BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25508_g1_i1 len=714 path=[8449:0-39 8489:40-71 8521:72-81
1600:82-118 10143:119-139 7291:140-165 7317:166-187 1733:188-267
7362:268-284 1830:285-352 6218:353-373 1919:374-713]

Length=714
                                                                      Score     E

ref|XP_007039203.1|  Subtilase family protein, putative                 261   4e-78   
ref|XP_011075896.1|  PREDICTED: subtilisin-like protease SBT3.5         258   1e-76   
gb|EYU45313.1|  hypothetical protein MIMGU_mgv11b017622mg               235   3e-73   
ref|XP_007210025.1|  hypothetical protein PRUPE_ppa018629mg             246   2e-72   
ref|XP_011038010.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    243   1e-71   
ref|XP_009344070.1|  PREDICTED: subtilisin-like protease SBT5.3         243   1e-71   
ref|XP_008239249.1|  PREDICTED: subtilisin-like protease                244   2e-71   
ref|XP_011038008.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    243   2e-71   
emb|CBI34614.3|  unnamed protein product                                248   4e-71   
ref|XP_004309572.1|  PREDICTED: subtilisin-like protease-like           243   6e-71   
ref|XP_010661922.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    247   7e-71   
ref|XP_002518937.1|  Cucumisin precursor, putative                      240   5e-70   Ricinus communis
ref|XP_010056037.1|  PREDICTED: subtilisin-like protease SBT5.3         239   7e-70   
gb|KCW72613.1|  hypothetical protein EUGRSUZ_E01073                     243   2e-69   
ref|XP_002317663.1|  subtilase family protein                           238   2e-69   Populus trichocarpa [western balsam poplar]
ref|XP_007210725.1|  hypothetical protein PRUPE_ppa022363mg             237   5e-69   
ref|XP_010056036.1|  PREDICTED: subtilisin-like protease SBT5.3         236   9e-69   
ref|XP_007039330.1|  Subtilase family protein, putative                 238   1e-68   
gb|KCW72614.1|  hypothetical protein EUGRSUZ_E01074                     236   1e-68   
ref|XP_009350314.1|  PREDICTED: subtilisin-like protease SBT5.3         235   1e-68   
ref|XP_011040610.1|  PREDICTED: subtilisin-like protease SBT3.3         233   1e-67   
emb|CAN80173.1|  hypothetical protein VITISV_018392                     234   2e-67   Vitis vinifera
ref|XP_011038011.1|  PREDICTED: subtilisin-like protease SBT3.5         231   6e-67   
ref|XP_003634153.1|  PREDICTED: subtilisin-like protease SBT3.5         230   1e-66   
ref|XP_004309570.1|  PREDICTED: subtilisin-like protease-like           230   2e-66   
emb|CBI23086.3|  unnamed protein product                                231   2e-66   
ref|XP_010104913.1|  Subtilisin-like protease                           230   2e-66   
ref|XP_003634152.2|  PREDICTED: subtilisin-like protease SBT3.5         229   4e-66   
emb|CDX93810.1|  BnaA09g24100D                                          228   8e-66   
ref|XP_002273195.2|  PREDICTED: subtilisin-like protease SBT3.5         228   9e-66   Vitis vinifera
ref|XP_010318062.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    227   1e-65   
ref|XP_010318060.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    228   1e-65   
ref|XP_010421966.1|  PREDICTED: subtilisin-like protease SBT3.3         227   2e-65   
ref|XP_009114845.1|  PREDICTED: subtilisin-like protease SBT5.3         227   2e-65   
ref|XP_006397048.1|  hypothetical protein EUTSA_v10028454mg             224   2e-64   
ref|XP_009128710.1|  PREDICTED: subtilisin-like protease SBT5.3         224   4e-64   
emb|CDY25259.1|  BnaA02g21970D                                          223   4e-64   
gb|KFK45040.1|  hypothetical protein AALP_AA1G336300                    223   5e-64   
ref|XP_002891020.1|  subtilase family protein                           223   7e-64   
ref|XP_006287119.1|  hypothetical protein CARUB_v10000289mg             223   8e-64   
ref|XP_011081356.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    223   1e-63   
ref|XP_006306822.1|  hypothetical protein CARUB_v10008364mg             222   1e-63   
ref|XP_010437012.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    221   1e-63   
emb|CDX99526.1|  BnaC09g24660D                                          221   3e-63   
ref|NP_564412.1|  Subtilase 3.5                                         221   4e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009128706.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    219   4e-63   
emb|CDY36894.1|  BnaC07g01060D                                          217   4e-63   
ref|XP_010437005.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    221   4e-63   
ref|XP_009128705.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    220   6e-63   
emb|CDX86874.1|  BnaA09g22640D                                          220   6e-63   
ref|XP_002891021.1|  predicted protein                                  220   8e-63   
ref|XP_002891022.1|  subtilase family protein                           220   9e-63   
emb|CDY67954.1|  BnaAnng25710D                                          220   9e-63   
ref|XP_009128704.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    219   1e-62   
ref|XP_010529677.1|  PREDICTED: subtilisin-like protease SBT3.3         219   1e-62   
ref|NP_564414.2|  Subtilase family protein SBT3.3                       219   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397045.1|  hypothetical protein EUTSA_v10028448mg             218   5e-62   
emb|CDX94251.1|  BnaC02g29110D                                          217   9e-62   
gb|KFK31852.1|  hypothetical protein AALP_AA6G166800                    221   1e-61   
emb|CDX93808.1|  BnaA09g24080D                                          215   3e-61   
ref|XP_002298973.2|  subtilase family protein                           216   3e-61   Populus trichocarpa [western balsam poplar]
ref|XP_009114847.1|  PREDICTED: subtilisin-like protease SBT5.3         216   3e-61   
ref|XP_010542096.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    216   4e-61   
ref|XP_010499843.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    218   5e-61   
ref|XP_009114844.1|  PREDICTED: subtilisin-like protease SBT5.3         215   6e-61   
ref|XP_006397047.1|  hypothetical protein EUTSA_v10028468mg             214   6e-61   
ref|XP_002298974.2|  hypothetical protein POPTR_0001s45470g             214   7e-61   Populus trichocarpa [western balsam poplar]
ref|XP_006287107.1|  hypothetical protein CARUB_v10000269mg             214   8e-61   
ref|XP_010461117.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    214   1e-60   
ref|XP_006306827.1|  hypothetical protein CARUB_v10008369mg             213   2e-60   
ref|XP_009348696.1|  PREDICTED: subtilisin-like protease SBT5.4         212   5e-60   
gb|KFK31853.1|  hypothetical protein AALP_AA6G166900                    211   1e-59   
ref|XP_011081355.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    211   2e-59   
emb|CDY54842.1|  BnaC05g51310D                                          213   5e-59   
ref|XP_010529681.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    208   7e-59   
ref|XP_010529680.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    208   7e-59   
ref|XP_010529679.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    208   7e-59   
ref|XP_006286616.1|  hypothetical protein CARUB_v10002407mg             208   9e-59   
ref|XP_010455451.1|  PREDICTED: subtilisin-like protease SBT3.5         212   1e-58   
ref|XP_002874635.1|  subtilase family protein                           208   2e-58   
ref|XP_006439186.1|  hypothetical protein CICLE_v10018942mg             208   2e-58   
ref|XP_008342302.1|  PREDICTED: subtilisin-like protease                207   2e-58   
ref|XP_010104911.1|  Subtilisin-like protease SDD1                      207   2e-58   
ref|NP_567358.1|  Subtilase family protein                              207   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011038012.1|  PREDICTED: subtilisin-like protease SBT3.5         207   3e-58   
gb|EYU19440.1|  hypothetical protein MIMGU_mgv1a001654mg                207   3e-58   
ref|XP_006476262.1|  PREDICTED: subtilisin-like protease SDD1-like      207   3e-58   
ref|XP_010318061.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    207   4e-58   
ref|XP_002317660.2|  hypothetical protein POPTR_0011s15400g             207   4e-58   Populus trichocarpa [western balsam poplar]
ref|NP_567361.1|  Subtilase family protein                              206   5e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010109770.1|  hypothetical protein L484_008446                   206   6e-58   
emb|CBI23085.3|  unnamed protein product                                210   8e-58   
ref|NP_001078370.1|  subtilisin-like protease                           206   8e-58   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98849.1|  subtilisin-like protease -like protein                 206   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415136.1|  hypothetical protein EUTSA_v10006855mg             206   1e-57   
emb|CAB40021.1|  subtilisin-like protease-like protein                  206   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567360.1|  Subtilase family protein                              206   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567362.1|  subtilisin-like protease                              206   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190697.1|  subtilisin-like protease                           206   1e-57   
emb|CDX93811.1|  BnaA09g24110D                                          205   1e-57   
ref|XP_006289915.1|  hypothetical protein CARUB_v10003531mg             205   1e-57   
ref|XP_010470046.1|  PREDICTED: subtilisin-like protease SBT3.3         199   2e-57   
ref|XP_009351288.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    205   2e-57   
ref|NP_174573.1|  Subtilisin-like serine endopeptidase family pro...    205   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006289363.1|  hypothetical protein CARUB_v10002849mg             205   2e-57   
ref|XP_010542106.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    204   2e-57   
ref|XP_008392654.1|  PREDICTED: subtilisin-like protease SDD1           205   2e-57   
ref|XP_011040612.1|  PREDICTED: subtilisin-like protease SBT3.5         204   4e-57   
ref|XP_010421968.1|  PREDICTED: subtilisin-like protease SBT3.3         204   4e-57   
ref|XP_010437025.1|  PREDICTED: subtilisin-like protease SBT3.5         204   5e-57   
ref|XP_002874634.1|  subtilase family protein                           204   6e-57   
ref|XP_009348700.1|  PREDICTED: subtilisin-like protease SBT5.3         204   6e-57   
emb|CBI34615.3|  unnamed protein product                                203   6e-57   
ref|XP_002278450.2|  PREDICTED: subtilisin-like protease SBT3.3         203   8e-57   Vitis vinifera
emb|CDX84657.1|  BnaA03g15730D                                          203   8e-57   
ref|XP_007131764.1|  hypothetical protein PHAVU_011G039900g             203   9e-57   
emb|CBI23066.3|  unnamed protein product                                202   1e-56   
ref|XP_006286455.1|  hypothetical protein CARUB_v10000290mg             201   1e-56   
ref|XP_007201744.1|  hypothetical protein PRUPE_ppa001956mg             202   1e-56   
ref|NP_567359.1|  Subtilase family protein                              202   1e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008775642.1|  PREDICTED: subtilisin-like protease SBT5.3         202   1e-56   
ref|XP_010436981.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    201   2e-56   
gb|KCW55411.1|  hypothetical protein EUGRSUZ_I01318                     202   2e-56   
ref|XP_010028643.1|  PREDICTED: subtilisin-like protease SBT5.3         202   2e-56   
ref|XP_002460565.1|  hypothetical protein SORBIDRAFT_02g030760          202   2e-56   Sorghum bicolor [broomcorn]
ref|XP_010461118.1|  PREDICTED: subtilisin-like protease SBT3.5         202   2e-56   
gb|KDP41723.1|  hypothetical protein JCGZ_26741                         202   3e-56   
tpg|DAA62442.1|  TPA: putative subtilase family protein                 197   3e-56   
tpg|DAA62443.1|  TPA: putative subtilase family protein                 198   3e-56   
ref|XP_010478713.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    200   4e-56   
gb|EMS51782.1|  Subtilisin-like protease SDD1                           201   4e-56   
gb|AET04097.2|  subtilisin-like serine protease                         201   4e-56   
gb|EMT21161.1|  Cucumisin                                               201   4e-56   
ref|XP_002893749.1|  hypothetical protein ARALYDRAFT_473479             200   7e-56   
ref|XP_010499844.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    201   7e-56   
dbj|BAK05842.1|  predicted protein                                      201   7e-56   
ref|XP_010478712.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    201   8e-56   
ref|XP_006286454.1|  hypothetical protein CARUB_v10000290mg             200   9e-56   
gb|KHN39834.1|  Cucumisin                                               200   9e-56   
ref|XP_003537841.1|  PREDICTED: cucumisin-like                          200   9e-56   
ref|XP_006580143.1|  PREDICTED: subtilisin-like protease SDD1-lik...    199   9e-56   
ref|XP_010436973.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    200   9e-56   
ref|XP_002872521.1|  predicted protein                                  200   1e-55   
ref|NP_564413.2|  subtilase family protein                              200   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006286458.1|  hypothetical protein CARUB_v10000288mg             200   1e-55   
gb|AAF31277.1|AC006424_6  Second of four adjacent putative subtil...    200   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006580142.1|  PREDICTED: subtilisin-like protease SDD1-lik...    199   1e-55   
gb|AAD03438.1|  similar to the subtilase family of serine proteas...    200   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006580141.1|  PREDICTED: subtilisin-like protease SDD1-lik...    200   1e-55   
ref|XP_003524182.2|  PREDICTED: subtilisin-like protease SDD1-lik...    200   2e-55   
ref|XP_006306820.1|  hypothetical protein CARUB_v10008362mg             200   2e-55   
ref|XP_010470055.1|  PREDICTED: subtilisin-like protease SBT3.3         199   2e-55   
ref|XP_006370729.1|  hypothetical protein POPTR_0001s45480g             197   2e-55   
ref|XP_007042045.1|  Subtilase family protein, putative isoform 4       196   2e-55   
tpg|DAA62441.1|  TPA: putative subtilase family protein                 197   2e-55   
ref|XP_011012404.1|  PREDICTED: subtilisin-like protease SBT3.5         199   3e-55   
ref|XP_006415135.1|  hypothetical protein EUTSA_v10006863mg             199   3e-55   
ref|XP_010551747.1|  PREDICTED: subtilisin-like protease SBT3.5         199   3e-55   
ref|XP_002298975.2|  hypothetical protein POPTR_0001s45490g             199   4e-55   Populus trichocarpa [western balsam poplar]
ref|XP_004146562.1|  PREDICTED: subtilisin-like protease-like           198   4e-55   
ref|XP_010436935.1|  PREDICTED: subtilisin-like protease SBT3.3         198   5e-55   
ref|XP_007131420.1|  hypothetical protein PHAVU_011G012100g             195   5e-55   
ref|XP_004309569.1|  PREDICTED: subtilisin-like protease SDD1-like      198   5e-55   
ref|XP_010263869.1|  PREDICTED: subtilisin-like protease SBT3.5         198   6e-55   
ref|XP_009132975.1|  PREDICTED: subtilisin-like protease SBT5.3         198   6e-55   
ref|XP_009137202.1|  PREDICTED: subtilisin-like protease SBT5.3         198   6e-55   
ref|XP_004504377.1|  PREDICTED: subtilisin-like protease SDD1-lik...    196   7e-55   
ref|XP_010449025.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    198   7e-55   
gb|KHG28029.1|  Subtilisin-like protease SDD1                           198   7e-55   
ref|NP_567632.1|  Subtilase family protein                              198   7e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007042043.1|  Subtilase family protein, putative isoform 2       196   8e-55   
ref|NP_001159267.1|  uncharacterized protein LOC100304357 precursor     197   8e-55   Zea mays [maize]
ref|XP_006829160.1|  hypothetical protein AMTR_s00001p00269990          197   9e-55   
ref|XP_003578494.1|  PREDICTED: subtilisin-like protease SBT3.5         197   9e-55   
ref|XP_008668394.1|  PREDICTED: putative subtilase family protein...    196   9e-55   
ref|XP_004292430.1|  PREDICTED: subtilisin-like protease-like           197   1e-54   
ref|XP_006829610.1|  hypothetical protein AMTR_s00122p00026080          197   1e-54   
ref|XP_002512984.1|  Xylem serine proteinase 1 precursor, putative      197   1e-54   Ricinus communis
emb|CDY61569.1|  BnaCnng38020D                                          199   1e-54   
ref|XP_002518939.1|  Cucumisin precursor, putative                      197   1e-54   Ricinus communis
ref|XP_007131422.1|  hypothetical protein PHAVU_011G012100g             194   2e-54   
ref|XP_004957446.1|  PREDICTED: subtilisin-like protease SDD1-like      197   2e-54   
ref|NP_001169390.1|  putative subtilase family protein precursor        197   2e-54   Zea mays [maize]
gb|AIC80773.1|  subtilase                                               196   2e-54   
emb|CDX94043.1|  BnaC07g36770D                                          196   2e-54   
ref|XP_010445228.1|  PREDICTED: subtilisin-like protease SBT3.3         197   2e-54   
ref|XP_007042042.1|  Subtilase family protein, putative isoform 1       196   2e-54   
ref|XP_008452040.1|  PREDICTED: subtilisin-like protease                196   2e-54   
ref|XP_004504376.1|  PREDICTED: subtilisin-like protease SDD1-lik...    196   2e-54   
ref|XP_008236858.1|  PREDICTED: subtilisin-like protease                196   2e-54   
ref|NP_001063751.1|  Os09g0530800                                       196   3e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010421967.1|  PREDICTED: subtilisin-like protease SBT3.3         196   3e-54   
gb|KFK28745.1|  hypothetical protein AALP_AA7G041500                    196   3e-54   
gb|KFK41045.1|  hypothetical protein AALP_AA2G078300                    196   3e-54   
ref|XP_007042044.1|  Subtilase family protein, putative isoform 3       196   3e-54   
ref|XP_010647672.1|  PREDICTED: subtilisin-like protease SBT3.5         196   3e-54   
ref|XP_010271498.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    196   4e-54   
ref|XP_009351289.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    196   4e-54   
emb|CBI38006.3|  unnamed protein product                                196   4e-54   
ref|XP_010271499.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    196   4e-54   
ref|XP_002305456.2|  hypothetical protein POPTR_0004s16850g             196   5e-54   Populus trichocarpa [western balsam poplar]
ref|XP_011037192.1|  PREDICTED: subtilisin-like protease SBT3.5         195   6e-54   
ref|XP_010455450.1|  PREDICTED: subtilisin-like protease SBT3.3         195   7e-54   
gb|EAZ09847.1|  hypothetical protein OsI_32138                          195   8e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_003629621.1|  Subtilisin-like protease                           195   8e-54   
ref|XP_007131421.1|  hypothetical protein PHAVU_011G012100g             194   1e-53   
ref|XP_007209077.1|  hypothetical protein PRUPE_ppa001674mg             194   1e-53   
ref|XP_002867836.1|  subtilase family protein                           194   2e-53   
ref|XP_008804320.1|  PREDICTED: subtilisin-like protease SBT5.3         193   3e-53   
ref|XP_007039328.1|  Subtilase family protein, putative isoform 2       193   4e-53   
ref|XP_010919043.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    192   5e-53   
ref|XP_010919042.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    192   5e-53   
emb|CDX98690.1|  BnaA03g44750D                                          192   6e-53   
ref|XP_010529409.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    192   8e-53   
ref|XP_010529408.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    192   1e-52   
ref|NP_564869.1|  Subtilase-like protein                                191   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009344068.1|  PREDICTED: subtilisin-like protease SBT5.3         191   1e-52   
ref|XP_007039327.1|  Subtilase family protein, putative isoform 1       192   1e-52   
gb|KFK45041.1|  hypothetical protein AALP_AA1G336500                    191   2e-52   
gb|AAL24366.1|  subtilisin proteinase-like                              191   2e-52   Arabidopsis thaliana [mouse-ear cress]
emb|CAB36809.1|  subtilisin proteinase-like                             191   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006660880.1|  PREDICTED: subtilisin-like protease-like           191   2e-52   
ref|NP_567633.2|  Subtilase family protein                              191   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010513580.1|  PREDICTED: subtilisin-like protease SBT3.3         189   9e-52   
emb|CDX82843.1|  BnaC01g12930D                                          189   1e-51   
ref|XP_009105193.1|  PREDICTED: subtilisin-like protease SBT5.3         189   1e-51   
ref|XP_010538683.1|  PREDICTED: subtilisin-like protease SBT3.5         188   1e-51   
emb|CDY07492.1|  BnaA07g25710D                                          189   1e-51   
ref|XP_008778811.1|  PREDICTED: xylem serine proteinase 1-like          177   1e-51   
gb|KDP25228.1|  hypothetical protein JCGZ_20384                         181   1e-51   
ref|XP_010474133.1|  PREDICTED: subtilisin-like protease SBT3.3         188   2e-51   
ref|XP_008245809.1|  PREDICTED: subtilisin-like protease SDD1           188   2e-51   
ref|XP_010113170.1|  Subtilisin-like protease SDD1                      181   2e-51   
ref|XP_006391365.1|  hypothetical protein EUTSA_v10018142mg             188   2e-51   
emb|CDX79081.1|  BnaA01g11480D                                          187   3e-51   
ref|XP_010419003.1|  PREDICTED: subtilisin-like protease SBT3.3         187   3e-51   
ref|XP_002887016.1|  subtilase family protein                           187   3e-51   
ref|XP_009407970.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    186   7e-51   
ref|XP_010528996.1|  PREDICTED: subtilisin-like protease SBT3.5         186   8e-51   
ref|XP_010554964.1|  PREDICTED: subtilisin-like protease SBT3.3         186   1e-50   
ref|XP_009135013.1|  PREDICTED: subtilisin-like protease SBT5.3         186   1e-50   
ref|XP_006413751.1|  hypothetical protein EUTSA_v10024480mg             186   1e-50   
ref|XP_009392092.1|  PREDICTED: subtilisin-like protease                184   2e-50   
ref|XP_006301478.1|  hypothetical protein CARUB_v10021900mg             185   2e-50   
emb|CDY07491.1|  BnaA07g25700D                                          185   2e-50   
emb|CDY49640.1|  BnaCnng17920D                                          185   3e-50   
ref|XP_002447443.1|  hypothetical protein SORBIDRAFT_06g001140          184   3e-50   Sorghum bicolor [broomcorn]
ref|XP_002888489.1|  subtilase family protein                           184   4e-50   
ref|XP_009392091.1|  PREDICTED: subtilisin-like protease SBT5.3         182   5e-50   
ref|XP_009105192.1|  PREDICTED: subtilisin-like protease SBT5.3         183   1e-49   
emb|CAH66108.1|  OSIGBa0115D20.1                                        183   1e-49   Oryza sativa [red rice]
emb|CDY49641.1|  BnaCnng17930D                                          182   1e-49   
gb|AAD03431.1|  similar to the subtilase family of serine proteas...    182   1e-49   Arabidopsis thaliana [mouse-ear cress]
emb|CAB36808.1|  subtilisin-like protease                               182   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006423460.1|  hypothetical protein CICLE_v10027857mg             181   2e-49   
gb|KDO40058.1|  hypothetical protein CISIN_1g006582mg                   181   3e-49   
gb|AAD03430.1|  similar to the subtilase family of serine proteas...    181   4e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010931731.1|  PREDICTED: subtilisin-like protease SBT3.5         181   4e-49   
ref|XP_006413752.1|  hypothetical protein EUTSA_v10027359mg             181   4e-49   
ref|XP_006487362.1|  PREDICTED: subtilisin-like protease SDD1-lik...    181   6e-49   
ref|XP_006423459.1|  hypothetical protein CICLE_v10027857mg             181   6e-49   
ref|XP_006487361.1|  PREDICTED: subtilisin-like protease SDD1-lik...    181   6e-49   
ref|XP_009391860.1|  PREDICTED: subtilisin-like protease SBT5.3         181   7e-49   
ref|XP_011079238.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    181   9e-49   
ref|XP_008804318.1|  PREDICTED: subtilisin-like protease                180   1e-48   
ref|XP_009387964.1|  PREDICTED: subtilisin-like protease SBT5.3         180   1e-48   
ref|XP_010100157.1|  Subtilisin-like protease SDD1                      179   2e-48   
emb|CAB87667.1|  subtilisin-like protease-like protein                  179   3e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568255.1|  Subtilase family protein                              179   3e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009387941.1|  PREDICTED: subtilisin-like protease Glyma18g...    177   3e-48   
gb|AES89241.2|  subtilisin-like serine protease                         177   4e-48   
ref|XP_003572336.1|  PREDICTED: subtilisin-like protease SBT3.5         178   5e-48   
gb|AAG51763.1|AC066691_3  hypothetical protein; 8963-6048               178   7e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001046518.1|  Os02g0270200                                       176   7e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011090078.1|  PREDICTED: subtilisin-like protease SBT3.5         178   8e-48   
emb|CDX94252.1|  BnaC02g29120D                                          177   9e-48   
ref|XP_008804316.1|  PREDICTED: subtilisin-like protease SBT5.4         177   1e-47   
gb|KFK41050.1|  hypothetical protein AALP_AA2G078900                    177   1e-47   
ref|NP_564868.2|  Subtilisin-like serine endopeptidase family pro...    177   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301525.1|  hypothetical protein CARUB_v10021953mg             177   1e-47   
ref|XP_009391852.1|  PREDICTED: subtilisin-like protease SBT5.3         177   1e-47   
ref|XP_009391857.1|  PREDICTED: subtilisin-like protease SBT5.4         177   1e-47   
ref|XP_010470496.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    177   1e-47   
ref|XP_009391854.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    177   2e-47   
gb|EEE63324.1|  hypothetical protein OsJ_18135                          176   2e-47   
ref|XP_006662913.1|  PREDICTED: cucumisin-like                          177   2e-47   
ref|XP_010470495.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    177   2e-47   
ref|XP_002523401.1|  conserved hypothetical protein                     176   2e-47   
ref|XP_010934029.1|  PREDICTED: subtilisin-like protease SBT3.5         176   3e-47   
ref|XP_010511550.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    176   3e-47   
ref|XP_010931718.1|  PREDICTED: subtilisin-like protease SBT3.5         176   3e-47   
ref|XP_010434193.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    176   4e-47   
ref|XP_010511549.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    176   4e-47   
ref|NP_001052068.2|  Os04g0120000                                       179   4e-47   
ref|NP_193895.2|  Subtilase family protein                              176   4e-47   
emb|CDX98693.1|  BnaA03g44780D                                          176   5e-47   
tpg|DAA57282.1|  TPA: putative subtilase family protein                 174   5e-47   
ref|XP_009137200.1|  PREDICTED: subtilisin-like protease SBT5.3         176   5e-47   
ref|XP_006399712.1|  hypothetical protein EUTSA_v10012766mg             175   6e-47   
ref|XP_002871506.1|  subtilase family protein                           175   6e-47   
ref|XP_010434192.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    176   7e-47   
gb|AAX95895.1|  Subtilase family, putative                              175   7e-47   
gb|EEE56708.1|  hypothetical protein OsJ_06199                          175   8e-47   
ref|XP_010917817.1|  PREDICTED: subtilisin-like protease SBT3.5         175   9e-47   
ref|XP_010920365.1|  PREDICTED: subtilisin-like protease SBT3.5         175   9e-47   
gb|EEC72887.1|  hypothetical protein OsI_06697                          175   9e-47   
emb|CAE01679.2|  OSJNBb0089K24.4                                        174   2e-46   
ref|NP_001044507.1|  Os01g0795000                                       173   2e-46   
ref|NP_001052071.1|  Os04g0121100                                       173   2e-46   
ref|NP_001052072.2|  Os04g0121300                                       173   3e-46   
gb|AAG09442.1|AF200467_1  subtilase                                     173   3e-46   
emb|CDY65868.1|  BnaAnng21170D                                          173   3e-46   
ref|XP_004970244.1|  PREDICTED: cucumisin-like                          173   4e-46   
gb|KFK45042.1|  hypothetical protein AALP_AA1G336600                    173   4e-46   
ref|XP_009125836.1|  PREDICTED: subtilisin-like protease SBT5.4         173   4e-46   
ref|XP_008674940.1|  PREDICTED: subtilisin-like protease SBT5.3         173   4e-46   
ref|XP_009391853.1|  PREDICTED: subtilisin-like protease SBT5.3         173   4e-46   
ref|XP_010934028.1|  PREDICTED: subtilisin-like protease SBT3.5         172   4e-46   
emb|CAE01678.2|  OSJNBb0089K24.3                                        173   4e-46   
emb|CDX91186.1|  BnaC02g04110D                                          173   5e-46   
gb|EEC67681.1|  hypothetical protein OsI_35120                          173   5e-46   
ref|XP_008783547.1|  PREDICTED: subtilisin-like protease SBT5.3         172   5e-46   
emb|CAN77487.1|  hypothetical protein VITISV_020248                     172   6e-46   
gb|EEC71630.1|  hypothetical protein OsI_04057                          175   7e-46   
ref|XP_010449088.1|  PREDICTED: subtilisin-like protease SBT3.5         173   7e-46   
ref|XP_009391855.1|  PREDICTED: subtilisin-like protease isoform X2     172   7e-46   
emb|CBI16560.3|  unnamed protein product                                172   8e-46   
ref|XP_010651399.1|  PREDICTED: subtilisin-like protease SBT3.5         172   8e-46   
ref|XP_010439493.1|  PREDICTED: subtilisin-like protease SBT3.5         172   9e-46   
emb|CAE76052.1|  B1248C03.11                                            174   1e-45   
emb|CAE01301.2|  OSJNBa0020P07.18                                       172   1e-45   
ref|XP_008797388.1|  PREDICTED: subtilisin-like protease SBT5.3         172   1e-45   
gb|EMT05074.1|  Subtilisin-like protease                                174   1e-45   
gb|AID21686.1|  At4g21323p-like protein                                 172   2e-45   
gb|AID21679.1|  At4g21323p-like protein                                 172   2e-45   
emb|CAH66111.1|  OSIGBa0115D20.4                                        171   2e-45   
gb|AID21627.1|  At4g21323p-like protein                                 171   2e-45   
ref|XP_010092449.1|  Subtilisin-like protease SDD1                      167   2e-45   
gb|EEC68285.1|  hypothetical protein OsI_36335                          171   2e-45   
emb|CCI61493.1|  unnamed protein product                                171   2e-45   
ref|XP_002873539.1|  hypothetical protein ARALYDRAFT_909167             169   3e-45   
ref|XP_006283138.1|  hypothetical protein CARUB_v10004165mg             170   3e-45   
ref|XP_006644839.1|  PREDICTED: subtilisin-like protease SDD1-like      170   4e-45   
gb|KDO76781.1|  hypothetical protein CISIN_1g042478mg                   171   5e-45   
ref|XP_002299096.2|  hypothetical protein POPTR_0001s03950g             169   5e-45   
gb|AID21654.1|  At4g21323p-like protein                                 170   5e-45   
ref|NP_001173742.1|  Os04g0120300                                       169   6e-45   
ref|NP_567624.1|  Subtilase family protein                              170   7e-45   
ref|XP_002872522.1|  subtilase family protein                           169   8e-45   
gb|AID21619.1|  At4g21323p-like protein                                 170   8e-45   
ref|XP_010445229.1|  PREDICTED: subtilisin-like protease SBT3.3         169   8e-45   
ref|XP_004978766.1|  PREDICTED: subtilisin-like protease-like           169   8e-45   
ref|XP_010463200.1|  PREDICTED: subtilisin-like protease SBT3.5         169   9e-45   
gb|AID21582.1|  AT4G21323p                                              170   9e-45   
ref|XP_006283139.1|  hypothetical protein CARUB_v10004165mg             169   1e-44   
gb|EEE55520.1|  hypothetical protein OsJ_03743                          169   1e-44   
ref|XP_009376062.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    169   1e-44   
dbj|BAJ90143.1|  predicted protein                                      169   1e-44   
dbj|BAJ96374.1|  predicted protein                                      169   1e-44   
dbj|BAD53008.1|  subtilisin-like serine proteinase-like protein         162   1e-44   
ref|XP_010103096.1|  Subtilisin-like protease                           168   2e-44   
gb|ABV21208.1|  At4g21326                                               168   2e-44   
gb|EMS61069.1|  Subtilisin-like protease                                168   2e-44   
ref|XP_009376077.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    169   2e-44   
ref|XP_008392653.1|  PREDICTED: subtilisin-like protease                166   2e-44   
gb|EMS53237.1|  Subtilisin-like protease                                168   2e-44   
gb|AID21602.1|  At4g21323p-like protein                                 169   2e-44   
ref|XP_008351327.1|  PREDICTED: subtilisin-like protease                169   2e-44   
ref|XP_003607044.1|  Subtilisin-like protease                           167   2e-44   
ref|NP_001172893.1|  Os02g0270933                                       170   2e-44   
ref|XP_007210133.1|  hypothetical protein PRUPE_ppa022964mg             167   3e-44   
ref|NP_567625.4|  subtilase 3.12                                        168   3e-44   
emb|CDM80022.1|  unnamed protein product                                167   3e-44   
ref|XP_009376069.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    167   3e-44   
ref|XP_011048159.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    168   3e-44   
ref|XP_004970242.1|  PREDICTED: subtilisin-like protease SDD1-like      167   4e-44   
ref|XP_009420612.1|  PREDICTED: subtilisin-like protease SBT5.4         167   4e-44   
ref|XP_009590702.1|  PREDICTED: subtilisin-like protease                167   4e-44   
ref|XP_010438771.1|  PREDICTED: subtilisin-like protease SBT3.5         167   5e-44   
dbj|BAJ94791.1|  predicted protein                                      167   5e-44   
ref|XP_010230265.1|  PREDICTED: subtilisin-like protease SBT3.5         167   5e-44   
emb|CAA20197.1|  putative protein                                       170   5e-44   
ref|XP_006840155.1|  hypothetical protein AMTR_s00089p00068070          159   5e-44   
emb|CAE01298.2|  OSJNBa0020P07.15                                       169   8e-44   
emb|CDM82077.1|  unnamed protein product                                166   8e-44   
ref|XP_003572330.1|  PREDICTED: subtilisin-like protease SBT3.5         166   8e-44   
ref|XP_010480961.1|  PREDICTED: subtilisin-like protease SBT3.5         166   8e-44   
ref|XP_010103095.1|  Subtilisin-like protease                           167   9e-44   
ref|XP_002869615.1|  predicted protein                                  166   9e-44   
ref|NP_001044505.1|  Os01g0794800                                       166   1e-43   
ref|XP_003572346.1|  PREDICTED: subtilisin-like protease SBT3.5         166   1e-43   
ref|XP_006413795.1|  hypothetical protein EUTSA_v10024459mg             166   1e-43   
ref|XP_006358675.1|  PREDICTED: xylem serine proteinase 1-like          168   1e-43   
emb|CDY58475.1|  BnaA03g58460D                                          166   1e-43   
ref|XP_007207186.1|  hypothetical protein PRUPE_ppa017229mg             166   1e-43   
ref|XP_009767539.1|  PREDICTED: subtilisin-like protease                166   2e-43   
ref|XP_003581117.1|  PREDICTED: subtilisin-like protease SBT3.3         166   2e-43   
dbj|BAJ93156.1|  predicted protein                                      165   2e-43   
ref|XP_009137185.1|  PREDICTED: subtilisin-like protease SBT5.4         166   2e-43   
ref|XP_010436375.1|  PREDICTED: subtilisin-like protease SBT3.5         165   2e-43   
ref|XP_006445567.1|  hypothetical protein CICLE_v10014478mg             164   3e-43   
gb|EMT01939.1|  Subtilisin-like protease                                164   3e-43   
dbj|BAJ93872.1|  predicted protein                                      165   3e-43   
ref|XP_002869894.1|  hypothetical protein ARALYDRAFT_329472             168   3e-43   
gb|EMT20729.1|  Subtilisin-like protease                                166   3e-43   
emb|CDX94032.1|  BnaC07g36660D                                          165   3e-43   
ref|XP_006489003.1|  PREDICTED: subtilisin-like protease-like           165   4e-43   
gb|KDO54486.1|  hypothetical protein CISIN_1g003970mg                   165   4e-43   
dbj|BAJ98357.1|  predicted protein                                      156   4e-43   
gb|EMS50761.1|  Subtilisin-like protease                                164   5e-43   
gb|AHJ61058.1|  Hwi2                                                    164   6e-43   
gb|EAZ29545.1|  hypothetical protein OsJ_13620                          164   7e-43   
ref|XP_006304869.1|  hypothetical protein CARUB_v10012621mg             164   7e-43   
ref|XP_009590434.1|  PREDICTED: subtilisin-like protease SDD1           164   7e-43   
emb|CDX92763.1|  BnaC07g40210D                                          164   7e-43   
ref|XP_006468476.1|  PREDICTED: cucumisin-like                          162   7e-43   
ref|NP_001046523.1|  Os02g0271600                                       163   7e-43   
gb|EYU39005.1|  hypothetical protein MIMGU_mgv1a021060mg                164   8e-43   
ref|XP_008461718.1|  PREDICTED: subtilisin-like protease isoform X1     164   8e-43   
gb|EAZ13817.1|  hypothetical protein OsJ_03742                          164   9e-43   
ref|XP_008461720.1|  PREDICTED: subtilisin-like protease isoform X2     163   9e-43   
ref|NP_567744.1|  protein UNFERTILIZED EMBRYO SAC 17                    164   9e-43   
gb|EAY76130.1|  hypothetical protein OsI_04059                          164   9e-43   
ref|XP_006351094.1|  PREDICTED: cucumisin-like                          164   1e-42   
ref|XP_006851521.1|  hypothetical protein AMTR_s00040p00169800          160   1e-42   
gb|AID21603.1|  At4g21326p-like protein                                 163   1e-42   
ref|XP_011048160.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    163   1e-42   
ref|XP_002867838.1|  subtilase family protein                           162   1e-42   
ref|XP_007039329.1|  Subtilase family protein                           161   1e-42   
gb|AGN12874.1|  putative transcription factor DYSFUNCTIONAL TAPET...    163   1e-42   
ref|XP_011036040.1|  PREDICTED: cucumisin-like                          162   2e-42   
emb|CBI34765.3|  unnamed protein product                                163   2e-42   
ref|XP_004245414.1|  PREDICTED: subtilisin-like protease                163   2e-42   
ref|XP_011048158.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    163   2e-42   
ref|XP_002275807.1|  PREDICTED: cucumisin-like                          163   2e-42   
ref|XP_011082896.1|  PREDICTED: subtilisin-like protease SBT5.3         163   2e-42   
ref|XP_008221640.1|  PREDICTED: subtilisin-like protease                163   2e-42   
ref|XP_006356658.1|  PREDICTED: subtilisin-like protease-like           163   2e-42   
ref|XP_006468475.1|  PREDICTED: cucumisin-like                          160   2e-42   
ref|XP_010059854.1|  PREDICTED: subtilisin-like protease                162   2e-42   
ref|XP_002524250.1|  Cucumisin precursor, putative                      162   3e-42   
ref|XP_009790649.1|  PREDICTED: subtilisin-like protease SDD1 iso...    162   3e-42   
ref|XP_009790650.1|  PREDICTED: subtilisin-like protease SDD1 iso...    162   3e-42   
gb|ADQ37368.1|  unknown                                                 162   3e-42   
gb|EYU21314.1|  hypothetical protein MIMGU_mgv1a001662mg                162   3e-42   
gb|ADQ37356.1|  unknown                                                 162   3e-42   
gb|EMT21268.1|  Subtilisin-like protease                                162   3e-42   
ref|XP_006653124.1|  PREDICTED: subtilisin-like protease-like           162   4e-42   
emb|CCI61494.1|  unnamed protein product                                162   4e-42   
gb|EMS67122.1|  Subtilisin-like protease                                162   4e-42   
ref|NP_001052082.1|  Os04g0127300                                       161   4e-42   
emb|CBI31873.3|  unnamed protein product                                162   5e-42   
ref|XP_008779567.1|  PREDICTED: cucumisin-like                          161   5e-42   
ref|XP_008663777.1|  PREDICTED: subtilisin-like protease SBT5.3         162   5e-42   
gb|EAZ29539.1|  hypothetical protein OsJ_13613                          161   5e-42   
emb|CAE76069.1|  B1340F09.7                                             161   5e-42   
gb|AID21653.1|  At4g21326p-like protein                                 162   5e-42   
gb|EMS63596.1|  Cucumisin                                               162   5e-42   
ref|NP_001130788.1|  putative subtilase family protein precursor        162   5e-42   
emb|CBI24459.3|  unnamed protein product                                161   5e-42   
gb|AID21678.1|  At4g21326p-like protein                                 161   6e-42   
gb|AID21685.1|  At4g21326p-like protein                                 161   6e-42   
ref|XP_009790648.1|  PREDICTED: subtilisin-like protease SDD1 iso...    161   6e-42   
ref|XP_010662545.1|  PREDICTED: cucumisin-like                          161   7e-42   
ref|XP_009137589.1|  PREDICTED: subtilisin-like protease isoform X2     161   7e-42   
ref|XP_002264496.1|  PREDICTED: cucumisin-like                          161   7e-42   
ref|XP_006287131.1|  hypothetical protein CARUB_v10000302mg             161   7e-42   
ref|XP_002524251.1|  Cucumisin precursor, putative                      161   7e-42   
gb|EPS65938.1|  hypothetical protein M569_08836                         161   7e-42   
gb|KDP28707.1|  hypothetical protein JCGZ_14478                         161   8e-42   
ref|XP_009137588.1|  PREDICTED: subtilisin-like protease isoform X1     161   8e-42   
ref|NP_001067647.1|  Os11g0261600                                       152   8e-42   
gb|EMS63058.1|  Subtilisin-like protease                                161   8e-42   
ref|XP_006440509.1|  hypothetical protein CICLE_v10023551mg             160   1e-41   
ref|XP_001777292.1|  predicted protein                                  160   1e-41   
gb|EAZ29546.1|  hypothetical protein OsJ_13621                          160   1e-41   
ref|XP_006306824.1|  hypothetical protein CARUB_v10008367mg             161   1e-41   
gb|ADQ37345.1|  unknown                                                 160   1e-41   
dbj|BAJ91233.1|  predicted protein                                      160   1e-41   
gb|EMT13355.1|  Subtilisin-like protease                                160   1e-41   
ref|XP_004308918.1|  PREDICTED: cucumisin-like                          160   1e-41   
ref|XP_002316254.1|  hypothetical protein POPTR_0010s20420g             160   1e-41   
ref|XP_009149504.1|  PREDICTED: subtilisin-like protease                160   2e-41   
ref|XP_002320086.2|  subtilase family protein                           160   2e-41   
ref|XP_004243217.1|  PREDICTED: subtilisin-like protease SBT5.3         160   2e-41   
gb|EAY76129.1|  hypothetical protein OsI_04058                          161   2e-41   
gb|KGN50591.1|  hypothetical protein Csa_5G188380                       159   2e-41   
ref|XP_004165286.1|  PREDICTED: LOW QUALITY PROTEIN: cucumisin-like     160   2e-41   
gb|EEC76675.1|  hypothetical protein OsI_14653                          158   2e-41   
gb|EMS55531.1|  Subtilisin-like protease                                159   2e-41   
ref|XP_010091819.1|  Subtilisin-like protease SDD1                      160   2e-41   
ref|XP_010445236.1|  PREDICTED: subtilisin-like protease SBT3.5         161   2e-41   
ref|XP_002511772.1|  Xylem serine proteinase 1 precursor, putative      160   2e-41   
ref|XP_006850442.1|  hypothetical protein AMTR_s00165p00065060          159   2e-41   
emb|CDY44210.1|  BnaC05g15670D                                          160   2e-41   
gb|EFQ30434.1|  PA domain-containing protein                            160   2e-41   
gb|AID21581.1|  AT4G21326p                                              160   2e-41   
gb|AID21628.1|  At4g21326p-like protein                                 160   2e-41   
gb|AFW55829.1|  putative subtilase family protein                       158   2e-41   
dbj|BAJ97332.1|  predicted protein                                      160   3e-41   



>ref|XP_007039203.1| Subtilase family protein, putative [Theobroma cacao]
 gb|EOY23704.1| Subtilase family protein, putative [Theobroma cacao]
Length=776

 Score =   261 bits (668),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 161/220 (73%), Gaps = 8/220 (4%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--GGII  527
            DY+SPRD  GHGTHTSS A GS V+NVSY GL FGT RGGAP ARLA+YK+ W+  GG+ 
Sbjct  220  DYLSPRDPSGHGTHTSSIAGGSFVANVSYYGLGFGTVRGGAPGARLAMYKVCWQLYGGVC  279

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LK FDEAIHDGVDV+S S  A++PL ++VD   S+  GSFHAVA GITVV AAGN
Sbjct  280  SDADVLKGFDEAIHDGVDVLSVSLVADIPLYSDVDQRGSIPIGSFHAVAKGITVVCAAGN  339

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF---  176
             GP A+TV    PWILTVAA+T DR FPTPI LGN QT+MGQ++FTG+DT    LV+   
Sbjct  340  AGPRAETVQNTAPWILTVAASTVDRSFPTPIMLGNNQTIMGQAMFTGEDTVFATLVYPEV  399

Query  175  ---LPDKFCETLTTTDTWIAGKVVLCFTGKHGLDIDVEGI  65
               +  + CE+L++ D W+AGKVVLCF  ++ + +  +GI
Sbjct  400  SDLMVPRNCESLSSNDDWMAGKVVLCFVSEYNMSLLDDGI  439



>ref|XP_011075896.1| PREDICTED: subtilisin-like protease SBT3.5 [Sesamum indicum]
Length=783

 Score =   258 bits (659),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 152/206 (74%), Gaps = 6/206 (3%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            ++IS RD  GHGTH +S A GS V NVS++GLA G  RGGAPRARLAIYK+GW GG +  
Sbjct  227  EFISTRDSAGHGTHCASIAGGSFVRNVSFQGLAGGVARGGAPRARLAIYKVGWIGGAVSS  286

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
             D LKAFDEAIHDGVDV+S S G ++PL  E+D  D +++GSFHAVAHGITVV +AGN G
Sbjct  287  VDILKAFDEAIHDGVDVLSISLGIDLPLYPEIDKLDVIYYGSFHAVAHGITVVCSAGNSG  346

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLP---  170
            P  QTV    PW+++VAA+T DR FPTPI LGN Q   GQ++F GKDTG + L ++    
Sbjct  347  PEYQTVEDVAPWVISVAASTIDRSFPTPIVLGNKQVFTGQAMFDGKDTGFLKLAYIERGD  406

Query  169  ---DKFCETLTTTDTWIAGKVVLCFT  101
               +++CE +T  DTW+AGKVVLCFT
Sbjct  407  VGGERYCEYITANDTWVAGKVVLCFT  432



>gb|EYU45313.1| hypothetical protein MIMGU_mgv11b017622mg, partial [Erythranthe 
guttata]
Length=254

 Score =   235 bits (599),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 139/179 (78%), Gaps = 0/179 (0%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            ++ISPRD  GHGTH +STA GS VSNVSY GLA GT RGGAP ARLA+YK+GW GG++  
Sbjct  31   EFISPRDSDGHGTHCASTAGGSPVSNVSYDGLARGTARGGAPGARLAVYKVGWLGGVVSS  90

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            +D LKAFDEAIHDGVDV+S S G ++PL  EVD  D +++GSFHAVA+G+TVV +AGN G
Sbjct  91   SDILKAFDEAIHDGVDVLSISLGIDLPLYPEVDKRDIIYYGSFHAVANGVTVVCSAGNSG  150

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDK  164
            P  QTV    PW++TVAA+T DR +PTPI LGN QT  GQS++ GKDTG V+L F  ++
Sbjct  151  PGYQTVEDVAPWVVTVAASTIDRLYPTPIMLGNNQTFAGQSMYVGKDTGYVELFFYSER  209



>ref|XP_007210025.1| hypothetical protein PRUPE_ppa018629mg [Prunus persica]
 gb|EMJ11224.1| hypothetical protein PRUPE_ppa018629mg [Prunus persica]
Length=773

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 152/210 (72%), Gaps = 10/210 (5%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--GGII  527
            +++SPRD  GHGTHTSSTA GS V+NVSYKGL  GT +GGAP ARLAIYK+ W+  GG  
Sbjct  210  EFLSPRDAHGHGTHTSSTAAGSFVTNVSYKGLGHGTIKGGAPNARLAIYKVCWKVLGGQC  269

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFDEAIHDGVDV+S S G+++PL +EVD  D +  GSFHAVA GITVV  A N
Sbjct  270  SSADILKAFDEAIHDGVDVLSLSIGSSIPLFSEVDERDGIATGSFHAVARGITVVCGAAN  329

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPD  167
            +GP+A+TV    PWI+TVAA+T DR FPT ITLGN +T +GQ++FTG + G   L++   
Sbjct  330  DGPSAETVQNTAPWIITVAASTMDRSFPTSITLGNNKTFLGQAMFTGPEIGFASLIYPES  389

Query  166  K--------FCETLTTTDTWIAGKVVLCFT  101
            K         C++L+   T +AGKVVLCFT
Sbjct  390  KGLDPTAAGVCQSLSLNKTMVAGKVVLCFT  419



>ref|XP_011038010.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Populus 
euphratica]
Length=704

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 154/214 (72%), Gaps = 10/214 (5%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
            +G  ++ SPRD  GHGTHT+STA G+ + NVSY+GLA GT RGGAPRARLAIYK+ W   
Sbjct  139  SGNREFFSPRDANGHGTHTASTAAGTFIDNVSYRGLAHGTIRGGAPRARLAIYKVCWNVL  198

Query  538  GGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVT  359
            GG    AD LKAFDEAIHDGVDV+S S G+++PL +++D  D +  GSFHAVA GITVV 
Sbjct  199  GGQCSSADILKAFDEAIHDGVDVLSLSIGSSIPLFSDIDERDGIATGSFHAVAKGITVVC  258

Query  358  AAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLV  179
             A N+GP AQTV    PWILTVAA++ DR FPTPITLGN +T +GQ++++GK+ G   L+
Sbjct  259  GAANDGPFAQTVQNTAPWILTVAASSMDRAFPTPITLGNNKTFLGQAIYSGKEIGFRSLI  318

Query  178  FLPDK--------FCETLTTTDTWIAGKVVLCFT  101
            +   K         C+ L+  ++ +AGKVVLCFT
Sbjct  319  YPEAKGLNPNSAGVCQFLSVDNSMVAGKVVLCFT  352



>ref|XP_009344070.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=699

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 150/208 (72%), Gaps = 8/208 (4%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--GGII  527
            ++ SPRD  GHGTHTSSTA GS V+N+SYKGL  GT RGGAP ARLAIYK+ W   GG  
Sbjct  139  EFHSPRDAHGHGTHTSSTAAGSFVANISYKGLGLGTIRGGAPNARLAIYKVCWNVLGGQC  198

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFDEAIHDGVDV+S S   +VPL ++VD  D +  GSFHAVA GITVV AAGN
Sbjct  199  STADILKAFDEAIHDGVDVLSLSIVYSVPLFSDVDERDGIATGSFHAVAKGITVVCAAGN  258

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPD  167
             GP+AQTV    PWI+TVAA+T DR+FPT ITLGN +T +GQ++FTG + G  +LV+   
Sbjct  259  SGPSAQTVGNTAPWIITVAASTMDREFPTSITLGNNKTFLGQAMFTGTEIGFTNLVYPES  318

Query  166  K------FCETLTTTDTWIAGKVVLCFT  101
            +       CE+L+   T + GKVVLCFT
Sbjct  319  EGPTDGGVCESLSLNKTIVVGKVVLCFT  346



>ref|XP_008239249.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008239250.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008239251.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=772

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 151/210 (72%), Gaps = 10/210 (5%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--GGII  527
            +++SPRD  GHGTHTSSTA GS V+NVSYKGL  GT +GGAP ARLAIYK+ W+  GG  
Sbjct  210  EFLSPRDAHGHGTHTSSTAAGSFVTNVSYKGLGHGTIKGGAPNARLAIYKVCWKVLGGQC  269

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFDEAIHDGVDV+S S G+++PL +EVD  D +  GSFHAVA GITVV  A N
Sbjct  270  SSADILKAFDEAIHDGVDVLSLSIGSSIPLFSEVDERDGIATGSFHAVARGITVVCGAAN  329

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPD  167
            +GP+A+ V    PWI+TVAA+T DR FPT ITLGN +T +GQ++FTG + G   L++   
Sbjct  330  DGPSAEMVQNTAPWIITVAASTMDRSFPTSITLGNNKTFLGQAMFTGPEIGFASLIYPES  389

Query  166  K--------FCETLTTTDTWIAGKVVLCFT  101
            K         C++L+   T +AGKVVLCFT
Sbjct  390  KGLDPTAAGVCQSLSFNKTMVAGKVVLCFT  419



>ref|XP_011038008.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Populus 
euphratica]
 ref|XP_011038009.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Populus 
euphratica]
Length=775

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 154/214 (72%), Gaps = 10/214 (5%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
            +G  ++ SPRD  GHGTHT+STA G+ + NVSY+GLA GT RGGAPRARLAIYK+ W   
Sbjct  210  SGNREFFSPRDANGHGTHTASTAAGTFIDNVSYRGLAHGTIRGGAPRARLAIYKVCWNVL  269

Query  538  GGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVT  359
            GG    AD LKAFDEAIHDGVDV+S S G+++PL +++D  D +  GSFHAVA GITVV 
Sbjct  270  GGQCSSADILKAFDEAIHDGVDVLSLSIGSSIPLFSDIDERDGIATGSFHAVAKGITVVC  329

Query  358  AAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLV  179
             A N+GP AQTV    PWILTVAA++ DR FPTPITLGN +T +GQ++++GK+ G   L+
Sbjct  330  GAANDGPFAQTVQNTAPWILTVAASSMDRAFPTPITLGNNKTFLGQAIYSGKEIGFRSLI  389

Query  178  FLPDK--------FCETLTTTDTWIAGKVVLCFT  101
            +   K         C+ L+  ++ +AGKVVLCFT
Sbjct  390  YPEAKGLNPNSAGVCQFLSVDNSMVAGKVVLCFT  423



>emb|CBI34614.3| unnamed protein product [Vitis vinifera]
Length=2139

 Score =   248 bits (634),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 155/215 (72%), Gaps = 12/215 (6%)
 Frame = -3

Query  712   TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
             +G  +++SPRD  GHGTHTSSTA GS V NVSYKGLA GT RGGAP ARLAIYK+ W   
Sbjct  944   SGNQEFLSPRDANGHGTHTSSTAGGSFVGNVSYKGLALGTVRGGAPHARLAIYKVCWNVL  1003

Query  538   GGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVT  359
             GG    AD LKAFDEAI+DGV V+S S G+++PL +++D  D +  GSFHAVA GITVV 
Sbjct  1004  GGQCSSADILKAFDEAINDGVHVLSLSIGSSIPLFSDIDERDGIATGSFHAVAKGITVVC  1063

Query  358   AAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLV  179
              A N+GP AQTV    PWILTVAA+T DR FPTPITLGN +TL+GQ+LFTGK+TG   LV
Sbjct  1064  GASNDGPQAQTVQNTAPWILTVAASTMDRAFPTPITLGNNKTLLGQALFTGKETGFSGLV  1123

Query  178   FLPDKF---------CETLTTTDTWIAGKVVLCFT  101
             + P+           CE L+   T +AGKVVLCFT
Sbjct  1124  Y-PEVSGLALNSAGQCEALSLDQTSVAGKVVLCFT  1157


 Score =   238 bits (608),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 150/217 (69%), Gaps = 10/217 (5%)
 Frame = -3

Query  700   DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--GGII  527
             DY+SPRD  GHGTHTS+ A GS + N SY+GL  G  RGGAPRAR+A+YK+ W    G  
Sbjct  1705  DYLSPRDSIGHGTHTSTIASGSFLVNASYQGLGLGIVRGGAPRARIAMYKVCWNVAAGQC  1764

Query  526   MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
               AD LKAFDEAIHDGVDV+S S G+++PL +EVD  D +  GSFHAVA G+TVV  A  
Sbjct  1765  ASADILKAFDEAIHDGVDVLSVSLGSDIPLFSEVDERDGIAIGSFHAVAKGMTVVCGAST  1824

Query  346   EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLV----  179
             +GP+AQ+V    PWILTVAA+T DR FPTPITLGN  T++GQ++F GK+ G   LV    
Sbjct  1825  DGPSAQSVQNTAPWILTVAASTIDRSFPTPITLGNNVTILGQAMFPGKEIGFSGLVHPET  1884

Query  178   --FLPDK--FCETLTTTDTWIAGKVVLCFTGKHGLDI  80
                LP     CE+L+  +T +AG VVLCFT + G  I
Sbjct  1885  PGLLPTAAGVCESLSLNNTTVAGNVVLCFTTELGTKI  1921



>ref|XP_004309572.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=837

 Score =   243 bits (620),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 154/219 (70%), Gaps = 11/219 (5%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--GGII  527
            +++SPRD  GHGTHT+STA GS V+NVSYKGL  GT RGGAP ARLAIYK+ W   GG  
Sbjct  275  EFMSPRDAHGHGTHTASTAAGSFVTNVSYKGLGHGTIRGGAPNARLAIYKVCWNVLGGQC  334

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LK FDEAIHDGVDV+S S G +VPL ++VD  D +  GSFHAVA GITVV AA N
Sbjct  335  SAADMLKGFDEAIHDGVDVLSLSIGGSVPLFSDVDERDGISTGSFHAVARGITVVCAASN  394

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPD  167
            +GP+AQTV    PWI+TVAA+T DR FPT ITLGN +T +GQ++FTG + G   L++   
Sbjct  395  DGPSAQTVQNISPWIITVAASTMDRAFPTSITLGNNKTFLGQAMFTGLEIGFTSLIYPES  454

Query  166  K--------FCETLTTTDTWIAGKVVLCFTGKHGLDIDV  74
            K         C++L+  +T ++G VVLCFT   G  IDV
Sbjct  455  KGLYPTATGVCDSLSLNNTMVSGMVVLCFTSL-GRRIDV  492



>ref|XP_010661922.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Vitis vinifera]
Length=1488

 Score =   247 bits (630),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 155/215 (72%), Gaps = 12/215 (6%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
            +G  +++SPRD  GHGTHTSSTA GS V NVSYKGLA GT RGGAP ARLAIYK+ W   
Sbjct  218  SGNQEFLSPRDANGHGTHTSSTAGGSFVGNVSYKGLALGTVRGGAPHARLAIYKVCWNVL  277

Query  538  GGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVT  359
            GG    AD LKAFDEAI+DGV V+S S G+++PL +++D  D +  GSFHAVA GITVV 
Sbjct  278  GGQCSSADILKAFDEAINDGVHVLSLSIGSSIPLFSDIDERDGIATGSFHAVAKGITVVC  337

Query  358  AAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLV  179
             A N+GP AQTV    PWILTVAA+T DR FPTPITLGN +TL+GQ+LFTGK+TG   LV
Sbjct  338  GASNDGPQAQTVQNTAPWILTVAASTMDRAFPTPITLGNNKTLLGQALFTGKETGFSGLV  397

Query  178  FLPDKF---------CETLTTTDTWIAGKVVLCFT  101
            + P+           CE L+   T +AGKVVLCFT
Sbjct  398  Y-PEVSGLALNSAGQCEALSLDQTSVAGKVVLCFT  431


 Score =   235 bits (600),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 147/210 (70%), Gaps = 10/210 (5%)
 Frame = -3

Query  700   DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--GGII  527
             DY+SPRD  GHGTHTS+ A GS + N SY+GL  G  RGGAPRAR+A+YK+ W    G  
Sbjct  931   DYLSPRDSIGHGTHTSTIASGSFLVNASYQGLGLGIVRGGAPRARIAMYKVCWNVAAGQC  990

Query  526   MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
               AD LKAFDEAIHDGVDV+S S G+++PL +EVD  D +  GSFHAVA G+TVV  A  
Sbjct  991   ASADILKAFDEAIHDGVDVLSVSLGSDIPLFSEVDERDGIAIGSFHAVAKGMTVVCGAST  1050

Query  346   EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLV----  179
             +GP+AQ+V    PWILTVAA+T DR FPTPITLGN  T++GQ++F GK+ G   LV    
Sbjct  1051  DGPSAQSVQNTAPWILTVAASTIDRSFPTPITLGNNVTILGQAMFPGKEIGFSGLVHPET  1110

Query  178   --FLPDK--FCETLTTTDTWIAGKVVLCFT  101
                LP     CE+L+  +T +AG VVLCFT
Sbjct  1111  PGLLPTAAGVCESLSLNNTTVAGNVVLCFT  1140



>ref|XP_002518937.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF43470.1| Cucumisin precursor, putative [Ricinus communis]
Length=778

 Score =   240 bits (612),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 153/215 (71%), Gaps = 12/215 (6%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
            +G  +++S RD  GHGTHT+STA G+ VSNVSYKGLA G  RGGAPRARLAIYK+ W+  
Sbjct  212  SGDLEFLSARDANGHGTHTASTAAGAFVSNVSYKGLAPGIIRGGAPRARLAIYKVCWDVL  271

Query  538  GGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVT  359
            GG    AD LKA DEAIHDGVDV+S S G+++PL +++D  D +  GSFHAVA GITVV 
Sbjct  272  GGQCSSADILKAIDEAIHDGVDVMSLSIGSSIPLFSDIDERDGIATGSFHAVARGITVVC  331

Query  358  AAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLV  179
            AA N+GP+AQTV    PWILTVAA+T DR FPTPI LGN +T +GQ+ FTGK+ G   L 
Sbjct  332  AAANDGPSAQTVQNTAPWILTVAASTMDRAFPTPIILGNNRTFLGQATFTGKEIGFRGL-  390

Query  178  FLPDK---------FCETLTTTDTWIAGKVVLCFT  101
            F P            C++L+   T +AGKVVLCFT
Sbjct  391  FYPQASGLDPNAAGACQSLSLNATLVAGKVVLCFT  425



>ref|XP_010056037.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=773

 Score =   239 bits (610),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 154/219 (70%), Gaps = 12/219 (5%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
            +G  +++SPRD  GHGTHTSSTAVGS VSNVSY+G+ +GT RGGAPRARLA+YK+ W   
Sbjct  207  SGDLEFLSPRDANGHGTHTSSTAVGSFVSNVSYRGIGYGTARGGAPRARLAVYKVCWNVL  266

Query  538  GGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVT  359
             G    AD LKAFDEAIHDGVDV+S S G  +PL ++VD  D +  G+FHAVA GITVV 
Sbjct  267  NGQCSSADILKAFDEAIHDGVDVLSVSIGTAIPLFSDVDDRDGIATGAFHAVAQGITVVC  326

Query  358  AAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLV  179
             AGN+GPAAQTV    PWILTV A + DR F T ITLGN +TL+GQ+++TGK+ G   L+
Sbjct  327  GAGNDGPAAQTVQNTAPWILTVGATSIDRAFRTIITLGNNETLVGQAIYTGKEIGFTTLL  386

Query  178  FLPD---------KFCETLTTTDTWIAGKVVLCFTGKHG  89
            + P+           CE L+   T +AGKVVLCFT   G
Sbjct  387  Y-PEGTTLDPTSGGVCERLSPNATLMAGKVVLCFTSTAG  424



>gb|KCW72613.1| hypothetical protein EUGRSUZ_E01073, partial [Eucalyptus grandis]
Length=1447

 Score =   243 bits (619),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 154/219 (70%), Gaps = 12/219 (5%)
 Frame = -3

Query  712   TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
             +G  +++SPRD  GHGTHTSSTAVGS VSNVSY+G+ +GT RGGAPRARLA+YK+ W   
Sbjct  915   SGDLEFLSPRDANGHGTHTSSTAVGSFVSNVSYRGIGYGTARGGAPRARLAVYKVCWNVL  974

Query  538   GGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVT  359
              G    AD LKAFDEAIHDGVDV+S S G  +PL ++VD  D +  G+FHAVA GITVV 
Sbjct  975   NGQCSSADILKAFDEAIHDGVDVLSVSIGTAIPLFSDVDDRDGIATGAFHAVAQGITVVC  1034

Query  358   AAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLV  179
              AGN+GPAAQTV    PWILTV A + DR F T ITLGN +TL+GQ+++TGK+ G   L+
Sbjct  1035  GAGNDGPAAQTVQNTAPWILTVGATSIDRAFRTIITLGNNETLVGQAIYTGKEIGFTTLL  1094

Query  178   FLPD---------KFCETLTTTDTWIAGKVVLCFTGKHG  89
             + P+           CE L+   T +AGKVVLCFT   G
Sbjct  1095  Y-PEGTTLDPTSGGVCERLSPNATLMAGKVVLCFTSTAG  1132



>ref|XP_002317663.1| subtilase family protein [Populus trichocarpa]
 gb|EEE98275.1| subtilase family protein [Populus trichocarpa]
Length=770

 Score =   238 bits (607),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 149/209 (71%), Gaps = 10/209 (5%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--GGII  527
            ++ SPRD  GHGTHT+STA G+ V NVSY+GL  GT RGGAPRA+LAIYK+ W   GG  
Sbjct  212  EFFSPRDANGHGTHTASTAAGNFVDNVSYRGLGLGTIRGGAPRAQLAIYKVCWNVLGGQC  271

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFDEAIHDGVDV+S S G+++PL +++D  DS+  GSFHAVA GITVV  A N
Sbjct  272  ASADILKAFDEAIHDGVDVLSLSIGSSIPLFSDIDERDSIATGSFHAVAKGITVVCGASN  331

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPD  167
            +GP+AQTV    PWILTVAA++ DR FPTPITLGN +T  G+ L++G DTG  +L +   
Sbjct  332  DGPSAQTVQNTAPWILTVAASSMDRAFPTPITLGNNKTFRGKGLYSGNDTGFRNLFYPVA  391

Query  166  K--------FCETLTTTDTWIAGKVVLCF  104
            K         C++L    + +AGKVVLCF
Sbjct  392  KGLDPNSAGVCQSLLVDASTVAGKVVLCF  420



>ref|XP_007210725.1| hypothetical protein PRUPE_ppa022363mg [Prunus persica]
 gb|EMJ11924.1| hypothetical protein PRUPE_ppa022363mg [Prunus persica]
Length=783

 Score =   237 bits (605),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 145/210 (69%), Gaps = 10/210 (5%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--GGII  527
            D++SPRD+ GHGTHTS+ A GS V N SY+GL  G+ RGGAPRARLA+YK+ W    G  
Sbjct  221  DFLSPRDVFGHGTHTSTIAGGSFVYNASYRGLGLGSVRGGAPRARLAMYKVCWNVPRGQC  280

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFD+AIHDGVDVIS S G  +PL +EVD  D++  GSFHAVA GI VV  A N
Sbjct  281  SSADILKAFDDAIHDGVDVISVSLGTQLPLFSEVDDRDTISIGSFHAVAKGIPVVCGAAN  340

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPD  167
            EGP+A TV    PWILTVAA T DR FPTPITLGN  T++GQ++F GK+ G   LV+  +
Sbjct  341  EGPSAYTVENTAPWILTVAATTIDRSFPTPITLGNNLTILGQAIFAGKEVGFTGLVYPEN  400

Query  166  K--------FCETLTTTDTWIAGKVVLCFT  101
                      CE+L   +T +AG VVLCFT
Sbjct  401  PGLIPSLAGVCESLLLNNTPVAGNVVLCFT  430



>ref|XP_010056036.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=774

 Score =   236 bits (603),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 154/215 (72%), Gaps = 12/215 (6%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            +G  +++SPRD  GHGTHTSSTAVGS VSNVSY+G+ +GT RGGAPRARLA+YK+ W   
Sbjct  207  SGDLEFLSPRDANGHGTHTSSTAVGSFVSNVSYRGIGYGTARGGAPRARLAVYKVCWNVL  266

Query  532  IIM--GADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVT  359
             +    AD LKAFDEAIHDGVDV+S S G  +PL ++VD  D++  G+FHAVA GITVV 
Sbjct  267  NVQCSSADILKAFDEAIHDGVDVLSVSIGTAIPLFSDVDDRDAIATGAFHAVAQGITVVC  326

Query  358  AAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLV  179
             AGN+GPAAQTV    PWILTV A + DR F T ITLGN +TL+GQ+++TGK+ G   L+
Sbjct  327  GAGNDGPAAQTVQNTAPWILTVGATSIDRAFRTIITLGNNETLVGQAIYTGKEIGFTTLL  386

Query  178  FLPD---------KFCETLTTTDTWIAGKVVLCFT  101
            + P+           CE L+   T +AGKVVLCFT
Sbjct  387  Y-PEGTTLDPTSAGVCERLSPNATLMAGKVVLCFT  420



>ref|XP_007039330.1| Subtilase family protein, putative [Theobroma cacao]
 gb|EOY23831.1| Subtilase family protein, putative [Theobroma cacao]
Length=1029

 Score =   238 bits (607),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 147/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--GGII  527
            +Y SPRD  GHGTHTSSTA GS V NVSY+GL  GT RGGAP ARLAIYK+ W   GG  
Sbjct  213  EYFSPRDANGHGTHTSSTAGGSYVRNVSYRGLGPGTVRGGAPHARLAIYKVCWNVLGGQC  272

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFDEAIHDGVDV+S S G ++PL ++VD  D +  GSFHAVA GITVV  A N
Sbjct  273  ASADILKAFDEAIHDGVDVLSLSIGYSLPLFSDVDERDGIATGSFHAVARGITVVCGAAN  332

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPD  167
            +GP+AQTV    PWI+TVAA+T DR FPTPITLGN +T +GQ++FTGK+ G   L + P+
Sbjct  333  DGPSAQTVQNTAPWIVTVAASTMDRAFPTPITLGNNKTFLGQAIFTGKENGFTGLTY-PE  391

Query  166  KF---------CETLTTTDTWIAGKVVLCF  104
                       C+ L    T +AGKVVLCF
Sbjct  392  GTGLDPTSAGACQDLLLNSTLVAGKVVLCF  421


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  700   DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYK  551
             DY+SPRD  GHGTHTS+ A GS V+N SYKGLA GT RGGAPRAR+A+YK
Sbjct  965   DYMSPRDSFGHGTHTSTIAGGSFVANASYKGLALGTSRGGAPRARIAMYK  1014



>gb|KCW72614.1| hypothetical protein EUGRSUZ_E01074 [Eucalyptus grandis]
Length=758

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 154/215 (72%), Gaps = 12/215 (6%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            +G  +++SPRD  GHGTHTSSTAVGS VSNVSY+G+ +GT RGGAPRARLA+YK+ W   
Sbjct  191  SGDLEFLSPRDANGHGTHTSSTAVGSFVSNVSYRGIGYGTARGGAPRARLAVYKVCWNVL  250

Query  532  IIM--GADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVT  359
             +    AD LKAFDEAIHDGVDV+S S G  +PL ++VD  D++  G+FHAVA GITVV 
Sbjct  251  NVQCSSADILKAFDEAIHDGVDVLSVSIGTAIPLFSDVDDRDAIATGAFHAVAQGITVVC  310

Query  358  AAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLV  179
             AGN+GPAAQTV    PWILTV A + DR F T ITLGN +TL+GQ+++TGK+ G   L+
Sbjct  311  GAGNDGPAAQTVQNTAPWILTVGATSIDRAFRTIITLGNNETLVGQAIYTGKEIGFTTLL  370

Query  178  FLPD---------KFCETLTTTDTWIAGKVVLCFT  101
            + P+           CE L+   T +AGKVVLCFT
Sbjct  371  Y-PEGTTLDPTSAGVCERLSPNATLMAGKVVLCFT  404



>ref|XP_009350314.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=718

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 148/214 (69%), Gaps = 10/214 (5%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--GGII  527
            ++ SPRD  GHGTHT++TA GS V+N SY+GLA G  RGGAPRA LA+YK  W     + 
Sbjct  157  EFYSPRDGAGHGTHTATTAAGSFVANASYQGLALGVVRGGAPRAHLAVYKTCWNVLNFVC  216

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFDEAI+DGVDV+S S G   P  AEVD  D++  GSFHAVA GITVV AA N
Sbjct  217  AAADLLKAFDEAIYDGVDVLSLSIGNYNPKFAEVDKRDAIATGSFHAVAKGITVVCAADN  276

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFL--  173
             GPA QTVS   PWI+TVAA T DR FPTPITLGN +TL+GQ++F GK+ G   LV+   
Sbjct  277  TGPAPQTVSNVAPWIITVAATTIDRSFPTPITLGNNKTLLGQAMFVGKEVGFTGLVYPEG  336

Query  172  PDKF------CETLTTTDTWIAGKVVLCFTGKHG  89
            P++F      CE+LT   T +AG VV+CFT   G
Sbjct  337  PEQFPTAYGVCESLTLNTTHVAGNVVICFTTMPG  370



>ref|XP_011040610.1| PREDICTED: subtilisin-like protease SBT3.3 [Populus euphratica]
Length=770

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 147/209 (70%), Gaps = 10/209 (5%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--GGII  527
            ++ SPRD  GHGTHT+STA G+ V NVSY+GL  GT RGGAP A+LAIYK+ W   GG+ 
Sbjct  212  EFFSPRDANGHGTHTASTAAGNFVDNVSYRGLGLGTVRGGAPHAQLAIYKVCWNVLGGLC  271

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFDEAIHDGVDV+S S G+++PL +++D  D +  GSFHAVA GITVV  A N
Sbjct  272  AAADILKAFDEAIHDGVDVLSLSIGSSIPLFSDIDERDGIATGSFHAVAKGITVVCGASN  331

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPD  167
            +GP+AQTV    PW+LTVAA++ DR FPTPITLGN +T  G+ L++G DTG   L +   
Sbjct  332  DGPSAQTVQNTAPWVLTVAASSMDRAFPTPITLGNNKTFRGKGLYSGNDTGFRSLFYPVA  391

Query  166  K--------FCETLTTTDTWIAGKVVLCF  104
            K         C++L    + +AGKVVLCF
Sbjct  392  KGLDPNSAGVCQSLLVDASTVAGKVVLCF  420



>emb|CAN80173.1| hypothetical protein VITISV_018392 [Vitis vinifera]
Length=928

 Score =   234 bits (597),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 147/208 (71%), Gaps = 8/208 (4%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--GGII  527
            DY+SPRD  GHGTHTS+ A GS V NVSY GL  GT RGGAPRARLA+YK+ W   GG+ 
Sbjct  221  DYLSPRDWLGHGTHTSTIAGGSSVHNVSYNGLGLGTVRGGAPRARLAMYKVCWNLYGGVC  280

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD  K  DEAIHDGVDV+S S  +++PL + VD +D +   SFHAV  GI VV+AAGN
Sbjct  281  ADADIFKGIDEAIHDGVDVLSLSISSDIPLFSHVDQHDGISIASFHAVVRGIPVVSAAGN  340

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF---  176
             GP+A+TVS   PWI+TVAA+T DR F T ITLGN QT+ G++++ GKDTG  +L +   
Sbjct  341  SGPSAETVSNTAPWIITVAASTMDRLFATHITLGNNQTITGEAVYLGKDTGFTNLAYPEV  400

Query  175  ---LPDKFCETLTTTDTWIAGKVVLCFT  101
               L  ++CE+L   DT+ AG VVLCFT
Sbjct  401  SDLLAPRYCESLLPNDTFAAGNVVLCFT  428



>ref|XP_011038011.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=781

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 146/208 (70%), Gaps = 8/208 (4%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG--II  527
            DY+SPRD+ GHGTH S+ A GS VSN S+KGL  G  RG A RAR+A+YK+ W  G  I 
Sbjct  221  DYLSPRDVVGHGTHVSAIAAGSFVSNTSFKGLGLGLARGAATRARIAMYKVFWNVGPVIC  280

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD L+AFDEAIHDGVD++S S G+ VPL ++VD  D +  G+FHAVA GI V+ AAGN
Sbjct  281  SSADLLRAFDEAIHDGVDLLSLSIGSFVPLFSDVDERDGIAIGAFHAVAKGIPVIAAAGN  340

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF---  176
             GP AQT+    PWILTVAA+T DR FPT +TLGN  T+MGQ+LF GK+ G   LV+   
Sbjct  341  TGPHAQTIQNTAPWILTVAASTVDRSFPTLLTLGNNITIMGQALFAGKEIGFTGLVYPET  400

Query  175  ---LPDKFCETLTTTDTWIAGKVVLCFT  101
               +   FCE+L+  +T + GKVVLCFT
Sbjct  401  SELVYPSFCESLSFNNTSVDGKVVLCFT  428



>ref|XP_003634153.1| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 148/213 (69%), Gaps = 10/213 (5%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW--E  539
            T   +Y+SPRD  GHGTHTSS A GS V N SY GL FGT RGGAP ARLA+YK+ W  E
Sbjct  214  TEYLEYLSPRDALGHGTHTSSIAGGSPVVNASYYGLGFGTVRGGAPGARLAMYKVCWNLE  273

Query  538  GGIIMGADTLKAFDEAIHDGVDVISASFGA-NVPLSAEVDPNDSLHFGSFHAVAHGITVV  362
            GG    AD LKAFD+AIHDGVDV+S S G+ ++P +  + P DS+  GSFHAVA GI+VV
Sbjct  274  GGFCSDADILKAFDKAIHDGVDVLSVSLGSDDIPFTEIIKP-DSILIGSFHAVAQGISVV  332

Query  361  TAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDL  182
             AAGN GP+AQTV    PWILTVAA++ DR FPTPITLGN +T+MGQ++  G  TG   L
Sbjct  333  CAAGNGGPSAQTVENTAPWILTVAASSIDRSFPTPITLGNNRTVMGQAMLIGNLTGFASL  392

Query  181  VFLPDKF------CETLTTTDTWIAGKVVLCFT  101
            V+  D        C  ++  DT +AGKV LCFT
Sbjct  393  VYPDDPHLQSPSSCLYMSPNDTSVAGKVALCFT  425



>ref|XP_004309570.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=739

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 141/210 (67%), Gaps = 10/210 (5%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--GGII  527
            DY+SPRD+ GHGTHTS+ A GS V N SYKG+  G  RGGAPRARLA+YK+ W    G  
Sbjct  176  DYMSPRDVVGHGTHTSTIAGGSFVYNASYKGIGLGIVRGGAPRARLAMYKVCWNVPRGQC  235

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFD+AIHDGVDVIS S G  +PL +EVD  D++  GSFHAV  GI VV AA N
Sbjct  236  SNADLLKAFDDAIHDGVDVISVSLGTQLPLFSEVDDRDAISIGSFHAVTKGIPVVCAAAN  295

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPD  167
            EGP+A TV    PWILTVAA+T DR FPT ITLGN  T++GQ+LF G +     LV+  +
Sbjct  296  EGPSAYTVENTAPWILTVAASTIDRSFPTNITLGNNLTILGQALFAGTEVDFTGLVYPEN  355

Query  166  K--------FCETLTTTDTWIAGKVVLCFT  101
                      CE L   +T +AG VVLCFT
Sbjct  356  PGLIPSLAGVCEALLLNNTPVAGNVVLCFT  385



>emb|CBI23086.3| unnamed protein product [Vitis vinifera]
Length=842

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 148/213 (69%), Gaps = 10/213 (5%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW--E  539
            T   +Y+SPRD  GHGTHTSS A GS V N SY GL FGT RGGAP ARLA+YK+ W  E
Sbjct  280  TEYLEYLSPRDALGHGTHTSSIAGGSPVVNASYYGLGFGTVRGGAPGARLAMYKVCWNLE  339

Query  538  GGIIMGADTLKAFDEAIHDGVDVISASFGA-NVPLSAEVDPNDSLHFGSFHAVAHGITVV  362
            GG    AD LKAFD+AIHDGVDV+S S G+ ++P +  + P DS+  GSFHAVA GI+VV
Sbjct  340  GGFCSDADILKAFDKAIHDGVDVLSVSLGSDDIPFTEIIKP-DSILIGSFHAVAQGISVV  398

Query  361  TAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDL  182
             AAGN GP+AQTV    PWILTVAA++ DR FPTPITLGN +T+MGQ++  G  TG   L
Sbjct  399  CAAGNGGPSAQTVENTAPWILTVAASSIDRSFPTPITLGNNRTVMGQAMLIGNLTGFASL  458

Query  181  VFLPDKF------CETLTTTDTWIAGKVVLCFT  101
            V+  D        C  ++  DT +AGKV LCFT
Sbjct  459  VYPDDPHLQSPSSCLYMSPNDTSVAGKVALCFT  491



>ref|XP_010104913.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC02149.1| Subtilisin-like protease [Morus notabilis]
Length=803

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 150/219 (68%), Gaps = 12/219 (5%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
            +G  +++SPRD  GHGTHT+STA GS V NVSYKGLA G  RGGAP+AR+A+YK+ W   
Sbjct  236  SGQTEFLSPRDANGHGTHTASTAAGSFVGNVSYKGLAGGNARGGAPKARVAVYKVCWNLL  295

Query  538  GGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVT  359
            GG    AD LKAFDEAIHDGVDV+S S G  +PL A+VD  D +  GSFHAVA+GI+VV 
Sbjct  296  GGQCSSADILKAFDEAIHDGVDVLSLSIGFGIPLYADVDERDGIATGSFHAVANGISVVC  355

Query  358  AAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLV  179
             AGN+GP+AQTV    PWILTVAAN+ DR F   ITLGN +TL+GQ+L T K+     L+
Sbjct  356  GAGNDGPSAQTVQNTAPWILTVAANSIDRAFLASITLGNNKTLVGQALITRKENAFTGLL  415

Query  178  FLPDK---------FCETLTTTDTWIAGKVVLCFTGKHG  89
            + P+           C+ LT   T  AGKVVLCFT   G
Sbjct  416  Y-PESHGLDPTASAICQALTLNGTDAAGKVVLCFTSMSG  453



>ref|XP_003634152.2| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score =   229 bits (584),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 145/212 (68%), Gaps = 8/212 (4%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
            T   +Y+SPRD  GHGTHTSS A GS V N SY GL FGT RGGAP ARLA+YK  W   
Sbjct  214  TKYLEYLSPRDALGHGTHTSSIAGGSPVVNASYYGLGFGTVRGGAPGARLAMYKACWNLG  273

Query  538  GGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVT  359
            GG    AD LKAFD+AIHDGVDV+S S G++  L  E+   DS+  GSFHAVA GI+VV 
Sbjct  274  GGFCSDADILKAFDKAIHDGVDVLSVSLGSDDILFTEIIKPDSILIGSFHAVAQGISVVC  333

Query  358  AAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLV  179
            AAGN GP+AQTV    PWILTVAA++ DR FPTPITLGN +T+MGQ++  G  TG   LV
Sbjct  334  AAGNGGPSAQTVENTAPWILTVAASSIDRSFPTPITLGNNRTVMGQAMLIGNHTGFASLV  393

Query  178  FLPDKF------CETLTTTDTWIAGKVVLCFT  101
            +  D        C +++  DT +AGKV LCFT
Sbjct  394  YPDDPHLQSPSNCLSISPNDTSVAGKVALCFT  425



>emb|CDX93810.1| BnaA09g24100D [Brassica napus]
Length=750

 Score =   228 bits (581),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 147/219 (67%), Gaps = 15/219 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            DYISPRD  GHGTH +S A GS V NVSYKGLA GT RGGAPRAR+A+YK  W     EG
Sbjct  198  DYISPRDFNGHGTHVASIAGGSFVPNVSYKGLAGGTLRGGAPRARIAMYKACWYLEELEG  257

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 +D +KA D+AIHDGVDV+S S G+ VPL +E D  D +  G+FHAVA+GITVV A
Sbjct  258  VTCSFSDIMKAMDDAIHDGVDVLSLSLGSRVPLFSETDMRDGIATGAFHAVANGITVVCA  317

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GP+AQTV    PWILTVAA T DR F TPITLGN + ++GQ+++TG + G   LV+
Sbjct  318  GGNAGPSAQTVVNTAPWILTVAATTLDRSFATPITLGNNKVILGQAMYTGPELGFTSLVY  377

Query  175  LPDK---------FCETLT-TTDTWIAGKVVLCFTGKHG  89
              D           CE+L   ++  +AGK+VLCFT   G
Sbjct  378  PEDPGNSNDTFTGECESLNLNSNRTMAGKIVLCFTTTRG  416



>ref|XP_002273195.2| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score =   228 bits (582),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 145/212 (68%), Gaps = 8/212 (4%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
            T   +Y+SPRD  GHGTHTSS A GS V N SY GL FGT RGGAP ARLA+YK  W   
Sbjct  214  TEYLEYLSPRDALGHGTHTSSIAGGSPVVNASYYGLGFGTVRGGAPGARLAMYKACWNLG  273

Query  538  GGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVT  359
            GG    AD LKAFD+AIHDGVDV+S S G++  L  E+   DS+  GSFHAVA GI+VV 
Sbjct  274  GGFCSDADILKAFDKAIHDGVDVLSVSLGSDDILFTEIIKPDSILIGSFHAVAQGISVVC  333

Query  358  AAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLV  179
            AAGN GP+AQTV    PWILTVAA++ DR FPTPITLGN +T+MGQ++  G  TG   LV
Sbjct  334  AAGNGGPSAQTVDNTAPWILTVAASSIDRSFPTPITLGNNRTVMGQAMLIGNHTGFASLV  393

Query  178  FLPDKF------CETLTTTDTWIAGKVVLCFT  101
            +  D        C +++  DT +AGKV LCFT
Sbjct  394  YPDDPHVESPSNCLSISPNDTSVAGKVALCFT  425



>ref|XP_010318062.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X3 [Solanum 
lycopersicum]
 ref|XP_010318063.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X3 [Solanum 
lycopersicum]
Length=732

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 144/211 (68%), Gaps = 10/211 (5%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE---GGI  530
            D  SPRD  GH THTSSTA GS   N SY  L +GT +GGAP+AR+A+YK+ W    GG 
Sbjct  180  DIASPRDRDGHDTHTSSTAGGSFTPNASYHRLGYGTVKGGAPKARIAMYKVCWNWLIGGC  239

Query  529  IMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAG  350
               ADT+ A DEAIHDGVD++S S G  +PL A++D  + + F SFHAV+ GITV+ + G
Sbjct  240  TF-ADTMMAIDEAIHDGVDILSISLGLEIPLYADIDMRNGIAFASFHAVSKGITVICSGG  298

Query  349  NEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVV-----D  185
            NEGP  QTV    PWILTVAA++ DR FPT ITLGN QT  GQS++TGK+TG +     +
Sbjct  299  NEGPYPQTVVNISPWILTVAASSIDRSFPTLITLGNNQTFSGQSMYTGKETGFIGIAHQE  358

Query  184  LVFLPD-KFCETLTTTDTWIAGKVVLCFTGK  95
            +  L D +FC  L T DTW AGKVVLCF  K
Sbjct  359  ISELEDTRFCNNLNTNDTWAAGKVVLCFIVK  389



>ref|XP_010318060.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Solanum 
lycopersicum]
Length=772

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 144/211 (68%), Gaps = 10/211 (5%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE---GGI  530
            D  SPRD  GH THTSSTA GS   N SY  L +GT +GGAP+AR+A+YK+ W    GG 
Sbjct  220  DIASPRDRDGHDTHTSSTAGGSFTPNASYHRLGYGTVKGGAPKARIAMYKVCWNWLIGGC  279

Query  529  IMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAG  350
               ADT+ A DEAIHDGVD++S S G  +PL A++D  + + F SFHAV+ GITV+ + G
Sbjct  280  TF-ADTMMAIDEAIHDGVDILSISLGLEIPLYADIDMRNGIAFASFHAVSKGITVICSGG  338

Query  349  NEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVV-----D  185
            NEGP  QTV    PWILTVAA++ DR FPT ITLGN QT  GQS++TGK+TG +     +
Sbjct  339  NEGPYPQTVVNISPWILTVAASSIDRSFPTLITLGNNQTFSGQSMYTGKETGFIGIAHQE  398

Query  184  LVFLPD-KFCETLTTTDTWIAGKVVLCFTGK  95
            +  L D +FC  L T DTW AGKVVLCF  K
Sbjct  399  ISELEDTRFCNNLNTNDTWAAGKVVLCFIVK  429



>ref|XP_010421966.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=762

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 144/223 (65%), Gaps = 6/223 (3%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +YISPRD  GHGTH SST  GS V+NVSY GL  GT RGGAPR  +AIYK  W  G+  G
Sbjct  207  EYISPRDFNGHGTHVSSTVGGSYVANVSYLGLGRGTVRGGAPRVHIAIYKACWLHGVCSG  266

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD LKA DEAI+DGVDV+S S G NVPL  E D  + L  G+FHAVA GI VV +AGN G
Sbjct  267  ADVLKAIDEAINDGVDVLSLSLGLNVPLYQETDMRELLSVGAFHAVAKGIPVVASAGNNG  326

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDKF  161
            P AQT+S   PWILTVAA T DR FPT ITLGN  T++GQ++F G   G V+L  +PDK 
Sbjct  327  PGAQTISNVAPWILTVAATTQDRSFPTIITLGNNITILGQAIFAGPALGFVELT-IPDKP  385

Query  160  ----CETLT-TTDTWIAGKVVLCFTGKHGLDIDVEGIVAQSRA  47
                C  L       + GKVVLCFT        V GI+A   A
Sbjct  386  FSSDCAELPGNPKHTMEGKVVLCFTADSNAGAIVNGILAVKNA  428



>ref|XP_009114845.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=772

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 147/219 (67%), Gaps = 15/219 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            DYISPRD  GHGTH +S A GS V NVSYKGLA GT RGGAPRAR+A+YK  W     EG
Sbjct  205  DYISPRDFNGHGTHVASIAGGSFVPNVSYKGLAGGTLRGGAPRARIAMYKACWYLEELEG  264

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 +D +KA D+AIHDGVDV+S S G+ VPL +E D  D +  G+FHAVA+GITVV A
Sbjct  265  VTCSFSDIMKAMDDAIHDGVDVLSLSLGSRVPLFSETDMRDGIATGAFHAVANGITVVCA  324

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GP+AQTV    PWILTVAA T DR F TPITLGN + ++GQ+++TG + G   LV+
Sbjct  325  GGNAGPSAQTVVNTAPWILTVAATTLDRSFATPITLGNNKVILGQAMYTGPELGFTSLVY  384

Query  175  LPDK---------FCETLT-TTDTWIAGKVVLCFTGKHG  89
              D           CE+L   ++  +AGK+VLCFT   G
Sbjct  385  PEDPGNSNDTFTGECESLNLNSNRTMAGKIVLCFTTTRG  423



>ref|XP_006397048.1| hypothetical protein EUTSA_v10028454mg [Eutrema salsugineum]
 gb|ESQ38501.1| hypothetical protein EUTSA_v10028454mg [Eutrema salsugineum]
Length=764

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 143/216 (66%), Gaps = 2/216 (1%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-EGGIIM  524
            +Y+SPRD  GHGTH SST  GS + NVSY GL  G+ RGGAP  RLAIYK  W + G+  
Sbjct  211  EYLSPRDFSGHGTHVSSTIGGSFLPNVSYLGLGRGSVRGGAPGVRLAIYKACWLQSGVCS  270

Query  523  GADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNE  344
            GAD LKA DEAIHDGVDV+S S G+ VPL +E D  +    G+FHAVA GI VV AAGN 
Sbjct  271  GADVLKAIDEAIHDGVDVLSLSLGSKVPLYSETDVRELTSVGAFHAVAKGIPVVAAAGNA  330

Query  343  GPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDK  164
            GP AQT+S   PWILTVAA T DR FPT ITLGN  T++GQ++F G + G V L +    
Sbjct  331  GPMAQTISNVAPWILTVAATTLDRSFPTAITLGNNMTILGQAIFAGPELGFVGLAYPLSG  390

Query  163  FCETLTTT-DTWIAGKVVLCFTGKHGLDIDVEGIVA  59
             CE L+   +  + GKVVLCFT +  +   +  I A
Sbjct  391  DCEKLSANPNKTMEGKVVLCFTTETTVPPVINAITA  426



>ref|XP_009128710.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=764

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 146/221 (66%), Gaps = 2/221 (1%)
 Frame = -3

Query  703  ADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-EGGII  527
            A+Y SPRD  GHGTH SST  GS +  VSY GL  GT +GGAP  RLAIYK  W + G  
Sbjct  210  AEYASPRDFNGHGTHVSSTIGGSFLPGVSYLGLGRGTVKGGAPGVRLAIYKACWLQSGSC  269

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
             GAD LKA DEAIHDGVDV+S S G+ VPL +E D  +    G+FHAVA GI VV AAGN
Sbjct  270  SGADVLKAIDEAIHDGVDVLSLSLGSKVPLYSETDVRELTSVGAFHAVAKGIPVVAAAGN  329

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPD  167
            +GP+AQT+S   PWILTVAA T DR FPT ITLGN  T++GQ++F G + G  DL +   
Sbjct  330  DGPSAQTISNVAPWILTVAATTLDRSFPTAITLGNNITILGQAIFAGPELGYSDLTYPQS  389

Query  166  KFCETLTTT-DTWIAGKVVLCFTGKHGLDIDVEGIVAQSRA  47
              C+ L+   +  + GKVVLCFT +  +   V+ I+A   A
Sbjct  390  GDCQKLSANPNNTMEGKVVLCFTRETSVTPAVDAIIAVRNA  430



>emb|CDY25259.1| BnaA02g21970D [Brassica napus]
Length=742

 Score =   223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 146/221 (66%), Gaps = 2/221 (1%)
 Frame = -3

Query  703  ADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-EGGII  527
            A+Y SPRD  GHGTH SST  GS +  VSY GL  GT +GGAP  RLAIYK  W + G  
Sbjct  199  AEYASPRDFNGHGTHVSSTIGGSFLPGVSYLGLGRGTVKGGAPGVRLAIYKACWLQSGSC  258

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
             GAD LKA DEAIHDGVDV+S S G+ VPL +E D  +    G+FHAVA GI VV AAGN
Sbjct  259  SGADVLKAIDEAIHDGVDVLSLSLGSKVPLYSETDVRELTSVGAFHAVAKGIPVVAAAGN  318

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPD  167
            +GP+AQT+S   PWILTVAA T DR FPT ITLGN  T++GQ++F G + G  DL +   
Sbjct  319  DGPSAQTISNVAPWILTVAATTLDRSFPTAITLGNNITILGQAIFAGPELGYSDLTYPQS  378

Query  166  KFCETLTTT-DTWIAGKVVLCFTGKHGLDIDVEGIVAQSRA  47
              C+ L+   +  + GKVVLCFT +  +   V+ I+A   A
Sbjct  379  GDCQKLSANPNNTMEGKVVLCFTRETSVTPAVDAIIAVRNA  419



>gb|KFK45040.1| hypothetical protein AALP_AA1G336300 [Arabis alpina]
Length=776

 Score =   223 bits (569),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 139/219 (63%), Gaps = 15/219 (7%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW---  542
            T   DYIS RD  GHGTH +S A GS V NVSYKGLA GT RGGAPRAR+AIYK  W   
Sbjct  205  TNSRDYISARDYIGHGTHVASIAGGSFVPNVSYKGLAGGTVRGGAPRARIAIYKACWYVD  264

Query  541  --EGGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGIT  368
                     +D LKA DEA+HDGVDV+S S GA VPL  E D  D +  G+FHAV  GI 
Sbjct  265  QLRDVTCSSSDILKAMDEAMHDGVDVLSLSLGAQVPLLPETDIRDRISIGAFHAVVKGIV  324

Query  367  VVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVV  188
            VV A GN GPAAQTV    PWILTVAA T DR FPTPITLGN + ++GQ+L+TG + G  
Sbjct  325  VVCAGGNSGPAAQTVVNTAPWILTVAATTLDRSFPTPITLGNNKMILGQALYTGPELGFT  384

Query  187  DLVFLPD---------KFCETLT-TTDTWIAGKVVLCFT  101
             LV+  D           CE L    +  +AGKVVLCFT
Sbjct  385  SLVYPEDPGTSNETFSSVCERLDFNPNRTMAGKVVLCFT  423



>ref|XP_002891020.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67279.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   223 bits (568),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 145/216 (67%), Gaps = 17/216 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW---EGGI  530
            DYIS RD  GHGTHT+S A GS V N+SYKGLA G  RGGAPRAR+AIYK  W   + GI
Sbjct  207  DYISARDFIGHGTHTASIAGGSFVPNISYKGLAGGNLRGGAPRARIAIYKACWYVDQLGI  266

Query  529  IM--GADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
            +    +D LKA DEA+HDGVDV+S S GA +PL  E D  D +  G+FHAVA GI VV A
Sbjct  267  VACSSSDILKAMDEAMHDGVDVLSLSLGAQIPLYPETDLRDRIATGAFHAVAKGIIVVCA  326

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GPAAQTV    PWILTVAA T DR FPTPITLGN + ++GQ+L+TG++ G   L +
Sbjct  327  GGNSGPAAQTVLNTAPWILTVAATTLDRSFPTPITLGNRKVILGQALYTGQELGFTSLGY  386

Query  175  LPDK----------FCETLTTT-DTWIAGKVVLCFT  101
             P+            CE+L    +  +AGKVVLCFT
Sbjct  387  -PENPGNTNETFSGVCESLNLNPNRTMAGKVVLCFT  421



>ref|XP_006287119.1| hypothetical protein CARUB_v10000289mg, partial [Capsella rubella]
 gb|EOA20017.1| hypothetical protein CARUB_v10000289mg, partial [Capsella rubella]
Length=758

 Score =   223 bits (567),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 143/223 (64%), Gaps = 6/223 (3%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +YISPRD  GHGTH +ST  GS V NVSY GL  G+ RGGAP  +LAIYK  W+ G   G
Sbjct  207  EYISPRDFHGHGTHVASTVGGSFVHNVSYLGLGRGSVRGGAPGVQLAIYKACWQDGTCSG  266

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
             D LKA DEAIHDGVDV+S S G  VPL  E D  +    G+FHAVA GITVV +AGN+G
Sbjct  267  VDVLKAIDEAIHDGVDVLSLSLGLKVPLYQETDVRELTSVGTFHAVAKGITVVASAGNDG  326

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDKF  161
            PAAQT+S   PWILTVAA T DR FPT ITLGN  T +GQ++F G + G VDL + P+K 
Sbjct  327  PAAQTISNVAPWILTVAATTLDRSFPTTITLGNNITTLGQAIFGGPELGFVDLTY-PEKP  385

Query  160  ----CETLTTT-DTWIAGKVVLCFTGKHGLDIDVEGIVAQSRA  47
                C  L       + GKVVLCFT        V GI+A   A
Sbjct  386  LIGDCAGLAANPKNTMEGKVVLCFTADLSSAGLVNGIIAVKNA  428



>ref|XP_011081356.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Sesamum 
indicum]
Length=782

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 145/214 (68%), Gaps = 10/214 (5%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
            T + + +S RD +GHGTH SSTA G+ V+NVSY G+  GT RGGAPRARLAIYK+ W+  
Sbjct  218  TRLGEILSARDAEGHGTHVSSTAAGAYVANVSYDGVGLGTARGGAPRARLAIYKVCWKLS  277

Query  538  GGIIMGADTLKAFDEAIHDGVDVISASFGA-NVPLSAEVDPNDSLHFGSFHAVAHGITVV  362
            GG    AD LKAFDEAI DGV V++ S  A ++PL +EVD  D++  GSFHA+A GITVV
Sbjct  278  GGQCASADILKAFDEAIKDGVHVLTLSIAAASLPLYSEVDGRDAIAIGSFHAIARGITVV  337

Query  361  TAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDL  182
              AGN+GP  QTV    PWI+TVAA+T DR +PT ITLGN +T  GQS++TGK+ G   L
Sbjct  338  CGAGNDGPLPQTVKNTAPWIITVAASTMDRAYPTQITLGNNKTFQGQSIYTGKEEGFTGL  397

Query  181  VFLPD-------KFCETLTTTDTWIAGKVVLCFT  101
             +  D         CE L      +AGKVVLCFT
Sbjct  398  FYPADGGPDATAGVCEDLNLKPNLVAGKVVLCFT  431



>ref|XP_006306822.1| hypothetical protein CARUB_v10008364mg [Capsella rubella]
 gb|EOA39720.1| hypothetical protein CARUB_v10008364mg [Capsella rubella]
Length=770

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 142/211 (67%), Gaps = 11/211 (5%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            DYIS RD  GHGTH +STA GS V NVSYKGLA GT RGGAPRAR+A+YK  W     +G
Sbjct  207  DYISARDFDGHGTHVASTAGGSFVPNVSYKGLAGGTLRGGAPRARIAMYKACWYLEEVDG  266

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
               + +D +KA DEA+HDGVDV+S S    VPL  E D ++    G FHAVA GI VV A
Sbjct  267  VTCLNSDIMKAIDEAMHDGVDVLSISLTGEVPLLPETDLSNEFATGLFHAVAKGIVVVCA  326

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GP AQTV+   PWILTVAA T DR FPTPITLGN + ++GQ+ ++G + G+  LV+
Sbjct  327  GGNNGPEAQTVTNTAPWILTVAATTLDRSFPTPITLGNNKVILGQATYSGPELGLTSLVY  386

Query  175  LPDK-----FCETLTTT-DTWIAGKVVLCFT  101
              D       CE+L    ++ +AGKVVLCFT
Sbjct  387  PADAENSSGVCESLNLNPNSTMAGKVVLCFT  417



>ref|XP_010437012.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Camelina 
sativa]
Length=666

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 142/223 (64%), Gaps = 6/223 (3%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +YISPRD  GHGTH SST  GS V+NVSY GL  GT RGGAPR  +AIYK  W  G+  G
Sbjct  111  EYISPRDFNGHGTHVSSTVGGSYVANVSYLGLGSGTVRGGAPRVHIAIYKACWLHGVCSG  170

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD LKA DEAI+DGVDV+S S G  VPL  E D  + L  G+FHAV  GI VV +AGN G
Sbjct  171  ADVLKAMDEAINDGVDVLSLSLGLKVPLYQETDMRELLSVGAFHAVEKGIPVVASAGNNG  230

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDKF  161
            P AQT+S   PWILTVAA T DR FPT ITLGN  T++GQ++F G   G V+L  +PDK 
Sbjct  231  PGAQTISNVAPWILTVAATTQDRSFPTTITLGNNITILGQAIFGGPAVGFVELT-IPDKP  289

Query  160  ----CETLT-TTDTWIAGKVVLCFTGKHGLDIDVEGIVAQSRA  47
                C  L     + + GKVVLCFT          GI+A   A
Sbjct  290  FSTDCADLPGNPKSTMEGKVVLCFTADSNAGAMGNGILAVKNA  332



>emb|CDX99526.1| BnaC09g24660D [Brassica napus]
Length=753

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 143/211 (68%), Gaps = 12/211 (6%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            D+ISPRD  GHGTH ++ A GS++  +SYKGLA GT RGGAPRAR+A+YK  W+      
Sbjct  201  DFISPRDYDGHGTHVATIAGGSVLPGISYKGLAGGTVRGGAPRARIAMYKACWDDSGCYS  260

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD LKA DEAIHDGVDV+S S G  VP   E D  D++  G+FHAV  GITVV + GN G
Sbjct  261  ADILKAMDEAIHDGVDVLSLSLGYRVPYFPETDVRDAIATGAFHAVLKGITVVCSGGNSG  320

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDK-  164
            PAAQTV  A PWILTVAA T DR FPTP+TLGN + ++GQ+++TG + G   LV+ P+  
Sbjct  321  PAAQTVGNAAPWILTVAATTLDRSFPTPLTLGNNKVILGQAMYTGPELGFTSLVY-PENP  379

Query  163  ---------FCETLT-TTDTWIAGKVVLCFT  101
                      CE L   +++ + GKVVLCFT
Sbjct  380  GNSNESFYGTCELLLFNSNSTMEGKVVLCFT  410



>ref|NP_564412.1| Subtilase 3.5 [Arabidopsis thaliana]
 sp|Q9MAP7.1|SBT35_ARATH RecName: Full=Subtilisin-like protease SBT3.5; AltName: Full=Subtilase 
subfamily 3 member 5; Short=AtSBT3.5; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF31278.1|AC006424_7 First of four adjacent putative subtilase family > [Arabidopsis 
thaliana]
 gb|AAL67022.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AAP04132.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEE31542.1| Subtilase 3.5 [Arabidopsis thaliana]
Length=774

 Score =   221 bits (563),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 143/216 (66%), Gaps = 17/216 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE----GG  533
            DYIS RD  GHGTHT+S A GS V N+SYKGLA G  RGGAPRAR+AIYK  W     G 
Sbjct  207  DYISARDFIGHGTHTASIAGGSFVPNISYKGLAGGNLRGGAPRARIAIYKACWYVDQLGA  266

Query  532  I-IMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
            +    +D LKA DE++HDGVDV+S S GA +PL  E D  D +  G+FHAVA GI VV A
Sbjct  267  VACSSSDILKAMDESMHDGVDVLSLSLGAQIPLYPETDLRDRIATGAFHAVAKGIIVVCA  326

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GPAAQTV    PWI+TVAA T DR FPTPITLGN + ++GQ+L+TG++ G   LV+
Sbjct  327  GGNSGPAAQTVLNTAPWIITVAATTLDRSFPTPITLGNRKVILGQALYTGQELGFTSLVY  386

Query  175  LPDK----------FCETLTTT-DTWIAGKVVLCFT  101
             P+            CE L    +  +AGKVVLCFT
Sbjct  387  -PENAGFTNETFSGVCERLNLNPNRTMAGKVVLCFT  421



>ref|XP_009128706.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X3 [Brassica 
rapa]
Length=643

 Score =   219 bits (558),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 144/216 (67%), Gaps = 17/216 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            D+ISPRD+ GHGTH ++ A GS V ++SYKGLA GT RGGAPRAR+A+YK  W     + 
Sbjct  76   DFISPRDLNGHGTHVATIAAGSYVQDISYKGLAGGTVRGGAPRARIAMYKGCWYLDDLDI  135

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEAIHDGVDV+S S G+ VPL  E D  D +  G+FHAV  GITVV A
Sbjct  136  TTCSSADILKAMDEAIHDGVDVLSLSLGSVVPLHGETDIRDGISTGAFHAVLKGITVVCA  195

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GP AQTV+   PWI+TVAA T DR FPTPITLGN + ++GQ+++TG + G   LV+
Sbjct  196  GGNSGPEAQTVTNTAPWIVTVAATTLDRSFPTPITLGNNKVILGQAMYTGPELGFTSLVY  255

Query  175  LPDK---------FCE--TLTTTDTWIAGKVVLCFT  101
              D           CE  +L + DT + GKVVLCFT
Sbjct  256  PEDPGNSNETFSGTCEDLSLNSNDTMV-GKVVLCFT  290



>emb|CDY36894.1| BnaC07g01060D [Brassica napus]
Length=539

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 142/215 (66%), Gaps = 15/215 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            D+ISPRD+ GHGTH ++ A GS V ++SYKGLA G  RGGAPRAR+A+YK  W     + 
Sbjct  145  DFISPRDLNGHGTHVATIAAGSYVQDISYKGLAGGVVRGGAPRARIAMYKGCWYLDDLDI  204

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEAIHDGVDV+S S G+ VPL  E D  D +  G+FHAV  GITVV A
Sbjct  205  TTCSSADILKAMDEAIHDGVDVLSLSLGSVVPLHGETDIRDGISTGAFHAVLKGITVVCA  264

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GP AQTV+   PWI+TV+A T DR FPTPITLGN + ++GQ+++TG + G   LV+
Sbjct  265  GGNSGPEAQTVTNTAPWIVTVSATTLDRSFPTPITLGNNKVILGQAMYTGPELGFTSLVY  324

Query  175  LPDK---------FCETLT-TTDTWIAGKVVLCFT  101
              D           CE L+  ++  + GKVVLCFT
Sbjct  325  PEDPGNSNETFSGTCEDLSLNSNATMVGKVVLCFT  359



>ref|XP_010437005.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Camelina 
sativa]
Length=762

 Score =   221 bits (562),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 142/223 (64%), Gaps = 6/223 (3%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +YISPRD  GHGTH SST  GS V+NVSY GL  GT RGGAPR  +AIYK  W  G+  G
Sbjct  207  EYISPRDFNGHGTHVSSTVGGSYVANVSYLGLGSGTVRGGAPRVHIAIYKACWLHGVCSG  266

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD LKA DEAI+DGVDV+S S G  VPL  E D  + L  G+FHAV  GI VV +AGN G
Sbjct  267  ADVLKAMDEAINDGVDVLSLSLGLKVPLYQETDMRELLSVGAFHAVEKGIPVVASAGNNG  326

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDKF  161
            P AQT+S   PWILTVAA T DR FPT ITLGN  T++GQ++F G   G V+L  +PDK 
Sbjct  327  PGAQTISNVAPWILTVAATTQDRSFPTTITLGNNITILGQAIFGGPAVGFVELT-IPDKP  385

Query  160  ----CETLT-TTDTWIAGKVVLCFTGKHGLDIDVEGIVAQSRA  47
                C  L     + + GKVVLCFT          GI+A   A
Sbjct  386  FSTDCADLPGNPKSTMEGKVVLCFTADSNAGAMGNGILAVKNA  428



>ref|XP_009128705.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
 ref|XP_009128707.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
 ref|XP_009128709.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
Length=723

 Score =   220 bits (560),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 144/216 (67%), Gaps = 17/216 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            D+ISPRD+ GHGTH ++ A GS V ++SYKGLA GT RGGAPRAR+A+YK  W     + 
Sbjct  156  DFISPRDLNGHGTHVATIAAGSYVQDISYKGLAGGTVRGGAPRARIAMYKGCWYLDDLDI  215

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEAIHDGVDV+S S G+ VPL  E D  D +  G+FHAV  GITVV A
Sbjct  216  TTCSSADILKAMDEAIHDGVDVLSLSLGSVVPLHGETDIRDGISTGAFHAVLKGITVVCA  275

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GP AQTV+   PWI+TVAA T DR FPTPITLGN + ++GQ+++TG + G   LV+
Sbjct  276  GGNSGPEAQTVTNTAPWIVTVAATTLDRSFPTPITLGNNKVILGQAMYTGPELGFTSLVY  335

Query  175  LPDK---------FCE--TLTTTDTWIAGKVVLCFT  101
              D           CE  +L + DT + GKVVLCFT
Sbjct  336  PEDPGNSNETFSGTCEDLSLNSNDTMV-GKVVLCFT  370



>emb|CDX86874.1| BnaA09g22640D [Brassica napus]
Length=747

 Score =   220 bits (560),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 143/211 (68%), Gaps = 12/211 (6%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            D+ISPRD  GHGTH ++ A GS++  +SYKGLA GT RGGAPRAR+A+YK  W+      
Sbjct  195  DFISPRDYDGHGTHVATIAGGSVLPGISYKGLAGGTVRGGAPRARIAMYKACWDDSGCYS  254

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD LKA DEAIHDGVDV+S S G  VP   E D  D++  G+FHAV  GITVV + GN G
Sbjct  255  ADILKAMDEAIHDGVDVLSLSLGYRVPYFPETDVRDAIATGAFHAVLKGITVVCSGGNSG  314

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDK-  164
            PAAQTV  A PWILTVAA T DR FPTP+TLGN + ++GQ+++TG + G   LV+ P+  
Sbjct  315  PAAQTVGNAAPWILTVAATTLDRSFPTPLTLGNNKVILGQAMYTGPELGFTGLVY-PENP  373

Query  163  ---------FCETL-TTTDTWIAGKVVLCFT  101
                      CE L   +++ + GKVVLCFT
Sbjct  374  GNSNESFSGTCEFLDINSNSTMRGKVVLCFT  404



>ref|XP_002891021.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67280.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   220 bits (560),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 142/215 (66%), Gaps = 15/215 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            DYIS RD  GHGTH +ST  GSLV NVSYKGLA GT RGGAPRAR+A+YK  W     +G
Sbjct  207  DYISARDFDGHGTHVASTVGGSLVPNVSYKGLAKGTLRGGAPRARIAMYKACWYLNELDG  266

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 +D +KA DEAIHDGVDV+S S G  +PL++E D  D +  G+FHAV+ GI VV A
Sbjct  267  VTCSFSDIMKAIDEAIHDGVDVLSLSLGGRIPLNSETDLRDGIATGAFHAVSKGIVVVCA  326

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GPA+QTV    PWI+TVAA T DR F TPI LGN Q ++GQ+++TG + G   LV+
Sbjct  327  GGNAGPASQTVVNTAPWIVTVAATTLDRSFATPIILGNNQVILGQAMYTGPELGFTSLVY  386

Query  175  LPDK---------FCETLTTT-DTWIAGKVVLCFT  101
              D           CE+L    +  +AGKVVLCFT
Sbjct  387  PEDPGNSYDTFSGVCESLNLNPNHTMAGKVVLCFT  421



>ref|XP_002891022.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67281.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   220 bits (560),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 140/215 (65%), Gaps = 15/215 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            DYIS RD  GHGTH +S A GS V NVSYKGLA GT RGGAPRAR+A+YK  W     EG
Sbjct  207  DYISARDFDGHGTHVASIAGGSFVPNVSYKGLAGGTLRGGAPRARVAMYKACWFQEELEG  266

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 +D +KA DEA+HDGVDV+S S    VPL++E D  D    G FHAVA GI VV A
Sbjct  267  VTCSNSDIMKAIDEAMHDGVDVLSISLVGRVPLNSETDLRDEFATGLFHAVAKGIVVVCA  326

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GPAAQTV    PWI+TVAA T DR FPTPITLGN + ++GQ+ +TG + G+  L +
Sbjct  327  GGNAGPAAQTVVNIAPWIITVAATTLDRSFPTPITLGNNKVILGQATYTGPELGLTSLFY  386

Query  175  LPDK---------FCETLTTT-DTWIAGKVVLCFT  101
              D+          CE+L    +  +AGKVVLCFT
Sbjct  387  PEDERNSNETFSGVCESLNLNPNRTMAGKVVLCFT  421



>emb|CDY67954.1| BnaAnng25710D [Brassica napus]
Length=775

 Score =   220 bits (560),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 145/216 (67%), Gaps = 17/216 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            D+ISPRD+ GHGTH ++ A GS V ++SYKGL+ GT RGGAPRAR+A+YK  W     + 
Sbjct  212  DFISPRDLNGHGTHVATIAAGSYVQDISYKGLSGGTVRGGAPRARIAMYKGCWYLDDLDI  271

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEAIHDGVDV+S S G+ VPL  E+D  D +  G+FHAV  GITVV A
Sbjct  272  TTCSSADILKAMDEAIHDGVDVLSLSLGSVVPLHGEIDIRDGISTGAFHAVLKGITVVCA  331

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GP AQTV+   PWI+TVAA T DR FPTPITLGN + ++GQ+++TG + G   LV+
Sbjct  332  GGNSGPEAQTVTNTAPWIVTVAATTLDRSFPTPITLGNNKVILGQAMYTGPELGFTSLVY  391

Query  175  LPDK---------FCE--TLTTTDTWIAGKVVLCFT  101
              D           CE  +L + DT + GKVVLCFT
Sbjct  392  PEDPGNSNETFSGTCEDLSLNSNDTMV-GKVVLCFT  426



>ref|XP_009128704.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Brassica 
rapa]
Length=779

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 144/216 (67%), Gaps = 17/216 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            D+ISPRD+ GHGTH ++ A GS V ++SYKGLA GT RGGAPRAR+A+YK  W     + 
Sbjct  212  DFISPRDLNGHGTHVATIAAGSYVQDISYKGLAGGTVRGGAPRARIAMYKGCWYLDDLDI  271

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEAIHDGVDV+S S G+ VPL  E D  D +  G+FHAV  GITVV A
Sbjct  272  TTCSSADILKAMDEAIHDGVDVLSLSLGSVVPLHGETDIRDGISTGAFHAVLKGITVVCA  331

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GP AQTV+   PWI+TVAA T DR FPTPITLGN + ++GQ+++TG + G   LV+
Sbjct  332  GGNSGPEAQTVTNTAPWIVTVAATTLDRSFPTPITLGNNKVILGQAMYTGPELGFTSLVY  391

Query  175  LPDK---------FCE--TLTTTDTWIAGKVVLCFT  101
              D           CE  +L + DT + GKVVLCFT
Sbjct  392  PEDPGNSNETFSGTCEDLSLNSNDTMV-GKVVLCFT  426



>ref|XP_010529677.1| PREDICTED: subtilisin-like protease SBT3.3 [Tarenaya hassleriana]
Length=767

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 145/213 (68%), Gaps = 11/213 (5%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-EGGIIM  524
            +Y+SPRD  GHGTH S+ A GS V+NVSY G   GT RGGAP AR+A+YK  W + G  M
Sbjct  209  EYVSPRDFNGHGTHVSTIAAGSFVANVSYGGFGKGTARGGAPLARIAMYKACWLQVGTCM  268

Query  523  GADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNE  344
            G+D LKA DEAIHDGVDVIS S    +PL +E++  D +  GSFHAV+ GI VV AAGN+
Sbjct  269  GSDLLKAIDEAIHDGVDVISISVAFPIPLFSEIEIRDGISVGSFHAVSKGILVVCAAGNK  328

Query  343  GPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLP--  170
            GPAAQTV    PW+LTVAA T DR FPT ITLGN  T+ GQ+++ G + G   LV+    
Sbjct  329  GPAAQTVVNTAPWVLTVAATTLDRSFPTSITLGNNITMQGQAMYVGPELGFTGLVYPENP  388

Query  169  ----DKF---CETLTTT-DTWIAGKVVLCFTGK  95
                ++F   CE L+   ++ +AGKVVLCFT K
Sbjct  389  GTGDEEFSGDCERLSVNPNSTMAGKVVLCFTAK  421



>ref|NP_564414.2| Subtilase family protein SBT3.3 [Arabidopsis thaliana]
 sp|Q9MAP5.1|SBT33_ARATH RecName: Full=Subtilisin-like protease SBT3.3; AltName: Full=Subtilase 
subfamily 3 member 3; Short=AtSBT3.3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF31276.1|AC006424_5 Third of four adjacent putative subtilase family > [Arabidopsis 
thaliana]
 gb|AAM20591.1| subtilase, putative [Arabidopsis thaliana]
 gb|AAQ56790.1| At1g32960 [Arabidopsis thaliana]
 gb|AEE31544.1| Subtilase family protein SBT3.3 [Arabidopsis thaliana]
Length=777

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 141/219 (64%), Gaps = 17/219 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            DYIS RD  GHGTH +S A GS V NVSYKGLA GT RGGAPRAR+A+YK  W     +G
Sbjct  210  DYISARDFDGHGTHVASIAGGSFVPNVSYKGLAGGTLRGGAPRARIAMYKACWFHEELKG  269

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 +D +KA DEAIHDGVDV+S S    +PL++E D  D    G FHAVA GI VV A
Sbjct  270  VTCSDSDIMKAIDEAIHDGVDVLSISLVGQIPLNSETDIRDEFATGLFHAVAKGIVVVCA  329

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN+GPAAQTV    PWILTVAA T DR FPTPITLGN + ++GQ+ +TG + G+  LV+
Sbjct  330  GGNDGPAAQTVVNIAPWILTVAATTLDRSFPTPITLGNNKVILGQATYTGPELGLTSLVY  389

Query  175  LPDK----------FCETLTTTDTW-IAGKVVLCFTGKH  92
             P+            CE+L     + +A KVVLCFT   
Sbjct  390  -PENARNNNETFSGVCESLNLNPNYTMAMKVVLCFTASR  427



>ref|XP_006397045.1| hypothetical protein EUTSA_v10028448mg [Eutrema salsugineum]
 gb|ESQ38498.1| hypothetical protein EUTSA_v10028448mg [Eutrema salsugineum]
Length=777

 Score =   218 bits (555),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 142/216 (66%), Gaps = 17/216 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            D+ISPRD+ GHGTH ++ A GS V N+SYKGLA GT RGGAP AR+A+YK  W     E 
Sbjct  210  DFISPRDLNGHGTHVATIAGGSYVPNISYKGLAGGTVRGGAPHARIAMYKTCWYLDDSEI  269

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEAIHDGVDV+S S G+ VPL  E D  D +  G+FHAV  GITVV A
Sbjct  270  TTCSAADILKAMDEAIHDGVDVLSISLGSEVPLYGETDIRDGITTGAFHAVLKGITVVCA  329

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GP AQTV+   PWILTVAA T DR FPTPITLGN + ++GQ+++TG +     LV+
Sbjct  330  GGNSGPQAQTVTNIAPWILTVAATTLDRSFPTPITLGNNKVILGQAIYTGPEIDFTSLVY  389

Query  175  LPDK----------FCETLT-TTDTWIAGKVVLCFT  101
             P+            CE L+  ++  + GKVVLCFT
Sbjct  390  -PENPGKSSESFSGTCEELSVNSNRTMMGKVVLCFT  424



>emb|CDX94251.1| BnaC02g29110D [Brassica napus]
Length=761

 Score =   217 bits (552),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 143/216 (66%), Gaps = 17/216 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            D+ISPRD+ GHGTH ++ A G  V ++SYKGLA G  RGGAPRAR+A+YK  W     + 
Sbjct  212  DFISPRDLNGHGTHVATIAAGYYVQDISYKGLAGGVVRGGAPRARIAMYKGCWYLDDLDI  271

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEAIHDGVDV+S S G+ VPL  E+D  D +  G+FHAV  GITVV A
Sbjct  272  TTCSSADILKAMDEAIHDGVDVLSLSLGSVVPLHGEIDIRDGISTGAFHAVLKGITVVCA  331

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GP AQTV+   PWI+TVAA T DR FPTPITLGN + ++GQ+++TG + G   LV+
Sbjct  332  GGNSGPEAQTVTNTAPWIVTVAATTLDRSFPTPITLGNNKVILGQAMYTGPELGFTSLVY  391

Query  175  LPDK---------FCE--TLTTTDTWIAGKVVLCFT  101
              D           CE  +L + DT + GKVVLCFT
Sbjct  392  PEDPGNSNETFSGTCEDLSLNSNDTMV-GKVVLCFT  426



>gb|KFK31852.1| hypothetical protein AALP_AA6G166800 [Arabis alpina]
Length=1462

 Score =   221 bits (562),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 140/204 (69%), Gaps = 2/204 (1%)
 Frame = -3

Query  700   DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-EGGIIM  524
             +Y SPRD  GHGTH +ST  GS + NVSY GL  GT RGGAP  R+AIYK  W   G   
Sbjct  914   EYASPRDFNGHGTHVASTIGGSFLPNVSYLGLGRGTARGGAPGIRIAIYKACWLRSGSCS  973

Query  523   GADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNE  344
             GAD LKA DEAIHDGVDV+S S G+ VPL  E D  +    G+FHAVA GI VV AAGN+
Sbjct  974   GADVLKAIDEAIHDGVDVLSLSLGSKVPLFPETDVRELTSVGAFHAVAKGIPVVAAAGND  1033

Query  343   GPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDK  164
             GPAAQT++   PWILTVAA+T DR FPT ITLGN  T++GQ++F G +   V L +   +
Sbjct  1034  GPAAQTIANVAPWILTVAASTLDRSFPTAITLGNNITILGQAIFGGPELDFVGLAYPLSR  1093

Query  163   FCETLTTT-DTWIAGKVVLCFTGK  95
              CE L+T+ D  I GKVVLCFT +
Sbjct  1094  DCEDLSTSPDNTIEGKVVLCFTTR  1117


 Score =   204 bits (519),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 138/215 (64%), Gaps = 16/215 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            D+ISPR   GHGTH ++ A GS V N SYKGLA GT RGGAPRA +A+YK  W     + 
Sbjct  213  DFISPRAYNGHGTHVATIAGGSYVPNTSYKGLAGGTVRGGAPRAHIAVYKTCWYLDDLDA  272

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
             +   AD LKA DEAI+DGVDV+S S G   PL AE D  D +  G+FHAV  GITVV A
Sbjct  273  TLCSSADILKAMDEAIYDGVDVLSLSLGYE-PLFAETDVRDGISTGAFHAVLKGITVVCA  331

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
            AGN GPAAQTV+   PWI+TVAA T DR F TP+TLGN + ++GQ+++ G + G   LV+
Sbjct  332  AGNAGPAAQTVTNLAPWIITVAATTLDRSFATPMTLGNNRVILGQAMYAGPELGFTSLVY  391

Query  175  LPDK---------FCETLTTT-DTWIAGKVVLCFT  101
              +           CE L    +  +AGKVVLCFT
Sbjct  392  PENPENSNQNFSGVCERLLINPNHTMAGKVVLCFT  426



>emb|CDX93808.1| BnaA09g24080D [Brassica napus]
Length=748

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 144/215 (67%), Gaps = 15/215 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE----GG  533
            DY S RD  GHGTH +STA GS + +VSYKGLA GT RGGAPRAR+A+YK  W     GG
Sbjct  181  DYSSARDFVGHGTHVASTAGGSYIPDVSYKGLARGTMRGGAPRARIAMYKACWYLEELGG  240

Query  532  IIMGA-DTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
            +   + D LKA D+AIHDGVDV+S S G+ +PL++E D  D++  GSFHAVA GITVV A
Sbjct  241  VTCSSSDILKAIDDAIHDGVDVLSLSLGSRIPLNSETDLPDAIAIGSFHAVAKGITVVCA  300

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GP+AQT++   PWILTVAA T DR F TPI LGN + ++GQ+++T  + G   LV+
Sbjct  301  GGNAGPSAQTIANTAPWILTVAATTLDRSFATPIILGNKKVILGQAMYTAPNLGFTSLVY  360

Query  175  LPDK---------FCETLTTTDTW-IAGKVVLCFT  101
              D           CE+L       +AGKVVLCFT
Sbjct  361  PEDPGNSNETFNGDCESLNFIPIRAMAGKVVLCFT  395



>ref|XP_002298973.2| subtilase family protein [Populus trichocarpa]
 gb|EEE83778.2| subtilase family protein [Populus trichocarpa]
Length=786

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/232 (50%), Positives = 147/232 (63%), Gaps = 28/232 (12%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
            +G  ++ SPRD  GHGTHT+STA G+ + +VSY+GLA GT RGGAPRARLAIYK+ W   
Sbjct  203  SGNREFFSPRDANGHGTHTASTAAGTFIDDVSYRGLALGTIRGGAPRARLAIYKVCWNVL  262

Query  538  GGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVT  359
            GG    AD LKAFDEAIHDGVDV+S S G+++PL +++D  D +  GSFHAVA GITVV 
Sbjct  263  GGQCSSADILKAFDEAIHDGVDVLSLSIGSSIPLFSDIDERDGIATGSFHAVAKGITVVC  322

Query  358  AAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLM--GQSL----------  215
             A N+GP AQTV    PWILTVAA++ DR  PTPITLGN +T +  G SL          
Sbjct  323  GAANDGPFAQTVQNTAPWILTVAASSMDRALPTPITLGNNKTFLQHGSSLKPLHSKLNCL  382

Query  214  --------------FTGKDTGVVDLVFLPDKFCETLTTTDTWIAGKVVLCFT  101
                          F     G   + +  +  C+ L+  ++ +AGKVVLCFT
Sbjct  383  TVEPMISAQATTLNFHTNLAGPSHIFWKGNCVCQFLSVDNSMVAGKVVLCFT  434



>ref|XP_009114847.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=774

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 139/219 (63%), Gaps = 15/219 (7%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
            TG  DYIS RD  GHGTH +S A GS V NVSYKGLA G  RGGAPRAR+AIYK  W   
Sbjct  203  TGSRDYISARDFIGHGTHVASIAGGSFVPNVSYKGLAGGNLRGGAPRARIAIYKACWYVD  262

Query  538  --GGI-IMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGIT  368
              G +    +D LKA DEA+HDGVDV+S S GA VPL  E D  D +  G+FHAVA GI 
Sbjct  263  QLGAVACSSSDILKAMDEAMHDGVDVLSLSLGAQVPLFPETDLRDRIATGAFHAVAKGII  322

Query  367  VVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVV  188
            VV A GN GPAAQTV    PW++TVAA T DR F TPITLGN   ++GQ+L+TG + G  
Sbjct  323  VVCAGGNSGPAAQTVLNTAPWVITVAATTLDRSFLTPITLGNNNVILGQALYTGPEVGFT  382

Query  187  DLVFLPDK---------FCETLTTT-DTWIAGKVVLCFT  101
             LV+  +           CE L    +  + GKVVLCFT
Sbjct  383  SLVYPENSGHSNVTFSGVCERLNLNPNGTMRGKVVLCFT  421



>ref|XP_010542096.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Tarenaya hassleriana]
Length=812

 Score =   216 bits (549),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 140/219 (64%), Gaps = 15/219 (7%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW---  542
            T   DYISPRD  GHGTH ++ A GS + N+SYKGL  GT RGGAPRAR+A YK  W   
Sbjct  240  TETVDYISPRDYDGHGTHVATIAGGSFIPNISYKGLGQGTVRGGAPRARIAAYKACWYLD  299

Query  541  --EGGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGIT  368
              E      AD LKA DEAI+DG+DV+S S G  VPL  E D +D +  G+FHAV  GIT
Sbjct  300  SLESATCSSADILKAMDEAINDGIDVLSISLGIRVPLRLETDMSDGIATGAFHAVTKGIT  359

Query  367  VVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVV  188
            VV + GN GPAAQTV  A PWILTVAA T DR F T ITLGN  T++GQ+++TG+     
Sbjct  360  VVCSGGNAGPAAQTVVNAAPWILTVAATTLDRSFATAITLGNNLTILGQAMYTGRGLDFT  419

Query  187  DLVFLPDK---------FCETLT-TTDTWIAGKVVLCFT  101
             LV+  D           CE L   +++ +AGKVVLCFT
Sbjct  420  SLVYPEDPGNSNETFSGTCENLILNSNSTMAGKVVLCFT  458



>ref|XP_010499843.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Camelina sativa]
Length=1161

 Score =   218 bits (554),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 142/216 (66%), Gaps = 17/216 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE----GG  533
            DYIS RD  GHGTHTSS A GS V N+SYKGL+ G  RGGAPRAR+AIYK  W     G 
Sbjct  208  DYISARDFIGHGTHTSSIAGGSFVPNISYKGLSGGNLRGGAPRARVAIYKACWYVDQLGA  267

Query  532  I-IMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
            +    +D LKA DEA+HDGV+V+S S GA +PL  E D  D +  G+FHAVA GI VV A
Sbjct  268  VACSSSDILKAMDEAMHDGVNVLSLSLGAQIPLYPETDLRDRIATGAFHAVAKGIIVVCA  327

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GPAAQTV    PWILTVAA T DR FPTPITLGN + ++ Q+L+TG++ G   LV+
Sbjct  328  GGNSGPAAQTVLNTAPWILTVAATTLDRSFPTPITLGNRKVILSQALYTGQELGFTSLVY  387

Query  175  LPD----------KFCETL-TTTDTWIAGKVVLCFT  101
             P+            CE L    +  +AGKVVLCFT
Sbjct  388  -PEIAGNTNETFSGVCERLDLNPNRTMAGKVVLCFT  422


 Score =   180 bits (457),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 115/183 (63%), Gaps = 11/183 (6%)
 Frame = -3

Query  700   DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
             DYIS RD  GH TH +S A GS V NVSYKG       GGAPRAR+A+YK  W     + 
Sbjct  958   DYISARDFDGHRTHVASIAGGSFVPNVSYKG------XGGAPRARVAMYKACWYLEEVDR  1011

Query  535   GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                + +D +KA DEA+HD VDV+S S    VPL  E D  +    G FHAVA GI VV A
Sbjct  1012  VTCLNSDIMKAIDEAMHDSVDVLSISLVGQVPLLPETDMLNEFATGLFHAVAKGIVVVCA  1071

Query  355   AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
              GN GP AQTV    PWILTVAA T DR FPTPITLGN + ++GQ+ +TG + GV  LV+
Sbjct  1072  GGNNGPEAQTVVNIAPWILTVAATTLDRSFPTPITLGNNKVILGQATYTGPELGVTSLVY  1131

Query  175   LPD  167
               D
Sbjct  1132  PAD  1134



>ref|XP_009114844.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=774

 Score =   215 bits (547),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 144/215 (67%), Gaps = 15/215 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE----GG  533
            DY S RD  GHGTH +STA GS + +VSYKGLA GT RGGAPRAR+A+YK  W     GG
Sbjct  207  DYSSARDFVGHGTHVASTAGGSYIPDVSYKGLARGTMRGGAPRARIAMYKACWYLEELGG  266

Query  532  IIMGA-DTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
            +   + D LKA D+AIHDGVDV+S S G+ +PL++E D  D++  GSFHAVA GITVV A
Sbjct  267  VTCSSSDILKAIDDAIHDGVDVLSLSLGSRIPLNSETDLPDAIAIGSFHAVAKGITVVCA  326

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GP+AQT++   PWILTVAA T DR F TPI LGN + ++GQ+++T  + G   LV+
Sbjct  327  GGNAGPSAQTIANTAPWILTVAATTLDRSFATPIILGNKKVILGQAMYTAPNLGFTSLVY  386

Query  175  LPDK---------FCETLTTTDTW-IAGKVVLCFT  101
              D           CE+L       +AGKVVLCFT
Sbjct  387  PEDPGNSNETFNGDCESLNFIPIRAMAGKVVLCFT  421



>ref|XP_006397047.1| hypothetical protein EUTSA_v10028468mg [Eutrema salsugineum]
 gb|ESQ38500.1| hypothetical protein EUTSA_v10028468mg [Eutrema salsugineum]
Length=723

 Score =   214 bits (545),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 141/216 (65%), Gaps = 17/216 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            D+ISPRD  GHGTH ++ A GS + ++SYKGLA GT RGGAPRAR+A+YK  W     + 
Sbjct  156  DFISPRDFDGHGTHVATIAGGSALPSISYKGLAGGTVRGGAPRARIAMYKACWYLDSLDI  215

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEAIHDGVDV+S S G  VP   E D  D +  G+FHAV  GITVV +
Sbjct  216  TTCSSADLLKAMDEAIHDGVDVLSLSIGYRVPFYPETDIRDGIATGAFHAVLKGITVVCS  275

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GPAAQTV    PWILTVAA T DR FPTPITLGN + ++GQ+++TG + G   LV+
Sbjct  276  GGNSGPAAQTVGNTAPWILTVAATTLDRSFPTPITLGNNKVILGQAMYTGPELGFTSLVY  335

Query  175  LPDK----------FCET-LTTTDTWIAGKVVLCFT  101
             P+            CE  L  ++  +AGKVVLCFT
Sbjct  336  -PENPGNSNESFSGTCERLLINSNLTMAGKVVLCFT  370



>ref|XP_002298974.2| hypothetical protein POPTR_0001s45470g [Populus trichocarpa]
 gb|EEE83779.2| hypothetical protein POPTR_0001s45470g [Populus trichocarpa]
Length=749

 Score =   214 bits (546),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 143/220 (65%), Gaps = 18/220 (8%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
            +G  +++SPRD  GHGTH +STA G+ V NVSYKGL  GT RGGAPRA+LAIYK+ W   
Sbjct  205  SGNQEFLSPRDANGHGTHLASTAAGAFVDNVSYKGLGLGTARGGAPRAQLAIYKVCWSVF  264

Query  538  GGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVT  359
            GG    AD LKAFDEAIHDGVDV+S S G   PL +++D    + FGSFHAVA GITVV 
Sbjct  265  GGWCSAADVLKAFDEAIHDGVDVLSLSLGLPPPLFSDIDKRGGIDFGSFHAVAKGITVVC  324

Query  358  AAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQT--------------LMGQ  221
            +AGN+GP+AQTV    PWIL+VAA+T DR FPT ITLGN +T               +  
Sbjct  325  SAGNDGPSAQTVLNTAPWILSVAASTIDRAFPTSITLGNNKTFLVFLHCSKSLRFGFLTT  384

Query  220  SLFTGKDTGVVDLVFLPDKFCETLTTTDTWIAGKVVLCFT  101
            S +  K   + +   L    CE L+   + +AGKVVLCFT
Sbjct  385  SYYALKRDSLTNC--LACSACEYLSVNASMVAGKVVLCFT  422



>ref|XP_006287107.1| hypothetical protein CARUB_v10000269mg [Capsella rubella]
 gb|EOA20005.1| hypothetical protein CARUB_v10000269mg [Capsella rubella]
Length=780

 Score =   214 bits (546),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 144/216 (67%), Gaps = 17/216 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            D+ISPRD+ GHGTH S+ A GS V N+SYKGLA GT RGGA RAR+A+YK+ W     + 
Sbjct  213  DFISPRDLDGHGTHVSTIAGGSYVPNISYKGLAEGTVRGGASRARIAMYKVCWYLDDEDI  272

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEA+HDGVDV+S S G++VP+  E D  D +  G+FHAV  GITVV A
Sbjct  273  TSCSSADILKAMDEAMHDGVDVLSISLGSDVPMYGETDIRDGITTGAFHAVLKGITVVCA  332

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GP AQTV+   PWI+TVAA T DR F TPITLGN + ++GQ+++TG + G   LV+
Sbjct  333  GGNSGPEAQTVTNTAPWIVTVAATTLDRSFATPITLGNNKVILGQAMYTGPEVGFTSLVY  392

Query  175  LPDK----------FCETLT-TTDTWIAGKVVLCFT  101
             P+            CE L+  ++  + GKVVLCFT
Sbjct  393  -PENPGNSNANFSGTCEELSVNSNLTMVGKVVLCFT  427



>ref|XP_010461117.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.3 
[Camelina sativa]
Length=755

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 138/211 (65%), Gaps = 11/211 (5%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            DYIS RD  GHGTH +S A GS V NVSYK LA GT RGGAPRAR+A+YK  W     +G
Sbjct  207  DYISARDFDGHGTHVASIAGGSFVPNVSYKALAGGTLRGGAPRARVAMYKACWYLEELDG  266

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
               + +D +KA DEA+HDGVDV+S S    VPL  E D  +    G FHAVA GI VV A
Sbjct  267  VTCVNSDIMKAIDEAMHDGVDVLSISLVGQVPLLPETDMLNEFATGLFHAVAKGIVVVCA  326

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN+GP AQTV    PWILTVAA T DR FPTPITLGN + ++GQ+ +TG   G+  LV+
Sbjct  327  GGNDGPEAQTVVNIAPWILTVAATTLDRSFPTPITLGNNKVILGQATYTGPKLGLTSLVY  386

Query  175  LPDK-----FCETLT-TTDTWIAGKVVLCFT  101
              D       CE+L   ++  +AGKVVLCFT
Sbjct  387  PADAGNSSGVCESLNLNSNHTMAGKVVLCFT  417



>ref|XP_006306827.1| hypothetical protein CARUB_v10008369mg [Capsella rubella]
 gb|EOA39725.1| hypothetical protein CARUB_v10008369mg [Capsella rubella]
Length=769

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 140/216 (65%), Gaps = 17/216 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE----GG  533
            DYIS RD  GHGTHT+S A GS V N+SYKGLA G  RGGAPRAR+AIYK  W     G 
Sbjct  202  DYISARDFIGHGTHTASIAGGSFVPNISYKGLAGGNLRGGAPRARIAIYKACWYVDQLGA  261

Query  532  I-IMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
            +    +D LKA DE++HDGV+V+S S GA +PL  E D  D +  G+FHAVA GI VV A
Sbjct  262  VACSSSDILKAMDESMHDGVNVLSLSLGAQIPLYPETDLRDRIATGAFHAVAKGIIVVCA  321

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GPAAQTV    PW+LTVAA T DR FPT ITLGN + ++ Q+L+TG++ G   LV+
Sbjct  322  GGNSGPAAQTVLNTAPWVLTVAATTLDRSFPTHITLGNRKVILSQALYTGQELGFTSLVY  381

Query  175  LPDK----------FCETLTTTDTWI-AGKVVLCFT  101
             P+            CE L      I AGKVVLCFT
Sbjct  382  -PENAGNTNETYSGVCEYLDLNPNHILAGKVVLCFT  416



>ref|XP_009348696.1| PREDICTED: subtilisin-like protease SBT5.4 [Pyrus x bretschneideri]
Length=759

 Score =   212 bits (540),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 143/214 (67%), Gaps = 11/214 (5%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE----GG  533
            DY S RD  GHGTHT++TA GS V+N SYKGLA G  RGGAPRA LA+YK  W       
Sbjct  193  DYYSARDAYGHGTHTATTAAGSFVANASYKGLALGVVRGGAPRAHLAVYKACWRLSEPEP  252

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVP--LSAEVDPNDSLHFGSFHAVAHGITVVT  359
                AD LKAFDEAIHDGVDV+S S G++ P     EV  ++ +  GSF+AVA GITVV 
Sbjct  253  SCTDADLLKAFDEAIHDGVDVLSISIGSDDPNFKFEEVGMHNGIAIGSFYAVAKGITVVC  312

Query  358  AAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLV  179
            +AGN GPA QTVS   PWI+TVAA T DR FPTPITLGN +TL+GQ+LF GK+ G   LV
Sbjct  313  SAGNAGPAPQTVSNVAPWIITVAATTMDRSFPTPITLGNNKTLLGQALFVGKEVGFTGLV  372

Query  178  FLP----DKFCETLTTTDTWIAGKVVLCFTGKHG  89
             L     D  C++LT  +T +AG VV+  T   G
Sbjct  373  HLECPTADGACDSLTLGNT-LAGNVVIYLTTMPG  405



>gb|KFK31853.1| hypothetical protein AALP_AA6G166900 [Arabis alpina]
Length=787

 Score =   211 bits (538),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 143/216 (66%), Gaps = 17/216 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            D+ISPRD  GHGTH ++ A GS V N+SYKGLA GT RGGAP AR+A+YK  W     + 
Sbjct  220  DFISPRDFDGHGTHVATIAGGSYVPNISYKGLAGGTVRGGAPHARIAMYKACWYLDNLDI  279

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEA+HDGVDV+S S G++VP+  E D  D +  G+FHAV  GITVV +
Sbjct  280  TTCSSADILKAMDEAMHDGVDVLSISLGSDVPMYPETDVRDGITTGAFHAVLKGITVVCS  339

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN+GP AQTV+   PWI+TVAA T DR F TPITLGN + ++GQ+L+TG + G   LV+
Sbjct  340  GGNDGPEAQTVTNTAPWIVTVAATTLDRSFATPITLGNSKAILGQALYTGPELGFTSLVY  399

Query  175  LPDK----------FCETLT-TTDTWIAGKVVLCFT  101
             P+            CE L   ++  +AGKVVLCFT
Sbjct  400  -PENPGNSNESFSGTCEFLDFNSNRTMAGKVVLCFT  434



>ref|XP_011081355.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Sesamum 
indicum]
Length=805

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 146/237 (62%), Gaps = 33/237 (14%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
            T + + +S RD +GHGTH SSTA G+ V+NVSY G+  GT RGGAPRARLAIYK+ W+  
Sbjct  218  TRLGEILSARDAEGHGTHVSSTAAGAYVANVSYDGVGLGTARGGAPRARLAIYKVCWKLS  277

Query  538  GGIIMGADTLKAFDEAIHDGVDVISASFGA-NVPLSAEVDPNDSLHFGSFHAVAHGITVV  362
            GG    AD LKAFDEAI DGV V++ S  A ++PL +EVD  D++  GSFHA+A GITVV
Sbjct  278  GGQCASADILKAFDEAIKDGVHVLTLSIAAASLPLYSEVDGRDAIAIGSFHAIARGITVV  337

Query  361  TAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQT-----------------  233
              AGN+GP  QTV    PWI+TVAA+T DR +PT ITLGN +T                 
Sbjct  338  CGAGNDGPLPQTVKNTAPWIITVAASTMDRAYPTQITLGNNKTFQVSNLWFARCIKALIL  397

Query  232  ------LMGQSLFTGKDTGVVDLVFLPD-------KFCETLTTTDTWIAGKVVLCFT  101
                  L GQS++TGK+ G   L +  D         CE L      +AGKVVLCFT
Sbjct  398  IFQGKPLQGQSIYTGKEEGFTGLFYPADGGPDATAGVCEDLNLKPNLVAGKVVLCFT  454



>emb|CDY54842.1| BnaC05g51310D [Brassica napus]
Length=1424

 Score =   213 bits (542),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 142/219 (65%), Gaps = 15/219 (7%)
 Frame = -3

Query  700   DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
             DYIS RD  GHGTH +S A GS + +VSYKG A GT RGGAPRAR+A+YK  W     +G
Sbjct  872   DYISARDFNGHGTHVASIAGGSYIPDVSYKGFAGGTLRGGAPRARIAMYKACWYLEELDG  931

Query  535   GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                  +D +KA D+AIHD VDV+S S G+ VPL +E D  D +  G+FHAVA GITVV A
Sbjct  932   VTCSFSDIMKAMDDAIHDCVDVLSLSLGSRVPLFSETDMRDGIATGAFHAVAKGITVVCA  991

Query  355   AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
              GN GP+ QTV    PWILTVAA T DR F TPITLGN + ++GQ+++TG + G   LV+
Sbjct  992   GGNAGPSTQTVVNTAPWILTVAATTLDRSFATPITLGNNKLILGQAMYTGPELGFTSLVY  1051

Query  175   LPDK---------FCETLT-TTDTWIAGKVVLCFTGKHG  89
               D           CE+L   ++  +AGK+VLCFT   G
Sbjct  1052  PEDPGNSNDTFSGECESLNLNSNRTMAGKIVLCFTTTRG  1090


 Score =   199 bits (506),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 124/184 (67%), Gaps = 14/184 (8%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW---  542
            TG  DYIS RD  GHGTH +  A GS V NVSYKGLA G  RGGAPRAR+AIYK  W   
Sbjct  203  TGSRDYISARDFIGHGTHVACIAGGSFVPNVSYKGLAGGNLRGGAPRARIAIYKACWYVD  262

Query  541  EGGIIM--GADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGIT  368
            + G +    +D LKA DEA+HDGVDV+S S GA VPL A          G+FHAVA GI 
Sbjct  263  QLGTVACSSSDILKAMDEAMHDGVDVLSLSLGAQVPLIAT---------GAFHAVAKGII  313

Query  367  VVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVV  188
            VV A GN GPAAQTV    PW++TVAA T DR FPTPITLGN   ++GQ+L+TG++ G  
Sbjct  314  VVCAGGNSGPAAQTVLNTAPWVITVAATTLDRSFPTPITLGNNNVILGQALYTGQEVGFT  373

Query  187  DLVF  176
             LV+
Sbjct  374  SLVY  377



>ref|XP_010529681.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X3 [Tarenaya 
hassleriana]
Length=704

 Score =   208 bits (530),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 134/211 (64%), Gaps = 9/211 (4%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGII--  527
            +Y+SP+D  GHGTH ++T  GS V NV+Y G A G  RGGAP A +A+YK  W    I  
Sbjct  157  EYVSPKDFDGHGTHVATTIAGSFVPNVTYLGFAGGIIRGGAPLAHIAMYKACWHVTAIGT  216

Query  526  ---MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEAI DGVDVIS S   +VPL  E+D  D +  G+FHAVA GI VV A
Sbjct  217  ATCSSADMLKAIDEAIKDGVDVISISIAFSVPLFPEIDIRDGIAVGAFHAVARGIPVVCA  276

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GPAAQT+    PWILTVAA T DR FPTPITLGN  T++GQ L+ G   G   LV+
Sbjct  277  GGNAGPAAQTIVNTAPWILTVAATTLDRSFPTPITLGNNITILGQELYVGSGLGFTPLVY  336

Query  175  LPDKF---CETLTTT-DTWIAGKVVLCFTGK  95
                F   CE L+   +  +AGKVVLCFT K
Sbjct  337  PESPFSGDCEKLSANPNRTMAGKVVLCFTTK  367



>ref|XP_010529680.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Tarenaya 
hassleriana]
Length=707

 Score =   208 bits (530),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 134/211 (64%), Gaps = 9/211 (4%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGII--  527
            +Y+SP+D  GHGTH ++T  GS V NV+Y G A G  RGGAP A +A+YK  W    I  
Sbjct  157  EYVSPKDFDGHGTHVATTIAGSFVPNVTYLGFAGGIIRGGAPLAHIAMYKACWHVTAIGT  216

Query  526  ---MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEAI DGVDVIS S   +VPL  E+D  D +  G+FHAVA GI VV A
Sbjct  217  ATCSSADMLKAIDEAIKDGVDVISISIAFSVPLFPEIDIRDGIAVGAFHAVARGIPVVCA  276

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GPAAQT+    PWILTVAA T DR FPTPITLGN  T++GQ L+ G   G   LV+
Sbjct  277  GGNAGPAAQTIVNTAPWILTVAATTLDRSFPTPITLGNNITILGQELYVGSGLGFTPLVY  336

Query  175  LPDKF---CETLTTT-DTWIAGKVVLCFTGK  95
                F   CE L+   +  +AGKVVLCFT K
Sbjct  337  PESPFSGDCEKLSANPNRTMAGKVVLCFTTK  367



>ref|XP_010529679.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Tarenaya 
hassleriana]
Length=717

 Score =   208 bits (530),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 134/211 (64%), Gaps = 9/211 (4%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGII--  527
            +Y+SP+D  GHGTH ++T  GS V NV+Y G A G  RGGAP A +A+YK  W    I  
Sbjct  157  EYVSPKDFDGHGTHVATTIAGSFVPNVTYLGFAGGIIRGGAPLAHIAMYKACWHVTAIGT  216

Query  526  ---MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEAI DGVDVIS S   +VPL  E+D  D +  G+FHAVA GI VV A
Sbjct  217  ATCSSADMLKAIDEAIKDGVDVISISIAFSVPLFPEIDIRDGIAVGAFHAVARGIPVVCA  276

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GPAAQT+    PWILTVAA T DR FPTPITLGN  T++GQ L+ G   G   LV+
Sbjct  277  GGNAGPAAQTIVNTAPWILTVAATTLDRSFPTPITLGNNITILGQELYVGSGLGFTPLVY  336

Query  175  LPDKF---CETLTTT-DTWIAGKVVLCFTGK  95
                F   CE L+   +  +AGKVVLCFT K
Sbjct  337  PESPFSGDCEKLSANPNRTMAGKVVLCFTTK  367



>ref|XP_006286616.1| hypothetical protein CARUB_v10002407mg, partial [Capsella rubella]
 gb|EOA19514.1| hypothetical protein CARUB_v10002407mg, partial [Capsella rubella]
Length=719

 Score =   208 bits (530),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 134/208 (64%), Gaps = 6/208 (3%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            DY+SPRD +GHGTH +ST  GS + NV+Y GL  GT RGGAP   +AIYK  W      G
Sbjct  204  DYLSPRDFEGHGTHVASTIGGSFLPNVNYLGLGRGTARGGAPGVHIAIYKACWIQRGCSG  263

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD LKA DEAIHDGVD++S S   +VPL  E D       G+FHAVA GI VV AAGN G
Sbjct  264  ADVLKAIDEAIHDGVDILSLSLQTSVPLFPETDMRSLASVGAFHAVAKGIPVVAAAGNAG  323

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDKF  161
            P AQT+    PWILTVAA T DR FPT ITLGN  T++GQ++F G + G V L + P++ 
Sbjct  324  PTAQTICNVAPWILTVAATTQDRSFPTAITLGNNITILGQAIFAGPELGFVGLTY-PERP  382

Query  160  ----CETLTTT-DTWIAGKVVLCFTGKH  92
                CE L+    + + GKVVLCFT   
Sbjct  383  LSGDCEKLSANPSSAMEGKVVLCFTANE  410



>ref|XP_010455451.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=1533

 Score =   212 bits (539),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 145/215 (67%), Gaps = 15/215 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW--EGGII  527
            D+ISPRD  GHGTH ++ A GS V N+SYKGLA GT RGGAPRAR+A+YK  W  +   I
Sbjct  211  DFISPRDHDGHGTHVATIAGGSYVPNISYKGLAGGTVRGGAPRARIAMYKTCWYLDDEDI  270

Query  526  MG---ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
            M    AD LKA DEA+HDGVDV+S S G++VP+  E D  D +  G+FHAV  GITVV A
Sbjct  271  MSCSSADILKAIDEAMHDGVDVLSISLGSDVPMYGETDIPDGITTGAFHAVLKGITVVCA  330

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GP AQTV+   PWI+TVAA T DR F TPITLGN + ++GQ+++TG + G   LV+
Sbjct  331  GGNSGPEAQTVTNTAPWIVTVAATTLDRSFATPITLGNNKAILGQAMYTGPEIGFTSLVY  390

Query  175  L--PDK-------FCETLT-TTDTWIAGKVVLCFT  101
               P K        CE L+  ++  + GKVVLCFT
Sbjct  391  PENPGKSDHSFSGTCEELSVNSNLTMVGKVVLCFT  425


 Score =   203 bits (517),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 137/215 (64%), Gaps = 15/215 (7%)
 Frame = -3

Query  700   DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
             D+ISPRD  GHGTH ++ A GS V N SYKGLA GT RGGA RAR+A+YK  W     + 
Sbjct  966   DFISPRDHSGHGTHVATIAGGSYVPNTSYKGLAGGTVRGGAQRARIAMYKACWYLDDLDI  1025

Query  535   GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                  AD LKA DEA+HDGVDV+S S G  +P   E D   ++  G+FHAV  GITVV +
Sbjct  1026  NTCSSADLLKAMDEAMHDGVDVLSLSIGYRLPYYPETDIRAAIATGAFHAVLKGITVVCS  1085

Query  355   AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
              GN GPA+QTV    PWILTVAA T DR FPTPI LGN + ++GQ+++TG + G   LV+
Sbjct  1086  GGNSGPASQTVGNTAPWILTVAATTLDRSFPTPIILGNNKAVLGQAMYTGPELGFTSLVY  1145

Query  175   LPDK---------FCETL-TTTDTWIAGKVVLCFT  101
               +           CE L   ++  +AGKVVLCFT
Sbjct  1146  PENPGNSNESFFGTCELLFFNSNRTMAGKVVLCFT  1180



>ref|XP_002874635.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50894.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 141/216 (65%), Gaps = 17/216 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            D+ISPRD  GHGTH S+ A GS V N+SYKGLA GT RGGAPRAR+A+YK  W     + 
Sbjct  208  DFISPRDFDGHGTHVSTIAGGSYVPNISYKGLAGGTVRGGAPRARIAMYKACWYLDDEDI  267

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEA+HDGVDV+S S G+ VPLS E D  D +  G+FHAV  GITVV +
Sbjct  268  TTCSSADILKAMDEAMHDGVDVLSISLGSEVPLSDETDIRDGMTTGAFHAVLKGITVVCS  327

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GP + TV+   PW++TVAA T DR F TP+TLGN + ++GQ+++TG + G   LV+
Sbjct  328  GGNSGPDSLTVTNTAPWMVTVAATTLDRSFATPLTLGNNKVILGQAMYTGPELGFTSLVY  387

Query  175  LPDK----------FCETLT-TTDTWIAGKVVLCFT  101
             P+            CE L   ++  + GKVVLCFT
Sbjct  388  -PENPGNSNESFSGTCEELLFNSNRTMEGKVVLCFT  422



>ref|XP_006439186.1| hypothetical protein CICLE_v10018942mg [Citrus clementina]
 gb|ESR52426.1| hypothetical protein CICLE_v10018942mg [Citrus clementina]
Length=777

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 141/225 (63%), Gaps = 10/225 (4%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            T   +Y SPRD  GHGTHT+STA G  V   +Y+GLA G  RGGAP A LAIYK  W+ G
Sbjct  209  TNTDEYFSPRDAVGHGTHTASTAAGYFVEKANYRGLAAGLARGGAPLAHLAIYKACWDIG  268

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD LKAFD+AIHDGVDV+S S G  +PL + +D  DS+  GSFHA+A GITVV++A
Sbjct  269  C-TDADVLKAFDKAIHDGVDVLSVSIGNEIPLFSYIDQRDSIAIGSFHAIAKGITVVSSA  327

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKD----TGVV-  188
            GN+GP AQT+    PWI+TV A T DR FPT ITLGN Q L GQS+  GK     TG+  
Sbjct  328  GNDGPVAQTIVNTAPWIITVGATTIDRAFPTAITLGNHQVLWGQSVDIGKVSHGFTGLTY  387

Query  187  --DLVFLPDKF--CETLTTTDTWIAGKVVLCFTGKHGLDIDVEGI  65
               + F PD    C   +   T  AGK++LCF+     DI    I
Sbjct  388  SERIAFDPDSINDCRQGSLNATLAAGKIILCFSRPDTQDIQSAAI  432



>ref|XP_008342302.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 141/214 (66%), Gaps = 14/214 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +Y+SPRD  GHGTHTSSTA G  + N SYKGL+ G  RGGAP ARLA+YK+ W  G    
Sbjct  209  EYLSPRDAAGHGTHTSSTAAGDSIENASYKGLSAGLARGGAPSARLAVYKVCWATGGCSS  268

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD L AFD+AI+DGVDV+S S G+  PLS+ V+  D++  GSFHAVA GI+V+ +AGN G
Sbjct  269  ADLLAAFDDAIYDGVDVLSVSLGSPPPLSSYVE--DAVAIGSFHAVARGISVICSAGNSG  326

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTG-VVDLVFLPD-  167
            P  QTV  + PWI TVAA+T DR FPT ITLGN QT++GQ+L+TG D      LV+  D 
Sbjct  327  PYPQTVINSAPWIFTVAASTIDRAFPTVITLGNNQTVVGQALYTGMDINKYYPLVYGGDI  386

Query  166  ----------KFCETLTTTDTWIAGKVVLCFTGK  95
                        C+  T  +T   GKV+LCF  +
Sbjct  387  ASIDSDEDTAGSCDPGTLNETLATGKVILCFQSQ  420



>ref|XP_010104911.1| Subtilisin-like protease SDD1 [Morus notabilis]
 gb|EXC02147.1| Subtilisin-like protease SDD1 [Morus notabilis]
Length=783

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 137/215 (64%), Gaps = 11/215 (5%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            T   +++SPRD  GHGTHT+STA G  V   SY GLA G  RGGAP A LAIYK  W  G
Sbjct  213  TEAGEFLSPRDGNGHGTHTASTAGGYFVKQASYSGLAAGLARGGAPLAHLAIYKACWGVG  272

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD LKAFD+AIHDGVDV+S S G  VPL + VD  D++  GSFHA A GITVV++A
Sbjct  273  GCTNADLLKAFDKAIHDGVDVLSVSIGNEVPLFSYVDHRDAIAIGSFHATAKGITVVSSA  332

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGV------  191
            GN GP +QTVS   PW++TVAA T DR FPT ITLGN  TL GQSL TG    V      
Sbjct  333  GNNGPTSQTVSNTAPWLITVAATTIDRAFPTAITLGNNNTLWGQSLDTGSHNHVFASITY  392

Query  190  -----VDLVFLPDKFCETLTTTDTWIAGKVVLCFT  101
                 V+ +    K CE  +  +T  AGK+V+CF+
Sbjct  393  SERISVNSIDASSKDCEYGSLNETLAAGKIVVCFS  427



>ref|NP_567358.1| Subtilase family protein [Arabidopsis thaliana]
 emb|CAB40044.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78174.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82892.1| Subtilase family protein [Arabidopsis thaliana]
Length=765

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 138/214 (64%), Gaps = 15/214 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW----EGG  533
            D+ISPR   GHGTH ++ A GS V N SYKGLA GT RGGAPRAR+A+YK  W    +  
Sbjct  200  DFISPRGYNGHGTHVATIAGGSYVPNTSYKGLAGGTVRGGAPRARIAVYKTCWYLDLDIA  259

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD LKA DEAIHDGVDV+S S G   PL  E D  D +  G+FHAV  GITVV AA
Sbjct  260  ACSSADILKAMDEAIHDGVDVLSLSLGFE-PLYPETDVRDGIATGAFHAVLKGITVVCAA  318

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFL  173
            GN GPAAQTV    PWILTVAA T DR F TP+TLGN + ++GQ+++TG + G   LV+ 
Sbjct  319  GNAGPAAQTVGNTAPWILTVAATTLDRSFVTPMTLGNNKVILGQAIYTGTEVGFTSLVYP  378

Query  172  PDK---------FCET-LTTTDTWIAGKVVLCFT  101
             +           CE  L  ++  +AGKVVLCFT
Sbjct  379  ENPGNSNESFSGTCERLLINSNRTMAGKVVLCFT  412



>ref|XP_011038012.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=778

 Score =   207 bits (528),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 147/224 (66%), Gaps = 13/224 (6%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW---  542
            TG  +++SPRD  GHGTHT+STA G+ V+  SYKGLA G  RGGAP A LAIYK+ W   
Sbjct  215  TGSREFMSPRDGDGHGTHTASTAAGNFVAKASYKGLATGLARGGAPLAHLAIYKVCWNIE  274

Query  541  EGGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVV  362
            +GG    AD LKAFD+AIHDGVD++S S G N+PL + VD  +S+  GSFHA + GITVV
Sbjct  275  DGGGCTDADILKAFDKAIHDGVDILSVSIGINIPLFSYVDMRNSIAIGSFHATSKGITVV  334

Query  361  TAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK-DTGVVD  185
             +AGN+GP +QTV+   PW+ TVAA+T DR FPT I LGN +TL GQS+  GK +   V 
Sbjct  335  CSAGNDGPISQTVANTAPWLTTVAASTIDRAFPTAIILGNNKTLRGQSITKGKHNHRFVG  394

Query  184  LVF---------LPDKFCETLTTTDTWIAGKVVLCFTGKHGLDI  80
            L +         +  + C+  +   T  AGK++LCF+     D+
Sbjct  395  LTYSERIALNPMVSSQDCQPGSLNPTLAAGKIILCFSKSDTQDM  438



>gb|EYU19440.1| hypothetical protein MIMGU_mgv1a001654mg [Erythranthe guttata]
Length=778

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 144/217 (66%), Gaps = 13/217 (6%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
            T + +++S RD  GHGTH SSTA G+ V+NVSY G+  GT RGGAPRARLA+YK+ W+  
Sbjct  212  TRLGEFLSARDASGHGTHVSSTAAGADVANVSYNGVGVGTARGGAPRARLAVYKVCWKVR  271

Query  538  GGIIMGADTLKAFDEAIHDGVDVISASFGAN-VPLSAEVDPNDSLHFGSFHAVAHGITVV  362
             G+   AD LKAFDEAI DGV V++ S GA+ +PL +EVD  D++  GSFHAVA GI VV
Sbjct  272  SGLCAAADILKAFDEAIKDGVHVLTLSIGASSLPLYSEVDGRDAIAVGSFHAVAKGIPVV  331

Query  361  TAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLF-TGKDTGVVD  185
              AGN+GP+ QTV    PWI+TVAA+T DR F T ITLGN +TL GQS++      G   
Sbjct  332  CGAGNDGPSPQTVKNTAPWIITVAASTMDRAFSTQITLGNNKTLQGQSIYTGSGTGGGFT  391

Query  184  LVFLPDK---------FCETLTTTDTWIAGKVVLCFT  101
             ++ P            CE LT   + +AGKVVLCFT
Sbjct  392  GLYYPADGGANTSSTGVCEGLTLKPSLVAGKVVLCFT  428



>ref|XP_006476262.1| PREDICTED: subtilisin-like protease SDD1-like [Citrus sinensis]
Length=777

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 141/225 (63%), Gaps = 10/225 (4%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            T   +Y SPRD  GHGTHT+STA G  V   +Y+GLA G  RGGAP A LAIYK  W+ G
Sbjct  209  TNTDEYFSPRDAVGHGTHTASTAAGYFVEKANYRGLAAGLARGGAPLAHLAIYKACWDIG  268

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD LKAFD+AIHDGVDV+S S G  +PL + +D  DS+  GSFHA+A GITVV++A
Sbjct  269  C-TDADVLKAFDKAIHDGVDVLSVSIGNEIPLFSYIDQRDSIAIGSFHAIAKGITVVSSA  327

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKD----TGVV-  188
            GN+GP AQT+    PWI+TV A T DR FPT ITLGN Q L GQS+  GK     TG+  
Sbjct  328  GNDGPVAQTIVNTAPWIITVGATTIDRAFPTAITLGNHQVLWGQSIDIGKVSHGFTGLTY  387

Query  187  --DLVFLPDKF--CETLTTTDTWIAGKVVLCFTGKHGLDIDVEGI  65
               + F PD    C   +   T  AGK++LCF+     DI    I
Sbjct  388  SERIAFDPDSANDCRQGSLNATLAAGKIILCFSRPDTQDIQSAAI  432



>ref|XP_010318061.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Solanum 
lycopersicum]
Length=764

 Score =   207 bits (527),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 136/206 (66%), Gaps = 8/206 (4%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE---GGI  530
            D  SPRD  GH THTSSTA GS   N SY  L +GT +GGAP+AR+A+YK+ W    GG 
Sbjct  220  DIASPRDRDGHDTHTSSTAGGSFTPNASYHRLGYGTVKGGAPKARIAMYKVCWNWLIGGC  279

Query  529  IMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAG  350
               ADT+ A DEAIHDGVD++S S G  +PL A++D  + + F SFHAV+ GITV+ + G
Sbjct  280  TF-ADTMMAIDEAIHDGVDILSISLGLEIPLYADIDMRNGIAFASFHAVSKGITVICSGG  338

Query  349  NEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLP  170
            NEGP  QTV    PWILTVAA++ DR FPT ITLGN QT   ++ F G      ++  L 
Sbjct  339  NEGPYPQTVVNISPWILTVAASSIDRSFPTLITLGNNQTF-SETGFIG--IAHQEISELE  395

Query  169  D-KFCETLTTTDTWIAGKVVLCFTGK  95
            D +FC  L T DTW AGKVVLCF  K
Sbjct  396  DTRFCNNLNTNDTWAAGKVVLCFIVK  421



>ref|XP_002317660.2| hypothetical protein POPTR_0011s15400g [Populus trichocarpa]
 gb|EEE98272.2| hypothetical protein POPTR_0011s15400g [Populus trichocarpa]
Length=786

 Score =   207 bits (527),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 148/220 (67%), Gaps = 13/220 (6%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW--EGGII  527
            +++SPRD +GHG+HT+STA G+ V  VSYKGLA G  RGGAP A LAIYK+ W  E G  
Sbjct  227  EFMSPRDGEGHGSHTASTAAGNFVEKVSYKGLAAGLARGGAPLAHLAIYKVCWNIEDGGC  286

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFD+AIHDGVD++S S G N+PL + VD  +S+  GSFHA  +GI+V+ +AGN
Sbjct  287  TDADLLKAFDKAIHDGVDILSVSIGNNIPLFSYVDMRNSIAIGSFHATLNGISVICSAGN  346

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK-DTGVVDLVF--  176
            +GP +QTV    PW++TVAA+T DR FPT ITLGN +TL GQS+ TG+ + G   L +  
Sbjct  347  DGPISQTVENTAPWLITVAASTIDRTFPTAITLGNNKTLWGQSITTGQHNHGFASLTYSE  406

Query  175  -LP-------DKFCETLTTTDTWIAGKVVLCFTGKHGLDI  80
             +P        K C+  +   T  AGK++LC +  +  D+
Sbjct  407  RIPLNPMVDSAKDCQPGSLNATLAAGKIILCLSESNTQDM  446



>ref|NP_567361.1| Subtilase family protein [Arabidopsis thaliana]
 emb|CAB40047.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78177.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82895.1| Subtilase family protein [Arabidopsis thaliana]
Length=775

 Score =   206 bits (525),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 139/215 (65%), Gaps = 15/215 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            D+ISPRD  GHGTH ++ A GS V ++SYKGLA GT RGGAPRAR+A+YK  W     + 
Sbjct  208  DFISPRDRSGHGTHVATIAGGSYVPSISYKGLAGGTVRGGAPRARIAMYKACWYLDRFDI  267

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEA+HDGVDV+S S G   P   E D    +  G+FHAV  GITVV +
Sbjct  268  NTCSSADILKAMDEAMHDGVDVLSLSIGYRFPYFPETDVRAVIATGAFHAVLKGITVVCS  327

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GPAAQTV    PWILTVAA T DR FPTPITLGN + ++GQ+++TG + G   LV+
Sbjct  328  GGNSGPAAQTVGNTAPWILTVAATTLDRSFPTPITLGNNKLILGQAMYTGPELGFTSLVY  387

Query  175  LP------DKF---CETL-TTTDTWIAGKVVLCFT  101
                    + F   CE L   ++  +AGKVVLCFT
Sbjct  388  PENPGNSNESFSGDCELLFFNSNHTMAGKVVLCFT  422



>ref|XP_010109770.1| hypothetical protein L484_008446 [Morus notabilis]
 gb|EXC24675.1| hypothetical protein L484_008446 [Morus notabilis]
Length=745

 Score =   206 bits (524),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 138/215 (64%), Gaps = 14/215 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +++SPRD  GHGTHTSSTA G  V N S+ GLA G  RGGAP A LA+YK+ W  G    
Sbjct  175  EFLSPRDAAGHGTHTSSTAAGFPVENASFMGLARGRVRGGAPSAWLAVYKVCWATGGCSS  234

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD L AFD+AIHDGVDV+S S G++ PL + +D  D L  GSFHAVA GI+VV + GN G
Sbjct  235  ADLLAAFDDAIHDGVDVLSVSLGSSPPLPSYID--DVLAIGSFHAVAKGISVVCSGGNSG  292

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDT-GVVDLVFLPD-  167
            P  QTV    PWILTVAA+T DR FPT ITLGN QTL+GQ L+T KD      LV+  D 
Sbjct  293  PYTQTVINTAPWILTVAASTIDRGFPTTITLGNNQTLVGQGLYTSKDLDKFYSLVYGEDI  352

Query  166  ----------KFCETLTTTDTWIAGKVVLCFTGKH  92
                        C++ T  +T   GKVVLCF  ++
Sbjct  353  ASIDADITTAGSCDSGTLNNTLARGKVVLCFQSRY  387



>emb|CBI23085.3| unnamed protein product [Vitis vinifera]
Length=1884

 Score =   210 bits (534),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 134/212 (63%), Gaps = 28/212 (13%)
 Frame = -3

Query  712   TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
             T   +Y+SPRD  GHGTHTSS A GS V N SY GL FGT RGGAP ARLA+YK  W   
Sbjct  1342  TKYLEYLSPRDALGHGTHTSSIAGGSPVVNASYYGLGFGTVRGGAPGARLAMYKACWNLG  1401

Query  538   GGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVT  359
             GG    AD LKAFD+AIHDGVDVI                      GSFHAVA GI+VV 
Sbjct  1402  GGFCSDADILKAFDKAIHDGVDVIL--------------------IGSFHAVAQGISVVC  1441

Query  358   AAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLV  179
             AAGN GP+AQTV    PWILTVAA++ DR FPTPITLGN +T+MGQ++  G  TG   LV
Sbjct  1442  AAGNGGPSAQTVENTAPWILTVAASSIDRSFPTPITLGNNRTVMGQAMLIGNHTGFASLV  1501

Query  178   FLPDKF------CETLTTTDTWIAGKVVLCFT  101
             +  D        C +++  DT +AGKV LCFT
Sbjct  1502  YPDDPHLQSPSNCLSISPNDTSVAGKVALCFT  1533


 Score =   189 bits (479),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 120/172 (70%), Gaps = 8/172 (5%)
 Frame = -3

Query  592  FRGGAPRARLAIYKIGWE--GGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDP  419
             RGGAPRARLA+YK+ W   GG+   AD  K  DEAIHDGVDV+S S  +++PL + VD 
Sbjct  617  MRGGAPRARLAMYKVCWNLYGGVCADADIFKGIDEAIHDGVDVLSLSISSDIPLFSHVDQ  676

Query  418  NDSLHFGSFHAVAHGITVVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNG  239
            +D +   SFHAV  GI VV+AAGN GP+A+TVS   PWI+TVAA+T DR F T ITLGN 
Sbjct  677  HDGISIASFHAVVRGIPVVSAAGNSGPSAETVSNTAPWIITVAASTMDRLFATHITLGNN  736

Query  238  QTLMGQSLFTGKDTGVVDLVF------LPDKFCETLTTTDTWIAGKVVLCFT  101
            QT+ G++++ GKDTG  +L +      L  ++CE+L   DT+ AG VVLCFT
Sbjct  737  QTITGEAVYLGKDTGFTNLAYPEVSDLLAPRYCESLLPNDTFAAGNVVLCFT  788



>ref|NP_001078370.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82897.1| subtilisin-like protease [Arabidopsis thaliana]
Length=722

 Score =   206 bits (523),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 140/219 (64%), Gaps = 15/219 (7%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW---  542
            T   D+ISPRD+ GHGTH S+ A GS V N+SYKGLA GT RGGAPRA +A+YK  W   
Sbjct  152  TNSLDFISPRDLDGHGTHVSTIAGGSFVPNISYKGLAGGTVRGGAPRAHIAMYKACWYLD  211

Query  541  --EGGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGIT  368
              +      AD LKA DEA+HDGVDV+S S G++VPL  E D  D +  G+FHAV  GIT
Sbjct  212  DDDTTTCSSADILKAMDEAMHDGVDVLSISLGSSVPLYGETDIRDGITTGAFHAVLKGIT  271

Query  367  VVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVV  188
            VV + GN GP + TV+   PWI+TVAA T DR F TP+TLGN + ++GQ+++TG   G  
Sbjct  272  VVCSGGNSGPDSLTVTNTAPWIITVAATTLDRSFATPLTLGNNKVILGQAMYTGPGLGFT  331

Query  187  DLVFLPDK---------FCETLT-TTDTWIAGKVVLCFT  101
             LV+  +           CE L   ++  + GKVVLCFT
Sbjct  332  SLVYPENPGNSNESFSGTCEELLFNSNRTMEGKVVLCFT  370



>dbj|BAE98849.1| subtilisin-like protease -like protein [Arabidopsis thaliana]
Length=722

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 140/219 (64%), Gaps = 15/219 (7%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW---  542
            T   D+ISPRD+ GHGTH S+ A GS V N+SYKGLA GT RGGAPRA +A+YK  W   
Sbjct  152  TNSLDFISPRDLDGHGTHVSTIAGGSFVPNISYKGLAGGTVRGGAPRAHIAMYKACWYLD  211

Query  541  --EGGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGIT  368
              +      AD LKA DEA+HDGVDV+S S G++VPL  E D  D +  G+FHAV  GIT
Sbjct  212  DDDTTTCSSADILKAMDEAMHDGVDVLSISLGSSVPLYGETDIRDGITTGAFHAVLKGIT  271

Query  367  VVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVV  188
            VV + GN GP + TV+   PWI+TVAA T DR F TP+TLGN + ++GQ+++TG   G  
Sbjct  272  VVCSGGNSGPDSLTVTNTAPWIITVAATTLDRSFATPLTLGNNKVILGQAMYTGPGLGFT  331

Query  187  DLVFLPDK---------FCETLT-TTDTWIAGKVVLCFT  101
             LV+  +           CE L   ++  + GKVVLCFT
Sbjct  332  SLVYPENPGNSNESFSGTCEELLFNSNRTMEGKVVLCFT  370



>ref|XP_006415136.1| hypothetical protein EUTSA_v10006855mg [Eutrema salsugineum]
 gb|ESQ33489.1| hypothetical protein EUTSA_v10006855mg [Eutrema salsugineum]
Length=782

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 134/212 (63%), Gaps = 17/212 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW---EGGI  530
            DYIS RD  GHGTH +S A G  V NVSYKGLA G  RGGAPRAR+AIYK  W     G 
Sbjct  215  DYISARDFLGHGTHVASIAGGLFVPNVSYKGLASGNLRGGAPRARIAIYKACWYLERLGT  274

Query  529  IM--GADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
            +    +D LKA DEAIHDGVDV+S S GA VPL  + D  D +  G+FHAVA GI VV A
Sbjct  275  VACSSSDILKAMDEAIHDGVDVLSLSLGAQVPLFPKTDLRDRIATGAFHAVAKGIIVVCA  334

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GPAAQTV    PW++TVAA T DR FPTPITLGN   ++GQ+LFTG   G   LV+
Sbjct  335  GGNSGPAAQTVLNTAPWVITVAATTLDRSFPTPITLGNNNMILGQALFTGPQLGFTSLVY  394

Query  175  LPDK----------FCETLTTT-DTWIAGKVV  113
             P+            CE L    +  +AGKVV
Sbjct  395  -PENPVSSNETFTGVCERLNLNPNGTMAGKVV  425



>emb|CAB40021.1| subtilisin-like protease-like protein [Arabidopsis thaliana]
 emb|CAB78178.1| subtilisin-like protease-like protein [Arabidopsis thaliana]
Length=803

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 141/220 (64%), Gaps = 17/220 (8%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW---  542
            T   D+ISPRD+ GHGTH S+ A GS V N+SYKGLA GT RGGAPRA +A+YK  W   
Sbjct  233  TNSLDFISPRDLDGHGTHVSTIAGGSFVPNISYKGLAGGTVRGGAPRAHIAMYKACWYLD  292

Query  541  --EGGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGIT  368
              +      AD LKA DEA+HDGVDV+S S G++VPL  E D  D +  G+FHAV  GIT
Sbjct  293  DDDTTTCSSADILKAMDEAMHDGVDVLSISLGSSVPLYGETDIRDGITTGAFHAVLKGIT  352

Query  367  VVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVV  188
            VV + GN GP + TV+   PWI+TVAA T DR F TP+TLGN + ++GQ+++TG   G  
Sbjct  353  VVCSGGNSGPDSLTVTNTAPWIITVAATTLDRSFATPLTLGNNKVILGQAMYTGPGLGFT  412

Query  187  DLVFLPDK----------FCETLT-TTDTWIAGKVVLCFT  101
             LV+ P+            CE L   ++  + GKVVLCFT
Sbjct  413  SLVY-PENPGNSNESFSGTCEELLFNSNRTMEGKVVLCFT  451



>ref|NP_567360.1| Subtilase family protein [Arabidopsis thaliana]
 gb|AAD03437.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
Score=50.7, E=4.7e-13, n=3) [Arabidopsis thaliana]
 emb|CAB40046.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78176.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82894.1| Subtilase family protein [Arabidopsis thaliana]
Length=747

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 130/203 (64%), Gaps = 4/203 (2%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            DY+SPRD  GHGTH +ST  GS + NVSY GL  GT RGGAP   +A+YK  W      G
Sbjct  208  DYLSPRDFNGHGTHVASTIGGSFLPNVSYLGLGRGTARGGAPGVHIAVYKACWVQRGCSG  267

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD LKA DEAIHDGVD++S S   +VPL  E D  +    G+FHAVA GI VV AA N G
Sbjct  268  ADVLKAMDEAIHDGVDILSLSLQTSVPLFPETDARELTSVGAFHAVAKGIPVVAAASNAG  327

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDKF  161
            P AQT+S   PW+LTVAA T DR FPT ITLGN  T++GQ++F G + G V L +     
Sbjct  328  PTAQTLSNVAPWVLTVAATTQDRSFPTAITLGNNITILGQAIFGGSELGFVGLTYPESPL  387

Query  160  ---CETLTTT-DTWIAGKVVLCF  104
               CE L+    + + GKVVLCF
Sbjct  388  SGDCEKLSANPKSAMEGKVVLCF  410



>ref|NP_567362.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AAM91616.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEE82896.1| subtilisin-like protease [Arabidopsis thaliana]
Length=778

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 141/220 (64%), Gaps = 17/220 (8%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW---  542
            T   D+ISPRD+ GHGTH S+ A GS V N+SYKGLA GT RGGAPRA +A+YK  W   
Sbjct  208  TNSLDFISPRDLDGHGTHVSTIAGGSFVPNISYKGLAGGTVRGGAPRAHIAMYKACWYLD  267

Query  541  --EGGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGIT  368
              +      AD LKA DEA+HDGVDV+S S G++VPL  E D  D +  G+FHAV  GIT
Sbjct  268  DDDTTTCSSADILKAMDEAMHDGVDVLSISLGSSVPLYGETDIRDGITTGAFHAVLKGIT  327

Query  367  VVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVV  188
            VV + GN GP + TV+   PWI+TVAA T DR F TP+TLGN + ++GQ+++TG   G  
Sbjct  328  VVCSGGNSGPDSLTVTNTAPWIITVAATTLDRSFATPLTLGNNKVILGQAMYTGPGLGFT  387

Query  187  DLVFLPDK----------FCETLT-TTDTWIAGKVVLCFT  101
             LV+ P+            CE L   ++  + GKVVLCFT
Sbjct  388  SLVY-PENPGNSNESFSGTCEELLFNSNRTMEGKVVLCFT  426



>ref|NP_001190697.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82898.1| subtilisin-like protease [Arabidopsis thaliana]
Length=794

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 140/219 (64%), Gaps = 15/219 (7%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW---  542
            T   D+ISPRD+ GHGTH S+ A GS V N+SYKGLA GT RGGAPRA +A+YK  W   
Sbjct  224  TNSLDFISPRDLDGHGTHVSTIAGGSFVPNISYKGLAGGTVRGGAPRAHIAMYKACWYLD  283

Query  541  --EGGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGIT  368
              +      AD LKA DEA+HDGVDV+S S G++VPL  E D  D +  G+FHAV  GIT
Sbjct  284  DDDTTTCSSADILKAMDEAMHDGVDVLSISLGSSVPLYGETDIRDGITTGAFHAVLKGIT  343

Query  367  VVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVV  188
            VV + GN GP + TV+   PWI+TVAA T DR F TP+TLGN + ++GQ+++TG   G  
Sbjct  344  VVCSGGNSGPDSLTVTNTAPWIITVAATTLDRSFATPLTLGNNKVILGQAMYTGPGLGFT  403

Query  187  DLVFLPDK---------FCETLT-TTDTWIAGKVVLCFT  101
             LV+  +           CE L   ++  + GKVVLCFT
Sbjct  404  SLVYPENPGNSNESFSGTCEELLFNSNRTMEGKVVLCFT  442



>emb|CDX93811.1| BnaA09g24110D [Brassica napus]
Length=752

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 136/219 (62%), Gaps = 24/219 (11%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
            TG  DYIS RD  GHGTH +S A GS V NVSYKGLA G  RGGAPRAR+AIYK  W   
Sbjct  203  TGSRDYISARDFIGHGTHVASIAGGSFVPNVSYKGLAGGNLRGGAPRARIAIYKACWYVD  262

Query  538  --GGI-IMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGIT  368
              G +    +D LKA DEA+HDGVDV+S S GA VPL A          G+FHAVA GI 
Sbjct  263  QLGAVACSSSDILKAMDEAMHDGVDVLSLSLGAQVPLIAT---------GAFHAVAKGII  313

Query  367  VVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVV  188
            VV A GN GPAAQTV    PW++TVAA T DR F TPITLGN   ++GQ+L+TG + G  
Sbjct  314  VVCAGGNSGPAAQTVLNTAPWVITVAATTLDRSFLTPITLGNNNVILGQALYTGPEVGFT  373

Query  187  DLVFLPDK---------FCETLTTT-DTWIAGKVVLCFT  101
             LV+  +           CE L    +  + GKVVLCFT
Sbjct  374  SLVYPENSGHSNVTFSGVCERLNLNPNGTMRGKVVLCFT  412



>ref|XP_006289915.1| hypothetical protein CARUB_v10003531mg, partial [Capsella rubella]
 gb|EOA22813.1| hypothetical protein CARUB_v10003531mg, partial [Capsella rubella]
Length=748

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 139/216 (64%), Gaps = 18/216 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            D+ISPR   GHGTH ++ A GS V N SYKGLA GT RGGAPRAR+A+YK  W     + 
Sbjct  216  DFISPRGYNGHGTHVATIAGGSYVPNTSYKGLAGGTVRGGAPRARIAVYKTCWYLDDEDI  275

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEAIHDGVDV+S S G   PL  E D  D +  G+FHAV  GITVV A
Sbjct  276  TTCSSADILKAMDEAIHDGVDVLSLSLGYE-PLYPETDVRDGIATGAFHAVLKGITVVCA  334

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
            AGN GPAAQTV+   PWI+TVAA T DR F T +TLGN + +MGQ+++TG + G   LV+
Sbjct  335  AGNSGPAAQTVTNLAPWIITVAATTLDRSFATLMTLGNNKVIMGQAIYTGPELGFTSLVY  394

Query  175  LPDK----------FCETL-TTTDTWIAGKVVLCFT  101
             P+            CE L   ++  +AGKVVLCFT
Sbjct  395  -PENPGNSNESFSGTCERLIINSNRTMAGKVVLCFT  429



>ref|XP_010470046.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=410

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 137/221 (62%), Gaps = 10/221 (5%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +Y+SPRD  GHGTH +ST  GS + NV+Y GL  GT RGGAP   LAIYK  W       
Sbjct  186  EYLSPRDYTGHGTHVASTIGGSFLPNVNYSGLGRGTARGGAPGVYLAIYKACWFQMGCPR  245

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD LKA DEAIHDGVD++S S G+ VPL+ E D N S   G FHAVA GI VV +AGN G
Sbjct  246  ADVLKAIDEAIHDGVDILSLSLGSGVPLNLETDVNLSA-MGLFHAVAKGIHVVASAGNNG  304

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDKF  161
            PAAQT+    PWILTVAA T DR FPT ITLGN  T +GQ++F G +   V L +  D  
Sbjct  305  PAAQTIGNVAPWILTVAATTLDRSFPTAITLGNNITTLGQAIFGGPELSSVGLTYSRD--  362

Query  160  CETLTTTDTWI---AGKVVLCFTGKHGLDIDVEGIVAQSRA  47
            C  L+     I    GKVVLCFT     D+D    V ++ A
Sbjct  363  CAKLSANPKNINTMEGKVVLCFTA----DLDPLSKVVENAA  399



>ref|XP_009351288.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Pyrus 
x bretschneideri]
Length=771

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 141/214 (66%), Gaps = 15/214 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +Y+SPRD  GHGTHTSSTA G  + N SYKGLA G  RGGAP ARLA+YK+ W  G    
Sbjct  209  EYLSPRDAGGHGTHTSSTAAGDSIQNASYKGLAAGLARGGAPLARLAVYKVCWAVGC-SS  267

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD L AFD+AI+DGVDV+S S G+  PLS+ V+  D++  GSFHAVA GI+VV +AGN G
Sbjct  268  ADLLAAFDDAIYDGVDVLSVSLGSPPPLSSYVE--DAMAIGSFHAVAKGISVVCSAGNSG  325

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTG-VVDLVFLPD-  167
            P  QTV  + PWI TVAA+T DR FP  ITLGN QT++GQ+L+TG D      LV+  D 
Sbjct  326  PYPQTVINSAPWIFTVAASTIDRAFPAVITLGNNQTVVGQALYTGMDRNKYYPLVYGGDI  385

Query  166  ----------KFCETLTTTDTWIAGKVVLCFTGK  95
                        C+  T  +T  +GKV+LCF  +
Sbjct  386  ASIDSDKDTAGSCDPGTLNETLASGKVILCFQSR  419



>ref|NP_174573.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 gb|AAF31279.1|AC006424_8 Fourth of four adjacent putative subtilase family> [Arabidopsis 
thaliana]
 gb|AEE31545.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=734

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 135/214 (63%), Gaps = 14/214 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE----GG  533
            +YISPRD  GHGTH ++TA GS V + +Y GL  GT RGGAPRAR+A+YK  W       
Sbjct  169  EYISPRDFDGHGTHVAATAAGSFVPDTNYLGLGRGTARGGAPRARIAMYKACWHLVTGAT  228

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD +KA DEAIHDGVDV+S S G +VPL  EVD  D +  G+FHAVA GI VV A 
Sbjct  229  TCSAADLVKAIDEAIHDGVDVLSISNGFSVPLFPEVDTQDGVAVGAFHAVAKGIPVVCAG  288

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFL  173
            GN GP++QT+S   PWI+TVAA T DR FPT ITLGN  T++GQ+L+ G D    +LV+ 
Sbjct  289  GNAGPSSQTISNTAPWIITVAATTQDRSFPTFITLGNNVTVVGQALYQGPDIDFTELVYP  348

Query  172  PDK---------FCETLTTTDTW-IAGKVVLCFT  101
             D           CE L       I  K+VLCFT
Sbjct  349  EDSGASNETFYGVCEDLAKNPAHIIEEKIVLCFT  382



>ref|XP_006289363.1| hypothetical protein CARUB_v10002849mg, partial [Capsella rubella]
 gb|EOA22261.1| hypothetical protein CARUB_v10002849mg, partial [Capsella rubella]
Length=789

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 138/216 (64%), Gaps = 17/216 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            D+ISPRD  GHGTH ++ A GS V N SYKGLA GT RGGA RAR+A+YK  W     + 
Sbjct  225  DFISPRDNSGHGTHVATIAGGSYVPNTSYKGLAGGTVRGGAIRARIAMYKACWYLDDLDI  284

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEA+HDGVDV+S S G  +P   E D   ++  G+FHAV  GITVV +
Sbjct  285  NTCSSADLLKAMDEAMHDGVDVLSLSIGYRLPYYPETDVRAAIATGAFHAVLKGITVVCS  344

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GPAAQTV    PWILTVAA T DR FPTPI LGN + ++GQ+++TG + G   LV+
Sbjct  345  GGNSGPAAQTVGNTAPWILTVAATTLDRSFPTPIILGNNKAILGQAMYTGPELGFTSLVY  404

Query  175  LPDK----------FCETL-TTTDTWIAGKVVLCFT  101
             P+            CE L   ++  +AGKVVLCFT
Sbjct  405  -PENPGNSNESFFGTCELLFFNSNRTMAGKVVLCFT  439



>ref|XP_010542106.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Tarenaya hassleriana]
Length=712

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 142/207 (69%), Gaps = 6/207 (3%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE-GGIIM  524
            +YISPRD  GHGTH +STA GS +SNVSY GL  G  RGGAPRAR+A+YK  W       
Sbjct  157  EYISPRDYVGHGTHVASTAGGSFLSNVSYVGLGRGRMRGGAPRARIAVYKPCWNHQPSCT  216

Query  523  GADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNE  344
             +D L A DEA+HDGVDV+S S G+ +P+  E+D +D +  G+FHAVA GI V+ AAGN 
Sbjct  217  ASDILGAIDEAVHDGVDVLSISLGSTIPILPEIDTHDGIAVGAFHAVAKGIPVICAAGNI  276

Query  343  GPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDK  164
            GPAAQTV    PWILTVAA T DR FPTPITLGN  T++GQ+L+ G++ G   L++ P  
Sbjct  277  GPAAQTVVNVAPWILTVAATTQDRSFPTPITLGNNITILGQALYVGQELGFTSLLY-PQN  335

Query  163  F---CETLTTT-DTWIAGKVVLCFTGK  95
                CE L+   +  + GKVVLCFT K
Sbjct  336  VSGDCEKLSAIPNRTMVGKVVLCFTSK  362



>ref|XP_008392654.1| PREDICTED: subtilisin-like protease SDD1 [Malus domestica]
Length=785

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 138/219 (63%), Gaps = 11/219 (5%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            D++SPRD  GHGTHT+STA G  V N +Y+GLA G  RGGAP A LAIYK  W       
Sbjct  227  DFLSPRDGIGHGTHTASTAAGYFVKNANYRGLASGLARGGAPLAHLAIYKACWAFEGCTD  286

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD LKAFD+AIHDGVD+IS S G  +PL + VD  DS+  GSFHA+  GITVV +AGN+G
Sbjct  287  ADLLKAFDKAIHDGVDIISLSVGNEIPLFSYVDQRDSIAIGSFHAMTKGITVVCSAGNDG  346

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK-----------DTG  194
            P +QT+    PW++TVAA T DR FPT ITLGN QTL GQS+  GK           +  
Sbjct  347  PISQTIVNTAPWLITVAATTIDRAFPTAITLGNNQTLWGQSIDAGKYNREFASITYSERI  406

Query  193  VVDLVFLPDKFCETLTTTDTWIAGKVVLCFTGKHGLDID  77
             +D      K C+  +   T  +GK+VLCF+     DI+
Sbjct  407  AIDPTDDSAKDCQPGSLNATLASGKIVLCFSKSDQQDIE  445



>ref|XP_011040612.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=778

 Score =   204 bits (520),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 146/220 (66%), Gaps = 13/220 (6%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW--EGGII  527
            +++SPRD +GHG+HT+STA G+ V  VSYKGLA G  RGGAP A LAIYK+ W  E G  
Sbjct  219  EFMSPRDGEGHGSHTASTAAGNFVEKVSYKGLAAGLARGGAPLAHLAIYKVCWNIEDGGC  278

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFD+AIHDGVD++S S G N+PL + VD  +S+  GSFHA  +GI V+ +AGN
Sbjct  279  TDADLLKAFDKAIHDGVDILSVSIGNNIPLFSYVDMRNSIAIGSFHATLNGIPVICSAGN  338

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK-DTGVVDLVF--  176
            +GP +QTV    PW++TVAA+T DR FPT ITLGN +TL GQS+ TG+ + G   L +  
Sbjct  339  DGPISQTVENTAPWLITVAASTIDRTFPTAITLGNNKTLWGQSITTGQHNHGFASLTYSE  398

Query  175  -LP-------DKFCETLTTTDTWIAGKVVLCFTGKHGLDI  80
             +P        K C+  +   T   GK++LC +  +  D+
Sbjct  399  RIPLNPMVDSAKDCQPGSLNATLATGKIILCLSESNTQDM  438



>ref|XP_010421968.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=759

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 132/206 (64%), Gaps = 6/206 (3%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +Y+SPRD  GHGTH +ST  GS + NVSY GL  GT RGGAP   LAIYK  W      G
Sbjct  209  EYLSPRDFNGHGTHVASTVGGSFLPNVSYLGLGRGTARGGAPGVYLAIYKACWSQIGCSG  268

Query  520  ADTLKAFDEAIHDGVDVISASFGA-NVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNE  344
            AD LKA D+AIHDGVDV+S S G+ N+PL+ E D N     G FHAVA GI VV +AGN 
Sbjct  269  ADLLKAIDQAIHDGVDVLSLSLGSPNIPLNLETDVN-LFAMGLFHAVAKGIHVVASAGNN  327

Query  343  GPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLV----F  176
            GPAAQT++   PWILTVAA T DR FPT ITLGN  T +GQ++F G + G VDL      
Sbjct  328  GPAAQTIANVSPWILTVAATTLDRSFPTAITLGNNITTLGQAIFAGPELGFVDLTDPERP  387

Query  175  LPDKFCETLTTTDTWIAGKVVLCFTG  98
            L     E     +  + GKVVLCFT 
Sbjct  388  LSGDCAELRANPNKTMQGKVVLCFTA  413



>ref|XP_010437025.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=778

 Score =   204 bits (519),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 138/215 (64%), Gaps = 16/215 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            D+ISPR   GHGTH ++ A GS V N SYKGLA GT RGGAPRAR+A+YK  W     + 
Sbjct  212  DFISPRGYNGHGTHVATIAGGSYVPNTSYKGLARGTVRGGAPRARIAVYKTCWYLDDEDI  271

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
             I   AD LKA DEAI DGVDV+S S G   PL  E D  D +  G+FHAV  GITVV A
Sbjct  272  TICSAADILKAMDEAIDDGVDVLSLSLGYE-PLYPETDVRDGIAIGAFHAVMKGITVVCA  330

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
            AGN GPAAQTV+   PWI+TVAA T DR F TP+ LGN + ++GQ+++TG +     LV+
Sbjct  331  AGNAGPAAQTVTNLAPWIITVAATTLDRSFATPMILGNNKVILGQAIYTGPEVDFTSLVY  390

Query  175  LPDK---------FCETL-TTTDTWIAGKVVLCFT  101
              +           CE L   +++ +AGKVVLCFT
Sbjct  391  PENPGNSNESFSGTCERLIINSNSTMAGKVVLCFT  425



>ref|XP_002874634.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50893.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=781

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 140/215 (65%), Gaps = 15/215 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            D+ISPRD  GHGTH ++ A GS + N+SYKGLA GT RGGA RAR+A+YK  W     + 
Sbjct  214  DFISPRDHSGHGTHVATIAGGSPLHNISYKGLAGGTVRGGALRARIAMYKACWYLDNLDI  273

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEA+HDGVDV+S S G+ +P  +E D    +  G+FHAV  GITVV +
Sbjct  274  TTCSSADLLKAMDEAMHDGVDVLSLSIGSRLPYFSETDARAVIATGAFHAVLKGITVVCS  333

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GPA QTV    PWILTVAA T DR FPTPITLGN + ++GQ+++TG + G   LV+
Sbjct  334  GGNSGPAGQTVGNTAPWILTVAATTLDRSFPTPITLGNNKVILGQAMYTGPELGFTSLVY  393

Query  175  LP------DKF---CETL-TTTDTWIAGKVVLCFT  101
                    + F   CE L   ++  +AGKVVLCFT
Sbjct  394  PENPGNSNESFFGDCELLFFNSNRTMAGKVVLCFT  428



>ref|XP_009348700.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=778

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 138/223 (62%), Gaps = 11/223 (5%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            T   D++SPRD  GHGTHT+STA G  V N +Y+GLA G  RGGAP A LAIYK  W   
Sbjct  216  TNNVDFLSPRDGIGHGTHTASTAAGYFVKNANYRGLASGLARGGAPLAHLAIYKACWAFE  275

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD LKAFD+AIHDGVD+IS S G  +PL + VD  DS+  GSFHAV  GITVV +A
Sbjct  276  GCTDADLLKAFDKAIHDGVDIISLSVGNEIPLFSYVDQRDSIAIGSFHAVTKGITVVCSA  335

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK----------  203
             N+GP +QT+    PW++TVAA T DR FPT ITLGN QTL GQS+  GK          
Sbjct  336  ENDGPISQTIVNTAPWLITVAATTIDRAFPTAITLGNNQTLWGQSIDVGKYNPEFASITY  395

Query  202  -DTGVVDLVFLPDKFCETLTTTDTWIAGKVVLCFTGKHGLDID  77
             +   +D      K C+  +   T  +GK+VLCF+     DI+
Sbjct  396  SERIAIDPTDDSAKDCQPGSLNATLASGKIVLCFSKSDQQDIE  438



>emb|CBI34615.3| unnamed protein product [Vitis vinifera]
Length=737

 Score =   203 bits (517),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 140/220 (64%), Gaps = 13/220 (6%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--GGII  527
            +++SPRD  GHGTHT+STA G  V   +Y+GLA G  RGGAP ARLAIYK  W    G  
Sbjct  175  EFLSPRDGIGHGTHTASTAAGYFVEKANYRGLATGLARGGAPLARLAIYKACWAIISGAC  234

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFD+AIHDGVD++S S G ++PL + VD  DS+   SFHA+A GITVV +AGN
Sbjct  235  SDADILKAFDKAIHDGVDILSLSVGNDIPLFSYVDQRDSIAIASFHAIAKGITVVCSAGN  294

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK-DTGVVDLVFLP  170
            +GP +QT++   PW++TVAA T DR FPT I LGN QT +GQS+ TGK   G   L +  
Sbjct  295  DGPFSQTIANTAPWLITVAATTIDRAFPTAIILGNNQTFLGQSIDTGKHKLGFTGLTYSE  354

Query  169  D----------KFCETLTTTDTWIAGKVVLCFTGKHGLDI  80
                       K C+  +   T  AGK++LCF+     DI
Sbjct  355  RVALDPKDDSAKDCQPGSLNATLAAGKIILCFSKSDKQDI  394



>ref|XP_002278450.2| PREDICTED: subtilisin-like protease SBT3.3 [Vitis vinifera]
Length=787

 Score =   203 bits (517),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 140/220 (64%), Gaps = 13/220 (6%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--GGII  527
            +++SPRD  GHGTHT+STA G  V   +Y+GLA G  RGGAP ARLAIYK  W    G  
Sbjct  225  EFLSPRDGIGHGTHTASTAAGYFVEKANYRGLATGLARGGAPLARLAIYKACWAIISGAC  284

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFD+AIHDGVD++S S G ++PL + VD  DS+   SFHA+A GITVV +AGN
Sbjct  285  SDADILKAFDKAIHDGVDILSLSVGNDIPLFSYVDQRDSIAIASFHAIAKGITVVCSAGN  344

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK-DTGVVDLVFLP  170
            +GP +QT++   PW++TVAA T DR FPT I LGN QT +GQS+ TGK   G   L +  
Sbjct  345  DGPFSQTIANTAPWLITVAATTIDRAFPTAIILGNNQTFLGQSIDTGKHKLGFTGLTYSE  404

Query  169  D----------KFCETLTTTDTWIAGKVVLCFTGKHGLDI  80
                       K C+  +   T  AGK++LCF+     DI
Sbjct  405  RVALDPKDDSAKDCQPGSLNATLAAGKIILCFSKSDKQDI  444



>emb|CDX84657.1| BnaA03g15730D [Brassica napus]
Length=759

 Score =   203 bits (517),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 138/213 (65%), Gaps = 12/213 (6%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            + +SP D+ GHGTH +S A GS V + S+ GL  GT RG APRAR+A YK+ W   +   
Sbjct  220  EVMSPLDVTGHGTHCASIAAGSFVQDASFLGLGSGTARGSAPRARIASYKVCWSKEVCYS  279

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
             D LKA D AI DGVDVIS S G+ +PL  EVD +D    G+FHAV  GI VV A GN+G
Sbjct  280  PDILKAMDHAIRDGVDVISMSLGSTIPLEFEVDRSD-FAIGAFHAVMKGIPVVCAGGNDG  338

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQ-SLFTGKDTGVVDLVFLPDK  164
            P  QTVS   PWI+TVAA T DR+F TPITLGN  T++GQ SL+TGK+ G  D+V+L D 
Sbjct  339  PVTQTVSNVAPWIITVAATTMDREFFTPITLGNNVTVLGQESLYTGKEVGFADIVYLED-  397

Query  163  FCETLTTTDTWIA----GKVVLCFTGKHGLDID  77
                  T D ++A    GK+VL F  +  LDI+
Sbjct  398  -----LTKDDFLAGKAKGKIVLAFQIQSSLDIE  425



>ref|XP_007131764.1| hypothetical protein PHAVU_011G039900g [Phaseolus vulgaris]
 gb|ESW03758.1| hypothetical protein PHAVU_011G039900g [Phaseolus vulgaris]
Length=746

 Score =   203 bits (516),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 138/214 (64%), Gaps = 14/214 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +Y+SPRD  GHGTHTSSTA G  V N S+ GLA G  RGGAP A LA+YKI W  G    
Sbjct  176  EYLSPRDASGHGTHTSSTAAGVAVENASFMGLAKGLARGGAPSAWLAVYKICWSTGGCSS  235

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD L AFD+AI DGVD++SAS G++ PL   V+  D+L  GSFHAVA GI+VV + GN G
Sbjct  236  ADILAAFDDAIFDGVDILSASLGSDPPLPTYVE--DALAIGSFHAVAKGISVVCSGGNSG  293

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKD-TGVVDLVFLPD-  167
            P +QTV    PW++TVAA+T DR+FP+ I LGN QTL GQSL+TGKD +    +VF  D 
Sbjct  294  PYSQTVINTAPWVITVAASTIDREFPSRIILGNNQTLQGQSLYTGKDLSKFYPIVFGEDI  353

Query  166  ----------KFCETLTTTDTWIAGKVVLCFTGK  95
                      + C + +   T   GK +LCF  +
Sbjct  354  AASDADEESARGCNSGSLNATLAKGKAILCFQSR  387



>emb|CBI23066.3| unnamed protein product [Vitis vinifera]
Length=699

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/206 (56%), Positives = 129/206 (63%), Gaps = 30/206 (15%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
            T   +Y+SPRD  GHGTHTSS A GS V N SY GL FGT RGGAP ARLA+YK  W   
Sbjct  171  TEYLEYLSPRDALGHGTHTSSIAGGSPVVNASYYGLGFGTVRGGAPGARLAMYKACWNLG  230

Query  538  GGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVT  359
            GG    AD LKAFD+AIHDGVDVI                      GSFHAVA GI+VV 
Sbjct  231  GGFCSDADILKAFDKAIHDGVDVIL--------------------IGSFHAVAQGISVVC  270

Query  358  AAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLV  179
            AAGN GP+AQTV    PWILTVAA++ DR FPTPITLGN +T+MGQ++  G  TG   LV
Sbjct  271  AAGNGGPSAQTVDNTAPWILTVAASSIDRSFPTPITLGNNRTVMGQAMLIGNHTGFASLV  330

Query  178  FLPDKFCETLTTTDTWIAGKVVLCFT  101
            +  D   E        +AGKV LCFT
Sbjct  331  YPDDPHVE--------MAGKVALCFT  348



>ref|XP_006286455.1| hypothetical protein CARUB_v10000290mg [Capsella rubella]
 gb|EOA19353.1| hypothetical protein CARUB_v10000290mg [Capsella rubella]
Length=574

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 132/205 (64%), Gaps = 3/205 (1%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE-G  536
            T IADY+SPRD+ GHGTH +ST  GS + NVSY GL  GT RGGAP   +AIYK  W   
Sbjct  204  TLIADYLSPRDLNGHGTHVASTIGGSFLPNVSYLGLGEGTARGGAPGVHIAIYKACWLLE  263

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
            G    AD LKA D AI DGVDV+S S G+ VPL+ E D N  +  G FHAV  GI VV A
Sbjct  264  GTCTDADVLKAIDVAIDDGVDVLSLSLGSGVPLTIETDVN-LMAMGLFHAVEKGIHVVAA  322

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
            +GN GP AQ+VS   PWILTVAA T DR FPT ITLGN  T+MGQ+ F G + G V L +
Sbjct  323  SGNNGPVAQSVSNVAPWILTVAATTLDRSFPTAITLGNNITIMGQANFAGPELGSVGLTY  382

Query  175  LPDKFCETLTTTDTWIAGKVVLCFT  101
              D     L   +  + GKVVLCFT
Sbjct  383  SGD-CANLLDKPNNPMKGKVVLCFT  406



>ref|XP_007201744.1| hypothetical protein PRUPE_ppa001956mg [Prunus persica]
 gb|EMJ02943.1| hypothetical protein PRUPE_ppa001956mg [Prunus persica]
Length=736

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 141/214 (66%), Gaps = 14/214 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            ++ SPRD +GHGTHT+STA G+ + N S+ GLA G  RGGAP ARLA+YK+ W  G    
Sbjct  174  EFRSPRDAEGHGTHTASTAAGASIENASFMGLAAGLARGGAPSARLAVYKVCWGTGSCSS  233

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD L AFD+AI DGVDV+SAS G+  PL + V   D +  GSFHAVA GI+V+ +AGN G
Sbjct  234  ADLLAAFDDAIFDGVDVLSASLGSPPPLPSYV--KDVVSIGSFHAVAKGISVICSAGNSG  291

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTG-VVDLVFLPDK  164
            P  QTV  + PWI TVAA+T DR FPT ITLGN QT++GQ+L+TG DT     LV+  D 
Sbjct  292  PYPQTVINSAPWIFTVAASTIDRAFPTAITLGNNQTVVGQALYTGMDTNKFYPLVYGGDI  351

Query  163  F-----------CETLTTTDTWIAGKVVLCFTGK  95
                        C++ T  DT  +GK++LCF  +
Sbjct  352  ASIDADEDSAGNCDSGTLNDTLASGKMILCFQSR  385



>ref|NP_567359.1| Subtilase family protein [Arabidopsis thaliana]
 gb|AAD03440.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
Score=48.3, E=2.3e-12, n=4) [Arabidopsis thaliana]
 emb|CAB40045.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78175.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82893.1| Subtilase family protein [Arabidopsis thaliana]
Length=756

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 133/203 (66%), Gaps = 8/203 (4%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +Y+SPRD  GHGTH +ST  GS + NVSY GL  GT RGGAP   +A+YK  W G    G
Sbjct  208  EYLSPRDFAGHGTHVASTIGGSFLPNVSYVGLGRGTARGGAPGVHIAVYKACWSG-YCSG  266

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD LKA DEAIHDGVD++S S G +VPL  E    +    G+FHAVA GI VV AAGN G
Sbjct  267  ADVLKAMDEAIHDGVDILSLSLGPSVPLFPE---TEHTSVGAFHAVAKGIPVVIAAGNAG  323

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDKF  161
            P AQT+S   PW+LTVAA T DR FPT ITLGN  T++GQ+++ G + G V L +     
Sbjct  324  PTAQTISNVAPWVLTVAATTQDRSFPTAITLGNNITILGQAIYGGPELGFVGLTYPESPL  383

Query  160  ---CETLTTT-DTWIAGKVVLCF  104
               CE L+   ++ + GKVVLCF
Sbjct  384  SGDCEKLSANPNSTMEGKVVLCF  406



>ref|XP_008775642.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=737

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 141/215 (66%), Gaps = 15/215 (7%)
 Frame = -3

Query  703  ADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEG--GI  530
            ++Y+SPRD  GHGTHT+STA G L+ N SY+GLA GT RGGAP ARLA+YK  W+   G 
Sbjct  174  SEYLSPRDATGHGTHTASTAAGRLIKNASYRGLAAGTARGGAPFARLAVYKACWDTHPGE  233

Query  529  IMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAG  350
               AD LKAFDEAIHDGVDVIS S G +VPL + V+ +DS+  GSFHA A GI+VV +AG
Sbjct  234  CSDADILKAFDEAIHDGVDVISVSLGNHVPLLSYVE-DDSISIGSFHAAARGISVVCSAG  292

Query  349  NEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFT-GKDTGVVDLVFL  173
            N+GP +QTV+   PW+ TVAA + DR FPT I LGN  T++GQ+L T G   G  +L + 
Sbjct  293  NDGPFSQTVTNTAPWVTTVAAASIDRAFPTAIILGNNHTVLGQTLNTRGYKGGFHELRYS  352

Query  172  P-----------DKFCETLTTTDTWIAGKVVLCFT  101
                         + C   T   T   GKV+LCF+
Sbjct  353  EFVKKEKADAEYSRSCYIGTLNATLAKGKVILCFS  387



>ref|XP_010436981.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Camelina 
sativa]
Length=667

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 132/208 (63%), Gaps = 6/208 (3%)
 Frame = -3

Query  709  GIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGI  530
            G  +YISPRD  GHGTH +ST  GS V NVSY G+  GT RGGAP   +A+YK  W  G 
Sbjct  106  GNPEYISPRDFNGHGTHCASTIGGSFVPNVSYLGVGRGTARGGAPGVHIAMYKACWSTGR  165

Query  529  IMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAG  350
               AD LKA DEAIHDGVDV+S S GA   LS E D  D    G+FHAV  GI+VV AAG
Sbjct  166  CSNADILKAIDEAIHDGVDVLSLSLGARDSLSPETDVIDLTSVGTFHAVEKGISVVAAAG  225

Query  349  NEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLP  170
            N+GP AQT+S   PWILTVAA + DR FPT ITLGN  T++GQ++F G     V L + P
Sbjct  226  NDGPGAQTLSNVAPWILTVAATSLDRSFPTAITLGNNITILGQAIFAGPKLASVGLTY-P  284

Query  169  DKF----CETLTTT-DTWIAGKVVLCFT  101
            ++     C  L       + GKVVLCFT
Sbjct  285  ERPLSGDCAGLAANPKNTMQGKVVLCFT  312



>gb|KCW55411.1| hypothetical protein EUGRSUZ_I01318 [Eucalyptus grandis]
Length=769

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 137/214 (64%), Gaps = 14/214 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +++SPRD  GHGTHTSSTA GSLV + S+ GLA G  RGGAP A LA+YKI W  G    
Sbjct  208  EFLSPRDAVGHGTHTSSTAAGSLVEDASFAGLAQGLARGGAPAAWLAVYKICWSTGGCSS  267

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD L AFD+AI DGVDVIS S GA+ PL + VD  D+L  GSFHAVA GITVV + GN G
Sbjct  268  ADLLAAFDDAISDGVDVISLSLGASPPLPSYVD--DTLAIGSFHAVAKGITVVCSGGNSG  325

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFT-GKDTGVVDLVFLPD-  167
            P  QTV    PWI+TVAA+T DR FPT IT+GN QT +GQ+ +T G+      +V+  D 
Sbjct  326  PYPQTVINTAPWIITVAASTIDRAFPTAITMGNNQTFVGQAFYTRGRRDRYYPIVYGEDI  385

Query  166  ----------KFCETLTTTDTWIAGKVVLCFTGK  95
                      + CE  +   T   GKVVLCF  +
Sbjct  386  VSTNSDEDSARSCEVGSLNATLARGKVVLCFQSR  419



>ref|XP_010028643.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=792

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 137/214 (64%), Gaps = 14/214 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +++SPRD  GHGTHTSSTA GSLV + S+ GLA G  RGGAP A LA+YKI W  G    
Sbjct  231  EFLSPRDAVGHGTHTSSTAAGSLVEDASFAGLAQGLARGGAPAAWLAVYKICWSTGGCSS  290

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD L AFD+AI DGVDVIS S GA+ PL + VD  D+L  GSFHAVA GITVV + GN G
Sbjct  291  ADLLAAFDDAISDGVDVISLSLGASPPLPSYVD--DTLAIGSFHAVAKGITVVCSGGNSG  348

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFT-GKDTGVVDLVFLPD-  167
            P  QTV    PWI+TVAA+T DR FPT IT+GN QT +GQ+ +T G+      +V+  D 
Sbjct  349  PYPQTVINTAPWIITVAASTIDRAFPTAITMGNNQTFVGQAFYTRGRRDRYYPIVYGEDI  408

Query  166  ----------KFCETLTTTDTWIAGKVVLCFTGK  95
                      + CE  +   T   GKVVLCF  +
Sbjct  409  VSTNSDEDSARSCEVGSLNATLARGKVVLCFQSR  442



>ref|XP_002460565.1| hypothetical protein SORBIDRAFT_02g030760 [Sorghum bicolor]
 gb|EER97086.1| hypothetical protein SORBIDRAFT_02g030760 [Sorghum bicolor]
Length=765

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 140/218 (64%), Gaps = 14/218 (6%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            T I +++S RD  GHGTHT+STA G+LV++ +++GLA G  RGGAPRAR+A+YK+ W  G
Sbjct  198  TDIYEFMSARDAVGHGTHTASTAAGALVADANFRGLASGVARGGAPRARIAVYKVCWATG  257

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD L AFD+AIHDGVDV+S S G   PL A VD  D L  GSFHAVA GI VV +A
Sbjct  258  DCTSADILAAFDDAIHDGVDVLSVSLGQAPPLPAYVD--DVLSIGSFHAVARGIVVVCSA  315

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTG-VVDLVF  176
            GN GP ++TV  + PWI+TVAA T DR F   ITLGN  T +GQ+L+TGK  G  + +V+
Sbjct  316  GNSGPYSETVINSAPWIVTVAAGTIDRTFLAKITLGNNSTYVGQTLYTGKHPGKSIRIVY  375

Query  175  LPD-----------KFCETLTTTDTWIAGKVVLCFTGK  95
              D           + C   +   T + G VVLCF  +
Sbjct  376  AEDIASNNADDTDARSCTAGSLNSTLVKGNVVLCFQTR  413



>ref|XP_010461118.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=771

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 135/216 (63%), Gaps = 17/216 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGII--  527
            +YISPRD  GHGTH ++TA GS VS+ SY  L  GT RGGAPRAR+A+YK  W    I  
Sbjct  205  EYISPRDFNGHGTHVAATAAGSFVSDASYLALGRGTARGGAPRARVAMYKACWHLASIGT  264

Query  526  ---MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEAIHDGVDV+S S    +PL  EVD  D++  G+FHAVA GI VV +
Sbjct  265  ATCSAADMLKAIDEAIHDGVDVLSISTSFPIPLFPEVDAQDAMAVGAFHAVAKGIPVVCS  324

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GPA+QTV+   PWI+TVAA T DR FPT ITLGN  T++GQ+L+ G D     LV+
Sbjct  325  GGNAGPASQTVTNTAPWIITVAATTQDRSFPTLITLGNNITIVGQALYQGPDMDFTGLVY  384

Query  175  LPD----------KFCETLTTTDTW-IAGKVVLCFT  101
             P+            CE L       I  K+VLCFT
Sbjct  385  -PEGPGASNETFSGVCEDLAKNPARIIKEKIVLCFT  419



>gb|KDP41723.1| hypothetical protein JCGZ_26741 [Jatropha curcas]
Length=774

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 136/216 (63%), Gaps = 14/216 (6%)
 Frame = -3

Query  706  IADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGII  527
            + +Y+SPRD +GHGTHTSSTA G +V N S+ GLA G  RGGAP A LAIYK+ W  G  
Sbjct  203  VLEYLSPRDARGHGTHTSSTAAGVIVENASFMGLAQGLARGGAPSAWLAIYKVCWANGGC  262

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD L AFD+A+ DGVDV+S S G+  PL+  V+  D +  GSFHAV  GI+VV +AGN
Sbjct  263  SSADILAAFDDAVLDGVDVLSVSIGSTPPLATYVE--DPVAIGSFHAVTKGISVVCSAGN  320

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK------------  203
             GP  QTV    PW+ TVAA+T DR FPT ITLGN QT++GQ+L+TGK            
Sbjct  321  SGPYHQTVINTAPWVTTVAASTIDRAFPTRITLGNNQTVVGQALYTGKNADKFYPVVNGE  380

Query  202  DTGVVDLVFLPDKFCETLTTTDTWIAGKVVLCFTGK  95
            D  V        + CET T   T   GKV+LCF  +
Sbjct  381  DIAVAGAFEESARNCETGTLNATLARGKVILCFQSR  416



>tpg|DAA62442.1| TPA: putative subtilase family protein [Zea mays]
Length=487

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 136/218 (62%), Gaps = 14/218 (6%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            T I +++S RD  GHGTHT+STA G+LV+  S++GLA G  RGGAPRARLA+YK+ W  G
Sbjct  201  TDIYEFMSARDAVGHGTHTASTAAGALVAGASFRGLAGGVARGGAPRARLAVYKVCWATG  260

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD L AFD+AIHDGVDV+S S G   PL A VD  D L  GSFHAVA GI VV +A
Sbjct  261  DCTSADILAAFDDAIHDGVDVLSVSLGQAPPLPAYVD--DVLSIGSFHAVARGIVVVCSA  318

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFL  173
            GN GP ++TV  + PW++TVAA T DR F   I LGN  T +GQ+L++GK  G    +F 
Sbjct  319  GNSGPYSETVINSAPWLVTVAAGTIDRTFLAKIILGNNSTYVGQTLYSGKHPGNSMRIFY  378

Query  172  PD------------KFCETLTTTDTWIAGKVVLCFTGK  95
             +            + C   +   T + G VVLCF  +
Sbjct  379  AEDVASNNADDTDARSCTAGSLNSTLVKGTVVLCFQTR  416



>tpg|DAA62443.1| TPA: putative subtilase family protein [Zea mays]
Length=496

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 136/218 (62%), Gaps = 14/218 (6%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            T I +++S RD  GHGTHT+STA G+LV+  S++GLA G  RGGAPRARLA+YK+ W  G
Sbjct  38   TDIYEFMSARDAVGHGTHTASTAAGALVAGASFRGLAGGVARGGAPRARLAVYKVCWATG  97

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD L AFD+AIHDGVDV+S S G   PL A VD  D L  GSFHAVA GI VV +A
Sbjct  98   DCTSADILAAFDDAIHDGVDVLSVSLGQAPPLPAYVD--DVLSIGSFHAVARGIVVVCSA  155

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFL  173
            GN GP ++TV  + PW++TVAA T DR F   I LGN  T +GQ+L++GK  G    +F 
Sbjct  156  GNSGPYSETVINSAPWLVTVAAGTIDRTFLAKIILGNNSTYVGQTLYSGKHPGNSMRIFY  215

Query  172  PD------------KFCETLTTTDTWIAGKVVLCFTGK  95
             +            + C   +   T + G VVLCF  +
Sbjct  216  AEDVASNNADDTDARSCTAGSLNSTLVKGTVVLCFQTR  253



>ref|XP_010478713.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=645

 Score =   200 bits (509),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 134/216 (62%), Gaps = 17/216 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGII--  527
            +YISPRD  GHGTH ++TA GS V + SY  L  GT RGGAPRAR+A+YK  W    I  
Sbjct  79   EYISPRDFNGHGTHVAATAAGSFVPDASYLALGRGTARGGAPRARIAMYKACWHLASIGT  138

Query  526  ---MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEAIHDGVDV+S S    +PL  EVD  D++  G+FHAVA GI VV +
Sbjct  139  ATCSAADMLKAIDEAIHDGVDVLSISTSFPIPLFPEVDAQDAMAVGAFHAVAKGIPVVCS  198

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GPA+QTV+   PWI+TVAA T DR FPT ITLGN  T++GQ+L+ G D     LV+
Sbjct  199  GGNAGPASQTVTNTAPWIITVAATTQDRSFPTLITLGNNITIVGQALYQGPDMDFTGLVY  258

Query  175  LPD----------KFCETLTTTDTW-IAGKVVLCFT  101
             P+            CE L       I  K+VLCFT
Sbjct  259  -PEGPGASNETFSGVCEDLAKNPARIIKEKIVLCFT  293



>gb|EMS51782.1| Subtilisin-like protease SDD1 [Triticum urartu]
Length=734

 Score =   201 bits (511),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 142/230 (62%), Gaps = 16/230 (7%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            T I +Y+S RD  GHGTHT+STA G+LV + S++GLA G  RGGAPRARLA+YK+ W  G
Sbjct  204  TDIHEYMSARDAVGHGTHTASTAAGALVPDASFRGLASGVARGGAPRARLAVYKVCWATG  263

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD L AFD AIHDGVDV+S S G   PL A VD  D L  GSFHAV  GITVV +A
Sbjct  264  DCTSADILAAFDAAIHDGVDVLSVSLGQAPPLPAYVD--DVLAIGSFHAVVRGITVVCSA  321

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGV-VDLVF  176
            GN GP ++TV  + PW+LTVAA T DR F   ITLGN  T +GQ++++GK     + +V+
Sbjct  322  GNSGPYSETVINSAPWVLTVAAGTIDRTFLAKITLGNNSTYVGQTMYSGKHAATSMRIVY  381

Query  175  LPD-----------KFCETLTTTDTWIAGKVVLCFT--GKHGLDIDVEGI  65
              D           + C   +   T + G VVLCF   G+    + VE +
Sbjct  382  AEDVSSDNADDTDARSCTAGSLNATLVKGNVVLCFQTRGQRASQVAVETV  431



>gb|AET04097.2| subtilisin-like serine protease [Medicago truncatula]
Length=781

 Score =   201 bits (512),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 139/220 (63%), Gaps = 13/220 (6%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEG--GII  527
            +Y+S RD  GHGTHT+STA G  V N +Y+GLA G  RGGAP A LAIYK  W+   G  
Sbjct  223  EYLSARDAIGHGTHTASTAAGYFVENANYRGLASGLARGGAPLAHLAIYKACWDVPVGHC  282

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFD AIHDGVDV++ S G  +PL +  D  D++  GSFHA + GITVV++AGN
Sbjct  283  TDADILKAFDMAIHDGVDVLTVSLGIGIPLFSYADQRDTIAIGSFHATSKGITVVSSAGN  342

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDT-GVVDLVFLP  170
             GP +QTVS   PW++TVAA T DR FPT ITLGN  TL GQS+  GK   G V L +  
Sbjct  343  SGPISQTVSNTAPWLITVAATTIDRTFPTAITLGNNLTLWGQSIDNGKHALGFVGLTYSE  402

Query  169  D----------KFCETLTTTDTWIAGKVVLCFTGKHGLDI  80
                       K C++ +  +T  AGK+VLCF+     DI
Sbjct  403  RIARDPSDDLAKDCQSGSLNETMAAGKIVLCFSVSDQQDI  442



>gb|EMT21161.1| Cucumisin [Aegilops tauschii]
Length=710

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 142/230 (62%), Gaps = 16/230 (7%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            T I +Y+S RD  GHGTHT+STA G+LV + S++GLA G  RGGAPRARLA+YK+ W  G
Sbjct  206  TDIHEYMSARDAVGHGTHTASTAAGALVPDASFRGLASGVARGGAPRARLAVYKVCWATG  265

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD L AFD AIHDGVDV+S S G   PL A VD  D L  GSFHAV  GITVV +A
Sbjct  266  DCTSADILAAFDAAIHDGVDVLSVSLGQAPPLPAYVD--DVLAIGSFHAVVRGITVVCSA  323

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGV-VDLVF  176
            GN GP ++TV  + PW+LTVAA T DR F   ITLGN  T +GQ++++GK     + +V+
Sbjct  324  GNSGPYSETVINSAPWVLTVAAGTIDRTFLAKITLGNNSTYVGQTMYSGKHAATSMHIVY  383

Query  175  LPD-----------KFCETLTTTDTWIAGKVVLCFT--GKHGLDIDVEGI  65
              D           + C   +   T + G VVLCF   G+    + VE +
Sbjct  384  AEDVSSDNADDTDARSCTAGSLNATLVKGNVVLCFQTRGQRASQVAVETV  433



>ref|XP_002893749.1| hypothetical protein ARALYDRAFT_473479 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70008.1| hypothetical protein ARALYDRAFT_473479 [Arabidopsis lyrata subsp. 
lyrata]
Length=717

 Score =   200 bits (509),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 135/215 (63%), Gaps = 17/215 (8%)
 Frame = -3

Query  697  YISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGII---  527
            Y+SPRD  GHGTH ++TA GS V++ SY  L  GT RGGAPRAR+A+YK  W    I   
Sbjct  152  YVSPRDFNGHGTHVAATAAGSFVADASYLALGRGTARGGAPRARIAMYKACWHLASIGTA  211

Query  526  --MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD LKA DEAIHDGVDV+S S    +PL  EVD  D++  G+FHAVA GI VV + 
Sbjct  212  TCSAADMLKAIDEAIHDGVDVLSISTSFPIPLFPEVDARDAMAVGAFHAVAKGIPVVCSG  271

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFL  173
            GN GPA+QTV+   PWI+TVAA T DR FPT ITLGN  T++GQ+L+ G D     LV+ 
Sbjct  272  GNAGPASQTVTNTAPWIITVAATTQDRSFPTLITLGNNITIVGQALYQGPDMDFTGLVY-  330

Query  172  PD----------KFCETLTTTDTW-IAGKVVLCFT  101
            P+            CE L+      I  K+VLCFT
Sbjct  331  PEGPGASNETFSGVCEDLSKNPARIIKEKIVLCFT  365



>ref|XP_010499844.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
 ref|XP_010499845.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=771

 Score =   201 bits (510),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 134/216 (62%), Gaps = 17/216 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGII--  527
            +YISPRD  GHGTH ++TA GS V + SY  L  GT RGGAPRAR+A+YK  W    I  
Sbjct  205  EYISPRDFNGHGTHVAATAAGSFVPDASYLALGRGTARGGAPRARIAMYKACWHLASIGT  264

Query  526  ---MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEAIHDGVDV+S S    +PL  EVD  D++  G+FHAVA GI VV +
Sbjct  265  ATCSAADMLKAIDEAIHDGVDVLSISTSFPIPLFPEVDAQDAMAVGAFHAVAKGIPVVCS  324

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GPA+QTV+   PWI+TVAA T DR FPT ITLGN  T++GQ+L+ G D     LV+
Sbjct  325  GGNAGPASQTVTNTAPWIITVAATTQDRSFPTLITLGNNITIVGQALYQGPDMDFTGLVY  384

Query  175  LPD----------KFCETLTTTDTW-IAGKVVLCFT  101
             P+            CE L       I  K+VLCFT
Sbjct  385  -PEGPGASNETFSGVCEDLAKNPARIIKEKIVLCFT  419



>dbj|BAK05842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=770

 Score =   201 bits (510),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 141/228 (62%), Gaps = 16/228 (7%)
 Frame = -3

Query  706  IADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGII  527
            I +Y+S RD  GHGTHT+STA G+LV + S++GLA G  RGGAPRARLA+YK+ W  G  
Sbjct  205  IHEYMSARDAVGHGTHTASTAAGALVPDASFRGLASGVARGGAPRARLAVYKVCWATGDC  264

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD L AFD AIHDGVDV+S S G   PL A VD  D L  GSFHAV  GITVV +AGN
Sbjct  265  TSADILAAFDAAIHDGVDVLSVSLGQAPPLPAYVD--DVLAIGSFHAVVRGITVVCSAGN  322

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGV-VDLVFLP  170
             GP ++TV  + PW+LTVAA T DR F   ITLGN  T +GQ++++GK     + +V+  
Sbjct  323  SGPYSETVINSAPWVLTVAAGTIDRTFLAKITLGNNSTYVGQTMYSGKHAATSMRIVYAE  382

Query  169  D-----------KFCETLTTTDTWIAGKVVLCFT--GKHGLDIDVEGI  65
            D           + C   +   T + G VVLCF   G+    + VE +
Sbjct  383  DVSSDNADDSDARSCTAGSLNATLVKGNVVLCFQTRGQRASQVAVETV  430



>ref|XP_010478712.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
Length=771

 Score =   201 bits (510),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 134/216 (62%), Gaps = 17/216 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGII--  527
            +YISPRD  GHGTH ++TA GS V + SY  L  GT RGGAPRAR+A+YK  W    I  
Sbjct  205  EYISPRDFNGHGTHVAATAAGSFVPDASYLALGRGTARGGAPRARIAMYKACWHLASIGT  264

Query  526  ---MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEAIHDGVDV+S S    +PL  EVD  D++  G+FHAVA GI VV +
Sbjct  265  ATCSAADMLKAIDEAIHDGVDVLSISTSFPIPLFPEVDAQDAMAVGAFHAVAKGIPVVCS  324

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GPA+QTV+   PWI+TVAA T DR FPT ITLGN  T++GQ+L+ G D     LV+
Sbjct  325  GGNAGPASQTVTNTAPWIITVAATTQDRSFPTLITLGNNITIVGQALYQGPDMDFTGLVY  384

Query  175  LPD----------KFCETLTTTDTW-IAGKVVLCFT  101
             P+            CE L       I  K+VLCFT
Sbjct  385  -PEGPGASNETFSGVCEDLAKNPARIIKEKIVLCFT  419



>ref|XP_006286454.1| hypothetical protein CARUB_v10000290mg [Capsella rubella]
 gb|EOA19352.1| hypothetical protein CARUB_v10000290mg [Capsella rubella]
Length=754

 Score =   200 bits (509),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 115/206 (56%), Positives = 132/206 (64%), Gaps = 3/206 (1%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE-G  536
            T IADY+SPRD+ GHGTH +ST  GS + NVSY GL  GT RGGAP   +AIYK  W   
Sbjct  204  TLIADYLSPRDLNGHGTHVASTIGGSFLPNVSYLGLGEGTARGGAPGVHIAIYKACWLLE  263

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
            G    AD LKA D AI DGVDV+S S G+ VPL+ E D N  +  G FHAV  GI VV A
Sbjct  264  GTCTDADVLKAIDVAIDDGVDVLSLSLGSGVPLTIETDVN-LMAMGLFHAVEKGIHVVAA  322

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
            +GN GP AQ+VS   PWILTVAA T DR FPT ITLGN  T+MGQ+ F G + G V L +
Sbjct  323  SGNNGPVAQSVSNVAPWILTVAATTLDRSFPTAITLGNNITIMGQANFAGPELGSVGLTY  382

Query  175  LPDKFCETLTTTDTWIAGKVVLCFTG  98
              D     L   +  + GKVVLCFT 
Sbjct  383  SGD-CANLLDKPNNPMKGKVVLCFTA  407



>gb|KHN39834.1| Cucumisin, partial [Glycine soja]
Length=753

 Score =   200 bits (509),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 136/214 (64%), Gaps = 14/214 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +Y+SPRD  GHGTHTSSTA G  V N S+ GLA G  RGGAP A LAIYKI W  G    
Sbjct  180  EYLSPRDASGHGTHTSSTAAGVAVENASFMGLAKGLARGGAPSAWLAIYKICWSTGGCSS  239

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD L AFD+AI DGVD++SAS G++ PL   V+  D+L  GSFHAVA GI+VV + GN G
Sbjct  240  ADILAAFDDAIFDGVDILSASLGSDPPLPTYVE--DALAIGSFHAVAKGISVVCSGGNSG  297

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKD-TGVVDLVFLPD-  167
            P  QTV    PW++TVAA+T DR+F + I LGN QTL GQSL+TGKD +    +VF  D 
Sbjct  298  PYPQTVINTAPWLVTVAASTIDREFSSRIILGNNQTLQGQSLYTGKDLSKFYPIVFGEDI  357

Query  166  ----------KFCETLTTTDTWIAGKVVLCFTGK  95
                      + C + +   T   GK +LCF  +
Sbjct  358  AASDSDEESARSCNSGSLNSTLAKGKAILCFQSR  391



>ref|XP_003537841.1| PREDICTED: cucumisin-like [Glycine max]
Length=782

 Score =   200 bits (509),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 136/214 (64%), Gaps = 14/214 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +Y+SPRD  GHGTHTSSTA G  V N S+ GLA G  RGGAP A LAIYKI W  G    
Sbjct  209  EYLSPRDASGHGTHTSSTAAGVAVENASFMGLAKGLARGGAPSAWLAIYKICWSTGGCSS  268

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD L AFD+AI DGVD++SAS G++ PL   V+  D+L  GSFHAVA GI+VV + GN G
Sbjct  269  ADILAAFDDAIFDGVDILSASLGSDPPLPTYVE--DALAIGSFHAVAKGISVVCSGGNSG  326

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKD-TGVVDLVFLPD-  167
            P  QTV    PW++TVAA+T DR+F + I LGN QTL GQSL+TGKD +    +VF  D 
Sbjct  327  PYPQTVINTAPWLVTVAASTIDREFSSRIILGNNQTLQGQSLYTGKDLSKFYPIVFGEDI  386

Query  166  ----------KFCETLTTTDTWIAGKVVLCFTGK  95
                      + C + +   T   GK +LCF  +
Sbjct  387  AASDSDEESARSCNSGSLNSTLAKGKAILCFQSR  420



>ref|XP_006580143.1| PREDICTED: subtilisin-like protease SDD1-like isoform X4 [Glycine 
max]
 ref|XP_006580144.1| PREDICTED: subtilisin-like protease SDD1-like isoform X5 [Glycine 
max]
Length=650

 Score =   199 bits (506),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 139/220 (63%), Gaps = 13/220 (6%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGI--I  527
            +Y+S RD  GHGTHT+STA G  V N +Y+GLA G  RGGAP A LAIYK  W+  I   
Sbjct  93   EYLSARDAIGHGTHTASTAAGYFVGNANYRGLASGLARGGAPLAHLAIYKACWDFPIGDC  152

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFD+AIHDGVDV++ S G  +PL + VD  DSL  GSFHA + GITVV +AGN
Sbjct  153  TDADILKAFDKAIHDGVDVLTVSLGFAIPLFSYVDQRDSLAIGSFHATSKGITVVCSAGN  212

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK-DTGVVDLVFLP  170
             GP +QTV+   PWI+TV A T DR FP  ITLGN +T+ GQS+  GK + G V L +  
Sbjct  213  SGPVSQTVTNTAPWIITVGATTIDRAFPAAITLGNNRTVWGQSIDMGKHNLGSVGLTYSE  272

Query  169  D----------KFCETLTTTDTWIAGKVVLCFTGKHGLDI  80
                       K C++ +   T  AGK+VLCF+     DI
Sbjct  273  RIAVDPSDNLAKDCQSGSLNATMAAGKIVLCFSVSDQQDI  312



>ref|XP_010436973.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Camelina 
sativa]
Length=758

 Score =   200 bits (509),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 127/201 (63%), Gaps = 4/201 (2%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +Y+SPRD  GHGTH +ST  GS + NVSY  L  GT RGGAP   LAIYK  W       
Sbjct  209  EYVSPRDFSGHGTHVASTIGGSFLPNVSYSRLGRGTVRGGAPGVFLAIYKACWFQMGCSN  268

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD LKA DEAIHDGVDV+S S G+ VPL+ E D       G FHAV  GI VV +AGN G
Sbjct  269  ADLLKAIDEAIHDGVDVLSLSLGSGVPLNLETDVRLFFAMGLFHAVEKGIHVVASAGNNG  328

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDKF  161
            PAAQT+    PWILTVAA T DR FPT ITLGN  T++GQ++F G +   V L +  D  
Sbjct  329  PAAQTIGNVAPWILTVAATTLDRSFPTAITLGNNITILGQAIFAGPELSFVGLTYSGD--  386

Query  160  CETLTTTDTWIAGKVVLCFTG  98
            C  L+     + GKVVLCFT 
Sbjct  387  CAKLSANP--MEGKVVLCFTA  405



>ref|XP_002872521.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48780.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=766

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 138/215 (64%), Gaps = 16/215 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            D+ISPR   GHGTH ++ A GS V N+SYKGLA GT RGGAPRAR+A+YK        + 
Sbjct  200  DFISPRGYNGHGTHVATIAGGSYVPNISYKGLAGGTVRGGAPRARIAVYKTCLYLDDLDI  259

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEAIHDGVDV+S S G   PL  E D  D +  G+FHAV  GITVV A
Sbjct  260  TSCSSADILKAMDEAIHDGVDVLSLSLGFE-PLYPETDVRDGIATGAFHAVLKGITVVCA  318

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
            AGN GPAAQTV+   PWI+TVAA T DR F TP+TLGN + ++GQ+++TG +     LV+
Sbjct  319  AGNAGPAAQTVTNLAPWIITVAATTLDRSFVTPMTLGNNKVILGQAIYTGPEVAFTSLVY  378

Query  175  LPDK---------FCET-LTTTDTWIAGKVVLCFT  101
              +           CE  L  ++  +AGKVVLCFT
Sbjct  379  PENPGNSNESFSGTCERLLINSNRTMAGKVVLCFT  413



>ref|NP_564413.2| subtilase family protein [Arabidopsis thaliana]
 gb|AEE31543.1| subtilase family protein [Arabidopsis thaliana]
Length=773

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 140/215 (65%), Gaps = 15/215 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            DYIS RD  GHGTH +S A GS V NVSYKGL  GT RGGAPRAR+A+YK  W     +G
Sbjct  206  DYISARDFDGHGTHVASIAGGSFVPNVSYKGLGRGTLRGGAPRARIAMYKACWYINELDG  265

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 +D +KA DEAIHDGVDV+S S G  VPL++E D  D +  G+FHAVA GI VV A
Sbjct  266  VTCSFSDIMKAIDEAIHDGVDVLSISLGGRVPLNSETDLRDGIATGAFHAVAKGIVVVCA  325

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GP++QTV    PWILTVAA T DR F TPI LGN Q ++GQ+++ G + G   LV+
Sbjct  326  GGNAGPSSQTVVNTAPWILTVAATTLDRSFATPIILGNNQVILGQAMYIGPELGFTSLVY  385

Query  175  LPDK---------FCETLT-TTDTWIAGKVVLCFT  101
              D           CE+L   ++  +AGKVVLCFT
Sbjct  386  PEDPGNSIDTFSGVCESLNLNSNRTMAGKVVLCFT  420



>ref|XP_006286458.1| hypothetical protein CARUB_v10000288mg [Capsella rubella]
 gb|EOA19356.1| hypothetical protein CARUB_v10000288mg [Capsella rubella]
Length=759

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 134/212 (63%), Gaps = 9/212 (4%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-EG  536
            T   +YISPRD  GHGTH +ST  GS + NVSY GL  GT RGGAP   +AIYK  W +G
Sbjct  204  TETPEYISPRDFSGHGTHVASTIGGSFLPNVSYLGLGQGTARGGAPGVHIAIYKACWLQG  263

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
            G    AD LKA DEAIHDGVDV+S S G+  PL+ E D       G FHAV  GI VV +
Sbjct  264  GTCSSADLLKAIDEAIHDGVDVLSLSVGSGFPLTIETDV-QLFAMGLFHAVEKGIHVVAS  322

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
            AGN GP AQT+    PWILTVAA T DR FPT ITLGN  T++GQ++F     G V+L +
Sbjct  323  AGNNGPVAQTIGNVAPWILTVAATTLDRSFPTTITLGNNITILGQAIFARPKLGFVNLTY  382

Query  175  LPDKF----CETLTTTDTWIA--GKVVLCFTG  98
             P++     C +L   +  IA  GKVVLCFT 
Sbjct  383  -PERPLSGDCASLANPNNAIAMNGKVVLCFTA  413



>gb|AAF31277.1|AC006424_6 Second of four adjacent putative subtilase family> [Arabidopsis 
thaliana]
Length=763

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 140/215 (65%), Gaps = 15/215 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-----EG  536
            DYIS RD  GHGTH +S A GS V NVSYKGL  GT RGGAPRAR+A+YK  W     +G
Sbjct  206  DYISARDFDGHGTHVASIAGGSFVPNVSYKGLGRGTLRGGAPRARIAMYKACWYINELDG  265

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 +D +KA DEAIHDGVDV+S S G  VPL++E D  D +  G+FHAVA GI VV A
Sbjct  266  VTCSFSDIMKAIDEAIHDGVDVLSISLGGRVPLNSETDLRDGIATGAFHAVAKGIVVVCA  325

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GP++QTV    PWILTVAA T DR F TPI LGN Q ++GQ+++ G + G   LV+
Sbjct  326  GGNAGPSSQTVVNTAPWILTVAATTLDRSFATPIILGNNQVILGQAMYIGPELGFTSLVY  385

Query  175  LPDK---------FCETLT-TTDTWIAGKVVLCFT  101
              D           CE+L   ++  +AGKVVLCFT
Sbjct  386  PEDPGNSIDTFSGVCESLNLNSNRTMAGKVVLCFT  420



>ref|XP_006580142.1| PREDICTED: subtilisin-like protease SDD1-like isoform X3 [Glycine 
max]
Length=669

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 139/220 (63%), Gaps = 13/220 (6%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGI--I  527
            +Y+S RD  GHGTHT+STA G  V N +Y+GLA G  RGGAP A LAIYK  W+  I   
Sbjct  112  EYLSARDAIGHGTHTASTAAGYFVGNANYRGLASGLARGGAPLAHLAIYKACWDFPIGDC  171

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFD+AIHDGVDV++ S G  +PL + VD  DSL  GSFHA + GITVV +AGN
Sbjct  172  TDADILKAFDKAIHDGVDVLTVSLGFAIPLFSYVDQRDSLAIGSFHATSKGITVVCSAGN  231

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK-DTGVVDLVFLP  170
             GP +QTV+   PWI+TV A T DR FP  ITLGN +T+ GQS+  GK + G V L +  
Sbjct  232  SGPVSQTVTNTAPWIITVGATTIDRAFPAAITLGNNRTVWGQSIDMGKHNLGSVGLTYSE  291

Query  169  D----------KFCETLTTTDTWIAGKVVLCFTGKHGLDI  80
                       K C++ +   T  AGK+VLCF+     DI
Sbjct  292  RIAVDPSDNLAKDCQSGSLNATMAAGKIVLCFSVSDQQDI  331



>gb|AAD03438.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
Score=49.7, E=9.2e-13, n=3) [Arabidopsis thaliana]
Length=774

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 138/223 (62%), Gaps = 24/223 (11%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW----EGG  533
            D+ISPR   GHGTH ++ A GS V N SYKGLA GT RGGAPRAR+A+YK  W    +  
Sbjct  200  DFISPRGYNGHGTHVATIAGGSYVPNTSYKGLAGGTVRGGAPRARIAVYKTCWYLDLDIA  259

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD LKA DEAIHDGVDV+S S G   PL  E D  D +  G+FHAV  GITVV AA
Sbjct  260  ACSSADILKAMDEAIHDGVDVLSLSLGFE-PLYPETDVRDGIATGAFHAVLKGITVVCAA  318

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLM---------GQSLFTGKD  200
            GN GPAAQTV    PWILTVAA T DR F TP+TLGN + ++         GQ+++TG +
Sbjct  319  GNAGPAAQTVGNTAPWILTVAATTLDRSFVTPMTLGNNKVILVTTRYIHHNGQAIYTGTE  378

Query  199  TGVVDLVFLPDK---------FCET-LTTTDTWIAGKVVLCFT  101
             G   LV+  +           CE  L  ++  +AGKVVLCFT
Sbjct  379  VGFTSLVYPENPGNSNESFSGTCERLLINSNRTMAGKVVLCFT  421



>ref|XP_006580141.1| PREDICTED: subtilisin-like protease SDD1-like isoform X2 [Glycine 
max]
Length=788

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 139/220 (63%), Gaps = 13/220 (6%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGI--I  527
            +Y+S RD  GHGTHT+STA G  V N +Y+GLA G  RGGAP A LAIYK  W+  I   
Sbjct  231  EYLSARDAIGHGTHTASTAAGYFVGNANYRGLASGLARGGAPLAHLAIYKACWDFPIGDC  290

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFD+AIHDGVDV++ S G  +PL + VD  DSL  GSFHA + GITVV +AGN
Sbjct  291  TDADILKAFDKAIHDGVDVLTVSLGFAIPLFSYVDQRDSLAIGSFHATSKGITVVCSAGN  350

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK-DTGVVDLVFLP  170
             GP +QTV+   PWI+TV A T DR FP  ITLGN +T+ GQS+  GK + G V L +  
Sbjct  351  SGPVSQTVTNTAPWIITVGATTIDRAFPAAITLGNNRTVWGQSIDMGKHNLGSVGLTYSE  410

Query  169  D----------KFCETLTTTDTWIAGKVVLCFTGKHGLDI  80
                       K C++ +   T  AGK+VLCF+     DI
Sbjct  411  RIAVDPSDNLAKDCQSGSLNATMAAGKIVLCFSVSDQQDI  450



>ref|XP_003524182.2| PREDICTED: subtilisin-like protease SDD1-like isoform X1 [Glycine 
max]
Length=793

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 139/220 (63%), Gaps = 13/220 (6%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGI--I  527
            +Y+S RD  GHGTHT+STA G  V N +Y+GLA G  RGGAP A LAIYK  W+  I   
Sbjct  236  EYLSARDAIGHGTHTASTAAGYFVGNANYRGLASGLARGGAPLAHLAIYKACWDFPIGDC  295

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFD+AIHDGVDV++ S G  +PL + VD  DSL  GSFHA + GITVV +AGN
Sbjct  296  TDADILKAFDKAIHDGVDVLTVSLGFAIPLFSYVDQRDSLAIGSFHATSKGITVVCSAGN  355

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK-DTGVVDLVFLP  170
             GP +QTV+   PWI+TV A T DR FP  ITLGN +T+ GQS+  GK + G V L +  
Sbjct  356  SGPVSQTVTNTAPWIITVGATTIDRAFPAAITLGNNRTVWGQSIDMGKHNLGSVGLTYSE  415

Query  169  D----------KFCETLTTTDTWIAGKVVLCFTGKHGLDI  80
                       K C++ +   T  AGK+VLCF+     DI
Sbjct  416  RIAVDPSDNLAKDCQSGSLNATMAAGKIVLCFSVSDQQDI  455



>ref|XP_006306820.1| hypothetical protein CARUB_v10008362mg [Capsella rubella]
 gb|EOA39718.1| hypothetical protein CARUB_v10008362mg [Capsella rubella]
Length=771

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 134/216 (62%), Gaps = 17/216 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGII--  527
            +YISPRD  GHGTH ++TA GS V + SY  L  G  RGGAPRAR+A+YK  W    I  
Sbjct  205  EYISPRDFNGHGTHVAATAAGSFVPDASYLALGRGIARGGAPRARIAMYKACWHLASIGT  264

Query  526  ---MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEAIHDGVDV+S S    +PL  EVD  D++  G+FHAVA GI VV +
Sbjct  265  ATCSAADMLKAIDEAIHDGVDVLSISTSFPIPLFPEVDARDAMAVGAFHAVAKGIPVVCS  324

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GPA+QTV+   PWI+TVAA T DR FPT ITLGN  T++GQ+L+ G D   + LV+
Sbjct  325  GGNAGPASQTVTNTAPWIITVAATTQDRSFPTLITLGNNITIVGQALYQGPDMDFIGLVY  384

Query  175  LPD----------KFCETLTTTDTW-IAGKVVLCFT  101
             P+            CE L       I  K+VLCFT
Sbjct  385  -PEGPGASNETFSGVCEDLAKNPARIIKEKIVLCFT  419



>ref|XP_010470055.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=750

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 131/207 (63%), Gaps = 8/207 (4%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +Y+SPRD  GHGTH +ST  GS + NVSY GL  GT RGGAP   LA YK  W       
Sbjct  200  EYLSPRDFNGHGTHVASTIGGSFLPNVSYLGLGRGTARGGAPGVYLATYKACWSQIGCSD  259

Query  520  ADTLKAFDEAIHDGVDVISASFG-ANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNE  344
            AD LKA D+AIHDGVDV+S S G   +PL+ E D N     G FHAVA GI VV +AGN 
Sbjct  260  ADLLKAIDQAIHDGVDVLSLSLGPTEIPLNLETDVN-LFAMGLFHAVAKGIHVVASAGNN  318

Query  343  GPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDK  164
            GPAAQT++   PWILTVAA T DR FPT ITLGN  T +GQ++F G + G VDL + P++
Sbjct  319  GPAAQTIANVSPWILTVAATTLDRSFPTAITLGNNITTLGQAIFAGPELGSVDLTY-PER  377

Query  163  -----FCETLTTTDTWIAGKVVLCFTG  98
                   E     +  I GKVVLCFT 
Sbjct  378  PLSGDCAELRANPNKTIQGKVVLCFTA  404



>ref|XP_006370729.1| hypothetical protein POPTR_0001s45480g, partial [Populus trichocarpa]
 gb|ERP67298.1| hypothetical protein POPTR_0001s45480g, partial [Populus trichocarpa]
Length=556

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 133/206 (65%), Gaps = 14/206 (7%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
            +G  +++SPRD  GHGTHT+S AVG  V NVSYKGL  GT RGGAPRARLAIYK+ W   
Sbjct  144  SGNQEFLSPRDANGHGTHTASIAVGGFVENVSYKGLGLGTVRGGAPRARLAIYKVCWNVL  203

Query  538  GGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVT  359
            GG    AD LKAFDEAI DGVDV+S S     PL ++ D  D L  GSFHA   GIT+V 
Sbjct  204  GGWCSAADVLKAFDEAIDDGVDVLSLSL-RYPPLFSDTDERDGLAIGSFHAFTKGITIVC  262

Query  358  AAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLV  179
            +AGN+GP +QTV    PWIL V+A+T DR F T ITLG  +T +    +  +  GV    
Sbjct  263  SAGNDGPFSQTVLNTAPWILNVSASTIDRAFLTLITLGKNKTFLVYLQYC-ETCGV----  317

Query  178  FLPDKFCETLTTTDTWIAGKVVLCFT  101
                  C++L+   + ++GKVVLCFT
Sbjct  318  ------CQSLSVNPSMVSGKVVLCFT  337



>ref|XP_007042045.1| Subtilase family protein, putative isoform 4 [Theobroma cacao]
 gb|EOX97876.1| Subtilase family protein, putative isoform 4 [Theobroma cacao]
Length=535

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 137/214 (64%), Gaps = 14/214 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +++SPRD  GHG+HTSSTA G+LV N +++GLA G  RGGA  + LAIYK+ W  G    
Sbjct  208  EFMSPRDASGHGSHTSSTASGALVENANFRGLAQGLARGGASSSWLAIYKVCWATGGCSS  267

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD L AFD+AI DGV+V+S S G+  PLS  VD  D+L  GSFHAVA GI+VV +AGN G
Sbjct  268  ADLLAAFDDAIFDGVNVLSVSLGSPPPLSTYVD--DTLAIGSFHAVARGISVVCSAGNSG  325

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK------------DT  197
            P  QTV    PW++TVAA+T DRDFP+ +T+GN QT++GQS +TG+            D 
Sbjct  326  PYPQTVINTAPWVITVAASTIDRDFPSVVTMGNNQTVVGQSFYTGRKVNKFHPIVYGEDI  385

Query  196  GVVDLVFLPDKFCETLTTTDTWIAGKVVLCFTGK  95
               D+       C+  T   T   GK+VLCF  +
Sbjct  386  AATDVDENSAGSCDLETLNATLARGKIVLCFQSR  419



>tpg|DAA62441.1| TPA: putative subtilase family protein [Zea mays]
Length=593

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 136/218 (62%), Gaps = 14/218 (6%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            T I +++S RD  GHGTHT+STA G+LV+  S++GLA G  RGGAPRARLA+YK+ W  G
Sbjct  201  TDIYEFMSARDAVGHGTHTASTAAGALVAGASFRGLAGGVARGGAPRARLAVYKVCWATG  260

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD L AFD+AIHDGVDV+S S G   PL A VD  D L  GSFHAVA GI VV +A
Sbjct  261  DCTSADILAAFDDAIHDGVDVLSVSLGQAPPLPAYVD--DVLSIGSFHAVARGIVVVCSA  318

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFL  173
            GN GP ++TV  + PW++TVAA T DR F   I LGN  T +GQ+L++GK  G    +F 
Sbjct  319  GNSGPYSETVINSAPWLVTVAAGTIDRTFLAKIILGNNSTYVGQTLYSGKHPGNSMRIFY  378

Query  172  PD------------KFCETLTTTDTWIAGKVVLCFTGK  95
             +            + C   +   T + G VVLCF  +
Sbjct  379  AEDVASNNADDTDARSCTAGSLNSTLVKGTVVLCFQTR  416



>ref|XP_011012404.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=789

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 113/235 (48%), Positives = 147/235 (63%), Gaps = 24/235 (10%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW---  542
            TG  +++SPRD  GHGTHT+STA G+ V+  SYKGLA G  RGGAP A LAIYK+ W   
Sbjct  215  TGSREFMSPRDGDGHGTHTASTAAGNFVAKASYKGLATGLARGGAPLAHLAIYKVCWNIE  274

Query  541  EGGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVV  362
            +GG    AD LKAFD+AIHDGVD++S S G N+PL + VD  +S+  GSFHA + GITVV
Sbjct  275  DGGGCTDADILKAFDKAIHDGVDILSVSIGINIPLFSYVDMRNSIAIGSFHATSKGITVV  334

Query  361  -----------TAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSL  215
                        +AGN+GP +QTV+   PW+ TVAA+T DR FPT I LGN +TL GQS+
Sbjct  335  CSATLNGIPVICSAGNDGPISQTVANTAPWLTTVAASTIDRAFPTAIILGNNKTLRGQSI  394

Query  214  FTGK-DTGVVDLVF---------LPDKFCETLTTTDTWIAGKVVLCFTGKHGLDI  80
              GK +   V L +         +  + C+  +   T  AGK++LCF+     D+
Sbjct  395  TKGKHNHRFVGLTYSERIALNPMVSSQDCQPGSLNPTLAAGKIILCFSKSDTQDM  449



>ref|XP_006415135.1| hypothetical protein EUTSA_v10006863mg [Eutrema salsugineum]
 gb|ESQ33488.1| hypothetical protein EUTSA_v10006863mg [Eutrema salsugineum]
Length=776

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 134/215 (62%), Gaps = 15/215 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE-----G  536
            +Y+SPRD  GHGTH ++TA GS V + SY  L  G  RGGAPRAR+A+YK  W       
Sbjct  210  EYVSPRDFNGHGTHVAATAAGSFVPDASYLALGRGIARGGAPRARVAMYKACWHLTSLGT  269

Query  535  GIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
                 AD LKA DEAIHDGVDV+S S   ++PL  EVD  D++  G+FHAVA GI VV +
Sbjct  270  ATCSAADMLKAIDEAIHDGVDVLSISTSFSIPLFPEVDARDAMAVGAFHAVAKGIPVVCS  329

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN GPA+QTV+   PWI+TVAA T DR FPT ITLGN  T++GQ+L+ G D     LV+
Sbjct  330  GGNAGPASQTVTNTAPWIITVAATTQDRSFPTLITLGNNVTIVGQALYQGPDMDFTGLVY  389

Query  175  L--PDK-------FCETLTTTDTW-IAGKVVLCFT  101
               P+         CE L+      I  K+VLCFT
Sbjct  390  PEGPEASNETFSGVCEDLSKNPARIIKEKIVLCFT  424



>ref|XP_010551747.1| PREDICTED: subtilisin-like protease SBT3.5 [Tarenaya hassleriana]
Length=761

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 140/225 (62%), Gaps = 18/225 (8%)
 Frame = -3

Query  691  SPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMGADT  512
            SPRD+ GHGTH +S A GS V   S +GLA GT RGGAP AR+A YK+ W+     G+D 
Sbjct  225  SPRDVTGHGTHVTSIAAGSFVPGASVEGLAGGTARGGAPGARVATYKVCWKSAGCPGSDL  284

Query  511  LKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEGPAA  332
            +KA D+AIHD VDVIS S G  +P   EVDP D +   SFHAV  GI VV AAGNEGP  
Sbjct  285  VKAIDDAIHDRVDVISISIGNRIPNDFEVDPRD-IGIASFHAVMEGIPVVCAAGNEGPGP  343

Query  331  QTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF---LPDKF  161
            QTV    PWI+TVAA+T DR FP  +TLGN  T+M Q L+TG  TG VDLV+   LPD  
Sbjct  344  QTVDNVAPWIITVAASTMDRSFPIYLTLGNNLTMMAQGLYTGNQTGFVDLVYGGELPDAD  403

Query  160  CETLTTTDTWIAGKVVLCFTG----KHGLDIDVEG-----IVAQS  53
             +  +     + GK+VL F      K  L + V+G     I+AQS
Sbjct  404  IKNGS-----VMGKIVLIFMASDVEKEKLKLIVQGGSAGVIMAQS  443



>ref|XP_002298975.2| hypothetical protein POPTR_0001s45490g [Populus trichocarpa]
 gb|EEE83780.2| hypothetical protein POPTR_0001s45490g [Populus trichocarpa]
Length=786

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 107/219 (49%), Positives = 140/219 (64%), Gaps = 12/219 (5%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW--EGGII  527
            +++SPRD  GHGTHT+STA G+ V+  SYKGLA G  RGGAP A LAIYK+ W  E G  
Sbjct  228  EFMSPRDGDGHGTHTASTAAGNFVAKASYKGLATGLARGGAPLAHLAIYKVCWNIEDGGC  287

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFD+AIHDGVD++S S G ++PL +  D  +S+  GSFHA + GITVV +AGN
Sbjct  288  TDADILKAFDKAIHDGVDILSVSIGNDIPLFSYADMRNSIAIGSFHATSKGITVVCSAGN  347

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPD  167
            +GP +QTV+   PW+ TVAA+T DR FPT I LGN +TL GQS+  GK T     +   +
Sbjct  348  DGPISQTVANTAPWLTTVAASTIDRAFPTAIILGNNKTLRGQSITIGKHTHRFAGLTYSE  407

Query  166  KF----------CETLTTTDTWIAGKVVLCFTGKHGLDI  80
            +           C+  +   T  AGK++LC +     D+
Sbjct  408  RIALDPMVSSQDCQPGSLNPTLAAGKIILCLSKSDTQDM  446



>ref|XP_004146562.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004160980.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN53334.1| hypothetical protein Csa_4G047950 [Cucumis sativus]
Length=764

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 139/220 (63%), Gaps = 2/220 (1%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-EGGIIM  524
            +Y+SPRD+ GHGTHT+S A GS V+N++Y   A GT RGGAP ARLAIYK  W +  +  
Sbjct  213  EYLSPRDLNGHGTHTASIAAGSFVANINYHNNAAGTVRGGAPLARLAIYKALWTKDAVGS  272

Query  523  GADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNE  344
             AD LKA DEAI+DGVDV+S S G+  P   E +  + + FGSFHA+A GI+VV AAGN 
Sbjct  273  TADILKAIDEAINDGVDVLSMSIGSLTPFLPEFNEANDIAFGSFHAIAKGISVVCAAGNS  332

Query  343  GPAAQTVSGADPWILTVAANTPDRDFPTPI-TLGNGQTLMGQSLFTGKDTGVVDLVFLPD  167
            GP  QTV    PWI TVAANT DR F   I TL +  T +GQSL   K   V +L  L  
Sbjct  333  GPTPQTVENVAPWIFTVAANTIDRAFLASITTLPDNTTFLGQSLLDSKKDLVAELETLDT  392

Query  166  KFCETLTTTDTWIAGKVVLCFTGKHGLDIDVEGIVAQSRA  47
              C+ L   +T+I GKVV+CF+     +   +  +A +RA
Sbjct  393  GRCDDLLGNETFINGKVVMCFSNLADHNTIYDAAMAVARA  432



>ref|XP_010436935.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=761

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 143/219 (65%), Gaps = 7/219 (3%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-EGGIIM  524
            +Y+SPRD  GHGTH +ST  GS + NVSY GL  GT RGGAP   +AIYK  W + G   
Sbjct  208  EYLSPRDFSGHGTHVASTIGGSFLPNVSYLGLGQGTARGGAPGVHIAIYKACWLQIGTCT  267

Query  523  GADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNE  344
            GAD LKA DEAIHDGVD++S S  +++PL  E D  +    G+FHAVA GI VV AAGN 
Sbjct  268  GADVLKAIDEAIHDGVDILSLSLQSSIPLFPETDMRELTSVGAFHAVAKGIAVVAAAGNA  327

Query  343  GPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDK  164
            GP AQT+S   PWILTVAA T DR FPT ITLGN  T++GQ++F G + G V L + P++
Sbjct  328  GPTAQTISNVAPWILTVAATTQDRSFPTAITLGNNITILGQAIFGGPELGFVGLTY-PER  386

Query  163  F----CETLTTT-DTWIAGKVVLCFTGKHGLDIDVEGIV  62
                 CE L+   D+ + GKVVLCFT     +  +  ++
Sbjct  387  PLSGDCEKLSANPDSAMEGKVVLCFTANKPTNAAITAVI  425



>ref|XP_007131420.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
 gb|ESW03414.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
Length=510

 Score =   195 bits (495),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 138/220 (63%), Gaps = 13/220 (6%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGI--I  527
            +Y+S RD  GHGTHT+STA G+ V N +Y+GLA G  RGGAP A LAIYK  W   I   
Sbjct  217  EYLSARDAIGHGTHTASTAAGNFVGNANYRGLASGLARGGAPLAHLAIYKACWNFPIGDC  276

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFD+AI+DGVDV++ S G ++PL + VD  D +  GSFHA A GITVV +AGN
Sbjct  277  TDADILKAFDKAIYDGVDVLTVSLGFSIPLFSYVDQRDVIAIGSFHATAKGITVVCSAGN  336

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK-DTGVVDLVFLP  170
             GP +QT++   PWI+TV A T DR FP  ITLGN  T+ GQS+ TGK +   V L +  
Sbjct  337  SGPLSQTITNTAPWIITVGATTIDRAFPAAITLGNNLTVWGQSIDTGKHNLESVGLTYSE  396

Query  169  D----------KFCETLTTTDTWIAGKVVLCFTGKHGLDI  80
                       K C++ +   T  AGK+VLCF+     DI
Sbjct  397  RIALDSSENLAKACQSGSLNATMAAGKIVLCFSVSDQQDI  436



>ref|XP_004309569.1| PREDICTED: subtilisin-like protease SDD1-like [Fragaria vesca 
subsp. vesca]
Length=824

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 135/218 (62%), Gaps = 11/218 (5%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            D++SPRD  GHGTHT+STA G  V   +Y+GLA G  RGGAP A LAIYK+ W       
Sbjct  266  DFLSPRDGIGHGTHTASTAAGYFVKRANYRGLASGLARGGAPLAHLAIYKVCWTNRGCTD  325

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD LKAFD+AIHDGVD++S S G  VPL + VD  D++  GSFHA   GITVV +AGN+G
Sbjct  326  ADLLKAFDKAIHDGVDILSLSVGNEVPLFSYVDLRDTIAIGSFHATMKGITVVCSAGNDG  385

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK-----------DTG  194
            P +QT+    PW++TVAA   DR FP  ITLGN QTL GQS+  GK           +  
Sbjct  386  PISQTIVNTAPWLITVAATKIDRAFPAAITLGNNQTLWGQSIDIGKHNHGFSGLTYSERI  445

Query  193  VVDLVFLPDKFCETLTTTDTWIAGKVVLCFTGKHGLDI  80
             +D      K C++ +   T  +GK+VLCF+     DI
Sbjct  446  AIDSTDESAKDCQSGSLNATLASGKIVLCFSTSDEQDI  483



>ref|XP_010263869.1| PREDICTED: subtilisin-like protease SBT3.5 [Nelumbo nucifera]
Length=787

 Score =   198 bits (504),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 115/222 (52%), Positives = 140/222 (63%), Gaps = 22/222 (10%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            +G  +++SPRD  GHGTHTSSTA G+LV N S+ GLA G  RGGA  ARLAIYK+ W  G
Sbjct  216  SGSIEFLSPRDAVGHGTHTSSTAAGALVGNASFMGLAQGLARGGASAARLAIYKVCWSTG  275

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD L AFD+AI DGVDV+S S G+  PLS  ++  D+L  GSFHAVA GI VV + 
Sbjct  276  GCSSADLLAAFDDAIFDGVDVLSVSLGSAPPLSPYIE--DTLAIGSFHAVAKGIPVVCSG  333

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFL  173
            GN GP +QTV    PWI+TVAA+T DR FPT ITLGN QT++GQ+L T K    VD  F 
Sbjct  334  GNSGPYSQTVINTAPWIITVAASTIDRAFPTAITLGNNQTIVGQALLTEKH---VDK-FY  389

Query  172  PDKFCETLTTTD----------------TWIAGKVVLCFTGK  95
            P  + E++ + D                T   GKVVLCF  +
Sbjct  390  PIVYGESIASNDSDEDKARSCDVGSLNATLARGKVVLCFQSQ  431



>ref|XP_009132975.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=759

 Score =   198 bits (503),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 134/212 (63%), Gaps = 10/212 (5%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            + +SP D+ GHGTH +S A GS V + S+ GL  GT RG APRAR+A YK+ W   +   
Sbjct  220  EVMSPLDVTGHGTHCASIAAGSFVQDASFLGLGSGTARGSAPRARIASYKVCWSKEVCYS  279

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
             D LKA D AI DGVDVIS S G+ +PL  EVD +D    G+FHAV  GI VV A GN+G
Sbjct  280  PDILKAMDHAIRDGVDVISMSLGSTIPLEFEVDRSD-FAIGAFHAVMKGIPVVCAGGNDG  338

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQ-SLFTGKDTGVVDLVFLPDK  164
            P  QTVS   PWI+TV A T DR+F TPITLGN  T++GQ SL+TGK+ G  D+V+L D 
Sbjct  339  PHTQTVSNVAPWIITVGATTMDREFFTPITLGNNVTVLGQESLYTGKEVGFADIVYLED-  397

Query  163  FCETLTTTDTW---IAGKVVLCFTGKHGLDID  77
                LT  D       GK+V  F  +  LDI+
Sbjct  398  ----LTKDDILAGKAKGKIVFAFQIQSSLDIE  425



>ref|XP_009137202.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=771

 Score =   198 bits (503),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 145/227 (64%), Gaps = 21/227 (9%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
            T + ++ S RD  GHGTHT++ A GSLV NVS+ GLA GT RGGAPRAR+A YK+ W   
Sbjct  226  TTVREFKSNRDALGHGTHTATIAGGSLVPNVSFYGLARGTVRGGAPRARIASYKVCWNTM  285

Query  538  -------GGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVA  380
                   GG    AD LKAFD+AIHDGVDV+S S   ++P   EVD  D +  G+FHAV+
Sbjct  286  QKDGTGPGGSCSTADMLKAFDDAIHDGVDVLSVSISGDLPEDTEVDKPDFV--GAFHAVS  343

Query  379  HGITVVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKD  200
             GI VV AA NEGP AQTV+ A PW+LTVAA T DR FPT ITLGN QTL G+SLFTG +
Sbjct  344  KGIPVVAAASNEGPKAQTVANAAPWLLTVAATTLDRSFPTKITLGNKQTLFGESLFTGPE  403

Query  199  --TGVVDLVFLPDKFCETLTTTDTWIAGKVVLCFTGKHGLDIDVEGI  65
              TG+         + ++ +  +  + GK+VL F       ++ +G+
Sbjct  404  ISTGLA--------YWDSESDDNGDVKGKIVLVFDTTSTYPVETKGV  442



>ref|XP_004504377.1| PREDICTED: subtilisin-like protease SDD1-like isoform X2 [Cicer 
arietinum]
Length=599

 Score =   196 bits (498),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 139/221 (63%), Gaps = 13/221 (6%)
 Frame = -3

Query  703  ADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGI--  530
            ++Y+S RD  GHGTHT+STA G  V N +++GLA G  RGGAP A LAIYK  W+  +  
Sbjct  214  SEYLSARDAIGHGTHTASTAAGYFVENANHRGLASGLARGGAPLAHLAIYKACWDISVGD  273

Query  529  IMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAG  350
               AD LKAFD AIHDGVDV++ S G  +PL + VD  D++  GSFHA A GI VV +AG
Sbjct  274  CTDADILKAFDMAIHDGVDVLTVSLGIGIPLFSYVDQRDTIAIGSFHAAAKGIAVVCSAG  333

Query  349  NEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK-DTGVVDLVFL  173
            N GP +QT++   PWI+TVAA T DR FPT ITLGN  TL G+S+  GK + G V L + 
Sbjct  334  NSGPISQTITNTAPWIITVAATTIDRAFPTTITLGNNLTLFGESIDKGKHNIGFVGLTYS  393

Query  172  PD----------KFCETLTTTDTWIAGKVVLCFTGKHGLDI  80
                        K C+  +  ++  AGK+VLCF+     DI
Sbjct  394  ERIARDPSNDLAKDCQLGSLNESMAAGKIVLCFSVSDQQDI  434



>ref|XP_010449025.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Camelina 
sativa]
Length=775

 Score =   198 bits (503),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 137/214 (64%), Gaps = 21/214 (10%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW---  542
            T I D+ S RD  GHGTHT++ A GS V NVS+ GLA G  RGGAPRAR+A YK  W   
Sbjct  232  TIIQDFKSTRDANGHGTHTATIAGGSFVPNVSFYGLAGGMVRGGAPRARIASYKACWNIM  291

Query  541  --EGGIIMG----ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVA  380
              EGG   G    AD  KAFD+AIHDGVDV+S S G ++P  +EVD  D  +  +FHAVA
Sbjct  292  GDEGGRTEGRCTSADMWKAFDDAIHDGVDVLSVSIGGSIPEDSEVDKLD--YIAAFHAVA  349

Query  379  HGITVVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKD  200
             GITVV AAGNEGP AQTV    PW+LTVAA T DR FPT ITLGN QTLM +SLFTG +
Sbjct  350  KGITVVAAAGNEGPGAQTVDNVAPWLLTVAATTLDRSFPTKITLGNKQTLMAESLFTGPE  409

Query  199  --TGVVDLVFLPDKFCETLTTTDTWIAGKVVLCF  104
              TG+         F +  +  +  + GK VL F
Sbjct  410  ISTGLA--------FLDVHSDDNVDVKGKTVLVF  435



>gb|KHG28029.1| Subtilisin-like protease SDD1 [Gossypium arboreum]
Length=779

 Score =   198 bits (503),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 136/214 (64%), Gaps = 14/214 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +++SPRD  GHGTHTSSTA G+ V N +++GLA G  RGGAP + LAIYK+ W  G    
Sbjct  208  EFLSPRDAVGHGTHTSSTASGAEVKNANFRGLAQGIARGGAPSSWLAIYKVCWATGGCSS  267

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD L AFD+AI DGVD+ISAS G+  PLS  VD  D+L  GSFHAVA GI+VV +AGN G
Sbjct  268  ADILAAFDDAIFDGVDIISASLGSPPPLSTYVD--DALAIGSFHAVARGISVVCSAGNTG  325

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK------------DT  197
            P  QTV    PW++TVAA+T DRDFP  IT GN QT++GQS +TG+            D 
Sbjct  326  PYPQTVINTAPWVMTVAASTIDRDFPAVITQGNNQTVVGQSFYTGRGLNKFHPIVYGADI  385

Query  196  GVVDLVFLPDKFCETLTTTDTWIAGKVVLCFTGK  95
               ++       C+  T   T   GKV+LCF  +
Sbjct  386  AATNIDGTSAGSCDLETLNATLARGKVILCFQSR  419



>ref|NP_567632.1| Subtilase family protein [Arabidopsis thaliana]
 emb|CAB36807.1| serine protease-like protein [Arabidopsis thaliana]
 emb|CAB81270.1| serine protease-like protein [Arabidopsis thaliana]
 gb|AEE84483.1| Subtilase family protein [Arabidopsis thaliana]
Length=772

 Score =   198 bits (503),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 139/222 (63%), Gaps = 14/222 (6%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
            T I D+ S RD  GHGTHT++ A GS V NVS+ GLA GT RGGAPRAR+A YK+ W   
Sbjct  236  TIIQDFKSNRDAIGHGTHTATIAGGSFVPNVSFYGLARGTVRGGAPRARIASYKVCWNVV  295

Query  538  --GGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITV  365
               GI   AD  KAFD+AIHD VDV+S S GA +P ++EVD  D +   +FHAVA GITV
Sbjct  296  GYDGICTVADMWKAFDDAIHDQVDVLSVSIGAGIPENSEVDSVDFI--AAFHAVAKGITV  353

Query  364  VTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVD  185
            V A GN+GP AQ ++ A PW+LTVAA T DR FPT ITLGN QTL  +SLFTG +     
Sbjct  354  VAAGGNDGPGAQNITNAAPWLLTVAATTLDRSFPTKITLGNNQTLFAESLFTGPEIS-TS  412

Query  184  LVFLPDKFCETLTTTDTWIAGKVVLCFTGKHGLDIDVEGIVA  59
            L FL           +  + GK +L F   H   I   G+VA
Sbjct  413  LAFLDSDH-------NVDVKGKTILEFDSTHPSSIAGRGVVA  447



>ref|XP_007042043.1| Subtilase family protein, putative isoform 2 [Theobroma cacao]
 gb|EOX97874.1| Subtilase family protein, putative isoform 2 [Theobroma cacao]
Length=637

 Score =   196 bits (499),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 137/214 (64%), Gaps = 14/214 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +++SPRD  GHG+HTSSTA G+LV N +++GLA G  RGGA  + LAIYK+ W  G    
Sbjct  67   EFMSPRDASGHGSHTSSTASGALVENANFRGLAQGLARGGASSSWLAIYKVCWATGGCSS  126

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD L AFD+AI DGV+V+S S G+  PLS  VD  D+L  GSFHAVA GI+VV +AGN G
Sbjct  127  ADLLAAFDDAIFDGVNVLSVSLGSPPPLSTYVD--DTLAIGSFHAVARGISVVCSAGNSG  184

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK------------DT  197
            P  QTV    PW++TVAA+T DRDFP+ +T+GN QT++GQS +TG+            D 
Sbjct  185  PYPQTVINTAPWVITVAASTIDRDFPSVVTMGNNQTVVGQSFYTGRKVNKFHPIVYGEDI  244

Query  196  GVVDLVFLPDKFCETLTTTDTWIAGKVVLCFTGK  95
               D+       C+  T   T   GK+VLCF  +
Sbjct  245  AATDVDENSAGSCDLETLNATLARGKIVLCFQSR  278



>ref|NP_001159267.1| uncharacterized protein LOC100304357 precursor [Zea mays]
 gb|ACN25629.1| unknown [Zea mays]
Length=768

 Score =   197 bits (502),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 136/218 (62%), Gaps = 14/218 (6%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            T I +++S RD  GHGTHT+STA G+LV+  S++GLA G  RGGAPRARLA+YK+ W  G
Sbjct  201  TDIYEFMSARDAVGHGTHTASTAAGALVAGASFRGLAGGVARGGAPRARLAVYKVCWATG  260

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD L AFD+AIHDGVDV+S S G   PL A VD  D L  GSFHAVA GI VV +A
Sbjct  261  DCTSADILAAFDDAIHDGVDVLSVSLGQAPPLPAYVD--DVLSIGSFHAVARGIVVVCSA  318

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFL  173
            GN GP ++TV  + PW++TVAA T DR F   I LGN  T +GQ+L++GK  G    +F 
Sbjct  319  GNSGPYSETVINSAPWLVTVAAGTIDRTFLAKIILGNNSTYVGQTLYSGKHPGNSMRIFY  378

Query  172  PD------------KFCETLTTTDTWIAGKVVLCFTGK  95
             +            + C   +   T + G VVLCF  +
Sbjct  379  AEDVASNNADDTDARSCTAGSLNSTLVKGTVVLCFQTR  416



>ref|XP_006829160.1| hypothetical protein AMTR_s00001p00269990 [Amborella trichopoda]
 gb|ERM96576.1| hypothetical protein AMTR_s00001p00269990 [Amborella trichopoda]
Length=774

 Score =   197 bits (502),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 138/214 (64%), Gaps = 14/214 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +++S RD  GHG+HTSSTA G+ VSN S+ GLA G  RGGAP +R+A+YK+ W  G    
Sbjct  209  EFLSARDAVGHGSHTSSTAAGAFVSNASFMGLAKGVARGGAPHSRIAVYKVCWASGGCSS  268

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD L AFD+AI DGVDV+S S G+  PL   V+  D+L  GSFHAVA GITVV + GN G
Sbjct  269  ADLLAAFDDAISDGVDVLSVSLGSAPPLDPFVE--DALAVGSFHAVAKGITVVCSGGNSG  326

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTG-VVDLVFLPD-  167
               QTV    PW++TVAA+T DR FPT ITLGN QTL+GQ+L+TG+ +G  + +V+  D 
Sbjct  327  SRPQTVINTAPWLVTVAASTIDRSFPTTITLGNNQTLVGQALYTGRSSGKFLGVVYSEDI  386

Query  166  ----------KFCETLTTTDTWIAGKVVLCFTGK  95
                        CE  +   T   GKVVLCF  +
Sbjct  387  ALSGGETDKASTCEEGSLNATLAKGKVVLCFQSR  420



>ref|XP_003578494.1| PREDICTED: subtilisin-like protease SBT3.5 [Brachypodium distachyon]
Length=770

 Score =   197 bits (502),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 142/230 (62%), Gaps = 16/230 (7%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            T I +Y+S RD  GHGTHT+STA G+LV++ S++GLA G  RGGAPRARLA+YK+ W  G
Sbjct  203  TDINEYMSARDAVGHGTHTASTAAGALVADASFRGLASGVARGGAPRARLAVYKVCWATG  262

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD L AFD+AIHDGVDV+S S G   PL A VD  D L  GS HAV  GI VV +A
Sbjct  263  DCTSADILAAFDDAIHDGVDVLSVSLGQAPPLPAYVD--DVLSIGSLHAVMKGIVVVCSA  320

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTG-VVDLVF  176
            GN GP ++TV  + PW+LTVAA T DR F   ITLGN  + +GQ++++GK     + +V+
Sbjct  321  GNSGPYSETVINSAPWVLTVAAGTIDRTFLAKITLGNNISYVGQTMYSGKHAATTMRIVY  380

Query  175  LPD-----------KFCETLTTTDTWIAGKVVLCFT--GKHGLDIDVEGI  65
              D           + C   +   T + G VVLCF   G+    + VE I
Sbjct  381  AEDVSSDNADDSDARSCTAGSLNATLVKGNVVLCFQTRGQRAAQVAVETI  430



>ref|XP_008668394.1| PREDICTED: putative subtilase family protein isoform X1 [Zea 
mays]
Length=630

 Score =   196 bits (499),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 136/218 (62%), Gaps = 14/218 (6%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            T I +++S RD  GHGTHT+STA G+ V++ S++GLA G  RGGAPRARLA+YK+ W  G
Sbjct  199  TDIYEFMSARDAVGHGTHTASTAAGAPVADASFRGLASGVARGGAPRARLAVYKVCWATG  258

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD L AFD+AIHDGVDV+S S G   PL A VD  D L  GSFHAVA GI VV +A
Sbjct  259  DCTSADILAAFDDAIHDGVDVLSVSLGQAPPLPAYVD--DVLSIGSFHAVARGIAVVCSA  316

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTG-VVDLVF  176
            GN GP ++TV  + PWI+TVAA T DR F   I LGN  T  GQ+L++G   G  + LV+
Sbjct  317  GNSGPYSETVINSAPWIVTVAAGTIDRTFLAKIALGNNSTYAGQTLYSGAHPGRSMSLVY  376

Query  175  LPD-----------KFCETLTTTDTWIAGKVVLCFTGK  95
              D           + C   +   T   GKVVLCF  +
Sbjct  377  AEDIASNDADDTDARSCTAGSLNSTLAKGKVVLCFQTR  414



>ref|XP_004292430.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=801

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 136/214 (64%), Gaps = 14/214 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +++SPRD  GHGTHTSSTA G  + N S++GLA G  RGGAP + LAIYK+ W  G    
Sbjct  229  EFLSPRDASGHGTHTSSTAAGGYIENASFRGLASGLARGGAPSSWLAIYKVCWATGGCSS  288

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD L AFD+AI DGVDV+S S G+  PLS+ ++  D +  GSFHAVA GI+VV +AGN G
Sbjct  289  ADLLAAFDDAIFDGVDVLSVSLGSPPPLSSYIE--DVVSIGSFHAVAQGISVVCSAGNSG  346

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFT------------GKDT  197
            P +QTV  + PWI TVAA+T DR FPT I+LGN QT++GQ L+T            G+D 
Sbjct  347  PYSQTVINSAPWIFTVAASTIDRAFPTAISLGNNQTVVGQGLYTGMHVNKFYPLVYGQDI  406

Query  196  GVVDLVFLPDKFCETLTTTDTWIAGKVVLCFTGK  95
              +D        CE+ T   T   GK VLCF  +
Sbjct  407  ASIDADEDSAGSCESGTLNGTLANGKFVLCFQSR  440



>ref|XP_006829610.1| hypothetical protein AMTR_s00122p00026080 [Amborella trichopoda]
 gb|ERM97026.1| hypothetical protein AMTR_s00122p00026080 [Amborella trichopoda]
Length=732

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 141/221 (64%), Gaps = 29/221 (13%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            + +S RD   HGTHT+STAVGS V++ +++GLA GT RGGAP ARLA+YK  W GG +  
Sbjct  174  EILSARDSVDHGTHTASTAVGSPVTSATFRGLAVGTARGGAPLARLAVYKTAWLGGSVSA  233

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPN-DSLHFGSFHAVAHGITVVTAAGNE  344
            AD LKAFD AIHDGVDV+S S G ++PL + VD   D +  G+FHA+A GITVV + GN 
Sbjct  234  ADMLKAFDYAIHDGVDVLSLSLGVSLPLYSYVDEGPDGIMIGAFHAMARGITVVCSGGNS  293

Query  343  GPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDT----GVVDLVF  176
            GP  QTV  A PWILTVAA+T DR FPT ITLGN  T +GQ++ T K +    G+VD   
Sbjct  294  GPEPQTVEDAAPWILTVAASTIDRTFPTAITLGNNHTFLGQAMNTEKKSEAFVGLVD---  350

Query  175  LPDKFCETLTTTDTW----------------IAGKVVLCFT  101
                  ++L+T D+                   GKVVLCFT
Sbjct  351  -----SKSLSTNDSVEDEARKCLSGYLRRGSATGKVVLCFT  386



>ref|XP_002512984.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF49487.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=774

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 135/211 (64%), Gaps = 14/211 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +++SPRD  GHGTHTSS A G+LV N S+ GLA G  RGGAP A LAIYK+ W  G    
Sbjct  205  EFLSPRDADGHGTHTSSIATGALVRNASFNGLAQGMARGGAPSAWLAIYKVCWATGGCSS  264

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD L AFD+A+ DG +V+S S G+  PL+  ++  D +  GSFHAVA GI VV++AGN G
Sbjct  265  ADILAAFDDAVFDGANVLSVSLGSTPPLATYIE--DPIAIGSFHAVAKGIVVVSSAGNSG  322

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFL----  173
            P  QTV    PW++TVAA+T DR FPT ITLGN QTL GQ+ +TGK+TG    +      
Sbjct  323  PYPQTVQNTAPWVVTVAASTIDRAFPTIITLGNNQTLRGQAFYTGKNTGEFHPIVNGEDI  382

Query  172  ----PDKF----CETLTTTDTWIAGKVVLCF  104
                 D++    CE  T   T   GKV+LCF
Sbjct  383  AANDADEYGARGCEPGTLNATLARGKVILCF  413



>emb|CDY61569.1| BnaCnng38020D [Brassica napus]
Length=1177

 Score =   199 bits (507),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 136/212 (64%), Gaps = 10/212 (5%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            + +SP D+ GHGTH +S A GS V + S+ GL  GT RG APRAR+A YK+ W   +   
Sbjct  638  EVMSPLDVTGHGTHCASIAAGSFVQDASFLGLGSGTARGSAPRARIASYKVCWSKEVCYS  697

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
             D LKA D AI DGVDVIS S G+ +PL  EVD +D    G+FHAV  GI VV A GN+G
Sbjct  698  PDILKAMDHAIRDGVDVISMSLGSTIPLEFEVDRSD-FAIGAFHAVMKGIPVVCAGGNDG  756

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQ-SLFTGKDTGVVDLVFLPDK  164
            P  QTVS   PWI+TVAA T DR+F TPITLGN  T++GQ SL+TGK+ G  D+V+L D 
Sbjct  757  PVTQTVSNVAPWIITVAATTMDREFFTPITLGNNVTVLGQESLYTGKEVGFADIVYLED-  815

Query  163  FCETLTTTDTW---IAGKVVLCFTGKHGLDID  77
                LT  D       GK++  F  ++ LDI+
Sbjct  816  ----LTKNDFLAGKAKGKILFAFQIENSLDIE  843


 Score =   199 bits (507),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 137/212 (65%), Gaps = 10/212 (5%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            + +SP D+ GHGTH +S A GS V + S+ GL  GT RG APRAR+A YK+ W   +   
Sbjct  220  EVMSPLDVTGHGTHCASIAAGSFVQDASFLGLGSGTARGSAPRARIASYKVCWSKEVCYA  279

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
             D LKA D AI DGVDVIS S G+ +PL  EVD +D    G+FHAV  GI VV A GN+G
Sbjct  280  PDILKAMDHAIRDGVDVISMSLGSTIPLDFEVDRSD-FAIGAFHAVMKGIPVVCAGGNDG  338

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQ-SLFTGKDTGVVDLVFLPDK  164
            P +QTVS   PWI+TVAA T DR+F TPITLGN  T++GQ SL+TGK+ G  D+V+L D 
Sbjct  339  PHSQTVSNVAPWIITVAATTMDREFFTPITLGNNVTVLGQESLYTGKEVGFADIVYLED-  397

Query  163  FCETLTTTDTW---IAGKVVLCFTGKHGLDID  77
                LT  D       GK++  F  ++ LDI+
Sbjct  398  ----LTKNDFLAGKAKGKILFAFQIENSLDIE  425



>ref|XP_002518939.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF43472.1| Cucumisin precursor, putative [Ricinus communis]
Length=752

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 114/237 (48%), Positives = 148/237 (62%), Gaps = 22/237 (9%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            T   +++SPRD  GHGTHT+STA G  V N SYKGLA G  RGGAP A LA+YK+ W  G
Sbjct  184  TNSTEFLSPRDGDGHGTHTASTAAGYFVENASYKGLATGLARGGAPLAHLAVYKVCW--G  241

Query  532  IIMG----ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITV  365
            I +G    AD LKAFD+AI DGVD++S S G  +PL +  D  D++  GSFHA A GI V
Sbjct  242  IDVGGCTDADLLKAFDKAIQDGVDILSVSIGNEIPLFSYADQRDAIAIGSFHATASGIPV  301

Query  364  VTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKD-TGVV  188
            + +AGN+GP +QT+    PW++TVAA T DR FPT ITLGN  TL G+S+  G++  G +
Sbjct  302  ICSAGNDGPTSQTIVNTAPWLITVAATTIDRAFPTAITLGNNSTLWGKSIDKGRNHHGFL  361

Query  187  DLVF--------LPD--KFCETLTTTDTWIAGKVVLCFTGKHGLDIDVEGIVAQSRA  47
             L +        L D  K C+  +   T  AGKV+LCF+       D + IV+ S +
Sbjct  362  GLTYSERIAVDSLDDSAKDCQLGSLNTTLAAGKVILCFS-----KTDTQNIVSASNS  413



>ref|XP_007131422.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
 gb|ESW03416.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
Length=563

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 138/220 (63%), Gaps = 13/220 (6%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGI--I  527
            +Y+S RD  GHGTHT+STA G+ V N +Y+GLA G  RGGAP A LAIYK  W   I   
Sbjct  217  EYLSARDAIGHGTHTASTAAGNFVGNANYRGLASGLARGGAPLAHLAIYKACWNFPIGDC  276

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFD+AI+DGVDV++ S G ++PL + VD  D +  GSFHA A GITVV +AGN
Sbjct  277  TDADILKAFDKAIYDGVDVLTVSLGFSIPLFSYVDQRDVIAIGSFHATAKGITVVCSAGN  336

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK-DTGVVDLVFLP  170
             GP +QT++   PWI+TV A T DR FP  ITLGN  T+ GQS+ TGK +   V L +  
Sbjct  337  SGPLSQTITNTAPWIITVGATTIDRAFPAAITLGNNLTVWGQSIDTGKHNLESVGLTYSE  396

Query  169  D----------KFCETLTTTDTWIAGKVVLCFTGKHGLDI  80
                       K C++ +   T  AGK+VLCF+     DI
Sbjct  397  RIALDSSENLAKACQSGSLNATMAAGKIVLCFSVSDQQDI  436



>ref|XP_004957446.1| PREDICTED: subtilisin-like protease SDD1-like [Setaria italica]
Length=768

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 138/218 (63%), Gaps = 14/218 (6%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            T + +++S RD  GHGTHT+STA G+LV+N +++GLA G  RGGAP ARLA+YK+ W  G
Sbjct  201  TDVYEFMSARDAVGHGTHTASTAAGALVANANFRGLASGVARGGAPNARLAVYKVCWATG  260

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD L AFD+AIHD VDV+S S G   PL A VD  D L  GSFHAVA GI VV +A
Sbjct  261  DCTSADILAAFDDAIHDRVDVLSVSLGQAPPLPAYVD--DVLSIGSFHAVAKGIVVVCSA  318

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTG-VVDLVF  176
            GN GP ++TV  + PWI+TVAA T DR F T ITLGN  T +GQ+L++GK     + +V+
Sbjct  319  GNSGPYSETVINSAPWIVTVAAGTLDRTFLTKITLGNNSTYVGQTLYSGKHPAKSMRVVY  378

Query  175  LPD-----------KFCETLTTTDTWIAGKVVLCFTGK  95
              D           + C   +   T + G VVLCF  +
Sbjct  379  AEDIASNNADDTDARSCTAGSLNSTLVKGNVVLCFQTR  416



>ref|NP_001169390.1| putative subtilase family protein precursor [Zea mays]
 gb|ACN33599.1| unknown [Zea mays]
 tpg|DAA40612.1| TPA: putative subtilase family protein [Zea mays]
Length=769

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 136/218 (62%), Gaps = 14/218 (6%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            T I +++S RD  GHGTHT+STA G+ V++ S++GLA G  RGGAPRARLA+YK+ W  G
Sbjct  199  TDIYEFMSARDAVGHGTHTASTAAGAPVADASFRGLASGVARGGAPRARLAVYKVCWATG  258

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD L AFD+AIHDGVDV+S S G   PL A VD  D L  GSFHAVA GI VV +A
Sbjct  259  DCTSADILAAFDDAIHDGVDVLSVSLGQAPPLPAYVD--DVLSIGSFHAVARGIAVVCSA  316

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTG-VVDLVF  176
            GN GP ++TV  + PWI+TVAA T DR F   I LGN  T  GQ+L++G   G  + LV+
Sbjct  317  GNSGPYSETVINSAPWIVTVAAGTIDRTFLAKIALGNNSTYAGQTLYSGAHPGRSMSLVY  376

Query  175  LPD-----------KFCETLTTTDTWIAGKVVLCFTGK  95
              D           + C   +   T   GKVVLCF  +
Sbjct  377  AEDIASNDADDTDARSCTAGSLNSTLAKGKVVLCFQTR  414



>gb|AIC80773.1| subtilase [Cicer arietinum]
Length=720

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 139/221 (63%), Gaps = 13/221 (6%)
 Frame = -3

Query  703  ADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGI--  530
            ++Y+S RD  GHGTHT+STA G  V N +++GLA G  RGGAP A LAIYK  W+  +  
Sbjct  161  SEYLSARDAIGHGTHTASTAAGYFVENANHRGLASGLARGGAPLAHLAIYKACWDISVGD  220

Query  529  IMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAG  350
               AD LKAFD AIHDGVDV++ S G  +PL + VD  D++  GSFHA A GI VV +AG
Sbjct  221  CTDADILKAFDMAIHDGVDVLTVSLGIGIPLFSYVDQRDTIAIGSFHAAAKGIAVVCSAG  280

Query  349  NEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK-DTGVVDLVFL  173
            N GP +QT++   PWI+TVAA T DR FPT ITLGN  TL G+S+  GK + G V L + 
Sbjct  281  NSGPISQTITNTAPWIITVAATTIDRAFPTTITLGNNLTLFGESIDKGKHNIGFVGLTYS  340

Query  172  PD----------KFCETLTTTDTWIAGKVVLCFTGKHGLDI  80
                        K C+  +  ++  AGK+VLCF+     DI
Sbjct  341  ERIARDPSNDLAKDCQLGSLNESMAAGKIVLCFSVSDQQDI  381



>emb|CDX94043.1| BnaC07g36770D [Brassica napus]
Length=773

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 144/227 (63%), Gaps = 21/227 (9%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
            T + ++ S RD  GHGTHT++ A GSLV NVS+ GLA GT RGGAPRAR+A YK+ W   
Sbjct  228  TTVREFKSNRDALGHGTHTATIAGGSLVPNVSFYGLARGTVRGGAPRARIASYKVCWNTM  287

Query  538  -------GGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVA  380
                   GG    AD  KAFD+AIHDGVDV+S S   ++P   EVD  D +  G+FHAV+
Sbjct  288  QKDGTGPGGSCSTADMWKAFDDAIHDGVDVLSVSISGDLPEDTEVDKPDFV--GAFHAVS  345

Query  379  HGITVVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKD  200
             GI VV AA NEGP AQTV+ A PW+LTVAA T DR FPT ITLGN QTL G+SLFTG +
Sbjct  346  KGIPVVAAASNEGPKAQTVANAAPWLLTVAATTLDRSFPTKITLGNKQTLFGESLFTGPE  405

Query  199  --TGVVDLVFLPDKFCETLTTTDTWIAGKVVLCFTGKHGLDIDVEGI  65
              TG+         + ++ +  +  + GK+VL F       ++ +G+
Sbjct  406  ISTGLA--------YWDSESGNNADVKGKIVLVFDTTSTYPVETKGV  444



>ref|XP_010445228.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=875

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 128/186 (69%), Gaps = 13/186 (7%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW---  542
            T I D+ S RD  GHGTHT++ A GS V NVS+ GLA G  RGGAPRAR+A YK  W   
Sbjct  226  TIIQDFKSTRDANGHGTHTATIAGGSFVPNVSFYGLAGGMVRGGAPRARIASYKACWNIM  285

Query  541  --EGGIIMG----ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVA  380
              EGG   G    AD  KAFD+AIHDGVDV+S S G ++P  +EVD  D  +  +FHAVA
Sbjct  286  GDEGGRTEGRCTSADMWKAFDDAIHDGVDVLSVSIGGSIPEDSEVDKLD--YIAAFHAVA  343

Query  379  HGITVVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKD  200
             GITVV AAGNEGP AQTV    PW+LTVAA T DR FPT ITLGN QTLM +SLFTG +
Sbjct  344  KGITVVAAAGNEGPGAQTVDNVAPWLLTVAATTLDRSFPTKITLGNKQTLMAESLFTGPE  403

Query  199  --TGVV  188
              TG+V
Sbjct  404  ISTGMV  409


 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 101/158 (64%), Gaps = 12/158 (8%)
 Frame = -3

Query  607  LAFGTFRGGAPRARLAIYKIGW-----EGGIIMG----ADTLKAFDEAIHDGVDVISASF  455
            ++ G  RGGAPRAR+A YK  W     EGG   G    AD  KAFD+AIHDGVDV+S S 
Sbjct  404  ISTGMVRGGAPRARIASYKACWNIMGDEGGRTEGRCTSADMWKAFDDAIHDGVDVLSVSI  463

Query  454  GANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEGPAAQTVSGADPWILTVAANTPD  275
            G ++P  +EVD  D  +  +FHAVA GITVV AAGNEGP AQTV    PW+LTVAA T D
Sbjct  464  GGSIPEDSEVDKLD--YIAAFHAVAKGITVVAAAGNEGPGAQTVDNVAPWLLTVAATTLD  521

Query  274  RDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDKF  161
            R FPT ITLGN QTLM  S   GKD   V L   PD  
Sbjct  522  RSFPTKITLGNKQTLM-SSPIAGKDVAAVILAQKPDDL  558



>ref|XP_007042042.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
 gb|EOX97873.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
Length=778

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 137/214 (64%), Gaps = 14/214 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +++SPRD  GHG+HTSSTA G+LV N +++GLA G  RGGA  + LAIYK+ W  G    
Sbjct  208  EFMSPRDASGHGSHTSSTASGALVENANFRGLAQGLARGGASSSWLAIYKVCWATGGCSS  267

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD L AFD+AI DGV+V+S S G+  PLS  VD  D+L  GSFHAVA GI+VV +AGN G
Sbjct  268  ADLLAAFDDAIFDGVNVLSVSLGSPPPLSTYVD--DTLAIGSFHAVARGISVVCSAGNSG  325

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK------------DT  197
            P  QTV    PW++TVAA+T DRDFP+ +T+GN QT++GQS +TG+            D 
Sbjct  326  PYPQTVINTAPWVITVAASTIDRDFPSVVTMGNNQTVVGQSFYTGRKVNKFHPIVYGEDI  385

Query  196  GVVDLVFLPDKFCETLTTTDTWIAGKVVLCFTGK  95
               D+       C+  T   T   GK+VLCF  +
Sbjct  386  AATDVDENSAGSCDLETLNATLARGKIVLCFQSR  419



>ref|XP_008452040.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=761

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 130/201 (65%), Gaps = 4/201 (2%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEG-GIIM  524
            +Y+SPRD+ GHGTHT+STA GS V+N++Y   A GT RGGAP ARLAIYK  W   G+  
Sbjct  212  EYLSPRDLHGHGTHTASTAAGSFVANINYHNNAAGTARGGAPLARLAIYKALWTNRGVGS  271

Query  523  GADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNE  344
             AD LKA DEAIHDGVDV+S S G + P   E      + FGSFHA+  GI+VV AAGN 
Sbjct  272  SADILKAIDEAIHDGVDVLSISIGGSPPFYPEFTELSDIAFGSFHAITKGISVVCAAGNS  331

Query  343  GPAAQTVSGADPWILTVAANTPDRDFPTPI-TLGNGQTLMGQSLFTGKDTGVVDLVFLPD  167
            GP+ Q V    PWI TVA NT DR F + I TL +  T MGQSL   K   V +LV    
Sbjct  332  GPSPQMVDNVAPWIFTVATNTIDRAFLSSITTLRDNTTFMGQSLLESKKDLVAELVSW--  389

Query  166  KFCETLTTTDTWIAGKVVLCF  104
            + C+ L+  + +I GKVVLCF
Sbjct  390  ERCDQLSGNEAFINGKVVLCF  410



>ref|XP_004504376.1| PREDICTED: subtilisin-like protease SDD1-like isoform X1 [Cicer 
arietinum]
Length=773

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 139/221 (63%), Gaps = 13/221 (6%)
 Frame = -3

Query  703  ADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGI--  530
            ++Y+S RD  GHGTHT+STA G  V N +++GLA G  RGGAP A LAIYK  W+  +  
Sbjct  214  SEYLSARDAIGHGTHTASTAAGYFVENANHRGLASGLARGGAPLAHLAIYKACWDISVGD  273

Query  529  IMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAG  350
               AD LKAFD AIHDGVDV++ S G  +PL + VD  D++  GSFHA A GI VV +AG
Sbjct  274  CTDADILKAFDMAIHDGVDVLTVSLGIGIPLFSYVDQRDTIAIGSFHAAAKGIAVVCSAG  333

Query  349  NEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK-DTGVVDLVFL  173
            N GP +QT++   PWI+TVAA T DR FPT ITLGN  TL G+S+  GK + G V L + 
Sbjct  334  NSGPISQTITNTAPWIITVAATTIDRAFPTTITLGNNLTLFGESIDKGKHNIGFVGLTYS  393

Query  172  PD----------KFCETLTTTDTWIAGKVVLCFTGKHGLDI  80
                        K C+  +  ++  AGK+VLCF+     DI
Sbjct  394  ERIARDPSNDLAKDCQLGSLNESMAAGKIVLCFSVSDQQDI  434



>ref|XP_008236858.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=771

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 139/214 (65%), Gaps = 14/214 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            ++ SPRD  GHGTHT+STA G+ + N S+ GLA G  RGGAP ARLA+YK+ W  G    
Sbjct  209  EFRSPRDAGGHGTHTASTAAGASIENASFMGLAAGLARGGAPSARLAVYKVCWATGGCSS  268

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD L AFD+AI DGVDV+SAS G+  PL + V+  D +  GSFHAVA GI+V+ +AGN G
Sbjct  269  ADLLAAFDDAIFDGVDVLSASLGSPPPLPSYVE--DVVSIGSFHAVAKGISVICSAGNSG  326

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTG-VVDLVFLPDK  164
               QTV  + PWI TVAA+T DR FPT ITLGN QT++GQ+L+TG +T     LV+  D 
Sbjct  327  SYPQTVINSAPWIFTVAASTIDRAFPTAITLGNNQTVVGQALYTGMNTNKFYPLVYGGDI  386

Query  163  F-----------CETLTTTDTWIAGKVVLCFTGK  95
                        C++ T  DT   GK++LCF  +
Sbjct  387  ASIDADEDSAGNCDSGTLNDTLARGKMILCFQSR  420



>ref|NP_001063751.1| Os09g0530800 [Oryza sativa Japonica Group]
 dbj|BAF25665.1| Os09g0530800 [Oryza sativa Japonica Group]
 gb|EAZ45452.1| hypothetical protein OsJ_30103 [Oryza sativa Japonica Group]
Length=769

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 137/216 (63%), Gaps = 14/216 (6%)
 Frame = -3

Query  706  IADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGII  527
            I +++S RD  GHGTHT+STA G+LV+N S++GLA G  RGGA RARLA+YK+ W  G  
Sbjct  204  IYEFMSARDAVGHGTHTASTAAGALVANASFRGLAKGVARGGAQRARLAVYKVCWATGDC  263

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD L AFD+AIHDGVDVIS S G   PL A VD  D L  GSFHAVA G+ VV +AGN
Sbjct  264  TAADILAAFDDAIHDGVDVISVSLGQAPPLPAYVD--DVLSIGSFHAVAKGVVVVCSAGN  321

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKD-TGVVDLVFLP  170
             GP ++TV  + PWI+TVAA T DR F   I LGN  T +GQ+L++GK  +  V +V+  
Sbjct  322  SGPYSETVINSAPWIVTVAAGTIDRIFLAKIILGNNSTYVGQTLYSGKHPSKSVRIVYAE  381

Query  169  D-----------KFCETLTTTDTWIAGKVVLCFTGK  95
            D           + C   +   T + G VVLCF  +
Sbjct  382  DISSDNADDTDARSCTAGSLNATLVKGNVVLCFQTR  417



>ref|XP_010421967.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=761

 Score =   196 bits (498),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 113/205 (55%), Positives = 138/205 (67%), Gaps = 7/205 (3%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-EGGIIM  524
            +Y+SPRD  GHGTH +ST  GS + NVSY GL  GT RGGAP   +AIYK  W + G   
Sbjct  208  EYLSPRDFNGHGTHVASTIGGSFLPNVSYLGLGQGTARGGAPGVHIAIYKACWLQTGTCT  267

Query  523  GADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNE  344
            GAD LKA DEAIHDGVD++S S  ++VPL  E D  +    G+FHAV+ GI VV AAGN 
Sbjct  268  GADVLKAIDEAIHDGVDILSLSLQSSVPLFPETDMRELTSVGAFHAVSKGIAVVAAAGNA  327

Query  343  GPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDK  164
            GP AQT+S   PWILTVAA T DR FPT ITLGN  T++GQ++F G + G V L + P++
Sbjct  328  GPTAQTISNVAPWILTVAATTQDRSFPTAITLGNNITILGQAIFGGPELGFVGLTY-PER  386

Query  163  F----CETLTTT-DTWIAGKVVLCF  104
                 CE L+   D+ + GKVVLCF
Sbjct  387  PLSGDCENLSANPDSAMEGKVVLCF  411



>gb|KFK28745.1| hypothetical protein AALP_AA7G041500 [Arabis alpina]
Length=764

 Score =   196 bits (498),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 132/207 (64%), Gaps = 10/207 (5%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            T   D+ S RD+ GHGTHT++ A GS V N S+ GLA GT RGGAPRA +A YK+ W   
Sbjct  225  TTFRDFKSNRDVDGHGTHTATIAGGSFVPNASFYGLARGTVRGGAPRACIASYKVCWNNL  284

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHF-GSFHAVAHGITVVTA  356
                AD  KAFD+AIHDGVDV+S S GA VP  +EV   D L F  +FHAVA GI VV A
Sbjct  285  GCSSADMWKAFDDAIHDGVDVLSVSIGAKVPEESEV---DKLSFVAAFHAVAKGIPVVAA  341

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
            AGNEGP AQTV+   PW+LTVAA T DR FPT ITLGN QTL  +SLFTG +    DL F
Sbjct  342  AGNEGPGAQTVANVAPWLLTVAATTLDRSFPTKITLGNKQTLFAESLFTGPEIS-TDLAF  400

Query  175  LPDKFCETLTTTDTWIAGKVVLCFTGK  95
                  +  +  +  + GK VL F  +
Sbjct  401  F-----DPESDDNVDLKGKTVLVFNSE  422



>gb|KFK41045.1| hypothetical protein AALP_AA2G078300 [Arabis alpina]
Length=757

 Score =   196 bits (498),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 133/211 (63%), Gaps = 5/211 (2%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +++SP D  GHGTH +STA GS V + S+ GLA GT RG APRAR+A YK+ W       
Sbjct  219  EFMSPMDKIGHGTHCASTAAGSFVQDASFLGLAMGTARGSAPRARVASYKVCWNNQECFT  278

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
             D +KA D AIHDGVDVIS S G+ VPL  EVD +D     +FHAV  GI VV A GN+G
Sbjct  279  PDIVKAMDHAIHDGVDVISLSLGSEVPLDFEVDRSD-FAIAAFHAVMKGIPVVCAGGNDG  337

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQS-LFTGKDTGVVDLVFLPDK  164
            P  QT+S   PWI+TVAA T DR F TPITLGN  T++GQ  L+TGK+ G  DL+FL D 
Sbjct  338  PHTQTISNVSPWIITVAATTMDRQFFTPITLGNNITVLGQEGLYTGKEVGFTDLLFLNDM  397

Query  163  FCETLTTTDTWIAGKVVLCF-TGKHGLDIDV  74
              E          GK++  F TGK+  D  V
Sbjct  398  TKEDFKAGKA--KGKILFFFQTGKNQNDFVV  426



>ref|XP_007042044.1| Subtilase family protein, putative isoform 3 [Theobroma cacao]
 gb|EOX97875.1| Subtilase family protein, putative isoform 3 [Theobroma cacao]
Length=801

 Score =   196 bits (498),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 137/214 (64%), Gaps = 14/214 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +++SPRD  GHG+HTSSTA G+LV N +++GLA G  RGGA  + LAIYK+ W  G    
Sbjct  208  EFMSPRDASGHGSHTSSTASGALVENANFRGLAQGLARGGASSSWLAIYKVCWATGGCSS  267

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD L AFD+AI DGV+V+S S G+  PLS  VD  D+L  GSFHAVA GI+VV +AGN G
Sbjct  268  ADLLAAFDDAIFDGVNVLSVSLGSPPPLSTYVD--DTLAIGSFHAVARGISVVCSAGNSG  325

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK------------DT  197
            P  QTV    PW++TVAA+T DRDFP+ +T+GN QT++GQS +TG+            D 
Sbjct  326  PYPQTVINTAPWVITVAASTIDRDFPSVVTMGNNQTVVGQSFYTGRKVNKFHPIVYGEDI  385

Query  196  GVVDLVFLPDKFCETLTTTDTWIAGKVVLCFTGK  95
               D+       C+  T   T   GK+VLCF  +
Sbjct  386  AATDVDENSAGSCDLETLNATLARGKIVLCFQSR  419



>ref|XP_010647672.1| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score =   196 bits (498),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/222 (50%), Positives = 141/222 (64%), Gaps = 22/222 (10%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            +G  +++SPRD  GHGTHT+S A GSLV N +++GLA G  RGGAP A+LA+YK+ W  G
Sbjct  207  SGGVEFLSPRDAVGHGTHTASIAAGSLVKNANFRGLARGLARGGAPSAQLAVYKVCWSTG  266

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD L AFD+A+ DGVDV+S S G++ PL+A  D  DSL  GSFHAVA GI+VV +A
Sbjct  267  GCSSADVLAAFDDAVLDGVDVLSVSLGSSPPLTAYFD--DSLAIGSFHAVAKGISVVCSA  324

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFL  173
            GN GP  QTV    PWI++VAA+T DR F T ITLGN QTL+GQ+L+TGK+       F 
Sbjct  325  GNSGPYPQTVINTAPWIISVAASTIDRAFRTVITLGNNQTLVGQALYTGKNVN----KFY  380

Query  172  PDKFCETLTTTD----------------TWIAGKVVLCFTGK  95
               + E++ + D                T   G VVLCF  +
Sbjct  381  SFVYGESIVSQDSDEESARGCDIGSLNATLARGNVVLCFQTR  422



>ref|XP_010271498.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Nelumbo 
nucifera]
Length=777

 Score =   196 bits (497),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 110/222 (50%), Positives = 137/222 (62%), Gaps = 22/222 (10%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            +G  +++SPRD  GHGTHTSSTA G+LV N S+ GLA G  RGGAP ARL+IYK+ W  G
Sbjct  205  SGDVEFLSPRDAVGHGTHTSSTAAGALVGNASFMGLAQGLARGGAPAARLSIYKVCWSTG  264

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD L AFD+AI DGVDV+S S G+  PLS  ++  D+L  GSFH VA GI VV + 
Sbjct  265  GCSSADLLAAFDDAISDGVDVLSVSLGSPPPLSPYIE--DALAIGSFHVVAKGIPVVCSG  322

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFL  173
            GN GP++QTV    PWI+TVAA+T DR FPT I LGN  +L+GQ+L T K        F 
Sbjct  323  GNSGPSSQTVINTAPWIITVAASTIDRSFPTTIILGNNLSLVGQALLTEKHVN----KFY  378

Query  172  PDKFCETLTTTD----------------TWIAGKVVLCFTGK  95
            P  + E++ + D                T   GKVVLCF  +
Sbjct  379  PIVYGESIASNDSDEDKARSCDAGSLNATLARGKVVLCFQSR  420



>ref|XP_009351289.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Pyrus 
x bretschneideri]
Length=769

 Score =   196 bits (497),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 139/214 (65%), Gaps = 17/214 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +Y+SPRD  GHGTHTSSTA G  + N SYKGLA G  RGGAP ARLA+YK+ W  G    
Sbjct  209  EYLSPRDAGGHGTHTSSTAAGDSIQNASYKGLAAGLARGGAPLARLAVYKVCWAVG-CSS  267

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD L AFD+AI+DGVDV+S S G+  PLS+ V+  D++  GSFHAVA GI+VV +AGN G
Sbjct  268  ADLLAAFDDAIYDGVDVLSVSLGSPPPLSSYVE--DAMAIGSFHAVAKGISVVCSAGNSG  325

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTG-VVDLVFLPD-  167
            P  QTV  + PWI TVAA+T DR FP  ITLGN QT++  +L+TG D      LV+  D 
Sbjct  326  PYPQTVINSAPWIFTVAASTIDRAFPAVITLGNNQTVV--ALYTGMDRNKYYPLVYGGDI  383

Query  166  ----------KFCETLTTTDTWIAGKVVLCFTGK  95
                        C+  T  +T  +GKV+LCF  +
Sbjct  384  ASIDSDKDTAGSCDPGTLNETLASGKVILCFQSR  417



>emb|CBI38006.3| unnamed protein product [Vitis vinifera]
Length=805

 Score =   196 bits (497),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 110/222 (50%), Positives = 141/222 (64%), Gaps = 22/222 (10%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            +G  +++SPRD  GHGTHT+S A GSLV N +++GLA G  RGGAP A+LA+YK+ W  G
Sbjct  236  SGGVEFLSPRDAVGHGTHTASIAAGSLVKNANFRGLARGLARGGAPSAQLAVYKVCWSTG  295

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD L AFD+A+ DGVDV+S S G++ PL+A  D  DSL  GSFHAVA GI+VV +A
Sbjct  296  GCSSADVLAAFDDAVLDGVDVLSVSLGSSPPLTAYFD--DSLAIGSFHAVAKGISVVCSA  353

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFL  173
            GN GP  QTV    PWI++VAA+T DR F T ITLGN QTL+GQ+L+TGK+       F 
Sbjct  354  GNSGPYPQTVINTAPWIISVAASTIDRAFRTVITLGNNQTLVGQALYTGKNVN----KFY  409

Query  172  PDKFCETLTTTD----------------TWIAGKVVLCFTGK  95
               + E++ + D                T   G VVLCF  +
Sbjct  410  SFVYGESIVSQDSDEESARGCDIGSLNATLARGNVVLCFQTR  451



>ref|XP_010271499.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Nelumbo 
nucifera]
Length=774

 Score =   196 bits (497),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 110/222 (50%), Positives = 137/222 (62%), Gaps = 22/222 (10%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            +G  +++SPRD  GHGTHTSSTA G+LV N S+ GLA G  RGGAP ARL+IYK+ W  G
Sbjct  202  SGDVEFLSPRDAVGHGTHTSSTAAGALVGNASFMGLAQGLARGGAPAARLSIYKVCWSTG  261

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD L AFD+AI DGVDV+S S G+  PLS  ++  D+L  GSFH VA GI VV + 
Sbjct  262  GCSSADLLAAFDDAISDGVDVLSVSLGSPPPLSPYIE--DALAIGSFHVVAKGIPVVCSG  319

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFL  173
            GN GP++QTV    PWI+TVAA+T DR FPT I LGN  +L+GQ+L T K        F 
Sbjct  320  GNSGPSSQTVINTAPWIITVAASTIDRSFPTTIILGNNLSLVGQALLTEKHVN----KFY  375

Query  172  PDKFCETLTTTD----------------TWIAGKVVLCFTGK  95
            P  + E++ + D                T   GKVVLCF  +
Sbjct  376  PIVYGESIASNDSDEDKARSCDAGSLNATLARGKVVLCFQSR  417



>ref|XP_002305456.2| hypothetical protein POPTR_0004s16850g [Populus trichocarpa]
 gb|EEE85967.2| hypothetical protein POPTR_0004s16850g [Populus trichocarpa]
Length=775

 Score =   196 bits (497),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 138/214 (64%), Gaps = 14/214 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +++SPRD  GHGTHTSSTA G LV N S+ GLA G  RGGAP A LA+YK+ W  G    
Sbjct  209  EFLSPRDAGGHGTHTSSTATGGLVENASFMGLAQGLARGGAPSAWLAVYKVCWATGGCAE  268

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD L AFD+AI DGVDV+S S G+  PL+  V+  D++  GSF+AVA GI+VV +AGN G
Sbjct  269  ADLLAAFDDAIFDGVDVLSVSLGSAPPLATYVE--DAVAIGSFYAVAKGISVVCSAGNSG  326

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDKF  161
            P  QT++   PW++TVAA+T DR FPT ITLGN QT++GQ+L+TGK+      +   ++ 
Sbjct  327  PYPQTITNTAPWVVTVAASTIDRAFPTIITLGNNQTIVGQALYTGKNVDTFHPIVYGEEI  386

Query  160  ------------CETLTTTDTWIAGKVVLCFTGK  95
                        C + +   T   GKV+LCF  +
Sbjct  387  VADDSDEDSARGCASGSLNATLARGKVILCFESR  420



>ref|XP_011037192.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=775

 Score =   195 bits (496),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 138/214 (64%), Gaps = 14/214 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +++SPRD  GHGTHTSSTA G LV N S+ GLA G  RGGAP A LA+YK+ W  G    
Sbjct  209  EFLSPRDAGGHGTHTSSTATGGLVENASFMGLAQGLARGGAPSAWLAVYKVCWATGGCAE  268

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD L AFD+AI DGVDV+S S G+  PL+  V+  D++  GSF+AVA GI+VV +AGN G
Sbjct  269  ADLLAAFDDAIFDGVDVLSVSLGSAPPLATYVE--DAVAIGSFYAVAKGISVVCSAGNSG  326

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDKF  161
            P  QT++   PW++TVAA+T DR FPT ITLGN QT++GQ+L+TGK+      +   ++ 
Sbjct  327  PYPQTITNTAPWVVTVAASTIDRAFPTIITLGNNQTIVGQALYTGKNVDTFHPIVYGEEI  386

Query  160  ------------CETLTTTDTWIAGKVVLCFTGK  95
                        C + +   T   GKV+LCF  +
Sbjct  387  VADDSDEDSARGCASGSLNATLARGKVILCFESR  420



>ref|XP_010455450.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=763

 Score =   195 bits (495),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 113/205 (55%), Positives = 137/205 (67%), Gaps = 7/205 (3%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW-EGGIIM  524
            +Y+SPRD  GHGTH +ST  GS + NVSY GL  GT RGGAP   +AIYK  W + G   
Sbjct  210  EYLSPRDFNGHGTHVASTIGGSFLPNVSYLGLGQGTARGGAPGVHIAIYKACWLQTGTCT  269

Query  523  GADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNE  344
            GAD LKA DEAIHDGVD++S S  ++VPL  E D  +    G+FHAV+ GI VV AAGN 
Sbjct  270  GADVLKAIDEAIHDGVDILSLSLQSSVPLFPETDMRELTSVGAFHAVSKGIAVVAAAGNA  329

Query  343  GPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDK  164
            GP AQT+S   PWILTVAA T DR FPT ITLGN  T++GQ++F   + G V L + PD+
Sbjct  330  GPTAQTISNVAPWILTVAATTQDRSFPTAITLGNNITILGQAIFGDPELGFVGLTY-PDR  388

Query  163  F----CETLTTT-DTWIAGKVVLCF  104
                 CE L+   D+ + GKVVLCF
Sbjct  389  PLSGDCENLSANPDSAMEGKVVLCF  413



>gb|EAZ09847.1| hypothetical protein OsI_32138 [Oryza sativa Indica Group]
Length=769

 Score =   195 bits (495),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 137/216 (63%), Gaps = 14/216 (6%)
 Frame = -3

Query  706  IADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGII  527
            I +++S RD  GHGTHT+STA G+LV+N S++GLA G  RGGA RARLA+YK+ W  G  
Sbjct  204  IYEFMSARDAVGHGTHTASTAAGALVANASFRGLAKGVARGGAQRARLAVYKVCWATGDC  263

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD L AFD+AIHDGV+VIS S G   PL A VD  D L  GSFHAVA G+ VV +AGN
Sbjct  264  TAADILAAFDDAIHDGVNVISVSLGQAPPLPAYVD--DVLSIGSFHAVAKGVVVVCSAGN  321

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKD-TGVVDLVFLP  170
             GP ++TV  + PWI+TVAA T DR F   I LGN  T +GQ+L++GK  +  V +V+  
Sbjct  322  SGPYSETVINSAPWIVTVAAGTIDRIFLAKIILGNNSTYVGQTLYSGKHPSKSVRIVYAE  381

Query  169  D-----------KFCETLTTTDTWIAGKVVLCFTGK  95
            D           + C   +   T + G VVLCF  +
Sbjct  382  DISSDNADDTDARSCTAGSLNATLVKGNVVLCFQTR  417



>ref|XP_003629621.1| Subtilisin-like protease [Medicago truncatula]
Length=797

 Score =   195 bits (495),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 140/230 (61%), Gaps = 23/230 (10%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEG--GII  527
            +Y+S RD  GHGTHT+STA G  V N +Y+GLA G  RGGAP A LAIYK  W+   G  
Sbjct  222  EYLSARDAIGHGTHTASTAAGYFVENANYRGLASGLARGGAPLAHLAIYKACWDVPVGHC  281

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFD AIHDGVDV++ S G  +PL +  D  D++  GSFHA + GITVV++AGN
Sbjct  282  TDADILKAFDMAIHDGVDVLTVSLGIGIPLFSYADQRDTIAIGSFHATSKGITVVSSAGN  341

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTL----------MGQSLFTGKDT  197
             GP +QTVS   PW++TVAA T DR FPT ITLGN  TL          +GQS+  GK  
Sbjct  342  SGPISQTVSNTAPWLITVAATTIDRTFPTAITLGNNLTLWVGYNHFCIELGQSIDNGKHA  401

Query  196  -GVVDLVFLPD----------KFCETLTTTDTWIAGKVVLCFTGKHGLDI  80
             G V L +             K C++ +  +T  AGK+VLCF+     DI
Sbjct  402  LGFVGLTYSERIARDPSDDLAKDCQSGSLNETMAAGKIVLCFSVSDQQDI  451



>ref|XP_007131421.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
 gb|ESW03415.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
Length=775

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 138/220 (63%), Gaps = 13/220 (6%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGI--I  527
            +Y+S RD  GHGTHT+STA G+ V N +Y+GLA G  RGGAP A LAIYK  W   I   
Sbjct  217  EYLSARDAIGHGTHTASTAAGNFVGNANYRGLASGLARGGAPLAHLAIYKACWNFPIGDC  276

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFD+AI+DGVDV++ S G ++PL + VD  D +  GSFHA A GITVV +AGN
Sbjct  277  TDADILKAFDKAIYDGVDVLTVSLGFSIPLFSYVDQRDVIAIGSFHATAKGITVVCSAGN  336

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGK-DTGVVDLVFLP  170
             GP +QT++   PWI+TV A T DR FP  ITLGN  T+ GQS+ TGK +   V L +  
Sbjct  337  SGPLSQTITNTAPWIITVGATTIDRAFPAAITLGNNLTVWGQSIDTGKHNLESVGLTYSE  396

Query  169  D----------KFCETLTTTDTWIAGKVVLCFTGKHGLDI  80
                       K C++ +   T  AGK+VLCF+     DI
Sbjct  397  RIALDSSENLAKACQSGSLNATMAAGKIVLCFSVSDQQDI  436



>ref|XP_007209077.1| hypothetical protein PRUPE_ppa001674mg [Prunus persica]
 gb|EMJ10276.1| hypothetical protein PRUPE_ppa001674mg [Prunus persica]
Length=781

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 135/221 (61%), Gaps = 11/221 (5%)
 Frame = -3

Query  706  IADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGII  527
            + D+ SPRD  GHGTHT+STA G  V   +Y+GLA G  RGGAP A LAIYK  W     
Sbjct  221  VVDFRSPRDGIGHGTHTASTAAGYFVKRANYRGLASGLARGGAPLAHLAIYKACWAFEGC  280

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFD+AIHDGVD++S S G   PL + VD  DS+  GSFHA   GITVV +AGN
Sbjct  281  TDADLLKAFDKAIHDGVDILSLSVGNVTPLFSYVDQRDSIAIGSFHATTKGITVVCSAGN  340

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDT-GVVDLVFLP  170
            +GP +QT+    PW++TVAA T DR FPT ITLGN  TL GQS+   K   G V +++  
Sbjct  341  DGPISQTIVNTAPWLITVAATTIDRVFPTAITLGNNHTLWGQSIDIEKHKHGFVGIIYSE  400

Query  169  D----------KFCETLTTTDTWIAGKVVLCFTGKHGLDID  77
                       K C+  +   T  +GK+VLCF+     DI+
Sbjct  401  RIALDRTNDSAKDCQPGSLNATLASGKIVLCFSKSDQQDIE  441



>ref|XP_002867836.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44095.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=758

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 127/189 (67%), Gaps = 12/189 (6%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW---  542
            T I D+ S RD  GHGTHT++ A GS V NVS  GLA G  RGGAPRAR+A YK  W   
Sbjct  225  TIIQDFKSTRDANGHGTHTATIAGGSFVPNVSIYGLARGLVRGGAPRARIASYKACWNVM  284

Query  541  --EGGIIMG----ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVA  380
              EGG   G    AD  KAFD+AIHDGVDV+S S G  +P  +EVD  D  +  +FHAVA
Sbjct  285  GDEGGGTDGRCTTADMWKAFDDAIHDGVDVLSVSIGGAIPEDSEVDKLD--YIAAFHAVA  342

Query  379  HGITVVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKD  200
             GITVVTAAGNEGP AQTV+   PW+LTVAA T DR FPT ITLGN QTL  +SLFTG +
Sbjct  343  KGITVVTAAGNEGPGAQTVNNVAPWLLTVAATTLDRSFPTKITLGNKQTLFAESLFTGPE  402

Query  199  TGVVDLVFL  173
                 LVFL
Sbjct  403  IS-TGLVFL  410



>ref|XP_008804320.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=800

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 136/202 (67%), Gaps = 17/202 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +Y+SPRD  GHGTHT+STA GS V NVSY  L FG  RGGAPRARLA+YK  W  G   G
Sbjct  269  EYVSPRDYNGHGTHTASTAAGSPVENVSYHELGFGVARGGAPRARLAVYKAVWGKGSGAG  328

Query  520  --ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              A  L A D+AIHDGVD++S        LS +V+ +DS  FGS HAVA+GITVV AAGN
Sbjct  329  SYATVLAAMDDAIHDGVDILS--------LSLKVE-DDS--FGSLHAVANGITVVYAAGN  377

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLF--TGKDTGVVDLVFL  173
             GP  QT+    PW++TVAA+T DR FPT ITLGN QTL+GQS+F  T KD G  +L + 
Sbjct  378  LGPIPQTLLNEAPWVITVAASTIDRSFPTDITLGNNQTLVGQSMFYTTKKDNGFRELEYG  437

Query  172  PDKFCETLTTTDTWIAGKVVLC  107
                 ETL  T+  I GKVVLC
Sbjct  438  YSCTKETLNGTN--IVGKVVLC  457



>ref|XP_007039328.1| Subtilase family protein, putative isoform 2 [Theobroma cacao]
 gb|EOY23829.1| Subtilase family protein, putative isoform 2 [Theobroma cacao]
Length=776

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 137/226 (61%), Gaps = 15/226 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW--EGGII  527
            +++S RD  GHGTHT+STA G+ V N +Y+GLA G  RGGAPRA LA+YK  W  E G  
Sbjct  214  EFLSARDNSGHGTHTASTAAGNFVQNANYEGLAAGLARGGAPRAHLAVYKACWSFESGGC  273

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFD+AI DGVD++S S G ++PL + VD  +S+  GSFHA A GITV  +AGN
Sbjct  274  TDADILKAFDKAIQDGVDILSVSVGNSIPLYSYVDQRNSIAIGSFHATAKGITVACSAGN  333

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTG-KDTGVVDLVFLP  170
            +GP A T+    PWI+ VAA T DR F T ITLGN  TL GQS+ TG  + G   + F  
Sbjct  334  DGPTAMTIENTAPWIINVAATTVDRAFATAITLGNNLTLWGQSVDTGIHNHGFTGITF-S  392

Query  169  DKF-----------CETLTTTDTWIAGKVVLCFTGKHGLDIDVEGI  65
            D+            C+  +   T  AGK++LCF      DI    I
Sbjct  393  DRIAANSSDDSAQDCQPGSLNATLAAGKIILCFAQSSIQDISSAAI  438



>ref|XP_010919043.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Elaeis 
guineensis]
Length=741

 Score =   192 bits (489),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 135/215 (63%), Gaps = 15/215 (7%)
 Frame = -3

Query  703  ADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW--EGGI  530
            ++Y+SPRD  GHGTHT+S   G L+   SYKGLA GT RGGAP ARLA+YK  W  +   
Sbjct  231  SEYLSPRDATGHGTHTASIVAGRLIKKASYKGLAAGTARGGAPLARLAVYKACWATKAEE  290

Query  529  IMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAG  350
               AD LKAFDEAI DGVDVIS S G  +PLS   + +DS+  GSFHA A GI+VV +AG
Sbjct  291  CADADVLKAFDEAIRDGVDVISVSLGEQLPLSPYFE-HDSVSIGSFHAAARGISVVCSAG  349

Query  349  NEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSL----FTGKDTGVVDL  182
            N+GP +QTV+   PW+ TVAA + DR FPT I LGN  T +GQ+L    + G   G+   
Sbjct  350  NDGPFSQTVTNTAPWVTTVAAASIDRAFPTAIILGNNHTFLGQTLNTRGYKGGFHGLEYS  409

Query  181  VFLPD--------KFCETLTTTDTWIAGKVVLCFT  101
             F+ +        + C+  T   T   GKV+LCF+
Sbjct  410  EFIAEENVDADDSRGCDMDTLNATLAKGKVILCFS  444



>ref|XP_010919042.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Elaeis 
guineensis]
Length=792

 Score =   192 bits (489),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 135/215 (63%), Gaps = 15/215 (7%)
 Frame = -3

Query  703  ADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW--EGGI  530
            ++Y+SPRD  GHGTHT+S   G L+   SYKGLA GT RGGAP ARLA+YK  W  +   
Sbjct  231  SEYLSPRDATGHGTHTASIVAGRLIKKASYKGLAAGTARGGAPLARLAVYKACWATKAEE  290

Query  529  IMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAG  350
               AD LKAFDEAI DGVDVIS S G  +PLS   + +DS+  GSFHA A GI+VV +AG
Sbjct  291  CADADVLKAFDEAIRDGVDVISVSLGEQLPLSPYFE-HDSVSIGSFHAAARGISVVCSAG  349

Query  349  NEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSL----FTGKDTGVVDL  182
            N+GP +QTV+   PW+ TVAA + DR FPT I LGN  T +GQ+L    + G   G+   
Sbjct  350  NDGPFSQTVTNTAPWVTTVAAASIDRAFPTAIILGNNHTFLGQTLNTRGYKGGFHGLEYS  409

Query  181  VFLPD--------KFCETLTTTDTWIAGKVVLCFT  101
             F+ +        + C+  T   T   GKV+LCF+
Sbjct  410  EFIAEENVDADDSRGCDMDTLNATLAKGKVILCFS  444



>emb|CDX98690.1| BnaA03g44750D [Brassica napus]
Length=696

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 112/227 (49%), Positives = 144/227 (63%), Gaps = 21/227 (9%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--  539
            T + ++ S RD  GHGTHT++ A GSLV NVS+ GLA GT RGGAP+AR+A YK+ W   
Sbjct  163  TTVREFKSNRDALGHGTHTATIAGGSLVPNVSFYGLARGTVRGGAPQARIASYKVCWNTM  222

Query  538  -------GGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVA  380
                   GG    AD LKAFD+AIHDGVDV+S S   ++P   EVD  D +  G+FHAV+
Sbjct  223  QKDGTGPGGSCSTADMLKAFDDAIHDGVDVLSVSISGDLPEDTEVDKPDFV--GAFHAVS  280

Query  379  HGITVVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKD  200
             GI VV AA NEG  AQTV+ A PW+LTVAA T DR FPT ITLGN QTL G+SLFTG +
Sbjct  281  KGIPVVAAASNEGRKAQTVANAAPWLLTVAATTLDRSFPTKITLGNKQTLFGESLFTGPE  340

Query  199  --TGVVDLVFLPDKFCETLTTTDTWIAGKVVLCFTGKHGLDIDVEGI  65
              TG+         + ++ +  +  + GK+VL F       ++ +G+
Sbjct  341  ISTGLA--------YWDSESDDNGDVKGKIVLVFDTTSTYPVETKGV  379



>ref|XP_010529409.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Tarenaya 
hassleriana]
Length=761

 Score =   192 bits (488),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 123/182 (68%), Gaps = 16/182 (9%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            T + D++SPRD  GHGTH S+ A GS V  VSY GLA GT RGGAPRAR+A+YK  W   
Sbjct  211  TEVPDFLSPRDTNGHGTHVSAIAGGSFVPKVSYFGLARGTLRGGAPRARIAMYKACWN--  268

Query  532  IIMG-----------ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHA  386
             +MG           AD  KAFD+AIHDGVDV+S S G +VPL  EVD  D++   +FHA
Sbjct  269  -VMGDSGDAVGKCTTADIWKAFDDAIHDGVDVLSVSLGGSVPLDGEVDQLDNV--AAFHA  325

Query  385  VAHGITVVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTG  206
            V  GI VV AAGN+GP AQTV    PW+LTVAA T DR FPT I LGN QT+ G++L TG
Sbjct  326  VKKGIPVVCAAGNDGPNAQTVVNVAPWVLTVAATTLDRSFPTAIALGNNQTIFGEALHTG  385

Query  205  KD  200
            ++
Sbjct  386  RE  387



>ref|XP_010529408.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Tarenaya 
hassleriana]
Length=765

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 123/182 (68%), Gaps = 16/182 (9%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            T + D++SPRD  GHGTH S+ A GS V  VSY GLA GT RGGAPRAR+A+YK  W   
Sbjct  215  TEVPDFLSPRDTNGHGTHVSAIAGGSFVPKVSYFGLARGTLRGGAPRARIAMYKACWN--  272

Query  532  IIMG-----------ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHA  386
             +MG           AD  KAFD+AIHDGVDV+S S G +VPL  EVD  D++   +FHA
Sbjct  273  -VMGDSGDAVGKCTTADIWKAFDDAIHDGVDVLSVSLGGSVPLDGEVDQLDNV--AAFHA  329

Query  385  VAHGITVVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTG  206
            V  GI VV AAGN+GP AQTV    PW+LTVAA T DR FPT I LGN QT+ G++L TG
Sbjct  330  VKKGIPVVCAAGNDGPNAQTVVNVAPWVLTVAATTLDRSFPTAIALGNNQTIFGEALHTG  389

Query  205  KD  200
            ++
Sbjct  390  RE  391



>ref|NP_564869.1| Subtilase-like protein [Arabidopsis thaliana]
 gb|AAG51764.1|AC066691_4 subtilisin-like protein; 10849-13974 [Arabidopsis thaliana]
 gb|AEE34478.1| Subtilase-like protein [Arabidopsis thaliana]
Length=753

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 133/211 (63%), Gaps = 9/211 (4%)
 Frame = -3

Query  709  GIADY------ISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKI  548
            GI DY      +SPRD  GHGTH ++ A GS V+N +YKGLA GT RG AP AR+A+YK+
Sbjct  208  GIYDYPSLGESMSPRDHVGHGTHVAAIAAGSFVANANYKGLAGGTARGAAPHARIAMYKV  267

Query  547  GWEGGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGIT  368
             W     + AD LKA D +I DGVDVIS S G + P S ++D +D + FGSFHAV  GI 
Sbjct  268  CWREVGCITADLLKAIDHSIRDGVDVISISIGTDAPASFDIDQSD-IGFGSFHAVMKGIP  326

Query  367  VVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVV  188
            VV +AGNEGP AQTV    PWI+TVAA + DR FP PITLGN  T++G+ L T  + G  
Sbjct  327  VVASAGNEGPNAQTVDNVAPWIITVAATSLDRSFPIPITLGNNLTILGEGLNTFPEVGFT  386

Query  187  DLVFLPDKFCETLTTTDTWIAGKVVLCFTGK  95
            +L+   +    ++    T   G +VL FT  
Sbjct  387  NLILSDEMLSRSIEQGKT--QGTIVLAFTAN  415



>ref|XP_009344068.1| PREDICTED: subtilisin-like protease SBT5.3, partial [Pyrus x 
bretschneideri]
Length=758

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 140/211 (66%), Gaps = 13/211 (6%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE--GGII  527
            D++SPRD  GHGT  SS A GS V N+SYKGL  GT RGGAP ARLA+YK+ W    G  
Sbjct  207  DFLSPRDANGHGTAISSIAAGSFVYNISYKGLGGGTVRGGAPNARLAMYKVCWNLFNGYC  266

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKA D AIH+GV V+S S G +VP+S  VD  D++  GS+HA+   I VV +AGN
Sbjct  267  SSADILKAVDVAIHEGVHVLSLSLGDSVPISTIVD--DAIAIGSYHAITRDIIVVCSAGN  324

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF---  176
            +GP AQTV+   PW++TVAA+T DR FPT ITLGN  TL GQSLFTG  TG   L++   
Sbjct  325  DGPFAQTVTNTAPWVITVAASTMDRAFPTSITLGNNITLQGQSLFTGPHTGFTRLIYPKS  384

Query  175  -----LPDKFCETLTTTD-TWIAGKVVLCFT  101
                      C++L++ + T ++G VVLCFT
Sbjct  385  TKIDSTSTSICDSLSSLNKTMVSGNVVLCFT  415



>ref|XP_007039327.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY23828.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
Length=869

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 137/226 (61%), Gaps = 15/226 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW--EGGII  527
            +++S RD  GHGTHT+STA G+ V N +Y+GLA G  RGGAPRA LA+YK  W  E G  
Sbjct  307  EFLSARDNSGHGTHTASTAAGNFVQNANYEGLAAGLARGGAPRAHLAVYKACWSFESGGC  366

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFD+AI DGVD++S S G ++PL + VD  +S+  GSFHA A GITV  +AGN
Sbjct  367  TDADILKAFDKAIQDGVDILSVSVGNSIPLYSYVDQRNSIAIGSFHATAKGITVACSAGN  426

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTG-KDTGVVDLVFLP  170
            +GP A T+    PWI+ VAA T DR F T ITLGN  TL GQS+ TG  + G   + F  
Sbjct  427  DGPTAMTIENTAPWIINVAATTVDRAFATAITLGNNLTLWGQSVDTGIHNHGFTGITF-S  485

Query  169  DKF-----------CETLTTTDTWIAGKVVLCFTGKHGLDIDVEGI  65
            D+            C+  +   T  AGK++LCF      DI    I
Sbjct  486  DRIAANSSDDSAQDCQPGSLNATLAAGKIILCFAQSSIQDISSAAI  531



>gb|KFK45041.1| hypothetical protein AALP_AA1G336500, partial [Arabis alpina]
Length=678

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 135/215 (63%), Gaps = 16/215 (7%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG----  533
            +Y+SPRD  GHGTH ++TA GS V + SY  L  G  RGGAPRAR+A+YK  W       
Sbjct  190  EYVSPRDFNGHGTHVAATAAGSWVPDASYLALGRGIARGGAPRARVAMYKACWHVASAGI  249

Query  532  -IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTA  356
             I   AD LKA DEAIHDGVDV+S S    +PL  EVD  D++  G+FHAVA GI V+ +
Sbjct  250  AICSEADLLKAIDEAIHDGVDVLSISVSFQIPLRPEVDARDAIAVGAFHAVAKGIPVLCS  309

Query  355  AGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVF  176
             GN+GPA+QTV+   PWI+TVAA T DR FPT ITLGN  T++ Q+++ G +     LV+
Sbjct  310  GGNDGPASQTVTNTAPWIITVAATTQDRSFPTVITLGNNVTIVAQAMYQGPEMD-FGLVY  368

Query  175  L--PDKFCETLT--TTDTW------IAGKVVLCFT  101
               P+   ET +    D +      I  K+VLCFT
Sbjct  369  PEGPEASNETFSGACEDLYKNPARIIKEKIVLCFT  403



>gb|AAL24366.1| subtilisin proteinase-like [Arabidopsis thaliana]
 gb|AAM91203.1| subtilisin proteinase-like [Arabidopsis thaliana]
Length=703

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 121/180 (67%), Gaps = 11/180 (6%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW---  542
            T I D+ S RD  GHGTHT++ A GS V NVSY GLA G  RGGAPRAR+A YK  W   
Sbjct  162  TIIQDFQSTRDANGHGTHTATIAGGSFVPNVSYFGLAQGLVRGGAPRARIASYKACWNVM  221

Query  541  --EGGIIMG----ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVA  380
              EGG   G    AD  KAFD+AIHDGVDV+S S G  +P  +EVD  D  +  +FHAVA
Sbjct  222  RDEGGGTDGRCTSADMWKAFDDAIHDGVDVLSVSIGGGIPEDSEVDKLD--YIAAFHAVA  279

Query  379  HGITVVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKD  200
             GITVV AAGNEGP A TV    PW+LTVAA T DR FPT ITLGN QTL  +SLFTG +
Sbjct  280  KGITVVAAAGNEGPGAHTVDNVAPWLLTVAATTLDRSFPTKITLGNNQTLFAESLFTGPE  339



>emb|CAB36809.1| subtilisin proteinase-like [Arabidopsis thaliana]
 emb|CAB81272.1| subtilisin proteinase-like [Arabidopsis thaliana]
Length=718

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 120/180 (67%), Gaps = 11/180 (6%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW---  542
            T I D+ S RD  GHGTHT++ A GS V NVSY GLA G  RGGAPRAR+A YK  W   
Sbjct  162  TIIQDFQSTRDANGHGTHTATIAGGSFVPNVSYFGLAQGLVRGGAPRARIASYKACWNVM  221

Query  541  --EGG----IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVA  380
              EGG        AD  KAFD+AIHDGVDV+S S G  +P  +EVD  D  +  +FHAVA
Sbjct  222  RDEGGGTDGRCTSADMWKAFDDAIHDGVDVLSVSIGGGIPEDSEVDKLD--YIAAFHAVA  279

Query  379  HGITVVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKD  200
             GITVV AAGNEGP A TV    PW+LTVAA T DR FPT ITLGN QTL  +SLFTG +
Sbjct  280  KGITVVAAAGNEGPGAHTVDNVAPWLLTVAATTLDRSFPTKITLGNNQTLFAESLFTGPE  339



>ref|XP_006660880.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=768

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 136/216 (63%), Gaps = 14/216 (6%)
 Frame = -3

Query  706  IADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGII  527
            I +++S RD  GHGTHT+STA G+LV+N S++GLA G  RGGA +ARLA+YK+ W  G  
Sbjct  203  IFEFMSARDAVGHGTHTASTAAGALVANASFRGLANGVARGGAQKARLAVYKVCWATGDC  262

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD L AFD+AIHDGVDVIS S G   PL A V  ND L  GSFHA A G+ VV +AGN
Sbjct  263  SAADILAAFDDAIHDGVDVISVSLGQAPPLPAYV--NDVLSIGSFHAAAKGVVVVCSAGN  320

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKD-TGVVDLVFLP  170
             GP ++TV  + PWI+TVAA T DR F   I+LGN  T +GQ+L++GK  +    +V+  
Sbjct  321  SGPYSETVINSAPWIVTVAAGTIDRIFLAKISLGNNSTYVGQTLYSGKHPSKSRRIVYAE  380

Query  169  D-----------KFCETLTTTDTWIAGKVVLCFTGK  95
            D           + C   +   T + G VVLCF  +
Sbjct  381  DIASDNADNTDARSCTAGSLNATLVKGNVVLCFQTR  416



>ref|NP_567633.2| Subtilase family protein [Arabidopsis thaliana]
 gb|AAO00797.1| subtilisin proteinase - like [Arabidopsis thaliana]
 gb|AEE84485.1| Subtilase family protein [Arabidopsis thaliana]
Length=766

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 121/180 (67%), Gaps = 11/180 (6%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW---  542
            T I D+ S RD  GHGTHT++ A GS V NVSY GLA G  RGGAPRAR+A YK  W   
Sbjct  225  TIIQDFQSTRDANGHGTHTATIAGGSFVPNVSYFGLAQGLVRGGAPRARIASYKACWNVM  284

Query  541  --EGGIIMG----ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVA  380
              EGG   G    AD  KAFD+AIHDGVDV+S S G  +P  +EVD  D  +  +FHAVA
Sbjct  285  RDEGGGTDGRCTSADMWKAFDDAIHDGVDVLSVSIGGGIPEDSEVDKLD--YIAAFHAVA  342

Query  379  HGITVVTAAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKD  200
             GITVV AAGNEGP A TV    PW+LTVAA T DR FPT ITLGN QTL  +SLFTG +
Sbjct  343  KGITVVAAAGNEGPGAHTVDNVAPWLLTVAATTLDRSFPTKITLGNNQTLFAESLFTGPE  402



>ref|XP_010513580.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=730

 Score =   189 bits (479),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 118/173 (68%), Gaps = 1/173 (1%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            ++ SPRD KGHGTH ++TA GS VSNVSYKGLA GT RG AP AR+A+YK  W     + 
Sbjct  217  EFRSPRDAKGHGTHVAATAAGSFVSNVSYKGLAVGTARGAAPHARIAVYKTCWRRAGCIT  276

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD LKA D +I DGVDVIS S G   P S +VD +D + FGSF AV  GI VV +AGNEG
Sbjct  277  ADLLKAIDHSIRDGVDVISISIGNEPPASFDVDKDD-IAFGSFQAVMKGIPVVASAGNEG  335

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDL  182
            P AQT+    PWI+TVAA + DR FP PITLGN  T++ + L T  + G  +L
Sbjct  336  PGAQTIDNLAPWIITVAATSFDRSFPIPITLGNNLTVLAEGLNTFPEVGFSEL  388



>emb|CDX82843.1| BnaC01g12930D [Brassica napus]
Length=766

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/224 (52%), Positives = 139/224 (62%), Gaps = 22/224 (10%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            ++ S RD  GHGTHT++ A GS VSN S+ GLA GT RGGAPRAR+A YK+ W+    +G
Sbjct  243  EFKSNRDAIGHGTHTATIAGGSFVSNASFYGLAQGTVRGGAPRARIASYKVCWDL-FFLG  301

Query  520  A---DTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAG  350
                D  KA+D+AIHDGVDV+S S G NVP  +EVD  D +   +FHAVA GI VV AAG
Sbjct  302  CSIVDMWKAYDDAIHDGVDVLSVSLGGNVPEGSEVDQVDFV--AAFHAVAKGIPVVAAAG  359

Query  349  NEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKD--TGVVDLVF  176
            N+GP AQ+V    PW LTVAA T DR FPT ITLGN QT   +SLFTG D  TG+     
Sbjct  360  NDGPNAQSVINVAPWFLTVAATTLDRSFPTKITLGNNQTFYAESLFTGPDITTGLA----  415

Query  175  LPDKFCETLTTTDTWIAGKVVLCFT---GKHGLDIDVEGIVAQS  53
                F E+     T + GK VL F     K GL      I+AQS
Sbjct  416  ----FLESYRHNTTDMKGKTVLVFNKPVSKEGL---AAVILAQS  452



>ref|XP_009105193.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=757

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 129/200 (65%), Gaps = 3/200 (2%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +Y S RD  GHGTH S+ A GS V+N SYKGL  GT RG  P AR+A+YK  W     + 
Sbjct  221  EYRSARDGAGHGTHVSAIAAGSFVANASYKGLGGGTARGVGPHARIAMYKTCWGKLGCLT  280

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
             D LKA D +I DGVDVIS S GA+ P   E+D +D + FGSFHAV  GI VV +AGNEG
Sbjct  281  PDVLKAIDHSIRDGVDVISISIGADAPAGFEIDTSD-VSFGSFHAVMKGIPVVCSAGNEG  339

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDKF  161
            P AQTV    PWI+TVAA + DR FP PITLGN  T++G+ L T  + G  DL+ L ++ 
Sbjct  340  PNAQTVDNVAPWIITVAATSMDRSFPIPITLGNNITILGEGLNTFPEVGFTDLL-LQEEL  398

Query  160  CETLTTTDTWIAGKVVLCFT  101
             ET +     I GK+VL FT
Sbjct  399  MET-SIAQGQIKGKIVLAFT  417



>ref|XP_010538683.1| PREDICTED: subtilisin-like protease SBT3.5 [Tarenaya hassleriana]
Length=696

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 135/208 (65%), Gaps = 8/208 (4%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +Y SPRD  GHGT  +S A GS+V N SY+G+A G  RG APRAR+A YK+ W  G   G
Sbjct  156  EYKSPRDAYGHGTACASIAAGSIVPNASYRGMARGVMRGAAPRARIASYKVCWLKGASCG  215

Query  520  -ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNE  344
             ADT+KAFD+A+HDGVDV+S S G   P+ +E+D  D +  G+FHAV  GI VV AAGN 
Sbjct  216  LADTVKAFDDAVHDGVDVLSISLGGQSPVDSEIDGTDDIALGAFHAVTKGIPVVAAAGNA  275

Query  343  GPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDK  164
            GP AQT++   PWILTVAA T DR F   ITLGN  T+ GQ+++  +   V ++V + D 
Sbjct  276  GPDAQTLANVSPWILTVAATTLDRSFSVVITLGNNLTIRGQAVYN-RSAVVSEVVHIDDW  334

Query  163  FCETLTTTDTWIAGKVVLCFTGKHGLDI  80
               T +     + GKVVL F  K+ +D+
Sbjct  335  NSNTSS-----LQGKVVLIFL-KNEMDV  356



>emb|CDY07492.1| BnaA07g25710D [Brassica napus]
Length=757

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 129/200 (65%), Gaps = 3/200 (2%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +Y S RD  GHGTH S+ A GS V+N SYKGL  GT RG  P AR+A+YK  W     + 
Sbjct  221  EYRSARDGAGHGTHVSAIAAGSFVANASYKGLGGGTARGVGPHARIAMYKTCWGKLGCLT  280

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
             D LKA D +I DGVDVIS S GA+ P   E+D +D + FGSFHAV  GI VV +AGNEG
Sbjct  281  PDVLKAIDHSIRDGVDVISISIGADAPAGFEIDTSD-VSFGSFHAVMKGIPVVCSAGNEG  339

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDKF  161
            P AQTV    PWI+TVAA + DR FP PITLGN  T++G+ L T  + G  DL+ L ++ 
Sbjct  340  PNAQTVDNVAPWIITVAATSMDRSFPIPITLGNNITILGEGLNTFPEVGFTDLL-LQEEL  398

Query  160  CETLTTTDTWIAGKVVLCFT  101
             ET +     I GK+VL FT
Sbjct  399  MET-SIAQGQIKGKIVLAFT  417



>ref|XP_008778811.1| PREDICTED: xylem serine proteinase 1-like [Phoenix dactylifera]
Length=171

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 110/160 (69%), Gaps = 2/160 (1%)
 Frame = -3

Query  706  IADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGII  527
            + +++S RD  GHGTHTSSTAVGS + N S+ GLA G  RGGA RAR+A+YK+ W  G  
Sbjct  1    MVEFLSARDAVGHGTHTSSTAVGSFIGNASFMGLAQGLARGGASRARIAMYKVCWATGGC  60

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD L AFD+AIHDGVDV+S S G   PL A V+  D L  GSFHAVA GITVV +AGN
Sbjct  61   SSADILAAFDDAIHDGVDVLSVSLGQPPPLPAYVE--DVLAIGSFHAVARGITVVCSAGN  118

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLM  227
             GP +QTV    PWI+TVAA+T DR F    TLGN  T M
Sbjct  119  SGPYSQTVINTAPWIITVAASTVDRTFLAAFTLGNNITYM  158



>gb|KDP25228.1| hypothetical protein JCGZ_20384 [Jatropha curcas]
Length=335

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGW--E  539
            T   +++SPRD  GHGTHT+STA G  V   SYKGLA G  RGGAP A LA+YK+ W  E
Sbjct  170  TNSMEFLSPRDGSGHGTHTASTAAGYFVEKASYKGLAAGVARGGAPLAHLAVYKVCWDIE  229

Query  538  GGIIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVT  359
            GG    AD LKAFD+AI DGVDV+S S G  +PL + VD  DS+  GSFHA+++GI V+ 
Sbjct  230  GGGCSDADILKAFDKAIQDGVDVLSISIGNEIPLFSYVDQRDSIAIGSFHAISNGIPVIC  289

Query  358  AAGNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTL  230
            +AGN+GP +QT+    PW++TVAA T DR F T ITLGN +TL
Sbjct  290  SAGNDGPNSQTIVNTAPWLITVAATTIDRAFSTAITLGNNRTL  332



>ref|XP_010474133.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=754

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 119/173 (69%), Gaps = 1/173 (1%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            ++ SPRD KGHGTH ++TA GS VSN SYKGLA GT RG AP AR+A+YK  W     + 
Sbjct  218  EFRSPRDAKGHGTHVAATAAGSFVSNASYKGLAVGTARGAAPHARIAMYKTCWRRAGCIT  277

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD LKA D +I DGVDVIS S G + P S +VD +D + FGSF AV  GI VV +AGNEG
Sbjct  278  ADLLKAIDHSIRDGVDVISVSIGNDPPASFDVDMDD-IAFGSFQAVMKGIPVVASAGNEG  336

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDL  182
            P AQT+    PWI+TVAA + DR FP PITLGN  T++ + L T  + G ++L
Sbjct  337  PDAQTIDNVAPWIITVAATSFDRSFPVPITLGNNLTVLAEGLNTFPEVGFIEL  389



>ref|XP_008245809.1| PREDICTED: subtilisin-like protease SDD1 [Prunus mume]
Length=779

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 132/221 (60%), Gaps = 11/221 (5%)
 Frame = -3

Query  706  IADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGII  527
            + D++SPRD  GHGTHT+STA G  V  V+Y+GLA G  RGGAP A LAIYK  W     
Sbjct  219  VVDFLSPRDGIGHGTHTASTAAGYFVKRVNYRGLASGLARGGAPLAHLAIYKACWAFEGC  278

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD LKAFD+AIHDGVD++S S G   PL + VD  DS+  GSFHA A GITVV +A  
Sbjct  279  SDADLLKAFDKAIHDGVDILSLSVGNVTPLFSYVDQRDSIAIGSFHATAKGITVVCSAXX  338

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDT-GVVDLVFLP  170
                 QT+    PW++TVAA T DR FPT ITLGN QTL GQS+   K   G V +++  
Sbjct  339  XXXXXQTIVNTAPWLITVAATTIDRVFPTAITLGNNQTLWGQSIDIEKHKHGFVGIIYSE  398

Query  169  D----------KFCETLTTTDTWIAGKVVLCFTGKHGLDID  77
                       K C+      T  +GK+VLCF+     DI+
Sbjct  399  RIALDRTNDSAKDCQPGNLNATLASGKIVLCFSKSDQQDIE  439



>ref|XP_010113170.1| Subtilisin-like protease SDD1 [Morus notabilis]
 gb|EXC70835.1| Subtilisin-like protease SDD1 [Morus notabilis]
Length=318

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 112/160 (70%), Gaps = 3/160 (2%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWE---GGI  530
            DY+SPRD  GHGTHTS+ A GS V++ SY GL  GT RGGA +AR+A+YK+ W    GG+
Sbjct  143  DYLSPRDFGGHGTHTSTIAAGSSVADRSYNGLGVGTVRGGATQARIAMYKVCWSVFGGGL  202

Query  529  IMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAG  350
              GAD LKAFD ++ DGVDV+S S  A+VP   E D  +++  G+FHAVA G+ VV AAG
Sbjct  203  CAGADILKAFDVSVRDGVDVVSVSIAADVPSYPEADQRNAIAVGAFHAVAKGVAVVCAAG  262

Query  349  NEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTL  230
            N GP+ QTV    PWILTV A++ DR FPT + LGN  T+
Sbjct  263  NSGPSPQTVQNTSPWILTVGASSDDRSFPTRVKLGNNWTI  302



>ref|XP_006391365.1| hypothetical protein EUTSA_v10018142mg [Eutrema salsugineum]
 gb|ESQ28651.1| hypothetical protein EUTSA_v10018142mg [Eutrema salsugineum]
Length=791

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 121/179 (68%), Gaps = 2/179 (1%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            + +SP D  GHGTH +STAVGS V + ++ GLA GT RG APRAR+A YK+ W       
Sbjct  251  EVLSPLDKVGHGTHCASTAVGSFVQDANFLGLAQGTARGSAPRARIASYKVCWNNEECFT  310

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
             D LKA D AI DGVDV+S S G+ +PL  EVD +D     +FHAV  GI VV A GN+G
Sbjct  311  PDILKAIDHAIRDGVDVLSLSLGSEIPLDFEVDRSD-FAIAAFHAVMKGIPVVCAGGNDG  369

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQ-SLFTGKDTGVVDLVFLPD  167
            P +QT+S   PWI+TVAA T DR+F TPITLGN  TL+GQ SL+ GK+ G  DL++  D
Sbjct  370  PQSQTISNVAPWIITVAAMTMDREFFTPITLGNNITLLGQESLYIGKEVGFADLLYFDD  428



>emb|CDX79081.1| BnaA01g11480D [Brassica napus]
Length=751

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 132/204 (65%), Gaps = 16/204 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            ++ S RD  GHGTHT++ A GS VSN S+ GLA GT RGGAPRAR+A YK+ W+    +G
Sbjct  228  EFKSNRDAIGHGTHTATIAGGSFVSNASFYGLAQGTVRGGAPRARIASYKVCWDL-FFLG  286

Query  520  A---DTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAG  350
                D  KA+D+AIHDGVDV+S S G +VP  +EVD  D +   +FHAVA GI VV AAG
Sbjct  287  CSIVDMWKAYDDAIHDGVDVLSVSLGGDVPEGSEVDQVDFV--AAFHAVAKGIPVVAAAG  344

Query  349  NEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKD--TGVVDLVF  176
            N+GP AQ+V    PW LTVAA T DR FPT ITLGN QT   +SLFTG D  TG+     
Sbjct  345  NDGPNAQSVINVAPWFLTVAATTLDRSFPTKITLGNNQTFYAESLFTGPDITTGLA----  400

Query  175  LPDKFCETLTTTDTWIAGKVVLCF  104
                F E+ +   T + GK VL F
Sbjct  401  ----FLESYSHNTTGMKGKTVLAF  420



>ref|XP_010419003.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=719

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 129/203 (64%), Gaps = 9/203 (4%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            ++ SPRD KGHGTH ++TA GS VSN SYKGLA GT RG AP AR+A+YK  W     + 
Sbjct  183  EFRSPRDAKGHGTHVAATAAGSFVSNASYKGLAVGTARGAAPHARIAMYKTCWRRAGCIT  242

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            AD LKA D +I DGVDVIS S G + P S +VD +D + FGSF AV  GI VV +AGNEG
Sbjct  243  ADLLKAIDHSIRDGVDVISISIGNDPPASFDVDMDD-IAFGSFQAVMKGIPVVASAGNEG  301

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDL---VFLP  170
            P AQT+    PWI+TVAA + DR FP PITLGN  T++ + L T  + G  +L   + L 
Sbjct  302  PDAQTIDNVAPWIITVAATSFDRSFPVPITLGNNLTVLAEGLNTFPEVGFSELQNGIELL  361

Query  169  DKFCETLTTTDTWIAGKVVLCFT  101
            D   E   T      G +VL FT
Sbjct  362  DTNIEEGVT-----KGSIVLAFT  379



>ref|XP_002887016.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63275.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=753

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 127/197 (64%), Gaps = 3/197 (2%)
 Frame = -3

Query  691  SPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMGADT  512
            SPRDI+GHGTH S+ A GS V+  +Y GLA GT RG AP AR+A+YK  W+G   +  D 
Sbjct  220  SPRDIEGHGTHVSAIAAGSFVATANYNGLAGGTARGAAPHARIAMYKACWKGIGCITPDM  279

Query  511  LKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEGPAA  332
            LKA D +I DGVDVIS S G + P S ++D +D + FGSF AV  GI VV +AGNEGP A
Sbjct  280  LKAIDHSIRDGVDVISISIGTDAPASFDIDQSD-IAFGSFQAVMKGIPVVASAGNEGPNA  338

Query  331  QTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDKFCET  152
            QT+    PWI+TVAA + DR FP PITLGN  T++G+ L T  + G  DL+   +    +
Sbjct  339  QTIDNVAPWIITVAATSLDRSFPIPITLGNNLTILGEGLNTFPEAGFTDLILSDEMMSAS  398

Query  151  LTTTDTWIAGKVVLCFT  101
            +    T   G +VL FT
Sbjct  399  IEQGQT--QGTIVLAFT  413



>ref|XP_009407970.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009407971.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=769

 Score =   186 bits (473),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 134/216 (62%), Gaps = 14/216 (6%)
 Frame = -3

Query  706  IADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGII  527
            I +++S RD  GHGTHTSSTA G+ V N S+ G+A G  RGGA RARLAIYK+ W  G  
Sbjct  204  ILEFLSARDAVGHGTHTSSTAAGAFVGNASFMGIARGIARGGALRARLAIYKVCWATGGC  263

Query  526  MGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGN  347
              AD L AFD+AIHDGVDV+S S G + PL   ++  D L  GSFHAVA GITVV +AGN
Sbjct  264  SSADILAAFDDAIHDGVDVLSVSLGQSPPLPTYIE--DVLAIGSFHAVARGITVVCSAGN  321

Query  346  EGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDT-GVVDLVFLP  170
             GP +QTV    PW++TVAA+T DR F T I+LGN  T  GQ+L+ G+       +V+  
Sbjct  322  SGPFSQTVINTAPWVITVAASTIDRTFVTFISLGNNVTKAGQALYLGEHVDKFYGIVYAE  381

Query  169  DKFCETLTTTD-----------TWIAGKVVLCFTGK  95
            D   +   +TD           T   GKVVLCF  +
Sbjct  382  DIASDNADSTDARGCGAGSLNATLARGKVVLCFQTR  417



>ref|XP_010528996.1| PREDICTED: subtilisin-like protease SBT3.5 [Tarenaya hassleriana]
Length=756

 Score =   186 bits (473),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 126/199 (63%), Gaps = 3/199 (2%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            D++SPRD  GHGTH +STA GS V NVS  G A GT RGGAP AR+A YK+ W GG    
Sbjct  217  DFMSPRDKIGHGTHCASTAAGSFVQNVSRFGYAAGTVRGGAPHARIAAYKVCWNGGRCAS  276

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
             D LKA D++I DGVDVIS S G  +P + EVD  D+    +FHAV  GI VV AAGNEG
Sbjct  277  PDILKAIDQSIRDGVDVISLSLGGGLPANFEVDQKDT-STAAFHAVMKGIPVVFAAGNEG  335

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDKF  161
            P +QTV    PWI+TVAA   DR F   +TLGN +T+  +  F G +TG V LV + +  
Sbjct  336  PNSQTVDNVAPWIITVAAANMDRAFIAAMTLGNNRTIYAEGFFEGPETGFVGLVAVDE--  393

Query  160  CETLTTTDTWIAGKVVLCF  104
             + L   +  + GKVVL F
Sbjct  394  IKPLDIMEGKLKGKVVLVF  412



>ref|XP_010554964.1| PREDICTED: subtilisin-like protease SBT3.3 [Tarenaya hassleriana]
Length=762

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 130/203 (64%), Gaps = 9/203 (4%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +Y S RD   HGTH ++TA GS V   S+KGLA GT RGGAPR+R+A YK+ W      G
Sbjct  222  EYASARDGLAHGTHVAATAAGSFVPGASWKGLAGGTARGGAPRSRVAAYKVCWNRQGCPG  281

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
            +D +KA D+AI DGVDVIS S G  +P   EVD ND +   SFHAV  GI VV AAGNEG
Sbjct  282  SDMIKAIDDAIRDGVDVISISIGNAIPNDFEVDQND-IGIASFHAVMKGIPVVCAAGNEG  340

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDKF  161
            P  QTV    PWI+TVAA++ DR FP  +TLGN  T+  + ++TGK+ G VDLVF  +  
Sbjct  341  PDPQTVDNVAPWIITVAASSMDRSFPVSVTLGNNLTITARGVYTGKEVGFVDLVFGGE--  398

Query  160  CETLTTTDTW---IAGKVVLCFT  101
               L  +D     + GKVVL FT
Sbjct  399  ---LQGSDIRGGSVKGKVVLFFT  418



>ref|XP_009135013.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=751

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 131/204 (64%), Gaps = 16/204 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            ++ S RD  GHGTHT++ A GS VSN S+ GLA GT RGGAPRAR+A YK+ W+    +G
Sbjct  228  EFKSNRDAIGHGTHTATIAGGSFVSNASFYGLAQGTVRGGAPRARIASYKVCWDL-FFLG  286

Query  520  A---DTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAG  350
                D  KA+D+AIHDGVDV+S S G +VP  +EVD  D +   +FHAV  GI VV AAG
Sbjct  287  CSIVDMWKAYDDAIHDGVDVLSVSLGGDVPEGSEVDQVDFV--AAFHAVTKGIPVVAAAG  344

Query  349  NEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKD--TGVVDLVF  176
            N+GP AQ+V    PW LTVAA T DR FPT ITLGN QT   +SLFTG D  TG+     
Sbjct  345  NDGPNAQSVINVAPWFLTVAATTLDRSFPTKITLGNNQTFYAESLFTGPDITTGLA----  400

Query  175  LPDKFCETLTTTDTWIAGKVVLCF  104
                F E+ +   T + GK VL F
Sbjct  401  ----FLESYSHNTTGMKGKTVLAF  420



>ref|XP_006413751.1| hypothetical protein EUTSA_v10024480mg [Eutrema salsugineum]
 gb|ESQ55204.1| hypothetical protein EUTSA_v10024480mg [Eutrema salsugineum]
Length=766

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 131/212 (62%), Gaps = 8/212 (4%)
 Frame = -3

Query  712  TGIADYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGG  533
            T + ++ S RD  GHGTHT++ A GS V NVS+ GLA GT RGGAPRAR+A YK+ W G 
Sbjct  226  TELQEFKSNRDASGHGTHTATIAGGSFVHNVSFYGLAGGTVRGGAPRARIASYKVCWSGV  285

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
                AD  KA+D+AIHD VDV+S S G ++P  +EVD  D +   +FHAVA GI VV AA
Sbjct  286  GCTTADMWKAYDDAIHDRVDVLSVSLGGHIPEDSEVDALDFI--AAFHAVAQGIPVVAAA  343

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFL  173
            GN GP AQTV    PW LTVAA T DR FPT ITLGN QT   +SL+TG +     L FL
Sbjct  344  GNYGPRAQTVLNVAPWFLTVAATTLDRSFPTKITLGNNQTFFVESLYTGPEIS-TGLAFL  402

Query  172  PDKFCETLTTTDTWIAGKVVLCFTGKHGLDID  77
                 E +      + GK ++ F     + ID
Sbjct  403  NPYSDERID-----VKGKTIIVFDTHFPMGID  429



>ref|XP_009392092.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=574

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 130/201 (65%), Gaps = 16/201 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            DY SPRD  GHGTHT+STA GSLVS+V++ GL  GT RGGAPRARLAIYK+ W  GI   
Sbjct  220  DYDSPRDANGHGTHTASTAAGSLVSDVNFHGLGAGTARGGAPRARLAIYKVCWGSGICGE  279

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHF-GSFHAVAHGITVVTAAGNE  344
            AD L+A D+A+ +GVD++S S G               HF  S  AV  GITVV + GN+
Sbjct  280  ADVLQAIDDAVDNGVDILSLSIGGYG------------HFPASLGAVRKGITVVFSGGND  327

Query  343  GPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSL-FTGKDTGVVDLVFLPD  167
            GP  QT++ A PW++TVAA+T DR FPT I LGNG+TL+GQS+ +   D G  D V +  
Sbjct  328  GPVPQTINNAVPWVITVAASTIDRSFPTDIILGNGRTLVGQSMCYASSDPG--DKVLVAF  385

Query  166  KFCETLTTTDTWIAGKVVLCF  104
              C  +    T +A K+VLCF
Sbjct  386  DSCSVVPQYLTQLADKIVLCF  406



>ref|XP_006301478.1| hypothetical protein CARUB_v10021900mg, partial [Capsella rubella]
 gb|EOA34376.1| hypothetical protein CARUB_v10021900mg, partial [Capsella rubella]
Length=719

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 125/197 (63%), Gaps = 7/197 (4%)
 Frame = -3

Query  691  SPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMGADT  512
            SPRDI GHGTH ++ A GS V+N S+KGLA GT RG AP AR+A+YK  W+      ADT
Sbjct  217  SPRDIIGHGTHVAAIAAGSFVANASHKGLAVGTARGAAPHARIAVYKTCWKDLGCFTADT  276

Query  511  LKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEGPAA  332
            +KA D +I DGVDVIS S G + P S +VD +D + FGSF AV  GI VV AAGNEGP A
Sbjct  277  VKAIDHSIRDGVDVISLSIGTDAPASFDVDVDD-IGFGSFQAVMKGIPVVAAAGNEGPDA  335

Query  331  QTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDKFCET  152
            QT+    PWI+TVAA T DR FP PITLGN  T++G+ L T  + G  +L    + F   
Sbjct  336  QTIDNVAPWIITVAATTLDRSFPVPITLGNNLTILGEGLNTFPEVGFKELSLSMEMF---  392

Query  151  LTTTDTWIAGKVVLCFT  101
                D      +VL FT
Sbjct  393  ---NDDQPKDLIVLAFT  406



>emb|CDY07491.1| BnaA07g25700D [Brassica napus]
Length=759

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 117/177 (66%), Gaps = 2/177 (1%)
 Frame = -3

Query  694  ISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMGAD  515
            +SP D  GHGTH +STA GS V N +Y GL  GT RG APRAR+A YK+ W        D
Sbjct  221  MSPLDKVGHGTHCASTAAGSFVQNANYLGLGQGTARGSAPRARVAAYKVCWNNEECFTPD  280

Query  514  TLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEGPA  335
             LKA D A+ DGVDV+S S G+ +PL  EVD +D     +FHAV  GITVV A GN+GP 
Sbjct  281  ILKAMDHAMRDGVDVLSLSLGSEIPLDFEVDRSD-FAIAAFHAVMKGITVVCAGGNDGPE  339

Query  334  AQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQS-LFTGKDTGVVDLVFLPD  167
             QT+S   PWI+TVAA T DR+F TPITLGN  T++GQ  L+ G++ G  DL++  D
Sbjct  340  TQTISNVAPWIITVAATTMDREFFTPITLGNNVTVLGQEGLYIGEEVGFTDLIYFDD  396



>emb|CDY49640.1| BnaCnng17920D [Brassica napus]
Length=757

 Score =   185 bits (469),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 127/200 (64%), Gaps = 3/200 (2%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            +Y S RD  GHGTH S+ A GS V+N SYKGL  G  RG  P AR+A+YK  W     + 
Sbjct  221  EYRSARDGVGHGTHVSAIAAGSFVANASYKGLGGGAARGVGPHARIAMYKTCWGKLGCLT  280

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
             D LKA D +I DGVDVIS S GA+ P   E+D +D + FGSFHAV  GI VV +AGNEG
Sbjct  281  PDVLKAIDHSIRDGVDVISISIGADAPAGFEIDTSD-VSFGSFHAVMKGIPVVCSAGNEG  339

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTGVVDLVFLPDKF  161
            P AQTV    PWI+TVAA + DR FP PITLGN  T++G+ L T  + G  DL+ L  + 
Sbjct  340  PNAQTVDNIAPWIITVAATSMDRSFPVPITLGNNITILGEGLNTFPEVGFTDLL-LQAEL  398

Query  160  CETLTTTDTWIAGKVVLCFT  101
             ET +     I GK+VL FT
Sbjct  399  MET-SIAQGQIKGKIVLAFT  417



>ref|XP_002447443.1| hypothetical protein SORBIDRAFT_06g001140 [Sorghum bicolor]
 gb|EES11771.1| hypothetical protein SORBIDRAFT_06g001140 [Sorghum bicolor]
Length=771

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 129/206 (63%), Gaps = 17/206 (8%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEG----G  533
            +++SPRD  GHGTHT+STA G+LV NVS+ GLA G  RGGAPRARLA+YK  W      G
Sbjct  222  EFLSPRDANGHGTHTASTAAGNLVHNVSFNGLAHGVARGGAPRARLAVYKACWGAFPTHG  281

Query  532  IIMGADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAA  353
               GA  +KA D+AIHDGVDV+S S G             S + G+ HAVA+GITVV +A
Sbjct  282  SCSGAGIMKAIDDAIHDGVDVLSLSIGG-----------PSEYPGTLHAVANGITVVFSA  330

Query  352  GNEGPAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQSLFTGKDTG--VVDLV  179
            GN+GP  QTV    PW+LTVAA T DR FPT ITLGN Q L+GQSLF   +      +++
Sbjct  331  GNDGPVIQTVQNVSPWLLTVAATTVDRLFPTVITLGNNQRLVGQSLFVATEGADHFYEVL  390

Query  178  FLPDKFCETLTTTDTWIAGKVVLCFT  101
                + C+      T + GK++ C T
Sbjct  391  GYDAETCDPAYINSTDVKGKIIFCIT  416



>ref|XP_002888489.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64748.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=760

 Score =   184 bits (468),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 128/208 (62%), Gaps = 4/208 (2%)
 Frame = -3

Query  700  DYISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMG  521
            + +SP D  GHGTH +STAVGS V + +  GLA GT RG APRAR+A YK+ W       
Sbjct  219  EVMSPLDKMGHGTHCASTAVGSFVPDANVFGLAQGTARGSAPRARIASYKVCWNNDECFT  278

Query  520  ADTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEG  341
             D +KA D AI DGVDVIS S G+ VP+  EVD        +FHAV  GI VV A GN+G
Sbjct  279  PDIVKAIDHAIRDGVDVISLSLGSEVPVDFEVDSRSDFAIAAFHAVMKGIPVVCAGGNDG  338

Query  340  PAAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQS-LFTGKDTGVVDLVFLPDK  164
            P  QT+S   PW++TVAA T DR+F TPITLGN  TL+GQ  ++TGK+ G  DL++  D 
Sbjct  339  PDKQTISNVAPWLITVAATTMDREFFTPITLGNNITLLGQEGVYTGKEVGFTDLLYFEDL  398

Query  163  FCETLTTTDTWIAGKVVLCF-TGKHGLD  83
              E +        GK++  F T K+  D
Sbjct  399  TKEDMQAGKA--NGKILFFFQTAKYQDD  424



>ref|XP_009392091.1| PREDICTED: subtilisin-like protease SBT5.3, partial [Musa acuminata 
subsp. malaccensis]
Length=511

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 129/199 (65%), Gaps = 13/199 (7%)
 Frame = -3

Query  697  YISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMGA  518
            Y SPRD +GHGTHT+STA GSLV++ S+ GL  GT RGGAPRARLAIYK  W       A
Sbjct  210  YQSPRDSEGHGTHTASTAAGSLVTDASFHGLGAGTARGGAPRARLAIYKACWAKAGCPDA  269

Query  517  DTLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEGP  338
              LKA D+AIHDGVD++S S G  +            +F S HAVA GITV+ A GN+GP
Sbjct  270  AVLKAIDDAIHDGVDILSLSLGGVL----------HPYFASIHAVAKGITVIFAGGNDGP  319

Query  337  AAQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQS-LFTGKDTGVVDLVFLPDKF  161
              QT++   PW++TVAA+T DR FPT +TLG+ QT++GQS L+   D G   L +     
Sbjct  320  VTQTIANDMPWVITVAASTIDRSFPTLLTLGDNQTVVGQSLLYESMDEGFTKLAYGGSCS  379

Query  160  CETLTTTDTWIAGKVVLCF  104
             + L ++D  + GK+VLC+
Sbjct  380  RDALNSSD--VVGKIVLCY  396



>ref|XP_009105192.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=759

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 116/177 (66%), Gaps = 2/177 (1%)
 Frame = -3

Query  694  ISPRDIKGHGTHTSSTAVGSLVSNVSYKGLAFGTFRGGAPRARLAIYKIGWEGGIIMGAD  515
            +SP D  GHGTH +STA GS V N +Y GL  GT RG APRAR+A YK+ W        D
Sbjct  221  MSPLDKVGHGTHCASTAAGSFVQNANYLGLGQGTARGSAPRARVAAYKVCWNNEECFTPD  280

Query  514  TLKAFDEAIHDGVDVISASFGANVPLSAEVDPNDSLHFGSFHAVAHGITVVTAAGNEGPA  335
             LKA D A+ DGVDV+S S G+ +PL  EVD +D     +FHAV  GITVV A GN+GP 
Sbjct  281  ILKAMDHAMRDGVDVLSLSLGSEIPLDFEVDRSD-FAIAAFHAVMKGITVVCAGGNDGPE  339

Query  334  AQTVSGADPWILTVAANTPDRDFPTPITLGNGQTLMGQS-LFTGKDTGVVDLVFLPD  167
             QT+S   PWI+TV A T DR+F TPITLGN  T++GQ  L+ G++ G  DL++  D
Sbjct  340  TQTISNVAPWIITVGATTMDREFFTPITLGNNVTVLGQEGLYIGEEVGFTDLIYFDD  396



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1175877007191