BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25509_g3_i1 len=873 path=[3136:0-98 5690:99-872]

Length=873
                                                                      Score     E

ref|XP_007046438.1|  Uncharacterized protein TCM_000023               98.2    2e-21   
emb|CDP01750.1|  unnamed protein product                              95.9    1e-20   
ref|XP_002528523.1|  conserved hypothetical protein                   94.4    3e-20   Ricinus communis
ref|XP_006370753.1|  hypothetical protein POPTR_0001s46090g           88.6    4e-18   
ref|XP_007203185.1|  hypothetical protein PRUPE_ppa025168mg           77.4    4e-14   
gb|KDO71601.1|  hypothetical protein CISIN_1g043132mg                 77.0    6e-14   
gb|EYU30910.1|  hypothetical protein MIMGU_mgv1a021709mg              75.5    2e-13   
gb|KCW56466.1|  hypothetical protein EUGRSUZ_I02199                   75.1    3e-13   
gb|EYU30912.1|  hypothetical protein MIMGU_mgv1a023162mg              73.2    1e-12   
ref|XP_003629053.1|  hypothetical protein MTR_8g072610                72.4    2e-12   
gb|KCW53312.1|  hypothetical protein EUGRSUZ_J02566                   73.6    2e-12   
ref|XP_002317632.1|  hypothetical protein POPTR_0011s14830g           69.7    2e-11   Populus trichocarpa [western balsam poplar]
ref|XP_003631927.1|  PREDICTED: uncharacterized protein LOC100854263  65.1    8e-10   
gb|KHN03125.1|  hypothetical protein glysoja_040209                   64.3    2e-09   
gb|KHN38849.1|  hypothetical protein glysoja_014841                   63.9    3e-09   
ref|XP_003572871.1|  PREDICTED: uncharacterized protein LOC100842353  63.5    5e-09   
ref|XP_007156267.1|  hypothetical protein PHAVU_003G272000g           62.0    1e-08   
gb|KGN55589.1|  hypothetical protein Csa_3G000130                     59.7    6e-08   
ref|XP_003612425.1|  hypothetical protein MTR_5g024910                57.4    7e-07   
gb|EMT31165.1|  hypothetical protein F775_31563                       56.2    2e-06   
dbj|BAD07785.1|  hypothetical protein                                 55.1    5e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009417286.1|  PREDICTED: uncharacterized protein LOC103997706  52.4    3e-05   
ref|XP_004953670.1|  PREDICTED: uncharacterized protein LOC101776254  52.0    5e-05   
ref|XP_002454397.1|  hypothetical protein SORBIDRAFT_04g030060        50.1    5e-04   Sorghum bicolor [broomcorn]
ref|XP_007158040.1|  hypothetical protein PHAVU_002G119100g           48.9    5e-04   
ref|NP_001144487.1|  uncharacterized protein LOC100277464             48.1    9e-04   Zea mays [maize]
gb|AFW73084.1|  hypothetical protein ZEAMMB73_962020                  48.1    0.001   



>ref|XP_007046438.1| Uncharacterized protein TCM_000023 [Theobroma cacao]
 gb|EOX90595.1| Uncharacterized protein TCM_000023 [Theobroma cacao]
Length=146

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 82/143 (57%), Gaps = 25/143 (17%)
 Frame = +2

Query  227  YTRVQKPCTAGGGGYYKGFRLNSRRFSVHRLRAKFFHLFRLLSRLKSLYARAVRALMKRS  406
            Y RV + C   G    KGFRLN RRFSV  LRA+FF+LFRLLSR ++ Y RA+R + K  
Sbjct  7    YNRVGRRCQGSGN---KGFRLNPRRFSVQGLRARFFYLFRLLSRWRTSYGRALRLIKK--  61

Query  407  IGGKVGG-----------------RNLGITREINYALYGNNGGGELRLKSSFSRSNSFYA  535
            +G  +G                  R L   +E+   L  +      RL+ S  RSNSFY+
Sbjct  62   LGINIGNSSIKRDNSSGRVSSSSSRTLVTPKELQLPLPNST---TTRLRPSLGRSNSFYS  118

Query  536  EAIADCLDFIHRNSLSMEERPVL  604
            EAIADCL+FI R+SLS+++R  L
Sbjct  119  EAIADCLEFIKRSSLSVDQRQPL  141



>emb|CDP01750.1| unnamed protein product [Coffea canephora]
Length=142

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 72/114 (63%), Gaps = 5/114 (4%)
 Frame = +2

Query  275  KGFRLNSRRFSVHRLRAKFFHLFRLLSRLKSLYARAVRALMKRSIGGKVGGRNLGITRE-  451
            +GFR+N RRFSV RLR KF +L +L ++ +  Y  A+R++ K         RN G  R+ 
Sbjct  27   RGFRINPRRFSVQRLRTKFLYLLKLFNKWRFSYGNALRSMRKNLTRNSSCKRNSGSGRKS  86

Query  452  ---INYALYGNNGGGELRLKSSFSRSNSFYAEAIADCLDFIHRNSLSMEERPVL  604
               +    Y    G   RL+S ++R+NSFY+EAIADCLDFI RNSLSM+E PV+
Sbjct  87   LVVMKEVPYTYTMGDSSRLRS-YARTNSFYSEAIADCLDFIKRNSLSMDENPVI  139



>ref|XP_002528523.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33835.1| conserved hypothetical protein [Ricinus communis]
Length=127

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 80/121 (66%), Gaps = 14/121 (12%)
 Frame = +2

Query  257  GGGGYYKGFRLNSRRFSVHRLRAKFFHLFRLLSRLKSLYARAVRAL---MKRSIGGKVGG  427
            G GG  +GFRLN +RFSV RLRA+F +LF+LLSR KS Y  AV++L   M RS G K   
Sbjct  18   GYGG--RGFRLNCKRFSVQRLRARFVYLFKLLSRWKSSYGHAVQSLKRSMSRSSGIK---  72

Query  428  RNLGITREINYALYGNNGGGELRLKSSFSRSNSFYAEAIADCLDFIHRNSLSMEERPVLI  607
            RN    R +   +       + R++ +F RSNSFY+EAIADCL+FI R+S+S+E++ V  
Sbjct  73   RNTSSRRSLVVEV-----SSDCRMR-TFGRSNSFYSEAIADCLEFIKRSSISVEQKQVCP  126

Query  608  R  610
            R
Sbjct  127  R  127



>ref|XP_006370753.1| hypothetical protein POPTR_0001s46090g, partial [Populus trichocarpa]
 gb|ERP67322.1| hypothetical protein POPTR_0001s46090g, partial [Populus trichocarpa]
Length=141

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 75/122 (61%), Gaps = 6/122 (5%)
 Frame = +2

Query  260  GGGYYKGFRLN-SRRFSVHRLRAKFFHLFRLLSRLKSLYARAVRALMKRSIGGKVGGRNL  436
            G    +GFRL   RRFSV R RA+FF LFR LSR +S Y +AV+ L KR +G   G +  
Sbjct  21   GASCTRGFRLKYPRRFSVQRFRARFFCLFRFLSRWRSSYGQAVQYL-KRGMGRDSGIKRC  79

Query  437  GITREI----NYALYGNNGGGELRLKSSFSRSNSFYAEAIADCLDFIHRNSLSMEERPVL  604
            G ++ +      + +    G E     SF RSNSFY+EAIADCL+FI R+S+S+E++ V 
Sbjct  80   GSSKRVLVMDATSCHYMEKGDEHYSCRSFGRSNSFYSEAIADCLEFIKRSSISVEQKQVS  139

Query  605  IR  610
             R
Sbjct  140  PR  141



>ref|XP_007203185.1| hypothetical protein PRUPE_ppa025168mg [Prunus persica]
 gb|EMJ04384.1| hypothetical protein PRUPE_ppa025168mg [Prunus persica]
Length=146

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 76/132 (58%), Gaps = 19/132 (14%)
 Frame = +2

Query  251  TAGGGGYYKGFRLNSRRFSVHRL-RAKFFHLFRLLSRLKSLYARAVRAL---MKRSIGGK  418
              G G   +GFRLN RRFSV RL RA+F  LFR L   +  Y +A+++L   M RS    
Sbjct  16   AVGNGRGSRGFRLNPRRFSVSRLLRARFVCLFRFL---RCSYGQALQSLKKGMSRSSRPS  72

Query  419  VGG------RNLGITREINYA-LYGNNGGGE----LRLKSSFSRSNSFYAEAIADCLDFI  565
             G       RN   +R I     + N    E     RL+S F+RSNSFYAEAIADCL+FI
Sbjct  73   AGSGPSNIKRNNSSSRRILVTETHQNKARSEPADYCRLRS-FARSNSFYAEAIADCLEFI  131

Query  566  HRNSLSMEERPV  601
             R+S+S+++ PV
Sbjct  132  KRSSISLDQNPV  143



>gb|KDO71601.1| hypothetical protein CISIN_1g043132mg [Citrus sinensis]
Length=153

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 75/125 (60%), Gaps = 16/125 (13%)
 Frame = +2

Query  275  KGFRLN---SRRFSVHRLRAKFFHLFRLLSRLKSLYARAVRALM--KRSIGGKVGGRNLG  439
            KGFR+N   ++RFSV  LRA+F +LFRLLSR +  Y RA+++L+  K+  G  V  +   
Sbjct  27   KGFRVNVSKTKRFSVQGLRARFVYLFRLLSRWRFSYGRALKSLILSKKEKGIFVNIKRNN  86

Query  440  ITREINYALYGNNGGGE----------LRLKSSFSRSNSFYAEAIADCLDFIHRNS-LSM  586
             + + N     N+   +           R   SF RSNSFYAEAIADCL+FI R+S LS+
Sbjct  87   SSSKRNLVPNVNSMSSQGHEYHQPSVGCRSMRSFGRSNSFYAEAIADCLEFIKRSSTLSV  146

Query  587  EERPV  601
            +++P 
Sbjct  147  DQKPA  151



>gb|EYU30910.1| hypothetical protein MIMGU_mgv1a021709mg [Erythranthe guttata]
Length=139

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 67/117 (57%), Gaps = 4/117 (3%)
 Frame = +2

Query  278  GFRLNSRRFSVHRLRAKFFHLFRLLSRLKSLYARAVRALMKRSIGGKVGGR--NLGITRE  451
            G +LN RRF V RLR  F ++ R+L R K+ Y   VR L+ R++G +   R  ++     
Sbjct  23   GIKLNPRRFCVQRLRTNFMNIVRVLRRWKNYYKNGVRKLITRNLGTRKKERIDDVEFVYY  82

Query  452  INYALYGNNGGGELRLKSSFSRSNSFYAEAIADCLDFIHRNSLSMEE--RPVLIRQN  616
              Y    NN     R  +    SNSF +EAIADCL+FI RNS+S+++   P+LI+ N
Sbjct  83   NYYYYSKNNNNNNKRRVAIMEHSNSFSSEAIADCLEFIKRNSVSVDDDTNPMLIQHN  139



>gb|KCW56466.1| hypothetical protein EUGRSUZ_I02199 [Eucalyptus grandis]
Length=162

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 72/133 (54%), Gaps = 30/133 (23%)
 Frame = +2

Query  281  FRLNSRRFSVHRLRAKFFHLFRLLSRLKSLYARAVRALMKRSIGGKVGGRNL--------  436
            F+++SRRFSV RLRAKF  L R LSR +  Y RA+RAL KRSI  +    +         
Sbjct  28   FKVSSRRFSVQRLRAKFACLVRALSRWRCRYGRALRAL-KRSICCRESSADSTCSSVSSS  86

Query  437  ----------------GITREINYALYGNNGGGELRLKSSFSRSNSFYAEAIADCLDFIH  568
                            G      Y  YG+      +++ SF+RSNS Y+EAIADCL+FI 
Sbjct  87   SSCLRRSSSSRRNLVKGDASRCTY-YYGSGVSESCKVR-SFARSNSVYSEAIADCLEFIK  144

Query  569  RNSLSMEE---RP  598
            R+S+S++E   RP
Sbjct  145  RSSVSVDEYRDRP  157



>gb|EYU30912.1| hypothetical protein MIMGU_mgv1a023162mg [Erythranthe guttata]
Length=137

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 65/115 (57%), Gaps = 4/115 (3%)
 Frame = +2

Query  278  GFRLNSRRFSVHRLRAKFFHLFRLLSRLKSLYARAVRALMKRSIGGKVGGR--NLGITRE  451
            G +LN RRF V RLR  F ++ R+L R K+ Y   VR L+ R++G +   R  ++     
Sbjct  22   GIKLNPRRFCVQRLRTNFMNIVRVLRRWKNYYKNGVRKLITRNLGTRKKERIDDVEFVNY  81

Query  452  INYALYGNNGGGELRLKSSFSRSNSFYAEAIADCLDFIHRNSLSMEE--RPVLIR  610
              Y    NN     R       SNSF +EAIADCL+FI RNS+S+++   P+LI+
Sbjct  82   YYYYSSNNNNNNNKRRVPIMEHSNSFSSEAIADCLEFIKRNSVSVDDDTNPMLIQ  136



>ref|XP_003629053.1| hypothetical protein MTR_8g072610 [Medicago truncatula]
 gb|AET03529.1| hypothetical protein MTR_8g072610 [Medicago truncatula]
Length=125

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 64/115 (56%), Gaps = 6/115 (5%)
 Frame = +2

Query  260  GGGYYKGFRLNSRRFSVHRLRAKFFHLFRLLSRLKSLYARAVRALMK---RSIGGKVGGR  430
              G  KGFRLN R+F V RLR +F    RL + LK  Y  A++ L K   R IG K   R
Sbjct  10   SNGSNKGFRLNPRKFYVLRLRKRFNFFLRLFNNLKLSYGDALQMLKKVFCRKIGFK---R  66

Query  431  NLGITREINYALYGNNGGGELRLKSSFSRSNSFYAEAIADCLDFIHRNSLSMEER  595
            N    R +             +++SS+ RSNSFYAEAI DCL+FI R S+S +++
Sbjct  67   NNSSRRSLVRDEEVKGHDDYWKMRSSYGRSNSFYAEAIEDCLEFIKRTSISSKDQ  121



>gb|KCW53312.1| hypothetical protein EUGRSUZ_J02566 [Eucalyptus grandis]
Length=169

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 68/124 (55%), Gaps = 23/124 (19%)
 Frame = +2

Query  275  KGFRLNSRRFSVHRLRAKFFHLFRLLSRLKSLYARAVRAL------------------MK  400
            +GFR+N RR SV RLR +F  LFR+LSR +  Y +A++ L                  +K
Sbjct  35   RGFRINPRRLSVKRLRVRFASLFRVLSRCRFSYGQALKLLKSSCFFCRSRSRGWGGGGIK  94

Query  401  RSIGGKVGGRNLGITREINYALYGNNGGGELRLKSSFSRSNSFYAEAIADCLDFIHRNSL  580
            RS     G R   +   +       + G +LR    +SRSNSFY+EAIADCL+FI R S+
Sbjct  95   RSPSN--GSRRNLVVAHVKAEPGRADYGSKLRC---YSRSNSFYSEAIADCLEFIKRTSV  149

Query  581  SMEE  592
            S+++
Sbjct  150  SLDQ  153



>ref|XP_002317632.1| hypothetical protein POPTR_0011s14830g [Populus trichocarpa]
 gb|EEE98244.1| hypothetical protein POPTR_0011s14830g [Populus trichocarpa]
Length=129

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 71/135 (53%), Gaps = 18/135 (13%)
 Frame = +2

Query  227  YTRV-QKPCTAGGGGYYKGFRLN-SRRFSVHRLRAKFFHLFRLLSRLKSLYARAVRALMK  400
            YTRV ++     G    +GFRL   RRFSV RLRA          R +S Y RAV+ L +
Sbjct  6    YTRVGKRSHHRHGASCTRGFRLKYPRRFSVQRLRA----------RWRSSYGRAVQYLKR  55

Query  401  -----RSIGGKVGGRNLGITREINYALYGNNGGGELRLKSSFSRSNSFYAEAIADCLDFI  565
                  SI  + G    G   +     Y      + R +S F RSNSFY+EAIADCL+FI
Sbjct  56   GVNRNSSIIERCGSNERGFMMDATSCHYMGKVDDQYRFRS-FGRSNSFYSEAIADCLEFI  114

Query  566  HRNSLSMEERPVLIR  610
             R+S+S+E++ V  R
Sbjct  115  KRSSISVEQKQVSPR  129



>ref|XP_003631927.1| PREDICTED: uncharacterized protein LOC100854263 [Vitis vinifera]
Length=125

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 68/123 (55%), Gaps = 16/123 (13%)
 Frame = +2

Query  227  YTRVQKPCTAGGGGYYKGFRLNSRRFSVH-RLRAKFFHLFRLLSRLKSLYARAVRALMKR  403
            Y RV +    GG    +GFRLN +RFSV  R+R +  +LFRL         +AV +L KR
Sbjct  8    YKRVGRRSWHGG----RGFRLNPKRFSVLIRVRVRLMYLFRLC-------GQAVESL-KR  55

Query  404  SIGGKVGGRNLGITREINYALYGNNGGGELRLKSSFSRSNSFYAEAIADCLDFIHRNSLS  583
             I      +    +     +L   +G    R   SF R+NSFY+EAIADCL+FI R+SLS
Sbjct  56   GISRSRSTKKGSDSSRSRMSLMMESGDCRFR---SFGRTNSFYSEAIADCLEFIKRSSLS  112

Query  584  MEE  592
            +++
Sbjct  113  VDD  115



>gb|KHN03125.1| hypothetical protein glysoja_040209 [Glycine soja]
Length=145

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = +2

Query  227  YTRVQKPCTAGGGGY--YKGFRLNSRRFSVHRLRAKFFHLFRLLSRLKSLYARAVRALMK  400
            Y +V    ++G       +GFRLN R+F V RLR +F    RL    K  Y  A++ L+K
Sbjct  6    YNKVSTSTSSGKASSRCSRGFRLNPRKFYVLRLRKRFNFFLRLFDSWKLSYGEAIQ-LLK  64

Query  401  RSIGGKVG---------GRNLGITREINYALYGNNGGGELRLKSSFSRSNSFYAEAIADC  553
            + +  K G          R+L  +RE       ++   ++R   S  RSNSFYAEAIADC
Sbjct  65   KMVCRKSGLKRNNSNNSTRSLVRSRE---EKIKDHEDCKMR---SCGRSNSFYAEAIADC  118

Query  554  LDFIHRNSLS  583
            L+FI R S+S
Sbjct  119  LEFIKRTSIS  128



>gb|KHN38849.1| hypothetical protein glysoja_014841 [Glycine soja]
Length=141

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 63/125 (50%), Gaps = 4/125 (3%)
 Frame = +2

Query  218  RTCYTRVQKPCTAGGGGY--YKGFRLNSRRFSVHRLRAKFFHLFRLLSRLKSLYARAVRA  391
            R  Y +V    ++G       +GFRLN R+  V RLR +F     L    K  Y  A++ 
Sbjct  3    RMSYNKVSTSTSSGKASSRCSRGFRLNPRKLYVLRLRKRFNFFLGLFDSWKLSYGEAIQ-  61

Query  392  LMKRSIGGKVG-GRNLGITREINYALYGNNGGGELRLKSSFSRSNSFYAEAIADCLDFIH  568
            L+K+ +  K G  RN       ++       G +     SF RSNSFYAEAIADCL+FI 
Sbjct  62   LLKKVVCRKSGLKRNNSNNSTRSFVREEKIKGQDDCKMRSFGRSNSFYAEAIADCLEFIK  121

Query  569  RNSLS  583
            R S+S
Sbjct  122  RTSIS  126



>ref|XP_003572871.1| PREDICTED: uncharacterized protein LOC100842353 [Brachypodium 
distachyon]
Length=148

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 54/100 (54%), Gaps = 4/100 (4%)
 Frame = +2

Query  293  SRRFSVHRLRAKFFHLFRLLSRLKSLYARAVRALMKRSIGGKVGGRNLGITREINYALYG  472
            S RFSV RLRAK      L+ R   L A  +     R+  G    R L  T     A   
Sbjct  31   SNRFSVRRLRAKLVAFLGLVGRSARLLATRLGRRCART--GSSSTRELVATAPTPAA--N  86

Query  473  NNGGGELRLKSSFSRSNSFYAEAIADCLDFIHRNSLSMEE  592
            ++ G   R  +SF R+NSFYA+AIADCL+FI RNS+ +E+
Sbjct  87   SSKGAPRRAAASFMRTNSFYAQAIADCLEFIKRNSVPVED  126



>ref|XP_007156267.1| hypothetical protein PHAVU_003G272000g [Phaseolus vulgaris]
 gb|ESW28261.1| hypothetical protein PHAVU_003G272000g [Phaseolus vulgaris]
Length=125

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 61/128 (48%), Gaps = 18/128 (14%)
 Frame = +2

Query  227  YTRVQKPCTAGGGGYYKGFRLNSRRFSVHRLRAKFFHLFRLLSRLKSLYARAVRALMKRS  406
            Y+RV     +G     +GFRLN R+  V RLR +F    R+    K  Y  A++ L    
Sbjct  6    YSRV----CSGNASRCRGFRLNPRKLYVLRLRKRFNFFLRVFQSCKLSYGEAIQVL----  57

Query  407  IGGKVGGRNLGITREINYALYGNNGGGELRLKSSFSRSNSFYAEAIADCLDFIHR---NS  577
               KV  R  G  R        NN   E     S  RSNSFYAEAIADCL+FI R   +S
Sbjct  58   --KKVFCRKGGFKRN-----NTNNLVREDCKMGSCGRSNSFYAEAIADCLEFIKRTSTSS  110

Query  578  LSMEERPV  601
            +   + P+
Sbjct  111  MDQSQDPI  118



>gb|KGN55589.1| hypothetical protein Csa_3G000130 [Cucumis sativus]
Length=112

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 53/101 (52%), Gaps = 20/101 (20%)
 Frame = +2

Query  275  KGFRLNSRRFSVHRLRAKFFHLFRLLSRLKSLYARAVRALMKRSIGGKVGGRNLGITREI  454
            +GFRL SRR SV +LR+KF  L R+L+R             +RSI        + I +  
Sbjct  18   RGFRLTSRRLSVSKLRSKFGWLLRILNR------------WRRSI--------VEIKKSG  57

Query  455  NYALYGNNGGGELRLKSSFSRSNSFYAEAIADCLDFIHRNS  577
              +   +N   +     SF RSNSFYAEAIADCLDFI   S
Sbjct  58   TSSKGSSNSAAQAAKLRSFRRSNSFYAEAIADCLDFIKTTS  98



>ref|XP_003612425.1| hypothetical protein MTR_5g024910 [Medicago truncatula]
 gb|AES95383.1| hypothetical protein MTR_5g024910 [Medicago truncatula]
Length=149

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 63/119 (53%), Gaps = 7/119 (6%)
 Frame = +2

Query  266  GYYKGFRLNSRRFSVHRLRAKFFHLFRLLSRLKSLYARAVRALMKRSIGGKVGGRNLGIT  445
            G  +GFRLN  R    RLR +     R+  +LK  + +  + L+K+    K G +     
Sbjct  25   GKCRGFRLNLTRLYFSRLRKRVNFFLRIFDKLKLSHVQGFQ-LLKKVFCRKSGFKRNNSN  83

Query  446  REINYALYGN--NGGGELRLKSSFSRSNSFYAEAIADCLDFIHRNSLSMEER---PVLI  607
               N  +      G G+ R  SS+ R+NSFYAEAIADCL+FI R S+S  ++   P+++
Sbjct  84   SSRNGLMKDERIKGQGDCRF-SSYGRNNSFYAEAIADCLEFIKRTSISSMDQIQDPIVV  141



>gb|EMT31165.1| hypothetical protein F775_31563 [Aegilops tauschii]
Length=155

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 56/114 (49%), Gaps = 26/114 (23%)
 Frame = +2

Query  299  RFSVHRLRAKFFHLFRLLSRLKSLYARAVRALMKRSIGGKVGGRNLGITREINYALYGNN  478
            RFSV RLRAK      L+ R    +AR +   + R  GG         T      L G N
Sbjct  37   RFSVRRLRAKLLTFIGLVGR----HARHLARRISRRGGGSCPWSGSART------LVGGN  86

Query  479  G-------GGELRLK---------SSFSRSNSFYAEAIADCLDFIHRNSLSMEE  592
            G       GGE   K         +SF R+NSFYA+AIA+CL+FI RNS+ +E+
Sbjct  87   GSQRWCPPGGEAAAKKQQQAPRRAASFMRTNSFYAQAIAECLEFIKRNSVPVED  140



>dbj|BAD07785.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAY87269.1| hypothetical protein OsI_08671 [Oryza sativa Indica Group]
Length=150

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 51/104 (49%), Gaps = 10/104 (10%)
 Frame = +2

Query  299  RFSVHRLRAKFFHLFRLLSRLKSLYARAVRALMKRSIGGKVGGRNLGITREINYALYGNN  478
            RFSV RLRAK      L+ R    Y R + A+ +            G     +   +   
Sbjct  35   RFSVRRLRAKLLTFLGLVGR----YVRQLLAVRRPRSSSSSSSSAGGGCSRSSSTRFLVG  90

Query  479  GG------GELRLKSSFSRSNSFYAEAIADCLDFIHRNSLSMEE  592
            GG      G   +  SF RSNSFYA+AIADCL+FI RNS+ +E+
Sbjct  91   GGKHHVDGGRRTVPPSFMRSNSFYAQAIADCLEFIKRNSVPVED  134



>ref|XP_009417286.1| PREDICTED: uncharacterized protein LOC103997706 [Musa acuminata 
subsp. malaccensis]
Length=125

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 51/103 (50%), Gaps = 9/103 (9%)
 Frame = +2

Query  287  LNSRRFSVHRLRAKFFHLFRLLSRLKSLYARAVRALMKRSIGGKVGGRNLGITREINYAL  466
            L + RF+V  LR +   L+ L SR   +  R  R    R      G R         +  
Sbjct  21   LGANRFAVPLLRDRLCTLWSLFSRCVHVAKRGFRRNGSRWPSSNSGSRR-------GFVS  73

Query  467  YGNNGGG-ELRLKSSFSRSNSFYAEAIADCLDFIHRNSLSMEE  592
             G +GG  E RL+S    SNSFY EAIADCL+FI R+S+S  E
Sbjct  74   EGRHGGQIECRLRSCGG-SNSFYTEAIADCLEFIKRSSMSANE  115



>ref|XP_004953670.1| PREDICTED: uncharacterized protein LOC101776254 [Setaria italica]
Length=142

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 61/116 (53%), Gaps = 21/116 (18%)
 Frame = +2

Query  281  FRLNSR-RFSVHRLRAKFFHLFRLLSRLKSLYARAVRALMKR-SIGGKVGGRNLGITREI  454
            FRL  R RFSV RLRA+F            L  R VR L++R S  G  GG N    R  
Sbjct  28   FRLCPRNRFSVRRLRAEFLTFL-------GLVGRYVRHLVRRLSTSGGGGGGNGACGRSS  80

Query  455  NYALYGNNGGGE----------LRLKSSFSRSNSFYAEAIADCLDFIHRNSLSMEE  592
            +  +    GGG+           R  + F RSNSFY++AIADCL+FI RNS+ +E+
Sbjct  81   SRRVL--VGGGKDAAAAAASKGPRRAAPFVRSNSFYSQAIADCLEFIKRNSVPVED  134



>ref|XP_002454397.1| hypothetical protein SORBIDRAFT_04g030060 [Sorghum bicolor]
 gb|EES07373.1| hypothetical protein SORBIDRAFT_04g030060 [Sorghum bicolor]
Length=187

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 52/112 (46%), Gaps = 8/112 (7%)
 Frame = +2

Query  281  FRLNSR-RFSVHRLRAKFFHLFRLLSRLKSLYARAVRAL------MKRSIGGKVGGRNLG  439
            FRL  R RFSV RLRA+      L+ R   L  R +                + G R + 
Sbjct  40   FRLCPRNRFSVRRLRAELLTFLGLVGRYVRLLVRKLSTTRGGGGGGGNGGCARSGSRRVL  99

Query  440  ITREINYALYGNNGGGELRLKSSF-SRSNSFYAEAIADCLDFIHRNSLSMEE  592
            +                 R  + F +RSNSFY++AIADCL+FI RNS+ +E+
Sbjct  100  VVTGGAGRDKAPVAAASSRKPAPFIARSNSFYSQAIADCLEFIKRNSVPVED  151



>ref|XP_007158040.1| hypothetical protein PHAVU_002G119100g [Phaseolus vulgaris]
 gb|ESW30034.1| hypothetical protein PHAVU_002G119100g [Phaseolus vulgaris]
Length=142

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 49/91 (54%), Gaps = 12/91 (13%)
 Frame = +2

Query  329  FFHLFRLLSRLKSLYARAVRALMK---RSIGGKVGGRNL---GITREINYALYGNNGGGE  490
            F  L  L  R K  YA+A++ L K   R  G K    N    G+ R+         G  +
Sbjct  41   FTFLLNLFDRWKLSYAQALQLLKKVFRRKSGFKRNYSNSSRSGLVRDERIK-----GQSD  95

Query  491  LRLKSSFSRSNSFYAEAIADCLDFIHRNSLS  583
             RL SS+ R+NSFYAEAIADCL+FI R S+S
Sbjct  96   SRL-SSYGRNNSFYAEAIADCLEFIKRTSIS  125



>ref|NP_001144487.1| uncharacterized protein LOC100277464 [Zea mays]
 gb|ACG40854.1| hypothetical protein [Zea mays]
Length=140

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 48/102 (47%), Gaps = 4/102 (4%)
 Frame = +2

Query  293  SRRFSVHRLRAKFFHLFRLLSRLKSLYARAVRALMKRSIGGKVGGRNLGITREINYALYG  472
            +R FSV RLR +      L+ R   L  R + A       G    R  G  R +      
Sbjct  33   NRFFSVRRLRVELLTFLGLVGRYVRLLVRKLSASSSGG--GGGCARRTGSRRVLVVTTTT  90

Query  473  NNGGGELRLKSS--FSRSNSFYAEAIADCLDFIHRNSLSMEE  592
               G + +  +     RSNSFY++AIADCL+FI RNS+  E+
Sbjct  91   TTAGKKYKAPAPAPIVRSNSFYSQAIADCLEFIKRNSVPAED  132



>gb|AFW73084.1| hypothetical protein ZEAMMB73_962020 [Zea mays]
Length=151

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 48/102 (47%), Gaps = 4/102 (4%)
 Frame = +2

Query  293  SRRFSVHRLRAKFFHLFRLLSRLKSLYARAVRALMKRSIGGKVGGRNLGITREINYALYG  472
            +R FSV RLR +      L+ R   L  R + A       G    R  G  R +      
Sbjct  44   NRFFSVRRLRVELLTFLGLVGRYVRLLVRKLSASSSGG--GGGCARRTGSRRVLVVTTTT  101

Query  473  NNGGGELRLKSS--FSRSNSFYAEAIADCLDFIHRNSLSMEE  592
               G + +  +     RSNSFY++AIADCL+FI RNS+  E+
Sbjct  102  TTAGKKYKAPAPAPIVRSNSFYSQAIADCLEFIKRNSVPAED  143



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1761970051296