPASAR  254

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+  KD    ++ +  F  +V LH   KSLP  CT+KM P  CF P+ + Q
Sbjct  255   VKCVSDAGFFIHGKDVAGGRHIENFFGSVVRLHGSAKSLPASCTAKMRPELCFFPQYVAQ  314

Query  946   YVKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQIIS  1104
              +++PLF+ +SAYDS+Q++N  +         +++ K +    S   +  +QDF+ Q I 
Sbjct  315   TMRTPLFLINSAYDSWQIKNVLAPSAVDKKGSWKSCKLDLKKCSAAQLQTVQDFRTQFIG  374

Query  1105  ALPKPSATK---GFIVTSNFGH----SFAS--ADYKKRMFADSKSKTIEDGFYNWFFDKH  1257
             AL      K   G+ + S + H    S A+  AD K  + +++K   I     +WF+D+ 
Sbjct  375   ALSGGVTNKPANGYFINSCYAHCQSGSLATWLAD-KSPVVSNTK---IGKAVGDWFYDRA  430

Query  1258  PINLID  1275
                 ID
Sbjct  431   TFQKID  436



>gb|EYU37455.1| hypothetical protein MIMGU_mgv1a007934mg [Erythranthe guttata]
Length=390

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 146/365 (40%), Positives = 207/365 (57%), Gaps = 29/365 (8%)
 Frame = +1

Query  208   IIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDT  387
             +++   L +  T +  A  KGAVCLDGSPPAYH   G     +NWL+ + GGGWC +   
Sbjct  13    LLRTEGLYVNITYVQTAVAKGAVCLDGSPPAYHLDRGFGAGVNNWLVQIEGGGWCNN---  69

Query  388   YSTHDLSVESCSSRMKRELGSTFNM-APFVFKGIFGINATFT-KFYKWNRVIIRYCDGGS  561
                    V +C +R    LGS+  M     F  I      F   FY WNRV IRYCDG S
Sbjct  70    -------VTTCLARKTNRLGSSKQMIKQLAFSAILSDKPQFNPDFYNWNRVKIRYCDGSS  122

Query  562   FAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFT  741
             F GDVE  DPVTKLYYRGAR+F  V++EL+AKGMK+A+N + +G SAGGL  ++HCD F 
Sbjct  123   FTGDVEAVDPVTKLYYRGARVFVAVMEELLAKGMKNAQNAVLSGCSAGGLASILHCDSFK  182

Query  742   SRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFEC  921
             +  P   +VKC SD+  F+  KD   A + +A F+D+V  H   K+LP+ CTSKM P  C
Sbjct  183   ALLPVRTKVKCFSDAGYFINTKDISAADHIEAYFNDVVTTHGSAKNLPISCTSKMKPSLC  242

Query  922   FQPKNLVQYVKSPLFIFHSAYDSFQVQNTFS------MDLYRAIKNRSSISPTD-MALLQ  1080
             F P+ + + +++PLF+ ++AYDS+Q++N  +        ++   K   +   TD +  +Q
Sbjct  243   FFPQYVSKEIRTPLFVINAAYDSWQIKNILAPGVADPHGIWHDCKTDITKCSTDQLRTMQ  302

Query  1081  DFK----KQIISALPKPSATKGFIVTSNFGHSFASADYKKRMFA-DS---KSKTIEDGFY  1236
              F+    K I S L     T+G+ + S + H     + ++  FA DS    +KTI     
Sbjct  303   GFRLEFLKAISSGLGPLINTRGYFINSCYAH--CQTEMQENWFAIDSPKLNNKTIAKAVG  360

Query  1237  NWFFD  1251
             +WF+D
Sbjct  361   DWFYD  365



>ref|XP_006432880.1| hypothetical protein CICLE_v10001467mg [Citrus clementina]
 ref|XP_006471635.1| PREDICTED: protein notum homolog isoform X1 [Citrus sinensis]
 ref|XP_006471636.1| PREDICTED: protein notum homolog isoform X2 [Citrus sinensis]
 gb|ESR46120.1| hypothetical protein CICLE_v10001467mg [Citrus clementina]
 gb|KDO40407.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
 gb|KDO40408.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
Length=386

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 145/360 (40%), Positives = 204/360 (57%), Gaps = 27/360 (8%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYHF  G     +NWL+++ GG WC +          VE C
Sbjct  26    TYVENAVAKGAVCLDGSPPAYHFDKGFGAGINNWLVHIDGGAWCNN----------VEDC  75

Query  421   SSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
             S R     GS+ +M     F GI      F   FY WNRV +RYCDG SF GDVE  +P 
Sbjct  76    SKRRDSSYGSSKHMVKEANFTGILSNEQKFNPDFYDWNRVRVRYCDGASFTGDVEAVNPE  135

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L++RGAR+F+ V+++L+AKGMK+A+N I  G SAGGL  ++HCD F + FP   RVKC
Sbjct  136   TNLHFRGARVFEAVMEDLLAKGMKNAQNAILTGCSAGGLTSILHCDNFRALFPVDTRVKC  195

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
              +D+  F+  KD     + +  +  +VALH   K LP  CTS++SP  CF P+N+   +K
Sbjct  196   FADAGYFVNAKDVSGESHIEEFYKQVVALHGSAKHLPASCTSRLSPGLCFFPENVAGQIK  255

Query  955   SPLFIFHSAYDSFQVQNTFSMD------LYRAIK-NRSSISPTDMALLQDFKKQIISALP  1113
             +PLFI +SAYDS+Q+ N    +       + + K +  + S T +  +Q F+ Q ++AL 
Sbjct  256   TPLFIINSAYDSWQISNILVPEDADPKGAWSSCKVDIKTCSSTQLQTMQGFRVQFLNALA  315

Query  1114  --KPSATKGFIVTSNFGHSFASADYKKRMF-ADS---KSKTIEDGFYNWFFDKHPINLID  1275
                 S+++G  V S + H     DY++  F ADS       I     +W++D+ P   ID
Sbjct  316   GLGNSSSRGMFVDSCYTH--CRTDYQETWFSADSPVLDKTPIAKAVGDWYYDRSPFQKID  373



>ref|XP_007040900.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOY25401.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=399

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 140/363 (39%), Positives = 210/363 (58%), Gaps = 33/363 (9%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYHF PG     +NWL+++ GGGWC            VE C
Sbjct  31    TYLQSAVAKGAVCLDGSPPAYHFDPGSGAGVNNWLVHMEGGGWCED----------VERC  80

Query  421   SSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              SR   +LGS+  M   F F G+          FY WNR+ +RYCDG SF GDVE P  V
Sbjct  81    LSRRNTDLGSSEQMVKQFGFSGLLSSQQKSNPDFYNWNRIKVRYCDGSSFTGDVEAP--V  138

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
               L++RG RI++ ++++L+AKGM++AKN I +G SAGGL  ++HCDRF +  P   +VKC
Sbjct  139   NNLFFRGNRIWEAIIEDLLAKGMRNAKNAILSGCSAGGLASILHCDRFRALLPAATKVKC  198

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMS--PFECFQPKNLVQY  948
             +SD+  F+  KD    ++ +  +S +  LH   KSLP  CTS+MS  P  CF P+ +VQ 
Sbjct  199   ISDAGFFIHAKDVSGGQHIENFYSQVAKLHGSVKSLPASCTSRMSMKPELCFFPQYVVQT  258

Query  949   VKSPLFIFHSAYDSFQVQNTF---SMDLYRAIK----NRSSISPTDMALLQDFKKQIISA  1107
             +++P+F  ++AYDS+Q++N     + D  +A K    +    +P  + ++QDF+ Q +SA
Sbjct  259   MQTPIFFINAAYDSWQIKNILAPTAADSGKAWKSCKLDLKKCTPGQLKIIQDFRAQFLSA  318

Query  1108  LPKP--SATKGFIVTSNFGHSFASADYKKRMFADSKS-----KTIEDGFYNWFFDKHPIN  1266
             L     S+++G  + S + H  A    K+  ++ + S       I     +W++++ P+ 
Sbjct  319   LTGAGNSSSRGMFIDSCYAHCQAG---KQITWSSNNSPAVGNTKIAKAVGDWYYERSPVQ  375

Query  1267  LID  1275
              ID
Sbjct  376   KID  378



>ref|XP_006385134.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62931.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=430

 Score =   252 bits (643),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 145/364 (40%), Positives = 214/364 (59%), Gaps = 25/364 (7%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             L +  T +  A  KGAVCLDGSPPAYH+  G     ++WLI+  GGGWC +         
Sbjct  28    LYVGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNN---------  78

Query  406   SVESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V SC SR K  LGS+  M     F GI      F   FY WNRV IRYCDG SF GDV+
Sbjct  79    -VTSCLSRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQ  137

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               +P T L++RGARI+  V+++L+ KG+K+A+N + +G SAGGL  ++HCD F +    G
Sbjct  138   AVNPATNLHFRGARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALLRMG  197

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKCLSD+  F+ VKD   A + +  F++IV LH   K+LP+ CTS + P  CF P+ +
Sbjct  198   TKVKCLSDAGYFIKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSVLKPSFCFFPQYV  257

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQI  1098
                V++PLFI ++AYDS+Q++N  +      + ++++ K + ++ SP  +  +QDF+ Q 
Sbjct  258   APQVRTPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQF  317

Query  1099  ISALPKP--SATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPI  1263
             ++AL K   S+++G  + S + H   +   +K    DS     K I     +WF+D++P 
Sbjct  318   LNALNKSTNSSSRGLYIDSCYAHC-QTETQEKWFMEDSPVLGKKKIAKAVGDWFYDRNPF  376

Query  1264  NLID  1275
               ID
Sbjct  377   QKID  380



>ref|XP_009350399.1| PREDICTED: protein notum homolog [Pyrus x bretschneideri]
Length=398

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 139/359 (39%), Positives = 208/359 (58%), Gaps = 25/359 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T++  A  KGAVCLDGS PAYHF  G     +NWL+++ GGGWC S          V +C
Sbjct  30    TLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHIEGGGWCNS----------VATC  79

Query  421   SSRMKRELGSTFNMAPFV-FKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
               R     GS+  M   + F G+ G    T   FY WNR+ +RYCDG SF GDVE  DP 
Sbjct  80    LDRKNNYRGSSTKMEKTMSFSGVLGNKQQTNPDFYNWNRIKVRYCDGSSFTGDVEAVDPA  139

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L++RGAR+F+ ++D+L+AKGMK+A+  + +G SAGGL  ++HCD F S  P G +VKC
Sbjct  140   TNLHFRGARVFRAIIDDLLAKGMKNAQTALLSGCSAGGLASILHCDNFHSLLPVGTKVKC  199

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             L+D+  F+  K    ++Y +  +S++VALH   K+LP  CTS+MSP  CF P+N+V   +
Sbjct  200   LADAGYFINAKTLSGSQYIQTFYSEVVALHGSAKNLPASCTSRMSPGLCFFPQNVVPQTR  259

Query  955   SPLFIFHSAYDSFQVQNTFS---MDLYRAIKNR----SSISPTDMALLQDFKKQIISALP  1113
             +P+F  ++AYDS+Q++N  +    D   A KN      + SP+ +  +Q+++ Q ++A+ 
Sbjct  260   TPIFFVNAAYDSWQIKNILAPGVADPKGAWKNCKLSIKNCSPSQLQTMQEYRLQFLNAIA  319

Query  1114  KP--SATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
                 S++ G  + S + H       +  +  DS      TI     +W++D+ P   ID
Sbjct  320   GASSSSSNGLFIDSCYAHCQIGTQ-ETWLATDSPMLSKTTIAKAVGDWYYDRTPFKNID  377



>ref|XP_010536189.1| PREDICTED: uncharacterized protein LOC104811235 isoform X1 [Tarenaya 
hassleriana]
Length=391

 Score =   250 bits (639),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 139/366 (38%), Positives = 209/366 (57%), Gaps = 23/366 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  +GAVCLDGSPPAYHF  G     +NW++++ GGGWC  ND        +
Sbjct  24    VPITYLNSAVARGAVCLDGSPPAYHFDKGFGSGVNNWIVHMEGGGWC--ND--------I  73

Query  412   ESCSSRMKRELGSTFNM-APFVFKGIFGIN-ATFTKFYKWNRVIIRYCDGGSFAGDVEKP  585
              SCS R     GS+  M   F F GI G   +T   FY WNR+ +RYCDG SF GDVE  
Sbjct  74    ASCSERKNTMKGSSKLMNKDFGFSGILGSQQSTNPDFYNWNRIKVRYCDGSSFTGDVEAV  133

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +P  KL++RGAR+++ V+D+LMAKGM  A+N I +G SAG L  ++HCD+F +  P+  +
Sbjct  134   NPSNKLFFRGARVWRAVIDDLMAKGMNKAQNAILSGCSAGALAAILHCDQFHAILPRTAK  193

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+  KD     Y ++ +S +VALH   K+LPV CTS+M P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDITGGSYIESYYSKVVALHGSAKTLPVSCTSRMKPELCFFPQYVVP  253

Query  946   YVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIK----NRSSISPTDMALLQDFKKQIIS  1104
              +++PLF+ ++A+DS+Q++N     ++D  +  K    +    +P  +  +Q F+ QI+ 
Sbjct  254   SMRTPLFVVNAAFDSWQIKNVLAPSAVDKRKEWKDCKLDLKKCTPAQLRTVQGFRDQILR  313

Query  1105  ALP--KPSATKGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLI  1272
             AL     + ++G  + S   H    ++A +         +  I     +WF+D+ P    
Sbjct  314   ALAPVHSTTSRGLFLDSCHAHCQGGSAASWSGSKGPSVGNTKIAKAVGDWFYDRSPFQKT  373

Query  1273  DPNNVP  1290
             D    P
Sbjct  374   DCPTYP  379



>ref|XP_009132797.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=397

 Score =   251 bits (640),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 147/398 (37%), Positives = 217/398 (55%), Gaps = 45/398 (11%)
 Frame = +1

Query  133   DWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFS  312
              W+ L++ SL I              ++   L +  T +  A  +GAVCLDGSPPAYH  
Sbjct  6     QWLVLVVCSLAI--------------LKAEGLFVNITFVRNAVARGAVCLDGSPPAYHLH  51

Query  313   PGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAP-FVFKGIF  489
              G     ++WLI L GGGWC +          V +C SRM   LGS+  M     F  I 
Sbjct  52    RGSGTGINSWLIQLEGGGWCNN----------VTNCLSRMHTRLGSSKKMVENLAFSAIL  101

Query  490   GINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMK  666
                  +   FY WNRV +RYCDG SF GDV+  +P T L++RGAR++  V+ EL+AKGM+
Sbjct  102   SNKKQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHFRGARVWLAVMQELLAKGMR  161

Query  667   DAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFS  846
             +A+N + +G SAGGL  L+HCD F +  P G +VKCLSD+  FL  +D   A+Y K+ F 
Sbjct  162   NAENAVLSGCSAGGLASLMHCDSFRALLPMGTKVKCLSDAGFFLNTRDVSGAQYIKSYFK  221

Query  847   DIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF---SM  1017
             D+VALH   K+LP  CTS+++P  CF P+ + + +++P+FI ++AYDS+Q++N     + 
Sbjct  222   DVVALHGSAKNLPRTCTSRLTPAMCFFPQYVARQIRTPVFILNAAYDSWQIKNILAPRAA  281

Query  1018  DLYRA-------IKNRSSISPTDMALLQDFKKQIISAL--PKPSATKGFIVTSNFGHSFA  1170
             D Y         IKN     P  + ++QDF+ + +SA+     S+++G  + S + H   
Sbjct  282   DPYGKWQSCQLDIKN---CQPNQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHC-Q  337

Query  1171  SADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
             +       + DS      TI     +W +D+     ID
Sbjct  338   TETQTSWFWQDSPILNRTTIAKAVGDWVYDRKLFQKID  375



>ref|XP_004244443.1| PREDICTED: uncharacterized protein LOC101251798 [Solanum lycopersicum]
Length=392

 Score =   250 bits (639),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 141/359 (39%), Positives = 199/359 (55%), Gaps = 25/359 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYHF  G     +NW I L GG WC +  T          C
Sbjct  30    TYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWFIQLEGGAWCNNATT----------C  79

Query  421   SSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
               R K  LGS+  M   V F GI    A F   FY WNR+ IRYCDG SF GDV   DP 
Sbjct  80    LERTKTRLGSSKLMVKTVSFSGILSNKAKFNPDFYNWNRIRIRYCDGSSFTGDVAAADPR  139

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             TK++YRGARIF  V+D+ +AKGMK+A+N I AG SAG L  ++HCDRF    P G +VKC
Sbjct  140   TKVFYRGARIFSAVMDDFLAKGMKNAQNAILAGCSAGSLAAILHCDRFKGLLPSGAKVKC  199

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             LSD+  F+  +      + +  +S++V  H   K+LP  CTS++ P  CF P+N+ Q ++
Sbjct  200   LSDAGFFINTQTISGTSHIEKFYSEVVNTHGSAKNLPQSCTSRLKPGLCFFPQNVAQQIQ  259

Query  955   SPLFIFHSAYDSFQVQNTFS---MDLYRAIKNRS----SISPTDMALLQDFKKQIISALP  1113
             +PLF+ ++AYDS+Q++N  +    D +   +N        S   +  +Q F+ + + AL 
Sbjct  260   TPLFLVNAAYDSWQIKNILAPGVADPHGTWRNCKLDILKCSSAQLQTMQAFRSEFLKALN  319

Query  1114  K--PSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
                PS+T+G+ + S + H   +   +  +  DS      TI     +W++++     ID
Sbjct  320   SLGPSSTRGYYINSCYAHC-QTGTQETWLRDDSPVLSGTTIAKAVGDWYYERKRFQEID  377



>emb|CDX99377.1| BnaC01g11750D [Brassica napus]
Length=452

 Score =   252 bits (644),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 147/398 (37%), Positives = 217/398 (55%), Gaps = 45/398 (11%)
 Frame = +1

Query  133   DWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFS  312
              W+ L++ SL I              ++   L +  T +  A  +GAVCLDGSPPAYH  
Sbjct  61    QWVILVVCSLAI--------------LKAEGLFVNITFVRNAVARGAVCLDGSPPAYHLH  106

Query  313   PGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAP-FVFKGIF  489
              G     ++WLI L GGGWC +          V +C SRM   LGS+  M     F  I 
Sbjct  107   RGSGTGINSWLIQLEGGGWCNN----------VTNCLSRMHTRLGSSKKMVENLAFSAIL  156

Query  490   GINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMK  666
                  +   FY WNRV +RYCDG SF GDV+  +P T L++RGAR++  V+ EL+AKGM+
Sbjct  157   SNKKQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHFRGARVWLAVMQELLAKGMR  216

Query  667   DAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFS  846
             +A+N + +G SAGGL  L+HCD F +  P G +VKCLSD+  FL  +D   A+Y K+ F 
Sbjct  217   NAENAVLSGCSAGGLASLMHCDSFRALLPMGTKVKCLSDAGFFLNTRDVSGAQYIKSYFK  276

Query  847   DIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF---SM  1017
             D+VALH   K+LP  CTS+++P  CF P+ + + +++P+FI ++AYDS+Q++N     + 
Sbjct  277   DVVALHGSAKNLPRTCTSRLTPAMCFFPQYVARQIRTPVFILNAAYDSWQIKNILAPRAA  336

Query  1018  DLYRA-------IKNRSSISPTDMALLQDFKKQIISAL--PKPSATKGFIVTSNFGHSFA  1170
             D Y         IKN     P  + ++QDF+ + +SA+     S+++G  + S + H   
Sbjct  337   DPYGKWQSCQLDIKN---CQPNQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHC-Q  392

Query  1171  SADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
             +       + DS      TI     +W +D+     ID
Sbjct  393   TETQTSWFWQDSPILNRTTIAKAVGDWVYDRKLFQKID  430



>ref|XP_006494119.1| PREDICTED: protein notum homolog isoform X1 [Citrus sinensis]
 ref|XP_006494120.1| PREDICTED: protein notum homolog isoform X2 [Citrus sinensis]
Length=392

 Score =   250 bits (639),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 145/360 (40%), Positives = 206/360 (57%), Gaps = 27/360 (8%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYHF  G     +NWL+++ GG WC +          V  C
Sbjct  32    TYVEDAVAKGAVCLDGSPPAYHFDKGFGAGINNWLVHIDGGAWCNN----------VADC  81

Query  421   SSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
             S+R     GS+  M     F GI      F   FY WNRV +RYCDG SF GDVE  +P 
Sbjct  82    SNRRDSSYGSSKYMVKEANFTGILSNEQNFNPDFYDWNRVKVRYCDGASFTGDVEAVNPE  141

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L++RGAR+F+ V+++L+AKGMK+A+N I  G SAGGL  ++HCD F + FP   RVKC
Sbjct  142   TNLHFRGARVFEAVMEDLLAKGMKNAQNAILTGCSAGGLTSILHCDNFRALFPVDTRVKC  201

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
              +D+  F+ VKD   A +    +  +VALH   K LP  CTS++SP  CF P+N+   VK
Sbjct  202   FADAGYFVNVKDVSGASHIVEFYKQVVALHGSAKHLPASCTSRLSPGLCFFPQNVAGQVK  261

Query  955   SPLFIFHSAYDSFQVQNTFSMD------LYRAIK-NRSSISPTDMALLQDFKKQIISALP  1113
             +PLFI +SAYDS+Q+ N    D       + + K +  + S T +  +Q F+ Q ++AL 
Sbjct  262   TPLFIINSAYDSWQITNILVPDDADPKGTWSSCKVDIKTCSSTQLQTMQGFRVQFLNALA  321

Query  1114  K--PSATKGFIVTSNFGHSFASADYKKR-MFADS---KSKTIEDGFYNWFFDKHPINLID  1275
             +   S+++G ++ S + H     +Y++  + ADS       I     +W++D+ P   ID
Sbjct  322   ELGNSSSRGMLIDSCYTH--CRTEYQEAWLSADSPVLDKTPIAKAVGDWYYDRSPFQKID  379



>gb|KCW72726.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=373

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 146/388 (38%), Positives = 217/388 (56%), Gaps = 36/388 (9%)
 Frame = +1

Query  124   RSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAY  303
             R   W+C+     ++S+Q          +I+     +  T +  A  KGAVCLDGSPPAY
Sbjct  5     RLRTWLCV-----ILSIQI---------LIKSEAFNVGITYVQNAVAKGAVCLDGSPPAY  50

Query  304   HFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMA-PFVFK  480
             HF  G    A+NWLI   GG WC +          V +C +R    LGS+  M     F 
Sbjct  51    HFDKGVGAGANNWLILFEGGAWCNN----------VTTCLARRDTRLGSSKQMVKELSFS  100

Query  481   GIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAK  657
             GI      F   FY WN++ +RYCDG SF GDVE  +P T L++RGAR F  +V++LM+K
Sbjct  101   GILSNKQKFNPDFYNWNKIKVRYCDGASFTGDVEAVNPATNLHFRGARAFVAIVEDLMSK  160

Query  658   GMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKA  837
             GM +A+N I AG SAGGL  +++CDRF +  P   +VKCL+D+  F+  KD   A + + 
Sbjct  161   GMSNAQNAILAGCSAGGLTAILNCDRFRALVPARTKVKCLADAGYFINAKDVSGASHIEN  220

Query  838   VFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFSM  1017
              +S++VA H   K+LP  CTSKM P  CF P+N+V  +++PLFI ++AYDS+Q++N  + 
Sbjct  221   FYSEVVATHGSAKNLPTSCTSKMKPGLCFFPQNVVPQIQTPLFIINAAYDSWQIKNILAP  280

Query  1018  DL------YRAIK-NRSSISPTDMALLQDFKKQIISALPK--PSATKGFIVTSNFGHSFA  1170
              +      +R+ K +    SP  + ++QDF+ + + AL     S ++G  + S + H  A
Sbjct  281   GVADRHGTWRSCKLDIKKCSPNQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCYAHCQA  340

Query  1171  -SADYKKRMFADSKSKTIEDGFYNWFFD  1251
              + +   R  +   +KT+   F+N F D
Sbjct  341   GTQETWLRNDSPVVAKTVMTTFFNIFHD  368



>emb|CDX78933.1| BnaA01g10000D [Brassica napus]
Length=452

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 147/398 (37%), Positives = 217/398 (55%), Gaps = 45/398 (11%)
 Frame = +1

Query  133   DWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFS  312
              W+ L++ SL I              ++   L +  T +  A  +GAVCLDGSPPAYH  
Sbjct  61    QWLVLVVCSLAI--------------LKAEGLFVNITFVRNAVARGAVCLDGSPPAYHLH  106

Query  313   PGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAP-FVFKGIF  489
              G     ++WLI L GGGWC +          V +C SRM   LGS+  M     F  I 
Sbjct  107   RGSGTGINSWLIQLEGGGWCNN----------VTNCLSRMHTRLGSSKKMVENLAFSAIL  156

Query  490   GINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMK  666
                  +   FY WNRV +RYCDG SF GDV+  +P T L++RGAR++  V+ EL+AKGM+
Sbjct  157   SNKKQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHFRGARVWLAVMQELLAKGMR  216

Query  667   DAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFS  846
             +A+N + +G SAGGL  L+HCD F +  P G +VKCLSD+  FL  +D   A+Y K+ F 
Sbjct  217   NAENAVLSGCSAGGLASLMHCDSFRALLPMGTKVKCLSDAGFFLNTRDVSGAQYIKSYFK  276

Query  847   DIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF---SM  1017
             D+VALH   K+LP  CTS+++P  CF P+ + + +++P+FI ++AYDS+Q++N     + 
Sbjct  277   DVVALHGSAKNLPRTCTSRLTPAMCFFPQYVARQIRTPVFILNAAYDSWQIKNILAPRAA  336

Query  1018  DLYRA-------IKNRSSISPTDMALLQDFKKQIISAL--PKPSATKGFIVTSNFGHSFA  1170
             D Y         IKN     P  + ++QDF+ + +SA+     S+++G  + S + H   
Sbjct  337   DPYGKWQSCQLDIKN---CQPNQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHC-Q  392

Query  1171  SADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
             +       + DS      TI     +W +D+     ID
Sbjct  393   TETQTSWFWQDSPILNRTTIAKAVGDWVYDRKLFQKID  430



>ref|XP_010248193.1| PREDICTED: uncharacterized protein LOC104591101 [Nelumbo nucifera]
Length=394

 Score =   250 bits (639),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 151/396 (38%), Positives = 213/396 (54%), Gaps = 39/396 (10%)
 Frame = +1

Query  145   LLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKD  324
             LLI++LVI    V +N             +  T +  A  KGAVCLDGSPPAYH +PG  
Sbjct  12    LLIWTLVI----VGAN----------GYFVGITYVDNAVAKGAVCLDGSPPAYHMAPGFG  57

Query  325   EDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMA-PFVFKGIFGINA  501
                +NWLI L GG WC +  T          C +R    LGS+  M     F G      
Sbjct  58    SGVNNWLILLEGGAWCNNATT----------CLARKNTRLGSSKEMVKQLSFSGFLSDKE  107

Query  502   TFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKN  678
              F   F+ WN+V +RYCDG SF GDVE  DP T LYYRG RIF  VVD+L+ KGMK+A+N
Sbjct  108   KFNPDFFNWNKVKVRYCDGSSFTGDVEAVDPATNLYYRGQRIFNAVVDDLLEKGMKNAQN  167

Query  679   VIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVA  858
              + +G SAGGL V++HCD+F    P+  +VKC++D+  F+  K     +Y K  FSD+V 
Sbjct  168   ALLSGCSAGGLSVILHCDKFRELLPQSTKVKCMADAGFFINAKTIAGTEYIKEFFSDVVT  227

Query  859   LHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFSMDL-----  1023
              HQ  K+LP  CTSK     CF P+N+   V +PLFI ++AYDS+QV+N  +  +     
Sbjct  228   THQSAKNLPASCTSKGDXTLCFFPQNVAPQVTTPLFILNAAYDSYQVKNILAPGIADPHG  287

Query  1024  --YRAIKNRSSISPTDMALLQDFKKQIISALP--KPSATKGFIVTSNFGHSFASADYKKR  1191
               +    + +  S T +  +Q F+K+ ++A+   + S TKG  + S + H   S   +  
Sbjct  288   TWHDCKLDITKCSDTQLQAIQGFRKEFLNAIKGVEGSPTKGLFINSCYSHC-QSGMQETW  346

Query  1192  MFADS---KSKTIEDGFYNWFFDKHPINLIDPNNVP  1290
             +  DS    + +I     +W+FD+  +  I+    P
Sbjct  347   LREDSPVLDNMSISKAVGDWYFDRGTVQKIEQCEYP  382



>ref|XP_004509522.1| PREDICTED: uncharacterized protein LOC101493258 isoform X1 [Cicer 
arietinum]
 ref|XP_004509523.1| PREDICTED: uncharacterized protein LOC101493258 isoform X2 [Cicer 
arietinum]
Length=400

 Score =   250 bits (639),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 139/364 (38%), Positives = 206/364 (57%), Gaps = 25/364 (7%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             + +P T +  A  KGAVCLDGSPPAYHF  G      NW+++  GGGWC +         
Sbjct  26    VAVPITYVQSAVAKGAVCLDGSPPAYHFDKGVGAGIDNWIVHFEGGGWCNN---------  76

Query  406   SVESCSSRMKRELGSTFNM-APFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V +C  R    LGS+  M     F G F     F   FY WNR+ +RYCDG SF GDVE
Sbjct  77    -VSTCLDRRDTRLGSSKKMDKQLSFSGFFSNGKKFNPDFYDWNRIKVRYCDGASFTGDVE  135

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               DP T L++RGARIF  V+++L+AKGMK+AKN I +G SAGGL  ++ CDRF +  P  
Sbjct  136   AVDPATNLHFRGARIFVAVIEDLLAKGMKNAKNAILSGCSAGGLTSILQCDRFKTLLPAA  195

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKC+SD+  F+ VK    A++ +  +S +V  H   K+LP  CTS++SP  CF P+N+
Sbjct  196   AKVKCVSDAGYFINVKAVSGAQHIEQFYSQVVQTHGSAKNLPQSCTSRLSPGLCFFPQNV  255

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQI  1098
                +K+P+F  ++AYDS+Q++N  +  +      +R  K + ++ SP  +  +Q F+ Q 
Sbjct  256   AAQIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDINNCSPNQLTTMQGFRTQF  315

Query  1099  ISALP--KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPI  1263
             + A+     S +KG  +   + H   +   +  M +DS    + TI     +W++D+   
Sbjct  316   LQAISGLSNSPSKGLFIDGCYAHC-QTGMQETWMRSDSPVLANTTIAKAVGDWYYDRKTF  374

Query  1264  NLID  1275
             + ID
Sbjct  375   HQID  378



>gb|EYU37453.1| hypothetical protein MIMGU_mgv1a007583mg [Erythranthe guttata]
Length=403

 Score =   250 bits (638),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 149/396 (38%), Positives = 216/396 (55%), Gaps = 32/396 (8%)
 Frame = +1

Query  127   SNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYH  306
             ++ W+ LLI  + +S   VN              ++  T++  A EKGAVCLDGSP  YH
Sbjct  10    ADHWLKLLICVIALSSTKVNVRA---------SEMVNITLLSNAVEKGAVCLDGSPAGYH  60

Query  307   FSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRE--LGSTFNMAPFVFK  480
             ++ G  + A++W+IYL GGGWC             +SC  R+K    L ST N+    F 
Sbjct  61    YAKGYGDGANSWMIYLPGGGWCGRK----------QSCIDRVKYSPMLSSTKNITQENFG  110

Query  481   GIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAK  657
              I   N T    FY WNRV IRYCDG SF GDV+K DP T L+ RG+RIF  V+DEL++K
Sbjct  111   AILSPNKTSNPDFYNWNRVFIRYCDGSSFMGDVKKVDPETNLHKRGSRIFTSVIDELLSK  170

Query  658   GMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKA  837
             G+KDAKNV+  G SAGGL  +++CDRF +  P    VKC+SDS  F+  K+   A   + 
Sbjct  171   GLKDAKNVMLTGNSAGGLATILNCDRFRALVPNANMVKCVSDSGFFIHAKNLPNAAGRER  230

Query  838   VFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF--  1011
              FS +V  H  +K LP  CTS+M P  CF P+NLV ++K+PLF+ +S +D FQ+Q     
Sbjct  231   TFSRVVHFHGISKFLPKSCTSRMKPGLCFFPENLVAHIKTPLFLLNSDFDKFQIQVNLKP  290

Query  1012  ----SMDLYRAIKNRSSISPTDMALLQDFKKQIISALP--KPSATKGFIVTSNFGHSF--  1167
                 +       +N ++ +P  + +++DF+   +  L     + ++G  + S + H F  
Sbjct  291   HPVDNPGWVNCTRNITTCTPPQLQIIKDFRNTFLETLKGVGNNPSRGLFINSCYIHDFLY  350

Query  1168  ASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLID  1275
                 Y         +KTI     +W+F++  + LID
Sbjct  351   LMGRYNSPDSPKLHNKTIAQAIGDWYFNRSSVRLID  386



>gb|KDP28067.1| hypothetical protein JCGZ_19475 [Jatropha curcas]
Length=394

 Score =   249 bits (637),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 150/401 (37%), Positives = 212/401 (53%), Gaps = 44/401 (11%)
 Frame = +1

Query  124   RSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAY  303
             R + W  LL F L++      S              IP  +I  A  KGAVCLDGS PAY
Sbjct  5     RLSQWCYLLAFMLILFKTEGGS--------------IPIVLIENAKAKGAVCLDGSAPAY  50

Query  304   HFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPFV-FK  480
             HF  G+    +NW++++ GGGWC            +ESC +R     GS+  M   + F 
Sbjct  51    HFQKGEGTGINNWIVHMEGGGWCDD----------IESCLARRNTYKGSSSKMNKTMGFS  100

Query  481   GIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAK  657
             GI G        FY WNR+ IRYCDG SF GDVE+ DP T LY+RG R++Q V+DEL+AK
Sbjct  101   GILGSKQVSNPDFYNWNRIKIRYCDGSSFTGDVEEVDPKTNLYFRGERVWQAVIDELLAK  160

Query  658   GMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKA  837
             GM +A+N I +G SAGGL  ++HCD+F S  P    VKC+SD+  F+  KD       + 
Sbjct  161   GMNNAQNAILSGCSAGGLAAILHCDKFKSFLPATATVKCVSDAGYFIHGKDIAGGYEIEN  220

Query  838   VFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFS-  1014
              F  IV  H   K+LP  CTSKM P  CF P+N+ Q +++PLF+ +SAYD +Q++N  + 
Sbjct  221   FFGRIVTTHGSAKNLPASCTSKMKPELCFFPENVAQTMQTPLFVINSAYDFWQLKNVLAP  280

Query  1015  -----MDLYRAIK-NRSSISPTDMALLQDFKKQIISALPKPSATK---GFIVTSNFGHSF  1167
                     +++ K + +   P  +  +QDF+ Q I+AL      K   G+ + S + H  
Sbjct  281   SAADRKGTFKSCKLDLTKCKPAQLETVQDFRTQFINALNIGLGNKTVNGYFIDSCYAHCQ  340

Query  1168  ASADY-----KKRMFADSKSKTIEDGFYNWFFDKHPINLID  1275
               +       K  +  D++   I     +W+FD+ P   ID
Sbjct  341   TGSPLVWLAEKSPVLNDTR---IAKAVGDWYFDRAPFQKID  378



>ref|XP_010434425.1| PREDICTED: uncharacterized protein LOC104718381 isoform X2 [Camelina 
sativa]
Length=379

 Score =   249 bits (636),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 140/361 (39%), Positives = 204/361 (57%), Gaps = 23/361 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT           V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  412   ESCSSRMKRELGST-FNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKP  585
              SC  R     GS+ F    F F GI G   +T   FY WNR+ +RYCDG SF G+V   
Sbjct  74    ASCIERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAV  133

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +P  KL++RGAR+++ VVD+LMAKGMK+A+N I +G SAG L  ++HCD F +  P+  R
Sbjct  134   NPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAR  193

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+  KD     Y ++ +S +VALH   KSLP+ CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKMKPELCFFPQYVVP  253

Query  946   YVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIKN----RSSISPTDMALLQDFKKQIIS  1104
             ++++PLF+ ++A+DS+Q++N     ++D  +  KN        S   +  +Q F+ Q++ 
Sbjct  254   FMRTPLFVINAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCSAAQLKTVQGFRDQMMR  313

Query  1105  ALPKPSAT--KGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLI  1272
             AL    +T  +G  + S   H    ++A +         +  I     NWF+ +     I
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQVANTRIAKAVGNWFYGRSAFQKI  373

Query  1273  D  1275
             D
Sbjct  374   D  374



>gb|EEC77932.1| hypothetical protein OsI_17271 [Oryza sativa Indica Group]
Length=530

 Score =   253 bits (647),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 151/419 (36%), Positives = 222/419 (53%), Gaps = 34/419 (8%)
 Frame = +1

Query  58    GGLDLLTLEANNPESLRMAVSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIP  237
             GG+    + A  P +  MA S  S +W+      LV+ +   +S         D+D++  
Sbjct  118   GGVSAQLIAAATPTAGGMAAS--SGEWLSRAAMVLVLGLVVASSAKA-----GDVDMVFL  170

Query  238   KTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVES  417
             K+ +      GAVCLDGSPP YHFSPG    A+NWL+++ GGGWC +           + 
Sbjct  171   KSAV----STGAVCLDGSPPVYHFSPGSGSGANNWLVHMEGGGWCRN----------AQE  216

Query  418   CSSRMKRELGSTFNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
             CS R     GS+  M P  F GI G N      FY WNR+ +RYCDG SF GDVE  +  
Sbjct  217   CSVRQGNFRGSSKFMRPLSFSGIIGGNQRNNPDFYNWNRIKVRYCDGSSFTGDVETVETS  276

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L++RGAR++  ++++L+AKGM  A+N + +G SAGGL  ++HCD+F    P    VKC
Sbjct  277   TNLHFRGARVWNAIIEDLLAKGMSKAQNALLSGCSAGGLAAILHCDQFRDLLPATANVKC  336

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
              SD+  F+  KD     + +  + D+V LH   K+LP  CTSKMSP  CF P+N+V  ++
Sbjct  337   FSDAGFFVDGKDITGNDFVRTFYKDVVNLHGSAKNLPSSCTSKMSPDLCFFPQNVVPTLR  396

Query  955   SPLFIFHSAYDSFQVQNTFSMDLYRAIK-------NRSSISPTDMALLQDFKKQIISALP  1113
             +PLFI ++AYD++Q++N  +       K       + ++ S + +  LQ+F+   ++ALP
Sbjct  397   TPLFILNAAYDAWQIKNVLAPSAADKKKTWAKCKLDITACSSSQLTTLQNFRTDFLAALP  456

Query  1114  KPS---ATKGFIVTSNFGH-SFASADYKKRMFADSKSKT-IEDGFYNWFFDKHPINLID  1275
             KP    A     + S + H    S D      +    KT I     +WF D+     ID
Sbjct  457   KPEQSPANLSIFIDSCYAHCQSGSQDTWLAQGSPVVEKTQIGKAVGDWFHDREVSRRID  515



>ref|XP_009388128.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=393

 Score =   249 bits (637),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 138/321 (43%), Positives = 200/321 (62%), Gaps = 19/321 (6%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             L +P T++  A  KGAVCLDGSPPAYHFSPG    A+NWL+++ GGGWC +         
Sbjct  28    LGVPMTLLHSAVAKGAVCLDGSPPAYHFSPGSGSGANNWLVHMEGGGWCRN---------  78

Query  406   SVESCSSRMKRELGSTFNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEK  582
              VE C  R     GS+ +M P  F GI G +  +   FY WNRV IRYCDG SF GDVE+
Sbjct  79    -VEECLERKNNFRGSSNHMKPLSFSGILGKSKKYNPDFYNWNRVKIRYCDGSSFTGDVER  137

Query  583   PDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGV  762
              DP T L+YRGAR++  ++++L+AKGM  A+N + +G SAGGL  ++HCD+F S  P   
Sbjct  138   VDPATNLHYRGARVWLAIMEDLLAKGMNKAENALLSGCSAGGLASILHCDKFRSLLPASA  197

Query  763   RVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLV  942
             +VKC SD+  F+  KD       +++++D+V LH   K+LP  CTS +SP  CF P+N+V
Sbjct  198   KVKCFSDAGYFIDGKDITGTTSIRSLYNDVVNLHGSGKNLPSSCTSSLSPSLCFFPQNVV  257

Query  943   QYVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIK----NRSSISPTDMALLQDFKKQII  1101
               + +PLFI ++AYD++Q++NT    S D +++      N +S S   +  +QDF+ + +
Sbjct  258   PKMSTPLFILNAAYDAWQIKNTLAPSSADPHKSWNACKLNITSCSSDQLEKMQDFRSEFL  317

Query  1102  SALPKP-SATKGFIVTSNFGH  1161
              ALP   +++ G  + S + H
Sbjct  318   RALPASGNSSTGMFIISCYAH  338



>ref|XP_008378614.1| PREDICTED: uncharacterized protein LOC103441693 [Malus domestica]
 ref|XP_008347801.1| PREDICTED: uncharacterized protein LOC103410927 [Malus domestica]
Length=393

 Score =   249 bits (637),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 137/359 (38%), Positives = 207/359 (58%), Gaps = 25/359 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T++  A  KGAVCLDGS PAYHF  G     +NWL+Y  GGGWC +          V +C
Sbjct  30    TLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVYFEGGGWCNT----------VATC  79

Query  421   SSRMKRELGSTFNMA-PFVFKGIF-GINATFTKFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
               R    LGS+  M    +F G+      T   FY WNR+ +RYCDG SF GDVE  DP 
Sbjct  80    LDRSNYSLGSSTKMEKTMLFSGVLSNKQKTNPDFYNWNRIKVRYCDGSSFTGDVEAVDPA  139

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L++RGAR+F+ ++D+L+AKGMK+A++ + +G SAGGL  ++HCD F S  P   +VKC
Sbjct  140   TNLHFRGARVFRAIMDDLLAKGMKNAQSALLSGCSAGGLASILHCDNFRSLLPVDAKVKC  199

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             + D+  F+  +    + Y +A +S++VALH   K+LP  CTS+MSP  CF P+N+V   +
Sbjct  200   VPDAGYFINARTVSGSPYIQAFYSEVVALHGSAKNLPASCTSRMSPGLCFFPQNVVPLTR  259

Query  955   SPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQIISALP  1113
             +P+F  ++AYD +Q+QN  + D+      ++  K N  + SP+ +  +Q+F+ Q +  + 
Sbjct  260   TPIFFVNAAYDWWQIQNILAPDVADPEGAWKKCKLNIKNCSPSQLQTMQEFRLQFLKTIT  319

Query  1114  KP--SATKGFIVTSNFGHSFASADYKKRMFADSK---SKTIEDGFYNWFFDKHPINLID  1275
                 S++ G+ + S + H       +  + ADS      TI +   +W++D  P   ID
Sbjct  320   GASNSSSHGWFIHSCYAHCQIEMQ-ETWLAADSPMLCKTTIAEAVGDWYYDLTPFRKID  377



>emb|CDP15690.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   249 bits (637),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 134/360 (37%), Positives = 206/360 (57%), Gaps = 27/360 (8%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYH   G     ++WL+++ GGGWC +          V +C
Sbjct  30    TYVESAVAKGAVCLDGSPPAYHLDRGFGAGINSWLVHIEGGGWCNN----------VTTC  79

Query  421   SSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
               R    LGS+  MA    F GI      F   FY WNRV +RYCDG SF GDVE  +P 
Sbjct  80    LDRKNTRLGSSKQMAKQLAFSGILANKPKFNPDFYNWNRVKVRYCDGSSFTGDVEAVNPA  139

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L+YRGAR+F  V+++L+AKGM++A++ + +G SAGGL  ++HCD F +  P G +VKC
Sbjct  140   TNLHYRGARVFVAVIEDLLAKGMRNAESAVLSGCSAGGLTSILHCDSFKALLPLGTKVKC  199

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
              +D+  F+  KD    ++ +A ++D+V  H   K+LP  CTS+M P  CF P+ + Q ++
Sbjct  200   FADAGYFINAKDVSGVQHIEAFYNDVVNTHGSAKNLPATCTSRMKPGLCFFPQYMAQEIR  259

Query  955   SPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQIISALP  1113
             +PLFI ++AYDS+Q++N  +        L+   K + +  S + + ++Q F+ + +SA+ 
Sbjct  260   TPLFITNAAYDSWQIKNILAPGVADPHGLWHNCKLDITRCSASQLQIIQGFRLEFLSAVN  319

Query  1114  --KPSATKGFIVTSNFGHSFASADYKKRMFADS----KSKTIEDGFYNWFFDKHPINLID  1275
                 S+++G+ +   + H     + ++    D       KTI     +WF+D+ P   ID
Sbjct  320   GLGTSSSRGYFINGCYAH--CQTEMQETWLRDDSPRLNDKTIAKAVGDWFYDRSPFQTID  377



>ref|XP_011082152.1| PREDICTED: protein notum homolog isoform X2 [Sesamum indicum]
Length=378

 Score =   249 bits (635),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 135/349 (39%), Positives = 205/349 (59%), Gaps = 27/349 (8%)
 Frame = +1

Query  274   VCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGST  453
             VCLDGSPPAYH   G     +NWL+++ GGGWC +          V +C +R    LGS+
Sbjct  20    VCLDGSPPAYHLDRGYGTGINNWLVHIEGGGWCNN----------VTTCLARKNNRLGSS  69

Query  454   -FNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIF  627
              + +    F GI    A F   FY WNRV +RYCDG SF GDVE  +PVTKL+YRGAR+F
Sbjct  70    KYMVKQLAFSGILNNKANFNPDFYNWNRVKVRYCDGASFTGDVEAVNPVTKLHYRGARVF  129

Query  628   QVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVK  807
               V+++L+AKGMK+A+N + +G SAGGL  ++HCD F +  P G +VKC SD+  F+  K
Sbjct  130   LAVMEDLLAKGMKNAENAVLSGCSAGGLAAILHCDSFKALLPMGTKVKCFSDAGYFINTK  189

Query  808   DPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYD  987
             D   A++ +A + D+V+ H   K+LP  CTS+M P  CF P+ + + +++PLFI ++AYD
Sbjct  190   DVSGAQHIEAFYHDVVSTHGSAKNLPRSCTSRMKPSLCFFPQYVAREIRTPLFIINAAYD  249

Query  988   SFQVQNTFSMDL-------YRAIKNRSSISPTDMALLQDFKKQIISAL--PKPSATKGFI  1140
             S+Q++N  +  +       +    + +  S T +  +Q F+ + I AL     S ++G+ 
Sbjct  250   SWQIKNILAPGVADPHGTWHNCKTDINKCSATQLQTMQGFRLEFIRALYGLGVSTSRGYF  309

Query  1141  VTSNFGHSFASADYKKRMF-ADS---KSKTIEDGFYNWFFDKHPINLID  1275
             + S + H     + ++  + +DS    +KTI     +WF+D+ P    D
Sbjct  310   INSCYAH--CQTEMQETWYRSDSPKLNNKTIAKAVGDWFYDRSPFQKGD  356



>ref|XP_010677538.1| PREDICTED: protein notum homolog isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=389

 Score =   249 bits (636),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 142/362 (39%), Positives = 207/362 (57%), Gaps = 25/362 (7%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KG VCLDGSPPAYHF  G      NWLI++ GG WC +  T        
Sbjct  24    VPITYVQDAVAKGGVCLDGSPPAYHFDKGFGAGIHNWLIHMEGGAWCNNATT--------  75

Query  412   ESCSSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKP  585
               C  R K  LGS+  M   + F GI    A ++  FY WNR+ +RYCDG SF GDVE  
Sbjct  76    --CLERTKTRLGSSKLMTKQYTFSGILSNQAKYSPDFYNWNRIKVRYCDGSSFTGDVEAV  133

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             DP  K+YYRGAR+++ ++D+L+AKGMK+A+N I AG SAGGLG ++ CD F +  P G +
Sbjct  134   DPKAKVYYRGARLWRAIMDDLLAKGMKNAENAILAGCSAGGLGAILQCDNFRALLPSGAK  193

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKCLSD+  F+  KD     + + VF+D+V  H   K+LP  CTSK  P  CF P+   +
Sbjct  194   VKCLSDAGFFINAKDISGVSHIQEVFADVVTTHGSAKNLPPSCTSKFDPKLCFFPEYAAR  253

Query  946   YVKSPLFIFHSAYDSFQVQNTFS---MDLYRAIKNRSS----ISPTDMALLQDFKKQIIS  1104
              +++PLF+ ++AYD++Q++NT +    D +    +  S     S + + ++  F++  ++
Sbjct  254   GIQTPLFLLNAAYDAWQIKNTLAPGVADRHGTWHDCKSDIIKCSNSQIQIMHGFRQDFLA  313

Query  1105  ALPK--PSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINL  1269
             AL     S ++GF + S + H   S   +  +  DS    + TI     +WF+D+ P   
Sbjct  314   ALSSLGNSNSRGFYINSCYSHC-QSGTQETWLRDDSPLLDNTTICKAVGDWFYDRKPFQK  372

Query  1270  ID  1275
             ID
Sbjct  373   ID  374



>ref|XP_010449359.1| PREDICTED: uncharacterized protein LOC104731629 [Camelina sativa]
Length=391

 Score =   249 bits (636),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 140/361 (39%), Positives = 204/361 (57%), Gaps = 23/361 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT           V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  412   ESCSSRMKRELGST-FNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKP  585
              SC  R     GS+ F    F F GI G   +T   FY WNR+ +RYCDG SF G+V   
Sbjct  74    ASCIERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAV  133

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +P  KL++RGAR+++ VVD+LMAKGMK+A+N I +G SAG L  ++HCD F +  P+  R
Sbjct  134   NPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAR  193

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+  KD     Y ++ +S +VALH   KSLP+ CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKMKPELCFFPQYVVP  253

Query  946   YVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIKN----RSSISPTDMALLQDFKKQIIS  1104
             ++++PLF+ ++A+DS+Q++N     ++D  +  KN        S   +  +Q F+ Q++ 
Sbjct  254   FMRTPLFVINAAFDSWQIKNVLAPTAVDKRKEWKNCKLDLKKCSAAQLKTVQGFRDQMMR  313

Query  1105  ALPKPSAT--KGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLI  1272
             AL    +T  +G  + S   H    ++A +         +  I     NWF+ +     I
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQVANTRISKAVGNWFYGRSAFQKI  373

Query  1273  D  1275
             D
Sbjct  374   D  374



>ref|NP_567585.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 gb|AAK96722.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 gb|AAL47339.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 gb|AAM64921.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 dbj|BAF00825.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 gb|AEE84177.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=391

 Score =   249 bits (636),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 141/361 (39%), Positives = 204/361 (57%), Gaps = 23/361 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT           V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  412   ESCSSRMKRELGST-FNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKP  585
              SC+ R     GS+ F    F F GI G   +T   FY WNR+ +RYCDG SF G+VE  
Sbjct  74    ASCNERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVEAV  133

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +P  KL++RGAR+++ VVD+LMAKGMK+A+N I +G SAG L  ++HCD F +  P+   
Sbjct  134   NPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAS  193

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+  KD     Y ++ +S +VALH   KSLPV CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDITGGSYIQSYYSKVVALHGSAKSLPVSCTSKMKPELCFFPQYVVP  253

Query  946   YVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIKN----RSSISPTDMALLQDFKKQIIS  1104
              +++PLF+ ++A+DS+Q++N     ++D  +  KN        S   +  +Q F+ Q++ 
Sbjct  254   SMRTPLFVINAAFDSWQIKNVLAPTAVDKGKEWKNCKLDLKKCSAAQLKTVQGFRDQMMR  313

Query  1105  ALPKPSAT--KGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLI  1272
             AL    +T  +G  + S   H    ++A +         +  I     NWF+ +     I
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGDKGPQVANTRIAKAVGNWFYGRSAFQKI  373

Query  1273  D  1275
             D
Sbjct  374   D  374



>ref|XP_010235850.1| PREDICTED: protein notum homolog isoform X1 [Brachypodium distachyon]
 ref|XP_010235851.1| PREDICTED: protein notum homolog isoform X1 [Brachypodium distachyon]
Length=395

 Score =   249 bits (636),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 146/358 (41%), Positives = 207/358 (58%), Gaps = 25/358 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGS PAYH + G      +WL++  GGGWC++          V +C
Sbjct  32    TYVDSAVAKGAVCLDGSAPAYHLARGFGSGVDSWLVHFEGGGWCSN----------VTTC  81

Query  421   SSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
               R    LGS+  MA  V F GI          FY WN+V +RYCDG SF GD E+ DP 
Sbjct  82    LERKNTRLGSSKEMAKQVAFSGILSNTPDHNPDFYNWNKVRVRYCDGSSFTGDKEEVDPT  141

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             TKL+YRGAR++Q V+++L+AKGM  A+N + +G SAGGL  ++HCDRF  R P    VKC
Sbjct  142   TKLHYRGARVWQAVMEDLLAKGMDRAENALISGCSAGGLTSVLHCDRFRDRMPVEANVKC  201

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             LSD+  F+ VKD    K+    F+D+V  H   K+LP  CTSK+ P  C  P+N V+ ++
Sbjct  202   LSDAGFFIDVKDIAGEKHAADFFNDVVTTHGSAKNLPSSCTSKLPPGMCLFPQNEVKQIQ  261

Query  955   SPLFIFHSAYDSFQVQNTF----SMDLYRAIKNR-SSISPTDMALLQDFKKQIISALPK-  1116
             +PLFI ++AYDS+QV+N      S   +R+ K+  +  S   +  LQ F+   + AL + 
Sbjct  262   TPLFILNAAYDSWQVRNILVPGGSDPHWRSCKHDINQCSEKQLKTLQGFRDDFLKALEEQ  321

Query  1117  -PSATKGFIVTSNFGHSFASADYKKRMFA-DS---KSKTIEDGFYNWFFDKHPINLID  1275
               S+++G  + S F H    ++ ++  FA DS    +K I +   +WF+D+ P   ID
Sbjct  322   GSSSSRGLFINSCFAH--CQSEIQEIWFAPDSPVLGNKKIANAIGDWFYDRSPFQEID  377



>ref|XP_006599203.1| PREDICTED: uncharacterized protein LOC100781246 isoform X1 [Glycine 
max]
 ref|XP_006599204.1| PREDICTED: uncharacterized protein LOC100781246 isoform X2 [Glycine 
max]
 ref|XP_006599205.1| PREDICTED: uncharacterized protein LOC100781246 isoform X3 [Glycine 
max]
Length=399

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 139/359 (39%), Positives = 204/359 (57%), Gaps = 25/359 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYHF  G     +NW+++  GGGWC +          V +C
Sbjct  30    TFVENAVAKGAVCLDGSPPAYHFHKGSGAGINNWIVHFEGGGWCNN----------VTTC  79

Query  421   SSRMKRELGSTFNM-APFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              SR    LGS+  M     F G F  +  F   FY WNR+ +RYCDG SF GDVE  DP 
Sbjct  80    LSRRDTRLGSSKKMDTSLSFSGFFSNSKKFNPDFYDWNRIKVRYCDGSSFTGDVEAVDPK  139

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L++RGAR+F VVV++L+AKGMK+A+N I +G SAGGL  +++CDRF S  P   +VKC
Sbjct  140   TNLHFRGARVFAVVVEDLLAKGMKNAQNAIISGCSAGGLASILNCDRFKSLLPATTKVKC  199

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             L+D+  F+ VKD   A+  +  +S +V  H   K+LP  CTS++ P  CF P+N+V  + 
Sbjct  200   LADAGFFINVKDVSGAQRIEEFYSQVVQTHGSAKNLPTSCTSRLRPGLCFFPQNVVSQIS  259

Query  955   SPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQIISALP  1113
             +P+F  ++AYDS+Q++N  +         +R  K +  + SP  ++++Q F+   + A  
Sbjct  260   TPIFFVNAAYDSWQIKNILAPGAADPRGQWRECKLDIKNCSPNQLSVMQGFRTDFLRAFS  319

Query  1114  --KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
                 +A+KG  +   + H   +   +  +  DS      +I     +WF+D+ P   ID
Sbjct  320   VVGNAASKGHFIDGCYAHC-QTGIQETWLRNDSPVVAKTSIAKAVGDWFYDRRPFREID  377



>ref|XP_010434424.1| PREDICTED: uncharacterized protein LOC104718381 isoform X1 [Camelina 
sativa]
Length=391

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 140/361 (39%), Positives = 204/361 (57%), Gaps = 23/361 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT           V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  412   ESCSSRMKRELGST-FNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKP  585
              SC  R     GS+ F    F F GI G   +T   FY WNR+ +RYCDG SF G+V   
Sbjct  74    ASCIERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAV  133

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +P  KL++RGAR+++ VVD+LMAKGMK+A+N I +G SAG L  ++HCD F +  P+  R
Sbjct  134   NPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAR  193

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+  KD     Y ++ +S +VALH   KSLP+ CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKMKPELCFFPQYVVP  253

Query  946   YVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIKN----RSSISPTDMALLQDFKKQIIS  1104
             ++++PLF+ ++A+DS+Q++N     ++D  +  KN        S   +  +Q F+ Q++ 
Sbjct  254   FMRTPLFVINAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCSAAQLKTVQGFRDQMMR  313

Query  1105  ALPKPSAT--KGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLI  1272
             AL    +T  +G  + S   H    ++A +         +  I     NWF+ +     I
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQVANTRIAKAVGNWFYGRSAFQKI  373

Query  1273  D  1275
             D
Sbjct  374   D  374



>gb|KHN41567.1| Protein notum like [Glycine soja]
Length=399

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 139/359 (39%), Positives = 204/359 (57%), Gaps = 25/359 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYHF+ G     +NW+++  GGGWC +          V +C
Sbjct  30    TFVENAVAKGAVCLDGSPPAYHFNKGSGAGINNWIVHFEGGGWCNN----------VTTC  79

Query  421   SSRMKRELGSTFNM-APFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              SR    LGS+  M     F G F  +  F   FY WNR+ +RYCDG SF GDVE  DP 
Sbjct  80    LSRRDTRLGSSKKMDTSLSFSGFFSNSKKFNPDFYDWNRIKVRYCDGSSFTGDVEAVDPK  139

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L++RGAR+F VVV++L+AKGMK+A+N I +G SAGGL  +++CDRF S  P   +VKC
Sbjct  140   TNLHFRGARVFAVVVEDLLAKGMKNAQNAIISGCSAGGLASILNCDRFKSLLPATTKVKC  199

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             L+D+  F+ VKD   A+  +  +S +V  H   K+LP  CTS++ P  CF P+N+V  + 
Sbjct  200   LADAGFFINVKDVSGAQRIEEFYSQVVQTHGSAKNLPTSCTSRLRPGLCFFPQNVVSQIS  259

Query  955   SPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQIISALP  1113
             +P+F  ++AYDS+Q++N  +         +R  K +  + SP  ++++Q F+   + A  
Sbjct  260   TPIFFVNAAYDSWQIKNILAPGAADPHGQWRECKLDIKNCSPNQLSVMQGFRTDFLRAFS  319

Query  1114  --KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
                  A+KG  +   + H   +   +  +  DS      +I     +WF+D+ P   ID
Sbjct  320   VVGNGASKGHFIDGCYAHC-QTGIQETWLRNDSPVVAKTSIAKAVGDWFYDRRPFREID  377



>ref|XP_006363883.1| PREDICTED: uncharacterized protein LOC102589191 [Solanum tuberosum]
Length=476

 Score =   251 bits (642),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 145/366 (40%), Positives = 210/366 (57%), Gaps = 25/366 (7%)
 Frame = +1

Query  223   DLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHD  402
             DL +  TI+  A  +GAVCLDGSPPAYH   G      NW+IYL GGGWC S        
Sbjct  5     DLNVNITILESATAQGAVCLDGSPPAYHLHRGHGTGLDNWIIYLDGGGWCES--------  56

Query  403   LSVESCSSRMKRELGSTFNMAPFVF-KGIF-GINATFTKFYKWNRVIIRYCDGGSFAGDV  576
               +  C  R    LGST  M    F  GI    +    +F+ WNRV ++YCDG SF GDV
Sbjct  57    --IPECLYRTTTYLGSTKKMGQQAFFSGILHNTSKQNPEFHNWNRVRVKYCDGSSFTGDV  114

Query  577   EKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPK  756
             E+  P  KLY+RGARIF+ ++++L +KGMK+A+N I +G SAGGL  +++CD+F    P+
Sbjct  115   EQVHPENKLYFRGARIFKAIMEDLSSKGMKNAENAILSGTSAGGLATILNCDKFKCLLPE  174

Query  757   GVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKN  936
               RVKC++D+S F+  K      + + ++ +IV LH+  K+LP  CTS M P  CF P+N
Sbjct  175   NARVKCVADASFFINGKSIYGTSFTQEMYQNIVNLHESAKNLPPACTSAMEPSLCFFPEN  234

Query  937   LVQYVKSPLFIFHSAYDSFQVQNTFS---MDLYRA----IKNRSSISPTDMALLQDFK--  1089
             ++ YV++PLFI +S YDS+Q+ NT     +D   A    IK+ SS + + + ++Q F   
Sbjct  235   VMPYVQTPLFIINSIYDSWQINNTLVPPYLDKQHAWKACIKSISSCTSSQLIIIQAFGVE  294

Query  1090  -KQIISALPKPSATKGFIVTSNFGHSFASAD--YKKRMFADSKSKTIEDGFYNWFFDKHP  1260
               +    LP P +T+G+ +TS + H        + K       +KTI +   +W+F++  
Sbjct  295   FSKTFEGLP-PCSTRGYFLTSCYSHGGIRLTPYWLKTSSLTLFNKTIAEAVADWYFEREG  353

Query  1261  INLIDP  1278
             I   DP
Sbjct  354   IQYTDP  359



>ref|XP_008373438.1| PREDICTED: protein notum homolog isoform X1 [Malus domestica]
Length=466

 Score =   251 bits (641),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 150/406 (37%), Positives = 214/406 (53%), Gaps = 39/406 (10%)
 Frame = +1

Query  100   SLRMAVSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVC  279
             S R     R   W+ +L    V +V  + +  +P  I          T +  A  KGAVC
Sbjct  25    SYRQMAGARLGQWLSVL----VCAVMLLKAAALPVGI----------TYVHSAVAKGAVC  70

Query  280   LDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFN  459
             LDGSPPAYH   G     +NWL+++ GGGWC +          + +C  R    LGS+  
Sbjct  71    LDGSPPAYHLDKGYGSGINNWLVHIEGGGWCNN----------ITTCLVRKNNRLGSSKK  120

Query  460   M-APFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQV  633
             M     F GI      F   FY WNRV +RYCDG SF GDV   +  T L++RGARIF+ 
Sbjct  121   MLKEIAFSGILNSRHIFNPDFYNWNRVKVRYCDGASFTGDVAAVNLATGLFFRGARIFRA  180

Query  634   VVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDP  813
             V++EL+AKGM  AKN I +G SAGGL  ++HCD F +  P G +VKC+SD+  F+  KD 
Sbjct  181   VIEELLAKGMGKAKNAILSGCSAGGLASILHCDNFHALLPVGAKVKCVSDAGYFINAKDV  240

Query  814   ERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSF  993
               A++ +  FS +VA H   K+LP  CTSK+SP  CF P+     +++P+F  ++AYDS+
Sbjct  241   SGARHVEQFFSQVVATHGSAKNLPPSCTSKLSPGLCFFPQYFASQIRTPMFYVNAAYDSW  300

Query  994   QVQNTFS---MDLYRAIKNR----SSISPTDMALLQDFKKQIISALPKPSA--TKGFIVT  1146
             Q++N  +    D +   +N     +   PT +  +QDF+ Q +SA+   S   +KG  + 
Sbjct  301   QIKNILAPGVADPHGTWQNCKLDITHCKPTQLKTMQDFRAQFLSAIGGVSGSRSKGMFID  360

Query  1147  SNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
             S + H       +  +  DS      TI     +WF+D+ P   ID
Sbjct  361   SCYAHCQTELQ-ETWLMPDSPVLNKTTIAKAVGDWFYDRTPFQKID  405



>ref|XP_010536220.1| PREDICTED: protein notum homolog isoform X1 [Tarenaya hassleriana]
Length=399

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 138/367 (38%), Positives = 207/367 (56%), Gaps = 31/367 (8%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             L +  T +  A  KGAVCLDGSPPAYH   G     +NWLI L GGGWC +         
Sbjct  25    LFVDITYVQKAVAKGAVCLDGSPPAYHLDRGSGTGINNWLIQLEGGGWCNN---------  75

Query  406   SVESCSSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V +C +RM+  LGS+  MA    F  I      +   FY WNRV IRYCDG SF GDV+
Sbjct  76    -VTNCVARMRTHLGSSKQMAKQIAFSAILSNRRQYNPDFYNWNRVKIRYCDGSSFTGDVQ  134

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               DP T L++RG R++  V+++L+AKGM++A+N + +G SAGGL  ++HCD F +  P G
Sbjct  135   TVDPDTNLHFRGGRVWLAVMEDLLAKGMRNAENAVLSGCSAGGLASMLHCDSFRALLPMG  194

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKC+SD+  F+  +D   A+Y +  F D+V LH   K+LP+ CTS+++P  CF P+ +
Sbjct  195   SKVKCISDAGFFVNTRDVSGAEYIREYFKDVVTLHGSAKNLPLSCTSRLNPALCFFPQYV  254

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFS----------MDLYRAIKNRSSISPTDMALLQDFK  1089
              Q++++PLF+ ++AYDS+Q++N  +                IKN     P  + ++QDF+
Sbjct  255   AQHIRTPLFVLNAAYDSWQIKNILAPRAADPNGKWQSCQLDIKN---CQPNQLKVMQDFR  311

Query  1090  KQIISAL--PKPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDK  1254
              + +SA+     S+++G  + S + H   +       + DS      TI     +W +D+
Sbjct  312   LEFLSAVIGLGKSSSRGMFIDSCYAHC-QTESQTSWFWPDSPRLDRVTIAKAVGDWVYDR  370

Query  1255  HPINLID  1275
                  ID
Sbjct  371   TLFQKID  377



>emb|CAA67728.1| pectinacetylesterase precursor [Vigna radiata var. radiata]
Length=399

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 145/400 (36%), Positives = 216/400 (54%), Gaps = 39/400 (10%)
 Frame = +1

Query  118   SPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPP  297
             + R   W+ +LI  +++    + +  +P  I          T +  A  KGAVCLDGSPP
Sbjct  3     TSRKGQWLSVLICVVLL----LKAEGVPVGI----------TFVENAVAKGAVCLDGSPP  48

Query  298   AYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNM-APFV  474
             AYHF  G     +NW+++  GGGWC +          V SC SR    LGS+  M     
Sbjct  49    AYHFHKGSGAGINNWIVHFEGGGWCNN----------VTSCLSRRDTRLGSSKKMDTQLS  98

Query  475   FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELM  651
             F G F  +  F   FY WNR+ +RYCDG SF GDVE  DP T L++RG+R+F  VVD+L+
Sbjct  99    FSGFFSNSKKFNPDFYDWNRIKVRYCDGSSFTGDVEAVDPATNLHFRGSRVFAAVVDDLL  158

Query  652   AKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYF  831
             AKGMK+A+N I +G SAGGL  +++CDRF S  P+  +VKCL+D+  F+ VKD   A+  
Sbjct  159   AKGMKNAQNAIISGCSAGGLAAILNCDRFKSLLPRTTKVKCLADAGYFINVKDVSGAQRI  218

Query  832   KAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF  1011
             +  +S +V  H   K+LP  CTS++ P  CF P+N+V  + +P+F  ++AYDS+Q++N  
Sbjct  219   EEFYSQVVQTHGSAKNLPASCTSRLRPGLCFFPQNVVSQISTPIFFVNAAYDSWQIKNIL  278

Query  1012  S------MDLYRAIK-NRSSISPTDMALLQDFKKQIISALPK--PSATKGFIVTSNFGHS  1164
             +         +R  K +    S   ++ +Q F+   + A      S +KG  +   + H 
Sbjct  279   APGAADPHGTWRECKLDIKKCSSNQLSAMQVFRTDFLRAFGAVGNSPSKGHFIDGCYAHC  338

Query  1165  FASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
               +   +  +  DS    S TI     +W++D+ P   ID
Sbjct  339   -QTGTQETWLRNDSPVLGSTTIAKAVGDWYYDRKPFKQID  377



>ref|NP_193677.2| putative pectinacetylesterase [Arabidopsis thaliana]
 gb|AAT70429.1| At4g19420 [Arabidopsis thaliana]
 gb|AAU45212.1| At4g19420 [Arabidopsis thaliana]
 gb|AEE84180.1| putative pectinacetylesterase [Arabidopsis thaliana]
Length=397

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 149/398 (37%), Positives = 213/398 (54%), Gaps = 45/398 (11%)
 Frame = +1

Query  133   DWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFS  312
              W+  L+ SLVI              +    L +  T +  A  KGAVCLDGSPPAYH  
Sbjct  6     QWLIYLVCSLVI--------------MNTEGLFVNITFVRNAVAKGAVCLDGSPPAYHLD  51

Query  313   PGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAP-FVFKGIF  489
              G     ++WLI L GGGWC +          V +C SRM   LGS+  M     F  I 
Sbjct  52    RGSGTGINSWLIQLEGGGWCNN----------VTNCVSRMHTRLGSSKKMVENLAFSAIL  101

Query  490   GINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMK  666
                  +   FY WNRV +RYCDG SF GDVE  +P T L++RGAR++  V+ EL+AKGM 
Sbjct  102   SNKKQYNPDFYNWNRVKVRYCDGASFTGDVEAVNPATNLHFRGARVWLAVMQELLAKGMI  161

Query  667   DAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFS  846
             +A+N + +G SAGGL  L+HCD F +  P G +VKCLSD+  FL  +D    +Y K  F 
Sbjct  162   NAENAVLSGCSAGGLASLMHCDSFRALLPMGTKVKCLSDAGFFLNTRDVSGVQYIKTYFE  221

Query  847   DIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF---SM  1017
             D+V LH   K+LP  CTS+++P  CF P+ + + +++PLFI ++AYDS+Q++N     + 
Sbjct  222   DVVTLHGSAKNLPRSCTSRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAA  281

Query  1018  DLYRA-------IKNRSSISPTDMALLQDFKKQIISAL--PKPSATKGFIVTSNFGHSFA  1170
             D Y         IKN     P+ + ++QDF+ + +SA+     S+++G  + S + H   
Sbjct  282   DPYGKWQSCQLDIKN---CHPSQIKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHC-Q  337

Query  1171  SADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
             +       + DS      TI     +W +D+     ID
Sbjct  338   TETQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKID  375



>ref|XP_006368062.1| PREDICTED: protein notum homolog, partial [Solanum tuberosum]
Length=329

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 140/349 (40%), Positives = 199/349 (57%), Gaps = 39/349 (11%)
 Frame = +1

Query  136   WICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSP  315
             ++CLLIF                  ++   LL+  TI+  A  KGAVCLDG+PPAYH   
Sbjct  9     FVCLLIF------------------VRTESLLVNITILESAVAKGAVCLDGTPPAYHLDR  50

Query  316   GKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNM-APFVFKGIFG  492
             G     +NW+I L GGGWC +          V  C +R    LGS+  M     F G+  
Sbjct  51    GSGPGVNNWVISLEGGGWCQN----------VTLCLTRKNTRLGSSAKMDHQLPFSGMMS  100

Query  493   INATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKD  669
              +  F  +FY WNRV +RYCDGGSF GDVE  DP T L+YRGARIF+ +++EL+A+GM  
Sbjct  101   NDPNFNPEFYNWNRVSVRYCDGGSFTGDVEAIDPGTGLHYRGARIFKAIMEELLAQGMNT  160

Query  670   AKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSD  849
             ++N I +G SAGGL  ++HCD F +  P   +VKC SD+  F+ + D     Y +  F+D
Sbjct  161   SQNAILSGCSAGGLATILHCDNFRTLLPNNAKVKCFSDAGYFIHLNDISGKPYIEHYFND  220

Query  850   IVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQN------TF  1011
             +V LH   K+LP  CTSK+ P  CF P+N+ Q +K+PLFI ++AYD +QV+N      T 
Sbjct  221   VVTLHGSAKNLPPSCTSKLKPGLCFFPENVAQQIKTPLFIINAAYDHWQVRNILVAPGTD  280

Query  1012  SMDLYRAIK-NRSSISPTDMALLQDFKKQIISALP--KPSATKGFIVTS  1149
                 + + K N  + +P  + +LQ F++  + AL     S+T+G+ + S
Sbjct  281   PKGAWTSCKANIKNCTPYQLTVLQGFREDFLKALEGIGRSSTRGYYINS  329



>dbj|BAJ97261.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00807.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=393

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/355 (40%), Positives = 200/355 (56%), Gaps = 22/355 (6%)
 Frame = +1

Query  247   IPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSS  426
             +  A  KGAVCLDGSPP YHFSPG    A NW++++ GGGWC +           E C+ 
Sbjct  34    VKSAVAKGAVCLDGSPPVYHFSPGSGSGADNWVVHMEGGGWCKT----------PEECAV  83

Query  427   RMKRELGSTFNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKL  603
             R     GS+  M P  F GI G +  +   FY WNRV +RYCDG SF GDVE+ D  T L
Sbjct  84    RKGNFRGSSKYMKPLSFSGILGGSQQYNPDFYNWNRVKVRYCDGSSFTGDVEEVDSSTNL  143

Query  604   YYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSD  783
             +YRGAR++  ++++L+ +GM  AKN I +G SAGGL  ++HCD+F    P    VKC+SD
Sbjct  144   HYRGARVWDAIIEDLLNRGMSKAKNAILSGCSAGGLAAILHCDKFNDLLPPSASVKCVSD  203

Query  784   SSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPL  963
             +  F+   D    K+ +  F ++V LH   K+LP  CTS+ SP  CF P++++  +K+PL
Sbjct  204   AGYFIDGTDITGNKFVRTSFKNVVNLHGSVKNLPSSCTSRTSPELCFFPQHVLPTLKTPL  263

Query  964   FIFHSAYDSFQVQNTF-------SMDLYRAIKNRSSISPTDMALLQDFKKQIISALPKP-  1119
             FI ++AYDS+Q++N           +  +   +    S + +  LQ F+ + +SALPKP 
Sbjct  264   FILNAAYDSWQIRNILVPSAADKKKEWAKCKLDIKGCSSSQLVTLQHFRDEFLSALPKPG  323

Query  1120  -SATKGFIVTSNFGHSFASA-DYKKRMFADSKSKT-IEDGFYNWFFDKHPINLID  1275
              S + G  + S F H  + A D      + S  KT I     +WFFD+     ID
Sbjct  324   QSPSVGMFIDSCFAHCQSGAQDSWNADGSPSLQKTKIGKAVGDWFFDRAVSQRID  378



>ref|XP_006363875.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=402

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 144/382 (38%), Positives = 216/382 (57%), Gaps = 27/382 (7%)
 Frame = +1

Query  175   QYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYL  354
             Q++ S    + + +   L +  T +     KGAVCLDGSPPAYH   G     ++WLI +
Sbjct  8     QWIYSFVTLSIVFRTEGLFVNITYVLSGVAKGAVCLDGSPPAYHHDKGFGTGVNSWLIQM  67

Query  355   AGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWN  528
              GGGWC +          + +C SR    LGS+  M     F GI      F   FY WN
Sbjct  68    EGGGWCNN----------ISTCLSRKNTRLGSSKQMVENLAFSGILSNLPQFNPDFYNWN  117

Query  529   RVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagg  708
             RV + YCDG SF GDV+  +P+T L++RGAR+F  V+++L+AKGMK+A+N I +G SAGG
Sbjct  118   RVKVGYCDGSSFTGDVQAVNPITNLHFRGARVFLAVMEDLLAKGMKNAENAILSGCSAGG  177

Query  709   lgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPV  888
             L  ++HCD F +  P G +VKC SD+  F+  KD   A + +  F D+V+LH   K+LP 
Sbjct  178   LTSILHCDSFKALLPMGAKVKCFSDAGYFIDAKDISGAPHIEEYFRDVVSLHGSAKNLPP  237

Query  889   ECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFS---MDLYRAIKNRS----  1047
              CTS++ P  CF P+N+ Q+V++PLF+ ++AYDS+Q++N  +    D Y    N      
Sbjct  238   VCTSRLKPDLCFFPQNVAQHVRTPLFLVNAAYDSWQIKNILAPGVADPYGFWLNCKLDIL  297

Query  1048  SISPTDMALLQDFKKQIISALPK--PSATKGFIVTSNFGHSFASADYKKRMF-ADS---K  1209
               S   + ++  ++   + AL    PS+++G+ + S F H     + ++  + ADS    
Sbjct  298   KCSSRQLQIMHGYRLLFLRALNALGPSSSRGYFINSCFAH--CQTEVQETWYRADSPKLA  355

Query  1210  SKTIEDGFYNWFFDKHPINLID  1275
             +KTI     +WF+DK+P   ID
Sbjct  356   NKTIAKALGDWFYDKNPFQKID  377



>ref|XP_002867940.1| hypothetical protein ARALYDRAFT_492921 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44199.1| hypothetical protein ARALYDRAFT_492921 [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 140/361 (39%), Positives = 204/361 (57%), Gaps = 23/361 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT           V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  412   ESCSSRMKRELGST-FNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKP  585
              SC+ R     GS+ F    F F GI G   +T   FY WNR+ +RYCDG SF G+VE  
Sbjct  74    ASCNERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVEAV  133

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +P  KL++RGAR+++ V+D+LMAKGMK+A+N I +G SAG L  ++HCD F +  P+   
Sbjct  134   NPANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAS  193

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+  KD     Y ++ +S +VALH   KSLPV CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDITGGSYIESYYSKVVALHGSAKSLPVSCTSKMKPELCFFPQYVVP  253

Query  946   YVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIKN----RSSISPTDMALLQDFKKQIIS  1104
              +++PLF+ ++A+DS+Q++N     ++D  +  KN        S   +  +Q F+ Q++ 
Sbjct  254   SMRTPLFVINAAFDSWQIKNVLAPTAVDKGKQWKNCKLDLKKCSAAQLKTVQGFRDQMMR  313

Query  1105  ALPKPSAT--KGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLI  1272
             AL    +T  +G  + S   H    ++A +         +  I     NWF+ +     I
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGDKGPQVANTRIAKAVGNWFYGRSAFQKI  373

Query  1273  D  1275
             D
Sbjct  374   D  374



>gb|AAM65412.1| pectin acetylesterase [Arabidopsis thaliana]
Length=391

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/364 (36%), Positives = 207/364 (57%), Gaps = 21/364 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT   T      ++
Sbjct  24    VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTM  83

Query  412   ESCSSRMKRELGSTFNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKPD  588
             +  S  M ++ G         F GI G   +T   FY WNR+ +RYCDG SF GD+E  D
Sbjct  84    KGSSKLMNKDFG---------FSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVD  134

Query  589   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRV  768
             P  KL++RGAR+++ V+D+LMAKGM +A+N I +G SAG L  ++HCD+F S  PK  +V
Sbjct  135   PANKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDQFKSTLPKTAKV  194

Query  769   KCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  948
             KC+SD+  F+  KD     Y ++ ++ +VA H   KSLP  CTS M P  CF P+ + + 
Sbjct  195   KCVSDAGYFIHGKDITGGSYIQSYYAKVVATHGSAKSLPASCTSSMKPELCFFPQYVAKT  254

Query  949   VKSPLFIFHSAYDSFQVQNTF---SMDLYRAIK----NRSSISPTDMALLQDFKKQIISA  1107
             +++PLF+ ++A+DS+Q++N     S+D  +A K    +    +   +  +Q ++ Q+++A
Sbjct  255   LQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTVQGYRDQVLAA  314

Query  1108  LP--KPSATKGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLID  1275
             L   + + T G  + S   H    ++A +         +  +     +WFF++     +D
Sbjct  315   LAPVQSATTNGLFLDSCHAHCQGGSAATWSGDKGPTVANTKMAKAVGDWFFERSTFQNVD  374

Query  1276  PNNV  1287
              +++
Sbjct  375   CSSL  378



>ref|XP_011028482.1| PREDICTED: uncharacterized protein LOC105128479 isoform X2 [Populus 
euphratica]
Length=481

 Score =   251 bits (641),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 144/364 (40%), Positives = 213/364 (59%), Gaps = 25/364 (7%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             L +  T +  A  KGAVCLDGSPPAYH+  G     ++WLI+  GGGWC +         
Sbjct  107   LYVGITYVKSAVAKGAVCLDGSPPAYHWDKGSGTGINSWLIHFEGGGWCNN---------  157

Query  406   SVESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V SC SR K  LGS+  M     F GI      F   FY WNRV IRYCDG SF GDV+
Sbjct  158   -VTSCLSRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQ  216

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               +P T L++RGARI+  V+++L+ KG+K+A+N + +G SAGGL  ++HCD F +    G
Sbjct  217   AVNPATNLHFRGARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALLRMG  276

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKCLSD+  F+ VKD   A + +  F++IV LH   K+LP+ CTS + P  CF P+ +
Sbjct  277   TKVKCLSDAGYFIKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSMLKPSFCFFPQYV  336

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQI  1098
                V++PLFI ++AYDS+Q++N  +      + ++++ K + ++ SP  +  +QDF+ Q 
Sbjct  337   APQVRTPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQF  396

Query  1099  ISALPKP--SATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPI  1263
             ++AL     S+++G  + S + H   +   +K    DS     K I     +WF+D++P 
Sbjct  397   LNALKTSTNSSSRGLYIDSCYAHC-QTETQEKWFMEDSPVLGKKKIAKAVGDWFYDRNPF  455

Query  1264  NLID  1275
               ID
Sbjct  456   QKID  459



>emb|CDY09289.1| BnaC03g63190D [Brassica napus]
Length=397

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 146/399 (37%), Positives = 217/399 (54%), Gaps = 45/399 (11%)
 Frame = +1

Query  130   NDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHF  309
             N W+ L++ SL I              ++   LL+  T +  A  KGAVCLDGSPPAYH 
Sbjct  5     NQWLVLVVCSLAI--------------LKAEGLLVNITFVRNAVAKGAVCLDGSPPAYHL  50

Query  310   SPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAP-FVFKGI  486
               G     ++WLI L GGGWC +          V +C SRM  +LGS+  M     F  I
Sbjct  51    DRGSGTGINSWLIQLEGGGWCHN----------VTNCISRMHTKLGSSKKMVENLAFSAI  100

Query  487   FGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGM  663
                       FY WNRV +RYCDG SF GDV+  +P T L++RGAR++  V+ EL+AKGM
Sbjct  101   LSNKEQRNPDFYNWNRVKVRYCDGSSFTGDVKTVNPATNLHFRGARVWLAVMRELLAKGM  160

Query  664   KDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVF  843
             ++A+N + +G SAGGL  L+HCD F +  P G  VKCLSD+  FL  +D   A+Y K+ F
Sbjct  161   RNAENAVLSGCSAGGLASLMHCDSFRALLPMGTNVKCLSDAGFFLNTRDVSGAQYIKSYF  220

Query  844   SDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFS---  1014
             +D+V LH   K+LP  CTS+++P  CF P+ + + +++P+F+ ++AYDS+Q++N  +   
Sbjct  221   NDVVTLHGSAKNLPRSCTSRLTPAMCFFPQYVARQIRTPVFVLNAAYDSWQIKNILAPRA  280

Query  1015  -------MDLYRAIKNRSSISPTDMALLQDFKKQIISAL--PKPSATKGFIVTSNFGHSF  1167
                          IKN      + + ++QDF+ + +SA+     SA++G  + S + H  
Sbjct  281   ADPDGKWQSCQLDIKN---CQRSQLKVMQDFRLEFLSAVIGLGRSASRGMFIDSCYTHC-  336

Query  1168  ASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
              +       + DS      TI     +W +D++    ID
Sbjct  337   QTETQTSWFWQDSPILNRTTIAKAVGDWVYDRNLFQKID  375



>ref|XP_011028479.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
 ref|XP_011028480.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
 ref|XP_011028481.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
Length=509

 Score =   251 bits (642),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 144/364 (40%), Positives = 213/364 (59%), Gaps = 25/364 (7%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             L +  T +  A  KGAVCLDGSPPAYH+  G     ++WLI+  GGGWC +         
Sbjct  107   LYVGITYVKSAVAKGAVCLDGSPPAYHWDKGSGTGINSWLIHFEGGGWCNN---------  157

Query  406   SVESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V SC SR K  LGS+  M     F GI      F   FY WNRV IRYCDG SF GDV+
Sbjct  158   -VTSCLSRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQ  216

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               +P T L++RGARI+  V+++L+ KG+K+A+N + +G SAGGL  ++HCD F +    G
Sbjct  217   AVNPATNLHFRGARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALLRMG  276

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKCLSD+  F+ VKD   A + +  F++IV LH   K+LP+ CTS + P  CF P+ +
Sbjct  277   TKVKCLSDAGYFIKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSMLKPSFCFFPQYV  336

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQI  1098
                V++PLFI ++AYDS+Q++N  +      + ++++ K + ++ SP  +  +QDF+ Q 
Sbjct  337   APQVRTPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQF  396

Query  1099  ISALPKP--SATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPI  1263
             ++AL     S+++G  + S + H   +   +K    DS     K I     +WF+D++P 
Sbjct  397   LNALKTSTNSSSRGLYIDSCYAHC-QTETQEKWFMEDSPVLGKKKIAKAVGDWFYDRNPF  455

Query  1264  NLID  1275
               ID
Sbjct  456   QKID  459



>ref|XP_006413980.1| hypothetical protein EUTSA_v10025385mg [Eutrema salsugineum]
 gb|ESQ55433.1| hypothetical protein EUTSA_v10025385mg [Eutrema salsugineum]
Length=397

 Score =   248 bits (633),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 149/397 (38%), Positives = 216/397 (54%), Gaps = 45/397 (11%)
 Frame = +1

Query  136   WICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSP  315
             W+ LL+ SLVI              ++   L +  T +  A  KGAVCLDGSPPAYH   
Sbjct  7     WVFLLVCSLVI--------------LETEALYVNITFVRNAVAKGAVCLDGSPPAYHLDR  52

Query  316   GKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAP-FVFKGIFG  492
             G     ++WLI L GGGWC +          V +C SRM   LGS+  M     F  I  
Sbjct  53    GFGTGINSWLIQLEGGGWCNN----------VTNCVSRMHTRLGSSKRMVEKLAFSAILS  102

Query  493   INATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKD  669
                 +   FY WNRV +RYCDG SF GDV+  +P T L++RGAR++  V+ EL+AKGM +
Sbjct  103   NKRQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPATNLHFRGARVWLAVMQELLAKGMIN  162

Query  670   AKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSD  849
             A+N + +G SAGGL  L+HCD F +  P G +VKCLSD+  FL  +D   A+Y K+ F+D
Sbjct  163   AENAVLSGCSAGGLATLMHCDSFRALLPMGAKVKCLSDAGFFLNTRDVAGAQYIKSYFND  222

Query  850   IVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF---SMD  1020
             +V LH   K+LP  CTS+++P  CF P+ + + +++PLFI ++AYDS+Q++N     + D
Sbjct  223   VVTLHGSAKNLPRSCTSRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAAD  282

Query  1021  LYRA-------IKNRSSISPTDMALLQDFKKQIISAL--PKPSATKGFIVTSNFGHSFAS  1173
              Y         IKN     P  + ++QDF+ + + A+     S+++G  + S + H   +
Sbjct  283   PYGKWQSCQLDIKN---CQPNQLKVMQDFRLEFLRAVIGLGRSSSRGMFIDSCYTHC-QT  338

Query  1174  ADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
                    + DS      TI     +W +D+     ID
Sbjct  339   ETQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKID  375



>ref|XP_010439720.1| PREDICTED: uncharacterized protein LOC104723107 [Camelina sativa]
Length=391

 Score =   248 bits (632),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 140/361 (39%), Positives = 203/361 (56%), Gaps = 23/361 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT           V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  412   ESCSSRMKRELGST-FNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKP  585
              SC  R     GS+ F    F F GI G   +T   FY WNR+ +RYCDG SF G+V   
Sbjct  74    ASCIERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAV  133

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +P  KL++RGAR+++ VVD+LMAKGMK+A+N I +G SAG L  ++HCD F +  P+  R
Sbjct  134   NPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAR  193

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+  KD     Y ++ +S +VALH   KSLP+ CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKMKPELCFFPQYVVP  253

Query  946   YVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIKN----RSSISPTDMALLQDFKKQIIS  1104
              +++PLF+ ++A+DS+Q++N     ++D  +  KN        S   +  +Q F+ Q++ 
Sbjct  254   SMRTPLFVINAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCSAAQLKTVQGFRDQMMR  313

Query  1105  ALPKPSAT--KGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLI  1272
             AL    +T  +G  + S   H    ++A +         +  I     NWF+ +     I
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQVANTRISKAVGNWFYGRSAFQKI  373

Query  1273  D  1275
             D
Sbjct  374   D  374



>ref|NP_199341.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 dbj|BAB10249.1| pectin acetylesterase [Arabidopsis thaliana]
 gb|AAL15296.1| AT5g45280/K9E15_6 [Arabidopsis thaliana]
 gb|AED95226.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=391

 Score =   248 bits (632),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 130/364 (36%), Positives = 207/364 (57%), Gaps = 21/364 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT   T      ++
Sbjct  24    VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTM  83

Query  412   ESCSSRMKRELGSTFNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKPD  588
             +  S  M ++ G         F GI G   +T   FY WNR+ +RYCDG SF GD+E  D
Sbjct  84    KGSSKLMNKDFG---------FSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVD  134

Query  589   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRV  768
             P  KL++RGAR+++ V+D+LMAKGM +A+N I +G SAG L  ++HCD+F S  PK  +V
Sbjct  135   PTHKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDQFKSTLPKTAKV  194

Query  769   KCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  948
             KC+SD+  F+  KD     Y ++ ++ +VA H   KSLP  CTS M P  CF P+ + + 
Sbjct  195   KCVSDAGYFIHGKDITGGSYIQSYYAKVVATHGSAKSLPASCTSSMKPDLCFFPQYVAKT  254

Query  949   VKSPLFIFHSAYDSFQVQNTF---SMDLYRAIK----NRSSISPTDMALLQDFKKQIISA  1107
             +++PLF+ ++A+DS+Q++N     S+D  +A K    +    +   +  +Q ++ Q+++A
Sbjct  255   LQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTVQGYRDQVLAA  314

Query  1108  LP--KPSATKGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLID  1275
             L   + + T G  + S   H    ++A +         +  +     +WFF++     +D
Sbjct  315   LAPVRSATTNGLFLDSCHAHCQGGSAATWSGDKGPTVANTKMAKAVGDWFFERSTFQNVD  374

Query  1276  PNNV  1287
              +++
Sbjct  375   CSSL  378



>ref|XP_006280604.1| hypothetical protein CARUB_v10026563mg [Capsella rubella]
 gb|EOA13502.1| hypothetical protein CARUB_v10026563mg [Capsella rubella]
Length=391

 Score =   248 bits (632),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 131/364 (36%), Positives = 206/364 (57%), Gaps = 21/364 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT   T      ++
Sbjct  24    VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTM  83

Query  412   ESCSSRMKRELGSTFNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKPD  588
             +  S  M ++ G         F GI G   +T   FY WNR+ +RYCDG SF GD+E  D
Sbjct  84    KGSSKLMNKDFG---------FSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVD  134

Query  589   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRV  768
             P  KL++RGAR+++ V+D+LMAKGM +A+N I +G SAG L  ++HCD+F S  PK  +V
Sbjct  135   PTNKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDQFKSILPKTAKV  194

Query  769   KCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  948
             KC+SD+  F+  KD     Y ++ +  +VA H   KSLP  CTS M P  CF P+ + + 
Sbjct  195   KCVSDAGYFIHGKDISGGSYIQSYYGKVVATHGSAKSLPASCTSTMKPELCFFPQYVAKT  254

Query  949   VKSPLFIFHSAYDSFQVQNTF---SMDLYRAIK----NRSSISPTDMALLQDFKKQIISA  1107
             +++PLF+ ++A+DS+Q++N     S+D  +A K    +    + + +  +Q ++ Q+++A
Sbjct  255   LQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTASQLQTVQGYRDQVLAA  314

Query  1108  LP--KPSATKGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLID  1275
             L   +   T G  + S   H    ++A +         +  +     +WFF++     ID
Sbjct  315   LAPVRADTTSGLFLDSCHAHCQGGSAATWSGDKGPTVANTKMAKAVGDWFFERSTFQNID  374

Query  1276  PNNV  1287
              +++
Sbjct  375   CSSL  378



>ref|XP_008373439.1| PREDICTED: protein notum homolog isoform X2 [Malus domestica]
 ref|XP_008373440.1| PREDICTED: protein notum homolog isoform X2 [Malus domestica]
Length=438

 Score =   249 bits (635),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 148/398 (37%), Positives = 212/398 (53%), Gaps = 39/398 (10%)
 Frame = +1

Query  124   RSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAY  303
             R   W+ +L    V +V  + +  +P  I          T +  A  KGAVCLDGSPPAY
Sbjct  5     RLGQWLSVL----VCAVMLLKAAALPVGI----------TYVHSAVAKGAVCLDGSPPAY  50

Query  304   HFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNM-APFVFK  480
             H   G     +NWL+++ GGGWC +          + +C  R    LGS+  M     F 
Sbjct  51    HLDKGYGSGINNWLVHIEGGGWCNN----------ITTCLVRKNNRLGSSKKMLKEIAFS  100

Query  481   GIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAK  657
             GI      F   FY WNRV +RYCDG SF GDV   +  T L++RGARIF+ V++EL+AK
Sbjct  101   GILNSRHIFNPDFYNWNRVKVRYCDGASFTGDVAAVNLATGLFFRGARIFRAVIEELLAK  160

Query  658   GMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKA  837
             GM  AKN I +G SAGGL  ++HCD F +  P G +VKC+SD+  F+  KD   A++ + 
Sbjct  161   GMGKAKNAILSGCSAGGLASILHCDNFHALLPVGAKVKCVSDAGYFINAKDVSGARHVEQ  220

Query  838   VFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFS-  1014
              FS +VA H   K+LP  CTSK+SP  CF P+     +++P+F  ++AYDS+Q++N  + 
Sbjct  221   FFSQVVATHGSAKNLPPSCTSKLSPGLCFFPQYFASQIRTPMFYVNAAYDSWQIKNILAP  280

Query  1015  --MDLYRAIKNR----SSISPTDMALLQDFKKQIISALPKPSA--TKGFIVTSNFGHSFA  1170
                D +   +N     +   PT +  +QDF+ Q +SA+   S   +KG  + S + H   
Sbjct  281   GVADPHGTWQNCKLDITHCKPTQLKTMQDFRAQFLSAIGGVSGSRSKGMFIDSCYAHCQT  340

Query  1171  SADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
                 +  +  DS      TI     +WF+D+ P   ID
Sbjct  341   ELQ-ETWLMPDSPVLNKTTIAKAVGDWFYDRTPFQKID  377



>ref|XP_008355284.1| PREDICTED: uncharacterized protein LOC103418943 [Malus domestica]
Length=398

 Score =   248 bits (632),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 138/359 (38%), Positives = 208/359 (58%), Gaps = 25/359 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T++  A  KGAVCLDGS PAYHF  G     +NWL+++ GGGWC S          V +C
Sbjct  30    TLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHVEGGGWCNS----------VATC  79

Query  421   SSRMKRELGSTFNMAPFV-FKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
               R     GS+  M   + F G+ G    T   FY WNR+ +RYCDG SF GDVE  DP 
Sbjct  80    LDRKNNYRGSSTKMEKTMSFSGVLGNKQQTNPDFYNWNRIKVRYCDGSSFTGDVEAVDPA  139

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L++RGAR+F+ ++D+L+AKGMK+A+  + +G SAGGL  +++CD F S  P G +VKC
Sbjct  140   TNLHFRGARVFRAIIDDLLAKGMKNAQTALLSGCSAGGLASILNCDNFHSLLPVGTKVKC  199

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             L+D+  F+  K    ++Y +  +S++VALH   K+LP  CTS+MSP  CF P+N+V   +
Sbjct  200   LADAGYFINAKTVSGSQYIQTFYSEVVALHGSAKNLPASCTSRMSPGLCFFPQNVVPQTR  259

Query  955   SPLFIFHSAYDSFQVQNTFS---MDLYRAIKNR----SSISPTDMALLQDFKKQIISALP  1113
             +P+F  ++AYDS+Q++N  +    D   A KN      + SP+ +  +Q+++ Q ++A+ 
Sbjct  260   TPIFFVNAAYDSWQIKNILAPGVADPKGAWKNCKLSIKNCSPSQLQTMQEYRLQFLNAVA  319

Query  1114  KP--SATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
                 S++ G  + S + H       +  +  DS      TI     +W++D+ P   ID
Sbjct  320   GASSSSSNGLFIDSCYAHCQIGTQ-ETWLATDSPMLSKTTIAKAVGDWYYDRTPFKNID  377



>emb|CDX99378.1| BnaC01g11740D [Brassica napus]
Length=391

 Score =   247 bits (631),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 140/361 (39%), Positives = 202/361 (56%), Gaps = 23/361 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT           V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  412   ESCSSRMKRELGST-FNMAPFVFKGIFGINA-TFTKFYKWNRVIIRYCDGGSFAGDVEKP  585
              SC  R     GS+ F    F F GI G    T   FY WNR+ +RYCDG SF G+VE  
Sbjct  74    ASCIKRKGTMKGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGNVEAV  133

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +P  KL++RGAR+++ V+D+LMAKGMK+A+N I +G SAG L  ++HCD F +  P+  R
Sbjct  134   NPANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAR  193

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+  KD     Y ++ +S +VALH   KSLPV CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPVSCTSKMKPELCFFPQYVVP  253

Query  946   YVKSPLFIFHSAYDSFQVQNTFS---MDLYRAIKN----RSSISPTDMALLQDFKKQIIS  1104
              +++PLF+ ++A+DS+Q++N  +   +D  +   N        S   +  +Q F+ Q++ 
Sbjct  254   SMRTPLFVINAAFDSWQIKNVLAPTGVDKRKEWANCKLDLKKCSAAQLKTVQGFRDQMMR  313

Query  1105  ALPKPSAT--KGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLI  1272
             AL    +T  +G  + S   H    ++A +         +  I     NWF+ +     I
Sbjct  314   ALSPIHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQVANTKISKAVGNWFYGRSAFQKI  373

Query  1273  D  1275
             D
Sbjct  374   D  374



>gb|ABK24433.1| unknown [Picea sitchensis]
Length=399

 Score =   248 bits (632),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 137/365 (38%), Positives = 212/365 (58%), Gaps = 28/365 (8%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
              L+  T++  A  KGAVCLDGSPP YH S G     +NWL++  GG WC +         
Sbjct  29    FLVDLTLVEDAVAKGAVCLDGSPPGYHLSRGFGSGVNNWLVHFEGGSWCNN---------  79

Query  406   SVESCSSRMKRELGSTFNMAPFV-FKGIFGIN-ATFTKFYKWNRVIIRYCDGGSFAGDVE  579
              V +CS+R K  LGS+  M   V F G+ G N A    FY WNR+ +RYCDG SF GDVE
Sbjct  80    -VTTCSARTKTRLGSSKYMIKQVDFSGLLGNNKARNPDFYNWNRIKVRYCDGASFTGDVE  138

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               +PV KLY+RG R+F+ V+ +LMAKGM +A+  + +G SAGGL  ++HCD F +  PK 
Sbjct  139   AVNPVDKLYFRGQRVFKAVIGDLMAKGMINAQQAVISGCSAGGLTSILHCDNFRALMPKT  198

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKCL+D+  F+ VKD   A + ++ F+++  L Q  K+LP+ CT K+   +CF P+ L
Sbjct  199   TKVKCLADAGFFIDVKDVSGAYHIRSFFNEVATLQQSVKNLPLACTEKLGT-QCFFPQYL  257

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQI  1098
             + Y+++PLF+ ++ YDS+Q++N  +        L+   K +    SP  +  +Q F+ ++
Sbjct  258   LPYIQTPLFLLNAGYDSWQIKNIVAPGVADPHGLWHNCKLDIKKCSPNQLETMQGFRLEM  317

Query  1099  ISALP--KPSATKGFIVTSNFGHSFASADYKKRMFADSKSK----TIEDGFYNWFFDKHP  1260
             ++AL   + SA+ G  + S + H    ++ ++   A+   K    +I +   NW+F +  
Sbjct  318   LNALKIFQNSASGGMFINSCYAH--CQSEMQETWLANDSPKLNGLSIAEAVQNWYFGQGI  375

Query  1261  INLID  1275
             +   D
Sbjct  376   VKETD  380



>ref|XP_006283887.1| hypothetical protein CARUB_v10005004mg [Capsella rubella]
 gb|EOA16785.1| hypothetical protein CARUB_v10005004mg [Capsella rubella]
Length=391

 Score =   247 bits (631),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 140/361 (39%), Positives = 204/361 (57%), Gaps = 23/361 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT           V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  412   ESCSSRMKRELGST-FNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKP  585
              SC +R     GS+ F    F F GI G   +T   FY WNR+ +RYCDG SF G+V   
Sbjct  74    ASCLARKNTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAV  133

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +P  KL++RGAR+++ VVD+LMAKGMK+A+N I +G SAG L  ++HCD F +  P+  R
Sbjct  134   NPSNKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAR  193

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+  KD     Y ++ +S +VALH   KSLP+ CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPLSCTSKMKPELCFFPQYVVP  253

Query  946   YVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIKN----RSSISPTDMALLQDFKKQIIS  1104
              +++PLF+ ++A+DS+Q++N     ++D  +  KN        S   +  +Q F+ Q++ 
Sbjct  254   SMRTPLFVINAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCSAAQLRTVQGFRDQMMR  313

Query  1105  ALPKPSAT--KGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLI  1272
             AL    +T  +G  + S   H    ++A +         +  I     NWF+ +     I
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQVANTRIATAVGNWFYGRSAFQKI  373

Query  1273  D  1275
             D
Sbjct  374   D  374



>ref|XP_010244170.1| PREDICTED: uncharacterized protein LOC104588061 [Nelumbo nucifera]
Length=399

 Score =   247 bits (631),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 143/403 (35%), Positives = 221/403 (55%), Gaps = 43/403 (11%)
 Frame = +1

Query  115   VSPRSNDWICLLIFSLV-ISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGS  291
             ++ R+  WI +L+ +LV + V  VN               +  T +  A  KGAVCLDGS
Sbjct  2     INVRAVAWINILLCALVALKVNGVN---------------VGITYVETAVAKGAVCLDGS  46

Query  292   PPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNM-AP  468
             PPAYH   G     +NWL+++ GGGWC +          V +C +R    LGS+  M   
Sbjct  47    PPAYHLDKGFGSGINNWLVHIEGGGWCNN----------VTTCLARKNTRLGSSKQMLTE  96

Query  469   FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDE  645
               F GI      F   FY WNRV +RYCDG SF GDVE  DP T L+YRGAR++  V+++
Sbjct  97    IAFSGILSNKQQFNPDFYNWNRVKVRYCDGASFTGDVEAVDPTTNLHYRGARVWLAVIED  156

Query  646   LMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAK  825
             L+ KGMK+A+  + +G SAGGL  ++HCD F +  P GV+VKCL+D+  F+  KD    +
Sbjct  157   LLEKGMKNAEYALLSGCSAGGLTSILHCDSFRALLPMGVKVKCLADAGYFINAKDVSGTE  216

Query  826   YFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQN  1005
             + +A + D+V  H  +K+LP  CTS M P  CF P+ + Q +++PLF+ ++AYDS+Q++N
Sbjct  217   HIQAFYDDVVTTHGSSKNLPASCTSTMKPSMCFFPQYMEQGIRTPLFLLNAAYDSWQIKN  276

Query  1006  TFSMDL-------YRAIKNRSSISPTDMALLQDFKKQIISALP--KPSATKGFIVTSNFG  1158
               +  +       +    +  + SP+ +  +Q F+ + ++AL     S+ +G  + S + 
Sbjct  277   ILAPGVADPHGYWHNCKLDIKNCSPSQIQTMQGFRVEFLNALSGLGNSSPRGMFINSCYA  336

Query  1159  HSFASADYKKRMFADSK---SKT-IEDGFYNWFFDKHPINLID  1275
             H    ++ ++    D      KT I     +W++D+ P   ID
Sbjct  337   H--CQSEMQETWLRDDSPVLDKTPIAKAVGDWYYDRSPFQKID  377



>gb|KCW72723.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   247 bits (631),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 145/398 (36%), Positives = 218/398 (55%), Gaps = 39/398 (10%)
 Frame = +1

Query  124   RSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAY  303
             R   W+C+     ++S+Q          +I+     +  T +  A  KGAVCLDGSPPAY
Sbjct  5     RLRTWLCV-----ILSIQI---------LIKSEAFNVGITYVQNAVAKGAVCLDGSPPAY  50

Query  304   HFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMA-PFVFK  480
             HF  G    A+NWLI   GG WC +          V +C +R    LGS+  M     F 
Sbjct  51    HFDKGVGAGANNWLILFEGGAWCNN----------VTTCLARRDTRLGSSKQMVKELSFS  100

Query  481   GIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAK  657
             GI      F   FY WN++ +RYCDG SF GDVE  +P T L++RGAR F  +V++LM+K
Sbjct  101   GILSNKQKFNPDFYNWNKIKVRYCDGASFTGDVEAVNPATNLHFRGARAFVAIVEDLMSK  160

Query  658   GMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKA  837
             GM +A+N I AG SAGGL  +++CDRF +  P   +VKCL+D+  F+  KD   A + + 
Sbjct  161   GMSNAQNAILAGCSAGGLTAILNCDRFRALVPARTKVKCLADAGYFINAKDVSGASHIEN  220

Query  838   VFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFSM  1017
              +S++VA H   K+LP  CTSKM P  CF P+N+V  +++PLFI ++AYDS+Q++N  + 
Sbjct  221   FYSEVVATHGSAKNLPTSCTSKMKPGLCFFPQNVVPQIQTPLFIINAAYDSWQIKNILAP  280

Query  1018  DL------YRAIK-NRSSISPTDMALLQDFKKQIISALPK--PSATKGFIVTSNFGHSFA  1170
              +      +R+ K +    SP  + ++QDF+ + + AL     S ++G  + S + H  A
Sbjct  281   GVADRHGTWRSCKLDIKKCSPNQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCYAHCQA  340

Query  1171  SADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
                 +  +  DS      +I     +W++++     ID
Sbjct  341   GTQ-ETWLRNDSPVVAKTSIAKAVGDWYYERITSQKID  377



>ref|XP_010529277.1| PREDICTED: protein notum homolog [Tarenaya hassleriana]
Length=401

 Score =   247 bits (631),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 140/373 (38%), Positives = 205/373 (55%), Gaps = 31/373 (8%)
 Frame = +1

Query  208   IIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDT  387
             +++   L +  T +  A  KGAVCLDGSPPAYH   G     +NWLI L GGGWC +   
Sbjct  19    LLRTEGLFVNITYVKTAMAKGAVCLDGSPPAYHLDKGSGTGINNWLIQLEGGGWCNN---  75

Query  388   YSTHDLSVESCSSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGS  561
                    V +C +RM   LGS+  MA    F  I      +   FY WNRV IRYCDG S
Sbjct  76    -------VTNCIARMHTRLGSSKQMAKQIAFSAILSNRKQYNPDFYNWNRVKIRYCDGSS  128

Query  562   FAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFT  741
             F GDV+  DP T L++RGAR++  V+++L+AKGM +A+N + +G SAGGL  ++HCD F 
Sbjct  129   FTGDVQTVDPATNLHFRGARVWLAVMEDLLAKGMINAENAVLSGCSAGGLASMLHCDSFR  188

Query  742   SRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFEC  921
             +  P G +VKCLSD+  F+  +D    +Y +  F D+V LH   K+LP  CTSK++P  C
Sbjct  189   ALLPMGTKVKCLSDAGFFVNTRDVSGVQYIRQYFKDVVTLHGSAKNLPPSCTSKLNPALC  248

Query  922   FQPKNLVQYVKSPLFIFHSAYDSFQVQNTFS----------MDLYRAIKNRSSISPTDMA  1071
             F P+ + + +++PLF+ ++AYDS+Q++N  +                IKN     P  + 
Sbjct  249   FFPQYVARRIRTPLFLLNAAYDSWQIKNILAPRAADPNGKWQSCELDIKN---CQPNQIK  305

Query  1072  LLQDFKKQIISALP--KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFY  1236
             ++QDF+ Q +SA+     S ++G  + S + H   +       + DS      TI     
Sbjct  306   VMQDFRLQFLSAVTGLGKSPSRGMFIVSCYTHC-QTETQTSWFWTDSPRLNRTTIARAVG  364

Query  1237  NWFFDKHPINLID  1275
             +W +D+     ID
Sbjct  365   DWVYDRKLFQKID  377



>gb|ABK24994.1| unknown [Picea sitchensis]
Length=399

 Score =   247 bits (631),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 137/365 (38%), Positives = 212/365 (58%), Gaps = 28/365 (8%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
              L+  T++  A  KGAVCLDGSPP YH S G     +NWL++  GG WC +         
Sbjct  29    FLVDLTLVEDAVAKGAVCLDGSPPGYHLSRGFGSGVNNWLVHFEGGSWCNN---------  79

Query  406   SVESCSSRMKRELGSTFNMAPFV-FKGIFGIN-ATFTKFYKWNRVIIRYCDGGSFAGDVE  579
              V +CS+R K  LGS+  M   V F G+ G N A    FY WNR+ +RYCDG SF GDVE
Sbjct  80    -VTTCSARTKTRLGSSKYMIKQVDFSGLLGNNKARNPDFYNWNRIKVRYCDGASFTGDVE  138

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               +PV KLY+RG R+F+ V+ +LMAKGM +A+  + +G SAGGL  ++HCD F +  PK 
Sbjct  139   AVNPVDKLYFRGQRVFKAVIGDLMAKGMINAQQAVISGCSAGGLTSILHCDNFRALMPKT  198

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKCL+D+  F+ VKD   A + ++ F+++  L Q  K+LP+ CT K+   +CF P+ L
Sbjct  199   TKVKCLADAGFFIDVKDVSGAYHIRSFFNEVATLQQSVKNLPLACTEKLGT-QCFFPQYL  257

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQI  1098
             + Y+++PLF+ ++ YDS+Q++N  +        L+   K +    SP  +  +Q F+ ++
Sbjct  258   LPYIQTPLFLLNAGYDSWQIKNIVAPGVADPHGLWHNCKLDIKKCSPNQLETMQGFRLEM  317

Query  1099  ISALP--KPSATKGFIVTSNFGHSFASADYKKRMFADSKSK----TIEDGFYNWFFDKHP  1260
             ++AL   + SA+ G  + S + H    ++ ++   A+   K    +I +   NW+F +  
Sbjct  318   LNALKIFQNSASGGMFINSCYAH--CQSEMQETWLANDSPKLNGLSIAEAVQNWYFGQGI  375

Query  1261  INLID  1275
             +   D
Sbjct  376   VKETD  380



>emb|CAD41867.2| OSJNBa0041A02.14 [Oryza sativa Japonica Group]
 emb|CAH67867.1| B0403H10-OSIGBa0105A11.19 [Oryza sativa Indica Group]
Length=396

 Score =   247 bits (631),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 147/402 (37%), Positives = 215/402 (53%), Gaps = 34/402 (8%)
 Frame = +1

Query  109   MAVSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDG  288
             MA S  S +W+      LV+ +   +S         D+D++  K+ +      GAVCLDG
Sbjct  1     MAAS--SGEWLSRAAMVLVLGLVVASSAKA-----GDVDMVFLKSAV----STGAVCLDG  49

Query  289   SPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAP  468
             SPP YHFSPG    A+NWL+++ GGGWC +           + CS R     GS+  M P
Sbjct  50    SPPVYHFSPGSGSGANNWLVHMEGGGWCRN----------AQECSVRQGNFRGSSKFMRP  99

Query  469   FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDE  645
               F GI G N      FY WNR+ +RYCDG SF GDVE  +  T L++RGAR++  ++++
Sbjct  100   LSFSGIIGGNQRNNPDFYNWNRIKVRYCDGSSFTGDVETVETSTNLHFRGARVWNAIIED  159

Query  646   LMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAK  825
             L+AKGM  A+N + +G SAGGL  ++HCD+F    P    VKC SD+  F+  KD     
Sbjct  160   LLAKGMSKAQNALLSGCSAGGLAAILHCDQFRDLLPATANVKCFSDAGFFVDGKDITGND  219

Query  826   YFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQN  1005
             + +  + D+V LH   K+LP  CTSKMSP  CF P+N+V  +++PLFI ++AYD++Q++N
Sbjct  220   FVRTFYKDVVNLHGSAKNLPSSCTSKMSPDLCFFPQNVVPTLRTPLFILNAAYDAWQIKN  279

Query  1006  TFSMDLYRAIK-------NRSSISPTDMALLQDFKKQIISALPKPS---ATKGFIVTSNF  1155
               +       K       + ++ S + +  LQ+F+   ++ALPKP    A     + S +
Sbjct  280   VLAPSAADKKKTWAKCKLDITACSSSQLTTLQNFRTDFLAALPKPEQSPANLSIFIDSCY  339

Query  1156  GH-SFASADYKKRMFADSKSKT-IEDGFYNWFFDKHPINLID  1275
              H    S D      +    KT I     +WF D+     ID
Sbjct  340   AHCQSGSQDTWLAQGSPVVEKTQIGKAVGDWFHDREVSRRID  381



>ref|XP_006398195.1| hypothetical protein EUTSA_v10000914mg [Eutrema salsugineum]
 gb|ESQ39648.1| hypothetical protein EUTSA_v10000914mg [Eutrema salsugineum]
Length=391

 Score =   247 bits (630),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 132/361 (37%), Positives = 203/361 (56%), Gaps = 23/361 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT           +
Sbjct  24    VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTD----------I  73

Query  412   ESCSSRMKRELGST-FNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKP  585
              +C  R     GS+ F    F F GI G   +T   FY WNR+ +RYCDG SF GD+E  
Sbjct  74    ATCVKRKSTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAV  133

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             DP  KL++RGAR+++ V+D+LMAKGM +A+N I +G SAG L  ++HCD F S  PK  +
Sbjct  134   DPTNKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDEFKSIIPKTAK  193

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+  KD     Y ++ +  +VA H   KSLPV CTS M P  CF P+ +V+
Sbjct  194   VKCVSDAGFFIHGKDISGGSYIESYYGKVVATHGSAKSLPVSCTSSMKPELCFFPQYVVK  253

Query  946   YVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIK----NRSSISPTDMALLQDFKKQIIS  1104
              +++PLF+ ++A+DS+Q++N     S+D  +  K    +    +   +  +Q ++ Q+++
Sbjct  254   TMQTPLFVINAAFDSWQIKNVLAPTSVDKRKEWKTCKLDLKKCTAAQLQTVQGYRDQMLA  313

Query  1105  ALP--KPSATKGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLI  1272
             AL   + + T+G  + S   H    ++A +            +     +WF+++     +
Sbjct  314   ALAPVRATTTRGLFLDSCHAHCQGGSAATWSGAQGPQVGDTKMAKAVGDWFYERSTFQNV  373

Query  1273  D  1275
             D
Sbjct  374   D  374



>ref|XP_010056136.1| PREDICTED: protein notum homolog [Eucalyptus grandis]
 gb|KCW72724.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
 gb|KCW72725.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=399

 Score =   247 bits (631),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 145/398 (36%), Positives = 218/398 (55%), Gaps = 39/398 (10%)
 Frame = +1

Query  124   RSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAY  303
             R   W+C+     ++S+Q          +I+     +  T +  A  KGAVCLDGSPPAY
Sbjct  5     RLRTWLCV-----ILSIQI---------LIKSEAFNVGITYVQNAVAKGAVCLDGSPPAY  50

Query  304   HFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMA-PFVFK  480
             HF  G    A+NWLI   GG WC +          V +C +R    LGS+  M     F 
Sbjct  51    HFDKGVGAGANNWLILFEGGAWCNN----------VTTCLARRDTRLGSSKQMVKELSFS  100

Query  481   GIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAK  657
             GI      F   FY WN++ +RYCDG SF GDVE  +P T L++RGAR F  +V++LM+K
Sbjct  101   GILSNKQKFNPDFYNWNKIKVRYCDGASFTGDVEAVNPATNLHFRGARAFVAIVEDLMSK  160

Query  658   GMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKA  837
             GM +A+N I AG SAGGL  +++CDRF +  P   +VKCL+D+  F+  KD   A + + 
Sbjct  161   GMSNAQNAILAGCSAGGLTAILNCDRFRALVPARTKVKCLADAGYFINAKDVSGASHIEN  220

Query  838   VFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFSM  1017
              +S++VA H   K+LP  CTSKM P  CF P+N+V  +++PLFI ++AYDS+Q++N  + 
Sbjct  221   FYSEVVATHGSAKNLPTSCTSKMKPGLCFFPQNVVPQIQTPLFIINAAYDSWQIKNILAP  280

Query  1018  DL------YRAIK-NRSSISPTDMALLQDFKKQIISALPK--PSATKGFIVTSNFGHSFA  1170
              +      +R+ K +    SP  + ++QDF+ + + AL     S ++G  + S + H  A
Sbjct  281   GVADRHGTWRSCKLDIKKCSPNQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCYAHCQA  340

Query  1171  SADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
                 +  +  DS      +I     +W++++     ID
Sbjct  341   GTQ-ETWLRNDSPVVAKTSIAKAVGDWYYERLTFQKID  377



>ref|XP_004300392.1| PREDICTED: protein notum homolog [Fragaria vesca subsp. vesca]
Length=394

 Score =   247 bits (630),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 142/381 (37%), Positives = 210/381 (55%), Gaps = 37/381 (10%)
 Frame = +1

Query  202   TPIIQDLDLL------IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGG  363
             +P++  L LL      +  T++  A  KGAVCLDGSPPAYHF  G     +NWL+++ GG
Sbjct  11    SPLVCLLILLKAESHPVELTLVQSAVAKGAVCLDGSPPAYHFDKGFGAGINNWLVHIEGG  70

Query  364   GWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVI  537
             GWC            VESC  R K   GS+ +M   + F G+ G   T    FY WNR+ 
Sbjct  71    GWCKD----------VESCVERTKNFRGSSKHMEKTISFSGVLGKKETLNPDFYNWNRIK  120

Query  538   IRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgv  717
             +RYCDG SF GDVE  +P T L++RG R+F  V+D+L+AKGM +AKN + +G SAGGL  
Sbjct  121   VRYCDGSSFTGDVEAVNPATNLHFRGGRVFLAVIDDLLAKGMMNAKNALLSGCSAGGLAS  180

Query  718   lvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECT  897
             ++ CD F S  P G  VKCL+D+  F+  K    ++  +A +S +VALH   K LP  CT
Sbjct  181   ILQCDNFRSLLPAGTNVKCLADAGYFINAKSISGSQQIEAFYSQVVALHGSAKHLPASCT  240

Query  898   SKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFS----------MDLYRAIKNRS  1047
             S+++P  CF P+N+V  +++P+F+ ++AYDS+Q++N  +                IKN  
Sbjct  241   SRLNPGLCFFPQNVVPTLRTPIFLVNAAYDSWQIKNILAPSAADPKGSWKSCKMGIKN--  298

Query  1048  SISPTDMALLQDFKKQIISALPK--PSATKGFIVTSNFGHSFASADYKKRMFADS---KS  1212
               SP  +  +QD++   ++ L     S + G  + S + H       +  + ADS     
Sbjct  299   -CSPAQIQTMQDYRTTFLNVLNGGLTSPSHGAFIDSCYAHCQIGTQ-ETWLAADSPVVGK  356

Query  1213  KTIEDGFYNWFFDKHPINLID  1275
              TI     +W++++ P   ID
Sbjct  357   TTIAKAVGDWYYNRSPSKKID  377



>ref|NP_001053773.1| Os04g0602500 [Oryza sativa Japonica Group]
 dbj|BAF15687.1| Os04g0602500 [Oryza sativa Japonica Group]
 dbj|BAG93730.1| unnamed protein product [Oryza sativa Japonica Group]
Length=466

 Score =   249 bits (636),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 146/405 (36%), Positives = 217/405 (54%), Gaps = 32/405 (8%)
 Frame = +1

Query  100   SLRMAVSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVC  279
             S  +A++  S +W+      LV+ +   +S         D+D++  K+ +      GAVC
Sbjct  66    SSTLAMAASSGEWLSRAAMVLVLGLVVASSAKA-----GDVDMVFLKSAV----STGAVC  116

Query  280   LDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFN  459
             LDGSPP YHFSPG    A+NWL+++ GGGWC +           + CS R     GS+  
Sbjct  117   LDGSPPVYHFSPGSGSGANNWLVHMEGGGWCRN----------AQECSVRQGNFRGSSKF  166

Query  460   MAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVV  636
             M P  F GI G N      FY WNR+ +RYCDG SF GDVE  +  T L++RGAR++  +
Sbjct  167   MRPLSFSGIIGGNQRNNPDFYNWNRIKVRYCDGSSFTGDVETVETSTNLHFRGARVWNAI  226

Query  637   VDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPE  816
             +++L+AKGM  A+N + +G SAGGL  ++HCD+F    P    VKC SD+  F+  KD  
Sbjct  227   IEDLLAKGMSKAQNALLSGCSAGGLAAILHCDQFRDLLPATANVKCFSDAGFFVDGKDIT  286

Query  817   RAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQ  996
                + +  + D+V LH   K+LP  CTSKMSP  CF P+N+V  +++PLFI ++AYD++Q
Sbjct  287   GNDFVRTFYKDVVNLHGSAKNLPSSCTSKMSPDLCFFPQNVVPTLRTPLFILNAAYDAWQ  346

Query  997   VQNTFSMDLYRAIK-------NRSSISPTDMALLQDFKKQIISALPKPS---ATKGFIVT  1146
             ++N  +       K       + ++ S + +  LQ+F+   ++ALPKP    A     + 
Sbjct  347   IKNVLAPSAADKKKTWAKCKLDITACSSSQLTTLQNFRTDFLAALPKPEQSPANLSIFID  406

Query  1147  SNFGH-SFASADYKKRMFADSKSKT-IEDGFYNWFFDKHPINLID  1275
             S + H    S D      +    KT I     +WF D+     ID
Sbjct  407   SCYAHCQSGSQDTWLAQGSPVVEKTQIGKAVGDWFHDREVSRRID  451



>ref|XP_010494620.1| PREDICTED: uncharacterized protein LOC104771742 [Camelina sativa]
Length=391

 Score =   247 bits (630),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 130/364 (36%), Positives = 206/364 (57%), Gaps = 21/364 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT   T      ++
Sbjct  24    VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTM  83

Query  412   ESCSSRMKRELGSTFNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKPD  588
             +  S  M ++ G         F GI G   +T   FY WNR+ +RYCDG SF GD+E  D
Sbjct  84    KGSSKLMNKDFG---------FSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVD  134

Query  589   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRV  768
             P  KL++RGAR+++ V+D+LMAKGM +A+N I +G SAG L  ++HCD+F S  PK  +V
Sbjct  135   PANKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDQFKSILPKTAKV  194

Query  769   KCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  948
             KC+SD+  F+  KD     Y ++ +  +VA H   KSLP  CTS M P  CF P+ + + 
Sbjct  195   KCVSDAGYFIHGKDISGGSYIQSYYGKVVATHGSAKSLPASCTSTMKPELCFFPQYVAKT  254

Query  949   VKSPLFIFHSAYDSFQVQNTF---SMDLYRAIK----NRSSISPTDMALLQDFKKQIISA  1107
             +++PLF+ ++A+DS+Q++N     S+D  +A K    +    +   +  +Q ++ Q+++A
Sbjct  255   LQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTVQGYRDQVLAA  314

Query  1108  LP--KPSATKGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLID  1275
             L   + + T G  + S   H    ++A +         +  +     +WF+++     ID
Sbjct  315   LAPVRAATTSGLFLDSCHAHCQGGSAATWSGDKGPTVANTKMAKAVGDWFYERSTFQNID  374

Query  1276  PNNV  1287
              +++
Sbjct  375   CSSL  378



>emb|CDY26383.1| BnaA02g23870D [Brassica napus]
Length=391

 Score =   247 bits (630),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 129/360 (36%), Positives = 205/360 (57%), Gaps = 21/360 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT   T      ++
Sbjct  24    VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVKRKTTM  83

Query  412   ESCSSRMKRELGSTFNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKPD  588
             +  S  M ++ G         F GI G   +T   FY WNR+ +RYCDG SF GD+E  D
Sbjct  84    KGSSKFMNKDFG---------FSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVD  134

Query  589   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRV  768
             P  KL++RGAR+++ V+D+LMAKGM +A+N I +G SAG L  ++HCD+F S  P   +V
Sbjct  135   PTNKLFFRGARVWRAVIDDLMAKGMNNAQNAILSGCSAGALAAILHCDQFKSILPTTAKV  194

Query  769   KCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  948
             KC+SD+  F+  KD     Y ++ +S +V+ H   KSLP  CTS M P  CF P+ +V+ 
Sbjct  195   KCVSDAGFFIHGKDISGGSYIESYYSKVVSTHGSAKSLPASCTSSMKPELCFFPQYVVKT  254

Query  949   VKSPLFIFHSAYDSFQVQNTF---SMDLYRAIK----NRSSISPTDMALLQDFKKQIISA  1107
             +++PLF+ ++A+DS+Q++N     S+D  +  K    +    +   +  +Q+++ Q+++A
Sbjct  255   MQTPLFVINAAFDSWQIKNVLAPTSVDKRKEWKDCKLDLKKCTAAQLQTVQEYRDQMLAA  314

Query  1108  LP--KPSATKGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLID  1275
             L   + + T+G  + S   H    ++A +         +  +     +WF+++     ID
Sbjct  315   LAPVRATTTRGLFLDSCHAHCQGGSAATWSGAQGPQVGNTKMAKAVGDWFYERSTFQNID  374



>ref|XP_009132784.1| PREDICTED: uncharacterized protein LOC103857370 [Brassica rapa]
Length=391

 Score =   247 bits (630),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 139/361 (39%), Positives = 202/361 (56%), Gaps = 23/361 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT           V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  412   ESCSSRMKRELGST-FNMAPFVFKGIFGINA-TFTKFYKWNRVIIRYCDGGSFAGDVEKP  585
              SC  R     GS+ F    F F GI G    T   FY WNR+ +RYCDG SF G+VE  
Sbjct  74    ASCIKRKGTMKGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGNVEAV  133

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +P  KL++RGAR+++ V+D+LMAKGMK+A+N I +G SAG L  ++HCD F +  P+  R
Sbjct  134   NPANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAR  193

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+  KD     Y ++ +S +VALH   KSLP+ CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKMKPELCFFPQYVVP  253

Query  946   YVKSPLFIFHSAYDSFQVQNTFS---MDLYRAIKN----RSSISPTDMALLQDFKKQIIS  1104
              +++PLF+ ++A+DS+Q++N  +   +D  +   N        S   +  +Q F+ Q++ 
Sbjct  254   SMRTPLFVINAAFDSWQIKNVLAPTGVDKRKEWANCKLDLKKCSAAQLRTVQGFRDQMMR  313

Query  1105  ALPKPSAT--KGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLI  1272
             AL    +T  +G  + S   H    ++A +         +  I     NWF+ +     I
Sbjct  314   ALSPIHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQVANTKISKAVGNWFYGRSAFQKI  373

Query  1273  D  1275
             D
Sbjct  374   D  374



>ref|XP_009398466.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398467.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398468.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398469.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=395

 Score =   246 bits (629),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 140/360 (39%), Positives = 208/360 (58%), Gaps = 28/360 (8%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYH SPG     +NWL++L GGGWC +          + +C
Sbjct  29    TYVESAIPKGAVCLDGSPPAYHLSPGFGSGVNNWLVHLEGGGWCNN----------ITTC  78

Query  421   SSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              +R    LGS+  MA    F GI     +F   FY WN+V +RYCDG SF GDVE+ DP 
Sbjct  79    LARKNTRLGSSGQMAKQLAFSGILSNTQSFNPDFYNWNKVKVRYCDGSSFTGDVERVDPA  138

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L+YRGAR++  V++EL+A+GM  A+N + +G SAGGL  ++HCD F +  P   +VKC
Sbjct  139   TNLHYRGARVWLAVMEELLARGMSKAENALLSGCSAGGLASILHCDSFRNLLPASAKVKC  198

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             LSD+  F+ VKD   A++ KA ++D+V  H   K+LP+ CTS + P  CF P+ + Q ++
Sbjct  199   LSDAGYFINVKDISGAEHIKAFYNDVVTTHGSAKNLPL-CTSMIEPGMCFFPQYMAQEIE  257

Query  955   SPLFIFHSAYDSFQVQNTF---SMDLYRAIKNR----SSISPTDMALLQDFKKQIISA--  1107
             SPLFI ++AYDS+Q++N       D + +  N        S   + ++Q+F+ + ++A  
Sbjct  258   SPLFILNAAYDSWQIKNILVPTVADRHGSWHNCKLDIKLCSSAQLQIMQEFRLEFLNAVN  317

Query  1108  -LPKPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
              L  PS ++G  + S + H   S   +  +  +S       I +   +WF+++     ID
Sbjct  318   GLGTPS-SRGLFINSCYAHC-QSEMQETWLLPNSPMLDKIPIAEAVGDWFYNRSAFQKID  375



>ref|XP_007209211.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 ref|XP_007209212.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 gb|EMJ10410.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 gb|EMJ10411.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
Length=400

 Score =   247 bits (630),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 141/389 (36%), Positives = 209/389 (54%), Gaps = 35/389 (9%)
 Frame = +1

Query  151   IFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDED  330
             +F L  +V  + +  +P  I          T +  A  KGAVCLDGSPPAYH   G    
Sbjct  10    LFLLACAVTLLKAAGVPVEI----------TYVHSAIAKGAVCLDGSPPAYHHDKGFGSG  59

Query  331   ASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNM-APFVFKGIFGINATF  507
              +NWL+++ GGGWC +          V +C  R    LGS+  M     F GI      F
Sbjct  60    INNWLVHIEGGGWCNN----------VTNCLGRKNTRLGSSKQMLKAIAFSGILSNRKMF  109

Query  508   T-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVI  684
                FY WNR+ +RYCDG SF GDV   +P T LY+RGARIF+ V+++L+AKGM +A+N I
Sbjct  110   NPDFYNWNRIKVRYCDGASFTGDVAAVNPATGLYFRGARIFRAVIEDLLAKGMGNAQNAI  169

Query  685   FaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALH  864
              +G SAGGL  ++HCD F +  P G  VKC+SD+  F+ VKD   A++ + +FS +V  H
Sbjct  170   LSGCSAGGLTSILHCDNFHALLPAGTNVKCVSDAGYFINVKDVSGAQHIEELFSQVVETH  229

Query  865   QPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFSMDL-------  1023
                ++LP  CTSK+ P  CF P+ +   +++ +F  ++AYDS+Q++N  +  +       
Sbjct  230   GSARNLPPSCTSKLRPGLCFFPQYMASQIQTRIFFVNAAYDSWQIKNILAPGVADPHGTW  289

Query  1024  YRAIKNRSSISPTDMALLQDFKKQIISALPKPSAT--KGFIVTSNFGHSFASADYKKRMF  1197
             +    +  + SPT +  +QDF+ Q +SA+   +    KG  + S + H       +  + 
Sbjct  290   HECKLDIKNCSPTQLKAMQDFRVQFLSAVGGMTGCPLKGMFIDSCYAHCQTEMQ-ETWLM  348

Query  1198  ADS---KSKTIEDGFYNWFFDKHPINLID  1275
             ADS      TI     +WF+ + P   ID
Sbjct  349   ADSPVLNKTTIAQAVGDWFYGRTPFQKID  377



>ref|NP_001151183.1| LOC100284816 precursor [Zea mays]
 gb|ACG41900.1| carboxylic ester hydrolase [Zea mays]
Length=398

 Score =   246 bits (629),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 140/365 (38%), Positives = 201/365 (55%), Gaps = 27/365 (7%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
              L+  T +  A  KGAVCLDGS PAYH + G     ++WL++  GGGWC +         
Sbjct  26    FLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSGENSWLVHFEGGGWCNN---------  76

Query  406   SVESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V +C  R +  LGS+  MA    F GI          FY WN+V +RYCDG SF GDVE
Sbjct  77    -VTTCLQRKRTRLGSSKEMATQIAFSGILSDTPDDNPDFYNWNKVKVRYCDGSSFTGDVE  135

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
             + DP TKL+YRGARI+Q V+D+L+AKGM  A+N + +G SAGGL  ++HCDRF    P  
Sbjct  136   EVDPATKLHYRGARIWQAVMDDLLAKGMDKAENALISGCSAGGLTSILHCDRFHDLLPPA  195

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              RVKCLSD+  F+  KD     Y  A F+D+V  H   K+LP  CTS + P  CF P+N 
Sbjct  196   ARVKCLSDAGFFINEKDVAGVGYIAAFFNDVVTTHGSAKNLPPSCTSTLPPGTCFFPQNE  255

Query  940   VQYVKSPLFIFHSAYDSFQVQNTF-------SMDLYRAIKNRSSISPTDMALLQDFKKQI  1098
             V+ +++PLFI ++AYDS+QV+N             +    +    S + + +LQ F+   
Sbjct  256   VKQIQTPLFILNAAYDSWQVRNILVPGVADPHGKWHSCKHDIDQCSASQLRVLQGFRGDF  315

Query  1099  ISALPK--PSATKGFIVTSNFGHSFASADYKKRMFADSK----SKTIEDGFYNWFFDKHP  1260
             +  + +   S ++G  + S F H    ++ ++  F+       + T+ +   +WFFD+  
Sbjct  316   LKEVAELGNSDSRGLFINSCFVH--CQSEIQELWFSSDSPVLGNTTVANAVGDWFFDRSS  373

Query  1261  INLID  1275
                ID
Sbjct  374   FQKID  378



>ref|XP_010441760.1| PREDICTED: uncharacterized protein LOC104724893 [Camelina sativa]
Length=391

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/364 (36%), Positives = 206/364 (57%), Gaps = 21/364 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT   T      ++
Sbjct  24    VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTM  83

Query  412   ESCSSRMKRELGSTFNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKPD  588
             +  S  M ++ G         F GI G   +T   FY WNR+ +RYCDG SF GD+E  D
Sbjct  84    KGSSKLMNKDFG---------FSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVD  134

Query  589   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRV  768
             P  KL++RGAR+++ V+D+LMAKGM +A+N I +G SAG L  ++HCD+F S  PK  +V
Sbjct  135   PANKLFFRGARVWRAVIDDLMAKGMNNAQNAILSGCSAGALAAILHCDQFKSILPKTAKV  194

Query  769   KCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  948
             KC+SD+  F+  KD     Y ++ +  +VA H   KSLP  CTS M P  CF P+ + + 
Sbjct  195   KCVSDAGYFIHGKDISGGSYIQSYYGKVVATHGSAKSLPASCTSTMKPELCFFPQYVAKA  254

Query  949   VKSPLFIFHSAYDSFQVQNTF---SMDLYRAIK----NRSSISPTDMALLQDFKKQIISA  1107
             +++PLF+ ++A+DS+Q++N     S+D  +A K    +    +   +  +Q ++ Q+++A
Sbjct  255   LQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTVQGYRDQVLAA  314

Query  1108  LP--KPSATKGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLID  1275
             L   + + T G  + S   H    ++A +         +  +     +WF+++     ID
Sbjct  315   LAPVRAATTSGLFLDSCHAHCQGGSAATWSGDKGPTVANTKMAKAVGDWFYERSTFQNID  374

Query  1276  PNNV  1287
              +++
Sbjct  375   CSSL  378



>emb|CDX78932.1| BnaA01g09990D [Brassica napus]
Length=391

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 139/361 (39%), Positives = 201/361 (56%), Gaps = 23/361 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT           V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  412   ESCSSRMKRELGST-FNMAPFVFKGIFGINA-TFTKFYKWNRVIIRYCDGGSFAGDVEKP  585
              SC  R     GS+ F    F F GI G    T   FY WNR+ +RYCDG SF G+VE  
Sbjct  74    ASCIKRKGTMKGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGNVEAV  133

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +P  KL++RGAR+++ V+D+LMAKGMK+A+N I +G SAG L  ++HCD F +  P+  R
Sbjct  134   NPANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAR  193

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+  KD     Y ++ +S +VALH   KSLP+ CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKMKPELCFFPQYVVP  253

Query  946   YVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIKN----RSSISPTDMALLQDFKKQIIS  1104
              +++PLF+ ++A+DS+Q++N      +D  +   N        S   +  +Q F+ Q++ 
Sbjct  254   SMRTPLFVINAAFDSWQIKNVLVPTGVDKRKEWANCKLDLKKCSAAQLRTVQGFRDQMMR  313

Query  1105  ALPKPSAT--KGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLI  1272
             AL    +T  +G  + S   H    ++A +         +  I     NWF+ +     I
Sbjct  314   ALSPIHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQVANTKISKAVGNWFYGRSAFQKI  373

Query  1273  D  1275
             D
Sbjct  374   D  374



>ref|XP_002867938.1| pectinacetylesterase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44197.1| pectinacetylesterase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=380

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 142/367 (39%), Positives = 205/367 (56%), Gaps = 31/367 (8%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             L +  T +  A  KGAVCLDGSPPAYH   G     ++WLI L GGGWC +         
Sbjct  6     LFVNITYVRNAVAKGAVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCNN---------  56

Query  406   SVESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V +C SRM   LGS+  M     F  I      +   FY WNRV +RYCDG SF GDV+
Sbjct  57    -VTNCVSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVKVRYCDGSSFTGDVQ  115

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               +P T L++RGAR++  V+ EL+AKGM +A+N + +G SAGGL  L+HCD F +  P G
Sbjct  116   AVNPATNLHFRGARVWLAVMQELLAKGMINAENAVLSGCSAGGLASLMHCDSFRALLPMG  175

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKCLSD+  FL  +D    +Y K+ F D+V LH   K+LP  CTS+++P  CF P+ +
Sbjct  176   TKVKCLSDAGFFLNTRDVSGVQYIKSYFEDVVTLHGSAKNLPRSCTSRLTPAMCFFPQYV  235

Query  940   VQYVKSPLFIFHSAYDSFQVQNTF---SMDLYRA-------IKNRSSISPTDMALLQDFK  1089
              + +++PLFI ++AYDS+Q++N     + D Y         IKN     P+ + ++QDF+
Sbjct  236   ARQIRTPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKN---CHPSQIKVMQDFR  292

Query  1090  KQIISAL--PKPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDK  1254
              + +SA+     S+++G  + S + H   +       + DS      TI     +W +D+
Sbjct  293   LEFLSAVIGLGRSSSRGMFIDSCYTHC-QTETQTSWFWQDSPILNRTTIAKAVGDWVYDR  351

Query  1255  HPINLID  1275
                  ID
Sbjct  352   TLFQKID  358



>ref|XP_010481611.1| PREDICTED: uncharacterized protein LOC104760390 [Camelina sativa]
Length=391

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/363 (36%), Positives = 206/363 (57%), Gaps = 21/363 (6%)
 Frame = +1

Query  235   PKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVE  414
             P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT   T      +++
Sbjct  25    PITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTMK  84

Query  415   SCSSRMKRELGSTFNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKPDP  591
               S  M ++ G         F GI G   +T   FY WNR+ +RYCDG SF GD+E  DP
Sbjct  85    GSSKLMNKDFG---------FSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVDP  135

Query  592   VTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVK  771
               KL++RGAR+++ V+D+LMAKGM++A+N I +G SAG L  ++HCD+F S  PK  +VK
Sbjct  136   ANKLFFRGARVWRAVIDDLMAKGMRNAQNAILSGCSAGALAAILHCDQFKSILPKTAKVK  195

Query  772   CLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYV  951
             C+SD+  F+  KD     Y ++ +  +VA H   KSLP  CTS M P  CF P+ + + +
Sbjct  196   CVSDAGYFIHGKDISGGSYIQSYYGKVVATHGSAKSLPASCTSTMKPELCFFPQYVAKTL  255

Query  952   KSPLFIFHSAYDSFQVQNTF---SMDLYRAIK----NRSSISPTDMALLQDFKKQIISAL  1110
             ++PLF+ ++A+DS+Q++N     S+D  +A K    +    +   +  +Q ++ Q+++AL
Sbjct  256   QTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTVQGYRDQVLAAL  315

Query  1111  P--KPSATKGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLIDP  1278
                + + T G  + S   H    ++A +         +  +     +WF+++     ID 
Sbjct  316   APVRAATTSGLFLDSCHAHCQGGSAATWSGDKGPTVANTKMAKAVGDWFYERSTFQNIDC  375

Query  1279  NNV  1287
             +++
Sbjct  376   SSL  378



>gb|ACG39759.1| carboxylic ester hydrolase [Zea mays]
Length=398

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 140/365 (38%), Positives = 200/365 (55%), Gaps = 27/365 (7%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
              L+  T +  A  KGAVCLDGS PAYH + G      +WL++  GGGWC +         
Sbjct  26    FLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSGEKSWLVHFEGGGWCNN---------  76

Query  406   SVESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V +C  R +  LGS+  MA    F GI          FY WN+V +RYCDG SF GDVE
Sbjct  77    -VTTCLQRKRTRLGSSKEMATQIAFSGILSDTPDDNPDFYNWNKVKVRYCDGSSFTGDVE  135

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
             + DP TKL+YRGARI+Q V+D+L+AKGM  A+N + +G SAGGL  ++HCDRF    P  
Sbjct  136   EVDPATKLHYRGARIWQAVMDDLLAKGMDKAENALISGCSAGGLTSILHCDRFHDLLPPA  195

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              RVKCLSD+  F+  KD     Y  A F+D+V  H   K+LP  CTS + P  CF P+N 
Sbjct  196   ARVKCLSDAGFFINEKDVAGVGYIAAFFNDVVTTHGSAKNLPPSCTSTLPPGTCFFPQNE  255

Query  940   VQYVKSPLFIFHSAYDSFQVQNTF-------SMDLYRAIKNRSSISPTDMALLQDFKKQI  1098
             V+ +++PLFI ++AYDS+QV+N             +    +    S + + +LQ F+   
Sbjct  256   VKQIQTPLFILNAAYDSWQVRNILVPGVADPHGKWHSCKHDIDQCSASQLRVLQGFRGDF  315

Query  1099  ISALPK--PSATKGFIVTSNFGHSFASADYKKRMFADSK----SKTIEDGFYNWFFDKHP  1260
             +  + +   S ++G  + S F H    ++ ++  F+       + T+ +   +WFFD+  
Sbjct  316   LKEVAELGNSDSRGLFINSCFVH--CQSEIQELWFSSDSPVLGNTTVANAVGDWFFDRSS  373

Query  1261  INLID  1275
                ID
Sbjct  374   FQKID  378



>ref|XP_009108427.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=397

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 145/398 (36%), Positives = 216/398 (54%), Gaps = 45/398 (11%)
 Frame = +1

Query  133   DWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFS  312
              W+ L++ SL I              ++   LL+  T +  A  KGAVCLDGSPPAYH  
Sbjct  6     QWLVLVVCSLAI--------------LKAEGLLVNITFVRNAVAKGAVCLDGSPPAYHID  51

Query  313   PGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAP-FVFKGIF  489
              G     ++WLI L GGGWC +          V +C SRM  +LGS+  M     F  I 
Sbjct  52    RGSGTGINSWLIQLEGGGWCHN----------VTNCISRMHTKLGSSKKMVENLAFSAIL  101

Query  490   GINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMK  666
                      FY WNRV +RYCDG SF GDV+  +P T L++RGAR++  V+ EL+AKGM+
Sbjct  102   SNKEQRNPDFYNWNRVKVRYCDGSSFTGDVKTVNPATNLHFRGARVWLAVMQELLAKGMR  161

Query  667   DAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFS  846
             +A+N + +G SAGGL  L+HCD F +  P G  VKCLSD+  FL  +D   A+Y K+ F+
Sbjct  162   NAENAVLSGCSAGGLASLMHCDSFRALLPMGTNVKCLSDAGFFLNTRDVSGAQYIKSYFN  221

Query  847   DIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFS----  1014
             D+V LH   K+LP  CTS+++P  CF P+ + + +++P+F+ ++AYDS+Q++N  +    
Sbjct  222   DVVTLHGSAKNLPRSCTSRLNPAMCFFPQYVARQIRTPVFVLNAAYDSWQIKNILAPRAA  281

Query  1015  ------MDLYRAIKNRSSISPTDMALLQDFKKQIISAL--PKPSATKGFIVTSNFGHSFA  1170
                         IKN      + + ++QDF+ + +SA+     SA++G  + S + H   
Sbjct  282   DPEGKWQSCQLDIKN---CQRSQLKVMQDFRLEFLSAVIGLGRSASRGMFIDSCYTHC-Q  337

Query  1171  SADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
             +       + DS      TI     +W +D++    ID
Sbjct  338   TETQTSWFWQDSPILNRTTIAKAVGDWVYDRNLFQKID  375



>gb|EEE61621.1| hypothetical protein OsJ_16047 [Oryza sativa Japonica Group]
Length=670

 Score =   253 bits (646),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 151/419 (36%), Positives = 222/419 (53%), Gaps = 34/419 (8%)
 Frame = +1

Query  58    GGLDLLTLEANNPESLRMAVSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIP  237
             GG+    + A  P +  MA S  S +W+      LV+ +   +S         D+D++  
Sbjct  258   GGVSAQLIAAATPTAGGMAAS--SGEWLSRAAMVLVLGLVVASSAKA-----GDVDMVFL  310

Query  238   KTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVES  417
             K+ +      GAVCLDGSPP YHFSPG    A+NWL+++ GGGWC +           + 
Sbjct  311   KSAV----STGAVCLDGSPPVYHFSPGSGSGANNWLVHMEGGGWCRN----------AQE  356

Query  418   CSSRMKRELGSTFNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
             CS R     GS+  M P  F GI G N      FY WNR+ +RYCDG SF GDVE  +  
Sbjct  357   CSVRQGNFRGSSKFMRPLSFSGIIGGNQRNNPDFYNWNRIKVRYCDGSSFTGDVETVETS  416

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L++RGAR++  ++++L+AKGM  A+N + +G SAGGL  ++HCD+F    P    VKC
Sbjct  417   TNLHFRGARVWNAIIEDLLAKGMSKAQNALLSGCSAGGLAAILHCDQFRDLLPATANVKC  476

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
              SD+  F+  KD     + +  + D+V LH   K+LP  CTSKMSP  CF P+N+V  ++
Sbjct  477   FSDAGFFVDGKDITGNDFVRTFYKDVVNLHGSAKNLPSSCTSKMSPDLCFFPQNVVPTLR  536

Query  955   SPLFIFHSAYDSFQVQNTFSMDLYRAIK-------NRSSISPTDMALLQDFKKQIISALP  1113
             +PLFI ++AYD++Q++N  +       K       + ++ S + +  LQ+F+   ++ALP
Sbjct  537   TPLFILNAAYDAWQIKNVLAPSAADKKKTWAKCKLDITACSSSQVTTLQNFRTDFLAALP  596

Query  1114  KPS---ATKGFIVTSNFGH-SFASADYKKRMFADSKSKT-IEDGFYNWFFDKHPINLID  1275
             KP    A     + S + H    S D      +    KT I     +WF D+     ID
Sbjct  597   KPEQSPANLSIFIDSCYAHCQSGSQDTWLAQGSPVVEKTQIGKAVGDWFHDREVSRRID  655



>ref|XP_008808368.1| PREDICTED: uncharacterized protein LOC103720446 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008808369.1| PREDICTED: uncharacterized protein LOC103720446 isoform X2 [Phoenix 
dactylifera]
Length=396

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/399 (35%), Positives = 216/399 (54%), Gaps = 36/399 (9%)
 Frame = +1

Query  115   VSPRSNDWICLLIF-SLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGS  291
             +  +   WI L I   L+IS++           ++  D  +P T++  A  KGAVCLDGS
Sbjct  2     LGAKPGGWIYLFILLELLISMK-----------VEGFD--VPLTLVQSAVAKGAVCLDGS  48

Query  292   PPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPF  471
             PPAYHF+PG     +NWL+++ GGGWC +          VE C  R K   GS+  M   
Sbjct  49    PPAYHFAPGFGSGVNNWLVHMEGGGWCRN----------VEECKERTKNFRGSSKYMKQL  98

Query  472   VFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDEL  648
              F GI G        FY WN+V IRYCDG SF GD+E  +P T L++RGAR+++ ++D+L
Sbjct  99    SFSGILGKKQNLNPDFYNWNKVKIRYCDGSSFTGDIEAVNPATNLHFRGARVWRAIIDDL  158

Query  649   MAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKY  828
             +AK M  A+N + +G SAGGL  ++HCD F    P G RVKC SD+  F+  KD    + 
Sbjct  159   LAKRMNKAQNALLSGCSAGGLASILHCDSFRDLVPAGARVKCFSDAGYFINGKDVSGKES  218

Query  829   FKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNT  1008
              K  ++ +   H   K+LP  CTS+  P  CF P+ +VQ +++PLFI ++AYD++Q++N 
Sbjct  219   IKDFYNQVATTHGSAKNLPSSCTSRFPPSMCFFPQYVVQSMRTPLFILNAAYDAWQIKNI  278

Query  1009  FS------MDLYRAIK-NRSSISPTDMALLQDFKKQIISALPKPSATKGFIVTSNFGHSF  1167
              +        ++   K +    S   + ++Q F+ + + ALP  S++ G  + S + H  
Sbjct  279   LAPSPSDPRKVWGECKLDIKKCSSNQLQVMQGFRSEFMRALPANSSSIGMFIDSCYSHCQ  338

Query  1168  ASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
             + A  +  + +DS       I     +W+F +  +  ID
Sbjct  339   SGAQ-ETWLRSDSPVIDKMPIAKAVGDWYFGRTSMRKID  376



>ref|XP_008808367.1| PREDICTED: uncharacterized protein LOC103720446 isoform X1 [Phoenix 
dactylifera]
Length=399

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/403 (35%), Positives = 218/403 (54%), Gaps = 36/403 (9%)
 Frame = +1

Query  103   LRMAVSPRSNDWICLLIF-SLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVC  279
             + + +  +   WI L I   L+IS++           ++  D  +P T++  A  KGAVC
Sbjct  1     MLVMLGAKPGGWIYLFILLELLISMK-----------VEGFD--VPLTLVQSAVAKGAVC  47

Query  280   LDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFN  459
             LDGSPPAYHF+PG     +NWL+++ GGGWC +          VE C  R K   GS+  
Sbjct  48    LDGSPPAYHFAPGFGSGVNNWLVHMEGGGWCRN----------VEECKERTKNFRGSSKY  97

Query  460   MAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVV  636
             M    F GI G        FY WN+V IRYCDG SF GD+E  +P T L++RGAR+++ +
Sbjct  98    MKQLSFSGILGKKQNLNPDFYNWNKVKIRYCDGSSFTGDIEAVNPATNLHFRGARVWRAI  157

Query  637   VDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPE  816
             +D+L+AK M  A+N + +G SAGGL  ++HCD F    P G RVKC SD+  F+  KD  
Sbjct  158   IDDLLAKRMNKAQNALLSGCSAGGLASILHCDSFRDLVPAGARVKCFSDAGYFINGKDVS  217

Query  817   RAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQ  996
               +  K  ++ +   H   K+LP  CTS+  P  CF P+ +VQ +++PLFI ++AYD++Q
Sbjct  218   GKESIKDFYNQVATTHGSAKNLPSSCTSRFPPSMCFFPQYVVQSMRTPLFILNAAYDAWQ  277

Query  997   VQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQIISALPKPSATKGFIVTSNF  1155
             ++N  +        ++   K +    S   + ++Q F+ + + ALP  S++ G  + S +
Sbjct  278   IKNILAPSPSDPRKVWGECKLDIKKCSSNQLQVMQGFRSEFMRALPANSSSIGMFIDSCY  337

Query  1156  GHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
              H  + A  +  + +DS       I     +W+F +  +  ID
Sbjct  338   SHCQSGAQ-ETWLRSDSPVIDKMPIAKAVGDWYFGRTSMRKID  379



>ref|XP_008238012.1| PREDICTED: protein notum homolog isoform X2 [Prunus mume]
Length=400

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/389 (36%), Positives = 208/389 (53%), Gaps = 35/389 (9%)
 Frame = +1

Query  151   IFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDED  330
             +F L  +V  + +  +P  I          T +  A  KGAVCLDGSPPAYH   G    
Sbjct  10    LFLLACAVTLLKAAGVPVEI----------TYVHSAIAKGAVCLDGSPPAYHHDKGFGSG  59

Query  331   ASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNM-APFVFKGIFGINATF  507
              +NWL+++ GGGWC +          V +C  R    LGS+  M     F GI      F
Sbjct  60    INNWLVHIEGGGWCNN----------VTTCLGRKNTRLGSSKQMLKAIAFSGILSNRKMF  109

Query  508   T-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVI  684
                FY WNR+ +RYCDG SF GDV   +P T LY+RGARIF+ V+++L+AKGM +A+N I
Sbjct  110   NPDFYNWNRIKVRYCDGASFTGDVAAVNPATGLYFRGARIFRAVIEDLLAKGMGNAQNAI  169

Query  685   FaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALH  864
              +G SAGGL  ++HCD F +  P G  VKC+SD+  F+ VKD   A++ +  FS +V  H
Sbjct  170   LSGCSAGGLTSILHCDNFHALLPVGTNVKCVSDAGYFINVKDVSGAQHIEEFFSQVVETH  229

Query  865   QPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFSMDL-------  1023
                ++LP  CTSK+ P  CF P+ +   +++ +F  ++AYDS+Q++N  +  +       
Sbjct  230   GSARNLPPSCTSKLRPGLCFFPQYMASQIRTRIFFVNAAYDSWQIKNILAPGVADPHGTW  289

Query  1024  YRAIKNRSSISPTDMALLQDFKKQIISALPKPSAT--KGFIVTSNFGHSFASADYKKRMF  1197
             +    +  + SPT +  +QDF+ Q +SA+   +    KG  + S + H       +  + 
Sbjct  290   HECKLDIKNCSPTQLKAMQDFRVQFLSAIGGMTGCPLKGMFIDSCYAHCQTELQ-ETWLM  348

Query  1198  ADS---KSKTIEDGFYNWFFDKHPINLID  1275
             ADS      TI     +WF+ + P   ID
Sbjct  349   ADSPVLNKTTIAQAVGDWFYGRTPFQKID  377



>ref|XP_010677539.1| PREDICTED: protein notum homolog isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=388

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 142/362 (39%), Positives = 207/362 (57%), Gaps = 26/362 (7%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KG VCLDGSPPAYHF  G      NWLI++ GG WC +  T        
Sbjct  24    VPITYVQDAVAKGGVCLDGSPPAYHFDKGFGAGIHNWLIHMEGGAWCNNATT--------  75

Query  412   ESCSSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKP  585
               C  R K  LGS+  M   + F GI    A ++  FY WNR+ +RYCDG SF GDVE  
Sbjct  76    --CLERTKTRLGSSKLMTKQYTFSGILSNQAKYSPDFYNWNRIKVRYCDGSSFTGDVEAV  133

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             DP  K+YYRGAR+++ ++D+L+AKGMK+A+N I AG SAGGLG ++ CD F +  P G +
Sbjct  134   DPA-KVYYRGARLWRAIMDDLLAKGMKNAENAILAGCSAGGLGAILQCDNFRALLPSGAK  192

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKCLSD+  F+  KD     + + VF+D+V  H   K+LP  CTSK  P  CF P+   +
Sbjct  193   VKCLSDAGFFINAKDISGVSHIQEVFADVVTTHGSAKNLPPSCTSKFDPKLCFFPEYAAR  252

Query  946   YVKSPLFIFHSAYDSFQVQNTFS---MDLYRAIKNRSS----ISPTDMALLQDFKKQIIS  1104
              +++PLF+ ++AYD++Q++NT +    D +    +  S     S + + ++  F++  ++
Sbjct  253   GIQTPLFLLNAAYDAWQIKNTLAPGVADRHGTWHDCKSDIIKCSNSQIQIMHGFRQDFLA  312

Query  1105  ALPK--PSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINL  1269
             AL     S ++GF + S + H   S   +  +  DS    + TI     +WF+D+ P   
Sbjct  313   ALSSLGNSNSRGFYINSCYSHC-QSGTQETWLRDDSPLLDNTTICKAVGDWFYDRKPFQK  371

Query  1270  ID  1275
             ID
Sbjct  372   ID  373



>ref|XP_009128780.1| PREDICTED: uncharacterized protein LOC103853624 [Brassica rapa]
Length=391

 Score =   245 bits (626),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 129/360 (36%), Positives = 204/360 (57%), Gaps = 21/360 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT   T      ++
Sbjct  24    VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVKRKTTM  83

Query  412   ESCSSRMKRELGSTFNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKPD  588
             +  S  M ++ G         F GI G   +T   FY WNR+ +RYCDG SF GD+E  D
Sbjct  84    KGSSKFMNKDFG---------FSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVD  134

Query  589   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRV  768
             P  KL++RGAR+++ V+D+LMAKGM +A+N I +G SAG L  ++HCD+F S  P   +V
Sbjct  135   PTNKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDQFKSILPTTAKV  194

Query  769   KCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  948
             KC+SD+  F+  KD     Y ++ +S +V+ H   KSLP  CTS M P  CF P+ +V+ 
Sbjct  195   KCVSDAGFFIHGKDISGGSYIESYYSKVVSTHGSAKSLPASCTSSMKPELCFFPQYVVKT  254

Query  949   VKSPLFIFHSAYDSFQVQNTF---SMDLYRAIK----NRSSISPTDMALLQDFKKQIISA  1107
             +++PLF+ ++A+DS+Q++N     S+D  +  K    +    +   +  +Q ++ Q+++A
Sbjct  255   MQTPLFVINAAFDSWQIKNVLAPTSVDKRKEWKDCKLDLKKCTAAQLQTVQGYRDQMLAA  314

Query  1108  LP--KPSATKGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLID  1275
             L   + + T+G  + S   H    ++A +         +  +     +WF+++     ID
Sbjct  315   LAPVQATTTRGLFLDSCHAHCQGGSAATWSGAQGPQVGNTKMAKAVGDWFYERSTFQNID  374



>gb|KEH20327.1| pectinacetylesterase family protein [Medicago truncatula]
Length=393

 Score =   245 bits (626),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 138/364 (38%), Positives = 201/364 (55%), Gaps = 25/364 (7%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             + +P T +  A  KGAVCLDGSPPAYHF  G +    NW+++  GGGWC +  T      
Sbjct  26    VTVPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWCNNATT------  79

Query  406   SVESCSSRMKRELGSTFNM-APFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
                 C  R+   LGS+  M     F G F     F   FY WNR+ +RYCDG SF GDVE
Sbjct  80    ----CLDRIDTRLGSSKKMDKTLSFSGFFSSGKKFNPDFYNWNRIKVRYCDGSSFTGDVE  135

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               DP T L+YRG RIF  V+++L+AKGMK+AKN I +G SAGGL  ++ CDRF +  P  
Sbjct  136   AVDPKTNLHYRGGRIFVAVIEDLLAKGMKNAKNAILSGCSAGGLTSILQCDRFRTLLPAA  195

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKC+SD+  F+ VK    A + +  +S +V  H   K+LP  CTS++SP  CF P+N+
Sbjct  196   AKVKCVSDAGYFINVKAVSGASHIEQFYSQVVQTHGSAKNLPSSCTSRLSPGLCFFPQNV  255

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQI  1098
                +K+P+F  ++AYDS+Q++N  +  +      +R  K +  S S   ++ +Q F+ + 
Sbjct  256   AAQIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIKSCSANQLSTMQGFRTEF  315

Query  1099  ISALP--KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPI  1263
             + A+     S +KG  +   + H   +   +  M  DS      TI     +W++D+   
Sbjct  316   LKAISVVSNSPSKGMFIDGCYSHC-QTGMQETWMRTDSPVLAKTTIAKAVGDWYYDRSTF  374

Query  1264  NLID  1275
               ID
Sbjct  375   QQID  378



>emb|CDX87799.1| BnaC02g31500D [Brassica napus]
Length=391

 Score =   245 bits (625),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 129/360 (36%), Positives = 203/360 (56%), Gaps = 21/360 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT   T      ++
Sbjct  24    VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVKRKTTM  83

Query  412   ESCSSRMKRELGSTFNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKPD  588
             +  S  M ++ G         F GI G   +T   FY WNR+ +RYCDG SF GD+E  D
Sbjct  84    KGSSKFMNKDFG---------FSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVD  134

Query  589   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRV  768
             P  KL++RGAR+++ V+D+LMAKGM +A+N I +G SAG L  ++HCD F S  P   +V
Sbjct  135   PTNKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDEFKSILPTTAKV  194

Query  769   KCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  948
             KC+SD+  F+  KD     Y ++ +S +V+ H   KSLP  CTS M P  CF P+ +V+ 
Sbjct  195   KCVSDAGFFIHGKDISGGSYIESYYSKVVSTHGSAKSLPASCTSSMKPELCFFPQYVVKT  254

Query  949   VKSPLFIFHSAYDSFQVQNTF---SMDLYRAIK----NRSSISPTDMALLQDFKKQIISA  1107
             +++PLF+ ++A+DS+Q++N     S+D  +  K    +    +   +  +Q ++ Q+++A
Sbjct  255   MQTPLFVINAAFDSWQIKNVLAPTSVDKRKEWKDCKLDLKKCTAAQLQTVQGYRDQMLAA  314

Query  1108  LP--KPSATKGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLID  1275
             L   + + T+G  + S   H    ++A +         +  +     +WF+++     ID
Sbjct  315   LAPVRATTTRGLFLDSCHAHCQGGSAATWSGAQGPQVGNTKMAKAVGDWFYERSTFQNID  374



>ref|XP_003628995.1| Notum-like protein [Medicago truncatula]
Length=396

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 138/364 (38%), Positives = 201/364 (55%), Gaps = 25/364 (7%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             + +P T +  A  KGAVCLDGSPPAYHF  G +    NW+++  GGGWC +  T      
Sbjct  29    VTVPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWCNNATT------  82

Query  406   SVESCSSRMKRELGSTFNM-APFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
                 C  R+   LGS+  M     F G F     F   FY WNR+ +RYCDG SF GDVE
Sbjct  83    ----CLDRIDTRLGSSKKMDKTLSFSGFFSSGKKFNPDFYNWNRIKVRYCDGSSFTGDVE  138

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               DP T L+YRG RIF  V+++L+AKGMK+AKN I +G SAGGL  ++ CDRF +  P  
Sbjct  139   AVDPKTNLHYRGGRIFVAVIEDLLAKGMKNAKNAILSGCSAGGLTSILQCDRFRTLLPAA  198

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKC+SD+  F+ VK    A + +  +S +V  H   K+LP  CTS++SP  CF P+N+
Sbjct  199   AKVKCVSDAGYFINVKAVSGASHIEQFYSQVVQTHGSAKNLPSSCTSRLSPGLCFFPQNV  258

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQI  1098
                +K+P+F  ++AYDS+Q++N  +  +      +R  K +  S S   ++ +Q F+ + 
Sbjct  259   AAQIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIKSCSANQLSTMQGFRTEF  318

Query  1099  ISALP--KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPI  1263
             + A+     S +KG  +   + H   +   +  M  DS      TI     +W++D+   
Sbjct  319   LKAISVVSNSPSKGMFIDGCYSHC-QTGMQETWMRTDSPVLAKTTIAKAVGDWYYDRSTF  377

Query  1264  NLID  1275
               ID
Sbjct  378   QQID  381



>gb|EYU37448.1| hypothetical protein MIMGU_mgv1a007102mg [Erythranthe guttata]
Length=419

 Score =   246 bits (627),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 142/375 (38%), Positives = 210/375 (56%), Gaps = 25/375 (7%)
 Frame = +1

Query  196   IPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCT  375
             + T  + +L   I  T +  A EKGAVCLDG+PPAY+ S G  + A NWL+YL GG WC 
Sbjct  23    LTTQTLSELTDKINITYVNSAVEKGAVCLDGTPPAYYHSVGFGDGADNWLVYLEGGAWCN  82

Query  376   SNDTYSTHDLSVESCSSRMKRELGSTFNMAPFV--FKGIFGINATFTK-FYKWNRVIIRY  546
             S           E+C  R+K +  ++ +  P +    GIF +N TF + FY WN+VII Y
Sbjct  83    S----------TETCLERVKIKWLASTSTRPAIRYVSGIFTVNQTFNQAFYNWNKVIIVY  132

Query  547   CDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvH  726
             CDG SF GDVE+ DP T L+YRGARIF+ V+D+L+AKGMK+AKN +  G SAGGL  +++
Sbjct  133   CDGASFTGDVEEVDPTTNLHYRGARIFRAVIDDLLAKGMKNAKNAVLTGSSAGGLATILN  192

Query  727   CDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKM  906
             CDRF S  P   RVKC+SDS  F+  K+   A   +A F+ +  LH   K+LP  C SKM
Sbjct  193   CDRFRSLVPHATRVKCISDSGFFIHSKNMPGANEREAYFTQVAELHGMAKALPQSCASKM  252

Query  907   SPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFS-------MDLYRAIKNRSSISPTD  1065
             +P  C  P+ +++ +++PLFI  S +D +Q++   +               N +  + + 
Sbjct  253   NPGLCLFPEYVIKDMQTPLFILDSLFDLYQIKEMLAPFVGGCKEQWDDCTTNLTLCTSSQ  312

Query  1066  MALLQDFKKQIISALPK-PSATKGFIVTSNFGHSFA-SADYKKRMFADSK---SKTIEDG  1230
             + +++D +   +  L +  S + G  V + F H+     D  +  F        KTIE+ 
Sbjct  313   LQIMKDHRTAFLETLQEVESPSLGIFVHTCFLHTHVLDKDGWRCSFVARNVLAKKTIEEA  372

Query  1231  FYNWFFDKHPINLID  1275
               +W++D+     ID
Sbjct  373   IDDWYYDRSSFQQID  387



>ref|XP_010266384.1| PREDICTED: uncharacterized protein LOC104603916 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010266385.1| PREDICTED: uncharacterized protein LOC104603916 isoform X2 [Nelumbo 
nucifera]
Length=391

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 138/367 (38%), Positives = 208/367 (57%), Gaps = 32/367 (9%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             L +  T I  +  KGAVCLDGSPPAYH   G     +NWL+++ GGGWCT+         
Sbjct  23    LYVQITYIKSSVAKGAVCLDGSPPAYHLDKGFGSGINNWLVHIEGGGWCTN---------  73

Query  406   SVESCSSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V +C  R    LGS+  M     F GI   N  F   FY WNR+ +RYCDG SF GD+E
Sbjct  74    -VTTCLFRKNTHLGSSKKMVTEIAFSGILSNNKQFNPDFYNWNRIKVRYCDGASFTGDLE  132

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
             K DPVT L+YRGARI+  V+++L+ KGMK+A+  + +G SAGGL  ++HCD F +    G
Sbjct  133   KVDPVTNLHYRGARIWLAVIEDLLKKGMKNAEYALLSGCSAGGLASILHCDSFHALLSIG  192

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKCL+D+  F+ +K+    ++ K+ F+D+V  H   K+LP  CTS M P  CF P+ +
Sbjct  193   TKVKCLADAGYFVNLKEISGREHIKSYFNDVVTTHGSVKNLPTYCTSTMKPSMCFFPQYI  252

Query  940   VQYVKSPLFIFHSAYDSFQVQNT----------FSMDLYRAIKNRSSISPTDMALLQDFK  1089
             V  +++PLF+ ++AYDS+Q++N           + +     IKN SSI    +  +Q F+
Sbjct  253   VHGIRTPLFLLNAAYDSWQIRNILVPGVADPHGYWLSCKLDIKNCSSI---QLQTMQGFR  309

Query  1090  KQIISA-LPKPSATKGFIVTSNFGHSFASADYKKRMFADSK----SKTIEDGFYNWFFDK  1254
              + +SA L + S+++G  + S + H    ++ ++    D      +  I     +W++D+
Sbjct  310   MEFLSALLGQRSSSRGMFINSCYAH--CQSEMQETWLQDDSPVLDNTPIAKAVGDWYYDR  367

Query  1255  HPINLID  1275
                  ID
Sbjct  368   RSFQKID  374



>gb|KCW72722.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   244 bits (624),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 144/397 (36%), Positives = 216/397 (54%), Gaps = 37/397 (9%)
 Frame = +1

Query  124   RSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAY  303
             R   W+C+     ++S+Q          +I+     +  T +  A  KGAVCLDGSPPAY
Sbjct  5     RLRTWLCV-----ILSIQI---------LIKSEAFNVGITYVQNAVAKGAVCLDGSPPAY  50

Query  304   HFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMA-PFVFK  480
             HF  G    A+NWLI   GG WC +          V +C +R    LGS+  M     F 
Sbjct  51    HFDKGVGAGANNWLILFEGGAWCNN----------VTTCLARRDTRLGSSKQMVKELSFS  100

Query  481   GIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAK  657
             GI      F   FY WN++ +RYCDG SF GDVE  +P T L++RGAR F  +V++LM+K
Sbjct  101   GILSNKQKFNPDFYNWNKIKVRYCDGASFTGDVEAVNPATNLHFRGARAFVAIVEDLMSK  160

Query  658   GMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKA  837
             GM +A+N I AG SAGGL  +++CDRF +  P   +VKCL+D+  F+  KD   A + + 
Sbjct  161   GMSNAQNAILAGCSAGGLTAILNCDRFRALVPARTKVKCLADAGYFINAKDVSGASHIEN  220

Query  838   VFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFSM  1017
              +S++VA H   K+LP  CTSKM P  CF P+N+V  +++PLFI ++AYDS+Q++N  + 
Sbjct  221   FYSEVVATHGSAKNLPTSCTSKMKPGLCFFPQNVVPQIQTPLFIINAAYDSWQIKNILAP  280

Query  1018  DL------YRAIK-NRSSISPTDMALLQDFKKQIISALPK--PSATKGFIVTSNFGHSFA  1170
              +      +R+ K +    SP  + ++QDF+ + + AL     S ++G  + S   H  A
Sbjct  281   GVADRHGTWRSCKLDIKKCSPNQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCNTHCQA  340

Query  1171  S--ADYKKRMFADSKSKTIEDGFYNWFFDKHPINLID  1275
                A + +         +I     +W++++     ID
Sbjct  341   GTEATWLRNDSPIVAKTSIAKAVGDWYYERITSQKID  377



>gb|KDO40409.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
Length=372

 Score =   244 bits (622),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 141/350 (40%), Positives = 199/350 (57%), Gaps = 27/350 (8%)
 Frame = +1

Query  271   AVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGS  450
             AVCLDGSPPAYHF  G     +NWL+++ GG WC +          VE CS R     GS
Sbjct  22    AVCLDGSPPAYHFDKGFGAGINNWLVHIDGGAWCNN----------VEDCSKRRDSSYGS  71

Query  451   TFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARI  624
             + +M     F GI      F   FY WNRV +RYCDG SF GDVE  +P T L++RGAR+
Sbjct  72    SKHMVKEANFTGILSNEQKFNPDFYDWNRVRVRYCDGASFTGDVEAVNPETNLHFRGARV  131

Query  625   FQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIV  804
             F+ V+++L+AKGMK+A+N I  G SAGGL  ++HCD F + FP   RVKC +D+  F+  
Sbjct  132   FEAVMEDLLAKGMKNAQNAILTGCSAGGLTSILHCDNFRALFPVDTRVKCFADAGYFVNA  191

Query  805   KDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAY  984
             KD     + +  +  +VALH   K LP  CTS++SP  CF P+N+   +K+PLFI +SAY
Sbjct  192   KDVSGESHIEEFYKQVVALHGSAKHLPASCTSRLSPGLCFFPENVAGQIKTPLFIINSAY  251

Query  985   DSFQVQNTFSMD------LYRAIK-NRSSISPTDMALLQDFKKQIISALP--KPSATKGF  1137
             DS+Q+ N    +       + + K +  + S T +  +Q F+ Q ++AL     S+++G 
Sbjct  252   DSWQISNILVPEDADPKGAWSSCKVDIKTCSSTQLQTMQGFRVQFLNALAGLGNSSSRGM  311

Query  1138  IVTSNFGHSFASADYKKRMF-ADS---KSKTIEDGFYNWFFDKHPINLID  1275
              V S + H     DY++  F ADS       I     +W++D+ P   ID
Sbjct  312   FVDSCYTH--CRTDYQETWFSADSPVLDKTPIAKAVGDWYYDRSPFQKID  359



>gb|AET03471.2| pectinacetylesterase family protein [Medicago truncatula]
Length=424

 Score =   245 bits (626),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 138/364 (38%), Positives = 201/364 (55%), Gaps = 25/364 (7%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             + +P T +  A  KGAVCLDGSPPAYHF  G +    NW+++  GGGWC +  T      
Sbjct  57    VTVPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWCNNATT------  110

Query  406   SVESCSSRMKRELGSTFNM-APFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
                 C  R+   LGS+  M     F G F     F   FY WNR+ +RYCDG SF GDVE
Sbjct  111   ----CLDRIDTRLGSSKKMDKTLSFSGFFSSGKKFNPDFYNWNRIKVRYCDGSSFTGDVE  166

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               DP T L+YRG RIF  V+++L+AKGMK+AKN I +G SAGGL  ++ CDRF +  P  
Sbjct  167   AVDPKTNLHYRGGRIFVAVIEDLLAKGMKNAKNAILSGCSAGGLTSILQCDRFRTLLPAA  226

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKC+SD+  F+ VK    A + +  +S +V  H   K+LP  CTS++SP  CF P+N+
Sbjct  227   AKVKCVSDAGYFINVKAVSGASHIEQFYSQVVQTHGSAKNLPSSCTSRLSPGLCFFPQNV  286

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQI  1098
                +K+P+F  ++AYDS+Q++N  +  +      +R  K +  S S   ++ +Q F+ + 
Sbjct  287   AAQIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIKSCSANQLSTMQGFRTEF  346

Query  1099  ISALP--KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPI  1263
             + A+     S +KG  +   + H   +   +  M  DS      TI     +W++D+   
Sbjct  347   LKAISVVSNSPSKGMFIDGCYSHC-QTGMQETWMRTDSPVLAKTTIAKAVGDWYYDRSTF  405

Query  1264  NLID  1275
               ID
Sbjct  406   QQID  409



>ref|XP_007040902.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOY25403.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=401

 Score =   244 bits (624),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 139/364 (38%), Positives = 207/364 (57%), Gaps = 25/364 (7%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             + +P T +  A  KGAVCLDGSPPAYH+  G     ++WLI L GGGWC +         
Sbjct  25    VYVPITYVQSAVAKGAVCLDGSPPAYHWDRGYGTGINSWLIQLEGGGWCNN---------  75

Query  406   SVESCSSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V SC  R    LGS+  M   + F GI      F   FY WNRV +RYCDG SF GDV 
Sbjct  76    -VTSCLVRKNTHLGSSKRMVKQIPFSGILNNKHQFNPDFYNWNRVKVRYCDGSSFTGDVA  134

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               +PVT L++RGAR++  V+++L+AKGM++A+N + +G SAGGL  ++HCD F +  P G
Sbjct  135   AVNPVTNLHFRGARVWLAVMEDLLAKGMRNAENAVLSGCSAGGLASILHCDSFPALLPMG  194

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKCLSD+  F+  KD     Y +A F+ +VA H   K+L   CTS+M P  CF P+ +
Sbjct  195   TKVKCLSDAGYFINAKDVSGGHYIEAFFNQLVATHGSAKNLLPSCTSRMRPGLCFFPEYM  254

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQI  1098
              Q +++PLF  ++AYDS+Q++N  +  +      + + K +  +  P+ +  +QDF+ Q 
Sbjct  255   AQQIQTPLFFINAAYDSWQIRNILAPGIADPRGYWESCKLDIKNCLPSQIKTMQDFRLQF  314

Query  1099  ISALPK--PSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPI  1263
             + AL +   S+++G  + S + H          +  DS      +I     +WF+D++P 
Sbjct  315   LVALLRLGKSSSRGMFIDSCYAHCQTEMQ-GLWLMPDSPLLNKTSIAKAVGDWFYDRNPF  373

Query  1264  NLID  1275
               ID
Sbjct  374   QKID  377



>ref|XP_007156330.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
 gb|ESW28324.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
Length=397

 Score =   244 bits (623),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 137/359 (38%), Positives = 204/359 (57%), Gaps = 25/359 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGS PAYHF  G     +NW+++  GGGWC +          V SC
Sbjct  28    TFVENAVAKGAVCLDGSAPAYHFHKGSGAGINNWIVHFEGGGWCNN----------VTSC  77

Query  421   SSRMKRELGSTFNM-APFVFKGIFGINATFTK-FYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              SR    LGS+  M     F G F  +  F + FY WNR+ +RYCDG SF GDVE  DP 
Sbjct  78    LSRRDTRLGSSKKMDTQLSFSGFFSNSKKFNQDFYDWNRIKVRYCDGSSFTGDVEAVDPR  137

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L++RGAR+F  VV++L+AKGMK+A+N I +G SAGGL  +++CDRF +  P+  +VKC
Sbjct  138   TNLHFRGARVFAAVVEDLLAKGMKNAQNAIISGCSAGGLAAILNCDRFKALLPRTTKVKC  197

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             L+D+  F+ VKD   A+  +  +S +V  H   K+LP  CTS++ P  CF P+N+V  + 
Sbjct  198   LADAGYFINVKDVSGAQRIEEFYSQVVQTHGSAKNLPSSCTSRLKPGLCFFPQNVVSQIS  257

Query  955   SPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQIISALP  1113
             +P+F  ++AYDS+Q++N  +         +R  K +  + SP  ++++Q F+   + A  
Sbjct  258   TPIFFVNAAYDSWQIKNILAPGAADPHGQWRECKLDIKNCSPNQLSVMQVFRTDFLRAFG  317

Query  1114  K--PSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
                 S +KG  +   + H   +   +  +  DS    + TI     +WF+D+   + ID
Sbjct  318   AVGNSPSKGHFIDGCYAHC-QTGTQETWLRNDSPVLGNTTIARAVGDWFYDRRAFHQID  375



>ref|XP_010056135.1| PREDICTED: protein notum homolog [Eucalyptus grandis]
Length=392

 Score =   244 bits (623),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 140/397 (35%), Positives = 219/397 (55%), Gaps = 37/397 (9%)
 Frame = +1

Query  124   RSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAY  303
             R   W+C+     ++S+Q          +++   + +  T +  A  KGAVCLDGSPPAY
Sbjct  5     RLRTWLCV-----ILSIQI---------LLKSEAINVSITYVQNAVAKGAVCLDGSPPAY  50

Query  304   HFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMA-PFVFK  480
             HF  G    A+NWLI++ GGGWC +          V +C +R    +GS+  M     F 
Sbjct  51    HFDKGVGAGANNWLIFVEGGGWCNN----------VTTCLARRDTRVGSSKQMVKELSFS  100

Query  481   GIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAK  657
             GI      F   FY WN++ +RYCDG SF GDVE  +P T L++RGAR F  +V++LM+K
Sbjct  101   GILSNKQKFNPDFYNWNKIKVRYCDGASFTGDVEAVNPATNLHFRGARAFVAIVEDLMSK  160

Query  658   GMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKA  837
             GM +A+N I +G SAGGL  +++CDRF +  P   +VKCL+D+  F+  KD   A + + 
Sbjct  161   GMSNAQNAILSGCSAGGLAAILNCDRFRALMPARTKVKCLADAGYFINAKDVSGASHIEN  220

Query  838   VFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFSM  1017
              +S++VA H   K+LP  CTSKM P  CF P+N+V  +++PLFI ++AYD++Q++N  + 
Sbjct  221   FYSEVVATHGSAKNLPTSCTSKMKPGLCFFPQNVVPQIQTPLFIINAAYDAWQIKNILAP  280

Query  1018  DL------YRAIK-NRSSISPTDMALLQDFKKQIISALPK--PSATKGFIVTSNFGHSFA  1170
              +      + + K +    SP  + ++QDF+ + + AL     S ++G  + S   H  A
Sbjct  281   GVADPHGTWNSCKLDIKKCSPNQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCNTHCQA  340

Query  1171  S--ADYKKRMFADSKSKTIEDGFYNWFFDKHPINLID  1275
                A + +         +I     +W++++     ID
Sbjct  341   GTEATWLRNDSPIVAKTSIAKAVGDWYYERITSQKID  377



>gb|AFK37852.1| unknown [Lotus japonicus]
Length=399

 Score =   244 bits (623),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 140/368 (38%), Positives = 209/368 (57%), Gaps = 35/368 (10%)
 Frame = +1

Query  229   LIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLS  408
             ++P   +  A  KGAVCLDG+PPAYHF  G  E  +NW+++L GGGWC +          
Sbjct  26    IVPLIRLEKAVSKGAVCLDGTPPAYHFDEGSGEGVNNWIVFLEGGGWCNN----------  75

Query  409   VESCSSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEK  582
             V  C  R     GS+  M  P  F G    N  F   FY WNR+++RYCDG SF GDVE+
Sbjct  76    VTDCLLRKDTRRGSSDQMTEPRFFNGFLSENQKFNPDFYNWNRILVRYCDGASFTGDVEE  135

Query  583   PDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGV  762
              DP T L++RGAR+F  V++EL+AKGM++A+N I +G SAGGL  ++ CD F S  P   
Sbjct  136   VDPATNLHFRGARVFVAVIEELLAKGMQNAENAILSGCSAGGLATILQCDHFKSLLPAEA  195

Query  763   RVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLV  942
             +VKC+ D+  F+ VKD    +Y +  ++++VA H   K+LP  CTS+ SP  CF P+ + 
Sbjct  196   KVKCVPDAGYFINVKDTSGTQYIEEYYNEVVATHGSAKNLPPSCTSRRSPGLCFFPQYVA  255

Query  943   QYVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIKNR----SSISPTDMALLQDFKKQII  1101
               + +P+F  ++AYD++Q+ N F   S D +    N     ++ SP  +  +Q F+ + I
Sbjct  256   SEISTPIFYVNAAYDTWQIHNIFARGSADPHGIWHNCKLDINNCSPDQLTAIQGFRTEFI  315

Query  1102  SALP--KPSATKGFIVTSNFGH-------SFASADYKKRMFADSK-SKTIEDGFYNWFFD  1251
              AL   + S ++G  + S + H       S+ S+D  +   A++K  K + D    WF++
Sbjct  316   KALSVTENSRSEGMFIDSCYVHCQTETQESWLSSDSPQ--LANTKLGKAVGD----WFYE  369

Query  1252  KHPINLID  1275
             + P   ID
Sbjct  370   RSPFQKID  377



>ref|NP_001190770.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 gb|AEE84178.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=517

 Score =   248 bits (632),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 139/358 (39%), Positives = 204/358 (57%), Gaps = 23/358 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT           V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  412   ESCSSRMKRELGST-FNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKP  585
              SC+ R     GS+ F    F F GI G   +T   FY WNR+ +RYCDG SF G+VE  
Sbjct  74    ASCNERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVEAV  133

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +P  KL++RGAR+++ VVD+LMAKGMK+A+N I +G SAG L  ++HCD F +  P+   
Sbjct  134   NPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAS  193

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+  KD     Y ++ +S +VALH   KSLPV CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDITGGSYIQSYYSKVVALHGSAKSLPVSCTSKMKPELCFFPQYVVP  253

Query  946   YVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIKN----RSSISPTDMALLQDFKKQIIS  1104
              +++PLF+ ++A+DS+Q++N     ++D  +  KN        S   +  +Q F+ Q++ 
Sbjct  254   SMRTPLFVINAAFDSWQIKNVLAPTAVDKGKEWKNCKLDLKKCSAAQLKTVQGFRDQMMR  313

Query  1105  ALPKPSAT--KGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPIN  1266
             AL    +T  +G  + S   H    ++A +         +  I     NWF+ +  ++
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGDKGPQVANTRIAKAVGNWFYGRTSMD  371



>gb|AAP72959.1| pectin acetylesterase [Lactuca sativa]
Length=395

 Score =   244 bits (622),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 149/406 (37%), Positives = 220/406 (54%), Gaps = 46/406 (11%)
 Frame = +1

Query  115   VSPRSNDWICLLI---FSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLD  285
             +S R + W+C+ +    SL+ +  Y            D+ L    T +  A  KGAVCLD
Sbjct  2     MSERGDRWLCIFLVCTLSLLCTEAY------------DVGL----TFLNSAVAKGAVCLD  45

Query  286   GSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNM-  462
             GS PAYH   G      NWL++  GGGWC +            +C +R    LGS+  M 
Sbjct  46    GSAPAYHIDKGFGAGIDNWLVFFEGGGWCNN----------ATNCLTRRDTRLGSSKKML  95

Query  463   APFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVV  639
                 F G+F   A +   FY WNR+ +RYCDG SF GDVE  DP TKLYYRGARIF+ VV
Sbjct  96    TTETFSGMFHNKAKYNPDFYDWNRIKVRYCDGASFTGDVEAVDPNTKLYYRGARIFRAVV  155

Query  640   DELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPER  819
             D+L+AKGMK+AKN I AG SAGGL  ++ CD F S+ P   +VKCLSD+  F+  K    
Sbjct  156   DDLLAKGMKNAKNAILAGCSAGGLTSILQCDNFRSQLPATTKVKCLSDAGFFINAKTIIG  215

Query  820   AKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQV  999
               + +  ++D+V  H   K L   C +KMSP  CF P+N+VQ++K+P+F+ ++AYDS+QV
Sbjct  216   QSHIEGFYADVVRTHGSAKVLSPACLAKMSPGLCFFPQNMVQFIKTPIFLINAAYDSWQV  275

Query  1000  QNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQIISAL----PKPSATKGFIVT  1146
             +N  +  +      +R  K + +  S   + +LQ ++ + + AL       S ++G  + 
Sbjct  276   KNILAPGVADRKGTWRECKLDITKCSSAQLNVLQGYRLEFLKALNGFGNGNSPSRGMFIN  335

Query  1147  SNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
             S + H   +   +  +  DS    + TI     +W+++++    ID
Sbjct  336   SCYSHC-QTGIQETWLRNDSPLLGNTTIAKAVGDWYYERNTFQKID  380



>ref|XP_008347803.1| PREDICTED: uncharacterized protein LOC103410929 [Malus domestica]
Length=401

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/362 (38%), Positives = 207/362 (57%), Gaps = 25/362 (7%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +  T++  A  KGAVCLDGS  AYHF  G     +NWL+++ GGGWC +          V
Sbjct  30    VALTLVENAVAKGAVCLDGSAXAYHFDKGFGAGINNWLVHVEGGGWCNT----------V  79

Query  412   ESCSSRMKRELGSTFNMAPFV-FKGIFGIN-ATFTKFYKWNRVIIRYCDGGSFAGDVEKP  585
             E C  R     GS+  M   + F G+ G    T   FY WNR+ +RYCDG SF GDVE  
Sbjct  80    EDCLDRKSNYRGSSTKMEKTMSFSGVLGNKPKTNPDFYNWNRIKVRYCDGSSFTGDVEAV  139

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             DP T L++RGAR+F+ ++D L+AKGMK+A+N + +G SAGGL  ++HCD F S  P G +
Sbjct  140   DPATNLHFRGARVFRAIIDXLLAKGMKNAQNALLSGCSAGGLTSILHCDNFRSLLPVGTK  199

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKCL+D+  F+  K    +++ +  +S++VALH   K+LP  CTS+MSP  CF P+N+V 
Sbjct  200   VKCLADAGYFINAKSLSGSZHIQGFYSEVVALHGSAKNLPASCTSRMSPGLCFFPQNVVP  259

Query  946   YVKSPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQIIS  1104
                +P+F+ ++AYDS+Q++N  +  +      ++  K N  + SP+ +  LQ+++ Q + 
Sbjct  260   QTXTPIFLVNAAYDSWQIKNILAPGVADPKGAWKKCKLNIKNCSPSQLQTLQEYRLQFLK  319

Query  1105  --ALPKPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINL  1269
               A    S++ G  + S F H       +  + ADS      TI +   +W++D+     
Sbjct  320   TIAXSSTSSSHGAFIDSCFAHCQIGTQ-ETWLAADSPMLSKTTIANAVGDWYYDRTAFKK  378

Query  1270  ID  1275
              D
Sbjct  379   FD  380



>ref|XP_007051327.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOX95484.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=458

 Score =   246 bits (627),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 140/365 (38%), Positives = 205/365 (56%), Gaps = 29/365 (8%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             L++P T+I GA  KGAVCLDG+PP YH   G    +++WLI+L GGGWC +         
Sbjct  51    LMVPLTLIQGAASKGAVCLDGTPPGYHLDRGFGSGSNSWLIHLEGGGWCNN---------  101

Query  406   SVESCSSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              + +C  R     GS+  MA    F GI    A     FY WNRV +RYCDG SFAG  E
Sbjct  102   -IRTCVFRKTTRRGSSKFMAKQTNFTGILSNKAEENPDFYNWNRVKLRYCDGASFAG--E  158

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               +   +LY+RG RI+   ++ELMAKGM++A+  + +G SAGGL  ++HCD F   FPK 
Sbjct  159   GQNEANQLYFRGQRIWSAAMEELMAKGMQNAEQALLSGCSAGGLASILHCDEFKDLFPKT  218

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKCLSD+ +FL   +       + ++  +V L    K+LP  CTS+M P  CF P+NL
Sbjct  219   TKVKCLSDAGMFLDATNVAGGHSLRDMYGGVVTLQGVQKNLPNTCTSQMDPTSCFFPQNL  278

Query  940   VQYVKSPLFIFHSAYDSFQVQNTF---SMD---LYRAIK-NRSSISPTDMALLQDFKKQI  1098
             V  +++PLF+ ++AYD++QVQ +    S D    +R  K +RS  + T M  LQDF+ Q+
Sbjct  279   VANIRTPLFLLNAAYDAWQVQESLIPSSADPHGSWRECKMDRSHCNSTQMQFLQDFRSQM  338

Query  1099  ISALP--KPSATKGFIVTSNFGHSFASADYKKRMFADSK----SKTIEDGFYNWFFDKHP  1260
             ++A+     S   G  + S F H    ++ +   + +      +K +     +WFFD+  
Sbjct  339   LNAINVFSKSNQNGLFINSCFAH--CQSERQDTWYENDSPRIGNKAVAVSVGDWFFDRTA  396

Query  1261  INLID  1275
             +  ID
Sbjct  397   VKAID  401



>ref|XP_010244169.1| PREDICTED: protein notum homolog [Nelumbo nucifera]
Length=401

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 135/359 (38%), Positives = 200/359 (56%), Gaps = 25/359 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYH SPG     +NWL++  GG WC +          V SC
Sbjct  33    TYLQSAVAKGAVCLDGSPPAYHMSPGFGAGVNNWLVFFEGGSWCNN----------VTSC  82

Query  421   SSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              +R    LGS+  M   V F GI      F   FY WN++ +RYCDG SF GDVE  +P 
Sbjct  83    LARKNTRLGSSKQMTKEVSFSGILSNKEKFNPDFYNWNKIKVRYCDGSSFTGDVEAVNPA  142

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L++RG RIF  V+++L+AKGMK+AKN +  G SAGGL  ++HCDRF +  P   +VKC
Sbjct  143   TNLHFRGQRIFLAVIEDLLAKGMKNAKNALLTGCSAGGLTAILHCDRFRTLLPASTKVKC  202

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             ++D+  F+  K      + +A ++D+VA HQ  K+LP  CTS+ +P  CF P+ +   + 
Sbjct  203   MADAGFFINAKSVAGTSHIQAFYNDVVATHQSAKNLPASCTSRFNPGLCFFPQYVAPQIS  262

Query  955   SPLFIFHSAYDSFQVQNTFSMDL-------YRAIKNRSSISPTDMALLQDFKKQIISALP  1113
             +PLFI ++AYDS+QV+N  +  +       +    + +  S + + ++Q F+ + +S L 
Sbjct  263   TPLFILNAAYDSWQVKNILAPGVADPHGTWHDCKLDITKCSSSQLQIMQGFRMEFLSTLT  322

Query  1114  K--PSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
             +   S TK   + S + H   +   +  +  DS      +I     +W+FD+     ID
Sbjct  323   RLMGSPTKALFINSCYSHC-QTGTQETWLRDDSPVLDKTSISKAVGDWYFDRSGFQKID  380



>ref|XP_007156331.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
 gb|ESW28325.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
Length=417

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/359 (38%), Positives = 204/359 (57%), Gaps = 25/359 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGS PAYHF  G     +NW+++  GGGWC +          V SC
Sbjct  48    TFVENAVAKGAVCLDGSAPAYHFHKGSGAGINNWIVHFEGGGWCNN----------VTSC  97

Query  421   SSRMKRELGSTFNM-APFVFKGIFGINATFTK-FYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              SR    LGS+  M     F G F  +  F + FY WNR+ +RYCDG SF GDVE  DP 
Sbjct  98    LSRRDTRLGSSKKMDTQLSFSGFFSNSKKFNQDFYDWNRIKVRYCDGSSFTGDVEAVDPR  157

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L++RGAR+F  VV++L+AKGMK+A+N I +G SAGGL  +++CDRF +  P+  +VKC
Sbjct  158   TNLHFRGARVFAAVVEDLLAKGMKNAQNAIISGCSAGGLAAILNCDRFKALLPRTTKVKC  217

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             L+D+  F+ VKD   A+  +  +S +V  H   K+LP  CTS++ P  CF P+N+V  + 
Sbjct  218   LADAGYFINVKDVSGAQRIEEFYSQVVQTHGSAKNLPSSCTSRLKPGLCFFPQNVVSQIS  277

Query  955   SPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQIISALP  1113
             +P+F  ++AYDS+Q++N  +         +R  K +  + SP  ++++Q F+   + A  
Sbjct  278   TPIFFVNAAYDSWQIKNILAPGAADPHGQWRECKLDIKNCSPNQLSVMQVFRTDFLRAFG  337

Query  1114  K--PSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
                 S +KG  +   + H   +   +  +  DS    + TI     +WF+D+   + ID
Sbjct  338   AVGNSPSKGHFIDGCYAHC-QTGTQETWLRNDSPVLGNTTIARAVGDWFYDRRAFHQID  395



>ref|XP_004512351.1| PREDICTED: protein notum homolog isoform X3 [Cicer arietinum]
Length=448

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/363 (38%), Positives = 207/363 (57%), Gaps = 27/363 (7%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P + +  A  KGAVCLDGSPPAYHF  G     ++WL+   GGGWC +          +
Sbjct  29    VPISYVHNAVIKGAVCLDGSPPAYHFDKGFGTGINSWLVQFEGGGWCNN----------I  78

Query  412   ESCSSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKP  585
              +C  R    LGS+  MA    F GI      F   FY WNR+ +RYCDG SF GDVE  
Sbjct  79    TTCLGRKMNRLGSSKQMAKQIAFSGILNNRRLFNPDFYNWNRIKVRYCDGSSFTGDVEIV  138

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +PVTKL++RGAR+F  V++EL+AKGMK+AKN I +G SAGGL  ++HCDRF +  P+G +
Sbjct  139   NPVTKLHFRGARVFNAVMEELLAKGMKNAKNAIISGCSAGGLTSILHCDRFRALLPQGAK  198

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKCLSD+  F+  +D    ++ +  FS +V  H    +LP  CTS+++P  CF P+ +V 
Sbjct  199   VKCLSDAGYFINARDVSGTQHIEQFFSQVVTTHGSANNLPRSCTSRLNPKLCFFPQYVVS  258

Query  946   YVKSPLFIFHSAYDSFQVQNTFSMDL-------YRAIKNRSSISPTDMALLQDFKKQIIS  1104
              + +P+F  ++AYDS+Q++N  +  +       +    + ++ S   + L+Q F+ + + 
Sbjct  259   QITTPIFFVNAAYDSWQIKNILAPGVADPHGHWHSCKMDINNCSSNQLDLMQGFRTEFLR  318

Query  1105  ALP--KPSATKGFIVTSNFGHSFASADYKKRMF-ADS---KSKTIEDGFYNWFFDKHPIN  1266
             AL     S +KG  + S + H     + ++  F +DS      TI     +WF+++   +
Sbjct  319   ALTVLGNSPSKGMFIDSCYAH--CQTEMQETWFRSDSPLLAKTTIAKAVADWFYERRLFH  376

Query  1267  LID  1275
              ID
Sbjct  377   QID  379



>ref|XP_010266383.1| PREDICTED: uncharacterized protein LOC104603916 isoform X1 [Nelumbo 
nucifera]
Length=434

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 138/367 (38%), Positives = 208/367 (57%), Gaps = 32/367 (9%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             L +  T I  +  KGAVCLDGSPPAYH   G     +NWL+++ GGGWCT+         
Sbjct  66    LYVQITYIKSSVAKGAVCLDGSPPAYHLDKGFGSGINNWLVHIEGGGWCTN---------  116

Query  406   SVESCSSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V +C  R    LGS+  M     F GI   N  F   FY WNR+ +RYCDG SF GD+E
Sbjct  117   -VTTCLFRKNTHLGSSKKMVTEIAFSGILSNNKQFNPDFYNWNRIKVRYCDGASFTGDLE  175

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
             K DPVT L+YRGARI+  V+++L+ KGMK+A+  + +G SAGGL  ++HCD F +    G
Sbjct  176   KVDPVTNLHYRGARIWLAVIEDLLKKGMKNAEYALLSGCSAGGLASILHCDSFHALLSIG  235

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKCL+D+  F+ +K+    ++ K+ F+D+V  H   K+LP  CTS M P  CF P+ +
Sbjct  236   TKVKCLADAGYFVNLKEISGREHIKSYFNDVVTTHGSVKNLPTYCTSTMKPSMCFFPQYI  295

Query  940   VQYVKSPLFIFHSAYDSFQVQNT----------FSMDLYRAIKNRSSISPTDMALLQDFK  1089
             V  +++PLF+ ++AYDS+Q++N           + +     IKN SSI    +  +Q F+
Sbjct  296   VHGIRTPLFLLNAAYDSWQIRNILVPGVADPHGYWLSCKLDIKNCSSI---QLQTMQGFR  352

Query  1090  KQIISA-LPKPSATKGFIVTSNFGHSFASADYKKRMFADSK----SKTIEDGFYNWFFDK  1254
              + +SA L + S+++G  + S + H    ++ ++    D      +  I     +W++D+
Sbjct  353   MEFLSALLGQRSSSRGMFINSCYAH--CQSEMQETWLQDDSPVLDNTPIAKAVGDWYYDR  410

Query  1255  HPINLID  1275
                  ID
Sbjct  411   RSFQKID  417



>gb|AGT16732.1| carboxylic ester hydrolase [Saccharum hybrid cultivar R570]
Length=398

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 145/394 (37%), Positives = 208/394 (53%), Gaps = 39/394 (10%)
 Frame = +1

Query  136   WICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSP  315
             W C L+ +L +              +    LL+  T +  A  KGAVCLDGS PAYH + 
Sbjct  10    WCCALVCALAL--------------VAADGLLVDITYVESAVAKGAVCLDGSAPAYHLAR  55

Query  316   GKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAP-FVFKGIFG  492
             G     ++WL++  GGGWC +          V +C  R +  LGS+  M     F GI  
Sbjct  56    GSGSGENSWLVHFEGGGWCNN----------VTTCLQRKRTRLGSSKEMVTQIAFSGILS  105

Query  493   INATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKD  669
                     FY WN+V +RYCDG SF GDVE+ D  TKL+YRGARI+Q V+++L+AKGM  
Sbjct  106   DTPDGNPDFYNWNKVKVRYCDGSSFTGDVEEVDLTTKLHYRGARIWQAVMEDLLAKGMGK  165

Query  670   AKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSD  849
             A+N + +G SAGGL  ++HCDRF    P   RVKCLSD+  F+  KD     Y  A F+D
Sbjct  166   AENALISGCSAGGLTSILHCDRFHDLLPPAARVKCLSDAGFFINEKDVAGVGYIAAFFND  225

Query  850   IVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF------  1011
             +VA H   K+LP  CT  + P  CF P+N V+ +++PLFI ++AYDS+QV+N        
Sbjct  226   VVATHGSAKNLPPSCTLMLPPGMCFFPQNEVKQIQTPLFILNAAYDSWQVRNILVPGVAD  285

Query  1012  -SMDLYRAIKNRSSISPTDMALLQDFKKQIISALPKP--SATKGFIVTSNFGHSFASADY  1182
                  +    +    S + + +LQ F+   +  + +   S ++G  + S F H   S   
Sbjct  286   PHGQWHSCKHDIGQCSASQLRVLQGFRGDFLKEVSEQWISDSRGLFINSCFVHC-QSESQ  344

Query  1183  KKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
             +  + +DS    + TI +   +WFFD+     ID
Sbjct  345   ELWLSSDSPMLGNTTIANAVGDWFFDRSTFQKID  378



>ref|XP_009408703.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=398

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 144/394 (37%), Positives = 208/394 (53%), Gaps = 38/394 (10%)
 Frame = +1

Query  115   VSPRSNDWICLLI--FSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDG  288
             V  +S  W+C LI    L+  +Q    N             +P T++  A  +GAVCLDG
Sbjct  2     VGVKSGTWVCPLICLLYLLAFLQVEGDN-------------VPMTLLKSAVAEGAVCLDG  48

Query  289   SPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAP  468
             SP AY+ +PG    A+NWL+++ GGGWC++          V  C  R     GS+ +M P
Sbjct  49    SPAAYNLAPGSGSGANNWLLFVEGGGWCST----------VNDCVERKGNFRGSSNHMPP  98

Query  469   FVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDE  645
               F G+ G +      FY WNRV IRYCDG SF GD+EK DP T LY+RGAR+++ ++ +
Sbjct  99    VSFSGMLGGVQERNPDFYNWNRVKIRYCDGASFTGDIEKVDPATGLYFRGARVWRAIMKD  158

Query  646   LMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAK  825
             L+A+GM  A+N I  G SAGGL  ++HCD F S  P    VKC SD+  F+  KD   A 
Sbjct  159   LLARGMNKAQNAILGGCSAGGLTTILHCDSFRSLLPANATVKCFSDAGYFIDAKDISGAD  218

Query  826   YFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQN  1005
                + +SD++ LH    +LP  CTS +   +CF P+N+V  +K+PLFI ++AYD +Q++N
Sbjct  219   SILSFYSDVINLHASANNLPSSCTSSLPANKCFFPQNVVATMKTPLFILNAAYDQWQIRN  278

Query  1006  TF---SMDLYRAIKNR----SSISPTDMALLQDFKKQIISALPKP-SATKGFIVTSNFGH  1161
                  S D  +   +        S   +  LQ F+   ++ALP   S++ G  + S   H
Sbjct  279   ILVPNSADTNKTWGDCKLDIKKCSSDQLQTLQGFRTTFLNALPGAGSSSTGMFILSCHTH  338

Query  1162  SFASADYKKRMFADS---KSKTIEDGFYNWFFDK  1254
                S D      ADS    +  I     +W+F +
Sbjct  339   C-QSGDADTWFAADSPRIDNTPIGKAVGDWYFGR  371



>gb|KDO40416.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
 gb|KDO40417.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=324

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 130/336 (39%), Positives = 195/336 (58%), Gaps = 34/336 (10%)
 Frame = +1

Query  115   VSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSP  294
             V+ R   W+ LL+ +L++              ++     +  T +  A  KGAVCLDGSP
Sbjct  2     VAARMGQWLNLLVCALIL--------------LKADGFNVGITYVENAVVKGAVCLDGSP  47

Query  295   PAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPFV  474
             PAYHF  G     +NWL+++ GGGWC +          V +C  R K  LGS+  M   V
Sbjct  48    PAYHFDKGFGAGINNWLVHIEGGGWCNN----------VTTCLERKKTRLGSSKQMVKVV  97

Query  475   -FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDEL  648
              F G+      F   FY WNR+ +RYCDG SF GDVE  +P   L++RGAR+FQ V+++L
Sbjct  98    AFSGMLSNKQKFNPDFYNWNRIKVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMEDL  157

Query  649   MAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKY  828
             MAKGMK+A+N + +G SAGGL  ++HCD F + FP G +VKC +D+  F+  KD   A +
Sbjct  158   MAKGMKNAQNAVLSGCSAGGLTSILHCDNFRALFPVGTKVKCFADAGYFINAKDVSGASH  217

Query  829   FKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNT  1008
              +  ++ +VA H   K LP  CTS++SP  CF P+ + + + +PLFI ++AYDS+Q++N 
Sbjct  218   IEQFYAQVVATHGSAKHLPASCTSRLSPGLCFFPQYMARQITTPLFIINAAYDSWQIKNI  277

Query  1009  FS------MDLYRAIK-NRSSISPTDMALLQ-DFKK  1092
              +         + + K + ++ SPT +  +Q +F+K
Sbjct  278   LAPGVADPHGTWHSCKLDINNCSPTQLQTMQSNFQK  313



>gb|ACJ85294.1| unknown [Medicago truncatula]
 gb|AFK37076.1| unknown [Medicago truncatula]
Length=393

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 135/363 (37%), Positives = 199/363 (55%), Gaps = 23/363 (6%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             + +P T +  A  KGAVCLDGSPPAYHF  G +    NW+++  GGGWC +  T      
Sbjct  26    VTVPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWCNNATT------  79

Query  406   SVESCSSRMKRELGSTFNM-APFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
                 C  R+   LG +  M     F G F     F   FY WNR+ +RYCDG SF GDVE
Sbjct  80    ----CLDRIDTRLGPSKKMDKTLSFSGFFSSGKKFNPDFYNWNRIKVRYCDGSSFTGDVE  135

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               DP T L+YRG RIF  V+++L+AKGMK+AKN I +G SAGGL  ++ CDRF +  P  
Sbjct  136   AVDPKTNLHYRGGRIFVAVIEDLLAKGMKNAKNAILSGCSAGGLTSILQCDRFRTLLPAA  195

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKC+SD+  F+ VK    A + +  +S +V  H   K+LP  CTS++SP  CF P+N+
Sbjct  196   AKVKCVSDAGYFINVKAVSGASHIEQFYSQVVQTHGSAKNLPSSCTSRLSPGLCFFPQNV  255

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQI  1098
                +K+P+F  ++AYDS+Q++N  +  +      +R  K +  S S   ++ +Q F+ + 
Sbjct  256   AAQIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIKSCSANQLSTMQGFRTEF  315

Query  1099  ISALP--KPSATKGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPIN  1266
             + A+     S +KG  +   + H  +     + +  F      TI     +W++D+    
Sbjct  316   LKAISVVSNSPSKGMFIDGCYSHRQTGMQETWMRTDFPVLAKTTIAKAVGDWYYDRSTFQ  375

Query  1267  LID  1275
              ID
Sbjct  376   QID  378



>ref|XP_006385136.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62933.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=391

 Score =   242 bits (618),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 139/360 (39%), Positives = 211/360 (59%), Gaps = 26/360 (7%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             L +  T +  A  KGAVCLDGSPPAYH+  G     ++WLI+  GGGWC +         
Sbjct  28    LYVGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNN---------  78

Query  406   SVESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V SC SR K  LGS+  M     F GI      F   FY WNRV IRYCDG SF GDV+
Sbjct  79    -VTSCLSRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQ  137

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               +P T L++RGARI+  V+++L+ KG+K+A+N + +G SAGGL  ++HCD F +    G
Sbjct  138   AVNPATNLHFRGARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALLRMG  197

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKCLSD+  F+ VKD   A + +  F++IV LH   K+LP+ CTS + P  CF P+ +
Sbjct  198   TKVKCLSDAGYFIKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSVLKPSFCFFPQYV  257

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQI  1098
                V++PLFI ++AYDS+Q++N  +      + ++++ K + ++ SP  +  +QDF+ Q 
Sbjct  258   APQVRTPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQF  317

Query  1099  ISALPKP--SATKGFIVTSNFGHSFASADYKKRMFADSK---SKTIEDGFYNWFFDKHPI  1263
             ++AL K   S+++G  + S + H     + +++ F +      K + D  ++  +   PI
Sbjct  318   LNALNKSTNSSSRGLYIDSCYAH--CQTETQEKWFMEDSPVLGKKVRDCKFSPHYQSSPI  375



>ref|XP_009407792.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=431

 Score =   243 bits (621),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 148/401 (37%), Positives = 212/401 (53%), Gaps = 39/401 (10%)
 Frame = +1

Query  94    PESLRMAVSPRSNDWICLLI--FSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEK  267
             P + RM V  +S  W+C LI    L+  +Q    N             +P T++ GA  +
Sbjct  29    PLNFRM-VGVKSGTWVCPLICLLYLLAFLQVEGDN-------------VPMTLLKGAVAE  74

Query  268   GAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELG  447
             GAVCLDGSP AY+ +PG    A+NWL+++ GGGWC++          V  C  R     G
Sbjct  75    GAVCLDGSPAAYNLAPGSGSGANNWLLFVEGGGWCST----------VNDCVVRKGNFRG  124

Query  448   STFNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARI  624
             S+ +M P  F G+ G +      FY WNRV IRYCDG SF GD+EK DP T LY+RGAR+
Sbjct  125   SSNHMPPVSFSGMLGGVQQRNPDFYNWNRVKIRYCDGASFTGDIEKVDPATGLYFRGARV  184

Query  625   FQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIV  804
             ++ ++ +L+A+GM  A+  +  G SAGGL  ++HCD F S  P    VKC SD+  F+  
Sbjct  185   WRAIMKDLLARGMNKAQKALLGGCSAGGLTTILHCDSFRSLLPASATVKCFSDAGYFIDA  244

Query  805   KDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAY  984
             KD   A   ++ +SD+V LH    +LP  CTS++   +CF P N+V  +K+PLFI ++AY
Sbjct  245   KDISGADSIQSFYSDVVNLHGSANNLPSSCTSRLPANKCFFPLNVVATMKTPLFILNAAY  304

Query  985   DSFQVQNTF---SMDLYRAIKNR----SSISPTDMALLQDFKKQIISALPKP-SATKGFI  1140
             D +Q++N     S D   A  +        S   +  LQ F+   ++ALP   S+  G  
Sbjct  305   DQWQIKNILVPPSADPNNAWGDCKLDIKKCSSDQLQTLQGFRTTFLNALPGAGSSATGLF  364

Query  1141  VTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDK  1254
             + S   H   S D      ADS    +  I     +W+F +
Sbjct  365   ILSCHTHC-QSGDADTWFAADSPRIDNTPIGKAVGDWYFGR  404



>gb|AFK45147.1| unknown [Lotus japonicus]
Length=394

 Score =   242 bits (618),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 136/364 (37%), Positives = 205/364 (56%), Gaps = 25/364 (7%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             + +P T +  A  KGAVCLDGSPPAYHF  G     +NW+++  GG WC +         
Sbjct  25    VAVPTTFVQSAVAKGAVCLDGSPPAYHFHKGFGAGINNWIVHFEGGAWCNN---------  75

Query  406   SVESCSSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V +C +R    LGS+  M+  + F G F     F   FY WNR+ +RYCDG SF GDVE
Sbjct  76    -VTTCLARRDTRLGSSKKMSQTLSFSGFFSNGQKFNPDFYNWNRIKVRYCDGSSFTGDVE  134

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               DP T L++RG RIF  VV++L+A GMK+A+N I +G SAGGL  ++ CDRF S  P  
Sbjct  135   AVDPKTNLHFRGGRIFVAVVEDLLANGMKNAQNAILSGCSAGGLTSILQCDRFRSLIPAA  194

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKCLSD+  F+ +KD   A + + ++S +V  H   K+LP  CTS++ P  CF P+N+
Sbjct  195   AKVKCLSDAGYFINLKDVSGAAHIEQLYSQVVETHGSAKNLPASCTSRLRPGLCFFPQNV  254

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQDFKKQI  1098
                +K+P+   ++AYDS+QV+N  +  +      +R  K +    S   + ++Q F+ + 
Sbjct  255   AGQIKTPISFVNAAYDSYQVKNILAPGVADPHGTWRDCKLDIKKCSSNQLTVMQGFRTEF  314

Query  1099  ISALP--KPSATKGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPI  1263
             + A+   + S +KG  V   + H   +   +  M +DS    + TI     +WF+++   
Sbjct  315   LKAISVVENSPSKGMFVDGCYSHC-QTGMQETWMRSDSPVLANTTIAKAVGDWFYERRSF  373

Query  1264  NLID  1275
             + ID
Sbjct  374   SQID  377



>ref|XP_009407790.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=431

 Score =   243 bits (620),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 142/380 (37%), Positives = 210/380 (55%), Gaps = 43/380 (11%)
 Frame = +1

Query  79    LEANNPESLRMAVSPRSNDWICLLI--FSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIP  252
             + + +P + RM V  +S  W+C LI    L+  +Q    N             +P T++ 
Sbjct  24    VRSASPLNFRM-VGVKSGTWVCPLICLLYLLAFLQVEGDN-------------VPMTVLK  69

Query  253   GADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRM  432
             GA  +GAVCLDGS PAY+ +PG    A+NWL+++ GGGWC++          VE C +R 
Sbjct  70    GAVAEGAVCLDGSAPAYNLAPGSGSGANNWLVFVEGGGWCST----------VEECLARK  119

Query  433   KRELGSTFNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYY  609
                 GS+ +M P  F G+ G +  +   FY WNRV IRYCDG SF GD+EK DP T L++
Sbjct  120   NTFRGSSDHMPPQSFSGMLGGVQQSNPDFYNWNRVKIRYCDGASFTGDIEKVDPATGLHF  179

Query  610   RGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSS  789
             RGAR+++ ++ +L+AKGM  A+  +  G SAGGL  ++HCD F S  P    VKC SD+ 
Sbjct  180   RGARVWRAIMKDLLAKGMNKAQKALLGGCSAGGLTTILHCDNFRSLLPATATVKCFSDAG  239

Query  790   LFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFI  969
              F+  KD   A   ++ + D+V LH    +LP  CTS++   +CF P+N+V  +K+PLFI
Sbjct  240   YFIDAKDISGADAIQSFYGDVVKLHGSANNLPSSCTSRLPANKCFFPQNVVATLKTPLFI  299

Query  970   FHSAYDSFQV-----------QNTFSMDLYRAIKNRSSISPTDMALLQDFKKQIISALPK  1116
              ++AYD +Q+           +NT+  D    IK  SS     +  LQ F+   ++ALP 
Sbjct  300   LNAAYDQWQIDHILVPSSADPKNTWG-DCKLDIKKCSS---DQLQKLQGFRTTFLNALPG  355

Query  1117  P-SATKGFIVTSNFGHSFAS  1173
               S++ G  + S   H  + 
Sbjct  356   AGSSSTGLFILSCHTHCLSG  375



>ref|XP_010325697.1| PREDICTED: uncharacterized protein LOC101260962 [Solanum lycopersicum]
Length=608

 Score =   248 bits (632),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 139/360 (39%), Positives = 209/360 (58%), Gaps = 25/360 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T++  A  +GAVCLDGSPPAYH   G      +W+IYL GGGWC +          +  C
Sbjct  252   TVLHSATAQGAVCLDGSPPAYHLDRGHGTGLHSWVIYLDGGGWCNN----------ISDC  301

Query  421   SSRMKRELGSTFNMAPFVFKG--IFGINATFTKFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
              +R  + LGS+  M    F G  +   +    +F+ WNRV ++YCDG SF GDVE+ +P 
Sbjct  302   LNRSTKFLGSSTKMKRQSFFGGILHNTSKENPEFHNWNRVRVKYCDGASFTGDVEQINPE  361

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
              KLY+RGARIF+ ++++L  KGMK+A+N I  G SAGGL  +++CD+F S  P   RVKC
Sbjct  362   NKLYFRGARIFKAIMEDLWCKGMKNAENAILTGTSAGGLATILNCDKFKSLLPGSARVKC  421

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             ++ +  F+  K      + + ++ +IV+LH   K+LP  CTS M P  CF P+N+V Y++
Sbjct  422   VASAGFFIDGKTITGTSHIQEMYEEIVSLHGSAKNLPSACTSAMEPSLCFFPQNVVSYIQ  481

Query  955   SPLFIFHSAYDSFQVQNTFS---MDLYRA----IKNRSSISPTDMALLQDFKKQ---IIS  1104
             +PLFI +S YDS+Q+ NT     +D   A    IKN SS + + + +++ F  +   I  
Sbjct  482   TPLFIINSVYDSWQINNTLVPSYLDPQHAWKGCIKNISSCTSSQLIIIRAFGVEFLKIFG  541

Query  1105  ALPKPSATKGFIVTSNFGHS--FASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLIDP  1278
             ALP P  T+G+ +TS + H    +++ +         SKTI +   +W+F++     IDP
Sbjct  542   ALP-PCFTRGYFLTSCYSHGDILSTSYWYNTTSPRLLSKTIAEAVGDWYFERAGFQHIDP  600



>ref|XP_008808370.1| PREDICTED: uncharacterized protein LOC103720446 isoform X3 [Phoenix 
dactylifera]
Length=401

 Score =   242 bits (618),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 141/407 (35%), Positives = 217/407 (53%), Gaps = 42/407 (10%)
 Frame = +1

Query  103   LRMAVSPRSNDWICLLIF-SLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVC  279
             + + +  +   WI L I   L+IS++           ++  D  +P T++  A  KGAVC
Sbjct  1     MLVMLGAKPGGWIYLFILLELLISMK-----------VEGFD--VPLTLVQSAVAKGAVC  47

Query  280   LDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFN  459
             LDGSPPAYHF+PG     +NWL+++ GGGWC +          VE C  R K   GS+  
Sbjct  48    LDGSPPAYHFAPGFGSGVNNWLVHMEGGGWCRN----------VEECKERTKNFRGSSKY  97

Query  460   MAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVV  636
             M    F GI G        FY WN+V IRYCDG SF GD+E  +P T L++RGAR+++ +
Sbjct  98    MKQLSFSGILGKKQNLNPDFYNWNKVKIRYCDGSSFTGDIEAVNPATNLHFRGARVWRAI  157

Query  637   VDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPE  816
             +D+L+AK M  A+N + +G SAGGL  ++HCD F    P G RVKC SD+  F+  KD  
Sbjct  158   IDDLLAKRMNKAQNALLSGCSAGGLASILHCDSFRDLVPAGARVKCFSDAGYFINGKDVS  217

Query  817   RAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQ  996
               +  K  ++ +   H   K+LP  CTS+  P  CF P+ +VQ +++PLFI ++AYD++Q
Sbjct  218   GKESIKDFYNQVATTHGSAKNLPSSCTSRFPPSMCFFPQYVVQSMRTPLFILNAAYDAWQ  277

Query  997   VQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQIISALP--KPSATKGFIVTS  1149
             ++N  +        ++   K +    S   + ++Q F+ Q ++AL     S++ G  + S
Sbjct  278   IKNILAPSPSDPRKVWGECKLDIKKCSSNQLQVMQGFRTQFLNALAGFGSSSSTGMFINS  337

Query  1150  NFGHSFASADYKKRMFADSKSKTIE-----DGFYNWFFDKHPINLID  1275
              + H  +     +  +  S S  +E         +WF+D+     ID
Sbjct  338   CYAHCQSEM---QETWLSSNSPVLEKIPIAKAVGDWFYDRIAFQKID  381



>ref|XP_004512349.1| PREDICTED: protein notum homolog isoform X1 [Cicer arietinum]
 ref|XP_004512350.1| PREDICTED: protein notum homolog isoform X2 [Cicer arietinum]
Length=487

 Score =   244 bits (624),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 137/363 (38%), Positives = 207/363 (57%), Gaps = 27/363 (7%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P + +  A  KGAVCLDGSPPAYHF  G     ++WL+   GGGWC +          +
Sbjct  68    VPISYVHNAVIKGAVCLDGSPPAYHFDKGFGTGINSWLVQFEGGGWCNN----------I  117

Query  412   ESCSSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKP  585
              +C  R    LGS+  MA    F GI      F   FY WNR+ +RYCDG SF GDVE  
Sbjct  118   TTCLGRKMNRLGSSKQMAKQIAFSGILNNRRLFNPDFYNWNRIKVRYCDGSSFTGDVEIV  177

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +PVTKL++RGAR+F  V++EL+AKGMK+AKN I +G SAGGL  ++HCDRF +  P+G +
Sbjct  178   NPVTKLHFRGARVFNAVMEELLAKGMKNAKNAIISGCSAGGLTSILHCDRFRALLPQGAK  237

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKCLSD+  F+  +D    ++ +  FS +V  H    +LP  CTS+++P  CF P+ +V 
Sbjct  238   VKCLSDAGYFINARDVSGTQHIEQFFSQVVTTHGSANNLPRSCTSRLNPKLCFFPQYVVS  297

Query  946   YVKSPLFIFHSAYDSFQVQNTFSMDL-------YRAIKNRSSISPTDMALLQDFKKQIIS  1104
              + +P+F  ++AYDS+Q++N  +  +       +    + ++ S   + L+Q F+ + + 
Sbjct  298   QITTPIFFVNAAYDSWQIKNILAPGVADPHGHWHSCKMDINNCSSNQLDLMQGFRTEFLR  357

Query  1105  ALP--KPSATKGFIVTSNFGHSFASADYKKRMF-ADS---KSKTIEDGFYNWFFDKHPIN  1266
             AL     S +KG  + S + H     + ++  F +DS      TI     +WF+++   +
Sbjct  358   ALTVLGNSPSKGMFIDSCYAH--CQTEMQETWFRSDSPLLAKTTIAKAVADWFYERRLFH  415

Query  1267  LID  1275
              ID
Sbjct  416   QID  418



>ref|XP_010235852.1| PREDICTED: protein notum homolog isoform X2 [Brachypodium distachyon]
Length=353

 Score =   240 bits (613),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 140/347 (40%), Positives = 201/347 (58%), Gaps = 25/347 (7%)
 Frame = +1

Query  274   VCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGST  453
             +CLDGS PAYH + G      +WL++  GGGWC++          V +C  R    LGS+
Sbjct  1     MCLDGSAPAYHLARGFGSGVDSWLVHFEGGGWCSN----------VTTCLERKNTRLGSS  50

Query  454   FNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIF  627
               MA  V F GI          FY WN+V +RYCDG SF GD E+ DP TKL+YRGAR++
Sbjct  51    KEMAKQVAFSGILSNTPDHNPDFYNWNKVRVRYCDGSSFTGDKEEVDPTTKLHYRGARVW  110

Query  628   QVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVK  807
             Q V+++L+AKGM  A+N + +G SAGGL  ++HCDRF  R P    VKCLSD+  F+ VK
Sbjct  111   QAVMEDLLAKGMDRAENALISGCSAGGLTSVLHCDRFRDRMPVEANVKCLSDAGFFIDVK  170

Query  808   DPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYD  987
             D    K+    F+D+V  H   K+LP  CTSK+ P  C  P+N V+ +++PLFI ++AYD
Sbjct  171   DIAGEKHAADFFNDVVTTHGSAKNLPSSCTSKLPPGMCLFPQNEVKQIQTPLFILNAAYD  230

Query  988   SFQVQNTF----SMDLYRAIKNR-SSISPTDMALLQDFKKQIISALPK--PSATKGFIVT  1146
             S+QV+N      S   +R+ K+  +  S   +  LQ F+   + AL +   S+++G  + 
Sbjct  231   SWQVRNILVPGGSDPHWRSCKHDINQCSEKQLKTLQGFRDDFLKALEEQGSSSSRGLFIN  290

Query  1147  SNFGHSFASADYKKRMFA-DS---KSKTIEDGFYNWFFDKHPINLID  1275
             S F H    ++ ++  FA DS    +K I +   +WF+D+ P   ID
Sbjct  291   SCFAH--CQSEIQEIWFAPDSPVLGNKKIANAIGDWFYDRSPFQEID  335



>ref|XP_008673121.1| PREDICTED: uncharacterized protein LOC100382269 isoform X1 [Zea 
mays]
Length=422

 Score =   242 bits (618),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 143/372 (38%), Positives = 206/372 (55%), Gaps = 25/372 (7%)
 Frame = +1

Query  187   SNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGG  366
             ++P P+P + +L LL       GA EKGAVCLDGSPP YH   G    + +W++YL GG 
Sbjct  46    TDPSPSPELVELTLLT------GAREKGAVCLDGSPPGYHLQRGFGSGSHSWIVYLQGGA  99

Query  367   WCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPFVFKGIF-GINATFTKFYKWNRVIIR  543
             WC+SN T        E+CS R     GS+  M    F GIF         FY WN+V +R
Sbjct  100   WCSSNTT------DTETCSERKMTAYGSSKLMGAVTFDGIFRNQQPQNPDFYNWNKVYVR  153

Query  544   YCDGGSFAGDVE-KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvl  720
             YCDG SF+GD E +    TKL++RG+RI+  VVDELM KGM  A+  + AG SAGGL  L
Sbjct  154   YCDGASFSGDAEGEAQDGTKLFFRGSRIWDAVVDELMGKGMDAAEQALLAGCSAGGLATL  213

Query  721   vHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTS  900
             +HCD F +RFP+ V VKCL D   FL +KD    ++ ++VFS +V L   +  LP  C +
Sbjct  214   LHCDDFRARFPQEVPVKCLPDGGFFLDIKDLSGERHMRSVFSGVVQLQNVSGVLPKRCLA  273

Query  901   KMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQN------TFSMDLYRAIK-NRSSISP  1059
             K  P ECF P  L++ + +P FI +S YDS+Q+ N      +++ D + + + N  + S 
Sbjct  274   KKDPAECFFPAELIKSISTPTFIVNSEYDSWQIANVVAPDGSYTGDAWTSCRDNIRNCSS  333

Query  1060  TDMALLQDFKKQIISALPKPSATK--GFIVTSNFGH-SFASADYKKRMFADS-KSKTIED  1227
               M +L  F+ ++I  L      +  G  V S F H    S+D+     +    ++T+ +
Sbjct  334   EQMDVLHGFRAELIRELKVAEGEREWGLFVDSCFTHCQTQSSDWWHSPTSPRLGNQTVAE  393

Query  1228  GFYNWFFDKHPI  1263
                +W+F +  +
Sbjct  394   AVGDWYFGRRRV  405



>ref|XP_002454426.1| hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
 gb|EES07402.1| hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
Length=398

 Score =   241 bits (616),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 139/365 (38%), Positives = 199/365 (55%), Gaps = 27/365 (7%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             +L+  T +  A  KGAVCLDGS PAYH + G     ++WL++  GGGWC +         
Sbjct  26    VLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSGENSWLVHFEGGGWCNN---------  76

Query  406   SVESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V +C  R +  LGS+  MA    F GI          FY WN+V +RYCDG SF GDVE
Sbjct  77    -VTTCLQRKRTRLGSSKEMATQIAFSGILSDTPDGNPDFYNWNKVKVRYCDGSSFTGDVE  135

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
             + DP TKL++RGARI+Q V+++L+AKGM  A+N + +G SAGGL  ++HCDRF    P  
Sbjct  136   EVDPTTKLHFRGARIWQAVMEDLLAKGMDKAENALISGCSAGGLTSILHCDRFHDLLPLA  195

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              RVKCLSD+  F+  KD     Y  A F+D+V  H    +LP  CTS + P  CF PKN 
Sbjct  196   ARVKCLSDAGFFINEKDVAGVGYIAAFFNDVVTTHGSANNLPPSCTSMLPPGMCFFPKNE  255

Query  940   VQYVKSPLFIFHSAYDSFQVQNTF-------SMDLYRAIKNRSSISPTDMALLQDFKKQI  1098
             V+ + +PLFI ++AYDS+QV+N             +    +    S + + +LQ F+   
Sbjct  256   VKQIHTPLFILNAAYDSWQVRNILVPGVADPHGKWHSCKHDIGQCSASQLRVLQGFRGDF  315

Query  1099  ISALPKP--SATKGFIVTSNFGHSFASADYKKRMFADSKSK----TIEDGFYNWFFDKHP  1260
             +  + +   S ++G  + S F H    ++ ++  F+    K    TI +   +WFF +  
Sbjct  316   LKEVSEQANSDSRGLFINSCFVH--CQSESQELWFSSDSPKLGNTTIANAVGDWFFGRSS  373

Query  1261  INLID  1275
                ID
Sbjct  374   FQKID  378



>gb|KCW72721.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   241 bits (615),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 141/397 (36%), Positives = 215/397 (54%), Gaps = 37/397 (9%)
 Frame = +1

Query  124   RSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAY  303
             R   W+C+     ++S+Q          +I+     +  T +  A  KGAVCLDGSPPAY
Sbjct  5     RLRTWLCV-----ILSIQI---------LIKSEAFNVGITYVQNAVAKGAVCLDGSPPAY  50

Query  304   HFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMA-PFVFK  480
             HF  G    A+NWLI   GG WC +          V +C +R    LGS+  M     F 
Sbjct  51    HFDKGVGAGANNWLILFEGGAWCNN----------VTTCLARRDTRLGSSKQMVKELSFS  100

Query  481   GIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAK  657
             GI      F   FY WN++ +RYCDG SF GDVE  +P T L++RGAR F  +V++LM+K
Sbjct  101   GILSNKQKFNPDFYNWNKIKVRYCDGASFTGDVEAVNPATNLHFRGARAFVAIVEDLMSK  160

Query  658   GMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKA  837
             GM +A+N I +G SAGGL  +++CDRF +  P   +VKCL+D+  F+  KD   A + + 
Sbjct  161   GMSNAQNAILSGCSAGGLAAILNCDRFRALMPARTKVKCLADAGYFINAKDVSGASHIEN  220

Query  838   VFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFSM  1017
              +S++VA H   K+LP  CTSKM P  CF P+N+V  +++PLFI ++AYD++Q++N  + 
Sbjct  221   FYSEVVATHGSAKNLPTSCTSKMKPGLCFFPQNVVPQIQTPLFIINAAYDAWQIKNILAP  280

Query  1018  DL------YRAIK-NRSSISPTDMALLQDFKKQIISALPK--PSATKGFIVTSNFGHSFA  1170
              +      + + K +    SP  + ++QDF+ + + AL     S ++G  + S   H  A
Sbjct  281   GVADPHGTWNSCKLDIKKCSPNQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCNTHCQA  340

Query  1171  S--ADYKKRMFADSKSKTIEDGFYNWFFDKHPINLID  1275
                A + +         +I     +W++++     ID
Sbjct  341   GTEATWLRNDSPIVAKTSIAKAVGDWYYERITSQKID  377



>dbj|BAD94756.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
Length=285

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/263 (46%), Positives = 168/263 (64%), Gaps = 12/263 (5%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT           V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTD----------V  73

Query  412   ESCSSRMKRELGST-FNMAPFVFKGIFG-INATFTKFYKWNRVIIRYCDGGSFAGDVEKP  585
              SC+ R     GS+ F    F F GI G   +T   FY WNR+ +RYCDG SF G+VE  
Sbjct  74    ASCNERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVEAV  133

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +P  KL++RGAR+++ VVD+LMAKGMK+A+N I +G SAG L  ++HCD F +  P+   
Sbjct  134   NPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAS  193

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+  KD     Y ++ +S +VALH   KSLPV CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDITGGSYIQSYYSKVVALHGSAKSLPVSCTSKMKPELCFFPQYVVP  253

Query  946   YVKSPLFIFHSAYDSFQVQNTFS  1014
              +++PLF+ ++A+DS+Q++N  +
Sbjct  254   SMRTPLFVINAAFDSWQIKNVLA  276



>gb|KHG23648.1| Notum [Gossypium arboreum]
Length=395

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 136/363 (37%), Positives = 205/363 (56%), Gaps = 32/363 (9%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDG+PPAYH+  G     ++WLI L GGGWC +          V
Sbjct  28    VPITYVQSAVAKGAVCLDGTPPAYHWDKGYGTGINSWLIQLEGGGWCNN----------V  77

Query  412   ESCSSRMKRELGSTFNMAPFV-FKGIFGINATFTKFYKWNRVIIRYCDGGSFAGDVEKPD  588
              SC  R    LGS+  M   + F GI         FY WNR+ +RYCDG SF GDV   +
Sbjct  78    SSCLVRKNTHLGSSKRMVKQIPFSGIL----NNKHFYNWNRIKVRYCDGSSFTGDVAAVN  133

Query  589   PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRV  768
             PV  L++RGAR++  V+++L++KGM++A+N I +G SAGGL  ++HCD F +  P G +V
Sbjct  134   PVANLHFRGARVWLAVMEDLLSKGMRNAENAILSGCSAGGLASILHCDSFRALLPMGTKV  193

Query  769   KCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQY  948
             KC+SD+  F+  +D     Y +  F  +VA H   K+L   CTS+M P  CF P+ + Q 
Sbjct  194   KCISDAGYFINTRDVSGGHYIQTFFDQLVATHGSAKNLLPSCTSRMKPGLCFFPQYIAQQ  253

Query  949   VKSPLFIFHSAYDSFQVQNTFSMDLYRAIKNRSSIS-------PTDMALLQDFKKQIISA  1107
             +++PLFI ++AYDS+Q++N  +  +     +  S         P+ + ++QDF+ Q + A
Sbjct  254   IRTPLFIINAAYDSWQIRNILAPGIADPHGHWESCKLDIKNCLPSQIKVMQDFRLQFLVA  313

Query  1108  LPK--PSATKGFIVTSNFGHSFASADYKKRMFAD-----SKSKTIEDGFYNWFFDKHPIN  1266
             L +   SA++G  + S F H     + ++  F       +K+K I     +WF+D++P  
Sbjct  314   LLRLGKSASRGMFIDSCFAH--CQTEMQELWFMQDSPLLNKTK-IGKAVGDWFYDRNPFQ  370

Query  1267  LID  1275
              ID
Sbjct  371   KID  373



>ref|XP_006413981.1| hypothetical protein EUTSA_v10024796mg [Eutrema salsugineum]
 gb|ESQ55434.1| hypothetical protein EUTSA_v10024796mg [Eutrema salsugineum]
Length=564

 Score =   246 bits (627),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 137/354 (39%), Positives = 202/354 (57%), Gaps = 23/354 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGS PAYHF  G     +NW++++ GGGWCT           V
Sbjct  24    VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGINNWIVHMEGGGWCTD----------V  73

Query  412   ESCSSRMKRELGST-FNMAPFVFKGIFGINA-TFTKFYKWNRVIIRYCDGGSFAGDVEKP  585
              SC  R     GS+ F    F F GI G    T   FY WNR+ +RYCDG SF G+VE  
Sbjct  74    ASCIKRKGTMKGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGNVEAV  133

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +P  KL++RGAR+++ V+D+LMAKGMK+A+N I +G SAG L  ++HCD F +  P+  R
Sbjct  134   NPANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTAR  193

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+  KD     Y ++ +S +VALH   KSLP+ CTSKM P  CF P+ +V 
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPLSCTSKMRPELCFFPQYVVP  253

Query  946   YVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIK----NRSSISPTDMALLQDFKKQIIS  1104
             ++++PLF+ ++A+DS+Q++N     ++D  +  K    +    S   +  +Q F+ Q++ 
Sbjct  254   FMRTPLFVINAAFDSWQIKNVLAPTAVDKRKEWKTCKLDLKKCSAAQLKTVQGFRDQMMR  313

Query  1105  ALPKPSAT--KGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDK  1254
             AL    +T  +G  + S   H    ++A +         +  I     NWF+ +
Sbjct  314   ALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQVANTKIAKAVGNWFYGR  367



>ref|XP_008365238.1| PREDICTED: uncharacterized protein LOC103428882 [Malus domestica]
Length=311

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/289 (43%), Positives = 179/289 (62%), Gaps = 19/289 (7%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T++  A  KGAVCLDGS PAYHF  G     +NWL+++ GGGWC +          VE C
Sbjct  30    TLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHVEGGGWCNT----------VEDC  79

Query  421   SSRMKRELGSTFNMAPFV-FKGIFGIN-ATFTKFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
               R     GS+  M   + F G+ G    T   FY WNR+ +RYCDG SF GDVE  DP 
Sbjct  80    LDRKSNYRGSSTKMEKTMSFSGVLGNKPKTNPDFYNWNRIKVRYCDGSSFTGDVEAVDPA  139

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T L++RGAR+F+ ++D L+AKGMK+A+N + +G SAGGL  ++HCD F S  P G +VKC
Sbjct  140   TNLHFRGARVFRAIIDXLLAKGMKNAQNALLSGCSAGGLTSILHCDNFRSLLPVGTKVKC  199

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             L+D+  F+  K    +++ +  +S++VALH   K+LP  CTS+MSP  CF P+N+V   +
Sbjct  200   LADAGYFINAKSLSGSZHIQGFYSEVVALHGSAKNLPASCTSRMSPGLCFFPQNVVPQTR  259

Query  955   SPLFIFHSAYDSFQVQNTFSMDL------YRAIK-NRSSISPTDMALLQ  1080
             +P+F+ ++AYDS+Q++N  +  +      ++  K N  + SP+ +  LQ
Sbjct  260   TPIFLVNAAYDSWQIKNILAPGVADPKGAWKKCKLNIKNCSPSQLQTLQ  308



>ref|XP_002280816.3| PREDICTED: protein notum homolog [Vitis vinifera]
Length=408

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 140/376 (37%), Positives = 205/376 (55%), Gaps = 35/376 (9%)
 Frame = +1

Query  193   PIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWC  372
             P P P++ DL      T+IPGA  +GAVCLDG+ P YHF PG    A++WLI L GGGWC
Sbjct  38    PSPNPLMVDL------TLIPGAAARGAVCLDGTLPGYHFHPGFGSGANSWLIQLEGGGWC  91

Query  373   TSNDTYSTHDLSVESCSSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRY  546
              +          ++SC  R     GS+  M     F GI    A     F+ WNRV +RY
Sbjct  92    NN----------IKSCVFRKTTRRGSSKYMEKTLAFTGILSNKAEENPDFFNWNRVKLRY  141

Query  547   CDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvH  726
             CDG SF+G  E  +  T LY+RG RIF+  ++ELM+KGMK+A   + +G SAGGL  ++H
Sbjct  142   CDGASFSG--EGQNKATGLYFRGQRIFEAGMEELMSKGMKNADQALLSGCSAGGLASILH  199

Query  727   CDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKM  906
             CD F   FPK  +VKCLSD+  FL   D       + +++ +V+L    K+LP  CT+++
Sbjct  200   CDEFGDLFPKTTKVKCLSDAGFFLDATDAAGGHTMRNLYAGVVSLQGVEKNLPSTCTTRL  259

Query  907   SPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIK----NRSSISPTD  1065
              P  CF P+NL+  +K+PLF+ ++AYD++Q Q +    S D +   K    N  + + T 
Sbjct  260   DPTSCFFPENLIDNIKTPLFLLNAAYDAWQFQESLVPSSADPHGEWKGCKLNHVNCNSTQ  319

Query  1066  MALLQDFKKQIISALP--KPSATKGFIVTSNFGHSFASADYKKRMFADSK----SKTIED  1227
             +  LQDF+ +++  +         G  + S F H     + +   FAD       + I +
Sbjct  320   IQFLQDFRMEMLDDVKGFARDDQNGLFINSCFAH--CQTELQDTWFADDSPFLGKRKIAE  377

Query  1228  GFYNWFFDKHPINLID  1275
                +W+FD+ P+  ID
Sbjct  378   SVGDWYFDRRPVKAID  393



>ref|XP_010536210.1| PREDICTED: uncharacterized protein LOC104811251 [Tarenaya hassleriana]
Length=391

 Score =   241 bits (614),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 136/366 (37%), Positives = 200/366 (55%), Gaps = 23/366 (6%)
 Frame = +1

Query  232   IPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSV  411
             +P T +  A  KGAVCLDGSPPAYHF  G     +NW++++ GGGWC  ND        +
Sbjct  24    VPITYLDSAVAKGAVCLDGSPPAYHFDKGSGSGVNNWIVHMEGGGWC--ND--------I  73

Query  412   ESCSSRMKRELGST-FNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKP  585
              SCS R     GS+ F    F F GI G   +    FY WNR+ +RYCDG SF GDVE  
Sbjct  74    ASCSERKNTMKGSSKFMNKDFGFSGILGSKQSSNPDFYNWNRIKVRYCDGSSFTGDVEAV  133

Query  586   DPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVR  765
             +P  KL++RGAR+++ V+D+LMAKGM  A+N I +G SAG L  ++HCD+F +  P    
Sbjct  134   NPSNKLFFRGARVWRAVIDDLMAKGMNKAQNAILSGCSAGALAAILHCDQFRAILPSSAN  193

Query  766   VKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQ  945
             VKC+SD+  F+  KD     Y ++ +S +VALH   K LP  CTS   P  CF P+ +  
Sbjct  194   VKCVSDAGYFIHGKDISGGSYIESYYSKVVALHGSAKGLPESCTSTTKPELCFFPQYVAP  253

Query  946   YVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIKN----RSSISPTDMALLQDFKKQIIS  1104
              +++PLF+ ++A+DS+Q++N     ++D  +  KN        +   +  +Q F+ Q+++
Sbjct  254   SMRTPLFVVNAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCTAAQLQTVQGFRDQMLN  313

Query  1105  ALP--KPSATKGFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLI  1272
             AL   +  A+ G  + S   H    ++A +            I     +WF D+ P   +
Sbjct  314   ALAPVQSMASGGLFLDSCHAHCQGGSAASWSGSQGPSVDDTKIAKAVGDWFNDRSPFKKM  373

Query  1273  DPNNVP  1290
             D    P
Sbjct  374   DCPTYP  379



>ref|XP_008238011.1| PREDICTED: protein notum homolog isoform X1 [Prunus mume]
Length=401

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 141/390 (36%), Positives = 208/390 (53%), Gaps = 36/390 (9%)
 Frame = +1

Query  151   IFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDED  330
             +F L  +V  + +  +P  I          T +  A  KGAVCLDGSPPAYH   G    
Sbjct  10    LFLLACAVTLLKAAGVPVEI----------TYVHSAIAKGAVCLDGSPPAYHHDKGFGSG  59

Query  331   ASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNM-APFVFKGIFGINATF  507
              +NWL+++ GGGWC +          V +C  R    LGS+  M     F GI      F
Sbjct  60    INNWLVHIEGGGWCNN----------VTTCLGRKNTRLGSSKQMLKAIAFSGILSNRKMF  109

Query  508   T-KFYKWNRVIIRYCDGGSFAGDVEKPDP-VTKLYYRGARIFQVVVDELMAKGMKDAKNV  681
                FY WNR+ +RYCDG SF GDV   +P  T LY+RGARIF+ V+++L+AKGM +A+N 
Sbjct  110   NPDFYNWNRIKVRYCDGASFTGDVAAVNPQATGLYFRGARIFRAVIEDLLAKGMGNAQNA  169

Query  682   IFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVAL  861
             I +G SAGGL  ++HCD F +  P G  VKC+SD+  F+ VKD   A++ +  FS +V  
Sbjct  170   ILSGCSAGGLTSILHCDNFHALLPVGTNVKCVSDAGYFINVKDVSGAQHIEEFFSQVVET  229

Query  862   HQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFSMDL------  1023
             H   ++LP  CTSK+ P  CF P+ +   +++ +F  ++AYDS+Q++N  +  +      
Sbjct  230   HGSARNLPPSCTSKLRPGLCFFPQYMASQIRTRIFFVNAAYDSWQIKNILAPGVADPHGT  289

Query  1024  -YRAIKNRSSISPTDMALLQDFKKQIISALPKPSAT--KGFIVTSNFGHSFASADYKKRM  1194
              +    +  + SPT +  +QDF+ Q +SA+   +    KG  + S + H       +  +
Sbjct  290   WHECKLDIKNCSPTQLKAMQDFRVQFLSAIGGMTGCPLKGMFIDSCYAHCQTELQ-ETWL  348

Query  1195  FADS---KSKTIEDGFYNWFFDKHPINLID  1275
              ADS      TI     +WF+ + P   ID
Sbjct  349   MADSPVLNKTTIAQAVGDWFYGRTPFQKID  378



>ref|XP_006432878.1| hypothetical protein CICLE_v100013712mg, partial [Citrus clementina]
 gb|ESR46118.1| hypothetical protein CICLE_v100013712mg, partial [Citrus clementina]
Length=276

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 175/296 (59%), Gaps = 26/296 (9%)
 Frame = +1

Query  115  VSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSP  294
            V+ R   W+ LL+ +L++              ++     +  T +  A  KGAVCLDGSP
Sbjct  2    VAARMGQWLNLLVCALIL--------------LKADGFNVGITYVENAVVKGAVCLDGSP  47

Query  295  PAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPFV  474
            PAYHF  G     +NWL+++ GGGWC +          V +C  R K  LGS+  M   V
Sbjct  48   PAYHFDKGFGAGINNWLVHIEGGGWCNN----------VTTCLERKKTRLGSSKQMVKVV  97

Query  475  -FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDEL  648
             F G+      F   FY WNR+ +RYCDG SF GDVE  +P   L++RGAR+FQ V+++L
Sbjct  98   AFSGMLSNKQKFNPDFYNWNRIKVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMEDL  157

Query  649  MAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKY  828
            MAKGMK+A+N + +G SAGGL  ++HCD F + FP G +VKC +D+  F+  KD   A +
Sbjct  158  MAKGMKNAQNAVLSGCSAGGLTSILHCDNFRALFPVGTKVKCFADAGYFINAKDVSGASH  217

Query  829  FKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQ  996
             +  ++ +VA H   K LP  CTS++SP  CF P+ + + + +PLFI ++AYDS+Q
Sbjct  218  IEQFYAQVVATHGSAKHLPASCTSRLSPGLCFFPQYMARQITTPLFIINAAYDSWQ  273



>ref|XP_004970864.1| PREDICTED: protein notum homolog isoform X1 [Setaria italica]
Length=415

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 140/356 (39%), Positives = 193/356 (54%), Gaps = 23/356 (6%)
 Frame = +1

Query  229   LIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLS  408
             L+  T++ GA EKGAVCLDGSPP YH   G    A NWL+YL GGGWC +          
Sbjct  47    LVELTLLAGAREKGAVCLDGSPPGYHLQRGSGSGAHNWLVYLQGGGWCNT----------  96

Query  409   VESCSSRMKRELGSTFNMAPFVFKGIF-GINATFTKFYKWNRVIIRYCDGGSFAGDVEKP  585
              +SCS R   E GS+  M    F GI    +     F+ WN V+IRYCDG SFAGD E  
Sbjct  97    TKSCSERKMTEFGSSKFMEAVEFTGILSNRHRENPDFHNWNIVVIRYCDGASFAGDAEGE  156

Query  586   D-PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGV  762
             D   TKL++RG RI++ VVDELMAKG+  AK  +  G SAG L  L+HCD F  RFPK V
Sbjct  157   DLDGTKLFFRGLRIWEAVVDELMAKGLDTAKQAMLTGCSAGSLAALLHCDNFRERFPKDV  216

Query  763   RVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLV  942
              VKCLSD+  F+  KD    +  +++ + IV L    ++LP  C +   P ECF P  L+
Sbjct  217   SVKCLSDAGFFIDEKDLSGERSLRSLINGIVHLQNVREALPKGCLANKDPTECFFPPELI  276

Query  943   QYVKSPLFIFHSAYDSFQVQNTFSMDLYRAIKNRSS-------ISPTDMALLQDFKKQII  1101
             + + +P FI +S YDS+Q++N  + +     +  SS        S T + +L  F+K+++
Sbjct  277   KSISTPTFILNSDYDSWQIRNALAPNGSYPGQAWSSCKADIRNCSSTQIDVLHGFRKKLV  336

Query  1102  SALPKPSATK--GFIVTSNFGHSFA--SADYKKRMFADSKSKTIEDGFYNWFFDKH  1257
             S L      +  G  + S F H        +  R+     +KTI +   +W+F + 
Sbjct  337   SELKVAEHNRDWGLFIDSCFTHCQTPFRISWISRISPRLGNKTIAEAVGDWYFGRR  392



>ref|XP_004300391.1| PREDICTED: protein notum homolog [Fragaria vesca subsp. vesca]
Length=399

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 148/398 (37%), Positives = 215/398 (54%), Gaps = 38/398 (10%)
 Frame = +1

Query  124   RSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAY  303
             R   W+ LL+ S ++    + +  +P  I          TI+  A  KGAVCLDGSPPAY
Sbjct  5     RLGQWLNLLVCSALL----LKATGVPVGI----------TILQTAVAKGAVCLDGSPPAY  50

Query  304   HFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPFV-FK  480
             H+  G     +NWL+++ GGGWC +          V +C  R    LGS+  M   + F 
Sbjct  51    HWDKGFGSGLNNWLVHIEGGGWCHN----------VTNCLGRKNTRLGSSKKMLKEIPFS  100

Query  481   GIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAK  657
             GI     +    FY WNR+ +RYCDG SF GDV   DP T LY+RGAR+F+ V+ +L+AK
Sbjct  101   GILSNRQSLNPGFYNWNRIKVRYCDGSSFTGDVAAVDPATGLYFRGARVFRAVMADLLAK  160

Query  658   GMKDAKNVIFaggsagglgvlvHCDRFTSRF-PKGVRVKCLSDSSLFLIVKDPERAKYFK  834
             GM  A N + +G SAGGL  ++HCD F + F P G +VKC+SD+  F+ VKD   A++ +
Sbjct  161   GMGKAVNAVLSGCSAGGLTSILHCDNFRALFLPSGTKVKCVSDAGYFINVKDISGAQHVQ  220

Query  835   AVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFS  1014
               F+DIV  H   K+LP  CTSK+ P  CF P+ +V  +++P+F  ++AYDS+Q++N   
Sbjct  221   EYFTDIVTTHGSAKNLPPSCTSKLRPDLCFFPQYVVPQIRTPIFYVNAAYDSWQIKNIVV  280

Query  1015  MDL------YRAIK-NRSSISPTDMALLQDFKKQIISALP--KPSATKGFIVTSNFGHSF  1167
               +      +R  K +  + SPT +  +Q+F+ Q +SA+     SA KG  + S + H  
Sbjct  281   PGVADPHGTWRNCKLDIKNCSPTQLKTMQNFRLQFLSAIGGVSNSAVKGMFIDSCYLHCQ  340

Query  1168  ASADYKKRMFADS--KSKTIEDGFYNWFFDKHPINLID  1275
                     M         TI     +WF+D+     ID
Sbjct  341   TELQETWSMPNSPLLNKTTIARAVGDWFYDRTSFQKID  378



>ref|XP_004953591.1| PREDICTED: protein notum homolog isoform X2 [Setaria italica]
Length=315

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/264 (47%), Positives = 164/264 (62%), Gaps = 12/264 (5%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             LL+  T +  A  KGAVCLDGS PAYH + G     ++WL++  GGGWC++         
Sbjct  29    LLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSGVNSWLVHFEGGGWCSN---------  79

Query  406   SVESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V +C  R +  LGS+  MA    F GI      +   FY WN+V +RYCDG SF GDVE
Sbjct  80    -VTTCLQRKRTRLGSSKEMATQIAFSGILSDTPDYNPDFYNWNKVKVRYCDGSSFTGDVE  138

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
             + DP TKL+YRGARI+Q V+++L+AKGM  A+N + +G SAGGL  ++HCDRF    P G
Sbjct  139   EVDPTTKLHYRGARIWQAVMEDLLAKGMDKAENALISGCSAGGLTSILHCDRFHDLLPLG  198

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              RVKCLSD+  F+  KD     Y  A F+D+V  H   K+LP  CTS + P  CF P N 
Sbjct  199   ARVKCLSDAGFFINEKDVAGVGYIAAFFNDVVTTHGSAKNLPSSCTSILPPGVCFFPSNE  258

Query  940   VQYVKSPLFIFHSAYDSFQVQNTF  1011
             V+ +++PLFI ++AYD +QV+N  
Sbjct  259   VKQIQTPLFILNAAYDYWQVRNIL  282



>ref|XP_002280865.3| PREDICTED: protein notum homolog [Vitis vinifera]
Length=410

 Score =   240 bits (613),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 146/380 (38%), Positives = 209/380 (55%), Gaps = 35/380 (9%)
 Frame = +1

Query  181   VNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAG  360
             +   P P P++ DL      T+IPGA  KGAVCLDG+ P YHF PG    A++WLI L G
Sbjct  36    LEETPSPNPLMVDL------TLIPGAAAKGAVCLDGTLPGYHFHPGFGSGANSWLIQLEG  89

Query  361   GGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRV  534
             GGWC  ND        ++SC  R     GS+  M     F GI    A     F+ WNRV
Sbjct  90    GGWC--ND--------IKSCVFRKATRRGSSKYMEKTLAFTGILSNKAEENPDFFNWNRV  139

Query  535   IIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglg  714
              +RYCDG SF+G  E  +    LY+RG RIF+  ++ELM+KGMK+A   + +G SAGGL 
Sbjct  140   ELRYCDGASFSG--EGQNEAAGLYFRGQRIFEAGMEELMSKGMKNADQALLSGCSAGGLA  197

Query  715   vlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVEC  894
              ++HCD F   FP+  +VKCLSD+  FL V D       +  ++ +V+L    K+LP  C
Sbjct  198   SILHCDEFGGLFPETTKVKCLSDAGFFLDVTDAAGGHTIRNFYAGVVSLQGVEKNLPSTC  257

Query  895   TSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTF---SMD---LYRAIK-NRSSI  1053
              S+  P  CF P+NLV  +K+PLF+ ++AYD++Q   +    S+D    + A K N+S+ 
Sbjct  258   ISRFDPTSCFFPENLVDNIKTPLFLLNAAYDTWQFHQSLVPSSVDPHGEWNACKSNQSNC  317

Query  1054  SPTDMALLQDFKKQIISALPKPSA--TKGFIVTSNFGHSFASADYKKRMFADSK----SK  1215
             + T + LLQDF+ +++  +   +     G  + S F H     + +   FAD       K
Sbjct  318   NSTQIQLLQDFRMEMLDDVKSFARDDQNGLFINSCFVH--CQTERQDTWFADDSPLIGKK  375

Query  1216  TIEDGFYNWFFDKHPINLID  1275
              I +   +W+FD+ P+  ID
Sbjct  376   KIAESVGDWYFDRRPVKAID  395



>ref|NP_974575.2| putative pectinacetylesterase [Arabidopsis thaliana]
 gb|AEE84179.1| putative pectinacetylesterase [Arabidopsis thaliana]
Length=365

 Score =   239 bits (609),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 138/352 (39%), Positives = 197/352 (56%), Gaps = 31/352 (9%)
 Frame = +1

Query  271   AVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGS  450
             AVCLDGSPPAYH   G     ++WLI L GGGWC +          V +C SRM   LGS
Sbjct  6     AVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCNN----------VTNCVSRMHTRLGS  55

Query  451   TFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARI  624
             +  M     F  I      +   FY WNRV +RYCDG SF GDVE  +P T L++RGAR+
Sbjct  56    SKKMVENLAFSAILSNKKQYNPDFYNWNRVKVRYCDGASFTGDVEAVNPATNLHFRGARV  115

Query  625   FQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIV  804
             +  V+ EL+AKGM +A+N + +G SAGGL  L+HCD F +  P G +VKCLSD+  FL  
Sbjct  116   WLAVMQELLAKGMINAENAVLSGCSAGGLASLMHCDSFRALLPMGTKVKCLSDAGFFLNT  175

Query  805   KDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAY  984
             +D    +Y K  F D+V LH   K+LP  CTS+++P  CF P+ + + +++PLFI ++AY
Sbjct  176   RDVSGVQYIKTYFEDVVTLHGSAKNLPRSCTSRLTPAMCFFPQYVARQIRTPLFILNAAY  235

Query  985   DSFQVQNTF---SMDLYRA-------IKNRSSISPTDMALLQDFKKQIISAL--PKPSAT  1128
             DS+Q++N     + D Y         IKN     P+ + ++QDF+ + +SA+     S++
Sbjct  236   DSWQIKNILAPRAADPYGKWQSCQLDIKN---CHPSQIKVMQDFRLEFLSAVIGLGRSSS  292

Query  1129  KGFIVTSNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
             +G  + S + H   +       + DS      TI     +W +D+     ID
Sbjct  293   RGMFIDSCYTHC-QTETQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKID  343



>ref|XP_007163258.1| hypothetical protein PHAVU_001G219200g [Phaseolus vulgaris]
 gb|ESW35252.1| hypothetical protein PHAVU_001G219200g [Phaseolus vulgaris]
Length=405

 Score =   240 bits (612),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 137/365 (38%), Positives = 203/365 (56%), Gaps = 29/365 (8%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             LL+P T+IPGA  KGAVCLDG+ P YHF PG    A++W+I L GGGWC +         
Sbjct  40    LLVPLTLIPGAASKGAVCLDGTLPGYHFHPGFGSGANSWVIQLEGGGWCNT---------  90

Query  406   SVESCSSRMKRELGST-FNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              + SC  R     GS+ F      F GI    A     F+ WNRV +RYCDG SF+GD +
Sbjct  91    -IRSCVFRKTTRRGSSKFMEKQLPFTGILSNKAEENPDFFNWNRVKVRYCDGASFSGDSQ  149

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               D   +L +RG +I+Q  ++ELM+KGMK A   + +G SAGGL  ++HCD F + FP  
Sbjct  150   --DEAAQLQFRGQKIWQAAMEELMSKGMKQANQALLSGCSAGGLASIIHCDEFRTLFPTS  207

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKCLSD+ LFL   D    +  + +F  +V L +  K+LP  C +++ P  CF P+NL
Sbjct  208   TKVKCLSDAGLFLDAVDVSGVRTLRNLFGGVVKLQEVQKNLPKSCLNQLDPTSCFFPQNL  267

Query  940   VQYVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIK----NRSSISPTDMALLQDFKKQI  1098
             V +V++PLF+ ++AYD++QVQ +    S D + +      NR++ + + +   QDF+ Q+
Sbjct  268   VNHVETPLFLLNAAYDAWQVQESLVPSSADPHGSWNDCKHNRANCNSSQILFFQDFRNQM  327

Query  1099  ISALPKPS--ATKGFIVTSNFGHSFASADYKKRMFADSK----SKTIEDGFYNWFFDKHP  1260
             ++ +   S  +  G  + S F H     + +   FAD         I     +W+FD+  
Sbjct  328   LNYIKGFSGESQTGLFINSCFAH--CQTELQDTWFADDSPVIGHTPIAIAVGDWYFDRKT  385

Query  1261  INLID  1275
             +  ID
Sbjct  386   VKAID  390



>ref|XP_004304922.1| PREDICTED: protein notum homolog [Fragaria vesca subsp. vesca]
Length=399

 Score =   239 bits (609),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 146/402 (36%), Positives = 225/402 (56%), Gaps = 39/402 (10%)
 Frame = +1

Query  136   WICLLIFSLVIS-----VQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPA  300
             W+C++I +   +     VQY +     T II +  L++  T+I GAD KGAVCLDG+ PA
Sbjct  6     WVCIVIATFFSNWVDGFVQYSHEGDPKTEIINN-TLMVSLTLIQGADAKGAVCLDGTLPA  64

Query  301   YHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPFV-F  477
             Y+F  G      NWL++  GGGWC +          +  C +R K +LGS+  M P   F
Sbjct  65    YYFHRGHGSGKKNWLVHFQGGGWCGN----------ITDCVARKKTQLGSSNLMLPETGF  114

Query  478   KGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMA  654
              GI    A     F+ WNRV++  CDG SF+GD E  +   +L +RG RI+   +++LM+
Sbjct  115   TGILSYKAEENPDFFNWNRVMLPSCDGASFSGDSENKE--AQLQFRGHRIWLAAMEKLMS  172

Query  655   KGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFK  834
              GM+ AK  + +G SAGGL  ++HCD+F   F +  +VKCLSD+  FL   D      F+
Sbjct  173   LGMRHAKKALISGCSAGGLTSILHCDKFRGLFRRSTKVKCLSDAGFFLDSVDITGEPTFR  232

Query  835   AVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFS  1014
               FS++V+L    ++LP  CTS + P  CF P+NL+  +K+PLFI +SAYDSFQ Q  FS
Sbjct  233   NFFSNVVSLQAVKENLPHFCTSHLDPTSCFFPQNLLAGIKTPLFILNSAYDSFQFQ--FS  290

Query  1015  M--------DLYRAIK-NRSSISPTDMALLQDFKKQIISALPKPSATK--GFIVTSNFGH  1161
             +         L+ + K N ++ SP+ + +LQ F+ +++ AL   S +K  G  + S + H
Sbjct  291   LVPASADPNGLWNSCKLNVTNCSPSQLHILQGFRSRMLHALKPFSKSKQNGMFINSCYAH  350

Query  1162  SFASADYKKRMFADSKS----KTIEDGFYNWFFDKHPINLID  1275
                 + ++   +A + +    KTI     +W+FD+  + ++D
Sbjct  351   --CQSQFQLTWYAANSTIIGNKTISQSIGDWYFDRAEVKVVD  390



>ref|XP_007163257.1| hypothetical protein PHAVU_001G219200g [Phaseolus vulgaris]
 gb|ESW35251.1| hypothetical protein PHAVU_001G219200g [Phaseolus vulgaris]
Length=453

 Score =   240 bits (613),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/365 (38%), Positives = 203/365 (56%), Gaps = 29/365 (8%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             LL+P T+IPGA  KGAVCLDG+ P YHF PG    A++W+I L GGGWC +         
Sbjct  40    LLVPLTLIPGAASKGAVCLDGTLPGYHFHPGFGSGANSWVIQLEGGGWCNT---------  90

Query  406   SVESCSSRMKRELGST-FNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              + SC  R     GS+ F      F GI    A     F+ WNRV +RYCDG SF+GD +
Sbjct  91    -IRSCVFRKTTRRGSSKFMEKQLPFTGILSNKAEENPDFFNWNRVKVRYCDGASFSGDSQ  149

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               D   +L +RG +I+Q  ++ELM+KGMK A   + +G SAGGL  ++HCD F + FP  
Sbjct  150   --DEAAQLQFRGQKIWQAAMEELMSKGMKQANQALLSGCSAGGLASIIHCDEFRTLFPTS  207

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKCLSD+ LFL   D    +  + +F  +V L +  K+LP  C +++ P  CF P+NL
Sbjct  208   TKVKCLSDAGLFLDAVDVSGVRTLRNLFGGVVKLQEVQKNLPKSCLNQLDPTSCFFPQNL  267

Query  940   VQYVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIK----NRSSISPTDMALLQDFKKQI  1098
             V +V++PLF+ ++AYD++QVQ +    S D + +      NR++ + + +   QDF+ Q+
Sbjct  268   VNHVETPLFLLNAAYDAWQVQESLVPSSADPHGSWNDCKHNRANCNSSQILFFQDFRNQM  327

Query  1099  ISALPKPS--ATKGFIVTSNFGHSFASADYKKRMFADSK----SKTIEDGFYNWFFDKHP  1260
             ++ +   S  +  G  + S F H     + +   FAD         I     +W+FD+  
Sbjct  328   LNYIKGFSGESQTGLFINSCFAH--CQTELQDTWFADDSPVIGHTPIAIAVGDWYFDRKT  385

Query  1261  INLID  1275
             +  ID
Sbjct  386   VKAID  390



>ref|XP_006361594.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=518

 Score =   242 bits (617),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 143/349 (41%), Positives = 196/349 (56%), Gaps = 19/349 (5%)
 Frame = +1

Query  262   EKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRE  441
              +  VCLDG+PPAY++  G  E A+NW+IY  GG WC           +V  C +R   E
Sbjct  171   RRALVCLDGTPPAYYYEKGHGEGANNWIIYFRGGEWC----------YNVMDCLARATTE  220

Query  442   LGSTFNMAP--FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYR  612
              GS+   AP    F GI   N T    FY WNRV++ YCDG SF GDVE  DP+T L++R
Sbjct  221   RGSS-KYAPKQRSFYGILSNNKTINPDFYNWNRVMVIYCDGSSFTGDVEIVDPITNLHFR  279

Query  613   GARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSL  792
             GARIF  +++  + KGMK+AKN I +GGSAGGL  L+HCDRF +  P   RVKCL+D S 
Sbjct  280   GARIFLALIENFLEKGMKNAKNAILSGGSAGGLPALIHCDRFKALLPNSARVKCLADGSY  339

Query  793   FLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIF  972
             FL  K  +   +   V   ++ LH     LP  CTSKM+P  C  P+   Q +K+P FI 
Sbjct  340   FLHRKHKKEMSFMDTVNEGLIKLHHSANMLPSSCTSKMNPSLCLFPQYFQQGIKTPFFIV  399

Query  973   HSAYDSFQVQNTFSMDLYRAIKNRSSISPTDMALLQDFKKQIISALPKP--SATKGFIVT  1146
             +S +D+FQ+  TF         N  S S   +  LQDFK+  ++ALPK   S+++G  + 
Sbjct  400   NSMFDTFQINKTFPGYYEDLFSNTCSASL--VKTLQDFKQDFLNALPKQSNSSSRGMFID  457

Query  1147  SNFGHSFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLIDPNNVPF  1293
             S   HS  ++      F+   +K+I   F +W+FD+    LID  ++P 
Sbjct  458   SCLIHSQITSGVGWNGFS-VHNKSIAKAFSDWYFDRSHEQLIDKPDLPL  505



>gb|KHG30410.1| Protein notum [Gossypium arboreum]
Length=410

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/365 (38%), Positives = 200/365 (55%), Gaps = 29/365 (8%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             L++P T+I GA  KGAVCLDG+ P YH   G    A++W+I+L GGGWC +         
Sbjct  45    LIVPLTLIQGAASKGAVCLDGTLPGYHLHRGFGSGANSWVIHLEGGGWCNT---------  95

Query  406   SVESCSSRMKRELGST-FNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              + +C  R     GS+ F     +F GI    A     FY WNRV +RYCDG SFAG  E
Sbjct  96    -IRTCVFRKTTRRGSSKFMEKSIIFTGILSNKAEENPDFYNWNRVRVRYCDGASFAG--E  152

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               +   KLY+RG RI+   ++ELMAKGM++A   + +G SAGGL  ++HCD F + FP+ 
Sbjct  153   GQNEANKLYFRGQRIWLAAMEELMAKGMQNANQALLSGCSAGGLASILHCDEFKNLFPET  212

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKCLSD+ LFL   +       + ++  +V L    K+LP  CTS+  P  CF P+NL
Sbjct  213   TKVKCLSDAGLFLDATNVAGGHNLRDMYEGVVTLQGVQKNLPSTCTSQKDPTSCFFPQNL  272

Query  940   VQYVKSPLFIFHSAYDSFQVQNTF------SMDLYRAIK-NRSSISPTDMALLQDFKKQI  1098
             V  VK+P+F+ ++AYD++QV  +          L+RA K NRS  +   +   QDF+ Q+
Sbjct  273   VSNVKTPMFLLNAAYDAWQVDQSLIPSLADPHGLWRACKTNRSHCNSLQIQFFQDFRNQM  332

Query  1099  ISALP--KPSATKGFIVTSNFGHSFASADYKKRMFADSK----SKTIEDGFYNWFFDKHP  1260
             ++A+     S   G  + S F H    ++ +   + +      +K I     +WFFD+  
Sbjct  333   LNAVKIFSESNQNGLFINSCFAH--CQSERQDTWYENDSPRIGNKGIAVSVGDWFFDRTA  390

Query  1261  INLID  1275
             +  ID
Sbjct  391   VKAID  395



>ref|XP_010325633.1| PREDICTED: uncharacterized protein LOC101257588 isoform X2 [Solanum 
lycopersicum]
Length=397

 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/365 (38%), Positives = 202/365 (55%), Gaps = 32/365 (9%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             L +  T +     KGAVCLDGSPPAYH   G     ++WLI + GGGWC +         
Sbjct  25    LFVNITYVLSGVAKGAVCLDGSPPAYHHDKGFGTGVNSWLIQMEGGGWCNN---------  75

Query  406   SVESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V +C SR    LGS+  M     F GI      F   FY WNRV + YCDG SF GDV+
Sbjct  76    -VTTCLSRKNTRLGSSKQMVENLAFSGILSNKPQFNPDFYNWNRVKVGYCDGSSFTGDVQ  134

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
             + +P+TKL++RGAR+F  V++EL+AKGMK+A+NV            L     F +  P G
Sbjct  135   EVNPITKLHFRGARVFLAVMEELLAKGMKNAENV-----PPFAFLSLSQMLSFKALLPMG  189

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKC SD+  F+ VKD   A + +  F D+V+LH   K+LP  CTS++ P  CF P+N+
Sbjct  190   AKVKCFSDAGYFIDVKDISGAPHIEEYFRDVVSLHGSAKNLPPVCTSRLKPDLCFFPQNV  249

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFSMDL---YRAIKNRS----SISPTDMALLQDFKKQI  1098
              Q+V++PLF+ ++AYDS+Q++N  + D+   Y    N        S   + ++  ++   
Sbjct  250   AQHVRTPLFLVNAAYDSWQIKNILAPDVADPYGVWLNCKLDILKCSSRQLQIMHGYRLLF  309

Query  1099  ISALPK--PSATKGFIVTSNFGHSFASADYKKRMF-ADS---KSKTIEDGFYNWFFDKHP  1260
             + AL    PS+++G+ + S + H     + ++  + ADS    +KTI     +WF+DK+P
Sbjct  310   LRALNALGPSSSRGYFINSCYAH--CQTEVQETWYRADSPKLANKTIAKALGDWFYDKNP  367

Query  1261  INLID  1275
                ID
Sbjct  368   FQKID  372



>ref|XP_009610135.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=427

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 140/374 (37%), Positives = 205/374 (55%), Gaps = 35/374 (9%)
 Frame = +1

Query  199   PTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTS  378
             PTP      L+I  T+IPGA  +GAVCLDG+ P YH  PG    A++WLI L GGGWC S
Sbjct  59    PTP------LMIGLTLIPGAAARGAVCLDGTLPGYHIHPGSGSGANSWLIQLEGGGWCNS  112

Query  379   NDTYSTHDLSVESCSSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCD  552
                       V +C  R     GS+  M   + F GI    A     F+ WNRV +RYCD
Sbjct  113   ----------VRNCVYRKTTRRGSSKFMEKQIPFTGILSNKAEENPDFFNWNRVKVRYCD  162

Query  553   GGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCD  732
             G SFAGD E  +   +L +RG RI++  + ELM+KGM++A+  + +G SAGGL  ++HCD
Sbjct  163   GASFAGDSE--NKAAQLQFRGQRIWEAAMAELMSKGMRNAQQALLSGCSAGGLASILHCD  220

Query  733   RFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSP  912
              F + FP   +VKCLSD+ LF+   D       + +F  +V++    K+LP  CTSK+ P
Sbjct  221   EFRTLFPSSTKVKCLSDAGLFMDATDVSGGHALRNLFQGVVSVQGLQKTLPSTCTSKLDP  280

Query  913   FECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMA  1071
               CF P+NL+  +K+PLF+ ++AYDS+QVQ++ +        L+   K N    S + + 
Sbjct  281   TSCFFPQNLISNIKTPLFLLNAAYDSWQVQSSLAPPVADPKGLWHDCKLNNEQCSASQIQ  340

Query  1072  LLQDFKKQIISALP--KPSATKGFIVTSNFGHSFASADYKKRMFADSK----SKTIEDGF  1233
              LQ F+  +++A+     S   G  + S F H    ++ +   FAD      +K +    
Sbjct  341   FLQGFRNDMLNAVKGFAASTQNGLFINSCFAH--CQSERQDTWFADDSPLIDNKPVALAV  398

Query  1234  YNWFFDKHPINLID  1275
              +W+FD+  +  ID
Sbjct  399   GDWYFDRAGVKSID  412



>ref|XP_009759657.1| PREDICTED: uncharacterized protein LOC104212153 [Nicotiana sylvestris]
Length=429

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 156/406 (38%), Positives = 228/406 (56%), Gaps = 50/406 (12%)
 Frame = +1

Query  133   DWICLLIFSLVISVQYVNSNPIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFS  312
             D+  +L+ ++++SV Y+ +        +  DL +  TI+  A  KGAVCLDGS PA+HF 
Sbjct  6     DFNLVLMGAVLLSVLYLWTT------TEAEDLYVNTTILYSAIAKGAVCLDGSAPAFHFY  59

Query  313   PGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMAPFV--FKGI  486
             PG      +WLI+L GGGWC +             C +R + +L S    AP V  F G+
Sbjct  60    PGTGSGVYSWLIHLQGGGWCET----------TSDCQNRARSDLSS--KHAPIVAHFSGV  107

Query  487   FGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELM-AKG  660
                +      FY WN V IRYCDG S+ GD+E+ DP T L+YRGARIF+ +++EL+  KG
Sbjct  108   LSNDPQLNPDFYNWNLVKIRYCDGSSYTGDIEEVDPDTNLHYRGARIFEAIMEELLYRKG  167

Query  661   MKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVK----DPERAKY  828
             M  A+N I +G SAGGLG ++HCD+F   FP  VRVKC+SD++ FL VK    +P+  +Y
Sbjct  168   MIYAQNAILSGTSAGGLGAILHCDKFRYFFPLTVRVKCISDAAFFLNVKTITGEPQIEEY  227

Query  829   FKAVFSDIVALHQPNKSLPVECTSKMS-PFECFQPKNLVQYVKSPLFIFHSAYDSFQVQN  1005
             +K V    VALH   K+LP+ CT  ++ P  CF P+   Q+  +PLFI +SAYD+FQ+ +
Sbjct  228   YKRV----VALHGSAKNLPLSCTLSLNDPSLCFFPQYAAQHTYTPLFIINSAYDAFQINH  283

Query  1006  TF------SMDLYRAIK-NRSSISPTDMALLQDFKKQIISALPK--PSATKGFIVTSNFG  1158
             +          ++   K N +S SP+ +  +QDF+   + AL +  PS T+G+ ++S   
Sbjct  284   SLIPSEADPQHVWDYCKGNLNSCSPSQLQTIQDFRLTFLEALNELGPSTTRGYFISSCHS  343

Query  1159  H------SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLIDP  1278
             H      S+ S      +     +KTI +    WFFD+      DP
Sbjct  344   HHGIEIQSYWSYTNSPTL----ANKTIAEAVGGWFFDRSGFQGDDP  385



>ref|XP_008227765.1| PREDICTED: protein notum homolog isoform X2 [Prunus mume]
Length=431

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 138/376 (37%), Positives = 206/376 (55%), Gaps = 29/376 (8%)
 Frame = +1

Query  193   PIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWC  372
             P  T     L+L++P T+I  A  KGAVCLDG+ P YH  PG    A++WLI L GGGWC
Sbjct  55    PTQTQTQPPLNLMVPLTLIDSAASKGAVCLDGTLPGYHLHPGYGSGANSWLIQLEGGGWC  114

Query  373   TSNDTYSTHDLSVESCSSRMKRELGST-FNMAPFVFKGIFGINATFT-KFYKWNRVIIRY  546
              S          + +C  R     GS+ F      F GI    A     F+ WNRV +RY
Sbjct  115   NS----------IRNCVYRKTTRRGSSKFMEKQLPFTGILSNKAEENPDFFNWNRVKLRY  164

Query  547   CDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvH  726
             CDG SF+GD +  +   +L++RG RI+   ++ELM+KGM+ A   + +G SAGGL  ++H
Sbjct  165   CDGASFSGDSQ--NEAAQLHFRGQRIWLAAMEELMSKGMQKADQALLSGCSAGGLASILH  222

Query  727   CDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKM  906
             CD F   FP+  RVKCLSD+ +FL   D       K +++ +V+L +  K+LP  C   +
Sbjct  223   CDEFQDLFPETTRVKCLSDAGMFLDAIDVSGGHTLKNLYAGVVSLQEVQKNLPKTCIDHL  282

Query  907   SPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTD  1065
              P  CF P+NLV  VK+P+F+ ++AYD++QVQ + +        L+ A K N +  + + 
Sbjct  283   DPTSCFFPQNLVANVKTPMFLLNAAYDAWQVQASLAPPSADPRGLWGACKSNHALCNSSQ  342

Query  1066  MALLQDFKKQIISALP--KPSATKGFIVTSNFGHSFASADYKKRMFADSK----SKTIED  1227
             +  LQDF+ Q+++A+     S   G  + S F H    ++ +   FAD      ++ I  
Sbjct  343   IQFLQDFRNQMLNAVRDFSMSTKNGLFINSCFAH--CQSERQDTWFADDSPVLGNRAIAL  400

Query  1228  GFYNWFFDKHPINLID  1275
                +W+FD+ P+  ID
Sbjct  401   SVGDWYFDRLPVKAID  416



>emb|CBI37039.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/364 (37%), Positives = 200/364 (55%), Gaps = 29/364 (8%)
 Frame = +1

Query  229   LIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLS  408
             ++  T+IPGA  +GAVCLDG+ P YHF PG    A++WLI L GGGWC +          
Sbjct  1     MVDLTLIPGAAARGAVCLDGTLPGYHFHPGFGSGANSWLIQLEGGGWCNN----------  50

Query  409   VESCSSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEK  582
             ++SC  R     GS+  M     F GI    A     F+ WNRV +RYCDG SF+G  E 
Sbjct  51    IKSCVFRKTTRRGSSKYMEKTLAFTGILSNKAEENPDFFNWNRVKLRYCDGASFSG--EG  108

Query  583   PDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGV  762
              +  T LY+RG RIF+  ++ELM+KGMK+A   + +G SAGGL  ++HCD F   FPK  
Sbjct  109   QNKATGLYFRGQRIFEAGMEELMSKGMKNADQALLSGCSAGGLASILHCDEFGDLFPKTT  168

Query  763   RVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLV  942
             +VKCLSD+  FL   D       + +++ +V+L    K+LP  CT+++ P  CF P+NL+
Sbjct  169   KVKCLSDAGFFLDATDAAGGHTMRNLYAGVVSLQGVEKNLPSTCTTRLDPTSCFFPENLI  228

Query  943   QYVKSPLFIFHSAYDSFQVQNTF---SMDLYRAIK----NRSSISPTDMALLQDFKKQII  1101
               +K+PLF+ ++AYD++Q Q +    S D +   K    N  + + T +  LQDF+ +++
Sbjct  229   DNIKTPLFLLNAAYDAWQFQESLVPSSADPHGEWKGCKLNHVNCNSTQIQFLQDFRMEML  288

Query  1102  SALP--KPSATKGFIVTSNFGHSFASADYKKRMFADSK----SKTIEDGFYNWFFDKHPI  1263
               +         G  + S F H     + +   FAD       + I +   +W+FD+ P+
Sbjct  289   DDVKGFARDDQNGLFINSCFAH--CQTELQDTWFADDSPFLGKRKIAESVGDWYFDRRPV  346

Query  1264  NLID  1275
               ID
Sbjct  347   KAID  350



>ref|XP_003561153.1| PREDICTED: protein notum homolog [Brachypodium distachyon]
Length=388

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 140/355 (39%), Positives = 198/355 (56%), Gaps = 31/355 (9%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T++ GA EKGAVCLDGSPPAY    G      NWL+YL GGGWC +          +ESC
Sbjct  24    TLLAGATEKGAVCLDGSPPAYQLDRGFGSGRYNWLVYLEGGGWCDT----------IESC  73

Query  421   SSRMKRELGSTFNMAPFVFKGIFGINA-TFTKFYKWNRVIIRYCDGGSFAGDVEKPDP-V  594
             S   K  LGS+  +      GIF  +    + FY WN+V IRYCDG SF+GD E  D   
Sbjct  74    SKHKKSGLGSSNLIEAVQLPGIFSNDHRQNSDFYNWNKVFIRYCDGASFSGDAEGEDQDG  133

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             TKL++RG RI++ V+DELM KG+ +AK  + AG S+GGL VL+HCD F++RFP+ V VKC
Sbjct  134   TKLFFRGLRIWEAVIDELMEKGLANAKQALLAGCSSGGLAVLLHCDNFSARFPQTVPVKC  193

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
              SD+  FL +KD    ++ ++VFS +V L    K LP +C +K  P +CF P  +++ + 
Sbjct  194   FSDAGFFLDIKDISGERFIRSVFSGVVHLQNVRKVLPKDCLAKKEPTDCFFPAEVIKSIN  253

Query  955   SPLFIFHSAYDSFQVQNTFSMDLYRAIK-------NRSSISPTDMALLQDFKKQIISALP  1113
             +P FI +S YDS+Q+QN    D     K       N    +PT +  L  F++ +++ L 
Sbjct  254   TPTFILNSGYDSWQIQNVLVPDETSPEKSWLTCKANIRECNPTQIEALHGFRETLVNDLK  313

Query  1114  --KPSATKGFIVTSNFGHSFASADYKKRMFADS------KSKTIEDGFYNWFFDK  1254
               +     G  + S F H         R+  DS      ++K+I +   +W F +
Sbjct  314   VVQDKEDWGLFIDSCFTH----CQTPFRISWDSPISPRLQNKSIAEAVGDWHFGR  364



>ref|XP_010266380.1| PREDICTED: uncharacterized protein LOC104603915 isoform X1 [Nelumbo 
nucifera]
Length=412

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 141/406 (35%), Positives = 219/406 (54%), Gaps = 33/406 (8%)
 Frame = +1

Query  109   MAVSPRSNDWICLLIFSLVISVQYVNSNPIPTPIIQDLD-LLIPKTIIPGADEKGAVCLD  285
             M   P+S    C++I++   ++ Y+    I T I    +   +  T +  +  KGAVCLD
Sbjct  1     MLAPPQSPTSFCIMIYTRSAALLYL---LICTLITMKANGFFVGITYVENSIAKGAVCLD  57

Query  286   GSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESCSSRMKRELGSTFNMA  465
             GSPPAYH   G     +NWL++L GGGWC++      H  +    S +M +++       
Sbjct  58    GSPPAYHMDKGFGSGINNWLVHLEGGGWCSNVTICLAHKDTRHGSSKKMAKQI-------  110

Query  466   PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPVTKLYYRGARIFQVVVD  642
                F GI      F   FY WN++ +RYCDG SF GDVE  DP   LY RG R++Q V++
Sbjct  111   --AFSGILSNKENFNPDFYNWNKIKVRYCDGSSFTGDVEAIDPANNLYLRGERVWQAVME  168

Query  643   ELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKCLSDSSLFLIVKDPERA  822
             +L+ KGMK+AK  + +G S+GGL  ++HCDRF    P   +VKCLSD+  F+  KD    
Sbjct  169   DLLEKGMKNAKYALLSGCSSGGLAAILHCDRFRELLPVDAKVKCLSDAGYFINAKDVSGK  228

Query  823   KYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQ  1002
              + +A+++D+V  HQ  K+LPV CTS+  P  CF P+N+VQ + + LFI ++AYDS+Q++
Sbjct  229   DHIQAIYNDVVTTHQSAKNLPVSCTSRTEPSLCFFPQNVVQDMYTQLFILNAAYDSWQIK  288

Query  1003  NTFSMDLYRA----------IKNRSSISPTDMALLQDFKKQIISALPK--PSATKGFIVT  1146
             NT +  +             IKN SS   + +  +Q F+ + ++++ +   S+ KG  + 
Sbjct  289   NTLAPGVADPHGHWHYCKLDIKNCSS---SQLQTMQGFRSEFLNSVGELMSSSMKGMFIN  345

Query  1147  SNFGHSFASADYKKRMFADS---KSKTIEDGFYNWFFDKHPINLID  1275
             S + H  +    +  + ADS       I     +W+ D+     ID
Sbjct  346   SCYAHCQSEVQ-ETWLRADSPVLDKTPIAKAVGDWYNDRSDFKKID  390



>ref|XP_008227764.1| PREDICTED: protein notum homolog isoform X1 [Prunus mume]
Length=475

 Score =   239 bits (611),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 138/376 (37%), Positives = 206/376 (55%), Gaps = 29/376 (8%)
 Frame = +1

Query  193   PIPTPIIQDLDLLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWC  372
             P  T     L+L++P T+I  A  KGAVCLDG+ P YH  PG    A++WLI L GGGWC
Sbjct  55    PTQTQTQPPLNLMVPLTLIDSAASKGAVCLDGTLPGYHLHPGYGSGANSWLIQLEGGGWC  114

Query  373   TSNDTYSTHDLSVESCSSRMKRELGST-FNMAPFVFKGIFGINATFT-KFYKWNRVIIRY  546
              S          + +C  R     GS+ F      F GI    A     F+ WNRV +RY
Sbjct  115   NS----------IRNCVYRKTTRRGSSKFMEKQLPFTGILSNKAEENPDFFNWNRVKLRY  164

Query  547   CDGGSFAGDVEKPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvH  726
             CDG SF+GD +  +   +L++RG RI+   ++ELM+KGM+ A   + +G SAGGL  ++H
Sbjct  165   CDGASFSGDSQ--NEAAQLHFRGQRIWLAAMEELMSKGMQKADQALLSGCSAGGLASILH  222

Query  727   CDRFTSRFPKGVRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKM  906
             CD F   FP+  RVKCLSD+ +FL   D       K +++ +V+L +  K+LP  C   +
Sbjct  223   CDEFQDLFPETTRVKCLSDAGMFLDAIDVSGGHTLKNLYAGVVSLQEVQKNLPKTCIDHL  282

Query  907   SPFECFQPKNLVQYVKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTD  1065
              P  CF P+NLV  VK+P+F+ ++AYD++QVQ + +        L+ A K N +  + + 
Sbjct  283   DPTSCFFPQNLVANVKTPMFLLNAAYDAWQVQASLAPPSADPRGLWGACKSNHALCNSSQ  342

Query  1066  MALLQDFKKQIISALP--KPSATKGFIVTSNFGHSFASADYKKRMFADSK----SKTIED  1227
             +  LQDF+ Q+++A+     S   G  + S F H    ++ +   FAD      ++ I  
Sbjct  343   IQFLQDFRNQMLNAVRDFSMSTKNGLFINSCFAH--CQSERQDTWFADDSPVLGNRAIAL  400

Query  1228  GFYNWFFDKHPINLID  1275
                +W+FD+ P+  ID
Sbjct  401   SVGDWYFDRLPVKAID  416



>ref|XP_004970861.1| PREDICTED: protein notum homolog [Setaria italica]
Length=418

 Score =   238 bits (606),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 132/355 (37%), Positives = 197/355 (55%), Gaps = 21/355 (6%)
 Frame = +1

Query  229   LIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLS  408
             L+  T++ GA EKGAVCLDGSPPAYH   G    + +W+++L GG WC+SN T       
Sbjct  53    LVELTLVAGAQEKGAVCLDGSPPAYHLQRGSGSGSQSWIVFLQGGAWCSSNTT-------  105

Query  409   VESCSSRMKRELGSTFNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE-K  582
              E+CS R     GS+  M P  F G+F         FY WN+  +RYCDG SF+G+ E +
Sbjct  106   -ETCSGRKMTAYGSSKFMEPITFDGVFNDQQPQNPDFYNWNKAFVRYCDGASFSGNAEGE  164

Query  583   PDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGV  762
              +  TKLY+RG RI++ V+ ELM KGM  AK  + AG SAGGL  L+HCD F ++FP+ V
Sbjct  165   AEDGTKLYFRGLRIWEAVIAELMGKGMDTAKQALLAGCSAGGLATLLHCDNFRAKFPQEV  224

Query  763   RVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLV  942
              VKC+ D   FL  KD    +  ++VF+ +V L   ++ LP +C +K  P +CF P  L+
Sbjct  225   SVKCVPDGGFFLDAKDLSGERSMRSVFNGVVQLQNVSEVLPKDCLAKKDPTDCFFPAELI  284

Query  943   QYVKSPLFIFHSAYDSFQVQN------TFSMDLYRAIK-NRSSISPTDMALLQDFKKQII  1101
             + + +P FI +S YDS+Q+QN      ++  D +   + N  + S   + +L  F++++I
Sbjct  285   KSISTPTFIVNSEYDSWQIQNVVAPVGSYPGDTWSNCRDNIGNCSSKQIDVLHGFRRKLI  344

Query  1102  SALPKPSATK--GFIVTSNFGHSFA--SADYKKRMFADSKSKTIEDGFYNWFFDK  1254
               L      +  G  + S F H     +  +         +KTI +   +W+F +
Sbjct  345   HELKAAEGKREWGLFIDSCFTHCQTQWNGSWHSPTSPRLDNKTIAEAVGDWYFGR  399



>ref|XP_003609911.1| Pectin acetylesterase [Medicago truncatula]
 gb|AES92108.1| pectinacetylesterase family protein [Medicago truncatula]
Length=421

 Score =   238 bits (606),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 137/362 (38%), Positives = 202/362 (56%), Gaps = 25/362 (7%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             L++  T+I GA  KGAVCLDGS PAYHF  G    +++WLI+L GGGWC +         
Sbjct  56    LMVGLTLINGAAAKGAVCLDGSLPAYHFHRGYGSGSNSWLIHLEGGGWCGT---------  106

Query  406   SVESCSSRMKRELGSTFNMAPFV-FKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              V +C    K   GS++ M   + F GI    A     F+ WNRV IRYCDG SF+GD +
Sbjct  107   -VRNCIYSKKTRHGSSYFMEKQIPFIGILSNKAAENPDFFNWNRVKIRYCDGASFSGDSQ  165

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               +   +LY+RG RI+Q  +++LM+KGM+ AK  + +G SAGGL  ++HCD F   FP+ 
Sbjct  166   --NEAARLYFRGQRIWQAAMEDLMSKGMRYAKQALLSGCSAGGLSAILHCDEFRELFPRT  223

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              RVKC SD+ LFL   D    +  + +F  +V L   +KSLP  CT+ ++P  CF P++L
Sbjct  224   TRVKCFSDAGLFLDSVDVSGRRSLRNLFGSVVTLQGAHKSLPRSCTNHLNPILCFFPQHL  283

Query  940   VQYVKSPLFIFHSAYDSFQVQNT-------FSMDLYRAIKNRSSISPTDMALLQDFKKQI  1098
             +  V++PLF+ ++AYD++Q+Q +       +  + Y   KN +  S   +  LQ F+ Q+
Sbjct  284   IASVRTPLFLLNAAYDTWQIQASLAPPSADYHWNWYDCRKNYARCSSPQIQYLQGFRNQM  343

Query  1099  ISALPKPSATK--GFIVTSNFGH--SFASADYKKRMFADSKSKTIEDGFYNWFFDKHPIN  1266
             +    + S ++  G  + S F H  S     +  R      +K I D   NWFFD+  + 
Sbjct  344   LRVTRRFSRSRQNGLFINSCFAHCQSERQDTWHARGSPHIGNKGIADSVGNWFFDRVGVQ  403

Query  1267  LI  1272
              I
Sbjct  404   AI  405



>ref|XP_011074219.1| PREDICTED: protein notum homolog [Sesamum indicum]
Length=387

 Score =   236 bits (603),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 136/354 (38%), Positives = 195/354 (55%), Gaps = 19/354 (5%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +P A  KGAVCLDGSPPAY+F  G  +   NW+I+L GGGWC SN          + C
Sbjct  37    TFLPSAISKGAVCLDGSPPAYYFRKGFGDGIDNWVIFLEGGGWCASN----------KGC  86

Query  421   SSRMKRELGST-FNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKPDPV  594
               R     GST        FK I   N T    FY WNRV + YCDG S+ GDVE+    
Sbjct  87    LDRTNMSTGSTKLKEKRHYFKDILSSNHTINPNFYNWNRVYVGYCDGSSYTGDVEENTYP  146

Query  595   TKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVKC  774
             T+   RGA+IF VV+++++A+GMK+AKN I +GGSAG  G ++HCD F    PK  RVKC
Sbjct  147   TR---RGAKIFDVVMEDMLAQGMKNAKNAILSGGSAGAWGAILHCDGFRKLIPKASRVKC  203

Query  775   LSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYVK  954
             +SDS  F+  K+   AK  +  F+D++A H+ NK LP  CTSKM+   C  P+N+++ +K
Sbjct  204   ISDSGFFIHAKNLYGAKKREEYFADLIAYHRSNKFLPASCTSKMNASLCLFPENIIKDIK  263

Query  955   SPLFIFHSAYDSFQVQNTFSMD---LYRAIKNRSSISPTDMALLQDFKKQIISALPK-PS  1122
             +P+F   SA+D +Q++  +  D       + N    +PT + +++D++   I  L    S
Sbjct  264   TPIFFLESAFDYYQLKEHYFSDDPTWKICVDNLKVCTPTQLQIMKDYRATFIKELQGVKS  323

Query  1123  ATKGFIVTSNFGHSFASADYKKRMFADSKSKTIEDGFYNWFFDKHPINLIDPNN  1284
             ++ G  V S + H                +KT+ +   +W+FD+     ID  N
Sbjct  324   SSTGIFVHSCYRHGHLHEREGWDKSPKLGNKTVAEAISDWYFDRSSFQEIDTQN  377



>ref|XP_007205243.1| hypothetical protein PRUPE_ppa006114mg [Prunus persica]
 gb|EMJ06442.1| hypothetical protein PRUPE_ppa006114mg [Prunus persica]
Length=426

 Score =   237 bits (605),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 139/365 (38%), Positives = 204/365 (56%), Gaps = 30/365 (8%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             L++  T+I GA  KGAVCLDG+ PAYH  PG    A++WLI+L GG WC  ND       
Sbjct  65    LMVELTLIEGAGAKGAVCLDGTLPAYHLHPGHGSGANSWLIHLEGGAWC--ND-------  115

Query  406   SVESCSSRMKRELGSTFNMA-PFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
              + SCS+R     GS+  M     F GI    A    +F+ WNRV++RYCDG SF+GD E
Sbjct  116   -IRSCSNRKNSAYGSSSLMEKERAFTGILSNEAEDNPEFFNWNRVMLRYCDGASFSGDSE  174

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               +    L +RG RI+   +++LM KGM+ A   +  GGSAGGL  ++HCD F   FP  
Sbjct  175   NKE--ANLQFRGQRIWLSAMEDLMLKGMRYANQALLTGGSAGGLASILHCDEFRGLFPTT  232

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKC+SD+  FL   D    +  + +++ +V L    ++LP  CTS + P  CF P+NL
Sbjct  233   TKVKCMSDAGFFLDAVDISGGRTLRNLYTGVVGLQGVQENLPHYCTSHLDPTSCFFPENL  292

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFS-------MDLYRAIKNRSSISPTDMALLQDFKKQI  1098
             +  + +PLFI ++AYDS+Q+QN+ +        D      N +S SP+ M  LQ F+ Q+
Sbjct  293   IANITTPLFILNAAYDSWQIQNSLAPLSADPHGDWNGCRLNLASCSPSQMQFLQGFRNQM  352

Query  1099  ISALPKPSAT--KGFIVTSNFGHSFASADYKKRMFA-DS---KSKTIEDGFYNWFFDKHP  1260
             + AL + S +   G  + S + H       +   FA DS    +KTI +   +W+FD+  
Sbjct  353   LDALKQFSMSDQNGMFINSCYVHGQTG---QGAWFAPDSPAVGNKTIAEAVGDWYFDRAE  409

Query  1261  INLID  1275
             + ++D
Sbjct  410   VKVVD  414



>ref|XP_009142580.1| PREDICTED: protein notum homolog [Brassica rapa]
 emb|CDX80060.1| BnaA05g00960D [Brassica napus]
Length=413

 Score =   237 bits (604),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 135/365 (37%), Positives = 200/365 (55%), Gaps = 29/365 (8%)
 Frame = +1

Query  226   LLIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDL  405
             L++P T+I GA  KGAVCLDG+ P YH   G    A+ WLI L GGGWC +         
Sbjct  49    LMVPLTLIQGAASKGAVCLDGTLPGYHLHRGLGSGANRWLIQLEGGGWCNTR--------  100

Query  406   SVESCSSRMKRELGSTFNMAP-FVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVE  579
                SC  R     GS+ +M     F GI    A     F+ WNRV +RYCDG SF GD E
Sbjct  101   --RSCIFRKTTRRGSSNHMEKVLAFTGILSNKANENPDFFNWNRVKLRYCDGASFTGDSE  158

Query  580   KPDPVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKG  759
               D  ++LYYRG RI+QV ++EL++KGM+ A   + +G SAGGL  ++HCD+F +  P  
Sbjct  159   --DQSSQLYYRGQRIWQVAMEELLSKGMQKADQALLSGCSAGGLASILHCDQFKAVLPGT  216

Query  760   VRVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNL  939
              +VKCLSD+ +F+   D       + +F  +V +    K L   CT  + P  CF P+NL
Sbjct  217   TKVKCLSDAGMFMDAVDVSGGHSLRNMFQGVVTVQNLQKELSTTCTKHLDPTSCFFPQNL  276

Query  940   VQYVKSPLFIFHSAYDSFQVQNTFS------MDLYRAIK-NRSSISPTDMALLQDFKKQI  1098
             V  +K+P+F+ ++AYD++QVQ + +         ++A K + S  + + +   QDF+ Q+
Sbjct  277   VSEIKTPMFLLNAAYDAWQVQESLAPPSADRTGSWKACKSDHSHCNSSQIHFFQDFRSQM  336

Query  1099  ISALP--KPSATKGFIVTSNFGHSFASADYKKRMFA-DSK---SKTIEDGFYNWFFDKHP  1260
             ++A+     SA  G  + S F H    ++ +   FA DS     KT+ +   +W+FD+  
Sbjct  337   VNAVKTFSASAHNGLFINSCFAH--CQSERQDTWFAPDSPKLYGKTVAESVGDWYFDRKT  394

Query  1261  INLID  1275
             +  ID
Sbjct  395   VKAID  399



>ref|XP_008656990.1| PREDICTED: protein notum homolog isoform X2 [Zea mays]
Length=419

 Score =   237 bits (605),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 139/355 (39%), Positives = 190/355 (54%), Gaps = 23/355 (6%)
 Frame = +1

Query  229   LIPKTIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLS  408
             L+  T++ GA  KGAVCLDG+PP YH   G    A NWL++L GGGWC +          
Sbjct  51    LVDLTLLAGARGKGAVCLDGTPPGYHLRRGFGSGAHNWLVFLEGGGWCNT----------  100

Query  409   VESCSSRMKRELGSTFNMAPFVFKGIFGINATFT-KFYKWNRVIIRYCDGGSFAGDVEKP  585
              +SCS R     GS+  M    F GI   + T    FY WN V+IRYCDG SFAGD E  
Sbjct  101   TQSCSERKMTNFGSSKYMGAVNFTGILSNDHTENPDFYNWNTVVIRYCDGASFAGDAEGG  160

Query  586   D-PVTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGV  762
             D   TKL++RG RI++ VVDELM KGM  AK  +  G SAG L  L+HCD F  RFP  V
Sbjct  161   DLDGTKLFFRGLRIWKAVVDELMGKGMDAAKQALLTGCSAGSLAALLHCDNFHGRFPHEV  220

Query  763   RVKCLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLV  942
              VKCLSD+  F+  KD    +  +++ S +V L    + LP +C  K  P ECF P  L+
Sbjct  221   SVKCLSDAGFFIDEKDLSGERSMRSLISGVVHLQNVKEVLPNDCLQKKDPTECFFPAELI  280

Query  943   QYVKSPLFIFHSAYDSFQVQNTFSMDLYRAIKNRSS-------ISPTDMALLQDFKKQII  1101
             + + +P FI +S YDS+Q++N  + +     +  SS        S   + +L  FKK+++
Sbjct  281   KGITTPTFILNSDYDSWQIRNILAPNGSYPGQEWSSCKADIRNCSCAQLDVLHGFKKKLV  340

Query  1102  SALPKPSATK--GFIVTSNFGHSFASAD--YKKRMFADSKSKTIEDGFYNWFFDK  1254
             S L      K  G  + S F H     D  +   +     +K+I +   +W+FD+
Sbjct  341   SELKVAEDNKDWGLFIDSCFTHCQTPFDITWNSPISPRLGNKSISEAVGDWYFDR  395



>gb|EMT14315.1| hypothetical protein F775_08483 [Aegilops tauschii]
Length=400

 Score =   236 bits (603),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 141/357 (39%), Positives = 198/357 (55%), Gaps = 31/357 (9%)
 Frame = +1

Query  241   TIIPGADEKGAVCLDGSPPAYHFSPGKDEDASNWLIYLAGGGWCTSNDTYSTHDLSVESC  420
             T +  A  KGAVCLDGSPPAYH + G    AS+WL++  GGGWC +          V +C
Sbjct  31    TYVESAVAKGAVCLDGSPPAYHLARGSGSGASSWLVHFEGGGWCNN----------VTTC  80

Query  421   SSRMKRELGSTFNMAPFV-FKGIFGINATFT--KFYKWNRVIIRYCDGGSFAGDVEKPDP  591
               R    LGS+  MA  V F GI      +    FY WN+V +RYCDG SF G+ E+ DP
Sbjct  81    LQRSHTRLGSSKEMAKQVAFSGILSNAPEYNPVDFYNWNKVRVRYCDGSSFTGNKEEVDP  140

Query  592   VTKLYYRGARIFQVVVDELMAKGMKDAKNVIFaggsagglgvlvHCDRFTSRFPKGVRVK  771
              T L+YRGAR++Q V+++L+AKGM  A+N + +G SAGGL  ++HCDRF    P    VK
Sbjct  141   RTNLHYRGARVWQAVMEDLLAKGMNKAENALISGCSAGGLTSILHCDRFHRLLPAAANVK  200

Query  772   CLSDSSLFLIVKDPERAKYFKAVFSDIVALHQPNKSLPVECTSKMSPFECFQPKNLVQYV  951
             CLSD+  F+ VKD     +  A FSD+V  H   K+LP  CTSK+    C  P+N V+ +
Sbjct  201   CLSDAGFFINVKDIAGVNHAAAFFSDVVKTHGSVKNLPSLCTSKLPAGMCLFPQNEVKQI  260

Query  952   KSPLFIFHSAYDSFQVQNTF----SMDLYRAIKNR-SSISPTDMALLQD-----FKKQII  1101
             ++PLFI ++AYDS+QV+N      S   +R+ K+     S   + +LQD     F+   +
Sbjct  261   QTPLFILNAAYDSWQVRNILVPGGSDPRWRSCKHDIKQCSAKQLKILQDGADAGFRDHFL  320

Query  1102  SALPKP--SATKGFIVTSNFGHSFASADYKKRMFADSK----SKTIEDGFYNWFFDK  1254
              A+     S T+G  + S F H    ++ ++  FA        K I     +WF+ +
Sbjct  321   EAIEAQGDSPTRGLFINSCFAH--CQSEIQEIWFAPGSPVLGDKRIASAVGDWFYGR  375



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3804414986880