BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25510_g3_i11 len=803 path=[30524:0-11 30536:12-18 12800:19-21
12803:22-99 3239:100-145 25552:146-152 3292:153-158 3298:159-182
3322:183-297 3437:298-307 30848:308-322 20325:323-396 30900:397-404
30908:405-405 30928:406-410 16071:411-522 16183:523-564 8791:565-801
31474:802-802]

Length=803
                                                                      Score     E

ref|XP_010054432.1|  PREDICTED: uncharacterized protein LOC104442733    145   5e-68   
emb|CAN74851.1|  hypothetical protein VITISV_019620                     144   6e-68   Vitis vinifera
ref|XP_009759100.1|  PREDICTED: uncharacterized protein LOC104211704    145   1e-67   
ref|XP_007025937.1|  Cysteine-rich RLK 29, putative                     146   2e-67   
ref|XP_010448759.1|  PREDICTED: cysteine-rich receptor-like prote...    144   3e-67   
ref|XP_009340923.1|  PREDICTED: cysteine-rich receptor-like prote...    142   3e-67   
ref|XP_009137324.1|  PREDICTED: cysteine-rich receptor-like prote...    142   3e-67   
ref|XP_010686956.1|  PREDICTED: cysteine-rich receptor-like prote...    143   4e-67   
emb|CDX94168.1|  BnaC07g38020D                                          144   6e-67   
ref|XP_006365889.1|  PREDICTED: LOW QUALITY PROTEIN: putative cys...    149   7e-67   
ref|XP_010052449.1|  PREDICTED: putative receptor-like protein ki...    143   8e-67   
ref|XP_010644341.1|  PREDICTED: cysteine-rich receptor-like prote...    143   1e-66   
emb|CBI29180.3|  unnamed protein product                                143   1e-66   
ref|XP_009617477.1|  PREDICTED: cysteine-rich receptor-like prote...    142   1e-66   
ref|XP_010686970.1|  PREDICTED: putative receptor-like protein ki...    147   1e-66   
ref|XP_003635322.2|  PREDICTED: cysteine-rich receptor-like prote...    147   2e-66   
ref|XP_010267898.1|  PREDICTED: uncharacterized protein LOC104605002    141   2e-66   
ref|XP_009340924.1|  PREDICTED: cysteine-rich receptor-like prote...    142   2e-66   
ref|XP_006468228.1|  PREDICTED: uncharacterized protein LOC102629057    146   3e-66   
ref|XP_006606024.1|  PREDICTED: serine/threonine kinase-related p...    141   3e-66   
ref|XP_007025939.1|  Cysteine-rich RLK 29                               140   3e-66   
gb|KCW76451.1|  hypothetical protein EUGRSUZ_D00843                     142   3e-66   
ref|XP_009357560.1|  PREDICTED: cysteine-rich receptor-like prote...    142   4e-66   
ref|XP_008224863.1|  PREDICTED: uncharacterized protein LOC103324571    140   4e-66   
ref|XP_002518563.1|  serine-threonine protein kinase, plant-type,...    147   4e-66   Ricinus communis
ref|XP_010059510.1|  PREDICTED: uncharacterized protein LOC104447479    140   5e-66   
ref|XP_006468226.1|  PREDICTED: uncharacterized protein LOC102628483    142   5e-66   
ref|XP_002271125.3|  PREDICTED: cysteine-rich receptor-like prote...    145   5e-66   Vitis vinifera
ref|XP_008441094.1|  PREDICTED: uncharacterized protein LOC103485320    140   6e-66   
ref|XP_003517662.1|  PREDICTED: cysteine-rich receptor-like prote...    140   6e-66   
ref|XP_010090762.1|  Cysteine-rich receptor-like protein kinase 29      145   7e-66   
ref|XP_010041722.1|  PREDICTED: cysteine-rich receptor-like prote...    142   9e-66   
gb|KHN01545.1|  Cysteine-rich receptor-like protein kinase 29           145   1e-65   
ref|XP_006467959.1|  PREDICTED: cysteine-rich receptor-like prote...    141   1e-65   
ref|XP_002872592.1|  predicted protein                                  141   1e-65   
ref|XP_006590217.1|  PREDICTED: cysteine-rich receptor-like prote...    139   1e-65   
ref|XP_010433935.1|  PREDICTED: cysteine-rich receptor-like prote...    142   1e-65   
ref|XP_004145171.1|  PREDICTED: cysteine-rich receptor-like prote...    145   1e-65   
ref|XP_006365883.1|  PREDICTED: cysteine-rich receptor-like prote...    145   1e-65   
ref|XP_006285944.1|  hypothetical protein CARUB_v10007464mg             143   1e-65   
gb|KFK22120.1|  hypothetical protein AALP_AAs48628U000100               141   1e-65   
ref|XP_003589314.1|  Cysteine-rich receptor-like protein kinase         141   2e-65   
ref|XP_003635656.2|  PREDICTED: cysteine-rich receptor-like prote...    140   2e-65   
ref|XP_009768670.1|  PREDICTED: putative receptor-like protein ki...    141   2e-65   
ref|XP_009357379.1|  PREDICTED: cysteine-rich receptor-like prote...    140   2e-65   
ref|XP_008219910.1|  PREDICTED: uncharacterized protein LOC103320073    140   2e-65   
gb|KCW76366.1|  hypothetical protein EUGRSUZ_D00744                     139   2e-65   
gb|KFK23238.1|  hypothetical protein AALP_AAs43447U000100               142   2e-65   
ref|XP_006449131.1|  hypothetical protein CICLE_v10014521mg             141   2e-65   
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    140   3e-65   
emb|CAC84518.1|  putative receptor-like serine-threonine protein ...    140   3e-65   Solanum tuberosum [potatoes]
ref|XP_010247617.1|  PREDICTED: cysteine-rich receptor-like prote...    142   3e-65   
emb|CAC83607.1|  putative receptor-like serine-threonine protein ...    140   3e-65   Solanum tuberosum [potatoes]
ref|XP_006603573.1|  PREDICTED: cysteine-rich receptor-like prote...    139   3e-65   
emb|CAC83606.1|  putative receptor-like serine-threonine protein ...    140   3e-65   Solanum tuberosum [potatoes]
emb|CBI23395.3|  unnamed protein product                                142   3e-65   
ref|XP_008224864.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    144   3e-65   
gb|KDO37598.1|  hypothetical protein CISIN_1g008238mg                   141   3e-65   
ref|XP_009785802.1|  PREDICTED: putative receptor-like protein ki...    139   4e-65   
emb|CAC84552.1|  putative receptor-like serine-threonine protein ...    140   4e-65   Solanum tuberosum [potatoes]
ref|XP_003635675.2|  PREDICTED: cysteine-rich receptor-like prote...    138   4e-65   
ref|XP_008439953.1|  PREDICTED: cysteine-rich receptor-like prote...    140   4e-65   
gb|KHN15824.1|  Cysteine-rich receptor-like protein kinase 10           141   4e-65   
ref|XP_009785801.1|  PREDICTED: putative receptor-like protein ki...    139   4e-65   
ref|NP_567678.1|  cysteine-rich receptor-like protein kinase 6          141   4e-65   Arabidopsis thaliana [mouse-ear cress]
emb|CAA18461.1|  serine/threonine kinase-like protein                   141   4e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010052402.1|  PREDICTED: putative receptor-like protein ki...    139   5e-65   
ref|XP_007143168.1|  hypothetical protein PHAVU_007G049400g             143   5e-65   
gb|AAD21872.1|  receptor-like protein kinase homolog RK20-1             143   5e-65   Phaseolus vulgaris [French bean]
gb|KHN02670.1|  Cysteine-rich receptor-like protein kinase 25           138   5e-65   
gb|KDP20815.1|  hypothetical protein JCGZ_21286                         138   5e-65   
emb|CDX94167.1|  BnaC07g38010D                                          143   5e-65   
ref|XP_009357385.1|  PREDICTED: cysteine-rich receptor-like prote...    139   6e-65   
ref|XP_010655950.1|  PREDICTED: cysteine-rich receptor-like prote...    138   6e-65   
ref|XP_006449119.1|  hypothetical protein CICLE_v10014496mg             142   6e-65   
ref|XP_009134241.1|  PREDICTED: putative cysteine-rich receptor-l...    142   6e-65   
ref|XP_007011084.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    140   6e-65   
ref|XP_006365888.1|  PREDICTED: cysteine-rich receptor-like prote...    144   6e-65   
ref|XP_011096160.1|  PREDICTED: cysteine-rich receptor-like prote...    147   7e-65   
ref|XP_008345332.1|  PREDICTED: cysteine-rich receptor-like prote...    140   7e-65   
ref|XP_008358736.1|  PREDICTED: cysteine-rich receptor-like prote...    138   7e-65   
gb|KHN30448.1|  Cysteine-rich receptor-like protein kinase 10           144   7e-65   
ref|NP_001238492.1|  cysteine-rich protein precursor                    144   8e-65   
ref|XP_010267802.1|  PREDICTED: putative receptor-like protein ki...    146   8e-65   
ref|XP_004145170.1|  PREDICTED: polygalacturonase-like                  140   8e-65   
ref|XP_010439215.1|  PREDICTED: cysteine-rich receptor-like prote...    144   8e-65   
gb|KHG16271.1|  Cysteine-rich receptor-like protein kinase 25           139   8e-65   
ref|XP_010267803.1|  PREDICTED: cysteine-rich receptor-like prote...    146   8e-65   
ref|XP_007025935.1|  Cysteine-rich RLK 29, putative isoform 1           139   8e-65   
ref|XP_010456864.1|  PREDICTED: putative cysteine-rich receptor-l...    138   9e-65   
ref|XP_002518562.1|  ATP binding protein, putative                      139   9e-65   Ricinus communis
ref|XP_010059160.1|  PREDICTED: cysteine-rich receptor-like prote...    140   1e-64   
emb|CBI35335.3|  unnamed protein product                                138   1e-64   
ref|XP_003637959.1|  Cysteine-rich receptor-like protein kinase         142   1e-64   
ref|XP_003638007.1|  Cysteine-rich receptor-like protein kinase         142   1e-64   
ref|XP_007025964.1|  Cysteine-rich RLK 29, putative                     140   1e-64   
ref|XP_003635466.1|  PREDICTED: putative receptor-like protein ki...    139   1e-64   
gb|KDO37422.1|  hypothetical protein CISIN_1g005846mg                   142   1e-64   
gb|KEH43966.1|  cysteine-rich receptor-kinase-like protein              142   1e-64   
ref|XP_010057675.1|  PREDICTED: putative receptor-like protein ki...    140   1e-64   
ref|XP_006413574.1|  hypothetical protein EUTSA_v10024843mg             140   1e-64   
gb|AES98412.2|  cysteine-rich receptor-kinase-like protein              138   1e-64   
ref|XP_006467962.1|  PREDICTED: cysteine-rich receptor-like prote...    142   1e-64   
ref|XP_003615454.1|  Cysteine-rich receptor-like protein kinase         137   1e-64   
ref|XP_006449120.1|  hypothetical protein CICLE_v10014504mg             142   1e-64   
ref|XP_010668063.1|  PREDICTED: cysteine-rich receptor-like prote...    142   1e-64   
gb|KCW74848.1|  hypothetical protein EUGRSUZ_E03585                     140   1e-64   
gb|KDO37423.1|  hypothetical protein CISIN_1g005846mg                   142   2e-64   
ref|XP_009357384.1|  PREDICTED: cysteine-rich receptor-like prote...    139   2e-64   
ref|XP_010668062.1|  PREDICTED: cysteine-rich receptor-like prote...    142   2e-64   
ref|XP_010646899.1|  PREDICTED: cysteine-rich receptor-like prote...    138   2e-64   
ref|XP_009360784.1|  PREDICTED: cysteine-rich receptor-like prote...    145   2e-64   
ref|XP_009340920.1|  PREDICTED: cysteine-rich receptor-like prote...    139   2e-64   
ref|XP_008349286.1|  PREDICTED: cysteine-rich receptor-like prote...    137   2e-64   
emb|CDY13268.1|  BnaC09g23880D                                          140   2e-64   
gb|KHN01544.1|  Cysteine-rich receptor-like protein kinase 8            145   2e-64   
ref|XP_006343408.1|  PREDICTED: cysteine-rich receptor-like prote...    138   2e-64   
ref|XP_010439226.1|  PREDICTED: cysteine-rich receptor-like prote...    138   2e-64   
ref|XP_010059664.1|  PREDICTED: cysteine-rich receptor-like prote...    137   2e-64   
ref|XP_009338731.1|  PREDICTED: cysteine-rich receptor-like prote...    137   2e-64   
ref|XP_007143184.1|  hypothetical protein PHAVU_007G050600g             140   2e-64   
gb|KEH40073.1|  cysteine-rich receptor-kinase-like protein              141   2e-64   
ref|XP_009338737.1|  PREDICTED: cysteine-rich receptor-like prote...    137   2e-64   
ref|XP_009338745.1|  PREDICTED: cysteine-rich receptor-like prote...    137   2e-64   
ref|XP_009364729.1|  PREDICTED: cysteine-rich receptor-like prote...    138   3e-64   
ref|XP_009626038.1|  PREDICTED: putative receptor-like protein ki...    139   3e-64   
ref|XP_009364708.1|  PREDICTED: cysteine-rich receptor-like prote...    138   3e-64   
emb|CBI35672.3|  unnamed protein product                                138   3e-64   
gb|KDP20816.1|  hypothetical protein JCGZ_21287                         140   3e-64   
ref|XP_010247618.1|  PREDICTED: putative receptor-like protein ki...    144   3e-64   
gb|KDO75602.1|  hypothetical protein CISIN_1g006155mg                   138   3e-64   
gb|KCW75002.1|  hypothetical protein EUGRSUZ_E03765                     140   3e-64   
ref|XP_010057978.1|  PREDICTED: cysteine-rich receptor-like prote...    137   3e-64   
ref|XP_004155666.1|  PREDICTED: cysteine-rich receptor-like prote...    139   4e-64   
ref|XP_009626039.1|  PREDICTED: putative receptor-like protein ki...    139   4e-64   
ref|XP_006606014.1|  PREDICTED: cysteine-rich receptor-like prote...    140   4e-64   
ref|XP_006606016.1|  PREDICTED: cysteine-rich receptor-like prote...    137   4e-64   
ref|XP_006283252.1|  hypothetical protein CARUB_v10004288mg             142   4e-64   
gb|KHN15823.1|  Cysteine-rich receptor-like protein kinase 10           141   4e-64   
ref|XP_006449133.1|  hypothetical protein CICLE_v10014789mg             138   4e-64   
ref|XP_007025958.1|  Cysteine-rich RLK 29, putative                     142   4e-64   
gb|KFK30807.1|  hypothetical protein AALP_AA6G028400                    141   4e-64   
ref|XP_003592436.1|  Cysteine-rich receptor-like protein kinase         143   4e-64   
ref|XP_008225008.1|  PREDICTED: uncharacterized protein LOC103324687    144   4e-64   
gb|KHN15831.1|  Cysteine-rich receptor-like protein kinase 29           144   4e-64   
ref|XP_006606026.1|  PREDICTED: cysteine-rich receptor-like prote...    141   4e-64   
ref|XP_002867718.1|  predicted protein                                  142   5e-64   
ref|XP_008340068.1|  PREDICTED: cysteine-rich receptor-like prote...    137   5e-64   
ref|XP_006606025.1|  PREDICTED: cysteine-rich receptor-like prote...    141   5e-64   
ref|XP_006383968.1|  hypothetical protein POPTR_0004s02560g             139   5e-64   
emb|CDP20318.1|  unnamed protein product                                137   5e-64   
ref|XP_011098665.1|  PREDICTED: putative receptor-like protein ki...    145   5e-64   
ref|XP_009124034.1|  PREDICTED: cysteine-rich receptor-like prote...    142   5e-64   
ref|XP_003592435.1|  Cysteine-rich receptor-like protein kinase         143   5e-64   
ref|XP_011004252.1|  PREDICTED: putative receptor-like protein ki...    138   5e-64   
gb|KCW75000.1|  hypothetical protein EUGRSUZ_E03762                     136   5e-64   
ref|XP_011098674.1|  PREDICTED: putative receptor-like protein ki...    145   5e-64   
gb|AAN60348.1|  unknown                                                 142   5e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010057745.1|  PREDICTED: cysteine-rich receptor-like prote...    136   6e-64   
ref|XP_011004254.1|  PREDICTED: putative receptor-like protein ki...    138   6e-64   
gb|AES98408.2|  cysteine-rich receptor-kinase-like protein              140   6e-64   
ref|XP_003592434.1|  Cysteine-rich receptor-like protein kinase         142   6e-64   
gb|KCW75006.1|  hypothetical protein EUGRSUZ_E03770                     140   6e-64   
ref|XP_009340921.1|  PREDICTED: cysteine-rich receptor-like prote...    137   6e-64   
emb|CDY01595.1|  BnaC07g35850D                                          141   6e-64   
ref|XP_010247620.1|  PREDICTED: cysteine-rich receptor-like prote...    143   6e-64   
ref|NP_567679.2|  cysteine-rich receptor-like protein kinase 10         142   6e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011096162.1|  PREDICTED: cysteine-rich receptor-like prote...    142   6e-64   
ref|XP_007143171.1|  hypothetical protein PHAVU_007G049600g             141   6e-64   
ref|XP_006606015.1|  PREDICTED: cysteine-rich receptor-like prote...    140   6e-64   
ref|XP_008225006.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    137   6e-64   
gb|KCW76452.1|  hypothetical protein EUGRSUZ_D00844                     137   7e-64   
ref|NP_849426.1|  cysteine-rich receptor-like protein kinase 6          138   7e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004496792.1|  PREDICTED: cysteine-rich receptor-like prote...    139   7e-64   
ref|XP_007226138.1|  hypothetical protein PRUPE_ppa014741mg             136   7e-64   
ref|XP_009136929.1|  PREDICTED: cysteine-rich receptor-like prote...    143   7e-64   
emb|CDY41246.1|  BnaA01g12930D                                          143   7e-64   
ref|XP_003615450.1|  Cysteine-rich receptor-like protein kinase         140   7e-64   
emb|CBI41018.3|  unnamed protein product                                139   7e-64   
ref|XP_007213903.1|  hypothetical protein PRUPE_ppa003904mg             137   7e-64   
ref|XP_009137321.1|  PREDICTED: cysteine-rich receptor-like prote...    137   7e-64   
ref|XP_009357380.1|  PREDICTED: cysteine-rich receptor-like prote...    136   7e-64   
emb|CAA18465.1|  serine/threonine kinase-like protein                   141   7e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010059136.1|  PREDICTED: putative cysteine-rich receptor-l...    144   8e-64   
ref|XP_003635308.1|  PREDICTED: cysteine-rich receptor-like prote...    139   8e-64   
ref|XP_003555319.1|  PREDICTED: cysteine-rich receptor-like prote...    139   8e-64   
ref|XP_008224858.1|  PREDICTED: cysteine-rich receptor-like prote...    137   8e-64   
ref|XP_004232751.1|  PREDICTED: putative receptor-like protein ki...    140   9e-64   
ref|XP_010686957.1|  PREDICTED: putative receptor-like protein ki...    139   9e-64   
ref|XP_002869784.1|  hypothetical protein ARALYDRAFT_492546             143   9e-64   
ref|XP_006283285.1|  hypothetical protein CARUB_v10004321mg             141   9e-64   
ref|XP_002518554.1|  ATP binding protein, putative                      139   9e-64   Ricinus communis
ref|XP_004134968.1|  PREDICTED: cysteine-rich receptor-like prote...    140   9e-64   
ref|XP_004297920.1|  PREDICTED: cysteine-rich receptor-like prote...    136   1e-63   
gb|KCW75004.1|  hypothetical protein EUGRSUZ_E03766                     136   1e-63   
ref|XP_009136737.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    139   1e-63   
ref|XP_002518561.1|  ATP binding protein, putative                      142   1e-63   Ricinus communis
ref|XP_010054433.1|  PREDICTED: cysteine-rich receptor-like prote...    138   1e-63   
gb|KCW74371.1|  hypothetical protein EUGRSUZ_E03051                     137   1e-63   
ref|XP_010052450.1|  PREDICTED: putative receptor-like protein ki...    137   1e-63   
gb|KEH43963.1|  cysteine-rich receptor-kinase-like protein              140   1e-63   
ref|XP_008224868.1|  PREDICTED: LOW QUALITY PROTEIN: putative rec...    136   1e-63   
ref|XP_008370580.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    138   1e-63   
ref|XP_003637963.1|  Cysteine-rich receptor-like protein kinase         140   1e-63   
gb|KHN01552.1|  Cysteine-rich receptor-like protein kinase 29           138   1e-63   
ref|XP_010540946.1|  PREDICTED: cysteine-rich receptor-like prote...    137   1e-63   
ref|XP_010558703.1|  PREDICTED: cysteine-rich receptor-like prote...    137   1e-63   
gb|KCW76449.1|  hypothetical protein EUGRSUZ_D00841                     137   2e-63   
ref|XP_003638011.1|  Cysteine-rich receptor-like protein kinase         140   2e-63   
ref|XP_007211369.1|  hypothetical protein PRUPE_ppa002516mg             136   2e-63   
ref|XP_009598807.1|  PREDICTED: cysteine-rich receptor-like prote...    137   2e-63   
ref|XP_008224765.1|  PREDICTED: cysteine-rich receptor-like prote...    136   2e-63   
ref|XP_010057277.1|  PREDICTED: cysteine-rich receptor-like prote...    136   2e-63   
gb|KHN01543.1|  Cysteine-rich receptor-like protein kinase 29           135   2e-63   
ref|XP_006287218.1|  hypothetical protein CARUB_v10000395mg             135   2e-63   
ref|XP_006605286.1|  PREDICTED: receptor-like protein kinase isof...    137   2e-63   
ref|XP_006383962.1|  hypothetical protein POPTR_0004s02500g             139   2e-63   
gb|KHN01541.1|  Cysteine-rich receptor-like protein kinase 25           138   2e-63   
ref|XP_011076612.1|  PREDICTED: putative receptor-like protein ki...    138   2e-63   
ref|XP_010439218.1|  PREDICTED: cysteine-rich receptor-like prote...    137   2e-63   
gb|KFK30805.1|  hypothetical protein AALP_AA6G028200                    138   2e-63   
ref|XP_006283286.1|  hypothetical protein CARUB_v10004325mg             135   2e-63   
sp|Q8W4G6.2|CRK15_ARATH  RecName: Full=Cysteine-rich receptor-lik...    142   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011004253.1|  PREDICTED: cysteine-rich receptor-like prote...    138   2e-63   
ref|XP_010427119.1|  PREDICTED: cysteine-rich receptor-like prote...    135   2e-63   
ref|NP_194054.2|  cysteine-rich receptor-like protein kinase 15         142   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009598808.1|  PREDICTED: cysteine-rich receptor-like prote...    136   2e-63   
gb|KFK22843.1|  hypothetical protein AALP_AAs55098U000100               137   2e-63   
ref|XP_010267893.1|  PREDICTED: uncharacterized protein LOC104604997    137   2e-63   
ref|XP_010057674.1|  PREDICTED: putative receptor-like protein ki...    137   3e-63   
ref|XP_007025926.1|  Cysteine-rich RLK 29, putative isoform 2           136   3e-63   
ref|XP_009762725.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    137   3e-63   
ref|XP_010089688.1|  Cysteine-rich receptor-like protein kinase 29      136   3e-63   
emb|CDX98619.1|  BnaA03g44040D                                          140   3e-63   
ref|XP_008355788.1|  PREDICTED: cysteine-rich receptor-like prote...    135   3e-63   
ref|XP_010316622.1|  PREDICTED: putative receptor-like protein ki...    137   4e-63   
ref|XP_010456867.1|  PREDICTED: putative cysteine-rich receptor-l...    135   4e-63   
ref|XP_006606898.1|  PREDICTED: cysteine-rich receptor-like prote...    137   4e-63   
ref|XP_010316618.1|  PREDICTED: putative receptor-like protein ki...    137   4e-63   
emb|CDY10846.1|  BnaC01g14610D                                          139   4e-63   
gb|KHN23189.1|  Cysteine-rich receptor-like protein kinase 29           139   4e-63   
ref|XP_010448757.1|  PREDICTED: cysteine-rich receptor-like prote...    135   4e-63   
ref|XP_010448756.1|  PREDICTED: cysteine-rich receptor-like prote...    135   4e-63   
ref|XP_008363779.1|  PREDICTED: cysteine-rich receptor-like prote...    136   4e-63   
ref|XP_003556014.1|  PREDICTED: cysteine-rich receptor-like prote...    142   4e-63   
emb|CAN72253.1|  hypothetical protein VITISV_034184                     135   4e-63   Vitis vinifera
ref|XP_007143161.1|  hypothetical protein PHAVU_007G049000g             138   5e-63   
ref|XP_007143162.1|  hypothetical protein PHAVU_007G049100g             136   5e-63   
ref|XP_010448753.1|  PREDICTED: cysteine-rich receptor-like prote...    142   5e-63   
ref|XP_007025922.1|  Cysteine-rich RLK 29, putative isoform 1           136   5e-63   
ref|XP_002304944.2|  hypothetical protein POPTR_0004s02370g             140   5e-63   Populus trichocarpa [western balsam poplar]
emb|CDX76340.1|  BnaA08g10600D                                          136   5e-63   
ref|XP_010316621.1|  PREDICTED: putative receptor-like protein ki...    137   5e-63   
ref|XP_010492474.1|  PREDICTED: cysteine-rich receptor-like prote...    147   5e-63   
ref|XP_002869787.1|  predicted protein                                  139   5e-63   
ref|XP_010448301.1|  PREDICTED: cysteine-rich receptor-like prote...    141   5e-63   
ref|XP_003615455.1|  Cysteine-rich receptor-like protein kinase         135   5e-63   
ref|XP_010418085.1|  PREDICTED: cysteine-rich receptor-like prote...    135   5e-63   
ref|XP_003589297.1|  Cysteine-rich receptor-like protein kinase         137   6e-63   
ref|XP_010418086.1|  PREDICTED: cysteine-rich receptor-like prote...    135   6e-63   
ref|XP_007221601.1|  hypothetical protein PRUPE_ppa026879mg             136   6e-63   
ref|XP_010448761.1|  PREDICTED: cysteine-rich receptor-like prote...    139   7e-63   
ref|XP_007025923.1|  Cysteine-rich RLK 29, putative isoform 2           135   7e-63   
ref|XP_010448762.1|  PREDICTED: cysteine-rich receptor-like prote...    139   7e-63   
ref|XP_006396896.1|  hypothetical protein EUTSA_v10029153mg             136   7e-63   
ref|XP_009136761.1|  PREDICTED: cysteine-rich receptor-like prote...    140   8e-63   
ref|XP_010247032.1|  PREDICTED: uncharacterized protein LOC104590182    135   8e-63   
ref|XP_009340926.1|  PREDICTED: cysteine-rich receptor-like prote...    136   8e-63   
ref|XP_004292106.1|  PREDICTED: cysteine-rich receptor-like prote...    140   8e-63   
ref|XP_009136754.1|  PREDICTED: cysteine-rich receptor-like prote...    140   8e-63   
ref|XP_010448760.1|  PREDICTED: cysteine-rich receptor-like prote...    139   8e-63   
ref|XP_007143160.1|  hypothetical protein PHAVU_007G048900g             137   8e-63   
ref|XP_008364117.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    141   8e-63   
ref|XP_010052297.1|  PREDICTED: cysteine-rich receptor-like prote...    136   8e-63   
ref|XP_004134967.1|  PREDICTED: uncharacterized protein LOC101208125    135   9e-63   
ref|XP_004155667.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    139   9e-63   
gb|AAK28315.1|AF224705_1  receptor-like protein kinase 4                137   9e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137320.1|  PREDICTED: cysteine-rich receptor-like prote...    140   9e-63   
ref|XP_004134966.1|  PREDICTED: cysteine-rich receptor-like prote...    135   9e-63   
gb|AES59548.2|  cysteine-rich receptor-kinase-like protein              137   9e-63   
ref|XP_009136747.1|  PREDICTED: cysteine-rich receptor-like prote...    140   9e-63   
ref|XP_010059158.1|  PREDICTED: putative receptor-like protein ki...    134   9e-63   
gb|KCW74372.1|  hypothetical protein EUGRSUZ_E03053                     134   9e-63   
ref|XP_002316621.2|  hypothetical protein POPTR_0011s03270g             141   9e-63   
gb|KCW74377.1|  hypothetical protein EUGRSUZ_E03056                     138   1e-62   
emb|CDY25007.1|  BnaC02g40010D                                          137   1e-62   
emb|CDY10923.1|  BnaA03g45820D                                          140   1e-62   
ref|XP_009137319.1|  PREDICTED: cysteine-rich receptor-like prote...    140   1e-62   
ref|XP_010422102.1|  PREDICTED: putative cysteine-rich receptor-l...    135   1e-62   
emb|CDY41247.1|  BnaA01g12920D                                          139   1e-62   
ref|XP_007143203.1|  hypothetical protein PHAVU_007G052500g             139   1e-62   
ref|XP_006589610.1|  PREDICTED: cysteine-rich receptor-like prote...    138   1e-62   
ref|XP_010999534.1|  PREDICTED: cysteine-rich receptor-like prote...    141   1e-62   
ref|XP_010503063.1|  PREDICTED: putative cysteine-rich receptor-l...    135   1e-62   
ref|XP_010439214.1|  PREDICTED: cysteine-rich receptor-like prote...    138   1e-62   
ref|XP_004158051.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    140   1e-62   
ref|XP_004511332.1|  PREDICTED: cysteine-rich receptor-like prote...    139   1e-62   
ref|XP_003637975.1|  Cysteine-rich receptor-like protein kinase         135   1e-62   
ref|XP_006283266.1|  hypothetical protein CARUB_v10004297mg             139   1e-62   
ref|XP_004153373.1|  PREDICTED: cysteine-rich receptor-like prote...    139   1e-62   
ref|XP_010436426.1|  PREDICTED: uncharacterized protein LOC104720171    135   1e-62   
gb|KEH43947.1|  cysteine-rich receptor-kinase-like protein              135   1e-62   
ref|XP_010087722.1|  Cysteine-rich receptor-like protein kinase 25      137   1e-62   
ref|XP_004511333.1|  PREDICTED: cysteine-rich receptor-like prote...    139   1e-62   
ref|XP_009349613.1|  PREDICTED: cysteine-rich receptor-like prote...    134   1e-62   
gb|KHN01554.1|  Cysteine-rich receptor-like protein kinase 29           137   2e-62   
ref|XP_006373160.1|  hypothetical protein POPTR_0017s09230g             134   2e-62   
ref|XP_011010158.1|  PREDICTED: cysteine-rich receptor-like prote...    135   2e-62   
gb|KHN02669.1|  Cysteine-rich receptor-like protein kinase 29           137   2e-62   
ref|XP_007025925.1|  Cysteine-rich RLK 29, putative isoform 1           137   2e-62   
ref|XP_010469000.1|  PREDICTED: putative cysteine-rich receptor-l...    135   2e-62   
ref|XP_007143185.1|  hypothetical protein PHAVU_007G050700g             137   2e-62   
ref|XP_007206688.1|  hypothetical protein PRUPE_ppa022095mg             139   2e-62   
ref|XP_010514748.1|  PREDICTED: cysteine-rich receptor-like prote...    135   2e-62   
ref|XP_010529589.1|  PREDICTED: putative cysteine-rich receptor-l...    135   2e-62   
ref|XP_009136899.1|  PREDICTED: cysteine-rich receptor-like prote...    135   2e-62   
ref|XP_006373159.1|  hypothetical protein POPTR_0017s09230g             134   2e-62   
ref|XP_010059519.1|  PREDICTED: cysteine-rich receptor-like prote...    134   2e-62   
gb|KFK30477.1|  hypothetical protein AALP_AA7G265900                    136   2e-62   
ref|XP_008222717.1|  PREDICTED: putative receptor-like protein ki...    136   2e-62   
ref|XP_010529578.1|  PREDICTED: putative cysteine-rich receptor-l...    135   2e-62   
ref|XP_007025946.1|  Cysteine-rich protein, putative                    134   2e-62   
gb|KCW75010.1|  hypothetical protein EUGRSUZ_E037852                    133   2e-62   
ref|XP_004158052.1|  PREDICTED: cysteine-rich receptor-like prote...    138   2e-62   
gb|KFK30476.1|  hypothetical protein AALP_AA7G265900                    135   2e-62   
ref|XP_006606897.1|  PREDICTED: cysteine-rich receptor-like prote...    135   2e-62   
ref|XP_006413571.1|  hypothetical protein EUTSA_v10024630mg             139   2e-62   
ref|XP_008225761.1|  PREDICTED: cysteine-rich receptor-like prote...    137   2e-62   
ref|XP_004296281.1|  PREDICTED: cysteine-rich receptor-like prote...    134   2e-62   
ref|XP_003556004.1|  PREDICTED: cysteine-rich receptor-like prote...    137   2e-62   
ref|XP_007025940.1|  Cysteine-rich RLK 30, putative                     134   2e-62   
ref|XP_010448764.1|  PREDICTED: cysteine-rich receptor-like prote...    138   2e-62   
ref|XP_007213610.1|  hypothetical protein PRUPE_ppa002309mg             139   2e-62   
ref|XP_004172020.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    136   2e-62   
ref|XP_011002059.1|  PREDICTED: cysteine-rich receptor-like prote...    137   3e-62   
emb|CDY67333.1|  BnaAnng24050D                                          137   3e-62   
ref|XP_010448763.1|  PREDICTED: cysteine-rich receptor-like prote...    138   3e-62   
ref|XP_010540935.1|  PREDICTED: putative cysteine-rich receptor-l...    137   3e-62   
ref|XP_010316620.1|  PREDICTED: putative receptor-like protein ki...    134   3e-62   
ref|XP_009136382.1|  PREDICTED: cysteine-rich receptor-like prote...    137   3e-62   
ref|XP_007025938.1|  Cysteine-rich RLK 30, putative                     134   3e-62   
ref|XP_004496761.1|  PREDICTED: cysteine-rich receptor-like prote...    139   3e-62   
ref|XP_010433941.1|  PREDICTED: cysteine-rich receptor-like prote...    142   3e-62   
gb|KCW61422.1|  hypothetical protein EUGRSUZ_H04149                     135   3e-62   
ref|XP_010648190.1|  PREDICTED: cysteine-rich receptor-like prote...    136   3e-62   
ref|XP_009136374.1|  PREDICTED: cysteine-rich receptor-like prote...    137   3e-62   
ref|XP_010439209.1|  PREDICTED: cysteine-rich receptor-like prote...    142   3e-62   
ref|XP_010648189.1|  PREDICTED: cysteine-rich receptor-like prote...    136   3e-62   
ref|XP_010540918.1|  PREDICTED: cysteine-rich receptor-like prote...    137   3e-62   
ref|XP_006283254.1|  hypothetical protein CARUB_v10004290mg             137   3e-62   
ref|XP_009136389.1|  PREDICTED: cysteine-rich receptor-like prote...    137   3e-62   
ref|XP_009347948.1|  PREDICTED: cysteine-rich receptor-like prote...    141   4e-62   
ref|XP_003555314.1|  PREDICTED: cysteine-rich receptor-like prote...    133   4e-62   
ref|XP_010540909.1|  PREDICTED: cysteine-rich receptor-like prote...    137   4e-62   
ref|XP_010439210.1|  PREDICTED: cysteine-rich receptor-like prote...    142   4e-62   
ref|XP_010057983.1|  PREDICTED: cysteine-rich receptor-like prote...    137   4e-62   
ref|XP_003556018.2|  PREDICTED: cysteine-rich receptor-like prote...    142   4e-62   
ref|XP_010448726.1|  PREDICTED: putative cysteine-rich receptor-l...    139   4e-62   
ref|XP_010540927.1|  PREDICTED: cysteine-rich receptor-like prote...    137   4e-62   
ref|XP_010686980.1|  PREDICTED: cysteine-rich receptor-like prote...    138   4e-62   
ref|XP_008365742.1|  PREDICTED: putative receptor-like protein ki...    136   4e-62   
gb|KCW74323.1|  hypothetical protein EUGRSUZ_E02985                     135   4e-62   
gb|KCW75422.1|  hypothetical protein EUGRSUZ_E04182                     136   4e-62   
ref|XP_008222716.1|  PREDICTED: putative receptor-like protein ki...    136   4e-62   
ref|XP_010059666.1|  PREDICTED: cysteine-rich receptor-like prote...    134   4e-62   
ref|XP_008350333.1|  PREDICTED: cysteine-rich receptor-like prote...    136   4e-62   
ref|XP_010529593.1|  PREDICTED: cysteine-rich receptor-like prote...    136   5e-62   
gb|KHN02668.1|  Cysteine-rich receptor-like protein kinase 29           135   5e-62   
ref|XP_004153962.1|  PREDICTED: cysteine-rich receptor-like prote...    135   5e-62   
ref|XP_010059516.1|  PREDICTED: putative receptor-like protein ki...    133   5e-62   
ref|XP_002317217.2|  hypothetical protein POPTR_0011s03290g             143   5e-62   
ref|XP_010655874.1|  PREDICTED: cysteine-rich receptor-like prote...    137   5e-62   
ref|XP_006606020.1|  PREDICTED: cysteine-rich receptor-like prote...    139   5e-62   
ref|XP_010278041.1|  PREDICTED: putative receptor-like protein ki...    135   6e-62   
gb|EYU26072.1|  hypothetical protein MIMGU_mgv1a024803mg                135   6e-62   
gb|KFK22701.1|  hypothetical protein AALP_AAs67984U000300               134   6e-62   
ref|XP_002316708.2|  hypothetical protein POPTR_0011s03290g             143   6e-62   
ref|XP_006348198.1|  PREDICTED: cysteine-rich receptor-like prote...    133   6e-62   
gb|KHN15830.1|  Cysteine-rich receptor-like protein kinase 25           133   6e-62   
ref|XP_008222715.1|  PREDICTED: putative receptor-like protein ki...    134   6e-62   
gb|EYU44078.1|  hypothetical protein MIMGU_mgv1a002897mg                133   6e-62   
gb|KHN01547.1|  Cysteine-rich receptor-like protein kinase 29           136   6e-62   
gb|KCW74373.1|  hypothetical protein EUGRSUZ_E03054                     137   7e-62   
ref|XP_007214635.1|  hypothetical protein PRUPE_ppa001541mg             134   7e-62   
ref|XP_007143159.1|  hypothetical protein PHAVU_007G048800g             136   7e-62   
emb|CDY10824.1|  BnaC01g14390D                                          135   7e-62   
ref|XP_002518553.1|  ATP binding protein, putative                      133   7e-62   
emb|CBI39033.3|  unnamed protein product                                136   7e-62   
ref|XP_003536563.1|  PREDICTED: cysteine-rich receptor-like prote...    134   7e-62   
gb|KCW75401.1|  hypothetical protein EUGRSUZ_E04156                     134   7e-62   
ref|NP_192887.1|  putative cysteine-rich receptor-like protein ki...    137   7e-62   
gb|KCW75005.1|  hypothetical protein EUGRSUZ_E03767                     133   8e-62   
ref|XP_006398146.1|  hypothetical protein EUTSA_v10000811mg             141   8e-62   
gb|KHN01542.1|  Cysteine-rich receptor-like protein kinase 10           136   8e-62   
ref|XP_003556008.1|  PREDICTED: cysteine-rich receptor-like prote...    132   8e-62   
ref|XP_008384459.1|  PREDICTED: cysteine-rich receptor-like prote...    135   8e-62   
gb|KCW75412.1|  hypothetical protein EUGRSUZ_E04171                     133   8e-62   
ref|XP_003615209.1|  Cysteine-rich receptor-like protein kinase         136   8e-62   
ref|XP_010529579.1|  PREDICTED: putative cysteine-rich receptor-l...    139   8e-62   
emb|CDY41244.1|  BnaA01g12950D                                          134   9e-62   
gb|KCW76230.1|  hypothetical protein EUGRSUZ_D00611                     133   9e-62   
ref|XP_010059156.1|  PREDICTED: putative receptor-like protein ki...    134   9e-62   
emb|CDY55819.1|  BnaCnng29220D                                          137   1e-61   
ref|NP_001237891.1|  serine/threonine kinase-like protein precursor     133   1e-61   
gb|KHG26430.1|  Cysteine-rich receptor-like protein kinase 10           143   1e-61   
ref|XP_006605283.1|  PREDICTED: serine/threonine kinase-like prot...    133   1e-61   
ref|XP_007157184.1|  hypothetical protein PHAVU_002G049500g             137   1e-61   
ref|XP_010439193.1|  PREDICTED: cysteine-rich receptor-like prote...    138   1e-61   
ref|XP_010661208.1|  PREDICTED: putative receptor-like protein ki...    133   1e-61   
ref|XP_010316619.1|  PREDICTED: putative receptor-like protein ki...    134   1e-61   
ref|XP_007212929.1|  hypothetical protein PRUPE_ppa022450mg             135   1e-61   
ref|XP_003637942.1|  Cysteine-rich receptor-like protein kinase         138   1e-61   
gb|KCW76231.1|  hypothetical protein EUGRSUZ_D00611                     132   1e-61   
ref|XP_009136890.1|  PREDICTED: cysteine-rich receptor-like prote...    132   1e-61   
ref|XP_010439208.1|  PREDICTED: cysteine-rich receptor-like prote...    132   1e-61   
emb|CDO99704.1|  unnamed protein product                                140   1e-61   
dbj|BAF00041.1|  receptor-like protein kinase like protein              133   1e-61   
ref|XP_010455561.1|  PREDICTED: putative cysteine-rich receptor-l...    134   1e-61   
ref|XP_007224869.1|  hypothetical protein PRUPE_ppa022744mg             143   1e-61   
ref|XP_010434889.1|  PREDICTED: putative cysteine-rich receptor-l...    133   1e-61   
ref|XP_010059142.1|  PREDICTED: putative cysteine-rich receptor-l...    140   1e-61   
ref|XP_010059428.1|  PREDICTED: putative receptor-like protein ki...    134   1e-61   
ref|XP_010439192.1|  PREDICTED: cysteine-rich receptor-like prote...    138   1e-61   
gb|KEH40076.1|  cysteine-rich receptor-kinase-like protein              139   1e-61   
ref|XP_002304949.2|  hypothetical protein POPTR_0004s02440g             136   1e-61   
ref|XP_003556003.1|  PREDICTED: cysteine-rich receptor-like prote...    140   1e-61   
gb|KCW74344.1|  hypothetical protein EUGRSUZ_E03020                     140   1e-61   
gb|KHN01550.1|  Cysteine-rich receptor-like protein kinase 29           140   2e-61   
ref|XP_007213440.1|  hypothetical protein PRUPE_ppa025278mg             134   2e-61   
ref|XP_010655887.1|  PREDICTED: uncharacterized protein LOC100244284    136   2e-61   
ref|XP_010533171.1|  PREDICTED: cysteine-rich receptor-like prote...    135   2e-61   
ref|XP_010455562.1|  PREDICTED: putative cysteine-rich receptor-l...    133   2e-61   
ref|XP_006286770.1|  hypothetical protein CARUB_v10003321mg             135   2e-61   
ref|XP_010267806.1|  PREDICTED: putative receptor-like protein ki...    135   2e-61   
ref|XP_010455560.1|  PREDICTED: putative cysteine-rich receptor-l...    134   2e-61   
ref|XP_010059683.1|  PREDICTED: putative cysteine-rich receptor-l...    141   2e-61   
ref|XP_010087724.1|  Cysteine-rich receptor-like protein kinase 25      144   2e-61   
ref|XP_010267805.1|  PREDICTED: putative receptor-like protein ki...    135   2e-61   
gb|KCW74846.1|  hypothetical protein EUGRSUZ_E03582                     134   2e-61   
ref|XP_009372972.1|  PREDICTED: cysteine-rich receptor-like prote...    135   2e-61   
ref|XP_010455558.1|  PREDICTED: putative cysteine-rich receptor-l...    134   2e-61   
gb|KCW74366.1|  hypothetical protein EUGRSUZ_E03046                     134   2e-61   
gb|KCW61423.1|  hypothetical protein EUGRSUZ_H04150                     132   2e-61   
emb|CDY51977.1|  BnaC06g41760D                                          140   2e-61   
ref|XP_009372976.1|  PREDICTED: putative receptor-like protein ki...    135   2e-61   
ref|XP_009349608.1|  PREDICTED: cysteine-rich receptor-like prote...    134   2e-61   
ref|NP_192429.1|  cysteine-rich receptor-like protein kinase 25         136   2e-61   
ref|NP_194062.1|  putative cysteine-rich receptor-like protein ki...    138   2e-61   
ref|XP_009347969.1|  PREDICTED: cysteine-rich receptor-like prote...    134   2e-61   
ref|XP_006388606.1|  hypothetical protein POPTR_0138s00200g             133   2e-61   
emb|CDX76348.1|  BnaA08g10520D                                          136   2e-61   
ref|XP_010448752.1|  PREDICTED: cysteine-rich receptor-like prote...    132   2e-61   
ref|XP_010059522.1|  PREDICTED: cysteine-rich receptor-like prote...    133   3e-61   
gb|KCW75009.1|  hypothetical protein EUGRSUZ_E037791                    132   3e-61   
ref|XP_009367024.1|  PREDICTED: cysteine-rich receptor-like prote...    139   3e-61   
ref|XP_006383965.1|  hypothetical protein POPTR_0004s02530g             133   3e-61   
ref|XP_010059133.1|  PREDICTED: putative cysteine-rich receptor-l...    135   3e-61   
ref|XP_010451231.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    136   3e-61   
ref|XP_009108600.1|  PREDICTED: cysteine-rich receptor-like prote...    134   3e-61   
ref|XP_008224859.1|  PREDICTED: cysteine-rich receptor-like prote...    132   3e-61   
ref|XP_008377958.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    138   3e-61   
ref|XP_006283340.1|  hypothetical protein CARUB_v10004380mg             134   3e-61   
ref|XP_010436424.1|  PREDICTED: putative cysteine-rich receptor-l...    133   3e-61   
ref|XP_010112670.1|  Cysteine-rich receptor-like protein kinase 29      136   3e-61   
gb|KCW74369.1|  hypothetical protein EUGRSUZ_E030491                    132   4e-61   
ref|XP_006413569.1|  hypothetical protein EUTSA_v10024579mg             133   4e-61   
ref|XP_010267800.1|  PREDICTED: putative receptor-like protein ki...    138   4e-61   
ref|XP_009108591.1|  PREDICTED: cysteine-rich receptor-like prote...    136   4e-61   
ref|XP_010932139.1|  PREDICTED: cysteine-rich receptor-like prote...    137   4e-61   
emb|CDY10854.1|  BnaC01g14690D                                          131   4e-61   
ref|XP_006405044.1|  hypothetical protein EUTSA_v10000069mg             135   4e-61   
ref|XP_010433929.1|  PREDICTED: cysteine-rich receptor-like prote...    132   4e-61   
ref|XP_006396894.1|  hypothetical protein EUTSA_v10028517mg             133   4e-61   
ref|XP_006467961.1|  PREDICTED: putative cysteine-rich receptor-l...    134   5e-61   
emb|CDP04899.1|  unnamed protein product                                132   5e-61   
ref|XP_010453750.1|  PREDICTED: cysteine-rich receptor-like prote...    143   5e-61   
ref|XP_003638035.1|  Cysteine-rich receptor-like protein kinase         144   5e-61   
ref|XP_003637976.1|  Cysteine-rich receptor-like protein kinase         144   5e-61   
ref|XP_010057980.1|  PREDICTED: putative receptor-like protein ki...    132   5e-61   
ref|XP_010267801.1|  PREDICTED: cysteine-rich receptor-like prote...    138   5e-61   
ref|XP_006282816.1|  hypothetical protein CARUB_v10006547mg             134   5e-61   
emb|CDP04893.1|  unnamed protein product                                133   5e-61   
ref|XP_007214583.1|  hypothetical protein PRUPE_ppa026781mg             132   5e-61   
ref|XP_002518555.1|  ATP binding protein, putative                      135   5e-61   
ref|XP_003589299.1|  Cysteine-rich receptor-like protein kinase         136   5e-61   
gb|AES59550.2|  cysteine-rich receptor-kinase-like protein              136   6e-61   
ref|XP_004496856.1|  PREDICTED: cysteine-rich receptor-like prote...    132   6e-61   
ref|XP_010092288.1|  Cysteine-rich receptor-like protein kinase 10      134   6e-61   
ref|XP_008377949.1|  PREDICTED: putative receptor-like protein ki...    132   6e-61   
gb|KCW75014.1|  hypothetical protein EUGRSUZ_E03789                     132   6e-61   
ref|XP_006396890.1|  hypothetical protein EUTSA_v10028491mg             133   6e-61   
ref|XP_004496790.1|  PREDICTED: cysteine-rich receptor-like prote...    138   6e-61   
ref|XP_009334798.1|  PREDICTED: LOW QUALITY PROTEIN: putative rec...    132   6e-61   
gb|KCW75430.1|  hypothetical protein EUGRSUZ_E041921                    135   6e-61   
ref|XP_009112727.1|  PREDICTED: cysteine-rich receptor-like prote...    135   7e-61   
emb|CDX76944.1|  BnaC08g35300D                                          134   7e-61   
ref|XP_006449121.1|  hypothetical protein CICLE_v10014534mg             134   7e-61   
gb|KCW74364.1|  hypothetical protein EUGRSUZ_E03044                     133   7e-61   
ref|XP_010661211.1|  PREDICTED: putative receptor-like protein ki...    131   7e-61   
ref|XP_006286462.1|  hypothetical protein CARUB_v10000407mg             131   7e-61   



>ref|XP_010054432.1| PREDICTED: uncharacterized protein LOC104442733 [Eucalyptus grandis]
Length=1358

 Score =   145 bits (366),  Expect(2) = 5e-68, Method: Composition-based stats.
 Identities = 69/123 (56%), Positives = 94/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  49   RYRFLVSSLEGISFAE----EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
            R R L  + E +   E    E++++D   I+ ATN+FSD+NK+G+GGFGV+YKGT  +G+
Sbjct  307  RSRRLKKNFETVPVDEISNAESLQFDLNIIREATNDFSDSNKLGQGGFGVVYKGTLANGQ  366

Query  217  LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
            ++AVKRLS +L  G QEFKN+  L+A+ QHRNLVRLLGF LEG+E LL+YEFVPN SLD+
Sbjct  367  VIAVKRLSVDLGQGDQEFKNEVLLVARLQHRNLVRLLGFCLEGRERLLIYEFVPNSSLDH  426

Query  397  FLF  405
            F++
Sbjct  427  FIY  429


 Score =   140 bits (353),  Expect(2) = 5e-68, Method: Composition-based stats.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPV+   LDW RR KII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF  
Sbjct  430  DPVRRSRLDWERRQKIIGGIARGLLYLHEDSQLRIIHRDLKASNILLDAEMNPKISDFGT  489

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D+T D+T R+VGT GYM PEY +H   S+K +V+ FGVL+
Sbjct  490  ARLFAVDQTQDATSRVVGTYGYMAPEYAMHGLFSVKSDVFSFGVLL  535


 Score =   142 bits (357),  Expect(2) = 8e-66, Method: Composition-based stats.
 Identities = 65/112 (58%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +1

Query  97    EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
             E++++D   I+ ATN+FSD+NK+G+GGFGV+YKGT  +G+ +AVKR S +L+ G QEFKN
Sbjct  1015  ESLQFDLNIIREATNDFSDSNKLGQGGFGVVYKGTLANGQFIAVKRPSVDLRQGNQEFKN  1074

Query  277   KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSRTCIS  432
             +  L+A+ QHRNLVRLLGF LE +E LL+YEFVPN SLD+FL+    R+ +S
Sbjct  1075  EVLLVARLQHRNLVRLLGFCLEERERLLIYEFVPNSSLDHFLYDPVRRSQLS  1126


 Score =   136 bits (343),  Expect(2) = 8e-66, Method: Composition-based stats.
 Identities = 62/106 (58%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485   DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
             DPV+   L W RR KII  IARGL+YL+EDS L IIH +LKA N+LLD  +NPK++DF  
Sbjct  1118  DPVRRSQLSWQRRQKIIGGIARGLLYLHEDSQLRIIHRDLKAGNILLDAEMNPKISDFGT  1177

Query  665   ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
             ARLF +D+T D+T R+VGT GYM PEY +H   S+K +V+ FGVL+
Sbjct  1178  ARLFAVDQTQDATSRVVGTYGYMAPEYAMHGLFSVKSDVFSFGVLL  1223



>emb|CAN74851.1| hypothetical protein VITISV_019620 [Vitis vinifera]
Length=839

 Score =   144 bits (364),  Expect(2) = 6e-68, Method: Composition-based stats.
 Identities = 67/106 (63%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D ++   LDW RRYKII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  595  DLIRRAQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDAEMNPKISDFGM  654

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF++D+T  ST RIVGT GYM PEY +H   S+K +VY FGVLV
Sbjct  655  ARLFLVDQTQGSTSRIVGTYGYMAPEYAMHGHFSVKTDVYSFGVLV  700


 Score =   141 bits (355),  Expect(2) = 6e-68, Method: Composition-based stats.
 Identities = 66/103 (64%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++ +DF TI+ ATNNFSD+NK+G+GGFG +YKG   +G+ VAVKRLS     G  EFKN
Sbjct  492  ESLHFDFDTIRVATNNFSDSNKLGQGGFGPVYKGKLSNGQYVAVKRLSSGSAQGELEFKN  551

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +A L+AK QHRNLVRLLGF L+G E LL+YEFVPN SLD+F+F
Sbjct  552  EAVLVAKLQHRNLVRLLGFCLDGAERLLIYEFVPNTSLDHFIF  594



>ref|XP_009759100.1| PREDICTED: uncharacterized protein LOC104211704 [Nicotiana sylvestris]
Length=1351

 Score =   145 bits (365),  Expect(2) = 1e-67, Method: Composition-based stats.
 Identities = 68/106 (64%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D VK R LDW RR +II  IARG++YL+EDS L IIH +LKASNVLLD  +NPK++DF M
Sbjct  440  DSVKRRQLDWERRSRIIGGIARGILYLHEDSRLRIIHRDLKASNVLLDAEMNPKISDFGM  499

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T  ST RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  500  ARLFTLDETQGSTSRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLV  545


 Score =   140 bits (352),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 91/128 (71%), Gaps = 4/128 (3%)
 Frame = +1

Query  49   RYRFLVSSLEGISF----AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
            R R LV+  E I        E+++YDF TI+ ATNNFSD NK+G+GGFG +YKG   +G+
Sbjct  317  RKRKLVNKRESIHVDDISTAESLQYDFSTIRAATNNFSDVNKLGQGGFGPVYKGKLPNGQ  376

Query  217  LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
             VAVKRLS +   G  EFKN+  L+A+ QHRNLVRLLGF L+G E LLVYEFVPN SLD+
Sbjct  377  EVAVKRLSADSGQGDLEFKNEVLLVARLQHRNLVRLLGFCLDGIERLLVYEFVPNASLDH  436

Query  397  FLFGNGSR  420
            FLF +  R
Sbjct  437  FLFDSVKR  444


 Score =   148 bits (373),  Expect(2) = 2e-66, Method: Composition-based stats.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  485   DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
             D VK R LDW +RYKII  IA+G++YL+EDS L IIH +LKASNVLLD  +NPK++DF M
Sbjct  1115  DSVKRRQLDWEKRYKIIGGIAKGILYLHEDSRLRIIHRDLKASNVLLDADMNPKISDFGM  1174

Query  665   ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
             ARLF LD+T  +TRRIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  1175  ARLFTLDETQGNTRRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLV  1220


 Score =   132 bits (332),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 91/131 (69%), Gaps = 4/131 (3%)
 Frame = +1

Query  40    KGGRYRFLVSSLEGI----SFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFE  207
             K  + + L++ +E I    +   E+++YDF  IQ AT+NFS+ NK+G+GGFG +YKG   
Sbjct  989   KRQKRKHLLNPIESIHGDDTTTAESLQYDFSAIQAATDNFSNANKLGQGGFGPVYKGKLP  1048

Query  208   DGRLVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGS  387
             +G+ VAVKRLS     G  EFKN+  L+A+ QHRNLVRL GF L+G E LLVYEFVPN S
Sbjct  1049  NGQEVAVKRLSVGSGQGDLEFKNEVLLVARLQHRNLVRLRGFCLDGTERLLVYEFVPNAS  1108

Query  388   LDNFLFGNGSR  420
             LD+FLF +  R
Sbjct  1109  LDHFLFDSVKR  1119



>ref|XP_007025937.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
 gb|EOY28559.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
Length=680

 Score =   146 bits (369),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPVKH +LDW RRYKII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  439  DPVKHAYLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDAEMNPKISDFGM  498

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL  LD+T  +T RIVGT GYM PEY +H + S+K +V+ FGVL+
Sbjct  499  ARLCALDQTQGATSRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLL  544


 Score =   137 bits (345),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
            + E+++Y+F TI+ AT++FSD NK+G+GGFG +YKGT  DG L+AVKRLS +   G  EF
Sbjct  334  SAESLQYEFSTIRAATDDFSDANKLGQGGFGAVYKGTLADGELIAVKRLSTDSGQGDLEF  393

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            KN+  L+AK QHRNLVRL GF L+G E LL+YEFVPN SLD FLF
Sbjct  394  KNEVRLVAKLQHRNLVRLRGFCLDGNERLLIYEFVPNASLDQFLF  438



>ref|XP_010448759.1| PREDICTED: cysteine-rich receptor-like protein kinase 6 [Camelina 
sativa]
Length=679

 Score =   144 bits (364),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW +RYKII  IARG++YL+EDS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  444  DPTKQVQLDWTQRYKIIGGIARGILYLHEDSQLKIIHRDLKASNILLDVDINPKIADFGM  503

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F LD+T D+T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  504  ARIFGLDQTQDNTSRIVGTYGYMSPEYAMHGQFSMKSDVYSFGVLV  549


 Score =   139 bits (349),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
            A ++++ D+ TIQ ATNNF++ NKIG+GGFGV+YKGTF +G+ VAVKRLS+N + G  EF
Sbjct  339  AADSLQLDYRTIQTATNNFAERNKIGKGGFGVVYKGTFSNGKEVAVKRLSKNSRQGEAEF  398

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            K +  ++AK QHRNLVRLLGFSL+G+E +LVYE++PN SLD  LF
Sbjct  399  KTEVVVVAKLQHRNLVRLLGFSLQGEERILVYEYMPNKSLDYLLF  443



>ref|XP_009340923.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Pyrus x bretschneideri]
Length=694

 Score =   142 bits (359),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TIQ AT+NFSD +K+GEGGFG +YKG   DG+ VAVKRLS+N   G +EFKN
Sbjct  353  ESLQFDFATIQAATSNFSDDHKLGEGGFGQVYKGILSDGQEVAVKRLSKNSGQGSEEFKN  412

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+VPN SLD FLF
Sbjct  413  EMVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVPNKSLDRFLF  455


 Score =   140 bits (354),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  456  DPEKQGQLDWSRRYKIISGIARGIMYLHEDSQLRIIHRDLKASNILLDGEMNPKISDFGM  515

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D++  +T RIVGT GYM PEY +H + SIK ++Y FGVLV
Sbjct  516  ARIFGVDQSQANTSRIVGTYGYMSPEYAMHGQFSIKSDMYSFGVLV  561



>ref|XP_009137324.1| PREDICTED: cysteine-rich receptor-like protein kinase 15 [Brassica 
rapa]
Length=673

 Score =   142 bits (358),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP KH  L+W  RYKIIE I RG++YL++DS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  437  DPAKHGQLNWTLRYKIIEGITRGILYLHQDSRLTIIHRDLKASNILLDRNMNPKVADFGM  496

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T D+T +IVGT GYM PEY LH + S+K +VY FGVLV
Sbjct  497  ARIFGMDQTQDNTSKIVGTYGYMSPEYALHGQFSMKSDVYSFGVLV  542


 Score =   141 bits (355),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++ D++ IQ ATNN+S+ NKIGEGGFG +YKGTF +G  VAVKRLS++ + G  EFKN
Sbjct  334  ESLQLDYVIIQAATNNYSENNKIGEGGFGEVYKGTFANGVEVAVKRLSKSSRQGDTEFKN  393

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            + A++AK QHRNLVRLLGFSLE KE +LVYE+VPN SLD FLF
Sbjct  394  EVAVVAKLQHRNLVRLLGFSLEQKERILVYEYVPNKSLDYFLF  436



>ref|XP_010686956.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Beta 
vulgaris subsp. vulgaris]
Length=652

 Score =   143 bits (360),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++YD +T+Q ATNNFSD NK+GEGGFG ++KGT  +G+ +AVKRLS+N   G QEFKN
Sbjct  316  ESLQYDLLTLQTATNNFSDENKLGEGGFGGVFKGTLSNGQEIAVKRLSKNSGQGVQEFKN  375

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF + G+E LLVYE+VPN SLD FLF
Sbjct  376  EVLLVAKLQHRNLVRLLGFCIAGEEKLLVYEYVPNKSLDQFLF  418


 Score =   139 bits (351),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPVK   LDWGRRYKII  +ARG++YL++DS L IIH +LK SNVLLD  +N K++DF M
Sbjct  419  DPVKQGQLDWGRRYKIIGGVARGMLYLHQDSRLRIIHRDLKVSNVLLDSEMNAKVSDFGM  478

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T ++VGT GYM PEY +H + SIK +VY FGVLV
Sbjct  479  ARIFGVDQTQGNTSKVVGTYGYMSPEYAMHGQFSIKSDVYSFGVLV  524



>emb|CDX94168.1| BnaC07g38020D [Brassica napus]
Length=654

 Score =   144 bits (364),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP KH  L+W RRYKIIE IARG++YL++DS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  418  DPAKHGQLNWTRRYKIIEGIARGILYLHQDSRLTIIHRDLKASNILLDRDMNPKVADFGM  477

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T D+T +IVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  478  ARIFGMDQTQDNTSKIVGTYGYMAPEYAIHGQFSMKSDVYSFGVLV  523


 Score =   137 bits (345),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++ D+  IQ ATNN+S+ NKIGEGGFG +YKGTF +G  VAVKRLS++ + G  EFKN
Sbjct  315  ESLQLDYGIIQAATNNYSENNKIGEGGFGEVYKGTFANGVEVAVKRLSKSSRQGDTEFKN  374

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            + A++AK QHRNLVRLLGFSLE KE +LVYE+VPN SLD FLF
Sbjct  375  EVAVVAKLQHRNLVRLLGFSLEQKERILVYEYVPNKSLDYFLF  417



>ref|XP_006365889.1| PREDICTED: LOW QUALITY PROTEIN: putative cysteine-rich receptor-like 
protein kinase 23-like [Solanum tuberosum]
Length=937

 Score =   149 bits (375),  Expect(2) = 7e-67, Method: Composition-based stats.
 Identities = 69/106 (65%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPVK R LDW RR KII  +A+G++YL+EDS L IIH +LKASNVLLDE +NPK+ADF M
Sbjct  157  DPVKRRQLDWERRSKIIGGVAKGILYLHEDSRLRIIHRDLKASNVLLDEEMNPKIADFGM  216

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T  +T RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  217  ARLFTLDETQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLV  262


 Score =   133 bits (334),  Expect(2) = 7e-67, Method: Composition-based stats.
 Identities = 69/123 (56%), Positives = 86/123 (70%), Gaps = 4/123 (3%)
 Frame = +1

Query  49   RYRFLVSSLEGIS----FAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
            R R LV+ ++ I        E+ +YDF TI+ AT+NFS  NK+G+GGFG +YKG   + +
Sbjct  34   RRRKLVNDIQSIHGDDISTAESFQYDFSTIRAATDNFSSANKLGQGGFGPVYKGKLPNSQ  93

Query  217  LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
             VAVKRLS +   G  EFKN+  L+A+ QHRNLVRLLGF L+G E LLVYEFVPN SLD 
Sbjct  94   EVAVKRLSADSGQGDLEFKNEVMLVARLQHRNLVRLLGFCLDGTERLLVYEFVPNASLDQ  153

Query  397  FLF  405
            FLF
Sbjct  154  FLF  156


 Score =   149 bits (375),  Expect(2) = 5e-66, Method: Composition-based stats.
 Identities = 69/106 (65%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPVK R LDW RR KII  +A+G++YL+EDS L IIH +LKASNVLLDE +NPK+ADF M
Sbjct  708  DPVKRRQLDWERRSKIIGGVAKGILYLHEDSRLRIIHRDLKASNVLLDEEMNPKIADFGM  767

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T  +T RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  768  ARLFTLDETQGNTSRIVGTYGYMAPEYAMHRQFSVKSDVFSFGVLV  813


 Score =   130 bits (327),  Expect(2) = 5e-66, Method: Composition-based stats.
 Identities = 66/123 (54%), Positives = 87/123 (71%), Gaps = 4/123 (3%)
 Frame = +1

Query  49   RYRFLVSSLEGIS----FAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
            R R LV++++ I        E+ +YDF TI+ AT+NFS  NK+G+GGFG +YKG   + +
Sbjct  585  RRRKLVTNIQSIHGDDISTAESFQYDFSTIRAATDNFSSDNKLGQGGFGPVYKGKLPNSQ  644

Query  217  LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
             VAVKRLS +   G  EFKN+  L+A+ QHRNLVRLLG+  +G E LL+YEFVPN SLD+
Sbjct  645  EVAVKRLSADSGQGDLEFKNEVMLVARLQHRNLVRLLGYCFDGTERLLIYEFVPNASLDH  704

Query  397  FLF  405
            FLF
Sbjct  705  FLF  707



>ref|XP_010052449.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Eucalyptus 
grandis]
 gb|KCW76443.1| hypothetical protein EUGRSUZ_D00833 [Eucalyptus grandis]
Length=671

 Score =   143 bits (360),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  49   RYRFLVSSLEGISFAE----EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
            R R L  + E +   E    E++++D  TI+ ATN+FSD NK+G+GGFGV+YKGT  +G+
Sbjct  308  RSRRLKKNFETVPVDEITNAESLQFDLNTIREATNDFSDANKLGQGGFGVVYKGTLANGQ  367

Query  217  LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
            ++AVKRLS +L  G  EFKN+  L+A+ QHRNLVRLLGF LEG+E LL+YEFVPN SLD+
Sbjct  368  VIAVKRLSVDLGQGDPEFKNEVLLVARLQHRNLVRLLGFCLEGRERLLIYEFVPNSSLDH  427

Query  397  FLF  405
            F+F
Sbjct  428  FIF  430


 Score =   139 bits (349),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPV+ R LDW RR KII  IARGL+YL+EDS L IIH +LKASNVLLD  +NPK++DF  
Sbjct  431  DPVRRRQLDWERRQKIIGGIARGLLYLHEDSQLRIIHRDLKASNVLLDAEMNPKISDFGT  490

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D++ D+T R+VGT GYM PEY +H   S+K +V+ FGVL+
Sbjct  491  ARLFAVDQSQDATSRVVGTYGYMAPEYAMHGLFSVKSDVFSFGVLL  536



>ref|XP_010644341.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Vitis vinifera]
Length=660

 Score =   143 bits (361),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 91/130 (70%), Gaps = 3/130 (2%)
 Frame = +1

Query  40   KGGRYRFLVSSLEGISF---AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFED  210
            +  + R+     E + F    E+++++D  TIQ ATNNFSD NKIGEGGFG +YKGT   
Sbjct  296  RCAKKRYDTLEAENVEFNITTEQSLQFDLATIQAATNNFSDHNKIGEGGFGAVYKGTLSS  355

Query  211  GRLVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSL  390
            G+ +A+KRLS++   G  EFKN+  L+AK QHRNLVRLLGF LEG+E +LVYE+VPN SL
Sbjct  356  GQEIAIKRLSKSSGQGAVEFKNEVVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVPNKSL  415

Query  391  DNFLFGNGSR  420
            D FLF    R
Sbjct  416  DYFLFDPDKR  425


 Score =   138 bits (347),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL+EDS L +IH +LKASNVLLD  +NPK++DF M
Sbjct  421  DPDKRGQLDWSRRYKIIGGIARGILYLHEDSRLRVIHRDLKASNVLLDGDMNPKISDFGM  480

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T R+VGT GYM PEY +H   S+K +VY FGVLV
Sbjct  481  ARIFGVDQTQGNTNRVVGTYGYMSPEYAMHGRFSVKSDVYSFGVLV  526



>emb|CBI29180.3| unnamed protein product [Vitis vinifera]
Length=523

 Score =   143 bits (360),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
             E+++++D  TIQ ATNNFSD NKIGEGGFG +YKGT   G+ +A+KRLS++   G  EF
Sbjct  179  TEQSLQFDLATIQAATNNFSDHNKIGEGGFGAVYKGTLSSGQEIAIKRLSKSSGQGAVEF  238

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            KN+  L+AK QHRNLVRLLGF LEG+E +LVYE+VPN SLD FLF    R
Sbjct  239  KNEVVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVPNKSLDYFLFDPDKR  288


 Score =   138 bits (348),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL+EDS L +IH +LKASNVLLD  +NPK++DF M
Sbjct  284  DPDKRGQLDWSRRYKIIGGIARGILYLHEDSRLRVIHRDLKASNVLLDGDMNPKISDFGM  343

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T R+VGT GYM PEY +H   S+K +VY FGVLV
Sbjct  344  ARIFGVDQTQGNTNRVVGTYGYMSPEYAMHGRFSVKSDVYSFGVLV  389



>ref|XP_009617477.1| PREDICTED: cysteine-rich receptor-like protein kinase 10, partial 
[Nicotiana tomentosiformis]
Length=404

 Score =   142 bits (357),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D VK R LDW RR KII  +ARG++YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  157  DSVKRRQLDWERRSKIIGGVARGILYLHEDSRLRIIHRDLKASNILLDAEMNPKISDFGM  216

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T  ST RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  217  ARLFTLDETRGSTSRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLV  262


 Score =   139 bits (350),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 89/128 (70%), Gaps = 4/128 (3%)
 Frame = +1

Query  49   RYRFLVSSLEGISF----AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
            R R LV   E I        E+++YDF TI+ ATNNFSD NK+G+GGFG +YKG   +G+
Sbjct  34   RKRKLVDKRESIHVDDMSTAESLQYDFSTIRAATNNFSDVNKLGQGGFGPVYKGKLPNGQ  93

Query  217  LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
             VAVKRLS +   G  EFKN+  L+A+ QHRNLVRLLGF L G E LLVYEFVPN SLD+
Sbjct  94   EVAVKRLSADSGQGDLEFKNEVLLVARLQHRNLVRLLGFCLYGIERLLVYEFVPNASLDH  153

Query  397  FLFGNGSR  420
            FLF +  R
Sbjct  154  FLFDSVKR  161



>ref|XP_010686970.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Beta 
vulgaris subsp. vulgaris]
Length=670

 Score =   147 bits (370),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++YD  T+Q+AT+NFS+ NK+GEGGFG +YKG   DGR +AVKRLS N   G QEFKN
Sbjct  329  ESLQYDLTTLQSATSNFSEENKLGEGGFGGVYKGALSDGREIAVKRLSMNSSQGVQEFKN  388

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRL GF LEG+E LLVYE+VPN SLDNFLF
Sbjct  389  EVVLVAKLQHRNLVRLFGFCLEGQEKLLVYEYVPNKSLDNFLF  431


 Score =   134 bits (336),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPV    LDW  RYKII  IARG++YL+ DS L IIH +LKASNVLLD  +NPK+ADF M
Sbjct  432  DPVNQGLLDWTTRYKIIGGIARGMLYLHHDSQLRIIHRDLKASNVLLDADMNPKIADFGM  491

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T R+VGT GYM PEY ++ + S K +VY FGVLV
Sbjct  492  ARIFGVDQTQGNTSRVVGTYGYMSPEYAMNGQFSNKSDVYSFGVLV  537



>ref|XP_003635322.2| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis 
vinifera]
Length=1243

 Score =   147 bits (371),  Expect(2) = 2e-66, Method: Composition-based stats.
 Identities = 67/106 (63%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP++   LDW RRYKII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  437  DPIRRAQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDAEMNPKISDFGM  496

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF++D+T  +T RIVGT GYM PEY +H   S+K +VY FGVLV
Sbjct  497  ARLFLVDQTQGNTSRIVGTYGYMAPEYAMHGHFSVKTDVYSFGVLV  542


 Score =   133 bits (335),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++ +DF TI+ ATNNFSD+NK+G+GGFG +YKG   +G+ +AVKRLS     G  EFKN
Sbjct  334  ESLHFDFDTIRVATNNFSDSNKLGQGGFGPVYKGKLSNGQDIAVKRLSSGSGQGELEFKN  393

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF L+G E LL+YEFVPN SLD+F+F
Sbjct  394  EVVLVAKLQHRNLVRLLGFCLDGAERLLIYEFVPNTSLDHFIF  436


 Score =   139 bits (349),  Expect(2) = 1e-64, Method: Composition-based stats.
 Identities = 62/103 (60%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +2

Query  485   DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
             DP+K   L+W +RYKII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF +
Sbjct  1119  DPIKQTQLNWEKRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDAEMNPKISDFGI  1178

Query  665   ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFG  793
             ARLF +D+T ++T RI+GT GYM PEYVLH + S+K +VY  G
Sbjct  1179  ARLFAVDQTQENTSRIMGTYGYMAPEYVLHGKFSVKSDVYSLG  1221


 Score =   135 bits (340),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 87/123 (71%), Gaps = 0/123 (0%)
 Frame = +1

Query  37    MKGGRYRFLVSSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
             +K  R R    S EG +   E++++ F TI+ AT+NFSD NK+GEGGFG +YKG   DG+
Sbjct  996   LKKRRPRGQFLSFEGETRTLESLQFQFSTIRVATDNFSDANKLGEGGFGSVYKGRLSDGQ  1055

Query  217   LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
              +AVKRLS   K G QEFKN+  LMAK QHRNLVRLLGF LE  E LL+YEF+PN SL  
Sbjct  1056  EIAVKRLSAGSKQGEQEFKNEVLLMAKLQHRNLVRLLGFCLERSERLLIYEFMPNLSLHG  1115

Query  397   FLF  405
             F+F
Sbjct  1116  FIF  1118



>ref|XP_010267898.1| PREDICTED: uncharacterized protein LOC104605002 [Nelumbo nucifera]
Length=1359

 Score =   141 bits (356),  Expect(2) = 2e-66, Method: Composition-based stats.
 Identities = 66/103 (64%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F T+  ATNNFSD NKIGEGGFG +YKG F +G+ +AVKRLS+N   G  EFKN
Sbjct  329  ESLQFNFSTVAAATNNFSDANKIGEGGFGSVYKGKFPNGQEIAVKRLSKNSGQGAVEFKN  388

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +A L+AK QHRNLVRLLGF LEG+E +L+YE+V N SLD+FLF
Sbjct  389  EAMLVAKLQHRNLVRLLGFCLEGEEKILIYEYVVNKSLDHFLF  431


 Score =   139 bits (349),  Expect(2) = 2e-66, Method: Composition-based stats.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP +H  LDW  RYKIIE  ARGL+YL+EDS L IIH +LK SNVLLD  LNPK++DF M
Sbjct  432  DPDEHSRLDWPIRYKIIEGTARGLLYLHEDSRLKIIHRDLKVSNVLLDGDLNPKISDFGM  491

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D++  +T RIVGT GYM PEY +H + S+K +V+ FGVL+
Sbjct  492  ARIFQVDQSEANTNRIVGTYGYMSPEYAMHGQFSVKSDVFSFGVLL  537


 Score =   144 bits (362),  Expect(2) = 2e-65, Method: Composition-based stats.
 Identities = 67/102 (66%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +1

Query  100   AVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKNK  279
             +++ DF T++ +TNNFSD NK+GEGGFGV+YKG   DG+ +AVKRLS+N   G +EFKN+
Sbjct  1015  SLQMDFETVKASTNNFSDVNKLGEGGFGVVYKGRLFDGQEIAVKRLSRNSGQGAKEFKNE  1074

Query  280   AALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
             A L+AK QHRNLVRLLGF L G E LL+YEFV NGSLD+FLF
Sbjct  1075  AVLLAKLQHRNLVRLLGFCLSGGEKLLIYEFVSNGSLDHFLF  1116


 Score =   133 bits (335),  Expect(2) = 2e-65, Method: Composition-based stats.
 Identities = 63/106 (59%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485   DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
             DP+K   L W RRY II  +ARGL+YL+EDS   IIH +LKASNVLLDE +NPK++DF M
Sbjct  1117  DPIKCADLTWERRYGIIVGVARGLLYLHEDSRHRIIHRDLKASNVLLDEQMNPKISDFGM  1176

Query  665   ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
             ARLFV D+T  +T R+VGT GYM PEY +    S+K +V+ FGVL+
Sbjct  1177  ARLFVPDQTEGNTHRVVGTYGYMPPEYAMRGHFSVKSDVFSFGVLL  1222



>ref|XP_009340924.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Pyrus x bretschneideri]
Length=693

 Score =   142 bits (359),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TIQ AT+NFSD +K+GEGGFG +YKG   DG+ VAVKRLS+N   G +EFKN
Sbjct  353  ESLQFDFATIQAATSNFSDDHKLGEGGFGQVYKGILSDGQEVAVKRLSKNSGQGSEEFKN  412

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+VPN SLD FLF
Sbjct  413  EMVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVPNKSLDRFLF  455


 Score =   137 bits (346),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  456  DPEKQGQLDWSRRYKIISGIARGIMYLHEDSQLRIIHRDLKASNILLDGEMNPKISDFGM  515

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D++  +T RIVGT GYM PEY +H   S+K ++Y FGVL+
Sbjct  516  ARIFGVDQSQANTSRIVGTYGYMSPEYAMHGRFSVKSDMYSFGVLL  561



>ref|XP_006468228.1| PREDICTED: uncharacterized protein LOC102629057 [Citrus sinensis]
Length=1332

 Score =   146 bits (369),  Expect(2) = 3e-66, Method: Composition-based stats.
 Identities = 67/106 (63%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485   DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
             DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  1092  DPEKQGQLDWSRRYKIIGGIARGILYLHEDSRLRIIHRDLKASNILLDAEMNPKISDFGM  1151

Query  665   ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
             AR+F +D+T  +T RIVGT GYM PEY +H + S+K +VYGFGVLV
Sbjct  1152  ARIFGVDQTQGNTSRIVGTFGYMAPEYAMHGQFSVKSDVYGFGVLV  1197


 Score =   133 bits (335),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  97    EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
             E++++DF TI+ ATN FS  NK+GEGGFG +YKG    G+ +AVKRLS +   G QEFKN
Sbjct  989   ESLQFDFETIEVATNKFSTDNKLGEGGFGEVYKGVLPSGQEIAVKRLSASSGQGAQEFKN  1048

Query  277   KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
             +  L+AK QHRNLVRLLGF LEG+E +LVYEFVPN SLD FL+
Sbjct  1049  EVVLVAKLQHRNLVRLLGFCLEGEEKILVYEFVPNKSLDYFLY  1091


 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 84/120 (70%), Gaps = 7/120 (6%)
 Frame = +1

Query  61   LVSSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLS  240
            LVSS E + F   AV      I+ AT+ FSD+NK+G+GGFG +YKG   +G+ VAVKRLS
Sbjct  312  LVSS-EELPFVHLAV------IKAATDGFSDSNKLGQGGFGTVYKGVLPNGKEVAVKRLS  364

Query  241  QNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            +    G +EFKN+  L+AK QHRNLVRL+G  +EG+E LL+YE +PN SLD F+F +  R
Sbjct  365  RKSWQGLEEFKNEIILIAKLQHRNLVRLVGCGIEGEEKLLIYELMPNRSLDCFIFDSERR  424


 Score =   109 bits (272),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 53/112 (47%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = +2

Query  467  VKCSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPK  646
            + C   D  +   L+W   Y II  I++GL+YL+EDS L IIH +LK SNVLLD+ +  K
Sbjct  414  LDCFIFDSERRLQLNWNTCYNIIGGISKGLLYLHEDSRLKIIHRDLKPSNVLLDKDMVAK  473

Query  647  LADFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ++DF MAR+F  ++   +TRR+VGT GYM PEY +    S+K +V+ FGV+V
Sbjct  474  ISDFGMARIFCENQKTANTRRVVGTYGYMAPEYAMEGLFSVKSDVFSFGVIV  525



>ref|XP_006606024.1| PREDICTED: serine/threonine kinase-related protein [Glycine max]
Length=664

 Score =   141 bits (356),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPVK R LDW RRYKII  IARG+ YL+EDS L IIH +LKASNVLLDE +NPK++DF M
Sbjct  421  DPVKQRELDWSRRYKIIVGIARGIQYLHEDSQLRIIHRDLKASNVLLDENMNPKISDFGM  480

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            A++F  D+T  +T RIVGT GYM PEY +  + S+K +V+ FGVLV
Sbjct  481  AKIFQADQTQVNTGRIVGTYGYMSPEYAMRGQFSVKSDVFSFGVLV  526


 Score =   138 bits (348),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++D  T++ AT+ FSD NKIG+GGFGV+YKG F +G+ +AVKRLS     G  EF+N
Sbjct  318  ESLQFDLATVEAATDRFSDENKIGQGGFGVVYKGVFPNGQEIAVKRLSVTSLQGAVEFRN  377

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +AAL+AK QHRNLVRLLGF LEG+E +L+YE++PN SLD FLF
Sbjct  378  EAALVAKLQHRNLVRLLGFCLEGQEKILIYEYIPNKSLDRFLF  420



>ref|XP_007025939.1| Cysteine-rich RLK 29 [Theobroma cacao]
 gb|EOY28561.1| Cysteine-rich RLK 29 [Theobroma cacao]
Length=1349

 Score =   140 bits (354),  Expect(2) = 3e-66, Method: Composition-based stats.
 Identities = 66/106 (62%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485   DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
             D VK   LDW RRYKII  IARGL+YL+EDS L IIH +LKASNVLLD  + PK+ADF M
Sbjct  1105  DQVKRAQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNVLLDAEMAPKIADFGM  1164

Query  665   ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
             ARLF+ D+T  +T RIVGT GYM PEY +H + S+K +V+ FGV++
Sbjct  1165  ARLFIRDETQGNTSRIVGTFGYMAPEYAMHGQFSVKSDVFSFGVII  1210


 Score =   139 bits (349),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +1

Query  97    EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
             E++++DF TI+ AT+NFSD NK+G+GGFG +YKG   DG+ VAVKRLS +   G  EFKN
Sbjct  1002  ESLQFDFATIRIATDNFSDANKLGQGGFGAVYKGLLSDGQEVAVKRLSTDSGQGEVEFKN  1061

Query  277   KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
             +  L+AK QHRNLVRLLGF LEG+E LL+YEFVPN SLD+F+F    R
Sbjct  1062  EVLLVAKLQHRNLVRLLGFCLEGRERLLIYEFVPNTSLDHFIFDQVKR  1109


 Score =   139 bits (351),  Expect(2) = 1e-65, Method: Composition-based stats.
 Identities = 66/106 (62%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPVK   LDW RR KII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  441  DPVKCAHLDWERRNKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDAEMNPKISDFGM  500

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL  LD+T  +T RIVGT GYM PEY +H + S+K +V+ FGVL+
Sbjct  501  ARLCALDQTQGATSRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLL  546


 Score =   138 bits (347),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
            + E+++YDF TI+ AT++FSD NK+G+GGFG +YKGT   G L+AVKRLS +   G  EF
Sbjct  336  SAESLQYDFSTIRAATDDFSDANKLGQGGFGAVYKGTLASGELIAVKRLSTDSGQGDLEF  395

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            KN+  L+AK QHRNLVRL GF LEG E LL+YEFVPN SLD FLF
Sbjct  396  KNEVQLVAKLQHRNLVRLQGFCLEGNERLLIYEFVPNASLDQFLF  440



>gb|KCW76451.1| hypothetical protein EUGRSUZ_D00843 [Eucalyptus grandis]
Length=669

 Score =   142 bits (359),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 96/129 (74%), Gaps = 4/129 (3%)
 Frame = +1

Query  49   RYRFLVSSLEGISFAE----EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
            R R L  + E +   E    E++++D   I+ ATN+FSD+NK+G+GGFGV+YKGT  +G+
Sbjct  307  RSRRLKKNFETVPVDEISNAESLQFDLNIIREATNDFSDSNKLGQGGFGVVYKGTLANGQ  366

Query  217  LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
            ++AVKRLS +L  G QEFKN+  L+A+ QHRNLVRLLGF LEG+E LL+YEFVPN SLD+
Sbjct  367  VIAVKRLSVDLGQGDQEFKNEVLLVARLQHRNLVRLLGFCLEGRERLLIYEFVPNSSLDH  426

Query  397  FLFGNGSRT  423
            F++    R+
Sbjct  427  FIYDPVRRS  435


 Score =   137 bits (344),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPV+   LDW RR KII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF  
Sbjct  430  DPVRRSRLDWERRQKIIGGIARGLLYLHEDSQLRIIHRDLKASNILLDAEMNPKISDFGT  489

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D+T D+T R+VGT GYM PEY +H   S+K +V+ FGVL+
Sbjct  490  ARLFAVDQTQDATSRVVGTYGYMAPEYAMHGLFSVKSDVFSFGVLL  535



>ref|XP_009357560.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=564

 Score =   142 bits (357),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TIQ AT+NFSD +K+GEGGFG +YKG   +G+ VAVKRLS N   G +EFKN
Sbjct  223  ESLQFDFATIQAATSNFSDDHKLGEGGFGQVYKGILSNGQEVAVKRLSMNSDQGVEEFKN  282

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+VPN SLD+FLF
Sbjct  283  EMVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVPNKSLDHFLF  325


 Score =   137 bits (346),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  ++PK++DF M
Sbjct  326  DPEKQGQLDWSRRYKIISGIARGIMYLHEDSQLRIIHRDLKASNILLDGEMHPKISDFGM  385

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T RIVGT GYM PEY +H   S+K ++Y FGVLV
Sbjct  386  ARIFGVDQTQANTNRIVGTFGYMSPEYAMHGRFSVKSDLYSFGVLV  431



>ref|XP_008224863.1| PREDICTED: uncharacterized protein LOC103324571 [Prunus mume]
Length=1411

 Score =   140 bits (354),  Expect(2) = 4e-66, Method: Composition-based stats.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  ++PK++DF M
Sbjct  436  DPEKQGQLDWARRYKIIAGIARGIMYLHEDSRLRIIHRDLKASNILLDREMHPKISDFGM  495

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T RIVGT GYM PEY +H + S+K ++Y FGVL+
Sbjct  496  ARIFGVDQTQANTSRIVGTYGYMSPEYAMHGQFSVKSDLYSFGVLL  541


 Score =   139 bits (349),  Expect(2) = 4e-66, Method: Composition-based stats.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI  ATNNFSD NK+GEGGFG +YKG   +G+ VAVKRLS+N   G +EFKN
Sbjct  333  ESLQFDFSTIVAATNNFSDDNKLGEGGFGQVYKGILSNGQEVAVKRLSKNSGQGAEEFKN  392

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRL GF LEG+E +LVYE+V N SLD FLF
Sbjct  393  EMVLVAKLQHRNLVRLYGFCLEGEEKILVYEYVSNKSLDYFLF  435


 Score =   148 bits (374),  Expect(2) = 3e-62, Method: Composition-based stats.
 Identities = 73/137 (53%), Positives = 99/137 (72%), Gaps = 7/137 (5%)
 Frame = +1

Query  10    KEDLDSDSSMKGGRYRFLVSSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVM  189
             ++  ++  + K GR  +  +S+E + F       D  TI+ ATN FS++NK+GEGGFGV+
Sbjct  1055  RKKYNTAPNQKKGRNDYDTNSVESLQF-------DLETIETATNKFSESNKLGEGGFGVV  1107

Query  190   YKGTFEDGRLVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYE  369
             +KGT  +G+ +AVKRLS++ K G QEFKN+ AL+AK QHRNLVRLLGF LEG+E +LVYE
Sbjct  1108  FKGTLANGQEIAVKRLSKSSKQGVQEFKNEVALVAKLQHRNLVRLLGFCLEGEETILVYE  1167

Query  370   FVPNGSLDNFLFGNGSR  420
             +VPN SLD FLF +  R
Sbjct  1168  YVPNKSLDYFLFESKQR  1184


 Score =   118 bits (295),  Expect(2) = 3e-62, Method: Composition-based stats.
 Identities = 56/100 (56%), Positives = 74/100 (74%), Gaps = 1/100 (1%)
 Frame = +2

Query  506   LDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDMARLF-VL  682
             LDW  R  I   IARG++YL+EDS L +IH +LKASN+LLD  +NPK++DF MAR+F V 
Sbjct  1187  LDWSSRCMITGGIARGILYLHEDSRLRVIHRDLKASNILLDGNMNPKISDFGMARMFGVE  1246

Query  683   DKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
             D+T  +T+RIVGT GYM PEY +    S+K +V+ FGVL+
Sbjct  1247  DQTQGNTKRIVGTYGYMAPEYAMEGLYSVKSDVFSFGVLL  1286



>ref|XP_002518563.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF43950.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=1390

 Score =   147 bits (371),  Expect(2) = 4e-66, Method: Composition-based stats.
 Identities = 65/106 (61%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPV+   LDW +RYKII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  388  DPVRCVQLDWEKRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDSDMNPKISDFGM  447

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF++D+TH +T RIVGT GYM PEY +H + S K +++ FGVL+
Sbjct  448  ARLFIMDQTHSNTSRIVGTFGYMAPEYAMHGQFSFKSDIFSFGVLI  493


 Score =   132 bits (332),  Expect(2) = 4e-66, Method: Composition-based stats.
 Identities = 62/103 (60%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI+  T++FS+ NK+GEGGFG +YKGT   G+ +AVKRLS   K G  EFKN
Sbjct  285  ESLQFDFETIRICTDDFSEENKLGEGGFGSVYKGTLPMGQDIAVKRLSNGSKQGDLEFKN  344

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF L+G E LL+YEFVPN SLD ++F
Sbjct  345  EVLLVAKLQHRNLVRLLGFCLQGIERLLIYEFVPNASLDQYIF  387


 Score =   121 bits (304),  Expect(2) = 5e-54, Method: Composition-based stats.
 Identities = 55/99 (56%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = +1

Query  109   YDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKNKAAL  288
             ++  TI++ATNNFS  NK+GEGGFG +YKG   +G+ +AVKRLS   K G  EF+N+  +
Sbjct  1062  FNLTTIRSATNNFSTANKLGEGGFGPVYKGKLPNGQEIAVKRLSMTSKQGLDEFRNEVMV  1121

Query  289   MAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
             + K QH+NLVRLLG+  EG E LL+YE++ N SLD FLF
Sbjct  1122  IVKLQHKNLVRLLGYCTEGDEKLLIYEYLANTSLDAFLF  1160


 Score =   117 bits (293),  Expect(2) = 5e-54, Method: Composition-based stats.
 Identities = 57/106 (54%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = +2

Query  485   DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
             DP + + L W  R  II   ARGL+YL+EDS L IIH ++KASNVLLD  +NPK++DF  
Sbjct  1161  DPKRSKELYWEMRANIITGTARGLLYLHEDSRLKIIHRDMKASNVLLDNDMNPKISDFGT  1220

Query  665   ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
             AR+F  ++   +T R+VGT GYM PEY L   ISIK +VY FG+L+
Sbjct  1221  ARIFGGNQIEANTDRVVGTFGYMAPEYALEGVISIKSDVYSFGILM  1266



>ref|XP_010059510.1| PREDICTED: uncharacterized protein LOC104447479 [Eucalyptus grandis]
Length=1330

 Score =   140 bits (354),  Expect(2) = 5e-66, Method: Composition-based stats.
 Identities = 70/113 (62%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = +1

Query  67   SSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQN  246
            SS+  I+ AE +++YDF TIQ AT+NFS  NK+GEGGFG +++G   +G  +AVKRLSQ 
Sbjct  316  SSVNDIANAE-SLQYDFATIQAATDNFSHQNKLGEGGFGEVFQGRLNNGHQIAVKRLSQG  374

Query  247  LKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
               G  EFKN+  L+AK QHRNLVR+LGF LEG+E LLVYEFVPN SLD FLF
Sbjct  375  SGQGVGEFKNEVLLVAKLQHRNLVRMLGFCLEGEEKLLVYEFVPNKSLDYFLF  427


 Score =   138 bits (348),  Expect(2) = 5e-66, Method: Composition-based stats.
 Identities = 62/106 (58%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K + LDW RRYKI+  IARG++YL+EDS L IIH +LKASN+LLD  + PK++DF M
Sbjct  428  DPEKSKQLDWSRRYKIVCGIARGMLYLHEDSRLRIIHRDLKASNILLDSEMIPKISDFGM  487

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+ V+D+T  +T +IVGT GYM PEY +H + S+K +VY FGVL+
Sbjct  488  ARIVVVDQTQANTNKIVGTFGYMSPEYAMHGQFSVKSDVYSFGVLL  533


 Score =   136 bits (342),  Expect(2) = 1e-63, Method: Composition-based stats.
 Identities = 66/108 (61%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +1

Query  97    EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
             E++ Y   TIQ ATNNFS  NK+GEGGFG +++G   +G+ +AVK+LS++   G  EFKN
Sbjct  990   ESLLYHLATIQAATNNFSHQNKLGEGGFGAVFQGRLPNGQEIAVKKLSKSSGQGVGEFKN  1049

Query  277   KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
             + AL+AK QHRNLVRLLGF LEG+E LLVYEFVPN SLD FLF    R
Sbjct  1050  EVALVAKLQHRNLVRLLGFCLEGEEKLLVYEFVPNKSLDYFLFDPDKR  1097


 Score =   135 bits (339),  Expect(2) = 1e-63, Method: Composition-based stats.
 Identities = 62/105 (59%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +2

Query  485   DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
             DP K R LDW RRYKII  IARG++YL+EDS   IIH +LK SN+LLD  +NPK++DF M
Sbjct  1093  DPDKRRQLDWSRRYKIISGIARGMLYLHEDSRFRIIHRDLKPSNILLDSDMNPKISDFGM  1152

Query  665   ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVL  799
             AR+F  D+T   T  IVGT GY+ PEY +  +IS K +VY FGVL
Sbjct  1153  ARIFGADQTRAKTNHIVGTFGYLSPEYAMRGQISAKSDVYSFGVL  1197



>ref|XP_006468226.1| PREDICTED: uncharacterized protein LOC102628483 [Citrus sinensis]
Length=1349

 Score =   142 bits (357),  Expect(2) = 5e-66, Method: Composition-based stats.
 Identities = 66/106 (62%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP +   LDW RRYKII  IARGL+YL+EDS L IIH +LK SNVLLD  + PK+ADF M
Sbjct  411  DPTRRAQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKTSNVLLDAEMTPKIADFGM  470

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D+T  +T RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  471  ARLFEMDETQGNTSRIVGTYGYMAPEYAMHGQYSVKSDVFSFGVLV  516


 Score =   137 bits (345),  Expect(2) = 5e-66, Method: Composition-based stats.
 Identities = 65/103 (63%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI+ AT+NFSD NK+G+GGFG +YKG   DG  +AVKRLS++   G  EFKN
Sbjct  308  ESLQFDFNTIRVATDNFSDANKLGQGGFGAVYKGRLYDGAEIAVKRLSRDSGQGDLEFKN  367

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+A  QHRNLVRLLGFSLEG E LL+YEFVPN SLD+F+F
Sbjct  368  EVLLVANLQHRNLVRLLGFSLEGNERLLIYEFVPNTSLDHFIF  410


 Score =   128 bits (321),  Expect(2) = 1e-56, Method: Composition-based stats.
 Identities = 60/106 (57%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485   DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
             DPVK++ LDW +R  II  IARGL+YL+EDS L IIH ++KASNVLLD+ +NPK++DF  
Sbjct  1115  DPVKNKELDWAKRANIINGIARGLLYLHEDSRLKIIHRDMKASNVLLDDEMNPKISDFGT  1174

Query  665   ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
             AR+F  ++   +T ++VGT GYM PEY L    SIK +VY FGVL+
Sbjct  1175  ARIFGGNQLEANTEKVVGTYGYMAPEYALEGLFSIKSDVYSFGVLM  1220


 Score =   119 bits (299),  Expect(2) = 1e-56, Method: Composition-based stats.
 Identities = 61/111 (55%), Positives = 79/111 (71%), Gaps = 3/111 (3%)
 Frame = +1

Query  82    ISFAEEAVEYDFI---TIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLK  252
             ++  E++ E  +I   TI  ATNNFS+ NK+GEGGFG +YKG   +G+ VAVKRLS    
Sbjct  1004  VTEGEDSGEMHYIGLTTILAATNNFSNENKLGEGGFGPVYKGKLPNGKEVAVKRLSLRSS  1063

Query  253   GGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
              G +EF+N+  L+ K QH+NLVRLLG+ LEG E LLVYE++ N SLD FLF
Sbjct  1064  QGLEEFRNEVILIIKLQHKNLVRLLGYCLEGDEKLLVYEYMANTSLDAFLF  1114



>ref|XP_002271125.3| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis 
vinifera]
Length=692

 Score =   145 bits (365),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDW RRYKII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  448  DPIKRAQLDWDRRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDTEMNPKISDFGM  507

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLFV+D+T  +T RIVGT GYM PEY +H   S+K +VY FGVLV
Sbjct  508  ARLFVVDQTQGNTSRIVGTYGYMAPEYAMHGHFSVKTDVYSFGVLV  553


 Score =   134 bits (337),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI+ ATNNFSD NK+G+GGFG +YKG   +G+ +AVKRLS     G  EFKN
Sbjct  345  ESLQFDFATIRVATNNFSDANKLGQGGFGPVYKGRLSNGQEIAVKRLSSGSGQGELEFKN  404

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG E LL+YEFVP  SLDNF+F
Sbjct  405  EVILVAKLQHRNLVRLLGFCLEGIERLLIYEFVPKTSLDNFIF  447



>ref|XP_008441094.1| PREDICTED: uncharacterized protein LOC103485320 [Cucumis melo]
Length=1367

 Score =   140 bits (353),  Expect(2) = 6e-66, Method: Composition-based stats.
 Identities = 65/106 (61%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485   DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
             DP K   L+W RRYKII  IARGL+YL+EDS   IIH +LKASN+LLD+ +NPK+ DF M
Sbjct  1129  DPQKRTQLNWERRYKIINGIARGLLYLHEDSRFRIIHRDLKASNILLDQEMNPKIGDFGM  1188

Query  665   ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
             ARLF +D+T  +T RIVGT GYM PEYV H   S+K +V+ FG+LV
Sbjct  1189  ARLFEVDQTRGNTNRIVGTFGYMAPEYVKHGHFSVKSDVFSFGILV  1234


 Score =   138 bits (348),  Expect(2) = 6e-66, Method: Composition-based stats.
 Identities = 64/109 (59%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = +1

Query  97    EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
             E +++D  +I+ ATNNF+  NK+G+GGFGV+YKG    GR +AVKRL+ N + G  EFKN
Sbjct  1026  EMIQFDLDSIKAATNNFASENKLGQGGFGVVYKGRLAVGRPIAVKRLANNSQQGDAEFKN  1085

Query  277   KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSRT  423
             +  L+ K QHRNLVRLLGF L+G E LL+YEF+PNGSLDNF+F    RT
Sbjct  1086  EVLLVLKLQHRNLVRLLGFCLQGSERLLIYEFIPNGSLDNFIFDPQKRT  1134


 Score =   136 bits (343),  Expect(2) = 2e-63, Method: Composition-based stats.
 Identities = 62/108 (57%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E +++DF +I+ ATN+F+  NK+G+GGFGV+YKG   DGR +AVKRL+ + + G  EFKN
Sbjct  339  ETIQFDFDSIKVATNDFASENKLGQGGFGVVYKGKLPDGRAIAVKRLASSSQQGDVEFKN  398

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            +  LM K QHRNLVRLLGF L+G E LL+YEF+ NGSLD+F+F +  R
Sbjct  399  EVLLMLKLQHRNLVRLLGFCLQGSERLLIYEFIQNGSLDHFIFDSAKR  446


 Score =   134 bits (336),  Expect(2) = 2e-63, Method: Composition-based stats.
 Identities = 63/106 (59%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D  K   LDW  R KII  IARGL+YL+EDS   IIH +LKASN+LLDE +N K++DF M
Sbjct  442  DSAKRGLLDWETRCKIINGIARGLVYLHEDSQHRIIHRDLKASNILLDEDMNSKISDFGM  501

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D+T  +T R+VGT GYM PEYV+H   S+K +VY FG+LV
Sbjct  502  ARLFEVDQTQGNTNRVVGTYGYMAPEYVIHGRFSVKSDVYSFGILV  547



>ref|XP_003517662.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Glycine max]
Length=674

 Score =   140 bits (353),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII+ IARGL+YL+EDS L IIH +LKASNVLLDE + PK++DF M
Sbjct  430  DPTKKARLDWDRRYKIIQGIARGLLYLHEDSRLRIIHRDLKASNVLLDEEMIPKISDFGM  489

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL V  +T ++T R+VGT GYM PEY++H + SIK +V+ FGVLV
Sbjct  490  ARLIVAGQTQENTSRVVGTYGYMAPEYIMHGQFSIKSDVFSFGVLV  535


 Score =   138 bits (348),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F TI+ ATNNFSD+NK+GEGGFG +Y+G   +G+++AVKRLS +   G  EFKN
Sbjct  327  ESLQFNFDTIKVATNNFSDSNKLGEGGFGAVYQGRLSNGQVIAVKRLSSDSGQGGVEFKN  386

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGFSLEGKE LLVYE+VPN SLD F+F
Sbjct  387  EVLLLAKLQHRNLVRLLGFSLEGKEKLLVYEYVPNKSLDYFIF  429



>ref|XP_010090762.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
 gb|EXB40709.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
Length=900

 Score =   145 bits (365),  Expect(2) = 7e-66, Method: Composition-based stats.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K    DW  RYK I+ I+RGLIYL+EDS L IIH +LKASN+LLDE +NPK++DF M
Sbjct  659  DPTKRPSFDWDTRYKSIQGISRGLIYLHEDSRLRIIHRDLKASNILLDEEMNPKISDFGM  718

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLFV D+T D+T +IVGT GYM PEY +H + SIK +V+ FGVL+
Sbjct  719  ARLFVFDQTQDNTSQIVGTYGYMAPEYAMHGQFSIKSDVFSFGVLL  764


 Score =   133 bits (335),  Expect(2) = 7e-66, Method: Composition-based stats.
 Identities = 65/108 (60%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++ YDF TI  AT++FS+ NK+G GGFG +YKG   DG  +AVKRLS+    G QEFKN
Sbjct  556  ESLLYDFDTIAAATDDFSEENKLGVGGFGAVYKGQLSDGEYIAVKRLSKTSSQGDQEFKN  615

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            +  L+AK QHRNLVRLLGF L+ KE LLVYE+VPN SLD F+F    R
Sbjct  616  EVVLVAKLQHRNLVRLLGFCLKEKERLLVYEYVPNSSLDRFIFDPTKR  663



>ref|XP_010041722.1| PREDICTED: cysteine-rich receptor-like protein kinase 26, partial 
[Eucalyptus grandis]
Length=1020

 Score =   142 bits (358),  Expect(2) = 9e-66, Method: Composition-based stats.
 Identities = 67/106 (63%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   L+W RR KII  +ARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  776  DPLKRANLNWDRRQKIIMGVARGLLYLHEDSRLRIIHRDLKASNILLDSDMNPKISDFGM  835

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T   T RIVGT GYM PEYV+H   SIK +V+ FGVLV
Sbjct  836  ARLFELDQTQAETNRIVGTYGYMAPEYVMHGNFSIKSDVFSFGVLV  881


 Score =   135 bits (341),  Expect(2) = 9e-66, Method: Composition-based stats.
 Identities = 63/103 (61%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI+ AT+NFS++NK+G+GGFG +Y G F +G+ +AVKRLS N   G  EFKN
Sbjct  673  ESLQFDFGTIREATDNFSNSNKLGQGGFGAVYMGRFFNGQEIAVKRLSHNSSQGEVEFKN  732

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK  HRNLVRLLGF LEG E LL+YEFVPN SLD F+F
Sbjct  733  EVMLLAKLHHRNLVRLLGFCLEGVERLLIYEFVPNSSLDQFIF  775


 Score = 85.5 bits (210),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 39/71 (55%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +2

Query  590  IHYNLKASNVLLDEGLNPKLADFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISI  769
            ++ +LKASN+LLD  ++ K+ DF MARLF LD+T   T R+VGT GYM  EY +H   SI
Sbjct  263  VYMDLKASNILLDSDMHAKILDFGMARLFELDQTQAETNRVVGTYGYMALEYAMHGNFSI  322

Query  770  KPNVYGFGVLV  802
            K +V+ FGVLV
Sbjct  323  KSDVFSFGVLV  333



>gb|KHN01545.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=612

 Score =   145 bits (367),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP     LDW  RYKII  IARGL+YL+EDS L +IH +LKASN+LLDE +NPK+ADF M
Sbjct  381  DPNMKAQLDWESRYKIIRGIARGLLYLHEDSRLRVIHRDLKASNILLDEEMNPKIADFGM  440

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF++D+TH +TRRIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  441  ARLFLVDQTHANTRRIVGTCGYMAPEYAMHGQFSVKSDVFSFGVLV  486


 Score =   132 bits (332),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F TIQ AT +FSD+NK+G+GGFG +Y+G   +G+++AVKRLS++   G  EFKN
Sbjct  278  ESLQFNFNTIQVATEDFSDSNKLGQGGFGAVYRGRLSNGQMIAVKRLSRDSGQGDTEFKN  337

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG E LLVYE+VPN SLD F+F
Sbjct  338  EVLLVAKLQHRNLVRLLGFCLEGNERLLVYEYVPNKSLDYFIF  380



>ref|XP_006467959.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
[Citrus sinensis]
Length=577

 Score =   141 bits (355),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+    + W +RYKIIE IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  333  DPINREHMTWEKRYKIIEGIARGLLYLHEDSRLRIIHRDLKASNILLDSEMNPKISDFGM  392

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D+TH  T R+VGT GYM PEYV+H   S+K +++ FGVLV
Sbjct  393  ARLFEMDQTHSDTNRVVGTFGYMAPEYVMHGRFSVKSDIFSFGVLV  438


 Score =   137 bits (344),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            +++++DF TI+ AT+NFSD NK+G+GGFG +YKG   +G  +AVKRLS+N K G  EFKN
Sbjct  230  KSLQFDFETIRVATDNFSDANKLGQGGFGAVYKGMLSNGETIAVKRLSKNSKQGEIEFKN  289

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            +  L+A+ QHRNLVRLLGF LE KE +LVYEFVPN SLD+F+F   +R
Sbjct  290  EVLLLARLQHRNLVRLLGFCLERKERILVYEFVPNASLDHFIFDPINR  337



>ref|XP_002872592.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48851.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=668

 Score =   141 bits (355),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K R LDWGRRY II  IARG++YL++DS L IIH +LKASN+LLD+ +NPK+ADF M
Sbjct  431  DPTKRRQLDWGRRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDDDMNPKIADFGM  490

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +++T  +T +I GT GYM PEYV+H + S+K ++Y FGVLV
Sbjct  491  ARIFGMEQTRANTSKIAGTFGYMAPEYVMHGQFSMKSDIYSFGVLV  536


 Score =   137 bits (344),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
            + +++++DF TI+ AT+ FS+ NK+G+GGFG +YKG   +G  VAVKRLS+N   G QEF
Sbjct  326  SPQSLQFDFKTIEAATDRFSENNKVGQGGFGEVYKGRLSNGTEVAVKRLSKNSGQGSQEF  385

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            KN+  L+AK QHRNLVRLLGF LEG+E +LVYEFVPN SLD FLF    R
Sbjct  386  KNEVVLVAKLQHRNLVRLLGFCLEGEEQILVYEFVPNKSLDYFLFDPTKR  435



>ref|XP_006590217.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
[Glycine max]
Length=960

 Score =   139 bits (351),  Expect(2) = 1e-65, Method: Composition-based stats.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K + LDW RRYKII  IARG+ YL+EDS L IIH ++KASNVLLDE +NPK++DF M
Sbjct  717  DPAKQKELDWSRRYKIIVGIARGIQYLHEDSQLRIIHRDVKASNVLLDENMNPKISDFGM  776

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            A++F  D+T  +T RIVGT GYM PEY +  + S+K +V+ FGVLV
Sbjct  777  AKIFQADQTQVNTGRIVGTYGYMSPEYAMRGQFSVKSDVFSFGVLV  822


 Score =   138 bits (348),  Expect(2) = 1e-65, Method: Composition-based stats.
 Identities = 63/103 (61%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++D  T++ ATN FSD NKIG+GGFGV+YKG    G+ +AVKRLS     G  EF+N
Sbjct  614  ESLQFDLPTVEAATNRFSDENKIGQGGFGVVYKGVLPSGQEIAVKRLSVTSLQGAVEFRN  673

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +AAL+AK QHRNLVRLLGF LEG+E +L+YE++PN SLD FLF
Sbjct  674  EAALVAKLQHRNLVRLLGFCLEGQEKILIYEYIPNKSLDYFLF  716



>ref|XP_010433935.1| PREDICTED: cysteine-rich receptor-like protein kinase 6 [Camelina 
sativa]
Length=669

 Score =   142 bits (359),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            +P K   LDW +RYKII  IARG++YL+EDS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  435  EPTKQVQLDWTQRYKIIGGIARGILYLHEDSQLKIIHRDLKASNILLDVDINPKIADFGM  494

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F LD+T D+T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  495  ARIFGLDQTQDNTSRIVGTYGYMSPEYAMHGQFSMKSDVYSFGVLV  540


 Score =   135 bits (340),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
            A ++++ D+ TIQ ATNNF++ NKIG+GGFG +YKGTF +G+ VAVKRLS+N + G  EF
Sbjct  330  AADSLQLDYRTIQTATNNFAEGNKIGKGGFGEVYKGTFSNGKEVAVKRLSKNSRQGEAEF  389

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            K +  ++AK QHRNLVRLLGFSL+G E +LVYE++PN SLD  LF
Sbjct  390  KTEVVVVAKLQHRNLVRLLGFSLQGDERILVYEYMPNKSLDYLLF  434



>ref|XP_004145171.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
[Cucumis sativus]
Length=1122

 Score =   145 bits (367),  Expect(2) = 1e-65, Method: Composition-based stats.
 Identities = 65/111 (59%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            +++++DF TI  ATNNFS+ N++GEGGFGV+YKG  E+G+ +AVKRLS+    G +EFKN
Sbjct  325  DSLQFDFDTIHAATNNFSEENRVGEGGFGVVYKGRLENGQEIAVKRLSRGSLQGSEEFKN  384

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSRTCI  429
            +  L+AK QHRNLVRLLGF LEG E +L+YE++PN SLD FLF NG +  +
Sbjct  385  EVMLVAKLQHRNLVRLLGFCLEGGEKILIYEYIPNKSLDYFLFDNGGQKVL  435


 Score =   132 bits (332),  Expect(2) = 1e-65, Method: Composition-based stats.
 Identities = 60/99 (61%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  506  LDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDMARLFVLD  685
            LDW  R+KII  IARG++YL+EDS L I+H +LKASNVLLDE ++PK++DF MAR+  +D
Sbjct  435  LDWLSRHKIINGIARGMLYLHEDSRLRIVHRDLKASNVLLDEEMDPKISDFGMARIIQID  494

Query  686  KTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            +T  +TRRI GT GYM PEY +H   SIK +VY FGVL+
Sbjct  495  ETQKNTRRIAGTYGYMSPEYAMHGNFSIKSDVYSFGVLL  533


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  635  LNPKLADFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            +NPK++DF MAR+  +D+TH +TRRI GT  YM PEY +H   SIK +VY FGVL+
Sbjct  938  MNPKISDFGMARIIQIDETHINTRRIAGTFCYMSPEYAMHGIFSIKSDVYSFGVLL  993



>ref|XP_006365883.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Solanum tuberosum]
Length=676

 Score =   145 bits (367),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPVK R LDW +R KII  +A+G++YL+EDS L IIH +LKASNVLLDE +NPK+ADF M
Sbjct  429  DPVKRRQLDWEKRSKIIGGVAKGILYLHEDSRLRIIHRDLKASNVLLDEEMNPKIADFGM  488

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T  +T RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  489  ARLFTLDETQGNTSRIVGTYGYMSPEYAMHGQFSVKSDVFSFGVLV  534


 Score =   132 bits (332),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 88/128 (69%), Gaps = 4/128 (3%)
 Frame = +1

Query  49   RYRFLVSSLEGIS----FAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
            R R LV +++ I        E+ +YDF TI+ AT+NFS  NK+G+GGFG +YKGT  + +
Sbjct  306  RRRKLVKNIQSIHGDDISTAESFQYDFSTIRAATDNFSSDNKLGQGGFGPVYKGTLPNSQ  365

Query  217  LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
             VAVKRLS +   G  EFKN+  L+A+ QHRNLVRLLG+  +G E LL+YEFVPN SLD+
Sbjct  366  EVAVKRLSADSGQGDLEFKNEVMLVARLQHRNLVRLLGYCFDGTERLLIYEFVPNASLDH  425

Query  397  FLFGNGSR  420
            FLF    R
Sbjct  426  FLFDPVKR  433



>ref|XP_006285944.1| hypothetical protein CARUB_v10007464mg [Capsella rubella]
 gb|EOA18842.1| hypothetical protein CARUB_v10007464mg [Capsella rubella]
Length=666

 Score =   143 bits (360),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL++DS L IIH +LKASN+LLD+ +NPK+ DF M
Sbjct  430  DPTKQAQLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKASNILLDKDMNPKITDFGM  489

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F LD+T ++T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  490  ARIFGLDQTQENTSRIVGTYGYMSPEYAMHGQFSMKSDVYSFGVLV  535


 Score =   134 bits (338),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
             EE+++ D+ TIQ ATNN+S+ NKIG GGFG +YKGT  +G  VAVKRLS++   G  EF
Sbjct  325  TEESLQLDYRTIQAATNNYSENNKIGRGGFGEVYKGTLSNGSEVAVKRLSKSSGQGDTEF  384

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            KN+  ++AK QHRNLVRLLGFSLE +E +LVYE+VPN SLD FLF
Sbjct  385  KNEVVVVAKLQHRNLVRLLGFSLEREERILVYEYVPNKSLDYFLF  429



>gb|KFK22120.1| hypothetical protein AALP_AAs48628U000100, partial [Arabis alpina]
Length=392

 Score =   141 bits (356),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL++DS L I+H +LKASNVLLD  +NPK+ADF M
Sbjct  156  DPAKQGQLDWSRRYKIIGGIARGILYLHQDSRLTIVHRDLKASNVLLDADMNPKIADFGM  215

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  216  ARIFGIDQTEQNTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLV  261


 Score =   136 bits (342),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++ D+ TIQ ATNNF+++NKIGEGGFG +YKGT  DG  VAVKRLS++   G +EFKN
Sbjct  53   DSLQLDYRTIQTATNNFAESNKIGEGGFGQVYKGTLLDGTEVAVKRLSKSSGQGEREFKN  112

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+VPN SLD F+F
Sbjct  113  EVVLVAKLQHRNLVRLLGFCLEGEERVLVYEYVPNESLDYFVF  155



>ref|XP_003589314.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=372

 Score =   141 bits (355),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +2

Query  494  KHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDMARL  673
            K   L+WGRRYKII  IARG++YL+EDS L +IH +LKASN+LLDE +NPK+ADF MARL
Sbjct  155  KKAQLNWGRRYKIILGIARGILYLHEDSRLRVIHRDLKASNILLDEEMNPKIADFGMARL  214

Query  674  FVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            F +D+T ++T RIVGT GYM PEYV+  + S+K +V+ FG+LV
Sbjct  215  FSIDQTQENTNRIVGTYGYMAPEYVMQGQFSVKSDVFSFGILV  257


 Score =   136 bits (343),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = +1

Query  37   MKGGRYRFLVSSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
            M   R+  +    + I+   E +++DF T++ ATN+FSD+NK+G+GGFG +YKG F +G+
Sbjct  27   MPDKRFEEVQEEEDKINITTEQLQFDFNTMRIATNDFSDSNKLGKGGFGFVYKGRFSNGQ  86

Query  217  LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
             VAVKRLS N   G  EFKN+  L+AK QHRNLVRLLGF LEG+E LL+YEFV N SLD 
Sbjct  87   EVAVKRLSMNSGQGDLEFKNEVFLVAKLQHRNLVRLLGFCLEGRERLLIYEFVHNKSLDY  146

Query  397  FLFGNGSR  420
            F+FG  S+
Sbjct  147  FIFGRSSK  154



>ref|XP_003635656.2| PREDICTED: cysteine-rich receptor-like protein kinase 10, partial 
[Vitis vinifera]
Length=367

 Score =   140 bits (353),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   L W  RYKII  IARGL+YL+EDS L IIH +LKASNVLLDE +NPK+ADF M
Sbjct  128  DPIKRSQLHWKIRYKIIVGIARGLLYLHEDSRLRIIHRDLKASNVLLDEEMNPKIADFGM  187

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T   T RIVGT GYM PEY +H   S+K +V+ FGVLV
Sbjct  188  ARLFSLDQTQGDTSRIVGTYGYMAPEYAMHGNFSVKSDVFSFGVLV  233


 Score =   137 bits (344),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++   I+NATNNFSD+NK+G+GGFG +YKGT  +G+ +AVKRLS+    G  EFKN
Sbjct  25   ESLQFNLGPIRNATNNFSDSNKLGQGGFGAVYKGTLSNGQDIAVKRLSKGSGQGELEFKN  84

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSRT  423
            +  L+AK QHRNLVRLLGF LEG E LL+YEFVPN SLD+FLF    R+
Sbjct  85   EVLLVAKLQHRNLVRLLGFCLEGIERLLIYEFVPNASLDHFLFDPIKRS  133



>ref|XP_009768670.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Nicotiana 
sylvestris]
Length=683

 Score =   141 bits (356),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPVK R LDW RR +II  +ARG++YL+EDS L IIH +LKASNVLLD  +NPK++DF M
Sbjct  436  DPVKRRQLDWERRSRIIGGVARGILYLHEDSRLRIIHRDLKASNVLLDAEMNPKISDFGM  495

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T  +T RI GT GYM PEY +H + S+K +V+ FGVLV
Sbjct  496  ARLFTLDETQGNTSRIAGTYGYMAPEYAMHGQFSVKSDVFSFGVLV  541


 Score =   135 bits (341),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 88/123 (72%), Gaps = 4/123 (3%)
 Frame = +1

Query  49   RYRFLVSSLEGIS----FAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
            R R LV  ++ I        E+++YDF TI+ AT+NFS+ NK+G+GGFG +YKG   +G+
Sbjct  313  RKRKLVDEIQSIRGDDISTAESLQYDFSTIRTATDNFSNANKLGQGGFGPVYKGKLSNGQ  372

Query  217  LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
             VAVKRLS +   G  EFKN+  L+++ QHRNLVRLLGF L+G E LLVYEFVPN SLD 
Sbjct  373  EVAVKRLSADSGQGDLEFKNEVVLVSRLQHRNLVRLLGFCLDGTERLLVYEFVPNASLDQ  432

Query  397  FLF  405
            FLF
Sbjct  433  FLF  435



>ref|XP_009357379.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=669

 Score =   140 bits (352),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++ F TIQ AT+NFSD +K+GEGGFG +YKGT  +G+ VAVKRLS+N   G +EFKN
Sbjct  328  ESLQFHFATIQAATSNFSDDHKLGEGGFGQVYKGTLSNGQEVAVKRLSRNSGQGTEEFKN  387

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+VPN SLD FLF
Sbjct  388  EMVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVPNKSLDCFLF  430


 Score =   137 bits (345),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = +2

Query  473  CSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLA  652
            C   DP K   LDW  RYKII  IARG++YL+EDS L IIH +LKASN+LLD  ++PK++
Sbjct  427  CFLFDPEKQGQLDWSTRYKIISGIARGIMYLHEDSRLRIIHRDLKASNILLDGEMHPKIS  486

Query  653  DFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            DF MAR+F +D+T  ST RIVGT GYM PEY +H   S+K ++Y FGVLV
Sbjct  487  DFGMARIFGVDQTQASTNRIVGTYGYMSPEYAMHGHFSVKSDLYSFGVLV  536



>ref|XP_008219910.1| PREDICTED: uncharacterized protein LOC103320073 [Prunus mume]
Length=1309

 Score =   140 bits (352),  Expect(2) = 2e-65, Method: Composition-based stats.
 Identities = 65/106 (61%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP++   LDW  RYKII  I RGL+YL+EDS L IIH ++KASNVLLD  ++PK+ADF M
Sbjct  431  DPIRRAHLDWDSRYKIIVGIGRGLLYLHEDSRLRIIHRDMKASNVLLDAEMHPKIADFGM  490

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T   T R+VGT GYM PEYV+  + S+K +VY FGVLV
Sbjct  491  ARLFDLDQTQGETSRVVGTYGYMAPEYVMRGQFSVKSDVYSFGVLV  536


 Score =   137 bits (344),  Expect(2) = 2e-65, Method: Composition-based stats.
 Identities = 66/110 (60%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = +1

Query  76   EGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKG  255
            EG     EA+++DF +I+ ATNNFS+ NK+G GGFG +Y+G   +   +AVKRLS++   
Sbjct  321  EGDEIGTEALQFDFNSIKVATNNFSEANKLGRGGFGAVYRGRLWNEEDIAVKRLSRDSAQ  380

Query  256  GCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            G  EFKN+ AL+AK QHRNLVRLLGF LEG E LLVYEFVPN SLD F+F
Sbjct  381  GDIEFKNEVALVAKLQHRNLVRLLGFCLEGNERLLVYEFVPNASLDKFIF  430


 Score =   148 bits (373),  Expect(2) = 9e-65, Method: Composition-based stats.
 Identities = 67/106 (63%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485   DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
             DP+K   LDW RRYKII  I RGL+YL+EDS L +IH +LKA N+LLD  +NPK+ADF M
Sbjct  1075  DPIKRAQLDWDRRYKIIVGIGRGLVYLHEDSRLRVIHRDLKAGNILLDAEMNPKIADFGM  1134

Query  665   ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
             ARLFVLD+T   T RIVGT GYM PEY +H + S+K +VY FGVL+
Sbjct  1135  ARLFVLDQTEGETNRIVGTYGYMAPEYAMHGQFSVKSDVYSFGVLL  1180


 Score =   127 bits (318),  Expect(2) = 9e-65, Method: Composition-based stats.
 Identities = 61/105 (58%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +1

Query  91    AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
             + EA+++DF +I+ ATNNF + NK+G GGFG +Y+G   +   +AVKRLS++   G  EF
Sbjct  970   SAEALQFDFNSIRIATNNFCEGNKLGRGGFGAVYRGRLLNEEDIAVKRLSRDSTQGDIEF  1029

Query  271   KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
             +N+ AL+AK QHRNLVRLLGF LEG E LLVYEFV N SLD F+F
Sbjct  1030  RNEVALVAKLQHRNLVRLLGFCLEGNERLLVYEFVHNASLDQFIF  1074



>gb|KCW76366.1| hypothetical protein EUGRSUZ_D00744 [Eucalyptus grandis]
Length=390

 Score =   139 bits (349),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  67   SSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQN  246
              L GIS AE ++++D   I+ ATN+FSD+NK+G+GGFGV+Y GT  +G+ VAVKR   +
Sbjct  15   PPLNGISNAE-SLQFDLNIIREATNDFSDSNKLGQGGFGVVYTGTLANGQAVAVKRPYVD  73

Query  247  LKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSRT  423
            L  G QEFKN+  L+A+ QHRNLVRLLGF LEG+E LL+YEFVPN SLD+F++    R+
Sbjct  74   LGQGNQEFKNEVLLVARLQHRNLVRLLGFCLEGRERLLIYEFVPNSSLDHFIYDPVRRS  132


 Score =   138 bits (347),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPV+   L W RR KII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF  
Sbjct  127  DPVRRSQLGWQRRQKIIGGIARGLLYLHEDSQLRIIHRDLKASNILLDTEMNPKISDFGT  186

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D+T D+T R+VGT GYM PEY +H   S+K NV+ FGVL+
Sbjct  187  ARLFAVDQTQDATSRVVGTYGYMAPEYAMHGLFSVKSNVFSFGVLL  232



>gb|KFK23238.1| hypothetical protein AALP_AAs43447U000100 [Arabis alpina]
Length=571

 Score =   142 bits (358),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL++DS L IIH +LKASNVLLD  +NPK+ADF M
Sbjct  335  DPAKQGQLDWSRRYKIIGGIARGILYLHQDSRLTIIHRDLKASNVLLDADMNPKIADFGM  394

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  395  ARIFGIDQTEQNTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLV  440


 Score =   134 bits (338),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++ D+ TIQ+AT+NF+++NKIGEGGFG +YKGT  DG  VAVKRLS++   G +EFKN
Sbjct  232  DSLQLDYRTIQSATDNFAESNKIGEGGFGQVYKGTLLDGTEVAVKRLSKSSGQGEREFKN  291

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+VPN SLD F+F
Sbjct  292  EVVLVAKLQHRNLVRLLGFCLEGEERVLVYEYVPNESLDYFVF  334



>ref|XP_006449131.1| hypothetical protein CICLE_v10014521mg [Citrus clementina]
 gb|ESR62371.1| hypothetical protein CICLE_v10014521mg [Citrus clementina]
Length=664

 Score =   141 bits (356),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+    + W +RYKIIE IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  420  DPINREHMTWEKRYKIIEGIARGLLYLHEDSRLRIIHRDLKASNILLDSEMNPKISDFGM  479

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D+TH  T R+VGT GYM PEYV+H   S+K +++ FGVLV
Sbjct  480  ARLFEMDQTHSDTNRVVGTFGYMAPEYVMHGRFSVKSDIFSFGVLV  525


 Score =   135 bits (340),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            +++++DF TI+ AT+NFSD NK+G+GGFG +YKG   +G  +AVKRLS+N K G  EFKN
Sbjct  317  KSLQFDFETIRVATDNFSDANKLGQGGFGAVYKGMLLNGETIAVKRLSKNSKQGEIEFKN  376

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            +  L+A+ QHRNLVRLLGF LE KE +LVYEFVPN SLD+F+F   +R
Sbjct  377  EVLLLARLQHRNLVRLLGFCLERKERILVYEFVPNASLDHFIFDPINR  424



>ref|XP_004158053.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=2882

 Score =   140 bits (352),  Expect(2) = 3e-65, Method: Composition-based stats.
 Identities = 62/106 (58%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP + R LDW +RYKII  IARG++YL+EDS L IIH +LKASN+LLD+ +NPK++DF +
Sbjct  405  DPKRQRELDWLKRYKIIHGIARGMLYLHEDSRLRIIHRDLKASNILLDKNMNPKISDFGL  464

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+  +D+T  +T RIVGT GYM PEY +H   S+K +VY FGV+V
Sbjct  465  ARIVQVDQTQGNTNRIVGTYGYMAPEYAMHGNFSLKSDVYSFGVIV  510


 Score =   137 bits (344),  Expect(2) = 3e-65, Method: Composition-based stats.
 Identities = 60/103 (58%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI +ATNNFS+ N++GEGGFG +YKG  E+G+ +AVKRLS+    G +EFKN
Sbjct  302  ESLQFDFKTINDATNNFSEENRLGEGGFGAVYKGRLENGQEIAVKRLSRGSSQGFEEFKN  361

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLV+LLGF L+G E +L+YE++PN SL+ FLF
Sbjct  362  EVMLVAKLQHRNLVKLLGFCLDGGEKILIYEYIPNKSLNFFLF  404


 Score =   121 bits (304),  Expect(2) = 3e-53, Method: Composition-based stats.
 Identities = 55/103 (53%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = +2

Query  494   KHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDMARL  673
             K + LDW +R+ II  IARGL+YL+ DS L IIH +LKASN+LLD+ +NPK++DF MAR+
Sbjct  2654  KQKLLDWRKRFNIINGIARGLLYLHRDSRLRIIHRDLKASNILLDKDMNPKISDFGMARI  2713

Query  674   FVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
             F  ++   +T R+VGT GYM PEY +  + S K +V+ FGVL+
Sbjct  2714  FGSNEVEANTIRVVGTYGYMSPEYAMQGQFSEKSDVFSFGVLL  2756


 Score =   115 bits (287),  Expect(2) = 3e-53, Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +1

Query  109   YDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKNKAAL  288
             YDF  +  AT++F  + K+G+GGFG +YKGT  DG+ +A+KRLS+    G +EF N+  +
Sbjct  2552  YDFEKLAIATDSFDLSKKLGQGGFGPVYKGTLLDGQEIAIKRLSRASNQGYEEFINEVIV  2611

Query  289   MAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
             ++K QHRNLV+LLG  +EG+E +L+YE++PN SLD F+FG+  +
Sbjct  2612  ISKLQHRNLVQLLGCCIEGEEKMLIYEYMPNSSLDAFIFGSAKQ  2655



>emb|CAC84518.1| putative receptor-like serine-threonine protein kinase [Solanum 
tuberosum]
Length=651

 Score =   140 bits (353),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D VK R LDW RR KII  IA+G++YL+EDS L IIH +LKASNVLLD  +NPK++DF M
Sbjct  404  DSVKRRQLDWERRSKIIGGIAKGILYLHEDSRLRIIHRDLKASNVLLDAEMNPKISDFGM  463

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T  ST RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  464  ARLFELDETQGSTNRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLV  509


 Score =   136 bits (343),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 92/128 (72%), Gaps = 4/128 (3%)
 Frame = +1

Query  49   RYRFLVSSLEGISFAE----EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
            R R LV+ ++  S  +    E+ +YDF  I+ AT++FSD NK+GEGGFG +YKG  ++G+
Sbjct  281  RKRKLVNEIQSTSVDDTSIAESFQYDFSAIRAATDDFSDANKLGEGGFGPVYKGKLQNGQ  340

Query  217  LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
             VAVKRLS +   G  EFKN+  L+A+ QHRNLVRLLGF L+G E LLVYEFVPN SLD+
Sbjct  341  EVAVKRLSADSGQGDLEFKNEVLLVARLQHRNLVRLLGFCLDGTERLLVYEFVPNASLDH  400

Query  397  FLFGNGSR  420
            FLF +  R
Sbjct  401  FLFDSVKR  408



>ref|XP_010247617.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Nelumbo 
nucifera]
Length=690

 Score =   142 bits (358),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++ ITI  ATNNFSD NKIGEGGFG +YKG   +G+ +AVKRLS++   G  EFKN
Sbjct  343  ESLQFNLITITAATNNFSDGNKIGEGGFGSVYKGKLSNGQEIAVKRLSRSSGQGAVEFKN  402

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSRTCI  429
            +  L+AK QHRNLVRLLGF LEG+E +L+YEFVPN SLD FLF    R C+
Sbjct  403  EVVLVAKLQHRNLVRLLGFCLEGQEKILIYEFVPNKSLDYFLFDPDKRACL  453


 Score =   134 bits (338),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW  RYKII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  446  DPDKRACLDWPTRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDGDMNPKISDFGM  505

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D++  +T RIVGT GYM PEY +H + S+K +VY FGVL+
Sbjct  506  ARIFGVDQSQANTNRIVGTYGYMSPEYAMHGQFSVKSDVYSFGVLL  551



>emb|CAC83607.1| putative receptor-like serine-threonine protein kinase [Solanum 
tuberosum]
Length=676

 Score =   140 bits (353),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D VK R LDW RR KII  IA+G++YL+EDS L IIH +LKASNVLLD  +NPK++DF M
Sbjct  429  DSVKRRQLDWERRSKIIGGIAKGILYLHEDSRLRIIHRDLKASNVLLDAEMNPKISDFGM  488

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T  ST RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  489  ARLFELDETQGSTNRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLV  534


 Score =   136 bits (343),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 92/128 (72%), Gaps = 4/128 (3%)
 Frame = +1

Query  49   RYRFLVSSLEGISFAE----EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
            R R LV+ ++  S  +    E+ +YDF  I+ AT++FSD NK+GEGGFG +YKG  ++G+
Sbjct  306  RKRKLVNEIQSTSVDDTSIAESFQYDFSAIRAATDDFSDANKLGEGGFGPVYKGKLQNGQ  365

Query  217  LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
             VAVKRLS +   G  EFKN+  L+A+ QHRNLVRLLGF L+G E LLVYEFVPN SLD+
Sbjct  366  EVAVKRLSADSGQGDLEFKNEVLLVARLQHRNLVRLLGFCLDGTERLLVYEFVPNASLDH  425

Query  397  FLFGNGSR  420
            FLF +  R
Sbjct  426  FLFDSVKR  433



>ref|XP_006603573.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Glycine max]
Length=710

 Score =   139 bits (350),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARGL+YL+EDS L IIH +LKASNVLLDE + PK++DF M
Sbjct  466  DPTKKARLDWDRRYKIIRGIARGLLYLHEDSRLRIIHRDLKASNVLLDEEMIPKISDFGM  525

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL V  +T ++T R+VGT GYM PEY++H + SIK +V+ FGVLV
Sbjct  526  ARLIVAGQTQENTSRVVGTYGYMAPEYIMHGQFSIKSDVFSFGVLV  571


 Score =   137 bits (345),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++  TI+ ATNNFSD+NK+GEGGFG +Y+G   +G+++AVKRLS +   G  EFKN
Sbjct  363  ESLQFNLDTIKVATNNFSDSNKLGEGGFGAVYQGRLSNGQVIAVKRLSSDSGQGGVEFKN  422

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGFSLEGKE LLVYEFVPN SLD F+F
Sbjct  423  EVLLLAKLQHRNLVRLLGFSLEGKEKLLVYEFVPNKSLDYFIF  465



>emb|CAC83606.1| putative receptor-like serine-threonine protein kinase [Solanum 
tuberosum]
Length=676

 Score =   140 bits (353),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D VK R LDW RR KII  IA+G++YL+EDS L IIH +LKASNVLLD  +NPK++DF M
Sbjct  429  DSVKRRQLDWERRSKIIGGIAKGILYLHEDSRLRIIHRDLKASNVLLDAEMNPKISDFGM  488

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T  ST RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  489  ARLFELDETQGSTNRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLV  534


 Score =   136 bits (342),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 92/128 (72%), Gaps = 4/128 (3%)
 Frame = +1

Query  49   RYRFLVSSLEGISFAE----EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
            R R LV+ ++  S  +    E+ +YDF  I+ AT++FSD NK+GEGGFG +YKG  ++G+
Sbjct  306  RKRKLVNEIQSTSVDDTSIAESFQYDFSAIRAATDDFSDANKLGEGGFGPVYKGKLQNGQ  365

Query  217  LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
             VAVKRLS +   G  EFKN+  L+A+ QHRNLVRLLGF L+G E LLVYEFVPN SLD+
Sbjct  366  EVAVKRLSADSGQGDLEFKNEVLLVARLQHRNLVRLLGFCLDGTERLLVYEFVPNASLDH  425

Query  397  FLFGNGSR  420
            FLF +  R
Sbjct  426  FLFDSVKR  433



>emb|CBI23395.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   142 bits (359),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP++   LDW RRYKII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  131  DPIRRAQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDAEMNPKISDFGM  190

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF++D+T  +T RIVGT GYM PEY +H   S+K +VY FGVLV
Sbjct  191  ARLFLVDQTQGNTSRIVGTYGYMAPEYAMHGHFSVKTDVYSFGVLV  236


 Score =   134 bits (336),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++ +DF TI+ ATNNFSD+NK+G+GGFG +YKG   +G+ +AVKRLS     G  EFKN
Sbjct  28   ESLHFDFDTIRVATNNFSDSNKLGQGGFGPVYKGKLSNGQDIAVKRLSSGSGQGELEFKN  87

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF L+G E LL+YEFVPN SLD+F+F
Sbjct  88   EVVLVAKLQHRNLVRLLGFCLDGAERLLIYEFVPNTSLDHFIF  130



>ref|XP_008224864.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich receptor-like protein 
kinase 10 [Prunus mume]
Length=1165

 Score =   144 bits (363),  Expect(2) = 3e-65, Method: Composition-based stats.
 Identities = 66/106 (62%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485   DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
             DP  H  LDW  RYKII  IARGL+YL+EDS L IIH +LK SN+LLDE +NPK+ADF M
Sbjct  931   DPTDHAHLDWETRYKIIGGIARGLLYLHEDSRLRIIHRDLKPSNILLDEDMNPKIADFGM  990

Query  665   ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
             ARLF++D+T   T+ IVGT GYM PEY +H   S+K +V+ FGVLV
Sbjct  991   ARLFMMDQTQGDTKTIVGTYGYMAPEYAIHGRFSVKSDVFSFGVLV  1036


 Score =   132 bits (332),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++YDF TI++AT++FSD NK+G+GGFG +YKG   +GR +AVKRLS+N + G +EFK 
Sbjct  828  ESLQYDFDTIRSATDDFSDANKLGQGGFGAVYKGRLANGRYIAVKRLSKNSEQGDREFKT  887

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+A+ QHRNLVRLLGF L+  E +L+YE+VPN SL++F+F
Sbjct  888  EVTLVAQLQHRNLVRLLGFCLKAGERILIYEYVPNTSLNHFIF  930


 Score =   133 bits (334),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  506  LDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDMARLFVLD  685
            LDW  RYKII  IARGL+YL++DS L IIH +LKA NVLLD  +NPK+ADF MAR+F  D
Sbjct  307  LDWSSRYKIIGGIARGLLYLHQDSRLQIIHRDLKAGNVLLDGNMNPKIADFGMARIFGAD  366

Query  686  KTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            +T  STRRIVGT GYM PEY ++ + S+K ++Y  GVL+
Sbjct  367  QTQGSTRRIVGTYGYMPPEYAMYGQFSVKSDMYSLGVLI  405


 Score =   127 bits (319),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++D  TI+ AT NFSD N++G G FG +YKGT  DG  +AVKRLS+    G +EFKN
Sbjct  197  ESLQFDLRTIEAATENFSDQNRLGGGSFGEVYKGTLPDGLQIAVKRLSRGSGQGAEEFKN  256

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGN  411
            +  L+AK QHRNLVRLLGF  EG+E LLVYE V N SLD+FLFG+
Sbjct  257  EIVLVAKLQHRNLVRLLGFCSEGEEKLLVYELVENKSLDHFLFGS  301



>gb|KDO37598.1| hypothetical protein CISIN_1g008238mg [Citrus sinensis]
Length=573

 Score =   141 bits (355),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            +P K + LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  435  EPEKQQQLDWSRRYKIIGGIARGILYLHEDSRLRIIHRDLKASNILLDAEMNPKISDFGM  494

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            A++F +D+T  +T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  495  AKIFGVDQTQGNTNRIVGTYGYMAPEYAMHGQFSVKSDVYSFGVLV  540


 Score =   135 bits (339),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI+ ATNNFS  NK+GEGGFG +YKG    G+ +AVKRLS++   G QEFKN
Sbjct  332  ESLQFDFETIEVATNNFSTDNKLGEGGFGEVYKGVLPSGQEIAVKRLSRSSGQGGQEFKN  391

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYEFVPN SLD FL+
Sbjct  392  EVVLVAKLQHRNLVRLLGFCLEGEEKILVYEFVPNKSLDYFLY  434



>ref|XP_009785802.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X2 [Nicotiana sylvestris]
Length=671

 Score =   139 bits (351),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPVK   LDW RR KI+  IARG++YL+EDS L IIH +LKASNVLLD  +NPK++DF M
Sbjct  424  DPVKRTQLDWERRSKIVGGIARGILYLHEDSRLRIIHRDLKASNVLLDAEMNPKISDFGM  483

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T  +T RI GT GYM PEY +H + S+K +V+ FGVLV
Sbjct  484  ARLFTLDETQGNTSRIAGTYGYMAPEYAMHGQFSVKSDVFSFGVLV  529


 Score =   136 bits (343),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 89/129 (69%), Gaps = 4/129 (3%)
 Frame = +1

Query  49   RYRFLVSSLEGIS----FAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
            R R LV  ++ I        E+++YDF TI+ AT+NFS+ NK+G+GGFG +YKG   +G 
Sbjct  301  RKRKLVDEIQSIHGDDISTAESLQYDFSTIRAATDNFSNANKLGQGGFGPVYKGKLPNGE  360

Query  217  LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
             VAVKRLS +   G  EFKN+  L+++ QHRNLVRLLGF L+G E LLVYEFVPN SLD 
Sbjct  361  EVAVKRLSADSGQGDLEFKNEVVLVSRLQHRNLVRLLGFCLDGTERLLVYEFVPNASLDQ  420

Query  397  FLFGNGSRT  423
            FLF    RT
Sbjct  421  FLFDPVKRT  429



>emb|CAC84552.1| putative receptor-like serine-threonine protein kinase [Solanum 
tuberosum]
Length=676

 Score =   140 bits (354),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D VK R LDW RR KII  IA+G++YL+EDS L IIH +LKASNVLLD  +NPK++DF M
Sbjct  429  DSVKRRQLDWERRSKIIGGIAKGILYLHEDSRLRIIHRDLKASNVLLDAEMNPKISDFGM  488

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T  ST RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  489  ARLFELDETQGSTNRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLV  534


 Score =   135 bits (341),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 92/128 (72%), Gaps = 4/128 (3%)
 Frame = +1

Query  49   RYRFLVSSLEGISFAE----EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
            R R LV+ ++G S  +    E+ +YDF  I+ AT++FSD NK+GEGGFG +YKG  ++G+
Sbjct  306  RKRKLVNGIQGTSVDDTSIAESFQYDFSAIRAATDDFSDANKLGEGGFGPVYKGKLQNGQ  365

Query  217  LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
             VAVKRLS +   G  E KN+  L+A+ QHRNLVRLLGF L+G E LLVYEFVPN SLD+
Sbjct  366  EVAVKRLSADSGQGDLESKNEVLLVARLQHRNLVRLLGFCLDGTERLLVYEFVPNASLDH  425

Query  397  FLFGNGSR  420
            FLF +  R
Sbjct  426  FLFDSVKR  433



>ref|XP_003635675.2| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis 
vinifera]
Length=363

 Score =   138 bits (348),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D ++   LDW RRYKII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  119  DLIRRAQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDAEMNPKISDFGM  178

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF++D+T  +T RIVGT GYM PEY +H   S+K +VY FGVLV
Sbjct  179  ARLFLVDQTQGNTNRIVGTYGYMAPEYAMHGHFSVKTDVYSFGVLV  224


 Score =   137 bits (346),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++ +DF TI+ ATNNFSD+NK+G+GGFG +YKG   +G+ VAVKRLS     G  EFKN
Sbjct  16   ESLHFDFDTIRVATNNFSDSNKLGQGGFGPVYKGRLSNGQYVAVKRLSSGSAQGELEFKN  75

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +A L+AK QHRNLVRLLGF L+G E LL+YEFVPN SLD+F+F
Sbjct  76   EAVLVAKLQHRNLVRLLGFCLDGAERLLIYEFVPNTSLDHFIF  118



>ref|XP_008439953.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Cucumis 
melo]
Length=722

 Score =   140 bits (354),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +2

Query  494  KHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDMARL  673
            K   LDWGRRYKII  IARGL+YL+EDS L IIH +LKASN+LLDE +NPK+ADF +ARL
Sbjct  490  KRILLDWGRRYKIINGIARGLLYLHEDSRLRIIHRDLKASNILLDEEMNPKIADFGLARL  549

Query  674  FVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            F +D+T  +T RIVGT GYM PEY+ H + SIK +V+ FGVLV
Sbjct  550  FEVDETQGNTSRIVGTYGYMAPEYITHGQFSIKSDVFSFGVLV  592


 Score =   135 bits (340),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E +++DF  I++ATN+FS+ NK+G+GGFG +YKG   +G+ +AVKRL+ N + G  EFKN
Sbjct  384  ETIQFDFDVIKDATNDFSNENKLGQGGFGAVYKGKLPNGQHIAVKRLAHNSQQGDAEFKN  443

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+ K QHRNLVRLLGF L+G E LL+YEFVPNGSLD+F+F
Sbjct  444  EVLLVVKLQHRNLVRLLGFCLQGSERLLIYEFVPNGSLDHFIF  486



>gb|KHN15824.1| Cysteine-rich receptor-like protein kinase 10 [Glycine soja]
Length=665

 Score =   141 bits (355),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPVK R LDW RRYKII  IARG+ YL+EDS L IIH +LKASNVLLDE +NPK++DF M
Sbjct  422  DPVKQRELDWSRRYKIIVGIARGIQYLHEDSQLRIIHRDLKASNVLLDENMNPKISDFGM  481

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            A++F  D+T  +T RIVGT GYM PEY +  + S+K +V+ FGVLV
Sbjct  482  AKIFRADQTQINTGRIVGTYGYMSPEYAMRGQFSVKSDVFSFGVLV  527


 Score =   135 bits (339),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++D   ++ AT  FSD NKIG+GGFGV+YKG F +G+ +AVKRLS     G  EF+N
Sbjct  319  ESLQFDLAMVEAATEGFSDENKIGQGGFGVVYKGVFPNGQEIAVKRLSVTSLQGAVEFRN  378

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +AAL+AK QHRNLVRLLGF LEG+E +L+YE++PN SLD FLF
Sbjct  379  EAALVAKLQHRNLVRLLGFCLEGQEKILIYEYIPNKSLDRFLF  421



>ref|XP_009785801.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Nicotiana sylvestris]
Length=677

 Score =   139 bits (351),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPVK   LDW RR KI+  IARG++YL+EDS L IIH +LKASNVLLD  +NPK++DF M
Sbjct  430  DPVKRTQLDWERRSKIVGGIARGILYLHEDSRLRIIHRDLKASNVLLDAEMNPKISDFGM  489

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T  +T RI GT GYM PEY +H + S+K +V+ FGVLV
Sbjct  490  ARLFTLDETQGNTSRIAGTYGYMAPEYAMHGQFSVKSDVFSFGVLV  535


 Score =   136 bits (343),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 89/129 (69%), Gaps = 4/129 (3%)
 Frame = +1

Query  49   RYRFLVSSLEGIS----FAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
            R R LV  ++ I        E+++YDF TI+ AT+NFS+ NK+G+GGFG +YKG   +G 
Sbjct  307  RKRKLVDEIQSIHGDDISTAESLQYDFSTIRAATDNFSNANKLGQGGFGPVYKGKLPNGE  366

Query  217  LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
             VAVKRLS +   G  EFKN+  L+++ QHRNLVRLLGF L+G E LLVYEFVPN SLD 
Sbjct  367  EVAVKRLSADSGQGDLEFKNEVVLVSRLQHRNLVRLLGFCLDGTERLLVYEFVPNASLDQ  426

Query  397  FLFGNGSRT  423
            FLF    RT
Sbjct  427  FLFDPVKRT  435



>ref|NP_567678.1| cysteine-rich receptor-like protein kinase 6 [Arabidopsis thaliana]
 sp|Q9C5S9.1|CRK6_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase 6; Short=Cysteine-rich 
RLK6; AltName: Full=Receptor-like protein 
kinase 5; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK28316.1|AF224706_1 receptor-like protein kinase 5 [Arabidopsis thaliana]
 gb|AEE84714.1| cysteine-rich receptor-like protein kinase 6 [Arabidopsis thaliana]
Length=674

 Score =   141 bits (356),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = +2

Query  473  CSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLA  652
            C   DP K   LDW +RY II  IARG++YL++DS L IIH +LKASN+LLD  +NPK+A
Sbjct  434  CLLFDPTKQIQLDWMQRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADINPKIA  493

Query  653  DFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            DF MAR+F LD+T D+T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  494  DFGMARIFGLDQTQDNTSRIVGTYGYMAPEYAMHGQFSMKSDVYSFGVLV  543


 Score =   134 bits (337),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++ D+ TIQ ATN+F+++NKIG GGFG +YKGTF +G+ VAVKRLS+N + G  EFK 
Sbjct  335  DSLQLDYRTIQTATNDFAESNKIGRGGFGEVYKGTFSNGKEVAVKRLSKNSRQGEAEFKT  394

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  ++AK QHRNLVRLLGFSL+G+E +LVYE++PN SLD  LF
Sbjct  395  EVVVVAKLQHRNLVRLLGFSLQGEERILVYEYMPNKSLDCLLF  437



>emb|CAA18461.1| serine/threonine kinase-like protein [Arabidopsis thaliana]
 emb|CAA19830.1| serine/threonine kinase-like protein [Arabidopsis thaliana]
 emb|CAB79269.1| serine/threonine kinase-like protein [Arabidopsis thaliana]
Length=658

 Score =   141 bits (356),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = +2

Query  473  CSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLA  652
            C   DP K   LDW +RY II  IARG++YL++DS L IIH +LKASN+LLD  +NPK+A
Sbjct  418  CLLFDPTKQIQLDWMQRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADINPKIA  477

Query  653  DFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            DF MAR+F LD+T D+T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  478  DFGMARIFGLDQTQDNTSRIVGTYGYMAPEYAMHGQFSMKSDVYSFGVLV  527


 Score =   134 bits (338),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++ D+ TIQ ATN+F+++NKIG GGFG +YKGTF +G+ VAVKRLS+N + G  EFK 
Sbjct  319  DSLQLDYRTIQTATNDFAESNKIGRGGFGEVYKGTFSNGKEVAVKRLSKNSRQGEAEFKT  378

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  ++AK QHRNLVRLLGFSL+G+E +LVYE++PN SLD  LF
Sbjct  379  EVVVVAKLQHRNLVRLLGFSLQGEERILVYEYMPNKSLDCLLF  421



>ref|XP_010052402.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Eucalyptus 
grandis]
Length=664

 Score =   139 bits (350),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 94/124 (76%), Gaps = 1/124 (1%)
 Frame = +1

Query  52   YRFLVSSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVK  231
            + F+   ++GIS AE ++++D   I+ ATN+FSD+NK+G+GGFGV+Y GT  +G+ VAVK
Sbjct  307  FYFVPVPIDGISNAE-SLQFDLNIIREATNDFSDSNKLGQGGFGVVYTGTLANGQAVAVK  365

Query  232  RLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGN  411
            R   +L  G QEFKN+  L+A+ QHRNLVRLLGF LEG+E LL+YEFVPN SLD+F++  
Sbjct  366  RPYVDLGQGNQEFKNEVLLVARLQHRNLVRLLGFCLEGRERLLIYEFVPNSSLDHFIYDP  425

Query  412  GSRT  423
              R+
Sbjct  426  VRRS  429


 Score =   136 bits (343),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPV+   L W RR KII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF  
Sbjct  424  DPVRRSQLGWQRRQKIIGGIARGLLYLHEDSQLRIIHRDLKASNILLDTEMNPKISDFGT  483

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D+T D+T R+VGT GYM PEY +H   S+K NV+ FGVL+
Sbjct  484  ARLFAVDQTQDATSRVVGTYGYMAPEYAMHGLFSVKSNVFSFGVLL  529



>ref|XP_007143168.1| hypothetical protein PHAVU_007G049400g [Phaseolus vulgaris]
 gb|ESW15162.1| hypothetical protein PHAVU_007G049400g [Phaseolus vulgaris]
Length=672

 Score =   143 bits (360),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPVK   LDW  RYKII  IARGL+YL+EDS L IIH +LKASN+LLDE +NPK+ADF M
Sbjct  432  DPVKKAQLDWEMRYKIIRGIARGLLYLHEDSLLRIIHRDLKASNILLDEEMNPKIADFGM  491

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL +LD+TH +T R+VGT GYM PEY++  + S+K +++ FGVL+
Sbjct  492  ARLVLLDETHANTNRVVGTYGYMAPEYIMQGQFSVKSDIFSFGVLL  537


 Score =   132 bits (333),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            +++++DF TI+ AT +FS++NK+G+GGFG +Y+G   +G+++AVKRLS     G  EFKN
Sbjct  329  QSLQFDFDTIRVATEDFSNSNKLGQGGFGAVYRGRLPNGQMIAVKRLSSGSSQGDTEFKN  388

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  LMAK QHRNLVRLLGF LEG+E LL+YEFVPN SLD F+F
Sbjct  389  EVLLMAKLQHRNLVRLLGFCLEGRERLLIYEFVPNKSLDYFIF  431



>gb|AAD21872.1| receptor-like protein kinase homolog RK20-1 [Phaseolus vulgaris]
Length=666

 Score =   143 bits (360),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPVK   LDW  RYKII  IARGL+YL+EDS L IIH +LKASN+LLDE +NPK+ADF M
Sbjct  426  DPVKKAQLDWEMRYKIIRGIARGLLYLHEDSLLRIIHRDLKASNILLDEEMNPKIADFGM  485

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL +LD+TH +T R+VGT GYM PEY++  + S+K +++ FGVL+
Sbjct  486  ARLVLLDETHANTNRVVGTYGYMAPEYIMQGQFSVKSDIFSFGVLL  531


 Score =   132 bits (333),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            +++++DF TI+ AT +FS++NK+G+GGFG +Y+G   +G+++AVKRLS     G  EFKN
Sbjct  323  QSLQFDFDTIRVATEDFSNSNKLGQGGFGAVYRGRLPNGQMIAVKRLSSGSSQGDTEFKN  382

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  LMAK QHRNLVRLLGF LEG+E LL+YEFVPN SLD F+F
Sbjct  383  EVLLMAKLQHRNLVRLLGFCLEGRERLLIYEFVPNKSLDYFIF  425



>gb|KHN02670.1| Cysteine-rich receptor-like protein kinase 25 [Glycine soja]
Length=800

 Score =   138 bits (348),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K + LDW RRYKII  IARG+ YL+EDS L IIH +LKASNVLLDE +NPK++DF M
Sbjct  557  DPAKQKELDWSRRYKIIVGIARGIQYLHEDSQLRIIHRDLKASNVLLDENMNPKISDFGM  616

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            A++F  D+T  +T RIVGT GYM PEY +  + S+K +V+ FGVLV
Sbjct  617  AKIFQADQTQVNTGRIVGTYGYMSPEYAMRGQFSVKSDVFSFGVLV  662


 Score =   137 bits (345),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++D  T++ ATN FSD NKIG+GGFGV+YKG   +G+ +AVKRLS     G  EF+N
Sbjct  454  ESLQFDLPTVEAATNRFSDENKIGQGGFGVVYKGVLPNGQEIAVKRLSVTSLQGAVEFRN  513

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +AAL+AK QHRNLVRLLGF LEG+E +L+YE++PN SLD FLF
Sbjct  514  EAALVAKLQHRNLVRLLGFCLEGQEKILIYEYIPNKSLDYFLF  556



>gb|KDP20815.1| hypothetical protein JCGZ_21286 [Jatropha curcas]
Length=661

 Score =   138 bits (348),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++ DF T++ ATNNFSD NK+G+GGFG +YKGT  +G+ +AVKRLS++   G  EFKN
Sbjct  313  ESLQLDFETVKAATNNFSDENKLGQGGFGAVYKGTLYNGQTIAVKRLSKDSGQGDLEFKN  372

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            +  L+AK QHRNLVRLLGF LEG E LL+YEFVPN SLD+FLF    R
Sbjct  373  EVLLVAKLQHRNLVRLLGFCLEGNERLLIYEFVPNTSLDHFLFDRTKR  420


 Score =   137 bits (345),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D  K   LDW  RYKII  IARGL+YL+EDS L IIH ++KASN+LLD  +NPK++DF M
Sbjct  416  DRTKREELDWETRYKIICGIARGLVYLHEDSRLRIIHRDMKASNILLDADMNPKISDFGM  475

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLFV+D+T  +T RIVGT GYM PEY +H + S+K +V+ FGVL+
Sbjct  476  ARLFVMDQTQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLI  521



>emb|CDX94167.1| BnaC07g38010D [Brassica napus]
Length=653

 Score =   143 bits (361),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPVK   LDW RRYKII  IARG++YL++DS L IIH +LKASNVLLD  +NPK+ADF M
Sbjct  417  DPVKQCQLDWSRRYKIISGIARGILYLHQDSRLTIIHRDLKASNVLLDADMNPKIADFGM  476

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +++T ++T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  477  ARIFGMNQTEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLV  522


 Score =   132 bits (332),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++ D+ TIQ ATN+F+++NKIG+GGFG +YKGT  DG  VAVKRLS++   G  EFKN
Sbjct  314  ESLQLDYRTIQTATNDFAESNKIGQGGFGEVYKGTLSDGTEVAVKRLSKSSGQGDAEFKN  373

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK  HRNLVRLLGF LEG+E +LVYE+VPN SLD F+F
Sbjct  374  EVILVAKLLHRNLVRLLGFCLEGEERVLVYEYVPNESLDYFIF  416



>ref|XP_009357385.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=662

 Score =   139 bits (350),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = +2

Query  473  CSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLA  652
            C   DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  ++PK++
Sbjct  420  CFLFDPEKQGQLDWSRRYKIISGIARGIMYLHEDSRLRIIHRDLKASNILLDGEMHPKIS  479

Query  653  DFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            DF MAR+F +D+T  ST RIVGT GYM PEY +H   S+K ++Y FGVLV
Sbjct  480  DFGMARIFGVDQTQASTNRIVGTYGYMSPEYAMHGHFSVKSDLYSFGVLV  529


 Score =   136 bits (343),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TIQ AT+NFS+ +K+GEGGFG +YKGT  +G+ VAVKRLS+N   G +EFKN
Sbjct  321  ESLQFDFATIQAATSNFSNDHKLGEGGFGQVYKGTLSNGQEVAVKRLSRNSSQGTKEFKN  380

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+V N SLD FLF
Sbjct  381  EMVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVLNKSLDCFLF  423



>ref|XP_010655950.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Vitis vinifera]
Length=667

 Score =   138 bits (347),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL+EDS L +IH +LKASNVLLD  +NPK++DF M
Sbjct  428  DPDKQGQLDWSRRYKIIGRIARGILYLHEDSPLKVIHRDLKASNVLLDGDMNPKISDFGM  487

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  ST+R+VGT GYM PEY +H   S K +VY FGVLV
Sbjct  488  ARIFGVDQTRGSTKRVVGTYGYMSPEYAMHGHFSAKSDVYSFGVLV  533


 Score =   137 bits (345),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            +++++DF T++  TNNFSD NKIGEGGFG +YKGT   G+ +A+KRLS++   G  EFKN
Sbjct  325  QSLQFDFGTLEATTNNFSDDNKIGEGGFGDVYKGTLSSGKEIAIKRLSRSSAQGAVEFKN  384

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+VPN SLD+FLF
Sbjct  385  EVVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVPNKSLDHFLF  427



>ref|XP_006449119.1| hypothetical protein CICLE_v10014496mg [Citrus clementina]
 gb|ESR62359.1| hypothetical protein CICLE_v10014496mg [Citrus clementina]
Length=674

 Score =   142 bits (357),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  434  DPEKQGQLDWSRRYKIIGGIARGILYLHEDSRLRIIHRDLKASNILLDAEMNPKISDFGM  493

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T RI GT GYM PEY +H + S+K +VYGFGVLV
Sbjct  494  ARIFGVDQTQGNTSRIAGTFGYMAPEYAMHGQFSVKSDVYGFGVLV  539


 Score =   133 bits (335),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI+ ATN FS  NK+GEGGFG +YKG    G+ +AVKRLS +   G QEFKN
Sbjct  331  ESLQFDFETIEVATNKFSTDNKLGEGGFGEVYKGVLPSGQEIAVKRLSASSGQGAQEFKN  390

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYEFVPN SLD FL+
Sbjct  391  EVVLVAKLQHRNLVRLLGFCLEGEEKILVYEFVPNKSLDYFLY  433



>ref|XP_009134241.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
32 [Brassica rapa]
Length=671

 Score =   142 bits (357),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  482  ADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFD  661
            +DP+K + LDW +RY II  IARG++YL++DS L IIH ++KASN+LLD+ +NPK+ADF 
Sbjct  433  SDPIKRQQLDWTKRYNIIGGIARGILYLHQDSRLTIIHRDIKASNILLDDDMNPKVADFG  492

Query  662  MARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            MAR+F +D+T  +TR+I GT GYM PEYVLH  IS+K +VY FGVLV
Sbjct  493  MARIFGMDQTQANTRKIAGTFGYMSPEYVLHGRISMKSDVYSFGVLV  539


 Score =   133 bits (335),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++ D  TI+ AT+ FS+T KIG+GGFGV+YKGT  DG  VAVKRLS+N   G QEFKN
Sbjct  331  ESLQIDVKTIEAATDQFSETKKIGQGGFGVVYKGTLPDGTKVAVKRLSKNSGQGTQEFKN  390

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFL  402
            +  ++AK QHRNLVRLLGF +EG E +LVYEFVPN SLD  L
Sbjct  391  EVVVVAKLQHRNLVRLLGFCVEGDEQILVYEFVPNKSLDYLL  432



>ref|XP_007011084.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 25, putative 
[Theobroma cacao]
 gb|EOY19894.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 25, putative 
[Theobroma cacao]
Length=655

 Score =   140 bits (352),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP +   LDW +RYKII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  412  DPKRREQLDWEQRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDTDMNPKIADFGM  471

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D+T  +T RIVGT GYM PEY +H + S+K +++ FGVL+
Sbjct  472  ARLFAVDQTQGNTSRIVGTYGYMAPEYAMHGQFSVKSDIFSFGVLI  517


 Score =   135 bits (341),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 91/128 (71%), Gaps = 1/128 (1%)
 Frame = +1

Query  37   MKGGRYRFLVSSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
            M+  R + + S  E I  AE +++YDF TI+ ATNNF+D N++G+GGFG +YKG    G+
Sbjct  290  MRKTREQDVESDDENIITAE-SLQYDFDTIKAATNNFADENRLGQGGFGAVYKGRLSTGQ  348

Query  217  LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
             +AVKRLS++   G  EFKN+  L+AK QHRNLVRLLGFSLE  E LL+YEFVPN SLD 
Sbjct  349  DIAVKRLSKDSGQGDLEFKNEVLLLAKLQHRNLVRLLGFSLERTERLLIYEFVPNSSLDR  408

Query  397  FLFGNGSR  420
            F+F    R
Sbjct  409  FIFDPKRR  416



>ref|XP_006365888.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Solanum tuberosum]
Length=677

 Score =   144 bits (363),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPVK R LDW RR KII  +A+G++YL+EDS L IIH +LKASNVLLD  +NPK++DF M
Sbjct  430  DPVKRRQLDWERRSKIIGGVAKGILYLHEDSRLRIIHRDLKASNVLLDAEMNPKISDFGM  489

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T  ST RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  490  ARLFALDETQGSTTRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLV  535


 Score =   131 bits (329),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++YD  TI+ AT+NFS  NK+GEGGFG +YKG   +G+ VAVKRLS++   G  EFKN
Sbjct  327  ESLQYDLSTIRAATDNFSSANKLGEGGFGPVYKGVLSNGQEVAVKRLSKDSGQGDLEFKN  386

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            +  L+A+ QHRNLVRL GF  +G E LLVYEFVPN SLD FLF    R
Sbjct  387  EVLLVARLQHRNLVRLQGFCFDGTERLLVYEFVPNASLDQFLFDPVKR  434



>ref|XP_011096160.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Sesamum 
indicum]
Length=1317

 Score =   147 bits (370),  Expect(2) = 7e-65, Method: Composition-based stats.
 Identities = 68/106 (64%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K  +LDW RRYKII  IARG++YL+EDS L IIH +LKASNVLLD  +NPK+ADF M
Sbjct  430  DPIKKSYLDWERRYKIIGGIARGILYLHEDSRLRIIHRDLKASNVLLDGDMNPKIADFGM  489

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF  D+T  +T RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  490  ARLFGHDETQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLV  535


 Score =   129 bits (323),  Expect(2) = 7e-65, Method: Composition-based stats.
 Identities = 61/103 (59%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++ F TI++ATNNFSD NK+G+GGFG +YKG   + + +AVKRLS+N   G  EFK 
Sbjct  327  ESLQFAFGTIRDATNNFSDNNKLGQGGFGTVYKGKLPNAQEIAVKRLSRNSGQGDLEFKT  386

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+A+ QHRNLVRLLGF LEG+E +LVYEFV N SLD F+F
Sbjct  387  EVLLLARLQHRNLVRLLGFCLEGEEKVLVYEFVQNASLDLFIF  429


 Score =   142 bits (357),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 67/106 (63%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485   DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
             DP+K   LDW RRYKIIE IARG++YL+EDS + IIH +LKASNVLLD  +NPK+ADF M
Sbjct  1083  DPIKCSRLDWERRYKIIEGIARGILYLHEDSRIRIIHRDLKASNVLLDGDMNPKIADFGM  1142

Query  665   ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
             ARL   D+T  +T RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  1143  ARLSRNDETQGNTDRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLV  1188


 Score =   132 bits (332),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  97    EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
             E+++YDF  I+ ATN+FSD NK+G+GGFGV+Y G    G+ +AVKRLS+N   G  EFKN
Sbjct  980   ESLQYDFGKIRAATNDFSDANKLGKGGFGVVYWGKLLTGQEIAVKRLSKNSGQGNIEFKN  1039

Query  277   KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
             +  L+A+ QHRNLVRLLGFSLEG E LL+YEFV N SLD F+F
Sbjct  1040  EVLLVARLQHRNLVRLLGFSLEGTERLLIYEFVQNASLDQFIF  1082



>ref|XP_008345332.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=664

 Score =   140 bits (352),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++ F TIQ AT+NFSD +K+GEGGFG +YKGT  +G+ VAVKRLS+N   G +EFKN
Sbjct  323  ESLQFHFATIQAATSNFSDDHKLGEGGFGQVYKGTLSNGQEVAVKRLSRNSGQGTEEFKN  382

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+VPN SLD FLF
Sbjct  383  EMVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVPNKSLDCFLF  425


 Score =   135 bits (340),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = +2

Query  473  CSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLA  652
            C   D  K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  ++PK++
Sbjct  422  CFLFDHEKQGQLDWSRRYKIISGIARGIMYLHEDSQLRIIHRDLKASNILLDGDMHPKIS  481

Query  653  DFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            DF MAR+F +D+T  +T RIVGT GYM PEY +H + S+K ++Y FGVLV
Sbjct  482  DFGMARIFGVDQTQANTNRIVGTYGYMSPEYAMHGQFSVKSDLYSFGVLV  531



>ref|XP_008358736.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=664

 Score =   138 bits (348),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = +2

Query  473  CSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLA  652
            C   DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  ++PK++
Sbjct  422  CFLFDPEKQGQLDWSRRYKIISGIARGIMYLHEDSQLRIIHRDLKASNILLDGDMHPKIS  481

Query  653  DFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            DF MAR+F +D+T  +T RIVGT GYM PEY +H   S+K ++Y FGVLV
Sbjct  482  DFGMARIFGVDQTQANTNRIVGTYGYMSPEYAMHGXFSVKSDLYSFGVLV  531


 Score =   137 bits (344),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TIQ AT+NFSD +K+GEGGFG +YKGT  +G+ VAVKRLS N   G +EFKN
Sbjct  323  ESLQFDFATIQAATSNFSDDHKLGEGGFGQVYKGTLSNGQEVAVKRLSXNSGQGTEEFKN  382

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+V N SLD FLF
Sbjct  383  EMVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVLNKSLDCFLF  425



>gb|KHN30448.1| Cysteine-rich receptor-like protein kinase 10 [Glycine soja]
Length=669

 Score =   144 bits (363),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K R LDWGRRYKII  IARG+ YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  435  DPEKQRELDWGRRYKIIGGIARGIQYLHEDSRLRIIHRDLKASNILLDGDMNPKISDFGM  494

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T RIVGT GYM PEY +H E S+K +VY FGVL+
Sbjct  495  ARIFGVDQTQGNTSRIVGTYGYMAPEYAMHGEFSVKSDVYSFGVLL  540


 Score =   131 bits (329),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            +++++DF TI+ ATN FS  NK+GEGGFG +YKGT   G++VAVKRLS++   G +EFKN
Sbjct  332  DSLQFDFSTIEAATNKFSADNKLGEGGFGEVYKGTLSSGQVVAVKRLSKSSGQGGEEFKN  391

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  ++AK QHRNLVRLLGF L+G+E +LVYE+VPN SLD  LF
Sbjct  392  EVVVVAKLQHRNLVRLLGFCLQGEEKILVYEYVPNKSLDYILF  434



>ref|NP_001238492.1| cysteine-rich protein precursor [Glycine max]
 gb|ACM89479.1| cysteine-rich protein [Glycine max]
Length=667

 Score =   144 bits (363),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K R LDWGRRYKII  IARG+ YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  433  DPEKQRELDWGRRYKIIGGIARGIQYLHEDSRLRIIHRDLKASNILLDGDMNPKISDFGM  492

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T RIVGT GYM PEY +H E S+K +VY FGVL+
Sbjct  493  ARIFGVDQTQGNTSRIVGTYGYMAPEYAMHGEFSVKSDVYSFGVLL  538


 Score =   131 bits (329),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            +++++DF TI+ ATN FS  NK+GEGGFG +YKGT   G++VAVKRLS++   G +EFKN
Sbjct  330  DSLQFDFSTIEAATNKFSADNKLGEGGFGEVYKGTLSSGQVVAVKRLSKSSGQGGEEFKN  389

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  ++AK QHRNLVRLLGF L+G+E +LVYE+VPN SLD  LF
Sbjct  390  EVVVVAKLQHRNLVRLLGFCLQGEEKILVYEYVPNKSLDYILF  432



>ref|XP_010267802.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Nelumbo nucifera]
Length=673

 Score =   146 bits (368),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDW RRYKII  IARGL+YL+EDS L IIH +LKASN+LLDE +NPK+ADF M
Sbjct  436  DPIKRVQLDWERRYKIIGGIARGLLYLHEDSRLKIIHRDLKASNILLDEDMNPKIADFGM  495

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLFV+D+TH  T RIVGT GYM PEY+ H   S+K +V+ FGV++
Sbjct  496  ARLFVVDQTHACTSRIVGTYGYMAPEYIKHGHFSVKSDVFSFGVIL  541


 Score =   129 bits (324),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++ +F  I+ ATNNFS+ NK+G+GGFG +YKG   DGR VAVKRLS+N   G  EFKN
Sbjct  333  ESLQVNFSAIKAATNNFSNDNKLGQGGFGDVYKGRLLDGREVAVKRLSRNSGQGEVEFKN  392

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF  EG+E LL+YEFV N SLD+F+F
Sbjct  393  EVLLVAKLQHRNLVRLLGFCCEGQEKLLIYEFVQNASLDHFIF  435



>ref|XP_004145170.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=1594

 Score =   140 bits (352),  Expect(2) = 8e-65, Method: Composition-based stats.
 Identities = 62/106 (58%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP + R LDW +RYKII  IARG++YL+EDS L IIH +LKASN+LLD+ +NPK++DF +
Sbjct  420  DPKRQRELDWLKRYKIIHGIARGMLYLHEDSRLRIIHRDLKASNILLDKNMNPKISDFGL  479

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+  +D+T  +T RIVGT GYM PEY +H   S+K +VY FGV+V
Sbjct  480  ARIVQVDQTQGNTNRIVGTYGYMAPEYAMHGNFSLKSDVYSFGVIV  525


 Score =   135 bits (340),  Expect(2) = 8e-65, Method: Composition-based stats.
 Identities = 60/103 (58%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI +ATNNFS+ N++GEGGFG +YKG  E+G+ +AVKRLS+    G +EFKN
Sbjct  317  ESLQFDFKTINDATNNFSEENRLGEGGFGAVYKGRLENGQEIAVKRLSRGSSQGFEEFKN  376

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLV+LLGF L+G E +L+YE++PN SL+ FLF
Sbjct  377  EVMLVAKLQHRNLVKLLGFCLDGGEKILIYEYIPNKSLNFFLF  419


 Score =   134 bits (337),  Expect(2) = 2e-61, Method: Composition-based stats.
 Identities = 61/103 (59%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97    EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
             +++++DF  I+ ATN FS+ NK+GEGGFG ++KG  EDG+ +AVKRLS+    G +EFKN
Sbjct  1294  DSLQFDFKKIEAATNKFSEENKLGEGGFGSVFKGMLEDGQEIAVKRLSRGSLQGSEEFKN  1353

Query  277   KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
             +  L+AK QHRNLVRLLGF LEG+E +L+YEF+PN SLD  LF
Sbjct  1354  EVMLVAKLQHRNLVRLLGFCLEGEEKILIYEFIPNKSLDFLLF  1396


 Score =   130 bits (326),  Expect(2) = 2e-61, Method: Composition-based stats.
 Identities = 59/106 (56%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485   DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
             D    + L+W +RY+II  IARG++YL+EDS L IIH +LKASN+LLDE +N K++DF M
Sbjct  1397  DEEGQKQLNWLKRYRIINGIARGILYLHEDSRLRIIHRDLKASNILLDEDMNAKISDFGM  1456

Query  665   ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
             AR+  +D++  +T RIVGT GYM PEY +H   S+K +VY FGVLV
Sbjct  1457  ARIVQMDQSQGNTSRIVGTYGYMSPEYAMHGNFSMKSDVYSFGVLV  1502



>ref|XP_010439215.1| PREDICTED: cysteine-rich receptor-like protein kinase 6 [Camelina 
sativa]
Length=448

 Score =   144 bits (363),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW +RYKII  IARG++YL+EDS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  214  DPTKQVQLDWTQRYKIIGGIARGILYLHEDSQLKIIHRDLKASNILLDVDINPKIADFGM  273

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F LD+T D+T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  274  ARIFGLDQTQDNTSRIVGTYGYMSPEYAMHGQFSMKSDVYSFGVLV  319


 Score =   131 bits (329),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
            A ++++ D+ TIQ ATNNF++ NKIG+GGFG +YK TF +G+ VAVKRLS+N + G  EF
Sbjct  109  AADSLQLDYRTIQTATNNFAEGNKIGKGGFGEVYKDTFSNGKEVAVKRLSKNSRQGEAEF  168

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            K +  ++AK QHR+LVRLLGFSL+G E +LVYE++PN SLD  LF
Sbjct  169  KTEVVVVAKLQHRDLVRLLGFSLQGDERILVYEYMPNKSLDYILF  213



>gb|KHG16271.1| Cysteine-rich receptor-like protein kinase 25 [Gossypium arboreum]
Length=662

 Score =   139 bits (350),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = +2

Query  473  CSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLA  652
            C   DP K   LDW  RYKII  +ARG++YL+EDS L IIH +LK SN+LLD  +NPK++
Sbjct  419  CFLFDPEKQAQLDWSTRYKIIVGVARGILYLHEDSRLKIIHRDLKVSNILLDSDMNPKIS  478

Query  653  DFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            DF MAR+F +D+T ++T+R+VGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  479  DFGMARIFGVDQTQETTKRVVGTYGYMSPEYAMHGQFSVKSDVFSFGVLV  528


 Score =   135 bits (341),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++YDF TI+ ATNNFS++NK+GEGGFG +YKGT  +G+ +AVKRLS++   G +EFKN
Sbjct  320  ESLQYDFSTIEVATNNFSNSNKLGEGGFGEVYKGTLPNGQEIAVKRLSRSSGQGIEEFKN  379

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +A L+AK QHRNLVRLLGF LE +E +L+YEFV N SLD FLF
Sbjct  380  EALLVAKLQHRNLVRLLGFCLEREEKILIYEFVLNKSLDCFLF  422



>ref|XP_010267803.1| PREDICTED: cysteine-rich receptor-like protein kinase 15 isoform 
X2 [Nelumbo nucifera]
Length=671

 Score =   146 bits (368),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDW RRYKII  IARGL+YL+EDS L IIH +LKASN+LLDE +NPK+ADF M
Sbjct  434  DPIKRVQLDWERRYKIIGGIARGLLYLHEDSRLKIIHRDLKASNILLDEDMNPKIADFGM  493

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLFV+D+TH  T RIVGT GYM PEY+ H   S+K +V+ FGV++
Sbjct  494  ARLFVVDQTHACTSRIVGTYGYMAPEYIKHGHFSVKSDVFSFGVIL  539


 Score =   129 bits (324),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++ +F  I+ ATNNFS+ NK+G+GGFG +YKG   DGR VAVKRLS+N   G  EFKN
Sbjct  331  ESLQVNFSAIKAATNNFSNDNKLGQGGFGDVYKGRLLDGREVAVKRLSRNSGQGEVEFKN  390

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF  EG+E LL+YEFV N SLD+F+F
Sbjct  391  EVLLVAKLQHRNLVRLLGFCCEGQEKLLIYEFVQNASLDHFIF  433



>ref|XP_007025935.1| Cysteine-rich RLK 29, putative isoform 1 [Theobroma cacao]
 gb|EOY28557.1| Cysteine-rich RLK 29, putative isoform 1 [Theobroma cacao]
Length=666

 Score =   139 bits (350),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI+ AT+NFSD NK+G+GGFG +YKG   DG+ VAVKRLS +   G  EFKN
Sbjct  319  ESLQFDFATIRVATDNFSDANKLGQGGFGAVYKGLLPDGQEVAVKRLSTDSGQGEVEFKN  378

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            +  L+AK QHRNLVRLLGF LEG+E LL+YEFVPN SLD+F+F    R
Sbjct  379  EVLLVAKLQHRNLVRLLGFCLEGRERLLIYEFVPNASLDHFIFDQVKR  426


 Score =   136 bits (342),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D VK   LDW RRYKII  IARGL+YL+EDS L IIH +LKASN+LLD  + PK+ADF M
Sbjct  422  DQVKRIQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDAEMIPKIADFGM  481

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLFV D+T  +T RIVGT GYM PEY +H + S+K +V+ FGV++
Sbjct  482  ARLFVRDETQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVII  527



>ref|XP_010456864.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
35 [Camelina sativa]
Length=462

 Score =   138 bits (348),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
            + +++++DF TI+ AT+ FS+ NK+G+GGFG +YKGT  +G  VAVKRLS+N   G QEF
Sbjct  166  SPQSLQFDFKTIEAATDKFSENNKVGQGGFGEVYKGTLSNGTEVAVKRLSKNSGQGSQEF  225

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSRT  423
            KN+  L+AK QHRNLVRLLGF LEG E +LVYEFVPN SLD FLF    R 
Sbjct  226  KNEVVLVAKLQHRNLVRLLGFCLEGDEQILVYEFVPNKSLDYFLFDTLKRP  276


 Score =   136 bits (342),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D +K   LDW RRY II  IARG++YL++DS L IIH +LKASN+LLD+ +NPK+ADF M
Sbjct  271  DTLKRPQLDWSRRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDDDMNPKIADFGM  330

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +++T  +T +I GTSGYM PEYV+H + S+K +VY FGVLV
Sbjct  331  ARIFGMEQTRANTSKIAGTSGYMAPEYVMHGQFSMKSDVYSFGVLV  376



>ref|XP_002518562.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43949.1| ATP binding protein, putative [Ricinus communis]
Length=526

 Score =   139 bits (351),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDW +RY II  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  410  DPIKRANLDWDKRYNIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDADMNPKISDFGM  469

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL V+D+T  +T RIVGT GYM PEYV+H + S+K +V+ FGVL+
Sbjct  470  ARLVVMDQTQGNTNRIVGTYGYMAPEYVMHGQFSVKSDVFSFGVLL  515


 Score =   135 bits (340),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +1

Query  64   VSSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQ  243
            + S++ I    E++++DF T++ ATNNFS+ NK+G+GGFGV+YKGT  + + +AVKRLS+
Sbjct  296  IESVDEIQSELESLQFDFGTVRAATNNFSEENKLGQGGFGVVYKGTLYNRQDIAVKRLSK  355

Query  244  NLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +   G  EFKN+  L+AK QHRNLVRLLGF LEG E LL+YEFVPN SLD+F+F
Sbjct  356  DSGQGDLEFKNEVLLVAKLQHRNLVRLLGFCLEGNERLLIYEFVPNASLDHFIF  409



>ref|XP_010059160.1| PREDICTED: cysteine-rich receptor-like protein kinase 26 [Eucalyptus 
grandis]
Length=1004

 Score =   140 bits (354),  Expect(2) = 1e-64, Method: Composition-based stats.
 Identities = 66/106 (62%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   L+W RR KII  +ARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  760  DPLKRANLNWDRRQKIIMGVARGLLYLHEDSRLRIIHRDLKASNILLDSDMNPKISDFGM  819

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T   T RIVGT GYM PEY +H   SIK +V+ FGVLV
Sbjct  820  ARLFELDQTQAETNRIVGTYGYMAPEYAMHGNFSIKSDVFSFGVLV  865


 Score =   134 bits (337),  Expect(2) = 1e-64, Method: Composition-based stats.
 Identities = 61/103 (59%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI+ AT+NFS++ K+G+GGFG +Y G   +G+ +AVKRLS N   G  EFKN
Sbjct  657  ESLQFDFGTIREATDNFSNSKKLGQGGFGAVYMGRLYNGQEIAVKRLSHNSSQGEVEFKN  716

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+A+ QHRNLVRLLGF LEG E LL+YEFVPN SLD F+F
Sbjct  717  EVMLLARLQHRNLVRLLGFCLEGVERLLIYEFVPNSSLDQFIF  759


 Score =   139 bits (349),  Expect(2) = 3e-44, Method: Composition-based stats.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   L+W RR+KII  +ARG+ YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  42   DPLKRANLNWDRRHKIIMGVARGMCYLHEDSRLRIIHRDLKASNILLDSDMNPKISDFGM  101

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T   T R+VGT GYM PEY +H   S+K +V+ FGVLV
Sbjct  102  ARLFELDQTQAETNRVVGTYGYMAPEYAMHGNFSVKSDVFSFGVLV  147


 Score = 67.4 bits (163),  Expect(2) = 3e-44, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  286  LMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            L+A+ QHRNLVRLLG+ LEG E LL+YEFVPN SLD F+F
Sbjct  2    LLARLQHRNLVRLLGYCLEGVERLLIYEFVPNSSLDQFIF  41



>emb|CBI35335.3| unnamed protein product [Vitis vinifera]
Length=792

 Score =   138 bits (347),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL+EDS L +IH +LKASNVLLD  +NPK++DF M
Sbjct  428  DPDKQGQLDWSRRYKIIGRIARGILYLHEDSPLKVIHRDLKASNVLLDGDMNPKISDFGM  487

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  ST+R+VGT GYM PEY +H   S K +VY FGVLV
Sbjct  488  ARIFGVDQTRGSTKRVVGTYGYMSPEYAMHGHFSAKSDVYSFGVLV  533


 Score =   137 bits (344),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            +++++DF T++  TNNFSD NKIGEGGFG +YKGT   G+ +A+KRLS++   G  EFKN
Sbjct  325  QSLQFDFGTLEATTNNFSDDNKIGEGGFGDVYKGTLSSGKEIAIKRLSRSSAQGAVEFKN  384

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+VPN SLD+FLF
Sbjct  385  EVVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVPNKSLDHFLF  427



>ref|XP_003637959.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=655

 Score =   142 bits (357),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            +P +   L+W +RY II+CI RGLIYL+EDS L IIH +LKASN+LLD+G+NPK++DF +
Sbjct  417  NPARRAQLNWEKRYDIIKCIVRGLIYLHEDSRLRIIHRDLKASNILLDDGMNPKISDFGL  476

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLFV+D+T  +T +IVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  477  ARLFVIDQTQGNTSKIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLV  522


 Score =   132 bits (333),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F TI+ AT++FSD+NK+G+GGFGV+Y+G   +G+++AVKRLS++   G  EFKN
Sbjct  314  ESLQFNFDTIRVATSDFSDSNKLGQGGFGVVYRGKLPNGQMIAVKRLSKDSDQGDVEFKN  373

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            +  L+AK QHRNLVRLLGFSLEG+E LL+YE+V N SLD F+F    R
Sbjct  374  EVLLVAKLQHRNLVRLLGFSLEGREKLLIYEYVTNKSLDYFIFNPARR  421



>ref|XP_003638007.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=686

 Score =   142 bits (358),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            +P +   L+W +RY II+CI RGLIYL+EDS L IIH +LKASN+LLD+G+NPK++DF +
Sbjct  448  NPARRAQLNWEKRYDIIKCIVRGLIYLHEDSRLRIIHRDLKASNILLDDGMNPKISDFGL  507

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLFV+D+T  +T +IVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  508  ARLFVIDQTQGNTSKIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLV  553


 Score =   132 bits (333),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F TI+ AT++FSD+NK+G+GGFGV+Y+G   +G+++AVKRLS++   G  EFKN
Sbjct  345  ESLQFNFDTIRVATSDFSDSNKLGQGGFGVVYRGKLPNGQMIAVKRLSKDSDQGDVEFKN  404

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            +  L+AK QHRNLVRLLGFSLEG+E LL+YE+V N SLD F+F    R
Sbjct  405  EVLLVAKLQHRNLVRLLGFSLEGREKLLIYEYVTNKSLDYFIFNPARR  452



>ref|XP_007025964.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
 gb|EOY28586.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
Length=700

 Score =   140 bits (352),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPV+  +LDW RR+KII  IA+GL+YL+EDS L IIH NLKASN+LLD  LNPK++DF M
Sbjct  493  DPVRRAYLDWERRHKIIGGIAQGLLYLHEDSRLQIIHCNLKASNILLDAELNPKISDFGM  552

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
             RL  LD+T   T RI GT+GYM PEY LH + SIK +V+ FGVL+
Sbjct  553  GRLCALDQTQSVTSRIEGTNGYMAPEYALHGQFSIKSDVFSFGVLL  598


 Score =   134 bits (338),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +1

Query  103  VEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKNKA  282
            ++YDF TI+ AT++FSDTNK+G+GGFG +YKGT   G L+AVKRL+ +   G  EFKN+ 
Sbjct  392  LQYDFSTIRAATDDFSDTNKLGQGGFGTVYKGTIASGELIAVKRLTTDSGQGDLEFKNEV  451

Query  283  ALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
             L+AK QH+NLVRL GF LEG E LL+YEFVPN SLD FLF
Sbjct  452  QLVAKLQHKNLVRLQGFCLEGNERLLIYEFVPNASLDQFLF  492



>ref|XP_003635466.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Vitis 
vinifera]
Length=675

 Score =   139 bits (351),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D ++   LDW RRYKII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  431  DLIRRAQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDAEMNPKISDFGM  490

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF++D+T  ST RIVGT GYM PEY +H   S+K +VY FGVLV
Sbjct  491  ARLFLVDQTQGSTSRIVGTYGYMAPEYAMHGHFSVKTDVYSFGVLV  536


 Score =   135 bits (339),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++ +DF TI+ ATNNFSD+NK+G+GGFG +YKG   +G+ VAVKRLS     G  EFKN
Sbjct  328  ESLHFDFDTIRVATNNFSDSNKLGQGGFGPVYKGKLSNGQNVAVKRLSSGSAQGELEFKN  387

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF L+G E LL+YEFVPN SLD+F+F
Sbjct  388  EVVLVAKLQHRNLVRLLGFCLDGAERLLIYEFVPNTSLDHFIF  430



>gb|KDO37422.1| hypothetical protein CISIN_1g005846mg [Citrus sinensis]
Length=674

 Score =   142 bits (357),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  434  DPEKQGQLDWSRRYKIIGGIARGILYLHEDSRLRIIHRDLKASNILLDAEMNPKISDFGM  493

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  494  ARIFGVDQTQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVYSFGVLV  539


 Score =   132 bits (333),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI+ ATN FS  NK+GEGGFG +YKG    G+ +AVKRLS+    G +EFKN
Sbjct  331  ESLQFDFETIEVATNKFSTDNKLGEGGFGEVYKGVLPSGQEIAVKRLSKASGQGAEEFKN  390

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYEFVPN SLD FL+
Sbjct  391  EVVLVAKLQHRNLVRLLGFCLEGEEKILVYEFVPNKSLDYFLY  433



>gb|KEH43966.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=686

 Score =   142 bits (357),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            +P +   L+W +RY II+CI RGLIYL+EDS L IIH +LKASN+LLD+G+NPK++DF +
Sbjct  448  NPARRAQLNWEKRYDIIKCIVRGLIYLHEDSRLRIIHRDLKASNILLDDGMNPKISDFGL  507

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLFV+D+T  +T +IVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  508  ARLFVIDQTQGNTSKIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLV  553


 Score =   132 bits (333),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F TI+ AT++FSD+NK+G+GGFGV+Y+G   +G+++AVKRLS++   G  EFKN
Sbjct  345  ESLQFNFDTIRVATSDFSDSNKLGQGGFGVVYRGKLPNGQMIAVKRLSKDSDQGDVEFKN  404

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            +  L+AK QHRNLVRLLGFSLEG+E LL+YE+V N SLD F+F    R
Sbjct  405  EVLLVAKLQHRNLVRLLGFSLEGREKLLIYEYVTNKSLDYFIFNPARR  452



>ref|XP_010057675.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Eucalyptus 
grandis]
Length=669

 Score =   140 bits (352),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   L+W RR KII  +ARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  425  DPLKRANLNWDRRQKIIMGVARGLLYLHEDSRLRIIHRDLKASNILLDSDMNPKISDFGM  484

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T   T RIVGT GYM PEYV+H   SIK +V+ FGVLV
Sbjct  485  ARLFELDQTQAETNRIVGTYGYMAPEYVMHGNFSIKSDVFSFGVLV  530


 Score =   134 bits (338),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI+ AT+NFS++N++G+GGFG +Y G F +G+ +AVKRLS N   G  EFKN
Sbjct  322  ESLQFDFDTIREATDNFSNSNRLGQGGFGAVYMGRFFNGQEIAVKRLSHNSSQGEVEFKN  381

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG E LL+YEFVPN SLD F+F
Sbjct  382  EVMLLAKLQHRNLVRLLGFCLEGVERLLIYEFVPNSSLDQFIF  424



>ref|XP_006413574.1| hypothetical protein EUTSA_v10024843mg [Eutrema salsugineum]
 gb|ESQ55027.1| hypothetical protein EUTSA_v10024843mg [Eutrema salsugineum]
Length=547

 Score =   140 bits (353),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +2

Query  482  ADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFD  661
            +DP K   LDW  RYKII  IARG++YL++DS L IIH +LKASN+LLDE +NPK+ADF 
Sbjct  309  SDPAKQGQLDWTGRYKIIGGIARGILYLHQDSRLTIIHRDLKASNILLDEDMNPKIADFG  368

Query  662  MARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            MAR+F +D+T + T RIVGT GYM PEY +H   S+K +VY FGVLV
Sbjct  369  MARIFGIDQTQEDTSRIVGTYGYMSPEYAMHGHFSMKSDVYSFGVLV  415


 Score =   134 bits (336),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++ D+ TIQ ATN FS+ NKIG+GGFG +YKGTF DG  VAVKRLS++ + G  EFKN
Sbjct  207  ESLQLDYRTIQGATNGFSENNKIGQGGFGEVYKGTFSDGTEVAVKRLSKSSRQGDTEFKN  266

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFL  402
            +  ++AK QH+NLVRLLGFSLE +E +LVYE+VPN SLD FL
Sbjct  267  EVVVVAKLQHKNLVRLLGFSLEREERILVYEYVPNKSLDYFL  308



>gb|AES98412.2| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=553

 Score =   138 bits (347),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW +RYKII+ IARG++YL+EDS L IIH +LKA N+LLDE +N K++DF M
Sbjct  432  DPTKKAQLDWEKRYKIIKGIARGVLYLHEDSRLRIIHRDLKAGNILLDENMNAKISDFGM  491

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL ++D+T ++T  +VGT GYM PEYV+H E S+K +V+ FGVLV
Sbjct  492  ARLILVDQTQENTSSVVGTYGYMAPEYVMHGEFSVKSDVFSFGVLV  537


 Score =   136 bits (343),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F T++ ATN+FSD+NK+GEGGFG +Y+GT  +G+++AVKRLS N   G  EFKN
Sbjct  329  ESLQFNFDTVKVATNDFSDSNKLGEGGFGAVYQGTLSNGQVIAVKRLSMNSGQGDLEFKN  388

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  LMAK QH+NLVRLLGF++EG+E LLVYEFVPN SLD F+F
Sbjct  389  ELILMAKLQHQNLVRLLGFTIEGRERLLVYEFVPNKSLDYFIF  431



>ref|XP_006467962.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Citrus sinensis]
Length=674

 Score =   142 bits (357),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  434  DPEKQGQLDWSRRYKIIGGIARGILYLHEDSRLRIIHRDLKASNILLDAEMNPKISDFGM  493

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  494  ARIFGVDQTQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVYSFGVLV  539


 Score =   132 bits (332),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI+ ATN FS  NK+GEGGFG +YKG    G+ +AVKRLS+    G +EFKN
Sbjct  331  ESLQFDFETIEVATNKFSTDNKLGEGGFGEVYKGVLPSGQEIAVKRLSKASGQGAEEFKN  390

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYEFVPN SLD FL+
Sbjct  391  EVVLVAKLQHRNLVRLLGFCLEGEEKILVYEFVPNKSLDYFLY  433



>ref|XP_003615454.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=585

 Score =   137 bits (346),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW +RYKII+ IARG++YL+EDS L IIH +LKA N+LLDE +N K++DF M
Sbjct  464  DPTKKAQLDWEKRYKIIKGIARGVLYLHEDSRLRIIHRDLKAGNILLDENMNAKISDFGM  523

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL ++D+T ++T  +VGT GYM PEYV+H E S+K +V+ FGVLV
Sbjct  524  ARLILVDQTQENTSSVVGTYGYMAPEYVMHGEFSVKSDVFSFGVLV  569


 Score =   136 bits (343),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F T++ ATN+FSD+NK+GEGGFG +Y+GT  +G+++AVKRLS N   G  EFKN
Sbjct  361  ESLQFNFDTVKVATNDFSDSNKLGEGGFGAVYQGTLSNGQVIAVKRLSMNSGQGDLEFKN  420

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  LMAK QH+NLVRLLGF++EG+E LLVYEFVPN SLD F+F
Sbjct  421  ELILMAKLQHQNLVRLLGFTIEGRERLLVYEFVPNKSLDYFIF  463



>ref|XP_006449120.1| hypothetical protein CICLE_v10014504mg [Citrus clementina]
 gb|ESR62360.1| hypothetical protein CICLE_v10014504mg [Citrus clementina]
Length=671

 Score =   142 bits (357),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  431  DPEKQGQLDWSRRYKIIGGIARGILYLHEDSRLRIIHRDLKASNILLDAEMNPKISDFGM  490

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  491  ARIFGVDQTQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVYSFGVLV  536


 Score =   132 bits (332),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI+ ATN FS  NK+GEGGFG +YKG    G+ +AVKRLS++   G +EFKN
Sbjct  328  ESLQFDFETIEVATNKFSTDNKLGEGGFGEVYKGVLPSGQEIAVKRLSKSSGQGAEEFKN  387

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +L+YEFVPN SLD FL+
Sbjct  388  EVVLVAKLQHRNLVRLLGFCLEGEEKILIYEFVPNKSLDYFLY  430



>ref|XP_010668063.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=673

 Score =   142 bits (359),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++YD  T+++AT+NFSD NK+GEGGFG +YKGT  +GR +AVKRLS N   G QEFKN
Sbjct  332  ESLQYDLATLKSATSNFSDENKLGEGGFGSVYKGTLSNGREIAVKRLSMNSSQGIQEFKN  391

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRL GF LEG+E LLVYE+VPN SLD  LF
Sbjct  392  EVLLVAKLQHRNLVRLFGFCLEGEEKLLVYEYVPNKSLDKILF  434


 Score =   131 bits (330),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPV    LDWG RY+IIE IARG++YL+ DS L IIH +LKASNVLLD  +  K+ADF +
Sbjct  435  DPVNQSLLDWGTRYQIIEGIARGMLYLHHDSQLRIIHRDLKASNVLLDADMKAKIADFGL  494

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T R+VGT GYM PEY ++ + S K +VY FGVLV
Sbjct  495  ARIFGVDQTQGNTSRVVGTYGYMAPEYAMNGQFSNKSDVYSFGVLV  540



>gb|KCW74848.1| hypothetical protein EUGRSUZ_E03585, partial [Eucalyptus grandis]
Length=642

 Score =   140 bits (352),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   L+W RR KII  +ARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  425  DPLKRANLNWDRRQKIIMGVARGLLYLHEDSRLRIIHRDLKASNILLDSDMNPKISDFGM  484

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T   T RIVGT GYM PEYV+H   SIK +V+ FGVLV
Sbjct  485  ARLFELDQTQAETNRIVGTYGYMAPEYVMHGNFSIKSDVFSFGVLV  530


 Score =   134 bits (338),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI+ AT+NFS++N++G+GGFG +Y G F +G+ +AVKRLS N   G  EFKN
Sbjct  322  ESLQFDFDTIREATDNFSNSNRLGQGGFGAVYMGRFFNGQEIAVKRLSHNSSQGEVEFKN  381

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG E LL+YEFVPN SLD F+F
Sbjct  382  EVMLLAKLQHRNLVRLLGFCLEGVERLLIYEFVPNSSLDQFIF  424



>gb|KDO37423.1| hypothetical protein CISIN_1g005846mg [Citrus sinensis]
Length=571

 Score =   142 bits (359),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  434  DPEKQGQLDWSRRYKIIGGIARGILYLHEDSRLRIIHRDLKASNILLDAEMNPKISDFGM  493

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  494  ARIFGVDQTQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVYSFGVLV  539


 Score =   131 bits (330),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI+ ATN FS  NK+GEGGFG +YKG    G+ +AVKRLS+    G +EFKN
Sbjct  331  ESLQFDFETIEVATNKFSTDNKLGEGGFGEVYKGVLPSGQEIAVKRLSKASGQGAEEFKN  390

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYEFVPN SLD FL+
Sbjct  391  EVVLVAKLQHRNLVRLLGFCLEGEEKILVYEFVPNKSLDYFLY  433



>ref|XP_009357384.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=663

 Score =   139 bits (350),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = +2

Query  473  CSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLA  652
            C   DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  ++PK++
Sbjct  421  CFLFDPEKQGQLDWTRRYKIISGIARGILYLHEDSQLRIIHRDLKASNILLDGDMHPKIS  480

Query  653  DFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            DF MAR+F +D+T  +T RIVGT GYM PEY +H + S+K ++Y FGVLV
Sbjct  481  DFGMARIFGVDQTQANTNRIVGTYGYMSPEYAMHGQFSVKSDLYSFGVLV  530


 Score =   135 bits (339),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++ F TIQ AT+NFSD +K+GEGGFG +YKGT  +G+ VAVKRLS+N   G +EFKN
Sbjct  322  ESLQFHFATIQAATSNFSDDHKLGEGGFGQVYKGTLSNGQEVAVKRLSRNSGQGIEEFKN  381

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+V N SLD FLF
Sbjct  382  EMVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVLNKSLDCFLF  424



>ref|XP_010668062.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=681

 Score =   142 bits (359),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++YD  T+++AT+NFSD NK+GEGGFG +YKGT  +GR +AVKRLS N   G QEFKN
Sbjct  340  ESLQYDLATLKSATSNFSDENKLGEGGFGSVYKGTLSNGREIAVKRLSMNSSQGIQEFKN  399

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRL GF LEG+E LLVYE+VPN SLD  LF
Sbjct  400  EVLLVAKLQHRNLVRLFGFCLEGEEKLLVYEYVPNKSLDKILF  442


 Score =   131 bits (330),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPV    LDWG RY+IIE IARG++YL+ DS L IIH +LKASNVLLD  +  K+ADF +
Sbjct  443  DPVNQSLLDWGTRYQIIEGIARGMLYLHHDSQLRIIHRDLKASNVLLDADMKAKIADFGL  502

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T R+VGT GYM PEY ++ + S K +VY FGVLV
Sbjct  503  ARIFGVDQTQGNTSRVVGTYGYMAPEYAMNGQFSNKSDVYSFGVLV  548



>ref|XP_010646899.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis 
vinifera]
Length=668

 Score =   138 bits (347),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            +++++DF T++ ATNNFSD NKIGEGGFG +YKGT   G+ +A+KRLS++   G  EFKN
Sbjct  327  QSLQFDFGTLEAATNNFSDDNKIGEGGFGDVYKGTLSSGKEIAIKRLSRSSAQGAVEFKN  386

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+VPN SLD FLF
Sbjct  387  EVVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVPNKSLDCFLF  429


 Score =   136 bits (342),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +2

Query  473  CSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLA  652
            C   DP K   LDW RRYKII  IARG++YL+EDS L +IH +LKASNVLLD  +NPK++
Sbjct  426  CFLFDPDKQGQLDWSRRYKIIGGIARGILYLHEDSQLKVIHRDLKASNVLLDGDMNPKIS  485

Query  653  DFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            DF MAR+F  D+T  ST+R+VGT GYM PEY +    S K +VY FGVLV
Sbjct  486  DFGMARIFGGDQTRGSTKRVVGTYGYMSPEYAMRGHFSAKSDVYSFGVLV  535



>ref|XP_009360784.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=882

 Score =   145 bits (367),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 68/108 (63%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++D  TI+ ATN FSD NK+GEGGFGV++KGT  + + +AVKRLS++ K G QEFKN
Sbjct  546  ESLQFDLGTIETATNKFSDNNKLGEGGFGVVFKGTLANEQEIAVKRLSKSSKQGVQEFKN  605

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            + AL+AK QHRNLVRLLGF LEG+E +LVYE+VPN SLD FLF +  R
Sbjct  606  EVALVAKLQHRNLVRLLGFCLEGEETILVYEYVPNQSLDYFLFESKKR  653


 Score =   128 bits (322),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 61/104 (59%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +2

Query  494  KHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDMARL  673
            K   LDW RR  IIE I RG++YL+EDS L +IH +LKASN+LLDE +NPK++DF MAR+
Sbjct  652  KRERLDWSRRCMIIEGITRGIVYLHEDSRLRVIHRDLKASNILLDENMNPKISDFGMARM  711

Query  674  F-VLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            F V D+T  +T+RIVGT GYM PEY +    SIK +V+ FGVL+
Sbjct  712  FGVNDQTQGNTKRIVGTYGYMAPEYAMEGLYSIKSDVFSFGVLL  755



>ref|XP_009340920.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=676

 Score =   139 bits (350),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = +2

Query  473  CSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLA  652
            C   DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  ++PK++
Sbjct  434  CFLFDPEKQGQLDWTRRYKIISGIARGIMYLHEDSQLRIIHRDLKASNILLDGDMHPKIS  493

Query  653  DFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            DF MAR+F +D+T  +T RIVGT GYM PEY +H + S+K ++Y FGVLV
Sbjct  494  DFGMARIFGVDQTQANTNRIVGTYGYMSPEYAMHGQFSVKSDLYSFGVLV  543


 Score =   135 bits (339),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++ F TIQ AT+NFSD +K+GEGGFG +YKGT  +G+ VAVKRLS+N   G +EFKN
Sbjct  335  ESLQFHFATIQAATSNFSDDHKLGEGGFGQVYKGTLSNGQEVAVKRLSRNSGQGIEEFKN  394

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+V N SLD FLF
Sbjct  395  EMVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVLNKSLDCFLF  437



>ref|XP_008349286.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=664

 Score =   137 bits (345),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = +2

Query  473  CSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLA  652
            C   DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  ++PK++
Sbjct  422  CFLFDPEKQGQLDWSRRYKIISGIARGIMYLHEDSXLRIIHRDLKASNILLDGEMHPKIS  481

Query  653  DFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            DF MAR+F +D+T  +T RIVGT GYM PEY +H   S+K +++ FGVLV
Sbjct  482  DFGMARIFGVDQTQANTNRIVGTYGYMSPEYAMHGHFSVKSDLFSFGVLV  531


 Score =   137 bits (344),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TIQ AT+NFSD +K+GEGGFG +YKGT  +G+ VAVKRLS N   G +EFKN
Sbjct  323  ESLQFDFATIQAATSNFSDDHKLGEGGFGQVYKGTLSNGQEVAVKRLSXNSGQGTEEFKN  382

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+V N SLD FLF
Sbjct  383  EMVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVLNKSLDCFLF  425



>emb|CDY13268.1| BnaC09g23880D [Brassica napus]
Length=1078

 Score =   140 bits (352),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 61/106 (58%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K R LDW RRY +I  +ARG++YL++DS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  841  DPIKRRQLDWTRRYNVIRGVARGILYLHQDSRLTIIHRDLKASNILLDNDMNPKIADFGM  900

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +++T  +T +I GT GYM PEY +H   S+K +VY FGVLV
Sbjct  901  ARIFGMEQTRANTSKIAGTFGYMAPEYAMHGRFSMKSDVYSFGVLV  946


 Score =   134 bits (337),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 63/102 (62%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +1

Query  100  AVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKNK  279
            +++ DF TI+ ATN FS +NK+G+GGFG +YKG   +G  VAVKRLS+N   G QEF+N+
Sbjct  739  SLQIDFKTIEAATNKFSRSNKVGQGGFGEVYKGKLPNGAEVAVKRLSRNSGQGTQEFRNE  798

Query  280  AALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
              ++AK QHRNLVRLLGF +EG E +LVYEFVPN SLD FLF
Sbjct  799  VVVLAKLQHRNLVRLLGFCVEGDEQILVYEFVPNKSLDYFLF  840


 Score =   139 bits (350),  Expect(2) = 6e-57, Method: Composition-based stats.
 Identities = 67/114 (59%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = +2

Query  461  FLVKCSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLN  640
            FL   S+ DP K   LDW  RY II  I RGL+YL++DS L IIH ++KASN+LLDE +N
Sbjct  233  FLKSSSNVDPTKKSQLDWKSRYNIIGGITRGLLYLHQDSRLTIIHRDIKASNILLDEHIN  292

Query  641  PKLADFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            PK+ADF MAR F +D+T D T R+VGT  YM PEYV H + S K +VY FGVLV
Sbjct  293  PKIADFGMARNFRVDQTEDMTGRVVGTFSYMPPEYVTHGQYSTKSDVYSFGVLV  346


 Score =   109 bits (273),  Expect(2) = 6e-57, Method: Composition-based stats.
 Identities = 54/110 (49%), Positives = 75/110 (68%), Gaps = 0/110 (0%)
 Frame = +1

Query  40   KGGRYRFLVSSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRL  219
            K   Y+ L    +    + +++++DF TI+ AT+ FS  NK+G+GGFG +YKGT  DG  
Sbjct  119  KKQSYKTLKPQTDDDMTSPQSLQFDFGTIEAATDGFSRNNKLGQGGFGEVYKGTLLDGAE  178

Query  220  VAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYE  369
            V VKRL +N   G QEFKN+  ++AK QH+NLVRLLGF +EG E +LVY+
Sbjct  179  VPVKRLLRNSGQGTQEFKNEVVIVAKLQHKNLVRLLGFCVEGDEQILVYD  228



>gb|KHN01544.1| Cysteine-rich receptor-like protein kinase 8 [Glycine soja]
Length=551

 Score =   145 bits (366),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP      DW  RYKII  IARGL+YL+EDS L +IH +LKASN+LLDE +NPK+ADF M
Sbjct  359  DPNMKAQFDWESRYKIIRGIARGLLYLHEDSRLRVIHRDLKASNILLDEEMNPKIADFGM  418

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF++D+TH +TRRIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  419  ARLFLVDQTHANTRRIVGTCGYMAPEYAMHGQFSVKSDVFSFGVLV  464


 Score =   128 bits (322),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F TIQ AT +FSD+NK+G+GGFG +Y+G   +G+++AVK+LS++   G  +FKN
Sbjct  256  ESLQFNFNTIQVATEDFSDSNKLGQGGFGAVYRGRLSNGQMIAVKKLSRDSCQGDTKFKN  315

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG E LLVYE+VPN SLD F+F
Sbjct  316  EVLLVAKLQHRNLVRLLGFCLEGNERLLVYEYVPNKSLDYFIF  358



>ref|XP_006343408.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Solanum tuberosum]
Length=662

 Score =   138 bits (347),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K + LDW RRYKII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  425  DPEKQQLLDWSRRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDAEMNPKISDFGM  484

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D++ + T RIVGT GYM PEY +H + S+K +V+ FGVL+
Sbjct  485  ARIFGIDQSEEITSRIVGTYGYMSPEYAMHGQYSVKSDVFSFGVLL  530


 Score =   135 bits (341),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
            A E+++Y   TI+ AT NFS  NKIGEGGFGV+YKG   DG+ +AVKRLS++   G +EF
Sbjct  320  AAESLQYHLNTIRVATTNFSIDNKIGEGGFGVVYKGKLPDGQEIAVKRLSRSSGQGIEEF  379

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            KN+  L+AK QHRNLVRLLG+ LEG E +LVYEFVPN SLD FLF
Sbjct  380  KNEIVLIAKLQHRNLVRLLGYCLEGDEKILVYEFVPNKSLDYFLF  424



>ref|XP_010439226.1| PREDICTED: cysteine-rich receptor-like protein kinase 15 [Camelina 
sativa]
 ref|XP_010439227.1| PREDICTED: cysteine-rich receptor-like protein kinase 15 [Camelina 
sativa]
Length=670

 Score =   138 bits (347),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  506  LDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDMARLFVLD  685
            LDW RRYKIIE IARG++YL++DS L IIH +LKASN+LLD  +NPK++DF MAR+F +D
Sbjct  441  LDWTRRYKIIEGIARGILYLHQDSRLTIIHRDLKASNILLDADMNPKISDFGMARIFGMD  500

Query  686  KTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            +T ++T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  501  QTQENTSRIVGTYGYMAPEYAMHGQFSMKSDVYSFGVLV  539


 Score =   135 bits (341),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++ D+ TIQ ATNN+S+ NKIG+GGFG +YKGT  +G  +AVKRLS++   G  EFKN
Sbjct  331  ESLQLDYRTIQAATNNYSENNKIGQGGFGEVYKGTLSNGSDIAVKRLSKSSGQGDTEFKN  390

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            + AL+AK QHRNLVRLLGFS+EG+E +LVYE VPN SLD FLF
Sbjct  391  EVALVAKLQHRNLVRLLGFSIEGEERILVYEHVPNKSLDYFLF  433



>ref|XP_010059664.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=1054

 Score =   137 bits (345),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 62/106 (58%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K + LDW RRYKI+  IARG++YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  817  DPEKSKELDWLRRYKIVCGIARGMLYLHEDSRLRIIHRDLKASNILLDNEMNPKISDFGM  876

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+  +D+T  +T +IVGT GYM PEY +H + S+K +VY FGVL+
Sbjct  877  ARIVGVDQTQANTNKIVGTFGYMSPEYAMHGQFSVKSDVYSFGVLL  922


 Score =   136 bits (342),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 66/103 (64%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++YD  TIQ ATNNFS  NK+GEGGFG +++G   +G+ +AVKRLSQ+   G QEFKN
Sbjct  714  ESLQYDLATIQAATNNFSHQNKLGEGGFGEVFQGRLPNGQQIAVKRLSQSSGQGAQEFKN  773

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E LLVYEFV N SLD  LF
Sbjct  774  EVLLVAKLQHRNLVRLLGFCLEGEEKLLVYEFVLNKSLDYCLF  816



>ref|XP_009338731.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Pyrus x bretschneideri]
Length=665

 Score =   137 bits (345),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = +1

Query  100  AVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKNK  279
            A+++DF  IQ AT+NFSD +K+GEGGFG +YKG   +G+ VAVKRLS+N   G +EFKN+
Sbjct  325  ALQFDFAAIQAATSNFSDDHKLGEGGFGKVYKGILSNGQEVAVKRLSRNSDQGTEEFKNE  384

Query  280  AALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
              L+AK QHRNLVRLLGF LEG+E +L+YEFVPN SL+ FLF
Sbjct  385  MVLVAKLQHRNLVRLLGFCLEGQEKILIYEFVPNKSLNCFLF  426


 Score =   136 bits (342),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +2

Query  467  VKCSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPK  646
            + C   DP +   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  ++PK
Sbjct  421  LNCFLFDPERQGQLDWSRRYKIISGIARGIMYLHEDSRLRIIHRDLKASNILLDGEMHPK  480

Query  647  LADFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ++DF MAR+F +D+T  +T RIVGT GYM PEYV H   S+K ++Y FGVLV
Sbjct  481  ISDFGMARIFGVDQTQANTNRIVGTFGYMSPEYVRHGHFSVKSDLYSFGVLV  532



>ref|XP_007143184.1| hypothetical protein PHAVU_007G050600g [Phaseolus vulgaris]
 gb|ESW15178.1| hypothetical protein PHAVU_007G050600g [Phaseolus vulgaris]
Length=661

 Score =   140 bits (352),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++D  TI+ ATN FSD NKIG+GGFGV+YKG   DG+ +AVKRLS     G  EF+N
Sbjct  315  ESLQFDLATIEAATNRFSDENKIGQGGFGVVYKGVLPDGQEIAVKRLSVTSLQGAVEFRN  374

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +AAL+AK QHRNLVRLLGF LEG+E +L+YE++PN SLD FLF
Sbjct  375  EAALVAKLQHRNLVRLLGFCLEGQEKILIYEYIPNKSLDYFLF  417


 Score =   134 bits (336),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D +K R LDW +RYKII  IARG++YL+EDS L I+H +LKASNVLLDE +N K++DF M
Sbjct  418  DSIKQRELDWSKRYKIIVGIARGILYLHEDSQLRIVHRDLKASNVLLDENMNSKISDFGM  477

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            A++F  D+T  +T RIVGT GYM PEY +  + S+K +V+ FGVLV
Sbjct  478  AKIFQADQTQVNTGRIVGTYGYMSPEYAMRGQFSMKSDVFSFGVLV  523



>gb|KEH40073.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=667

 Score =   141 bits (356),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D  K   L+WGRRYKII  IARG++YL+EDS L +IH +LKASN+LLDE +NPK+ADF M
Sbjct  437  DQAKKAQLNWGRRYKIILGIARGILYLHEDSRLRVIHRDLKASNILLDEEMNPKIADFGM  496

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D+T ++T RIVGT GYM PEYV+  + S+K +V+ FG+LV
Sbjct  497  ARLFSIDQTQENTNRIVGTYGYMAPEYVMQGQFSVKSDVFSFGILV  542


 Score =   132 bits (331),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +1

Query  76   EGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKG  255
            + I+   E +++DF T++ ATN+FSD+NK+G+GGFG +YKG F +G+ VAVKRLS N   
Sbjct  327  DKINITTEQLQFDFNTMRIATNDFSDSNKLGKGGFGFVYKGRFSNGQEVAVKRLSMNSGQ  386

Query  256  GCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            G  EFKN+  L+AK QHRNLVRLLGF LEG+E LL+YEFV N SLD F+F    +
Sbjct  387  GDLEFKNEVFLVAKLQHRNLVRLLGFCLEGRERLLIYEFVHNKSLDYFIFDQAKK  441



>ref|XP_009338737.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Pyrus x bretschneideri]
Length=650

 Score =   137 bits (344),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = +1

Query  100  AVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKNK  279
            A+++DF  IQ AT+NFSD +K+GEGGFG +YKG   +G+ VAVKRLS+N   G +EFKN+
Sbjct  325  ALQFDFAAIQAATSNFSDDHKLGEGGFGKVYKGILSNGQEVAVKRLSRNSDQGTEEFKNE  384

Query  280  AALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
              L+AK QHRNLVRLLGF LEG+E +L+YEFVPN SL+ FLF
Sbjct  385  MVLVAKLQHRNLVRLLGFCLEGQEKILIYEFVPNKSLNCFLF  426


 Score =   136 bits (343),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +2

Query  467  VKCSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPK  646
            + C   DP +   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  ++PK
Sbjct  421  LNCFLFDPERQGQLDWSRRYKIISGIARGIMYLHEDSRLRIIHRDLKASNILLDGEMHPK  480

Query  647  LADFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ++DF MAR+F +D+T  +T RIVGT GYM PEYV H   S+K ++Y FGVLV
Sbjct  481  ISDFGMARIFGVDQTQANTNRIVGTFGYMSPEYVRHGHFSVKSDLYSFGVLV  532



>ref|XP_009338745.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X3 [Pyrus x bretschneideri]
Length=649

 Score =   137 bits (345),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = +1

Query  100  AVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKNK  279
            A+++DF  IQ AT+NFSD +K+GEGGFG +YKG   +G+ VAVKRLS+N   G +EFKN+
Sbjct  325  ALQFDFAAIQAATSNFSDDHKLGEGGFGKVYKGILSNGQEVAVKRLSRNSDQGTEEFKNE  384

Query  280  AALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
              L+AK QHRNLVRLLGF LEG+E +L+YEFVPN SL+ FLF
Sbjct  385  MVLVAKLQHRNLVRLLGFCLEGQEKILIYEFVPNKSLNCFLF  426


 Score =   136 bits (343),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +2

Query  467  VKCSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPK  646
            + C   DP +   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  ++PK
Sbjct  421  LNCFLFDPERQGQLDWSRRYKIISGIARGIMYLHEDSRLRIIHRDLKASNILLDGEMHPK  480

Query  647  LADFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ++DF MAR+F +D+T  +T RIVGT GYM PEYV H   S+K ++Y FGVLV
Sbjct  481  ISDFGMARIFGVDQTQANTNRIVGTFGYMSPEYVRHGHFSVKSDLYSFGVLV  532



>ref|XP_009364729.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=653

 Score =   138 bits (348),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = +2

Query  473  CSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLA  652
            C   DP K   LDW RRY+II  IARG++YL+EDS L IIH +LKASN+LLD  ++PK++
Sbjct  413  CFLFDPEKQGQLDWSRRYQIISGIARGIMYLHEDSRLRIIHRDLKASNILLDGDMHPKIS  472

Query  653  DFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            DF MAR+F +D+T  +T RIVGT GYM PEY +H + S+K ++Y FGVLV
Sbjct  473  DFGMARIFEVDQTQANTNRIVGTYGYMSPEYAMHGQFSVKSDMYSFGVLV  522


 Score =   135 bits (339),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TIQ AT+NFSD +++G+GGFG +YKGT  +G+ VAVKRLS+N   G +EFKN
Sbjct  314  ESLQFDFATIQAATSNFSDDHRLGKGGFGQVYKGTLSNGQEVAVKRLSRNSCQGTEEFKN  373

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+V N SLD FLF
Sbjct  374  EMVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVLNKSLDCFLF  416



>ref|XP_009626038.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Nicotiana 
tomentosiformis]
Length=674

 Score =   139 bits (351),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D VK R LDW RR KII  +ARG++YL+EDS L IIH +LKASNVLLD  +NPK++DF M
Sbjct  427  DSVKRRQLDWERRSKIIGGVARGILYLHEDSRLRIIHRDLKASNVLLDAEMNPKISDFGM  486

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T  +T RI GT GYM PEY +H + S+K +V+ FGVLV
Sbjct  487  ARLFTLDETQGNTSRIAGTYGYMAPEYAMHGQFSVKSDVFSFGVLV  532


 Score =   134 bits (336),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 91/128 (71%), Gaps = 4/128 (3%)
 Frame = +1

Query  49   RYRFLVSSLEGIS----FAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
            R R LV+ ++ I        E+++YDF TI+ AT+NFS+ NK+G+GGFG +YKG   +G+
Sbjct  304  RKRKLVNEIQSIRGDDISTAESLQYDFSTIRVATDNFSNANKLGQGGFGPVYKGKLPNGQ  363

Query  217  LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
             VAVKRLS +   G  EFKN+  L+++ QHRNLVRLLGF L+G E LLVYEFVPN SLD 
Sbjct  364  EVAVKRLSADSGQGDLEFKNEVLLVSRLQHRNLVRLLGFCLDGTERLLVYEFVPNASLDQ  423

Query  397  FLFGNGSR  420
            FLF +  R
Sbjct  424  FLFDSVKR  431



>ref|XP_009364708.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=650

 Score =   138 bits (348),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = +2

Query  473  CSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLA  652
            C   DP K   LDW RRY+II  IARG++YL+EDS L IIH +LKASN+LLD  ++PK++
Sbjct  410  CFLFDPEKQGQLDWSRRYQIISGIARGIMYLHEDSRLRIIHRDLKASNILLDGDMHPKIS  469

Query  653  DFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            DF MAR+F +D+T  +T RIVGT GYM PEY +H + S+K ++Y FGVLV
Sbjct  470  DFGMARIFEVDQTQANTNRIVGTYGYMSPEYAMHGQFSVKSDMYSFGVLV  519


 Score =   135 bits (339),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TIQ AT+NFSD +++G+GGFG +YKGT  +G+ VAVKRLS+N   G +EFKN
Sbjct  311  ESLQFDFATIQAATSNFSDDHRLGKGGFGQVYKGTLSNGQEVAVKRLSRNSCQGTEEFKN  370

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+V N SLD FLF
Sbjct  371  EMVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVLNKSLDCFLF  413



>emb|CBI35672.3| unnamed protein product [Vitis vinifera]
Length=699

 Score =   138 bits (347),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            +++++DF T++ ATNNFSD NKIGEGGFG +YKGT   G+ +A+KRLS++   G  EFKN
Sbjct  358  QSLQFDFGTLEAATNNFSDDNKIGEGGFGDVYKGTLSSGKEIAIKRLSRSSAQGAVEFKN  417

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+VPN SLD FLF
Sbjct  418  EVVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVPNKSLDCFLF  460


 Score =   135 bits (340),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +2

Query  473  CSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLA  652
            C   DP K   LDW RRYKII  IARG++YL+EDS L +IH +LKASNVLLD  +NPK++
Sbjct  457  CFLFDPDKQGQLDWSRRYKIIGGIARGILYLHEDSQLKVIHRDLKASNVLLDGDMNPKIS  516

Query  653  DFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            DF MAR+F  D+T  ST+R+VGT GYM PEY +    S K +VY FGVLV
Sbjct  517  DFGMARIFGGDQTRGSTKRVVGTYGYMSPEYAMRGHFSAKSDVYSFGVLV  566



>gb|KDP20816.1| hypothetical protein JCGZ_21287 [Jatropha curcas]
Length=670

 Score =   140 bits (353),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            +++++DF TI+ ATNNFS+ NK+G+GGFG +YKGT  DG+ +AVKRLS++   G  EFKN
Sbjct  319  KSLQFDFGTIRVATNNFSEENKLGQGGFGAVYKGTLSDGQDIAVKRLSKDSGQGDLEFKN  378

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            +  L+AK QHRNLVRLLGF LEGKE LL+YEFVPN SLD+FLF    R
Sbjct  379  EVLLVAKLQHRNLVRLLGFCLEGKERLLIYEFVPNTSLDHFLFNQNRR  426


 Score =   133 bits (334),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  506  LDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDMARLFVLD  685
            LDW RRYKII  IA+GL+YL+EDS L IIH ++KASN+LLD  +NPK++DF MARLF++D
Sbjct  430  LDWHRRYKIIGGIAKGLLYLHEDSRLRIIHRDMKASNILLDAEMNPKISDFGMARLFMVD  489

Query  686  KTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            +T  +T RIVGT GYM PEY +H + S+K +V+ FGVL+
Sbjct  490  QTQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLL  528



>ref|XP_010247618.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010247619.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Nelumbo nucifera]
Length=676

 Score =   144 bits (363),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDWG RYKIIE IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  430  DPIKRAELDWGTRYKIIEGIARGLLYLHEDSRLRIIHRDLKASNILLDRVMNPKISDFGM  489

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLFV D+TH +T RIVGT GYM PEY +  + S+K +V+ FG+L+
Sbjct  490  ARLFVQDQTHANTNRIVGTFGYMAPEYAMRGQFSVKSDVFSFGILL  535


 Score =   129 bits (324),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F  ++ ATNNFS++NK+G+GGFG +YKG   DG+ VAVKRL +N   G  EFKN
Sbjct  327  ESLQFNFEKLRAATNNFSESNKLGQGGFGSVYKGKLLDGQDVAVKRLCRNSGQGELEFKN  386

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF +EG+E LL+YEFVPN SL++FLF
Sbjct  387  EVLLLAKLQHRNLVRLLGFCIEGEEKLLIYEFVPNTSLNHFLF  429



>gb|KDO75602.1| hypothetical protein CISIN_1g006155mg [Citrus sinensis]
Length=658

 Score =   138 bits (348),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP +   LDW RRYKII  IARGL+YL+EDS L IIH +LK SNVLLD  + PK+ADF M
Sbjct  413  DPTRRAQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKTSNVLLDAEMTPKIADFGM  472

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D+T  +T RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  473  ARLFEMDETQGNTSRIVGTYGYMAPEYAMHGQYSVKSDVFSFGVLV  518


 Score =   134 bits (338),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI+ AT+NFSD NK+G+GGFG +YKG   DG  +AVKRLS++   G  EFKN
Sbjct  310  ESLQFDFNTIRVATDNFSDANKLGQGGFGAVYKGRLYDGAEIAVKRLSRDSGQGDLEFKN  369

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            +  L+A  QHRNLVRLLGFSLEG E LL+YEFVPN SLD+F+F    R
Sbjct  370  EVLLVANLQHRNLVRLLGFSLEGNERLLIYEFVPNTSLDHFIFDPTRR  417



>gb|KCW75002.1| hypothetical protein EUGRSUZ_E03765 [Eucalyptus grandis]
Length=728

 Score =   140 bits (353),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = +1

Query  67   SSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQN  246
            SS+  I+ AE +++YDF TI+ AT+NFS  NK+GEGGFG +++G   +G+ +AVKRLSQ 
Sbjct  379  SSVNDITNAE-SLQYDFATIKTATDNFSHQNKLGEGGFGEVFQGRLPNGQQIAVKRLSQG  437

Query  247  LKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
               G  EFKN+  L+AK QHRNLVR+LGF LEG+E LLVYEFVPN SLDNFLF
Sbjct  438  SGQGAAEFKNEVLLVAKLQHRNLVRMLGFCLEGEEKLLVYEFVPNKSLDNFLF  490


 Score =   133 bits (334),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K + L+W RRYKI+  IARG++YL+EDS L IIH +LKASN+LLD  + PK++DF M
Sbjct  491  DPEKSKQLNWSRRYKIVCGIARGMLYLHEDSRLRIIHRDLKASNILLDSEMIPKISDFGM  550

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+ V+D+T  +T +IVGT GYM PEY +H + S K +VY FGVL+
Sbjct  551  ARIVVVDQTQANTNKIVGTFGYMSPEYAMHGQFSAKSDVYSFGVLL  596



>ref|XP_010057978.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Eucalyptus 
grandis]
 gb|KCW75398.1| hypothetical protein EUGRSUZ_E04152 [Eucalyptus grandis]
Length=666

 Score =   137 bits (345),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = +1

Query  67   SSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQN  246
            SS+  I+ AE +++YDF TIQ AT+NFS  NK+GEGGFG +++G   +G+ +AVKRLSQ 
Sbjct  317  SSVNDITNAE-SLQYDFATIQTATDNFSHQNKLGEGGFGEVFQGRLTNGQQIAVKRLSQG  375

Query  247  LKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
               G  EFKN+  L+AK QHRNLVR+LGF LEG+E LLVYEFVPN SLD FLF
Sbjct  376  SGQGVGEFKNEVLLVAKLQHRNLVRMLGFCLEGEEKLLVYEFVPNKSLDYFLF  428


 Score =   135 bits (341),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K + LDW RRYKI+  IARG++YL+EDS L IIH +LKASN+LLD  + PK++DF M
Sbjct  429  DPEKSKQLDWSRRYKIVCGIARGMLYLHEDSRLRIIHRDLKASNILLDSEMIPKISDFGM  488

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+ V+D+T  +T +IVGT GYM PEY +H + S+K +VY FGVL+
Sbjct  489  ARIVVVDQTQANTNKIVGTFGYMSPEYAMHGQFSVKSDVYSFGVLL  534



>ref|XP_004155666.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Cucumis sativus]
Length=1320

 Score =   139 bits (351),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 64/99 (65%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  506   LDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDMARLFVLD  685
             LDW RRYK+I   ARGL+YL+EDS L IIH +LKASN+LLDE +NPK+ADF +ARLF +D
Sbjct  1091  LDWERRYKVINGTARGLLYLHEDSRLRIIHRDLKASNILLDEEMNPKIADFGLARLFEVD  1150

Query  686   KTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
             +T  +T RIVGT GYM PEY+ H + SIK +V+ FGVLV
Sbjct  1151  ETQGNTSRIVGTYGYMAPEYIAHGQFSIKSDVFSFGVLV  1189


 Score =   133 bits (335),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 59/101 (58%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +1

Query  103   VEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKNKA  282
             +++DF  I++ATN+FS+ NK+G+GGFG +Y+G   +G+ +AVKRL+ N + G  EFKN+ 
Sbjct  983   IQFDFDVIKDATNDFSNENKLGQGGFGAVYRGKLPNGQHIAVKRLAHNSQQGDAEFKNEV  1042

Query  283   ALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
              L+ K QHRNLVRLLGF L+G E LL+YEFVPNGSLD+F+F
Sbjct  1043  LLVVKLQHRNLVRLLGFCLQGSERLLIYEFVPNGSLDHFIF  1083


 Score =   135 bits (340),  Expect(2) = 3e-62, Method: Composition-based stats.
 Identities = 65/109 (60%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E V++DF +I+ ATNNF+  NK+G+GGFGV+YKG    GR +AVKRL+ N + G  EFKN
Sbjct  337  EMVQFDFDSIKAATNNFASENKLGQGGFGVVYKGRLGIGRPIAVKRLAINSQQGDLEFKN  396

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSRT  423
            +  L+ K QHRNLVRLLGF L+G E LL+YEF+PNGSLD+F+F    RT
Sbjct  397  EVLLVLKLQHRNLVRLLGFCLQGSERLLIYEFIPNGSLDSFIFDLEKRT  445


 Score =   131 bits (329),  Expect(2) = 3e-62, Method: Composition-based stats.
 Identities = 62/106 (58%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D  K   LDW RRYKII  IARGL+YL+EDS   IIH +LKASN+LLD+ +N K+ DF M
Sbjct  440  DLEKRTQLDWKRRYKIINGIARGLLYLHEDSRFRIIHRDLKASNILLDQEMNAKIGDFGM  499

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D+T  +T R+VGT GYM PEYV     S+K +V+ FG+LV
Sbjct  500  ARLFDVDQTQGNTNRVVGTFGYMAPEYVKQGHFSVKSDVFSFGILV  545



>ref|XP_009626039.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Nicotiana 
tomentosiformis]
Length=679

 Score =   139 bits (350),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D VK R LDW RR +II  +ARG++YL+EDS L IIH +LKASNVLLD  +NPK++DF M
Sbjct  432  DSVKRRQLDWERRSRIIGGVARGILYLHEDSRLRIIHRDLKASNVLLDADMNPKISDFGM  491

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T  +T RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  492  ARLFTLDETQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLV  537


 Score =   134 bits (336),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 89/128 (70%), Gaps = 4/128 (3%)
 Frame = +1

Query  49   RYRFLVSSLEGIS----FAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
            R R LV  ++ I        E+++YD  TI+ AT+NFS+ NK+G+GGFG +YKG   +G 
Sbjct  309  RKRKLVDEIQSIRGDDISTAESLQYDLSTIRAATDNFSNANKLGQGGFGPVYKGKLPNGE  368

Query  217  LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
             VAVKRLS +   G  EFKN+  L+A+ QHRNLVRLLGF L+G E LLVYEFVPN SLD+
Sbjct  369  EVAVKRLSADSGQGDLEFKNEVLLVARLQHRNLVRLLGFCLDGTERLLVYEFVPNASLDH  428

Query  397  FLFGNGSR  420
            FLF +  R
Sbjct  429  FLFDSVKR  436



>ref|XP_006606014.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
isoform X1 [Glycine max]
Length=671

 Score =   140 bits (354),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP     LDW  RYKII  I RGL+YL+EDS + +IH +LKASN+LLDE +NPK+ADF M
Sbjct  438  DPNMKAQLDWESRYKIIRGITRGLLYLHEDSRVRVIHRDLKASNILLDEEMNPKIADFGM  497

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF++D+TH +T RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  498  ARLFLVDQTHANTTRIVGTCGYMAPEYAMHGQFSVKSDVFSFGVLV  543


 Score =   132 bits (332),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F TIQ AT +FSD+NK+G+GGFG +Y+G   +G+++AVKRLS++   G  EFKN
Sbjct  335  ESLQFNFNTIQVATEDFSDSNKLGQGGFGAVYRGRLSNGQMIAVKRLSRDSGQGDTEFKN  394

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG E LLVYE+VPN SLD F+F
Sbjct  395  EVLLVAKLQHRNLVRLLGFCLEGNERLLVYEYVPNKSLDYFIF  437



>ref|XP_006606016.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Glycine max]
Length=667

 Score =   137 bits (345),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDW RRYKII  IARGL+YL+EDS L IIH +LKASN+LLDE ++PK++DF M
Sbjct  423  DPIKKAQLDWQRRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDEEMHPKISDFGM  482

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL  +D+T ++T RIVGT GYM PEY ++ + S K +V+ FGVLV
Sbjct  483  ARLVHMDQTQENTSRIVGTYGYMAPEYAIYGQFSAKSDVFSFGVLV  528


 Score =   135 bits (341),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 85/108 (79%), Gaps = 1/108 (1%)
 Frame = +1

Query  82   ISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGC  261
            ISFAE ++++DF TI+ ATN F+D NKIG+GGFG +Y+G   +G+ +AVKRLS++   G 
Sbjct  316  ISFAE-SLQFDFDTIRVATNEFADCNKIGQGGFGAVYRGQLSNGQEIAVKRLSRDSGQGD  374

Query  262  QEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
             EFKN+  L+AK QHRNLVRLLGF LEG E LLVYEFVPN SLD F+F
Sbjct  375  MEFKNEVLLVAKLQHRNLVRLLGFCLEGTERLLVYEFVPNKSLDYFIF  422



>ref|XP_006283252.1| hypothetical protein CARUB_v10004288mg [Capsella rubella]
 gb|EOA16150.1| hypothetical protein CARUB_v10004288mg [Capsella rubella]
Length=679

 Score =   142 bits (359),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL++DS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  443  DPTKQGQLDWARRYKIIGGIARGILYLHQDSRLTIIHRDLKASNILLDGDMNPKIADFGM  502

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T ++T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  503  ARIFGMDQTQENTSRIVGTYGYMSPEYAMHGKFSMKSDVYSFGVLV  548


 Score =   130 bits (327),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++ D+ TI+ ATN++SD NKIGEGGFG +YKG   +G  VAVKRLS+  + G  EFKN
Sbjct  340  DSLQLDYRTIRAATNDYSDRNKIGEGGFGEVYKGILTNGTEVAVKRLSKTSRQGETEFKN  399

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  ++AK QHRNLVRLLGFSLE +E +LVYE+VPN SLD FLF
Sbjct  400  EVVVVAKLQHRNLVRLLGFSLEREERILVYEYVPNKSLDYFLF  442



>gb|KHN15823.1| Cysteine-rich receptor-like protein kinase 10 [Glycine soja]
Length=659

 Score =   141 bits (355),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPVK R LDW RRY II  IARG++YL+EDS L IIH +LKASNVLLDE +NPK++DF M
Sbjct  421  DPVKQRELDWSRRYNIIVGIARGILYLHEDSQLRIIHRDLKASNVLLDENMNPKISDFGM  480

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            A++F  D+T  +T RIVGT GYM PEY +  + S+K +V+ FGVLV
Sbjct  481  AKIFQADQTQVNTGRIVGTFGYMSPEYAMRGQFSVKSDVFSFGVLV  526


 Score =   131 bits (330),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++D  TI+ ATN FSD NKIG+GGFGV+YKG   + + +AVKRLS     G  EF+N
Sbjct  318  ESLQFDLATIEAATNGFSDENKIGQGGFGVVYKGILPNRQEIAVKRLSVTSLQGAVEFRN  377

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +AAL+AK QHRNLVRLLGF LEG+E +L+YE++ N SLD+FLF
Sbjct  378  EAALVAKLQHRNLVRLLGFCLEGREKILIYEYITNKSLDHFLF  420



>ref|XP_006449133.1| hypothetical protein CICLE_v10014789mg [Citrus clementina]
 gb|ESR62373.1| hypothetical protein CICLE_v10014789mg [Citrus clementina]
Length=555

 Score =   138 bits (347),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP +   LDW RRYKII  IARGL+YL+EDS L IIH +LK SNVLLD  + PK+ADF M
Sbjct  310  DPTRRAQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKTSNVLLDAEMTPKIADFGM  369

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D+T  +T RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  370  ARLFEMDETQGNTSRIVGTYGYMAPEYAMHGQYSVKSDVFSFGVLV  415


 Score =   134 bits (338),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI+ AT+NFSD NK+G+GGFG +YKG   DG  +AVKRLS++   G  EFKN
Sbjct  207  ESLQFDFNTIRVATDNFSDANKLGQGGFGAVYKGRLYDGAEIAVKRLSRDSGQGDLEFKN  266

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            +  L+A  QHRNLVRLLGFSLEG E LL+YEFVPN SLD+F+F    R
Sbjct  267  EVLLVANLQHRNLVRLLGFSLEGNERLLIYEFVPNTSLDHFIFDPTRR  314



>ref|XP_007025958.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
 gb|EOY28580.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
Length=588

 Score =   142 bits (358),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPV+  +LDW RR+KII  IA+GL+YL+EDS L IIH NLKASN+LLD  LNPK++DF M
Sbjct  415  DPVRRAYLDWERRHKIIRGIAQGLLYLHEDSRLQIIHCNLKASNILLDAELNPKISDFGM  474

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL  LD+T   T RI GT+GYM PEY LH + SIK +V+ FGVL+
Sbjct  475  ARLCALDQTQSVTSRIEGTNGYMAPEYALHGQFSIKSDVFSFGVLL  520


 Score =   130 bits (327),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +1

Query  103  VEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKNKA  282
            ++YDF TI+ AT++FSD NK+G+GGFG +YKGT     L+AVKRL+ N   G  EFKN+ 
Sbjct  314  LQYDFSTIRAATDDFSDANKLGQGGFGAVYKGTIGSEELIAVKRLTTNSGQGDLEFKNEV  373

Query  283  ALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
             L+AK QH+NLVRL GF LEG E LL+YEFVPN SLD FLF
Sbjct  374  QLVAKLQHKNLVRLQGFCLEGNERLLIYEFVPNASLDQFLF  414



>gb|KFK30807.1| hypothetical protein AALP_AA6G028400 [Arabis alpina]
Length=663

 Score =   141 bits (355),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  482  ADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFD  661
            +DP K   LDW RR+KII  IARG++YL++DS L IIH +LKASN+LLD  +NPK+ADF 
Sbjct  426  SDPAKQAQLDWTRRFKIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFG  485

Query  662  MARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            MAR+F +++T ++T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  486  MARIFGMEQTQENTSRIVGTYGYMSPEYAMHGQFSMKSDVYSFGVLV  532


 Score =   131 bits (330),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++ D+  IQ AT+NFS+ NKIG GGFG +YKGTF DG  VAVKRLS+    G  EFKN
Sbjct  324  ESLQLDYRIIQAATDNFSENNKIGRGGFGEVYKGTFSDGAEVAVKRLSKTSGQGDTEFKN  383

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFL  402
            +  ++AK QHRNLVRLLGF LEG+E +LVYE+VPN SLD FL
Sbjct  384  EVVVVAKLQHRNLVRLLGFCLEGEERILVYEYVPNKSLDYFL  425



>ref|XP_003592436.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|AES62687.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=673

 Score =   143 bits (360),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   ++W RRYKIIE IARG++YL+EDS L IIH +LKASN+LLDE LNPK++DF M
Sbjct  431  DPEKAHQINWPRRYKIIEGIARGMLYLHEDSRLRIIHRDLKASNILLDENLNPKISDFGM  490

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T   T R+VGT GYM PEY +H E SIK +VY FGVLV
Sbjct  491  ARIFGVDQTRGITNRVVGTLGYMSPEYAMHGEFSIKTDVYSFGVLV  536


 Score =   129 bits (325),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 91/127 (72%), Gaps = 11/127 (9%)
 Frame = +1

Query  58   FLVSSLEGISF---AEEAVE--------YDFITIQNATNNFSDTNKIGEGGFGVMYKGTF  204
            +++S ++ I F    +E+VE        +DF TI  ATNNFS  NK+GEGGFG +YKG  
Sbjct  304  WIISKMKRIKFNSVPQESVEISRVEFLQFDFDTIATATNNFSGDNKLGEGGFGEVYKGML  363

Query  205  EDGRLVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNG  384
             +G+ +AVKRLS++   G +EFKN+  L+AK QHRNLVR+LGF L+G+E +L+YEF+PN 
Sbjct  364  FNGQEIAVKRLSRSSGQGIEEFKNEVVLVAKLQHRNLVRILGFCLDGEEKMLIYEFMPNK  423

Query  385  SLDNFLF  405
            SLD FLF
Sbjct  424  SLDYFLF  430



>ref|XP_008225008.1| PREDICTED: uncharacterized protein LOC103324687 [Prunus mume]
Length=1397

 Score =   144 bits (364),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 66/106 (62%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485   DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
             DP+K   LDW  RYKII  I RG+IYL+EDS L IIH +LKASN+L+D  +NPK++DF M
Sbjct  1149  DPIKRTQLDWDSRYKIIVGITRGIIYLHEDSRLRIIHRDLKASNILVDAEMNPKISDFGM  1208

Query  665   ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
             A+LFVLD+T  +T RIVGT GYM PEY +H   S+K +VY FGVLV
Sbjct  1209  AKLFVLDQTQGNTSRIVGTYGYMAPEYAMHGHFSVKSDVYSFGVLV  1254


 Score =   128 bits (321),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 63/111 (57%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +1

Query  91    AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
             + E++++DF TI+ AT++FS+ NK+G+GGFG +YKG   +G  +AVKRLS N   G  EF
Sbjct  1044  SAESLQFDFDTIRIATDDFSEANKLGQGGFGSVYKGRLFNGEDIAVKRLSTNSGQGDLEF  1103

Query  271   KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSRT  423
             KN+  L+A+ QHRNLVRLLGF LEG E LL+YEFVPN SLD+ +F    RT
Sbjct  1104  KNEVLLVARLQHRNLVRLLGFCLEGIERLLIYEFVPNSSLDHIIFDPIKRT  1154


 Score =   144 bits (363),  Expect(2) = 3e-62, Method: Composition-based stats.
 Identities = 66/105 (63%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDW RRYKII  I RGL+YL+EDS L IIH +LK SN+L+D  +NPK+ADF M
Sbjct  441  DPIKRAELDWDRRYKIIVGITRGLLYLHEDSRLRIIHRDLKVSNILIDGEMNPKIADFGM  500

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVL  799
            ARLFV D+T  +T+RIVGT GYM PEY +H   S+K +VY FGVL
Sbjct  501  ARLFVPDQTQANTKRIVGTYGYMSPEYAMHGHFSVKSDVYSFGVL  545


 Score =   122 bits (307),  Expect(2) = 3e-62, Method: Composition-based stats.
 Identities = 60/103 (58%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++ DF TI+ AT++FS+ NK+G+GGFG +YKG   +G  +AVKRLS N   G  EF+N
Sbjct  338  ESLQMDFDTIRLATDDFSEVNKLGQGGFGSVYKGKLFNGENIAVKRLSMNSGQGDIEFQN  397

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+A+ QHRNLVRLLGF LEG+E LLVYEFV N SLD  +F
Sbjct  398  EVLLVARLQHRNLVRLLGFCLEGQERLLVYEFVSNASLDRIIF  440



>gb|KHN15831.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=1343

 Score =   144 bits (363),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 65/106 (61%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  485   DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
             DP+K  +LDW RRYKIIE I+RGL+YL+EDS L IIH +LKASN+LLD+ +NPK++DF M
Sbjct  1110  DPIKRLFLDWERRYKIIEGISRGLLYLHEDSRLRIIHRDLKASNILLDDEMNPKISDFGM  1169

Query  665   ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
             ARL V D++  +T R+VGT GYM PEY +H   S+K +V+ FGVLV
Sbjct  1170  ARLLVADQSLGNTIRVVGTVGYMAPEYAMHGHFSVKSDVFSFGVLV  1215


 Score =   128 bits (322),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 62/103 (60%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +1

Query  97    EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
             E ++ DF TI +ATNNF+D NK+G+GGFG +YKG   +G+ VA+KRLS+    G  EFKN
Sbjct  1007  ETLQLDFQTIIDATNNFADANKVGQGGFGPVYKGRLPNGKEVAIKRLSRGSGQGDIEFKN  1066

Query  277   KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
             +  L+AK QHRNLVRLLGF LE  E +LVYEF+PN SLD F+F
Sbjct  1067  ELLLVAKLQHRNLVRLLGFCLETGERILVYEFLPNKSLDYFIF  1109


 Score =   128 bits (321),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 59/106 (56%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDW  RYKIIE IARGL+YL+EDS   IIH +LK SN+LLD  +NPK++DF  
Sbjct  435  DPIKRAHLDWKTRYKIIEGIARGLLYLHEDSQRRIIHRDLKLSNILLDADMNPKISDFGF  494

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D+T  +  +I GT GYM PEY  H ++S+K +V+ FGV++
Sbjct  495  ARLFNVDQTLFNASKIAGTYGYMAPEYARHGKLSMKLDVFSFGVII  540


 Score =   122 bits (307),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 61/104 (59%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +1

Query  94   EEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFK  273
            E +  +DF TI+  TNNFS  NK+G+GGFG +YKG   + + VA+KRLS N   G  EFK
Sbjct  331  ERSSLFDFDTIRVGTNNFSPANKLGQGGFGPVYKGMLFNEQEVAIKRLSSNSGQGEIEFK  390

Query  274  NKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            N+  LM++ QHRNLVRLLGF  E +E LLVYEF+PN SLD FLF
Sbjct  391  NEVLLMSRLQHRNLVRLLGFCFEREERLLVYEFLPNKSLDYFLF  434



>ref|XP_006606026.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform X2 [Glycine max]
Length=615

 Score =   141 bits (355),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPVK R LDW RRY II  IARG++YL+EDS L IIH +LKASNVLLDE +NPK++DF M
Sbjct  377  DPVKQRELDWSRRYNIIVGIARGILYLHEDSQLRIIHRDLKASNVLLDENMNPKISDFGM  436

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            A++F  D+T  +T RIVGT GYM PEY +  + S+K +V+ FGVLV
Sbjct  437  AKIFQADQTQVNTGRIVGTFGYMSPEYAMRGQFSVKSDVFSFGVLV  482


 Score =   131 bits (330),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++D  TI+ ATN FSD NKIG+GGFGV+YKG   + + +AVKRLS     G  EF+N
Sbjct  274  ESLQFDLATIEAATNGFSDENKIGQGGFGVVYKGILPNRQEIAVKRLSVTSLQGAVEFRN  333

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +AAL+AK QHRNLVRLLGF LEG+E +L+YE++ N SLD+FLF
Sbjct  334  EAALVAKLQHRNLVRLLGFCLEGREKILIYEYITNKSLDHFLF  376



>ref|XP_002867718.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43977.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=704

 Score =   142 bits (358),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = +2

Query  476  SHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLAD  655
            +H DP K   LDW  R+KIIE IARG++YL++DS L IIH +LKASN+LLD  +NPK+AD
Sbjct  498  AHTDPAKQGQLDWTERHKIIEGIARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIAD  557

Query  656  FDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            F MAR+F +D++ ++T RIVGT GYM PEY ++ + S+K +VY FGVLV
Sbjct  558  FGMARIFEMDQSQENTSRIVGTFGYMSPEYAINGQFSVKSDVYSFGVLV  606


 Score =   130 bits (327),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 90/120 (75%), Gaps = 1/120 (1%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++ D+  I+ ATN FS+ NKIG+GGFG +YKGTF +G  VAVKRLS++   G  EFKN
Sbjct  363  ESLQLDYKMIRAATNKFSENNKIGQGGFGEVYKGTFLNGTEVAVKRLSKSSGQGHTEFKN  422

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSRT-CISLWFEILR  453
            +  ++AK QH++LVRLLGFSLEG+E +LVYE+VPN SLD F+FG      C++  F IL+
Sbjct  423  EVVVVAKLQHKSLVRLLGFSLEGEERILVYEYVPNKSLDYFIFGQFQLLFCLNDCFAILK  482



>ref|XP_008340068.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=668

 Score =   137 bits (346),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TIQ AT+NFSD +K+GEGGFG +YKGT  +G+ VAVKRLS+N   G +EFKN
Sbjct  327  ESLQFDFATIQAATSNFSDDHKLGEGGFGQVYKGTLSNGQEVAVKRLSRNSGQGTEEFKN  386

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+V N SLD FLF
Sbjct  387  EMVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVLNKSLDCFLF  429


 Score =   135 bits (339),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = +2

Query  473  CSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLA  652
            C   DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  ++PK++
Sbjct  426  CFLFDPEKQGQLDWSRRYKIISGIARGIMYLHEDSRLRIIHRDLKASNILLDGEMHPKIS  485

Query  653  DFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            DF MAR+F +D+T  +T RIVGT GYM PEY +H   S+K ++  FGVLV
Sbjct  486  DFGMARIFGVDQTQANTNRIVGTYGYMSPEYAMHGHFSVKSDLXSFGVLV  535



>ref|XP_006606025.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform X1 [Glycine max]
Length=659

 Score =   141 bits (355),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPVK R LDW RRY II  IARG++YL+EDS L IIH +LKASNVLLDE +NPK++DF M
Sbjct  421  DPVKQRELDWSRRYNIIVGIARGILYLHEDSQLRIIHRDLKASNVLLDENMNPKISDFGM  480

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            A++F  D+T  +T RIVGT GYM PEY +  + S+K +V+ FGVLV
Sbjct  481  AKIFQADQTQVNTGRIVGTFGYMSPEYAMRGQFSVKSDVFSFGVLV  526


 Score =   131 bits (330),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++D  TI+ ATN FSD NKIG+GGFGV+YKG   + + +AVKRLS     G  EF+N
Sbjct  318  ESLQFDLATIEAATNGFSDENKIGQGGFGVVYKGILPNRQEIAVKRLSVTSLQGAVEFRN  377

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +AAL+AK QHRNLVRLLGF LEG+E +L+YE++ N SLD+FLF
Sbjct  378  EAALVAKLQHRNLVRLLGFCLEGREKILIYEYITNKSLDHFLF  420



>ref|XP_006383968.1| hypothetical protein POPTR_0004s02560g [Populus trichocarpa]
 gb|ERP61765.1| hypothetical protein POPTR_0004s02560g [Populus trichocarpa]
Length=621

 Score =   139 bits (350),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            +  +   LDW RRYKII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  376  NQARRAQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDADMNPKISDFGM  435

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLFV+D+T  +T RIVGT GYM PEY +H + S+K +V+ FGVL+
Sbjct  436  ARLFVMDETQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLI  481


 Score =   133 bits (335),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +1

Query  88   FAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQE  267
               E++++DF TI+ AT+NFS+ NK+G+GGFG +YKGT  +G+ VAVKRLS++   G  E
Sbjct  270  ITAESLQFDFSTIRAATDNFSEENKLGQGGFGSVYKGTLSNGQEVAVKRLSKDSGQGDLE  329

Query  268  FKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            FKN+  L+AK QHRNLVRL GF L+G E LL+YEFVPN SLD+F+F    R
Sbjct  330  FKNEVLLVAKLQHRNLVRLQGFCLQGIERLLIYEFVPNASLDHFIFNQARR  380



>emb|CDP20318.1| unnamed protein product [Coffea canephora]
Length=678

 Score =   137 bits (346),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +2

Query  473  CSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLA  652
            C   DP K   LDW RRYKII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK+A
Sbjct  437  CFLFDPEKQHMLDWSRRYKIIAGIARGLLYLHEDSRLRIIHRDLKASNILLDRDMNPKIA  496

Query  653  DFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            DF MARLF  D++  +T+ I GT GYM PEY +H   S K +V+ FGVLV
Sbjct  497  DFGMARLFGADQSAATTKTIAGTYGYMSPEYAMHGHFSTKSDVFSFGVLV  546


 Score =   135 bits (339),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 87/120 (73%), Gaps = 1/120 (1%)
 Frame = +1

Query  49   RYRFLVSSLEGISFA-EEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVA  225
            RY  +V + +   F+  E+++Y    IQ  TNNFS  NKIGEGGFG +YKGT ++G+ +A
Sbjct  321  RYDAIVEATDASQFSTPESLQYSLSLIQAITNNFSAENKIGEGGFGHVYKGTLQNGQEIA  380

Query  226  VKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            VKRLS++   G +EFKN+  L+A  QHRNLVRLLGF  EG+E LL+YEFVPN SLD FLF
Sbjct  381  VKRLSRSSMQGLEEFKNEILLVANLQHRNLVRLLGFCFEGEEKLLIYEFVPNKSLDCFLF  440



>ref|XP_011098665.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Sesamum indicum]
Length=638

 Score =   145 bits (366),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDW +RYKII+ I+RGL+YL+EDS L IIH +LKASNVLLDE +NPK++DF M
Sbjct  403  DPIKASILDWDKRYKIIQGISRGLLYLHEDSMLRIIHRDLKASNVLLDEKMNPKISDFGM  462

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL V+D++ D T RIVGT GYM PEY  H + SIK +V+ FGVLV
Sbjct  463  ARLLVVDQSQDRTNRIVGTYGYMAPEYATHGQFSIKSDVFSFGVLV  508


 Score =   127 bits (319),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 86/114 (75%), Gaps = 2/114 (2%)
 Frame = +1

Query  70   SLEGI--SFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQ  243
            SLE +  + + ++++YDF  I+ ATN+FS+ NK+GEGGFG +Y+G   + + +AVKRLS+
Sbjct  289  SLETVDDTTSIDSIQYDFEKIRAATNDFSEANKLGEGGFGAVYRGKLLNNQEIAVKRLSR  348

Query  244  NLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            N   G  EFKN+  L+ K QH+NLVRLLGFS +G E LL+YEFV NGSLD+F+F
Sbjct  349  NSSQGDVEFKNEVLLLVKLQHKNLVRLLGFSTQGHERLLIYEFVSNGSLDHFIF  402



>ref|XP_009124034.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Brassica rapa]
Length=674

 Score =   142 bits (359),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPVK   LDW RRY II  IARG++YL++DS L IIH +LKASNVLLDE +NPK+ADF M
Sbjct  439  DPVKRGQLDWTRRYNIIGGIARGVLYLHQDSRLTIIHRDLKASNVLLDENMNPKIADFGM  498

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F LD+T ++T RIVGT GYM PEY +  + S+K +VY FGVLV
Sbjct  499  ARIFGLDQTQENTSRIVGTYGYMSPEYAMRGQFSMKSDVYSFGVLV  544


 Score =   129 bits (325),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++ D+ TIQ ATN++S+ NKIG GGFG +YKG F +G  VAVKRLS++ + G  EFKN
Sbjct  336  DSLQLDYRTIQAATNDYSEDNKIGRGGFGEVYKGIFSNGTEVAVKRLSKSSEQGDTEFKN  395

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            +  L+AK QHRNLVRLLGFSLE +E +LVYE+VPN SL+ FLF    R
Sbjct  396  EVVLVAKLQHRNLVRLLGFSLEREERILVYEYVPNKSLNYFLFDPVKR  443



>ref|XP_003592435.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|AES62686.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=562

 Score =   143 bits (361),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   ++W RRYKIIE IARG++YL+EDS L IIH +LKASN+LLDE LNPK++DF M
Sbjct  431  DPEKAHQINWPRRYKIIEGIARGMLYLHEDSRLRIIHRDLKASNILLDENLNPKISDFGM  490

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T   T R+VGT GYM PEY +H E SIK +VY FGVLV
Sbjct  491  ARIFGVDQTRGITNRVVGTLGYMSPEYAMHGEFSIKTDVYSFGVLV  536


 Score =   129 bits (323),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 91/127 (72%), Gaps = 11/127 (9%)
 Frame = +1

Query  58   FLVSSLEGISF---AEEAVE--------YDFITIQNATNNFSDTNKIGEGGFGVMYKGTF  204
            +++S ++ I F    +E+VE        +DF TI  ATNNFS  NK+GEGGFG +YKG  
Sbjct  304  WIISKMKRIKFNSVPQESVEISRVEFLQFDFDTIATATNNFSGDNKLGEGGFGEVYKGML  363

Query  205  EDGRLVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNG  384
             +G+ +AVKRLS++   G +EFKN+  L+AK QHRNLVR+LGF L+G+E +L+YEF+PN 
Sbjct  364  FNGQEIAVKRLSRSSGQGIEEFKNEVVLVAKLQHRNLVRILGFCLDGEEKMLIYEFMPNK  423

Query  385  SLDNFLF  405
            SLD FLF
Sbjct  424  SLDYFLF  430



>ref|XP_011004252.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Populus euphratica]
Length=667

 Score =   138 bits (347),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            +  +   LDW RRYKII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  422  NQARRAQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDADMNPKISDFGM  481

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            A+LFV+D+T  +T RIVGT GYM PEY +H + S+K +V+ FGVL+
Sbjct  482  AKLFVMDETQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLI  527


 Score =   134 bits (337),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +1

Query  85   SFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQ  264
            +   E++++DF TI+ AT+NFS+ NK+G+GGFG +YKGT  +G+ VAVKRLS++   G  
Sbjct  315  TITPESLQFDFSTIRAATDNFSEENKLGQGGFGSVYKGTLSNGQEVAVKRLSKDSGQGDL  374

Query  265  EFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            EFKN+  L+AK QHRNLVRL GF L+G E LL+YEFVPN SLD+F+F    R
Sbjct  375  EFKNEVLLVAKLQHRNLVRLQGFCLQGIERLLIYEFVPNASLDHFVFNQARR  426



>gb|KCW75000.1| hypothetical protein EUGRSUZ_E03762 [Eucalyptus grandis]
Length=665

 Score =   136 bits (343),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K + LDW RRYKI+  IARG++YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  428  DPKKSKELDWSRRYKIVCGIARGMLYLHEDSRLRIIHRDLKASNILLDNEMNPKISDFGM  487

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+  +D+T  +T +IVGT GYM PEY +H + S+K +VY FGVL+
Sbjct  488  ARIVGVDQTQANTNKIVGTFGYMSPEYAMHGQFSVKSDVYSFGVLL  533


 Score =   135 bits (341),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++YD  TIQ AT+NFS  NK+GEGGFG +++G   +G+ +AVKRLSQ+   G QEFKN
Sbjct  325  DSLQYDLATIQTATDNFSHQNKLGEGGFGKVFQGRLPNGQQIAVKRLSQSSGQGAQEFKN  384

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E LLVYEFVPN SLD  LF
Sbjct  385  EVLLVAKLQHRNLVRLLGFCLEGEEKLLVYEFVPNKSLDYCLF  427



>ref|XP_011098674.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X2 [Sesamum indicum]
Length=593

 Score =   145 bits (366),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDW +RYKII+ I+RGL+YL+EDS L IIH +LKASNVLLDE +NPK++DF M
Sbjct  358  DPIKASILDWDKRYKIIQGISRGLLYLHEDSMLRIIHRDLKASNVLLDEKMNPKISDFGM  417

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL V+D++ D T RIVGT GYM PEY  H + SIK +V+ FGVLV
Sbjct  418  ARLLVVDQSQDRTNRIVGTYGYMAPEYATHGQFSIKSDVFSFGVLV  463


 Score =   127 bits (319),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++YDF  I+ ATN+FS+ NK+GEGGFG +Y+G   + + +AVKRLS+N   G  EFKN
Sbjct  255  DSIQYDFEKIRAATNDFSEANKLGEGGFGAVYRGKLLNNQEIAVKRLSRNSSQGDVEFKN  314

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+ K QH+NLVRLLGFS +G E LL+YEFV NGSLD+F+F
Sbjct  315  EVLLLVKLQHKNLVRLLGFSTQGHERLLIYEFVSNGSLDHFIF  357



>gb|AAN60348.1| unknown [Arabidopsis thaliana]
Length=658

 Score =   142 bits (357),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  +ARG++YL++DS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  424  DPAKKGQLDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGM  483

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F LD+T ++T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  484  ARIFGLDQTEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLV  529


 Score =   130 bits (327),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++ D+ TIQ AT++F ++NKIG+GGFG +YKGT  DG  VAVKRLS++   G  EFKN
Sbjct  321  DSLQLDYRTIQTATDDFVESNKIGQGGFGEVYKGTLSDGTEVAVKRLSKSSGQGEVEFKN  380

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF L+G+E +LVYE+VPN SLD FLF
Sbjct  381  EVVLVAKLQHRNLVRLLGFCLDGEERVLVYEYVPNKSLDYFLF  423



>ref|XP_010057745.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=644

 Score =   136 bits (343),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K + LDW RRYKI+  IARG++YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  407  DPKKSKELDWSRRYKIVCGIARGMLYLHEDSRLRIIHRDLKASNILLDNEMNPKISDFGM  466

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+  +D+T  +T +IVGT GYM PEY +H + S+K +VY FGVL+
Sbjct  467  ARIVGVDQTQANTNKIVGTFGYMSPEYAMHGQFSVKSDVYSFGVLL  512


 Score =   135 bits (341),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++YD  TIQ AT+NFS  NK+GEGGFG +++G   +G+ +AVKRLSQ+   G QEFKN
Sbjct  304  DSLQYDLATIQTATDNFSHQNKLGEGGFGKVFQGRLPNGQQIAVKRLSQSSGQGAQEFKN  363

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E LLVYEFVPN SLD  LF
Sbjct  364  EVLLVAKLQHRNLVRLLGFCLEGEEKLLVYEFVPNKSLDYCLF  406



>ref|XP_011004254.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X3 [Populus euphratica]
Length=625

 Score =   138 bits (347),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            +  +   LDW RRYKII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  380  NQARRAQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDADMNPKISDFGM  439

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            A+LFV+D+T  +T RIVGT GYM PEY +H + S+K +V+ FGVL+
Sbjct  440  AKLFVMDETQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLI  485


 Score =   134 bits (337),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +1

Query  85   SFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQ  264
            +   E++++DF TI+ AT+NFS+ NK+G+GGFG +YKGT  +G+ VAVKRLS++   G  
Sbjct  273  TITPESLQFDFSTIRAATDNFSEENKLGQGGFGSVYKGTLSNGQEVAVKRLSKDSGQGDL  332

Query  265  EFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            EFKN+  L+AK QHRNLVRL GF L+G E LL+YEFVPN SLD+F+F    R
Sbjct  333  EFKNEVLLVAKLQHRNLVRLQGFCLQGIERLLIYEFVPNASLDHFVFNQARR  384



>gb|AES98408.2| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=663

 Score =   140 bits (353),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW +RYKII+ I RG++YL+EDS L IIH +LKASN+LLD  +N K+ADF M
Sbjct  426  DPTKKAQLDWEKRYKIIQGITRGVLYLHEDSRLRIIHRDLKASNILLDGDMNAKIADFGM  485

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL ++D+T  +T RIVGT GYM PEYV+H E S+K +V+GFGVLV
Sbjct  486  ARLILVDQTQANTSRIVGTYGYMAPEYVMHGEFSVKSDVFGFGVLV  531


 Score =   132 bits (332),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F TI+ ATN+F D+NK+G+GGFG +Y+G   +G+++AVKRLS N   G  EFKN
Sbjct  323  ESLQFNFDTIRVATNDFCDSNKLGQGGFGAVYQGRLSNGQVIAVKRLSINSGQGDLEFKN  382

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF++EG+E LLVYEFVPN SLD F+F
Sbjct  383  EVRLVAKLQHRNLVRLLGFTVEGRERLLVYEFVPNKSLDYFIF  425



>ref|XP_003592434.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=801

 Score =   142 bits (359),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   ++W RRYKIIE IARG++YL+EDS L IIH +LKASN+LLDE LNPK++DF M
Sbjct  431  DPEKAHQINWPRRYKIIEGIARGMLYLHEDSRLRIIHRDLKASNILLDENLNPKISDFGM  490

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T   T R+VGT GYM PEY +H E SIK +VY FGVLV
Sbjct  491  ARIFGVDQTRGITNRVVGTLGYMSPEYAMHGEFSIKTDVYSFGVLV  536


 Score =   129 bits (325),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 91/127 (72%), Gaps = 11/127 (9%)
 Frame = +1

Query  58   FLVSSLEGISF---AEEAVE--------YDFITIQNATNNFSDTNKIGEGGFGVMYKGTF  204
            +++S ++ I F    +E+VE        +DF TI  ATNNFS  NK+GEGGFG +YKG  
Sbjct  304  WIISKMKRIKFNSVPQESVEISRVEFLQFDFDTIATATNNFSGDNKLGEGGFGEVYKGML  363

Query  205  EDGRLVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNG  384
             +G+ +AVKRLS++   G +EFKN+  L+AK QHRNLVR+LGF L+G+E +L+YEF+PN 
Sbjct  364  FNGQEIAVKRLSRSSGQGIEEFKNEVVLVAKLQHRNLVRILGFCLDGEEKMLIYEFMPNK  423

Query  385  SLDNFLF  405
            SLD FLF
Sbjct  424  SLDYFLF  430



>gb|KCW75006.1| hypothetical protein EUGRSUZ_E03770 [Eucalyptus grandis]
Length=687

 Score =   140 bits (352),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +2

Query  473  CSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLA  652
            C++ADP K   L+W  RYKI+  IARG++YL+EDS L IIH +LK SNVLLD  +NPK++
Sbjct  443  CNNADPQKSSQLNWSLRYKIVSGIARGMLYLHEDSRLRIIHRDLKCSNVLLDSEMNPKIS  502

Query  653  DFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            DF MAR+F +D+T  ST +IVGT GYM PEY +H + S+K +VY FG+L+
Sbjct  503  DFGMARIFGVDQTQASTNKIVGTFGYMSPEYAMHGKFSVKSDVYSFGILL  552


 Score =   132 bits (332),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++D  TIQ ATN+FS  NK+GEGGFG ++KG   D + +AVKRLS++ + G +EFKN
Sbjct  322  ESLQFDLATIQVATNDFSPENKLGEGGFGEVFKGRLPDVQQIAVKRLSRSSRQGDEEFKN  381

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFG  408
            +  L+AK QHRNLVRLLGF LEG E LL YEFVPN SLD FLFG
Sbjct  382  EVLLVAKLQHRNLVRLLGFCLEGDEKLLTYEFVPNRSLDYFLFG  425



>ref|XP_009340921.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=670

 Score =   137 bits (346),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = +2

Query  473  CSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLA  652
            C   DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  ++PK++
Sbjct  428  CFLFDPEKQGQLDWSRRYKIISGIARGIMYLHEDSRLKIIHRDLKASNILLDGEMHPKIS  487

Query  653  DFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            DF MAR+F +D+T  ST RIVGT GYM PEY +H   S+K ++Y FGVL+
Sbjct  488  DFGMARIFGVDQTQASTNRIVGTYGYMSPEYAMHGHFSVKSDLYSFGVLM  537


 Score =   134 bits (338),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TIQ AT+NFS+ +K+GEGGFG +YKGT  + + VAVKRLS+N   G +EFKN
Sbjct  329  ESLQFDFATIQAATSNFSNDHKLGEGGFGQVYKGTLSNSQEVAVKRLSRNSSQGTEEFKN  388

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+V N SLD FLF
Sbjct  389  EMVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVLNKSLDCFLF  431



>emb|CDY01595.1| BnaC07g35850D [Brassica napus]
Length=656

 Score =   141 bits (356),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   L W RRYKIIE IARG++YL++DS L IIH +LKASN+LLD  +NPK+A F M
Sbjct  425  DPTKKGQLSWTRRYKIIEGIARGMLYLHQDSRLTIIHRDLKASNILLDADMNPKIAGFGM  484

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T ++T RIVGT GYM PEYV+H + S+K +VY FGVLV
Sbjct  485  ARIFGMDQTQENTNRIVGTYGYMSPEYVIHGQFSMKSDVYSFGVLV  530


 Score =   130 bits (328),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++ D+ TIQ ATN++S+ NKIG+GGFG +YKGTF +G  VAVKRLS++   G  EFKN
Sbjct  322  DSLQLDYRTIQTATNDYSENNKIGQGGFGEVYKGTFLNGTEVAVKRLSKSSGQGETEFKN  381

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  ++AK QHRNLVRL+GFSLE +E +LVYE+VPN SLD FLF
Sbjct  382  EVVVVAKLQHRNLVRLMGFSLEREERILVYEYVPNKSLDYFLF  424



>ref|XP_010247620.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 isoform 
X2 [Nelumbo nucifera]
Length=675

 Score =   143 bits (361),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDWG RYKIIE IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  430  DPIKRAELDWGTRYKIIEGIARGLLYLHEDSRLRIIHRDLKASNILLDRVMNPKISDFGM  489

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLFV D+TH +T RIVGT GYM PEY +  + S+K +V+ FG+L+
Sbjct  490  ARLFVQDQTHANTNRIVGTFGYMAPEYAMRGQFSVKSDVFSFGILL  535


 Score =   129 bits (323),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F  ++ ATNNFS++NK+G+GGFG +YKG   DG+ VAVKRL +N   G  EFKN
Sbjct  327  ESLQFNFEKLRAATNNFSESNKLGQGGFGSVYKGKLLDGQDVAVKRLCRNSGQGELEFKN  386

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF +EG+E LL+YEFVPN SL++FLF
Sbjct  387  EVLLLAKLQHRNLVRLLGFCIEGEEKLLIYEFVPNTSLNHFLF  429



>ref|NP_567679.2| cysteine-rich receptor-like protein kinase 10 [Arabidopsis thaliana]
 sp|Q8GYA4.3|CRK10_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase 10; 
Short=Cysteine-rich RLK10; AltName: Full=Receptor-like protein 
kinase 4; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAC42412.1| putative receptor-like protein kinase 4 RLK4 [Arabidopsis thaliana]
 gb|AAO64889.1| At4g23180 [Arabidopsis thaliana]
 gb|AEE84719.1| cysteine-rich receptor-like protein kinase 10 [Arabidopsis thaliana]
Length=669

 Score =   142 bits (357),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  +ARG++YL++DS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  435  DPAKKGQLDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGM  494

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F LD+T ++T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  495  ARIFGLDQTEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLV  540


 Score =   130 bits (327),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++ D+ TIQ AT++F ++NKIG+GGFG +YKGT  DG  VAVKRLS++   G  EFKN
Sbjct  332  DSLQLDYRTIQTATDDFVESNKIGQGGFGEVYKGTLSDGTEVAVKRLSKSSGQGEVEFKN  391

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF L+G+E +LVYE+VPN SLD FLF
Sbjct  392  EVVLVAKLQHRNLVRLLGFCLDGEERVLVYEYVPNKSLDYFLF  434



>ref|XP_011096162.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Sesamum 
indicum]
Length=1074

 Score =   142 bits (358),  Expect(2) = 6e-64, Method: Composition-based stats.
 Identities = 67/106 (63%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDW RRYKII  IARGL+YL+EDS L IIH +LKASNVLLD  +NPK+ADF M
Sbjct  827  DPIKRSDLDWDRRYKIIAGIARGLVYLHEDSRLRIIHRDLKASNVLLDGEMNPKIADFGM  886

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL   D+T  +T +IVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  887  ARLVGQDETQRNTSKIVGTYGYMSPEYAMHGQFSVKSDVFSFGVLV  932


 Score =   130 bits (326),  Expect(2) = 6e-64, Method: Composition-based stats.
 Identities = 61/103 (59%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF  I++ATN+FSD NK+G+GGFG +Y G  ++G+ +AVKRLS+    G  EFKN
Sbjct  724  ESLQFDFGKIRDATNDFSDANKLGQGGFGAVYWGRLQNGQEIAVKRLSRESGQGNVEFKN  783

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGFS EG E LL+YEFV N SLD F+F
Sbjct  784  EVLLVAKLQHRNLVRLLGFSTEGTERLLIYEFVENASLDQFIF  826


 Score =   137 bits (346),  Expect(2) = 2e-62, Method: Composition-based stats.
 Identities = 65/106 (61%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDW RRYKIIE IARG++YL+EDS + IIH +LKASNVLLD  +NPK+ADF M
Sbjct  159  DPIKCSRLDWERRYKIIEGIARGILYLHEDSRIRIIHRDLKASNVLLDGDMNPKIADFGM  218

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
             RL   D+T  +T RIVGT GYM PEY +H + S+K +V+ F VLV
Sbjct  219  TRLSRNDETQGNTNRIVGTYGYMAPEYAMHGQFSVKSDVFSFEVLV  264


 Score =   129 bits (324),  Expect(2) = 2e-62, Method: Composition-based stats.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = +1

Query  52   YRFLVSSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVK  231
            +  L  S++ IS  E +++Y+F  I+ ATN+FSD NK+G+GGFGV+Y G F  G+ +AVK
Sbjct  42   HELLEVSIDEISTVE-SLQYEFGKIRAATNDFSDANKLGKGGFGVVYWGKFLTGQKIAVK  100

Query  232  RLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            RLS++   G  EFKN+  L+ + QHRNLVRLLGFSLEG E LL+YEFV N SLD F+F
Sbjct  101  RLSKSSGQGNIEFKNEVLLVVRLQHRNLVRLLGFSLEGTERLLIYEFVQNASLDQFIF  158



>ref|XP_007143171.1| hypothetical protein PHAVU_007G049600g [Phaseolus vulgaris]
 gb|ESW15165.1| hypothetical protein PHAVU_007G049600g [Phaseolus vulgaris]
Length=685

 Score =   141 bits (355),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP  +  LDW +RYKII  IARGL+YL+EDS L IIH +LKASN+LLDE +NPK+ADF M
Sbjct  440  DPAMNAQLDWEKRYKIIRGIARGLLYLHEDSQLRIIHRDLKASNILLDEEMNPKIADFGM  499

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL ++D+T  +T RIVGT GYM PEY +H + S+K +V+ FGVL+
Sbjct  500  ARLVLMDQTQANTSRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLI  545


 Score =   130 bits (328),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F TI+ AT +FSD+NK+G+GGFG++Y G   +G+++AVKRLS++   G  EFKN
Sbjct  337  ESLQFNFDTIRVATEDFSDSNKLGQGGFGIVYWGRLSNGQMIAVKRLSRDSGQGDTEFKN  396

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+ K QHRNLVRLLGF LEG+E LL+YEFVPN SLD F+F
Sbjct  397  EVVLVVKLQHRNLVRLLGFCLEGRERLLIYEFVPNKSLDYFIF  439



>ref|XP_006606015.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
isoform X2 [Glycine max]
Length=681

 Score =   140 bits (352),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP     LDW  RYKII  I RGL+YL+EDS + +IH +LKASN+LLDE +NPK+ADF M
Sbjct  438  DPNMKAQLDWESRYKIIRGITRGLLYLHEDSRVRVIHRDLKASNILLDEEMNPKIADFGM  497

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF++D+TH +T RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  498  ARLFLVDQTHANTTRIVGTCGYMAPEYAMHGQFSMKSDVFSFGVLV  543


 Score =   132 bits (332),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F TIQ AT +FSD+NK+G+GGFG +Y+G   +G+++AVKRLS++   G  EFKN
Sbjct  335  ESLQFNFNTIQVATEDFSDSNKLGQGGFGAVYRGRLSNGQMIAVKRLSRDSGQGDTEFKN  394

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG E LLVYE+VPN SLD F+F
Sbjct  395  EVLLVAKLQHRNLVRLLGFCLEGNERLLVYEYVPNKSLDYFIF  437



>ref|XP_008225006.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103324685 
[Prunus mume]
Length=1284

 Score =   137 bits (345),  Expect(2) = 6e-64, Method: Composition-based stats.
 Identities = 63/106 (59%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +2

Query  485   DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
             D   H  LDW  RYKII  IARG++YL+EDS + IIH +LK SN+LLDE +NPK+ADF M
Sbjct  1045  DTNNHEHLDWETRYKIIGGIARGILYLHEDSRVRIIHRDLKTSNILLDEDMNPKIADFGM  1104

Query  665   ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
             ARLF +D+T   TR + GT GYM PEYV+H   S+K +V+ FGVLV
Sbjct  1105  ARLFAIDQTQGDTRTVGGTYGYMAPEYVIHGRFSVKTDVFSFGVLV  1150


 Score =   135 bits (339),  Expect(2) = 6e-64, Method: Composition-based stats.
 Identities = 61/103 (59%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97    EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
             E+++YDF TI++AT++FSD NK+G GGFG +YKG   +G+ +AVKRLS+N + G +EFKN
Sbjct  942   ESLQYDFETIRSATDDFSDANKLGRGGFGAVYKGRLLNGQPIAVKRLSENSEQGDREFKN  1001

Query  277   KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
             +  L+A+ QHRNLVRLLGF L+  E LL+YE+VPN SLD+F+F
Sbjct  1002  EVMLLAQLQHRNLVRLLGFCLKTDERLLIYEYVPNTSLDHFIF  1044


 Score =   130 bits (326),  Expect(2) = 1e-53, Method: Composition-based stats.
 Identities = 58/103 (56%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++YDF TI++AT++FSD NK+G GGFG +YKG   +G  +AVKRLS+N + G +EFK 
Sbjct  333  ESLQYDFETIRSATDDFSDANKLGHGGFGAVYKGRLANGTYIAVKRLSKNSEQGEREFKT  392

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+A+ QHRNLVRLLGF L+  E +L+YE+VPN SL++F+F
Sbjct  393  EVTLVAQLQHRNLVRLLGFCLKAGERILIYEYVPNTSLNHFIF  435


 Score =   108 bits (269),  Expect(2) = 1e-53, Method: Composition-based stats.
 Identities = 52/85 (61%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+    LDW  RYKII  IARGL+YL+EDS L IIH +LK SN+LLDE +NPK+ADF M
Sbjct  436  DPINQAHLDWETRYKIIGGIARGLLYLHEDSRLRIIHRDLKPSNILLDEDMNPKIADFGM  495

Query  665  ARLFVLDKTHDSTRRIVGT-SGYMR  736
            ARLF++D+T   T  IVGT S Y++
Sbjct  496  ARLFMMDQTQGDTNTIVGTXSKYLQ  520



>gb|KCW76452.1| hypothetical protein EUGRSUZ_D00844 [Eucalyptus grandis]
Length=708

 Score =   137 bits (346),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPV+ R LDW RR KII  IARGL+YL+EDS L IIH +LKASN+LLD  + PK++DF  
Sbjct  504  DPVRSRQLDWERRQKIIVGIARGLLYLHEDSQLRIIHRDLKASNILLDAEMTPKISDFGT  563

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLFV+D+T D+T R+VGT GYM PEY +H   S+K +V+ FGVL+
Sbjct  564  ARLFVVDQTRDATSRVVGTYGYMAPEYAMHGLFSVKTDVFSFGVLL  609


 Score =   134 bits (337),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++YD  TI+ AT++FS  NK+G+GGFG +YKGT  +G+ +AV+RLS +L  G QEFKN
Sbjct  378  ESMQYDLNTIRAATDDFSGANKLGQGGFGAVYKGTLANGQFIAVRRLSIDLGQGDQEFKN  437

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSRTCISL  435
            +  L+A+ QHRNLVRLLGF LEG+E LL+Y+F PN SLD+F+F +     I L
Sbjct  438  EVLLVARLQHRNLVRLLGFCLEGRERLLIYDFEPNSSLDHFIFASSDLGLIEL  490



>ref|NP_849426.1| cysteine-rich receptor-like protein kinase 6 [Arabidopsis thaliana]
 dbj|BAC43097.1| putative receptor-like protein kinase 5 RLK5 [Arabidopsis thaliana]
 gb|AEE84715.1| cysteine-rich receptor-like protein kinase 6 [Arabidopsis thaliana]
Length=680

 Score =   138 bits (347),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 84/116 (72%), Gaps = 6/116 (5%)
 Frame = +2

Query  473  CSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLA  652
            C   DP K   LDW +RY II  IARG++YL++DS L IIH +LKASN+LLD  +NPK+A
Sbjct  434  CLLFDPTKQIQLDWMQRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADINPKIA  493

Query  653  DFDMARLFVLDKTHDSTRRIVGT------SGYMRPEYVLHDEISIKPNVYGFGVLV  802
            DF MAR+F LD+T D+T RIVGT      SGYM PEY +H + S+K +VY FGVLV
Sbjct  494  DFGMARIFGLDQTQDNTSRIVGTYFVVDSSGYMAPEYAMHGQFSMKSDVYSFGVLV  549


 Score =   134 bits (337),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++ D+ TIQ ATN+F+++NKIG GGFG +YKGTF +G+ VAVKRLS+N + G  EFK 
Sbjct  335  DSLQLDYRTIQTATNDFAESNKIGRGGFGEVYKGTFSNGKEVAVKRLSKNSRQGEAEFKT  394

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  ++AK QHRNLVRLLGFSL+G+E +LVYE++PN SLD  LF
Sbjct  395  EVVVVAKLQHRNLVRLLGFSLQGEERILVYEYMPNKSLDCLLF  437



>ref|XP_004496792.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Cicer arietinum]
Length=664

 Score =   139 bits (349),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP   R LDW RRYKII  IARG++YL+EDS L IIH +LKASNVLLDE +NPK++DF M
Sbjct  426  DPAMQRELDWSRRYKIIVGIARGILYLHEDSQLRIIHRDLKASNVLLDENMNPKISDFGM  485

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            A++F  D+T  +T RIVGT GYM PEY +  + S+K +V+ FGVLV
Sbjct  486  AKIFQADQTQVNTGRIVGTYGYMSPEYAMRGQFSVKSDVFSFGVLV  531


 Score =   133 bits (335),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            + +++DF  ++ ATN FS+ NKIGEGGFGV+YKG   +G  +AVKRLS     G  EF+N
Sbjct  323  DCLQFDFAAVEAATNCFSNKNKIGEGGFGVVYKGILPNGHEIAVKRLSATSLQGVIEFRN  382

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +A+L+AK QHRNLVRLLGF LEG+E +LVYE++PN SLD +LF
Sbjct  383  EASLVAKLQHRNLVRLLGFCLEGREKMLVYEYIPNKSLDRYLF  425



>ref|XP_007226138.1| hypothetical protein PRUPE_ppa014741mg [Prunus persica]
 gb|EMJ27337.1| hypothetical protein PRUPE_ppa014741mg [Prunus persica]
Length=689

 Score =   136 bits (343),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = +1

Query  49   RYRFLVSSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAV  228
            R++     LEG     EA+++DF +I+ ATNNFS+ NK+G GGFG +Y+G   +   +AV
Sbjct  316  RWKKRKEKLEGDEIGTEALQFDFNSIKIATNNFSEANKLGRGGFGAVYRGRLWNEEDIAV  375

Query  229  KRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            KRLS++   G  EFKN+ AL+AK QHRNLVRLLGF LEG E LLVYEFVPN SLD F+F
Sbjct  376  KRLSRDSAQGDIEFKNEVALVAKLQHRNLVRLLGFCLEGNERLLVYEFVPNASLDKFIF  434


 Score =   135 bits (341),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDW  RYKII  I RGL+YL+EDS L IIH ++KASNVLLD  ++PK+ADF M
Sbjct  435  DPIKRAHLDWDSRYKIIVGIGRGLLYLHEDSRLRIIHRDMKASNVLLDAEMHPKIADFGM  494

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T   T R+VGT GYM PEYV+  + S+K +VY FGVLV
Sbjct  495  ARLFDLDQTQGETSRVVGTYGYMAPEYVMRGQFSVKSDVYSFGVLV  540



>ref|XP_009136929.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Brassica 
rapa]
Length=668

 Score =   143 bits (360),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  +ARG++YL++DS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  430  DPAKQAQLDWSRRYKIIGGVARGILYLHQDSRLTIIHRDLKASNILLDGDMNPKIADFGM  489

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F LD+T ++T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  490  ARIFGLDQTQENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLV  535


 Score =   129 bits (323),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
              ++++ D+ +IQ AT +F+++NKIGEGGFG +YKGT  DG  VAVK+LS++   G  EF
Sbjct  325  TSDSLQLDYRSIQTATADFAESNKIGEGGFGEVYKGTLLDGTEVAVKKLSKSSGQGDVEF  384

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            KN+  L+AK QHRNLVRLLGF LEG+E +LVYE+VPN SLD FLF
Sbjct  385  KNEVVLVAKLQHRNLVRLLGFCLEGEERVLVYEYVPNKSLDYFLF  429



>emb|CDY41246.1| BnaA01g12930D [Brassica napus]
Length=668

 Score =   143 bits (360),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  +ARG++YL++DS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  430  DPAKQAQLDWSRRYKIIGGVARGILYLHQDSRLTIIHRDLKASNILLDGDMNPKIADFGM  489

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F LD+T ++T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  490  ARIFGLDQTQENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLV  535


 Score =   129 bits (323),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
              ++++ D+ +IQ AT +F+++NKIGEGGFG +YKGT  DG  VAVK+LS++   G  EF
Sbjct  325  TSDSLQLDYRSIQTATADFAESNKIGEGGFGEVYKGTLLDGTEVAVKKLSKSSGQGDVEF  384

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            KN+  L+AK QHRNLVRLLGF LEG+E +LVYE+VPN SLD FLF
Sbjct  385  KNEVVLVAKLQHRNLVRLLGFCLEGEERVLVYEYVPNKSLDYFLF  429



>ref|XP_003615450.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=700

 Score =   140 bits (352),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW +RYKII+ I RG++YL+EDS L IIH +LKASN+LLD  +N K+ADF M
Sbjct  426  DPTKKAQLDWEKRYKIIQGITRGVLYLHEDSRLRIIHRDLKASNILLDGDMNAKIADFGM  485

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL ++D+T  +T RIVGT GYM PEYV+H E S+K +V+GFGVLV
Sbjct  486  ARLILVDQTQANTSRIVGTYGYMAPEYVMHGEFSVKSDVFGFGVLV  531


 Score =   132 bits (331),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F TI+ ATN+F D+NK+G+GGFG +Y+G   +G+++AVKRLS N   G  EFKN
Sbjct  323  ESLQFNFDTIRVATNDFCDSNKLGQGGFGAVYQGRLSNGQVIAVKRLSINSGQGDLEFKN  382

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF++EG+E LLVYEFVPN SLD F+F
Sbjct  383  EVRLVAKLQHRNLVRLLGFTVEGRERLLVYEFVPNKSLDYFIF  425



>emb|CBI41018.3| unnamed protein product [Vitis vinifera]
Length=690

 Score =   139 bits (351),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   L+W +RYKII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF +
Sbjct  452  DPIKQTQLNWEKRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDAEMNPKISDFGI  511

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D+T ++T RI+GT GYM PEYVLH + S+K +VY  GVL+
Sbjct  512  ARLFAVDQTQENTSRIMGTYGYMAPEYVLHGKFSVKSDVYSLGVLI  557


 Score =   132 bits (332),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 86/123 (70%), Gaps = 0/123 (0%)
 Frame = +1

Query  37   MKGGRYRFLVSSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
            +K  R R    S EG +   E++++ F TI+ AT+NFSD NK+GEGGFG +YKG   DG+
Sbjct  329  LKKRRPRGQFLSFEGETRTLESLQFQFSTIRVATDNFSDANKLGEGGFGSVYKGRLSDGQ  388

Query  217  LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
             +AVKRLS   K G  EFKN+  LMAK QHRNLVRLLGF LE  E LL+YEF+PN SL  
Sbjct  389  EIAVKRLSAGSKQGELEFKNEVLLMAKLQHRNLVRLLGFCLERSERLLIYEFMPNLSLHG  448

Query  397  FLF  405
            F+F
Sbjct  449  FIF  451



>ref|XP_007213903.1| hypothetical protein PRUPE_ppa003904mg [Prunus persica]
 gb|EMJ15102.1| hypothetical protein PRUPE_ppa003904mg [Prunus persica]
Length=541

 Score =   137 bits (345),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  ++PK++DF M
Sbjct  303  DPEKQGQLDWSRRYKIIAGIARGIMYLHEDSRLRIIHRDLKASNILLDGEMHPKISDFGM  362

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T RIVGT GYM PEY +H + S+K ++Y FGVL+
Sbjct  363  ARIFGVDQTQANTSRIVGTYGYMSPEYAMHGQFSVKSDLYSFGVLL  408


 Score =   135 bits (339),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI  ATNNFSD NK+GEGGFG +YKG   +G+ VAVKRLS+N   G +EFKN
Sbjct  200  ESLQFDFSTIVAATNNFSDDNKLGEGGFGQVYKGILSNGQQVAVKRLSRNSGQGAEEFKN  259

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRL GF LEG+E +LVYE+V N SLD FLF
Sbjct  260  EMVLVAKLQHRNLVRLYGFCLEGEEKILVYEYVSNKSLDYFLF  302



>ref|XP_009137321.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Brassica 
rapa]
Length=662

 Score =   137 bits (346),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D  K   LDW RRYKII  IARG++YL++DS L IIH +LKASNVLLD  +NPK+ADF M
Sbjct  426  DLAKQTQLDWSRRYKIIGGIARGILYLHQDSRLTIIHRDLKASNVLLDSDMNPKIADFGM  485

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +++T ++T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  486  ARIFGMNQTEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLV  531


 Score =   134 bits (337),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++ D+ +IQ ATN FS++NKIG+GGFG +YKGT  DG  VAVKRLS++   G  EFKN
Sbjct  323  ESLQLDYRSIQTATNGFSESNKIGQGGFGEVYKGTLSDGTEVAVKRLSKSSGQGDAEFKN  382

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSRT  423
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+VPN SLD F+F    +T
Sbjct  383  EVILVAKLQHRNLVRLLGFCLEGEERVLVYEYVPNESLDYFIFDLAKQT  431



>ref|XP_009357380.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=671

 Score =   136 bits (343),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  ++PK++DF M
Sbjct  433  DPEKQGQLDWSRRYKIISGIARGIMYLHEDSQLRIIHRDLKASNILLDGEMHPKISDFGM  492

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T   T RIVGT GYM PEY +H   S+K ++Y FGVLV
Sbjct  493  ARIFGVDQTQADTNRIVGTFGYMSPEYAMHGHFSVKSDLYSFGVLV  538


 Score =   135 bits (340),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TIQ AT+NFSD +K+GEGGFG +YKG   +G+ VAVKRLS++   G +EFKN
Sbjct  330  ESLQFDFTTIQAATSNFSDDHKLGEGGFGQVYKGILSNGQEVAVKRLSRDSGQGAEEFKN  389

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+ K QHR+LVRLLGF LEG+E +LVYEFVPN SLD FLF
Sbjct  390  EMVLVGKLQHRSLVRLLGFCLEGEEKILVYEFVPNKSLDYFLF  432



>emb|CAA18465.1| serine/threonine kinase-like protein [Arabidopsis thaliana]
 emb|CAB79273.1| serine/threonine kinase-like protein [Arabidopsis thaliana]
Length=633

 Score =   141 bits (356),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  +ARG++YL++DS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  399  DPAKKGQLDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGM  458

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F LD+T ++T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  459  ARIFGLDQTEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLV  504


 Score =   130 bits (327),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++ D+ TIQ AT++F ++NKIG+GGFG +YKGT  DG  VAVKRLS++   G  EFKN
Sbjct  296  DSLQLDYRTIQTATDDFVESNKIGQGGFGEVYKGTLSDGTEVAVKRLSKSSGQGEVEFKN  355

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF L+G+E +LVYE+VPN SLD FLF
Sbjct  356  EVVLVAKLQHRNLVRLLGFCLDGEERVLVYEYVPNKSLDYFLF  398



>ref|XP_010059136.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
35 [Eucalyptus grandis]
Length=950

 Score =   144 bits (363),  Expect(2) = 8e-64, Method: Composition-based stats.
 Identities = 65/106 (61%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K + LDW RRY II  IARG++YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  116  DPKKSKQLDWPRRYNIISGIARGMLYLHEDSRLRIIHRDLKASNILLDNNMNPKISDFGM  175

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            A++F +D+T+ STRRIVGT GYM PEY +H + S K +VY FGVL+
Sbjct  176  AKIFGVDQTNASTRRIVGTYGYMSPEYAMHGQFSQKSDVYSFGVLL  221


 Score =   127 bits (320),  Expect(2) = 8e-64, Method: Composition-based stats.
 Identities = 62/115 (54%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = +1

Query  61   LVSSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLS  240
            +VSS +      E++++    I+ ATN+F++ NK+GEGGFG +Y+G   +G+ +AVKRLS
Sbjct  1    MVSSAKDEVKTAESLQFKISEIRTATNSFAEGNKLGEGGFGKVYRGRLPNGQEIAVKRLS  60

Query  241  QNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            Q+ + G QEFKN+  L+AK QHRNLVRLLGF LE  E LLVYE +PN SLD F+F
Sbjct  61   QSSRQGLQEFKNEIVLVAKLQHRNLVRLLGFCLEEGEKLLVYELMPNKSLDYFMF  115


 Score =   139 bits (351),  Expect(2) = 2e-62, Method: Composition-based stats.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K + L W RRYKII  IARG++YL+EDS L +IH +LKASNVLLD  +N K++DF M
Sbjct  710  DPEKSKQLHWPRRYKIISGIARGMLYLHEDSRLRVIHRDLKASNVLLDNDMNSKISDFGM  769

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T+ STRRIVGT GYM PEY +H   S K +VY FG+L+
Sbjct  770  ARIFRVDQTNASTRRIVGTYGYMSPEYAMHGHFSQKSDVYSFGILL  815


 Score =   127 bits (320),  Expect(2) = 2e-62, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            +++++D+  +  ATNNFS  NK+GEGGFG +Y+G F +G+ +AVK+LS + + G +EFKN
Sbjct  607  KSLQFDWDILLAATNNFSQENKLGEGGFGEVYQGRFPNGQEIAVKKLSHSSRQGVEEFKN  666

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LE  E LLVYEF+PN SLD F+F
Sbjct  667  EIVLVAKLQHRNLVRLLGFCLEAGEKLLVYEFMPNKSLDYFVF  709



>ref|XP_003635308.1| PREDICTED: cysteine-rich receptor-like protein kinase 15 [Vitis 
vinifera]
Length=678

 Score =   139 bits (351),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   L+W +RYKII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF +
Sbjct  440  DPIKQTQLNWEKRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDAEMNPKISDFGI  499

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D+T ++T RI+GT GYM PEYVLH + S+K +VY  GVL+
Sbjct  500  ARLFAVDQTQENTSRIMGTYGYMAPEYVLHGKFSVKSDVYSLGVLI  545


 Score =   132 bits (332),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 86/123 (70%), Gaps = 0/123 (0%)
 Frame = +1

Query  37   MKGGRYRFLVSSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGR  216
            +K  R R    S EG +   E++++ F TI+ AT+NFSD NK+GEGGFG +YKG   DG+
Sbjct  317  LKKRRPRGQFLSFEGETRTLESLQFQFSTIRVATDNFSDANKLGEGGFGSVYKGRLSDGQ  376

Query  217  LVAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDN  396
             +AVKRLS   K G  EFKN+  LMAK QHRNLVRLLGF LE  E LL+YEF+PN SL  
Sbjct  377  EIAVKRLSAGSKQGELEFKNEVLLMAKLQHRNLVRLLGFCLERSERLLIYEFMPNLSLHG  436

Query  397  FLF  405
            F+F
Sbjct  437  FIF  439



>ref|XP_003555319.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Glycine max]
Length=658

 Score =   139 bits (351),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP     LDW  RYKII  I RGL+YL+EDS L +IH +LKASN+LLDE ++PK+ADF M
Sbjct  425  DPNMKAQLDWESRYKIIRGITRGLLYLHEDSRLRVIHRDLKASNILLDEEMHPKIADFGM  484

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF++D+TH +T RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  485  ARLFLVDQTHANTTRIVGTCGYMAPEYAMHGQFSVKSDVFSFGVLV  530


 Score =   132 bits (332),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F TIQ AT +FSD+NK+G+GGFG +Y+G   +G+++AVKRLS++   G  EFKN
Sbjct  322  ESLQFNFNTIQVATEDFSDSNKLGQGGFGAVYRGRLSNGQMIAVKRLSRDSGQGDTEFKN  381

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG E LLVYE+VPN SLD F+F
Sbjct  382  EVLLVAKLQHRNLVRLLGFCLEGNERLLVYEYVPNKSLDYFIF  424



>ref|XP_008224858.1| PREDICTED: cysteine-rich receptor-like protein kinase 10, partial 
[Prunus mume]
Length=424

 Score =   137 bits (345),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  ++PK++DF M
Sbjct  186  DPEKQGQLDWARRYKIIAGIARGIMYLHEDSRLRIIHRDLKASNILLDGEMHPKISDFGM  245

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T RIVGT GYM PEY +H + S+K ++Y FGVL+
Sbjct  246  ARIFGVDQTQANTSRIVGTYGYMSPEYAMHGQFSVKSDLYSFGVLL  291


 Score =   134 bits (338),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI  ATNNFSD NK+GEGGFG +YKG   +G+ VAVKRLS+N   G +EFKN
Sbjct  83   ESLQFDFSTIVAATNNFSDDNKLGEGGFGQVYKGILSNGQEVAVKRLSKNSGQGAEEFKN  142

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRL GF LEG+E +LVYE+V N SLD FLF
Sbjct  143  EMVLVAKLQHRNLVRLYGFCLEGEEKILVYEYVSNKSLDYFLF  185



>ref|XP_004232751.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Solanum 
lycopersicum]
Length=676

 Score =   140 bits (354),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D VK R LDW RR KII  IA+G++YL+EDS L IIH +LKASNVLLD  +NPK++DF M
Sbjct  429  DSVKRRQLDWERRSKIIGGIAKGILYLHEDSRLRIIHRDLKASNVLLDAEMNPKISDFGM  488

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T  ST RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  489  ARLFELDETQGSTNRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLV  534


 Score =   130 bits (328),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = +1

Query  67   SSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQN  246
            +S++  S AE + +Y F  I+ AT++FSD NK+GEGGFG +YKG  ++G+ VAVKRLS +
Sbjct  317  TSVDDTSIAE-SFQYAFSAIRAATDDFSDANKLGEGGFGPVYKGKLQNGQEVAVKRLSAD  375

Query  247  LKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
               G  EFKN+  L+AK QHRNLVRLLGF L+  E LLVYEFVPN SLD+FLF +  R
Sbjct  376  SGQGDLEFKNEVLLVAKLQHRNLVRLLGFCLDRTERLLVYEFVPNASLDHFLFDSVKR  433



>ref|XP_010686957.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Beta 
vulgaris subsp. vulgaris]
Length=669

 Score =   139 bits (350),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++YD  T+Q+ATNNFS+ NK+GEGGFG +YKG   +GR +AVKRLS N   G QEFKN
Sbjct  328  DSLQYDLTTLQSATNNFSEANKLGEGGFGGVYKGALPNGREIAVKRLSMNSSQGVQEFKN  387

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVR+ GF  EG+E LLVYE+VPN SLD  LF
Sbjct  388  EVVLVAKLQHRNLVRVFGFCFEGQEKLLVYEYVPNKSLDKILF  430


 Score =   132 bits (333),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPV    LDW  RYKII  IARG++YL+ DS L IIH +LK SNVLLD  +NPK+ADF M
Sbjct  431  DPVNQGLLDWATRYKIIGGIARGMLYLHHDSQLRIIHRDLKPSNVLLDGDMNPKIADFGM  490

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T R+VGT GYM PEY ++ + S K +VY FGVLV
Sbjct  491  ARIFGVDQTQGNTSRVVGTYGYMSPEYAMNGQFSNKSDVYSFGVLV  536



>ref|XP_002869784.1| hypothetical protein ARALYDRAFT_492546 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46043.1| hypothetical protein ARALYDRAFT_492546 [Arabidopsis lyrata subsp. 
lyrata]
Length=662

 Score =   143 bits (361),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  +ARG++YL++DS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  428  DPAKQSQLDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGM  487

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F LD+T ++T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  488  ARIFGLDQTQENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLV  533


 Score =   128 bits (321),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++ D+  IQ AT++F+++NKIG+GGFG +YKGT  DG  VAVKRLS+    G  EFKN
Sbjct  325  DSLQLDYRKIQTATDDFAESNKIGQGGFGEVYKGTLSDGTEVAVKRLSKLSGQGEAEFKN  384

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF L+G+E +LVYE+VPN SLD FLF
Sbjct  385  EVVLVAKLQHRNLVRLLGFCLDGEERVLVYEYVPNKSLDYFLF  427



>ref|XP_006283285.1| hypothetical protein CARUB_v10004321mg [Capsella rubella]
 gb|EOA16183.1| hypothetical protein CARUB_v10004321mg [Capsella rubella]
Length=660

 Score =   141 bits (356),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  +ARG++YL++DS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  424  DPAKQGQLDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGM  483

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F LD+T ++T RIVGT GYM PEY +H + S+K ++Y FGVLV
Sbjct  484  ARIFGLDQTEENTNRIVGTYGYMSPEYAMHGQYSMKSDIYSFGVLV  529


 Score =   130 bits (326),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++ D+ TIQ AT++F+ +NKIGEGGFG +YKG   DG  VAVKRLSQ+   G  EFKN
Sbjct  321  DSLQLDYRTIQTATDDFAVSNKIGEGGFGEVYKGILSDGTEVAVKRLSQSSGQGEAEFKN  380

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF L+G E +LVYE+VPN SLD FLF
Sbjct  381  EVVLVAKLQHRNLVRLLGFCLDGVERVLVYEYVPNKSLDYFLF  423



>ref|XP_002518554.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43941.1| ATP binding protein, putative [Ricinus communis]
Length=579

 Score =   139 bits (350),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  +N K++DF M
Sbjct  436  DPEKQAQLDWSRRYKIIGGIARGIVYLHEDSRLRIIHRDLKASNILLDRNMNSKISDFGM  495

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T RIVGT GYM PEY +H + S+K ++Y FG+LV
Sbjct  496  ARIFGVDQTQGNTSRIVGTYGYMSPEYAMHGQFSVKSDMYSFGILV  541


 Score =   132 bits (332),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++ D  TI+ ATN FS  NK+GEGGFG +YKGT  +G+ +AVK+LS++   G +EFKN
Sbjct  333  ESLQIDLNTIEVATNKFSADNKLGEGGFGEVYKGTLPNGQEIAVKKLSRSSGQGAEEFKN  392

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            + AL+AK QHRNLVRLLGF LEG E +LVYEFVPN SLD FLF
Sbjct  393  EVALLAKLQHRNLVRLLGFCLEGAEKILVYEFVPNKSLDYFLF  435



>ref|XP_004134968.1| PREDICTED: cysteine-rich receptor-like protein kinase 26-like 
[Cucumis sativus]
Length=1112

 Score =   140 bits (353),  Expect(2) = 9e-64, Method: Composition-based stats.
 Identities = 64/106 (60%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D  K   LDW +R+KII   ARGL+YL+EDS L IIH +LKASN+LLDE +NPK+ADF M
Sbjct  420  DFTKRTLLDWEKRFKIINGTARGLLYLHEDSRLRIIHRDLKASNILLDEEMNPKIADFGM  479

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D+T  +T RIVGT GYM PEY++H + SIK +++ FGVL+
Sbjct  480  ARLFEVDETQGNTSRIVGTYGYMAPEYLMHGQFSIKSDIFSFGVLI  525


 Score =   131 bits (329),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E +++DF TI+ ATN+FS  NK+G+GGFG +YKG   +G+ +AVKRL+ N + G  EFKN
Sbjct  317  ETIQFDFETIKIATNDFSSENKLGQGGFGAVYKGKLPNGQRIAVKRLANNSQQGDVEFKN  376

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSRT  423
            +  LM K QHRNLVRLLGF L+  E LL+YEFVPN SLD F+F    RT
Sbjct  377  EVLLMLKLQHRNLVRLLGFCLQRTERLLIYEFVPNASLDQFIFDFTKRT  425


 Score =   132 bits (333),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +1

Query  100   AVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKNK  279
              +++DF TI+ ATN+FSD NK+G+GGFG +Y G   +G+ +AVKRL+ N + G  EFKN+
Sbjct  959   TIQFDFDTIKIATNDFSDENKLGQGGFGAVYMGKLLNGQHIAVKRLAHNSQQGDVEFKNE  1018

Query  280   AALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
               L+ K QHRNLVRLLGF L+G+E LL+YEFVPNGSLD+F+F
Sbjct  1019  VLLVVKLQHRNLVRLLGFCLQGRERLLIYEFVPNGSLDHFIF  1060


 Score = 66.6 bits (161),  Expect(2) = 4e-42, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  494   KHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEG  634
             K R LDW +RYKII  +ARGL+YL+EDS L IIH +LKASN+LL  G
Sbjct  1064  KRRLLDWEKRYKIINGVARGLLYLHEDSRLRIIHRDLKASNILLQIG  1110



>ref|XP_004297920.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Fragaria vesca subsp. vesca]
Length=676

 Score =   136 bits (342),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 91/112 (81%), Gaps = 1/112 (1%)
 Frame = +1

Query  70   SLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNL  249
            SLE IS  E +++YDF  I++ATN+FSD NK+G+GGFG +YKG   +G+ +AVKRLS++ 
Sbjct  323  SLEDISLVE-SLQYDFEDIRSATNDFSDENKLGQGGFGAVYKGRLYNGQYIAVKRLSKSS  381

Query  250  KGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            + G +EFKN+  L+A+ QHRNLVR+LGF L+G+E LL+YE++PN SLD+F+F
Sbjct  382  EQGDREFKNEVMLVAQLQHRNLVRILGFCLKGEERLLIYEYIPNTSLDHFIF  433


 Score =   135 bits (340),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+ + +LDW  RYKII  I RGL+YL+EDS L IIH +LKASN+LLDE +NPK+ADF M
Sbjct  434  DPINYGYLDWETRYKIIGGIVRGLLYLHEDSRLRIIHRDLKASNILLDENMNPKIADFGM  493

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLFV+D+T   T+ IVGT GYM PEY      S+K +V+ FGVL+
Sbjct  494  ARLFVMDQTQGDTKTIVGTFGYMAPEYASQGRFSVKSDVFSFGVLL  539



>gb|KCW75004.1| hypothetical protein EUGRSUZ_E03766 [Eucalyptus grandis]
Length=666

 Score =   136 bits (342),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = +1

Query  67   SSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQN  246
            SS+  I+ AE +++YDF TIQ AT+NFS  NK+GEGGFG +++G   +G  +AVKRLSQ 
Sbjct  317  SSVNDIANAE-SLQYDFATIQAATDNFSHQNKLGEGGFGEVFQGRLNNGHQIAVKRLSQG  375

Query  247  LKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
               G  EFKN+  L+AK QHRNLVR+LGF LEG+E LLVYEFVPN SLD FLF
Sbjct  376  SGQGVGEFKNEVLLVAKLQHRNLVRMLGFCLEGEEKLLVYEFVPNKSLDYFLF  428


 Score =   135 bits (340),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K + LDW RRYKI+  IARG++YL+EDS L IIH +LKASN+LLD  + PK++DF M
Sbjct  429  DPEKSKQLDWSRRYKIVCGIARGMLYLHEDSRLRIIHRDLKASNILLDSEMIPKISDFGM  488

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+ V+D+T  +T +IVGT GYM PEY +H + S+K +VY FGVL+
Sbjct  489  ARIVVVDQTQANTNKIVGTFGYMSPEYAMHGQFSVKSDVYSFGVLL  534



>ref|XP_009136737.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich receptor-like protein 
kinase 10 [Brassica rapa]
Length=662

 Score =   139 bits (351),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW  RYKII  IARG++YL++DS L IIH +LKASN+ LD  +NPK+ DF M
Sbjct  426  DPAKESQLDWNHRYKIIGGIARGILYLHQDSRLTIIHRDLKASNIFLDADMNPKIVDFGM  485

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            A++F +D+T +STRRIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  486  AKIFGMDQTEESTRRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLV  531


 Score =   132 bits (331),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
            + ++++ D+  IQ ATN FS++N IG GGFG +YKGTF DG  VAVKRLS+    G   F
Sbjct  321  SADSLQLDYKMIQAATNGFSESNNIGRGGFGEVYKGTFPDGTDVAVKRLSKTSGQGETNF  380

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            KN+ A++AK QHRNLVRLLGF LEGKE +LVYE+VPN SLD FLF
Sbjct  381  KNEVAVVAKLQHRNLVRLLGFCLEGKERILVYEYVPNKSLDYFLF  425



>ref|XP_002518561.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43948.1| ATP binding protein, putative [Ricinus communis]
Length=630

 Score =   142 bits (357),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D  KH  LDW RRYKII  IARGL+YL+EDS + IIH +LK SN+LLD  +NPK+ADF M
Sbjct  415  DQTKHESLDWERRYKIICGIARGLLYLHEDSQIRIIHRDLKTSNILLDMDMNPKIADFGM  474

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLFV+D+T  +T RIVGT GYM PEY +H + SIK +V+ FGVL+
Sbjct  475  ARLFVIDQTQGNTSRIVGTYGYMAPEYAMHGQFSIKSDVFSFGVLL  520


 Score =   129 bits (325),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
            + E+ + DF T++ AT+NFS+ NK+G+GGFG +YKGT  +G+ +AVKRLS+N + G  EF
Sbjct  310  SPESFQLDFGTVRVATDNFSEENKLGQGGFGAVYKGTLYNGQDIAVKRLSKNSEQGDLEF  369

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            KN+  L+AK QHRNLVRLLGF LE  E LL+YEF+PN SLD+FLF
Sbjct  370  KNEILLVAKLQHRNLVRLLGFCLERNERLLIYEFMPNTSLDHFLF  414



>ref|XP_010054433.1| PREDICTED: cysteine-rich receptor-like protein kinase 26 [Eucalyptus 
grandis]
Length=634

 Score =   138 bits (347),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPV+ R LDW RR KII  IARGL+YL+EDS L IIH +LKASN+LLD  + PK++DF  
Sbjct  430  DPVRSRQLDWERRQKIIVGIARGLLYLHEDSQLRIIHRDLKASNILLDAEMTPKISDFGT  489

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLFV+D+T D+T R+VGT GYM PEY +H   S+K +V+ FGVL+
Sbjct  490  ARLFVVDQTRDATSRVVGTYGYMAPEYAMHGLFSVKTDVFSFGVLL  535


 Score =   133 bits (335),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++YD  TI+ AT++FS  NK+G+GGFG +YKGT  +G+ +AV+RLS +L  G QEFKN
Sbjct  327  ESMQYDLNTIRAATDDFSGANKLGQGGFGAVYKGTLANGQFIAVRRLSIDLGQGDQEFKN  386

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+A+ QHRNLVRLLGF LEG+E LL+Y+F PN SLD+F+F
Sbjct  387  EVLLVARLQHRNLVRLLGFCLEGRERLLIYDFEPNSSLDHFIF  429



>gb|KCW74371.1| hypothetical protein EUGRSUZ_E03051 [Eucalyptus grandis]
Length=627

 Score =   137 bits (344),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 87/115 (76%), Gaps = 1/115 (1%)
 Frame = +1

Query  61   LVSSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLS  240
            LV  +  IS AE ++++DF TI+ AT+NFSD+ K+G+GGFG +Y G   +G+ +AVKRLS
Sbjct  269  LVEGVHEISTAE-SLQFDFNTIRAATDNFSDSKKLGQGGFGAVYMGQLSNGQEIAVKRLS  327

Query  241  QNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            QN   G  EFKN+  L+A+ QHRNLVRLLGF LEG E LL+YEFVPN SLD F+F
Sbjct  328  QNSSQGEVEFKNEVMLLARLQHRNLVRLLGFCLEGVEQLLIYEFVPNASLDQFIF  382


 Score =   134 bits (337),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   L+W RR+ II  +ARG++YL+E+S L IIH +LKASN+LLD  +NPK++DF M
Sbjct  383  DPLKRANLNWDRRHNIIMGVARGMLYLHEESRLRIIHRDLKASNILLDSNMNPKISDFGM  442

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T   T RIVGT GYM PEY +H   SIK +V+ FGVLV
Sbjct  443  ARLFELDQTRAETNRIVGTYGYMAPEYAMHGTFSIKSDVFSFGVLV  488



>ref|XP_010052450.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Eucalyptus 
grandis]
Length=670

 Score =   137 bits (345),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++D   I+ ATN+FSD NK+G+GGFGV+YKGT  +G+++AVKR S +L  G QEFKN
Sbjct  327  ESLQFDLNIIREATNDFSDANKVGQGGFGVVYKGTLANGQVIAVKRPSVDLGQGNQEFKN  386

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSRT  423
            +  L+A+ QHRNLVRLLGF LE +E LL+YEFVPN SLD+FL+    R+
Sbjct  387  EVLLVARLQHRNLVRLLGFCLEERERLLIYEFVPNSSLDHFLYDPVRRS  435


 Score =   134 bits (336),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPV+   L W RR KII  IARGL+YL+EDS L IIH +LKA N+LLD  +NPK++DF  
Sbjct  430  DPVRRSQLGWQRRQKIIGGIARGLLYLHEDSQLRIIHRDLKAGNILLDAEMNPKISDFGT  489

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D+T D+T R+VGT GYM PEY +H   S+K +V+ FGVL+
Sbjct  490  ARLFAVDQTQDATSRVVGTYGYMAPEYAMHGLFSVKSDVFSFGVLL  535



>gb|KEH43963.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=671

 Score =   140 bits (353),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDW RRYKII  IARGL+YL+EDS L IIH +LKASN+LLDE LNPK++DF M
Sbjct  425  DPIKKAQLDWERRYKIIGGIARGLLYLHEDSQLRIIHRDLKASNILLDEKLNPKISDFGM  484

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL ++D+T  +T +IVGT GYM PEY +  E S+K +V+ FGVLV
Sbjct  485  ARLLLVDETQVNTNKIVGTYGYMAPEYAMFGEFSVKSDVFSFGVLV  530


 Score =   130 bits (328),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F T+Q AT+NFS+ NK+G GGFGV+Y G    G+++AVKRLS N   G  EFKN
Sbjct  322  ESLQFNFETLQVATSNFSEANKLGHGGFGVVYHGILAGGQVIAVKRLSTNSGQGDVEFKN  381

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E LLVYE+VPN SLD F+F
Sbjct  382  EVLLVAKLQHRNLVRLLGFCLEGRERLLVYEYVPNKSLDYFIF  424



>ref|XP_008224868.1| PREDICTED: LOW QUALITY PROTEIN: putative receptor-like protein 
kinase At4g00960 [Prunus mume]
Length=667

 Score =   136 bits (342),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP  H  LDW  RYKII  IARG++YL+EDS + IIH +LKASN+LLDE +NPK+ADF +
Sbjct  429  DPNNHEHLDWETRYKIIGGIARGILYLHEDSRVRIIHRDLKASNILLDEDMNPKIADFGL  488

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLFV+D+T   T+ + GT GYM PEYV+H   S+K +V+ FGVLV
Sbjct  489  ARLFVIDQTQGDTQTVRGTYGYMAPEYVIHGRFSVKTDVFSFGVLV  534


 Score =   134 bits (338),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = +1

Query  70   SLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNL  249
            +LE +S  E +++YDF TI++AT++FSD NK+G GGFG +YKG    G+ +AVKRLS+N 
Sbjct  318  NLEDVSLVE-SLQYDFETIRSATDDFSDANKLGRGGFGAVYKGRLLSGKPIAVKRLSKNS  376

Query  250  KGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            + G +EFKN+  L+A+ QHRNLVRLLGF L+  E LL+YE+VPN SLD+F+F
Sbjct  377  EQGDREFKNEVMLLAQLQHRNLVRLLGFCLKTDERLLIYEYVPNTSLDHFIF  428



>ref|XP_008370580.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich receptor-like protein 
kinase 10 [Malus domestica]
Length=661

 Score =   138 bits (347),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TIQ AT+NFS+ +K+GEGGFG +YKG F +G+ VAVKRLS++   G +EFKN
Sbjct  320  ESLQFDFATIQAATSNFSEDHKLGEGGFGQVYKGIFSNGQEVAVKRLSRDSGQGAEEFKN  379

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+VPN SLD FLF
Sbjct  380  EMVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVPNKSLDYFLF  422


 Score =   133 bits (334),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW  RYKII  IARG++YL+EDS L IIH +LKASN+LLD  ++PK++DF M
Sbjct  423  DPEKQGQLDWSIRYKIISGIARGIMYLHEDSRLKIIHRDLKASNILLDGEMHPKISDFGM  482

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T   T RIVGT GYM PEY +H   SIK ++Y FGVLV
Sbjct  483  ARIFGVDQTQADTNRIVGTFGYMSPEYAMHGHFSIKSDLYSFGVLV  528



>ref|XP_003637963.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=671

 Score =   140 bits (353),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDW RRYKII  IARGL+YL+EDS L IIH +LKASN+LLDE LNPK++DF M
Sbjct  425  DPIKKAQLDWERRYKIIGGIARGLLYLHEDSQLRIIHRDLKASNILLDEKLNPKISDFGM  484

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL ++D+T  +T +IVGT GYM PEY +  E S+K +V+ FGVLV
Sbjct  485  ARLLLVDETQVNTNKIVGTYGYMAPEYAMFGEFSVKSDVFSFGVLV  530


 Score =   130 bits (328),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F T+Q AT+NFS+ NK+G GGFGV+Y G    G+++AVKRLS N   G  EFKN
Sbjct  322  ESLQFNFETLQVATSNFSEANKLGHGGFGVVYHGILAGGQVIAVKRLSTNSGQGDVEFKN  381

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E LLVYE+VPN SLD F+F
Sbjct  382  EVLLVAKLQHRNLVRLLGFCLEGRERLLVYEYVPNKSLDYFIF  424



>gb|KHN01552.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=658

 Score =   138 bits (347),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   L+W  RYKII  +ARGL+YL+EDS L IIH +LKASN+LL+E +NPK+ADF M
Sbjct  415  DPTKKAQLNWEMRYKIITGVARGLLYLHEDSHLRIIHRDLKASNILLNEEMNPKIADFGM  474

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL ++D+T  +T+RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  475  ARLVLMDQTQANTKRIVGTYGYMAPEYAMHGQFSMKSDVFSFGVLV  520


 Score =   132 bits (333),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++++F TI+ AT +FSD+NK+G+GGFG +Y+G   DG+++AVKRLS+    G  EFKN
Sbjct  312  QSLQFNFDTIRVATEDFSDSNKLGQGGFGAVYRGRLSDGQMIAVKRLSRESSQGDTEFKN  371

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E LL+YE+VPN SLD F+F
Sbjct  372  EVLLVAKLQHRNLVRLLGFCLEGRERLLIYEYVPNKSLDYFIF  414



>ref|XP_010540946.1| PREDICTED: cysteine-rich receptor-like protein kinase 11 [Tarenaya 
hassleriana]
Length=653

 Score =   137 bits (344),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
            A  ++++DF TI+ ATN FS +N++G+GGFG +YKGT  +G +VAVKRLS+    G +EF
Sbjct  321  APHSLQFDFKTIEAATNQFSHSNRLGQGGFGDVYKGTLPNGSVVAVKRLSKTSGQGDREF  380

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            KN+  L+AK QHRNLVRLLGF LEG+E +LVYEFVPN SLD FLF
Sbjct  381  KNEVVLLAKLQHRNLVRLLGFCLEGEEKILVYEFVPNKSLDYFLF  425


 Score =   134 bits (337),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D  K   L+W RR++II  IARG++YL++DS L IIH +LKASNVLLD  LNPK+ADF M
Sbjct  426  DRTKQEQLNWTRRHRIIVGIARGILYLHQDSRLTIIHRDLKASNVLLDSDLNPKIADFGM  485

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D+T  +T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  486  ARLFGMDQTRANTSRIVGTYGYMSPEYAMHGQFSMKSDVYSFGVLV  531



>ref|XP_010558703.1| PREDICTED: cysteine-rich receptor-like protein kinase 26 [Tarenaya 
hassleriana]
Length=668

 Score =   137 bits (346),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = +1

Query  82   ISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGC  261
            I    +++ +DF TI++AT+NF+  NK+G+GGFG +YKG   DG+ VAVKRLS+N   G 
Sbjct  331  IIVTTDSLLFDFDTIRDATDNFAIRNKLGQGGFGPVYKGVLPDGQRVAVKRLSRNAGQGE  390

Query  262  QEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSRTCI  429
             EFKN+  L+AK QHRNLVRLLGFS +G E LLVYEFV N SLDNF+F    RTC+
Sbjct  391  TEFKNEVLLVAKLQHRNLVRLLGFSTQGTERLLVYEFVENASLDNFIFDPVKRTCL  446


 Score =   133 bits (335),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPVK   LDWG+R +II  IARGL+YL+EDS L IIH +LKASNVLLDE + PK+ADF M
Sbjct  439  DPVKRTCLDWGKRCRIIGGIARGLVYLHEDSRLRIIHRDLKASNVLLDEEMTPKIADFGM  498

Query  665  ARLFVLDK-THDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL  +D+ T   T RIVGT GYM PEY +H + S K +VY FGVLV
Sbjct  499  ARLLDIDQSTQRFTGRIVGTYGYMAPEYAMHGQFSFKTDVYSFGVLV  545



>gb|KCW76449.1| hypothetical protein EUGRSUZ_D00841 [Eucalyptus grandis]
Length=654

 Score =   137 bits (345),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = +1

Query  49   RYRFLVSSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAV  228
            R R L  + E      E++++D   I+ ATN+FSD NK+G+GGFGV+YKGT  +G+++AV
Sbjct  307  RSRRLKKNFENEIRNAESLQFDLNIIREATNDFSDANKVGQGGFGVVYKGTLANGQVIAV  366

Query  229  KRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFG  408
            KR S +L  G QEFKN+  L+A+ QHRNLVRLLGF LE +E LL+YEFVPN SLD+FL+ 
Sbjct  367  KRPSVDLGQGNQEFKNEVLLVARLQHRNLVRLLGFCLEERERLLIYEFVPNSSLDHFLYD  426

Query  409  NGSRT  423
               R+
Sbjct  427  PVRRS  431


 Score =   133 bits (335),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPV+   L W RR KII  IARGL+YL+EDS L IIH +LKA N+LLD  +NPK++DF  
Sbjct  426  DPVRRSQLGWQRRQKIIGGIARGLLYLHEDSQLRIIHRDLKAGNILLDAEMNPKISDFGT  485

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D+T D+T R+VGT GYM PEY +H   S+K +V+ FGVL+
Sbjct  486  ARLFAVDQTQDATSRVVGTYGYMAPEYAMHGLFSVKSDVFSFGVLL  531



>ref|XP_003638011.1| Cysteine-rich receptor-like protein kinase, partial [Medicago 
truncatula]
Length=552

 Score =   140 bits (353),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDW RRYKII  IARGL+YL+EDS L IIH +LKASN+LLDE LNPK++DF M
Sbjct  425  DPIKKAQLDWERRYKIIGGIARGLLYLHEDSQLRIIHRDLKASNILLDEKLNPKISDFGM  484

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL ++D+T  +T +IVGT GYM PEY +  E S+K +V+ FGVLV
Sbjct  485  ARLLLVDETQVNTNKIVGTYGYMAPEYAMFGEFSVKSDVFSFGVLV  530


 Score =   130 bits (327),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F T+Q AT+NFS+ NK+G GGFGV+Y G    G+++AVKRLS N   G  EFKN
Sbjct  322  ESLQFNFETLQVATSNFSEANKLGHGGFGVVYHGILAGGQVIAVKRLSTNSGQGDVEFKN  381

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E LLVYE+VPN SLD F+F
Sbjct  382  EVLLVAKLQHRNLVRLLGFCLEGRERLLVYEYVPNKSLDYFIF  424



>ref|XP_007211369.1| hypothetical protein PRUPE_ppa002516mg [Prunus persica]
 gb|EMJ12568.1| hypothetical protein PRUPE_ppa002516mg [Prunus persica]
Length=663

 Score =   136 bits (342),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKA N+LLD  ++PK++DF M
Sbjct  425  DPEKQGQLDWARRYKIIAGIARGIMYLHEDSRLRIIHRDLKAGNILLDREMHPKISDFGM  484

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T RIVGT GYM PEY +H + S+K ++Y FGVL+
Sbjct  485  ARIFGVDQTQANTSRIVGTYGYMSPEYAMHGQFSVKSDLYSFGVLL  530


 Score =   134 bits (338),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI  ATNNFSD NK+GEGGFG +YKG   +G+ VAVKRLS+N   G +EFKN
Sbjct  322  ESLQFDFSTIVAATNNFSDDNKLGEGGFGQVYKGILSNGQEVAVKRLSKNSGQGAEEFKN  381

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRL GF LEG+E +LVYE+V N SLD FLF
Sbjct  382  EMVLVAKLQHRNLVRLYGFCLEGEEKILVYEYVSNKSLDYFLF  424



>ref|XP_009598807.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Nicotiana tomentosiformis]
Length=675

 Score =   137 bits (344),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   L+W RRYKII  IARGL+YL+EDS L +IH +LKASN+LLD  +NPK++DF M
Sbjct  436  DPEKQHLLNWSRRYKIIGGIARGLLYLHEDSRLRVIHRDLKASNILLDADMNPKISDFGM  495

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D++ D T RIVGT GYM PEY +H + S+K +V+ FGVL+
Sbjct  496  ARIFGIDQSEDITNRIVGTYGYMSPEYAMHGQYSVKSDVFSFGVLL  541


 Score =   134 bits (337),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++Y    IQ AT NFS  NKIGEGGFGV+YKG   +G+ +AVKRLS++   G QEFKN
Sbjct  333  ESLQYQLTNIQAATTNFSADNKIGEGGFGVVYKGILPNGQEIAVKRLSRSSGQGAQEFKN  392

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLG+  E +E LLVYEFVPN SLD FLF
Sbjct  393  EIVLIAKLQHRNLVRLLGYCFEAEEKLLVYEFVPNKSLDYFLF  435



>ref|XP_008224765.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Prunus 
mume]
Length=679

 Score =   136 bits (343),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  ++PK++DF M
Sbjct  441  DPEKQGHLDWARRYKIIAGIARGIMYLHEDSQLRIIHRDLKASNILLDGEMHPKISDFGM  500

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T RIVGT GYM PEY +H + S+K ++Y FGVL+
Sbjct  501  ARIFGVDQTQANTSRIVGTYGYMAPEYAMHGQFSVKSDLYSFGVLL  546


 Score =   134 bits (337),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI  ATNNFSD NK+GEGGFG +YKG   +G+ VAVKRLS+N   G +EFKN
Sbjct  338  ESLQFDFSTIVAATNNFSDDNKLGEGGFGQVYKGILSNGQEVAVKRLSRNSGQGAEEFKN  397

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNL+RL GF LEG+E +LVYE+V N SLD FLF
Sbjct  398  EMVLVAKLQHRNLIRLYGFCLEGEEKILVYEYVSNKSLDYFLF  440



>ref|XP_010057277.1| PREDICTED: cysteine-rich receptor-like protein kinase 29 [Eucalyptus 
grandis]
Length=672

 Score =   136 bits (342),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 88/122 (72%), Gaps = 1/122 (1%)
 Frame = +1

Query  40   KGGRYRFLVSSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRL  219
            K  R    V  +  IS AE ++++DF TI+ AT+NFSD+ K+G+GGFG +Y G   +G+ 
Sbjct  307  KQPRQSVEVEGVHEISTAE-SLQFDFNTIRAATDNFSDSKKLGQGGFGAVYMGQLSNGQE  365

Query  220  VAVKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNF  399
            +AVKRLSQN   G  EFKN+  L+A+ QHRNLVRLLGF LEG E LL+YEFVPN SLD F
Sbjct  366  IAVKRLSQNSSQGEVEFKNEVMLLARLQHRNLVRLLGFCLEGVEQLLIYEFVPNASLDQF  425

Query  400  LF  405
            +F
Sbjct  426  IF  427


 Score =   134 bits (338),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   L+W RR+ II  +ARG++YL+E+S L IIH +LKASN+LLD  +NPK++DF M
Sbjct  428  DPLKRANLNWDRRHNIIMGVARGMLYLHEESRLRIIHRDLKASNILLDSNMNPKISDFGM  487

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T   T RIVGT GYM PEY +H   SIK +V+ FGVLV
Sbjct  488  ARLFELDQTRAETNRIVGTYGYMAPEYAMHGTFSIKSDVFSFGVLV  533



>gb|KHN01543.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=549

 Score =   135 bits (341),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDW RRYKII  IARGL+YL+EDS L IIH +LKAS++LLDE ++PK++DF M
Sbjct  305  DPIKKAQLDWQRRYKIIGGIARGLLYLHEDSRLRIIHRDLKASSILLDEEMHPKISDFGM  364

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL  +D+T ++T RIVGT GYM PEY ++ + S K +V+ FGVLV
Sbjct  365  ARLVHMDQTQENTSRIVGTYGYMAPEYAIYGQFSAKSDVFSFGVLV  410


 Score =   135 bits (339),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 85/108 (79%), Gaps = 1/108 (1%)
 Frame = +1

Query  82   ISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGC  261
            I+FAE ++++DF TI+ ATN F+D NKIG+GGFG +Y+G   +G+ +AVKRLS++   G 
Sbjct  198  ITFAE-SLQFDFDTIRVATNEFADCNKIGQGGFGAVYRGQLSNGQEIAVKRLSRDSGQGD  256

Query  262  QEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
             EFKN+  L+AK QHRNLVRLLGF LEG E LLVYEFVPN SLD F+F
Sbjct  257  MEFKNEVLLVAKLQHRNLVRLLGFCLEGTERLLVYEFVPNKSLDYFIF  304



>ref|XP_006287218.1| hypothetical protein CARUB_v10000395mg [Capsella rubella]
 gb|EOA20116.1| hypothetical protein CARUB_v10000395mg [Capsella rubella]
Length=669

 Score =   135 bits (341),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRY II  IARG++YL++DS L IIH +LKASN+LLD+ +NPK+ADF M
Sbjct  432  DPTKQPLLDWSRRYHIIGGIARGILYLHQDSRLKIIHRDLKASNILLDDDMNPKIADFGM  491

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +++T  +T +I GT GYM PEYV+H + S+K +VY FGVLV
Sbjct  492  ARIFGIEQTGANTSKIAGTFGYMAPEYVMHGQFSMKSDVYSFGVLV  537


 Score =   134 bits (338),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
            +  ++++DF T++ AT+ FS  NK+G+GGFG +YKGT  +G  VAVKRLS+N   G QEF
Sbjct  327  SPHSLQFDFKTLEAATDKFSVNNKVGQGGFGEVYKGTLPNGTEVAVKRLSKNSGQGSQEF  386

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            KN+  L+AK QHRNLVRLLGF LEG E +LVYEFVPN SLD FLF
Sbjct  387  KNEVVLVAKLQHRNLVRLLGFCLEGDEQILVYEFVPNKSLDYFLF  431



>ref|XP_006605286.1| PREDICTED: receptor-like protein kinase isoform X1 [Glycine max]
Length=675

 Score =   137 bits (344),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   L+W  RYKII  +ARGL+YL+EDS L IIH +LKASN+LL+E +NPK+ADF M
Sbjct  432  DPTKKAQLNWEMRYKIITGVARGLLYLHEDSHLRIIHRDLKASNILLNEEMNPKIADFGM  491

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL ++D+T  +T RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  492  ARLVLMDQTQANTNRIVGTYGYMAPEYAMHGQFSMKSDVFSFGVLV  537


 Score =   133 bits (335),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++++F TI+ AT +FSD+NK+G+GGFG +Y+G   DG+++AVKRLS+    G  EFKN
Sbjct  329  QSLQFNFDTIRVATEDFSDSNKLGQGGFGAVYRGRLSDGQMIAVKRLSRESSQGDTEFKN  388

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEGKE LL+YE+VPN SLD F+F
Sbjct  389  EVLLVAKLQHRNLVRLLGFCLEGKERLLIYEYVPNKSLDYFIF  431



>ref|XP_006383962.1| hypothetical protein POPTR_0004s02500g [Populus trichocarpa]
 gb|ERP61759.1| hypothetical protein POPTR_0004s02500g [Populus trichocarpa]
Length=673

 Score =   139 bits (351),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
             EE++++D  TI+ ATNNFS  NK+GEGGFG +YKGTF +G+ +AVKRLS+    G  EF
Sbjct  329  TEESLQFDLSTIEAATNNFSPDNKLGEGGFGEVYKGTFPNGQHIAVKRLSKYSGHGAAEF  388

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            KN+  L+AK QHRNLVRLLG+ LEG+E LL+YEFVPN SLD FLF
Sbjct  389  KNEIVLVAKLQHRNLVRLLGYCLEGEEKLLIYEFVPNKSLDYFLF  433


 Score =   131 bits (329),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW  RYKII  IARGL+YL+EDS L IIH +LKASNVLLD  +NP++ADF +
Sbjct  434  DPAKQGLLDWLSRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNVLLDGEMNPRIADFGV  493

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            A++F +D++   T RI GT GYM PEY +H + S+K +VY FGVL+
Sbjct  494  AKIFGVDQSQGITSRIAGTFGYMSPEYAMHGQYSVKSDVYSFGVLI  539



>gb|KHN01541.1| Cysteine-rich receptor-like protein kinase 25 [Glycine soja]
Length=543

 Score =   138 bits (347),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDW RRY II  IARG++YL+EDS L IIH +LKASN+LLDE +NPK++DF M
Sbjct  298  DPIKKAQLDWQRRYNIIGGIARGILYLHEDSRLRIIHRDLKASNILLDEEMNPKISDFGM  357

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL  +D+T  +T RIVGT GYM PEYVL+ + S K +V+ FGVLV
Sbjct  358  ARLVHMDETQGNTSRIVGTYGYMAPEYVLYGQFSAKSDVFSFGVLV  403


 Score =   132 bits (333),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 87/108 (81%), Gaps = 1/108 (1%)
 Frame = +1

Query  82   ISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGC  261
            I+FAE +++++F TI+ ATN F+D+NK+G+GGFG +Y+G   +G+ +AVKRLS++   G 
Sbjct  191  ITFAE-SLQFNFDTIRAATNEFADSNKLGQGGFGAVYRGQLSNGQEIAVKRLSRDSGQGN  249

Query  262  QEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
             EFKN+  L+AK QHRNLV+LLGF LEG+E LL+YEFVPN SLD F+F
Sbjct  250  MEFKNEVLLVAKLQHRNLVKLLGFCLEGRERLLIYEFVPNKSLDYFIF  297



>ref|XP_011076612.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Sesamum 
indicum]
Length=683

 Score =   138 bits (348),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+ H +LDW RR+KII  IARG++YL+EDS L IIH +LKASNVLLD  +NPK+ADF M
Sbjct  446  DPINHSYLDWERRHKIIGGIARGILYLHEDSRLRIIHRDLKASNVLLDGNMNPKIADFGM  505

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL   D+T  +T RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  506  ARLCGHDETQGNTNRIVGTYGYMAPEYAIHGQFSVKSDVFSFGVLV  551


 Score =   132 bits (332),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
              E++++ F TI++ATNNFSD NK+G+GGFG +YKG F +G+ +AVKRLS+N   G  EF
Sbjct  341  TPESLQFAFSTIRDATNNFSDNNKLGQGGFGTVYKGKFLNGQEIAVKRLSKNSGQGDLEF  400

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            KN+  L+A+ QHRNLV+LLGFSL+G+E LLVYEFV N SLD F+F
Sbjct  401  KNEVLLLARLQHRNLVKLLGFSLQGEEKLLVYEFVQNASLDLFIF  445



>ref|XP_010439218.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Camelina 
sativa]
Length=653

 Score =   137 bits (344),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++ ++ TIQ ATN FS++NKIG GGFG +YKGTF +G +VAVKRLS+    G  EFKN
Sbjct  314  DSLQLNYRTIQAATNGFSESNKIGRGGFGEVYKGTFSNGTVVAVKRLSKTSGQGEAEFKN  373

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  ++AK QHRNLVRLLGF LEG+E +LVYEFVPN SLDNFLF
Sbjct  374  EVVVVAKLQHRNLVRLLGFCLEGEERILVYEFVPNKSLDNFLF  416


 Score =   134 bits (336),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRY II  IARG++YL++DS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  417  DPSKQGELDWTRRYNIIGGIARGILYLHQDSQLTIIHRDLKASNILLDADMNPKIADFGM  476

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D++ ++T RIVGT GYM PEY +  + SIK +VY FGV V
Sbjct  477  ARIFGMDQSAENTNRIVGTYGYMAPEYAMQGQYSIKSDVYSFGVSV  522



>gb|KFK30805.1| hypothetical protein AALP_AA6G028200 [Arabis alpina]
Length=522

 Score =   138 bits (347),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRY II  IARG++YL++DS L IIH +LKASN+LLD  ++PK+ADF M
Sbjct  292  DPAKQGLLDWTRRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADMSPKIADFGM  351

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+TH++T RIVGT GYM PEY +  + S+K +VY FGVLV
Sbjct  352  ARIFGMDQTHENTNRIVGTYGYMSPEYAMRGQFSMKSDVYSFGVLV  397


 Score =   132 bits (333),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++ D+ TIQ ATN++S+ NKIG+GGFG +YKGTF +G  +AVKRLS++   G  EFKN
Sbjct  189  ESLQLDYRTIQAATNDYSENNKIGQGGFGEVYKGTFFNGIEIAVKRLSKSSGQGDIEFKN  248

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            + A++AK QHRNLVRLLGFSLE +E +LVYE+VPN SLD+FLF
Sbjct  249  EVAVVAKLQHRNLVRLLGFSLEREERILVYEYVPNRSLDHFLF  291



>ref|XP_006283286.1| hypothetical protein CARUB_v10004325mg [Capsella rubella]
 gb|EOA16184.1| hypothetical protein CARUB_v10004325mg [Capsella rubella]
Length=654

 Score =   135 bits (341),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++ D+ TIQ ATN FS++NKIG GGFG +YKGTF +G +VAVKRLS+    G  EFKN
Sbjct  315  DSLKLDYKTIQAATNGFSESNKIGRGGFGEVYKGTFSNGTVVAVKRLSKTSGQGEVEFKN  374

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  ++AK QHRNLVRLLGF LEG+E +LVYEFVPN SLD+FLF
Sbjct  375  EVVVVAKLQHRNLVRLLGFCLEGEERILVYEFVPNKSLDSFLF  417


 Score =   134 bits (338),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL++DS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  418  DPSKQGELDWTRRYKIIGGIARGILYLHQDSQLTIIHRDLKASNILLDADMNPKIADFGM  477

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D + ++T RIVGT GYM PEY +  + SIK +VY FGV V
Sbjct  478  ARIFGMDHSAENTNRIVGTYGYMAPEYAMQGQYSIKSDVYSFGVSV  523



>sp|Q8W4G6.2|CRK15_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase 15; 
Short=Cysteine-rich RLK15; Flags: Precursor [Arabidopsis thaliana]
Length=627

 Score =   142 bits (359),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYK+I  IARG++YL++DS L IIH +LKASN+LLD  +NPKLADF +
Sbjct  424  DPAKQNQLDWTRRYKVIGGIARGILYLHQDSRLTIIHRDLKASNILLDADMNPKLADFGL  483

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T ++T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  484  ARIFGMDQTQENTSRIVGTFGYMAPEYAIHGQFSVKSDVYSFGVLV  529


 Score =   127 bits (320),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +1

Query  67   SSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQN  246
             + +G     E+++ D+  I+ ATN FS+ NKIG+GGFG +YKGTF +G  VAVKRLS++
Sbjct  311  PAFDGDDITTESLQLDYRMIRAATNKFSENNKIGQGGFGEVYKGTFSNGTEVAVKRLSKS  370

Query  247  LKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
               G  EFKN+  ++AK QHRNLVRLLGFS+ G E +LVYE++PN SLD FLF
Sbjct  371  SGQGDTEFKNEVVVVAKLQHRNLVRLLGFSIGGGERILVYEYMPNKSLDYFLF  423



>ref|XP_011004253.1| PREDICTED: cysteine-rich receptor-like protein kinase 29 isoform 
X2 [Populus euphratica]
Length=665

 Score =   138 bits (347),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +2

Query  491  VKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDMAR  670
             +   LDW RRYKII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF MA+
Sbjct  422  TRRAQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDADMNPKISDFGMAK  481

Query  671  LFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            LFV+D+T  +T RIVGT GYM PEY +H + S+K +V+ FGVL+
Sbjct  482  LFVMDETQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLI  525


 Score =   132 bits (332),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  85   SFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQ  264
            +   E++++DF TI+ AT+NFS+ NK+G+GGFG +YKGT  +G+ VAVKRLS++   G  
Sbjct  315  TITPESLQFDFSTIRAATDNFSEENKLGQGGFGSVYKGTLSNGQEVAVKRLSKDSGQGDL  374

Query  265  EFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            EFKN+  L+AK QHRNLVRL GF L+G E LL+YEFVPN SLD+F+F
Sbjct  375  EFKNEVLLVAKLQHRNLVRLQGFCLQGIERLLIYEFVPNASLDHFVF  421



>ref|XP_010427119.1| PREDICTED: cysteine-rich receptor-like protein kinase 14 [Camelina 
sativa]
Length=663

 Score =   135 bits (339),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
               ++ +DF TI+ ATN FS++NKIG GGFG +YKG F DG  +AVKRLS+    G +EF
Sbjct  323  TSSSLRFDFKTIEAATNKFSESNKIGRGGFGEVYKGMFPDGTELAVKRLSKTSGQGDEEF  382

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            KN+A L+AK QHRNLVRLLGF +EG+E LL+YEFVPN SLD FLF
Sbjct  383  KNEAVLVAKLQHRNLVRLLGFCVEGEEKLLIYEFVPNKSLDYFLF  427


 Score =   135 bits (339),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW +R+KII  I RG++YL++DS L IIH +LKASNVLLD  +NPK+ADF M
Sbjct  428  DPTKQHQLDWDKRFKIIGGICRGILYLHQDSRLTIIHRDLKASNVLLDSDMNPKIADFGM  487

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +TRRIVGT GYM PEY +    S+K +VY FGVLV
Sbjct  488  ARIFRIDQTQANTRRIVGTYGYMPPEYAMRGHFSVKSDVYSFGVLV  533



>ref|NP_194054.2| cysteine-rich receptor-like protein kinase 15 [Arabidopsis thaliana]
 gb|AAL32647.1| putative protein [Arabidopsis thaliana]
 gb|AAM91196.1| putative protein [Arabidopsis thaliana]
 gb|AEE84726.1| cysteine-rich receptor-like protein kinase 15 [Arabidopsis thaliana]
Length=507

 Score =   142 bits (359),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYK+I  IARG++YL++DS L IIH +LKASN+LLD  +NPKLADF +
Sbjct  304  DPAKQNQLDWTRRYKVIGGIARGILYLHQDSRLTIIHRDLKASNILLDADMNPKLADFGL  363

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T ++T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  364  ARIFGMDQTQENTSRIVGTFGYMAPEYAIHGQFSVKSDVYSFGVLV  409


 Score =   127 bits (320),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +1

Query  67   SSLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQN  246
             + +G     E+++ D+  I+ ATN FS+ NKIG+GGFG +YKGTF +G  VAVKRLS++
Sbjct  191  PAFDGDDITTESLQLDYRMIRAATNKFSENNKIGQGGFGEVYKGTFSNGTEVAVKRLSKS  250

Query  247  LKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
               G  EFKN+  ++AK QHRNLVRLLGFS+ G E +LVYE++PN SLD FLF
Sbjct  251  SGQGDTEFKNEVVVVAKLQHRNLVRLLGFSIGGGERILVYEYMPNKSLDYFLF  303



>ref|XP_009598808.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 isoform 
X2 [Nicotiana tomentosiformis]
Length=540

 Score =   136 bits (343),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   L+W RRYKII  IARGL+YL+EDS L +IH +LKASN+LLD  +NPK++DF M
Sbjct  301  DPEKQHLLNWSRRYKIIGGIARGLLYLHEDSRLRVIHRDLKASNILLDADMNPKISDFGM  360

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D++ D T RIVGT GYM PEY +H + S+K +V+ FGVL+
Sbjct  361  ARIFGIDQSEDITNRIVGTYGYMSPEYAMHGQYSVKSDVFSFGVLL  406


 Score =   134 bits (336),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++Y    IQ AT NFS  NKIGEGGFGV+YKG   +G+ +AVKRLS++   G QEFKN
Sbjct  198  ESLQYQLTNIQAATTNFSADNKIGEGGFGVVYKGILPNGQEIAVKRLSRSSGQGAQEFKN  257

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLG+  E +E LLVYEFVPN SLD FLF
Sbjct  258  EIVLIAKLQHRNLVRLLGYCFEAEEKLLVYEFVPNKSLDYFLF  300



>gb|KFK22843.1| hypothetical protein AALP_AAs55098U000100, partial [Arabis alpina]
Length=1008

 Score =   137 bits (346),  Expect(2) = 2e-63, Method: Composition-based stats.
 Identities = 63/106 (59%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW  RY II  I RG++YL++DS L IIH ++KASN+LLD  +NPK+ADF M
Sbjct  658  DPTKKGQLDWTTRYNIIGGITRGILYLHQDSRLTIIHRDIKASNILLDSDMNPKIADFGM  717

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR F +D+T D+TRR+VGT GYM PEYV H + S K +VY FGVL+
Sbjct  718  ARNFRVDQTEDNTRRVVGTFGYMPPEYVTHGQFSTKSDVYSFGVLI  763


 Score =   132 bits (333),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
            + +++++DF TI+ AT+ FS  NK+G+GGFG +YKG   DG  +AVKRLS+N + G +EF
Sbjct  553  SSQSLQFDFATIEAATDKFSSENKLGQGGFGEVYKGKLPDGTEIAVKRLSRNSRQGSREF  612

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            K +  ++AK QH+NLVRLLGF LEG+E +LVYEFVPN SLD FLF
Sbjct  613  KTEVVIVAKLQHKNLVRLLGFCLEGEEQILVYEFVPNKSLDYFLF  657


 Score =   130 bits (327),  Expect(2) = 4e-44, Method: Composition-based stats.
 Identities = 61/106 (58%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDW RRY II  I RG++YL++DS L IIH ++KASN+LLD  +NPK+ADF M
Sbjct  297  DPIKKGQLDWTRRYNIIGGITRGMLYLHQDSRLTIIHRDIKASNILLDAEMNPKIADFGM  356

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR F   +T  +T R+VGT GYM PEYV H + S K +VY FGVL+
Sbjct  357  ARNFRDHQTETNTGRVVGTFGYMSPEYVSHGQFSTKSDVYSFGVLI  402


 Score = 75.9 bits (185),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  226  VKRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +K  S+    G  EFKN+  L+AK QHRNLVRLLGFSL+G+E +LVYEFVPN SL+ FLF
Sbjct  237  LKLQSRTSDQGEVEFKNEVLLVAKLQHRNLVRLLGFSLQGEEKILVYEFVPNKSLNYFLF  296



>ref|XP_010267893.1| PREDICTED: uncharacterized protein LOC104604997 [Nelumbo nucifera]
Length=1361

 Score =   137 bits (344),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F  +  ATNNFSD NKIG+GGFG +YKG   +G+ +AVKRLS++ + G +EFKN
Sbjct  299  ESLQFNFSIVIAATNNFSDDNKIGQGGFGCVYKGILSNGQEIAVKRLSRSSRQGAEEFKN  358

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSRTCI  429
            +A L+AK QHRNLVRLLGF LEG+E +L+YEFVPN SLD  LF      C+
Sbjct  359  EAVLVAKLQHRNLVRLLGFCLEGEEKILIYEFVPNKSLDYLLFDPDGSECL  409


 Score =   133 bits (334),  Expect(2) = 2e-63, Method: Composition-based stats.
 Identities = 61/106 (58%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP     LDW  RYKII  IARGL+YL+EDS L IIH +LKASN+LLD  ++PK++DF M
Sbjct  402  DPDGSECLDWPTRYKIIVGIARGLLYLHEDSQLRIIHRDLKASNILLDGNMDPKISDFGM  461

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+   +T R+VGT GYM PEYV+  + S+K +VY FGVL+
Sbjct  462  ARIFCVDQNQANTNRVVGTFGYMSPEYVMRGQFSVKSDVYSFGVLL  507


 Score =   134 bits (337),  Expect(2) = 3e-62, Method: Composition-based stats.
 Identities = 63/106 (59%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485   DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
             DP +   LDW  RYKII  IARGL+YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  1122  DPDEGARLDWPTRYKIIGGIARGLLYLHEDSRLKIIHRDLKASNILLDGNMNPKISDFGM  1181

Query  665   ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
             AR+F +D+T  +T R+VGT GYM PEYV+H   S+K +V+ FGVL+
Sbjct  1182  ARIFGVDQTQANTSRVVGTFGYMPPEYVIHGLFSVKSDVFSFGVLL  1227


 Score =   132 bits (332),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97    EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
             E+++++  T+  ATNNFSD NKIG+GGFG +YKG   +G+ +AVKRLS++   G +EFKN
Sbjct  1019  ESLQFNLSTVIAATNNFSDDNKIGQGGFGCVYKGKLSNGQEIAVKRLSRSSGQGAKEFKN  1078

Query  277   KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
             +  L+AK +HRNLVRLLGF LEG+E +L+YEFVPN SLD FLF
Sbjct  1079  EVVLVAKLEHRNLVRLLGFCLEGEEKILIYEFVPNKSLDYFLF  1121



>ref|XP_010057674.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Eucalyptus 
grandis]
 gb|KCW74849.1| hypothetical protein EUGRSUZ_E03586 [Eucalyptus grandis]
Length=671

 Score =   137 bits (344),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   L+W RR+KII  +ARG++YL+EDS L IIH +LKASN+LLD  +NPK++DF M
Sbjct  427  DPLKRANLNWDRRHKIIMGVARGMLYLHEDSRLRIIHRDLKASNILLDSDMNPKISDFGM  486

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T   T R+VGT GYM PEY +H   S+K +V+ FGVLV
Sbjct  487  ARLFELDQTQAETNRVVGTYGYMAPEYAMHGNFSVKSDVFSFGVLV  532


 Score =   133 bits (334),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TI+ AT+NFSD+ K+G+GGFG +Y G   +G+ +AVKRLSQN   G  EFKN
Sbjct  324  ESLQFDFGTIRAATDNFSDSKKLGQGGFGAVYLGRLSNGQEIAVKRLSQNSGQGEVEFKN  383

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+A+ QHRNLVRLLGF LEG E LL+YEFVPN SLD F+F
Sbjct  384  EVMLLARLQHRNLVRLLGFCLEGVERLLIYEFVPNSSLDQFIF  426



>ref|XP_007025926.1| Cysteine-rich RLK 29, putative isoform 2, partial [Theobroma 
cacao]
 gb|EOY28548.1| Cysteine-rich RLK 29, putative isoform 2, partial [Theobroma 
cacao]
Length=545

 Score =   136 bits (342),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF T++ ATNNFSD NK+G+GGFG +YKG  ++G+ VAVKRLS +   G  EFKN
Sbjct  316  ESLQFDFATVRVATNNFSDANKLGQGGFGAVYKGLLQNGQEVAVKRLSTDSGQGEVEFKN  375

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSRT  423
            +  L+AK  HRNLVRLLGF LEG+E LL+YEFVPN SLD+F+F    R 
Sbjct  376  EVLLVAKLHHRNLVRLLGFCLEGRERLLIYEFVPNTSLDHFIFDQVKRA  424


 Score =   134 bits (336),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D VK   LDW RRYKII+ IARGL+YL+EDS L IIH +LKASN+LLD  + PK+ADF M
Sbjct  419  DQVKRAQLDWERRYKIIKGIARGLLYLHEDSRLRIIHRDLKASNILLDTDMIPKIADFGM  478

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF  D++  +T RIVGT GYM PEYV++ + S+K +V+ FGVL+
Sbjct  479  ARLFGQDESQANTSRIVGTYGYMAPEYVINGQFSVKSDVFSFGVLL  524



>ref|XP_009762725.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich receptor-like protein 
kinase 10, partial [Nicotiana sylvestris]
Length=404

 Score =   137 bits (346),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K + L+W RRYKII  IARGL+YL+EDS L +IH +LKASN+LLD  +NPK++DF M
Sbjct  165  DPEKQQLLNWSRRYKIIGGIARGLLYLHEDSRLRVIHRDLKASNILLDADMNPKISDFGM  224

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D++ + T RIVGT GYM PEY +H + S+K +V+ FGVL+
Sbjct  225  ARIFEIDQSEEITNRIVGTYGYMSPEYAMHGQYSVKSDVFSFGVLL  270


 Score =   132 bits (332),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++Y   +IQ AT NFS  N+IGEGGFGV+YKG   +G+ +A KRLS++   G QEFKN
Sbjct  62   ESLQYQLTSIQVATTNFSADNEIGEGGFGVVYKGILPNGQEIAXKRLSRSSGQGAQEFKN  121

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLG+  EG+E LLVYEFVPN SLD FLF
Sbjct  122  EIVLIAKLQHRNLVRLLGYCFEGEEKLLVYEFVPNKSLDYFLF  164



>ref|XP_010089688.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
 gb|EXB38211.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
Length=679

 Score =   136 bits (343),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARGL+YL+EDS L +IH +LKASN+LLD+ ++PK++DF M
Sbjct  434  DPSKRANLDWERRYKIIGGIARGLLYLHEDSRLRVIHRDLKASNILLDKEMHPKISDFGM  493

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLFV+D+T  +T RIVGT GYM PEY +H   S++ +V+ FGVL+
Sbjct  494  ARLFVVDQTQGNTNRIVGTYGYMAPEYAMHGHFSVRTDVFSFGVLL  539


 Score =   133 bits (335),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++Y F T + AT+NFS+ NK+G+GGFG +Y+G   +G+ +AVKRLS+N   G  EFKN
Sbjct  331  ESLQYSFETTRVATDNFSEANKLGQGGFGSVYRGKLPNGQDIAVKRLSRNSNQGDLEFKN  390

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            +  L+AK QHRNLVRLLGF LEG E LLVYEFVPN SLD+F+F    R
Sbjct  391  EVLLVAKLQHRNLVRLLGFCLEGSERLLVYEFVPNASLDHFIFDPSKR  438



>emb|CDX98619.1| BnaA03g44040D [Brassica napus]
Length=520

 Score =   140 bits (352),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   L W RRYKIIE I RG++YL++DS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  289  DPTKKGQLYWTRRYKIIEGIVRGMLYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGM  348

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T ++T RIVGT GYM PEYV+H + S+K +VY FGVLV
Sbjct  349  ARIFGMDQTQENTNRIVGTYGYMSPEYVIHGQFSMKSDVYSFGVLV  394


 Score =   129 bits (325),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++ D+ TIQ ATN++S+ NKIG+GGFG +YKGTF +G  VAVKRLS++   G  EFKN
Sbjct  186  DSLQLDYRTIQAATNDYSENNKIGQGGFGEVYKGTFLNGTEVAVKRLSKSSGQGETEFKN  245

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  ++AK QHRNLVRL+GFSLE +E +LVYE+VPN SLD FLF
Sbjct  246  EVVVVAKLQHRNLVRLMGFSLEREERILVYEYVPNKSLDYFLF  288



>ref|XP_008355788.1| PREDICTED: cysteine-rich receptor-like protein kinase 8 [Malus 
domestica]
Length=383

 Score =   135 bits (339),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DPV    L+W  RYKII  I+RGL+YL+EDS L IIH +LK SN+LLDE +NPK+ADF M
Sbjct  147  DPVNXGXLNWETRYKIIGGISRGLLYLHEDSRLRIIHRDLKPSNILLDEDMNPKIADFGM  206

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF +D+T   T+ IVGT GYM PEY +H   S+K +V+ FGVLV
Sbjct  207  ARLFTMDQTQGDTKTIVGTYGYMAPEYAIHGRFSVKSDVFSFGVLV  252


 Score =   134 bits (338),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++YDF TI++AT++FSD NK+G+GGFG +YKG   +GR +AVKRLS+N + G +EFK 
Sbjct  3    ESLQYDFETIKSATDDFSDANKLGQGGFGAVYKGRLPNGRXIAVKRLSKNSEQGDREFKT  62

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFG  408
            +  L+A+ QHRNLVRLLGF L+  E +L+YE+VPN SL++F+FG
Sbjct  63   EVTLVAQLQHRNLVRLLGFCLKAGERILIYEYVPNTSLNHFIFG  106



>ref|XP_010316622.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X2 [Solanum lycopersicum]
Length=605

 Score =   137 bits (344),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K + L+W +R KII  +A+G++YL+EDS L IIH +LKASNVLLD  +NPK++DF M
Sbjct  358  DPDKRKQLNWEKRSKIIGGVAKGILYLHEDSRLRIIHRDLKASNVLLDAEMNPKISDFGM  417

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T  ST RIVGT GYM PEY +H + S+K +V+ FGVLV
Sbjct  418  ARLFTLDETQGSTTRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLV  463


 Score =   132 bits (333),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 86/124 (69%), Gaps = 1/124 (1%)
 Frame = +1

Query  52   YRFLVS-SLEGISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAV  228
            YRF    +++  S   E+++YD  TI+ AT+NFS +NK+GEGGFG +YKG   +G+ VAV
Sbjct  239  YRFFKQVAVQSHSPPPESLQYDLSTIRAATDNFSSSNKLGEGGFGPVYKGVLSNGQEVAV  298

Query  229  KRLSQNLKGGCQEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFG  408
            KRLS +   G  EFKN+  L+A+ QHRNLVRL GF  +G E LLVYEFVPN SLD FLF 
Sbjct  299  KRLSVDSGQGDLEFKNEVLLVARLQHRNLVRLQGFCFDGTERLLVYEFVPNASLDQFLFD  358

Query  409  NGSR  420
               R
Sbjct  359  PDKR  362



>ref|XP_010456867.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
35 [Camelina sativa]
Length=584

 Score =   135 bits (339),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
            +  +V++ F TIQ+AT+NF ++N IG+GGFG +YKGT  DG  VAVKRLS+    G QEF
Sbjct  309  STHSVQFSFKTIQDATDNFEESNMIGQGGFGEVYKGTLLDGTEVAVKRLSKTSGQGTQEF  368

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            KN+A L+ K QHRNLVRLLGF LEG+E +LVYEFVPN SLD FL 
Sbjct  369  KNEAVLVTKLQHRNLVRLLGFCLEGEEKILVYEFVPNKSLDYFLL  413


 Score =   134 bits (338),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW  RY II  IARG++YL++DS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  414  DPEKQGELDWRIRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGM  473

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D++  STRRIVGT GYM PEY +H   S+K +VY FG+L+
Sbjct  474  ARIFGVDQSQASTRRIVGTYGYMSPEYAMHGHFSMKSDVYSFGILI  519



>ref|XP_006606898.1| PREDICTED: cysteine-rich receptor-like protein kinase 26-like 
[Glycine max]
Length=657

 Score =   137 bits (345),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDW RRY II  IARG++YL+EDS L IIH +LKASN+LLDE +NPK++DF M
Sbjct  412  DPIKKAQLDWQRRYNIIGGIARGILYLHEDSRLRIIHRDLKASNILLDEEMNPKISDFGM  471

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL  +D+T  +T RIVGT GYM PEYVL+ + S K +V+ FGVLV
Sbjct  472  ARLVHMDETQGNTSRIVGTYGYMAPEYVLYGQFSAKSDVFSFGVLV  517


 Score =   132 bits (332),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 87/108 (81%), Gaps = 1/108 (1%)
 Frame = +1

Query  82   ISFAEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGC  261
            I+FAE +++++F TI+ ATN F+D+NK+G+GGFG +Y+G   +G+ +AVKRLS++   G 
Sbjct  305  ITFAE-SLQFNFDTIRAATNEFADSNKLGQGGFGAVYRGQLSNGQEIAVKRLSRDSGQGN  363

Query  262  QEFKNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
             EFKN+  L+AK QHRNLV+LLGF LEG+E LL+YEFVPN SLD F+F
Sbjct  364  MEFKNEVLLVAKLQHRNLVKLLGFCLEGRERLLIYEFVPNKSLDYFIF  411



>ref|XP_010316618.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Solanum 
lycopersicum]
Length=671

 Score =   137 bits (344),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D VK   LDW RR KII  IARG++YL+EDS L IIH +LKA NVLLD  +NPK+ADF M
Sbjct  434  DQVKRSQLDWERRSKIIGGIARGIVYLHEDSRLRIIHRDLKAGNVLLDAEMNPKIADFGM  493

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF LD+T  +T RIVGT GYM PEY +  + S+K +VY FGVLV
Sbjct  494  ARLFTLDETQGNTNRIVGTYGYMAPEYAMQGQFSVKSDVYSFGVLV  539


 Score =   132 bits (333),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++YDF  I+ AT NFS+ NK+G+GGFG +YKG  ++G+ VAVKRLS +   G  EFKN
Sbjct  331  ESLQYDFSIIREATENFSNANKLGQGGFGPVYKGKLQNGQEVAVKRLSADSGQGDLEFKN  390

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSRT  423
            +  L+A+ QHRNLVRLLGF L+G E LLVYEFVPN SLD FLF    R+
Sbjct  391  EVLLVARLQHRNLVRLLGFCLDGTERLLVYEFVPNASLDQFLFDQVKRS  439



>emb|CDY10846.1| BnaC01g14610D [Brassica napus]
Length=664

 Score =   139 bits (350),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW  RYKII  IARG++YL++DS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  428  DPAKESQLDWNHRYKIIGGIARGILYLHQDSRLTIIHRDLKASNILLDTDMNPKVADFGM  487

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T ++TRRIVGT GYM PEY +  + S+K +VY FGVLV
Sbjct  488  ARIFGMDQTEENTRRIVGTYGYMSPEYAMRGQYSMKSDVYSFGVLV  533


 Score =   130 bits (326),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
            + ++++ D+  IQ ATN FS++N IG GGFG +YKGTF +G  VAVKRLS+    G   F
Sbjct  323  SADSLQLDYKMIQAATNGFSESNNIGRGGFGEVYKGTFTNGTEVAVKRLSKTSGQGETNF  382

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            KN+ A++AK QHRNLVRLLGF LEGKE +LVYE+VPN SLD FLF
Sbjct  383  KNEVAVVAKLQHRNLVRLLGFCLEGKERILVYEYVPNKSLDYFLF  427



>gb|KHN23189.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=821

 Score =   139 bits (349),  Expect(2) = 4e-63, Method: Composition-based stats.
 Identities = 62/106 (58%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            D      LDW +RYKII   ARG++YL++DS L +IH +LKASN+LLDE +NPK+ADF +
Sbjct  576  DQTNRAQLDWEKRYKIIAGTARGILYLHQDSRLRVIHRDLKASNILLDEDMNPKIADFGL  635

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLFV+D+TH  T R+VGT GYM PEY +H + S K +V+ FGVLV
Sbjct  636  ARLFVVDQTHADTNRVVGTYGYMAPEYAMHGQFSEKSDVFSFGVLV  681


 Score =   130 bits (328),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++ F TI+ ATN+FSD+NK+G+GGFG +YKG   +G+ +AVKRLS++   G +EFKN
Sbjct  473  ESLQFSFNTIREATNDFSDSNKLGQGGFGAVYKGRLINGQEIAVKRLSRDSGQGEREFKN  532

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLFGNGSR  420
            +  L+AK QHRNLVRLLGF LEG+E LLVYEFV N SLD F+F   +R
Sbjct  533  EVLLVAKLQHRNLVRLLGFCLEGRERLLVYEFVTNKSLDYFIFDQTNR  580



>ref|XP_010448757.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Camelina sativa]
Length=653

 Score =   135 bits (340),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++ ++ TIQ ATN FS++NKIG GGFG +YKGTF +G +VAVKRLS+    G  EFKN
Sbjct  314  DSLQLNYRTIQAATNGFSESNKIGRGGFGEVYKGTFSNGIVVAVKRLSKTSGQGEAEFKN  373

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  ++AK QHRNLVRLLGF LEG+E +LVYEFVPN SLDNFLF
Sbjct  374  EVVVVAKLQHRNLVRLLGFCLEGEERILVYEFVPNKSLDNFLF  416


 Score =   134 bits (336),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRY II  IARG++YL++DS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  417  DPSKQGELDWTRRYNIIGGIARGILYLHQDSQLTIIHRDLKASNILLDADMNPKIADFGM  476

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D++ ++T RIVGT GYM PEY +  + SIK +VY FGV V
Sbjct  477  ARIFGMDQSAENTNRIVGTYGYMAPEYAMQGQYSIKSDVYSFGVSV  522



>ref|XP_010448756.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Camelina sativa]
Length=654

 Score =   135 bits (340),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++ ++ TIQ ATN FS++NKIG GGFG +YKGTF +G +VAVKRLS+    G  EFKN
Sbjct  315  DSLQLNYRTIQAATNGFSESNKIGRGGFGEVYKGTFSNGIVVAVKRLSKTSGQGEAEFKN  374

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  ++AK QHRNLVRLLGF LEG+E +LVYEFVPN SLDNFLF
Sbjct  375  EVVVVAKLQHRNLVRLLGFCLEGEERILVYEFVPNKSLDNFLF  417


 Score =   134 bits (336),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRY II  IARG++YL++DS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  418  DPSKQGELDWTRRYNIIGGIARGILYLHQDSQLTIIHRDLKASNILLDADMNPKIADFGM  477

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D++ ++T RIVGT GYM PEY +  + SIK +VY FGV V
Sbjct  478  ARIFGMDQSAENTNRIVGTYGYMAPEYAMQGQYSIKSDVYSFGVSV  523



>ref|XP_008363779.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=678

 Score =   136 bits (343),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  IARG++YL+EDS L IIH +LKASN+LLD  ++PK++DF M
Sbjct  440  DPEKQGQLDWSRRYKIISGIARGIMYLHEDSRLRIIHRDLKASNILLDGEMHPKISDFGM  499

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T   T RIVGT GYM PEY +H   S+K ++Y FGVLV
Sbjct  500  ARIFGVDQTQADTNRIVGTFGYMSPEYAMHGHFSVKSDMYSFGVLV  545


 Score =   133 bits (334),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF TIQ AT+NFSD +K+GEGGFG +YKG   +G+ VAVKRLS++   G +EFKN
Sbjct  337  ESLQFDFATIQAATSNFSDDHKLGEGGFGQVYKGILSNGQEVAVKRLSRDSGQGTEEFKN  396

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+V N SLD FLF
Sbjct  397  EMVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVLNKSLDYFLF  439



>ref|XP_003556014.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
isoform 2 [Glycine max]
Length=666

 Score =   142 bits (357),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K + LDW RRYKI+E IARG+ YL+EDS L IIH +LKASNVLLD  +NPK++DF M
Sbjct  428  DPEKQKSLDWTRRYKIVEGIARGIQYLHEDSRLKIIHRDLKASNVLLDGDMNPKISDFGM  487

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F +D+T  +T RIVGT GYM PEY +H E S K +VY FGVL+
Sbjct  488  ARIFGVDQTQANTNRIVGTYGYMSPEYAMHGEYSAKSDVYSFGVLI  533


 Score =   127 bits (319),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +1

Query  91   AEEAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEF  270
            A E++ +DF TI+ AT+ FSD NK+GEGGFG +YKG    G+ VAVKRLS+N   G  EF
Sbjct  323  AVESLRFDFSTIEAATDKFSDANKLGEGGFGEVYKGLLPSGQEVAVKRLSKNSGQGGTEF  382

Query  271  KNKAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            KN+  ++AK QH+NLVRLLGF LEG+E +LVYEFV N SLD  LF
Sbjct  383  KNEVEVVAKLQHKNLVRLLGFCLEGEEKILVYEFVANKSLDYILF  427



>emb|CAN72253.1| hypothetical protein VITISV_034184 [Vitis vinifera]
Length=655

 Score =   135 bits (340),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +2

Query  473  CSHADPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLA  652
            C   DP K   LDW RRY II  IARG++YL+EDS L +IH +LKASNVLLD  +NPK++
Sbjct  412  CFLFDPDKQGQLDWSRRYMIIGGIARGILYLHEDSRLRVIHRDLKASNVLLDGDMNPKIS  471

Query  653  DFDMARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            DF MAR+F +D+T  +T R+VGT GYM PEY +H   S K +VY FGVLV
Sbjct  472  DFGMARIFGVDQTQGNTNRVVGTYGYMSPEYAMHGHFSAKSDVYSFGVLV  521


 Score =   134 bits (336),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            +++++DF T+Q ATNNFSD NKIG+GGFG +YK T   G+ +A+KRLS++   G  EFKN
Sbjct  313  QSLQFDFGTLQAATNNFSDDNKIGQGGFGDVYKVTLSSGQEIAIKRLSRSSVQGAVEFKN  372

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E +LVYE+VPN SLD FLF
Sbjct  373  EIVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVPNKSLDCFLF  415



>ref|XP_007143161.1| hypothetical protein PHAVU_007G049000g [Phaseolus vulgaris]
 gb|ESW15155.1| hypothetical protein PHAVU_007G049000g [Phaseolus vulgaris]
Length=685

 Score =   138 bits (347),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP     LDWG+R+KII  IARGL+YL+EDS L IIH +LKA N+LLDE +NPK+ADF  
Sbjct  440  DPAMKAQLDWGKRFKIITGIARGLLYLHEDSQLRIIHRDLKAGNILLDEEMNPKIADFGT  499

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL ++D+T  +T RIVGT GYM PEY LH + S+K +V+ FGVL+
Sbjct  500  ARLVLMDQTQVNTNRIVGTYGYMAPEYALHGQFSVKSDVFSFGVLI  545


 Score =   131 bits (329),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F TI+ AT +FSD+NK+G+GGFG +Y G   +G+++AVKRLS+N   G  EFKN
Sbjct  337  ESLQFNFDTIRVATEDFSDSNKLGQGGFGAVYWGRLSNGQIIAVKRLSRNSGQGDTEFKN  396

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+ K QHRNLVRLLGF LEG+E LL+YEFVPN SLD F+F
Sbjct  397  EVVLVVKLQHRNLVRLLGFCLEGRERLLIYEFVPNKSLDYFIF  439



>ref|XP_007143162.1| hypothetical protein PHAVU_007G049100g [Phaseolus vulgaris]
 gb|ESW15156.1| hypothetical protein PHAVU_007G049100g [Phaseolus vulgaris]
Length=673

 Score =   136 bits (342),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP     LDW +RYKII  IARGL+YL+EDS L IIH +LKASN+LLD+ +NPK+ADF M
Sbjct  428  DPAMKAQLDWEKRYKIIRGIARGLLYLHEDSQLRIIHRDLKASNILLDQEMNPKIADFGM  487

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARL ++D+T  +T RIVGT GYM PEY +    S+K +V+ FGVL+
Sbjct  488  ARLVLMDQTQANTSRIVGTYGYMAPEYAMQGHFSVKSDVFSFGVLI  533


 Score =   133 bits (334),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E+++++F TI+ AT +FSD+NK+G+GGFG +Y+G   +G ++AVKRLS+N   G  EFKN
Sbjct  325  ESLQFNFDTIRVATADFSDSNKLGQGGFGAVYRGKLPNGEIIAVKRLSRNSGQGDTEFKN  384

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+ K QHRNLVRLLGF LEG+E LLVYEFVPN SLD F+F
Sbjct  385  EVVLVVKLQHRNLVRLLGFCLEGRERLLVYEFVPNKSLDYFIF  427



>ref|XP_010448753.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Camelina 
sativa]
Length=656

 Score =   142 bits (357),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP K   LDW RRYKII  +ARG++YL++DS L IIH +LKASN+LLD  +NPK+ADF M
Sbjct  422  DPEKQGQLDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGM  481

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            AR+F LD+T ++T RIVGT GYM PEY +H + S+K +VY FGVLV
Sbjct  482  ARIFGLDQTEENTNRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLV  527


 Score =   127 bits (319),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            ++++ D+  IQ AT++F+ +NKIG+GGFG +YKGT  DG  VAVKRLS++   G  EFKN
Sbjct  319  DSLQLDYRKIQTATDDFAASNKIGQGGFGEVYKGTLTDGTEVAVKRLSKSSGQGEVEFKN  378

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF L+G+E +LVYE+VPN SLD FLF
Sbjct  379  EVVLVAKLQHRNLVRLLGFCLDGEERVLVYEYVPNKSLDYFLF  421



>ref|XP_007025922.1| Cysteine-rich RLK 29, putative isoform 1 [Theobroma cacao]
 gb|EOY28544.1| Cysteine-rich RLK 29, putative isoform 1 [Theobroma cacao]
Length=689

 Score =   136 bits (342),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  97   EAVEYDFITIQNATNNFSDTNKIGEGGFGVMYKGTFEDGRLVAVKRLSQNLKGGCQEFKN  276
            E++++DF ++ +ATNNFSD NK+G+GGFG +YKG   +G+ +AVKRLS++   G  EFKN
Sbjct  341  ESLQFDFASVLDATNNFSDANKLGQGGFGAVYKGQLPNGQKIAVKRLSRDSGQGDLEFKN  400

Query  277  KAALMAKFQHRNLVRLLGFSLEGKEVLLVYEFVPNGSLDNFLF  405
            +  L+AK QHRNLVRLLGF LEG+E LL+YEFVPN SLD+F+F
Sbjct  401  EVLLVAKLQHRNLVRLLGFCLEGQERLLIYEFVPNRSLDHFIF  443


 Score =   133 bits (334),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  485  DPVKHRWLDWGRRYKIIECIARGLIYLNEDSCLHIIHYNLKASNVLLDEGLNPKLADFDM  664
            DP+K   LDW  RYKII  IARGL+YL+EDS L IIH +LKASN+LLD  + PK+ADF M
Sbjct  444  DPIKRAQLDWETRYKIIAGIARGLLYLHEDSRLRIIHRDLKASNILLDTDMIPKIADFGM  503

Query  665  ARLFVLDKTHDSTRRIVGTSGYMRPEYVLHDEISIKPNVYGFGVLV  802
            ARLF  D++  +T RIVGT GYM PEYV++ + S+K +V+ FGVL+
Sbjct  504  ARLFGQDESQANTSRIVGTYGYMAPEYVINGQFSVKSDVFSFGVLL  549



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1487544256264