BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25504_g1_i4 len=1273 path=[4250:0-64 637:65-89 662:90-194
4439:195-210 753:211-238 2254:239-254 2270:255-283 4525:284-308
4549:309-329 577:330-353 4593:354-364 8115:365-374 8125:375-387
8138:388-392 4631:393-397 2089:398-514 6119:515-560 4798:561-625
4863:626-666 4904:667-674 4912:675-713 5992:714-743 8289:744-787
8333:788-788 8334:789-804 5040:805-926 8385:927-958 6584:959-994
819:995-1272]

Length=1273
                                                                      Score     E

ref|XP_009790594.1|  PREDICTED: equilibrative nucleotide transpor...    606   0.0      
ref|XP_009790593.1|  PREDICTED: equilibrative nucleotide transpor...    604   0.0      
ref|XP_009589135.1|  PREDICTED: equilibrative nucleotide transpor...    601   0.0      
emb|CDO99651.1|  unnamed protein product                                598   0.0      
ref|XP_011086142.1|  PREDICTED: equilibrative nucleotide transpor...    596   0.0      
ref|XP_011086138.1|  PREDICTED: equilibrative nucleotide transpor...    592   0.0      
emb|CDO99653.1|  unnamed protein product                                585   0.0      
ref|XP_006347157.1|  PREDICTED: equilibrative nucleotide transpor...    582   0.0      
ref|XP_004232785.1|  PREDICTED: equilibrative nucleotide transpor...    580   0.0      
ref|XP_002304988.2|  equilibrative nucleoside transporter family ...    578   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006352598.1|  PREDICTED: equilibrative nucleotide transpor...    578   0.0      
ref|XP_010327232.1|  PREDICTED: equilibrative nucleotide transpor...    577   0.0      
ref|XP_004233814.1|  PREDICTED: equilibrative nucleotide transpor...    573   0.0      
ref|XP_009787357.1|  PREDICTED: equilibrative nucleotide transpor...    573   0.0      
ref|XP_006347184.1|  PREDICTED: equilibrative nucleotide transpor...    572   0.0      
ref|XP_002524704.1|  nucleoside transporter, putative                   571   0.0      Ricinus communis
gb|KDP20869.1|  hypothetical protein JCGZ_21340                         571   0.0      
ref|XP_006352597.1|  PREDICTED: equilibrative nucleotide transpor...    570   0.0      
ref|XP_004232782.1|  PREDICTED: equilibrative nucleotide transpor...    569   0.0      
gb|KDP20868.1|  hypothetical protein JCGZ_21339                         569   0.0      
ref|XP_002304987.1|  equilibrative nucleoside transporter family ...    568   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010327231.1|  PREDICTED: equilibrative nucleotide transpor...    567   0.0      
ref|XP_011001160.1|  PREDICTED: equilibrative nucleotide transpor...    566   0.0      
gb|KHG13228.1|  Equilibrative nucleoside transporter 1                  561   0.0      
gb|EYU33943.1|  hypothetical protein MIMGU_mgv1a007099mg                557   0.0      
ref|XP_007043445.1|  Major facilitator superfamily protein isoform 2    557   0.0      
ref|XP_002270728.2|  PREDICTED: equilibrative nucleotide transpor...    556   0.0      Vitis vinifera
ref|XP_009607302.1|  PREDICTED: equilibrative nucleotide transpor...    555   0.0      
ref|XP_007025839.1|  Major facilitator superfamily protein              554   0.0      
ref|XP_007043444.1|  Major facilitator superfamily protein isoform 1    555   0.0      
ref|XP_006396631.1|  hypothetical protein EUTSA_v10028692mg             552   0.0      
ref|XP_002276682.1|  PREDICTED: equilibrative nucleotide transpor...    551   0.0      Vitis vinifera
gb|KEH36498.1|  equilibrative nucleoside transporter 6                  552   0.0      
ref|XP_008224922.1|  PREDICTED: equilibrative nucleotide transpor...    550   0.0      
emb|CDO99652.1|  unnamed protein product                                550   0.0      
ref|XP_010268890.1|  PREDICTED: equilibrative nucleotide transpor...    549   0.0      
ref|XP_007211738.1|  hypothetical protein PRUPE_ppa006222mg             549   0.0      
gb|EPS58545.1|  equilibrative nucleoside transporter                    549   0.0      
ref|XP_006467916.1|  PREDICTED: equilibrative nucleotide transpor...    548   0.0      
ref|XP_010924037.1|  PREDICTED: equilibrative nucleotide transpor...    548   0.0      
ref|XP_006467919.1|  PREDICTED: equilibrative nucleotide transpor...    548   0.0      
ref|XP_004134737.1|  PREDICTED: equilibrative nucleotide transpor...    548   0.0      
ref|XP_010106728.1|  Equilibrative nucleoside transporter 4             546   0.0      
ref|XP_002874833.1|  hypothetical protein ARALYDRAFT_911781             546   0.0      
ref|XP_010924032.1|  PREDICTED: equilibrative nucleotide transpor...    546   0.0      
ref|XP_006449192.1|  hypothetical protein CICLE_v10017611mg             546   0.0      
ref|XP_008439926.1|  PREDICTED: equilibrative nucleotide transpor...    546   0.0      
ref|XP_008439927.1|  PREDICTED: equilibrative nucleotide transpor...    545   0.0      
ref|XP_008439925.1|  PREDICTED: equilibrative nucleotide transpor...    546   0.0      
ref|XP_008439924.1|  PREDICTED: equilibrative nucleotide transpor...    546   0.0      
gb|KGN49174.1|  hypothetical protein Csa_6G516820                       545   0.0      
ref|XP_006449191.1|  hypothetical protein CICLE_v10015491mg             544   0.0      
ref|XP_008439923.1|  PREDICTED: equilibrative nucleotide transpor...    545   0.0      
ref|XP_008439922.1|  PREDICTED: equilibrative nucleotide transpor...    545   0.0      
ref|XP_007149910.1|  hypothetical protein PHAVU_005G109300g             544   0.0      
ref|XP_009402883.1|  PREDICTED: equilibrative nucleotide transpor...    544   0.0      
ref|XP_008439921.1|  PREDICTED: equilibrative nucleotide transpor...    545   0.0      
ref|XP_008439920.1|  PREDICTED: equilibrative nucleotide transpor...    545   0.0      
gb|KDP24206.1|  hypothetical protein JCGZ_25863                         543   0.0      
ref|XP_008230198.1|  PREDICTED: equilibrative nucleotide transpor...    543   0.0      
ref|XP_007216101.1|  hypothetical protein PRUPE_ppa018615mg             542   0.0      
emb|CDY46379.1|  BnaA09g19930D                                          541   0.0      
ref|XP_010431742.1|  PREDICTED: equilibrative nucleotide transpor...    541   0.0      
ref|XP_009114502.1|  PREDICTED: equilibrative nucleotide transpor...    541   0.0      
ref|XP_006287835.1|  hypothetical protein CARUB_v10001055mg             540   0.0      
ref|XP_009348006.1|  PREDICTED: equilibrative nucleotide transpor...    539   0.0      
emb|CDY69920.1|  BnaCnng65950D                                          539   0.0      
ref|NP_192421.1|  equilibrative nucleotide transporter 3                539   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009112694.1|  PREDICTED: equilibrative nucleotide transpor...    539   0.0      
ref|XP_010422385.1|  PREDICTED: equilibrative nucleotide transpor...    538   0.0      
emb|CBI40869.3|  unnamed protein product                                555   0.0      
ref|XP_010455844.1|  PREDICTED: equilibrative nucleotide transpor...    538   0.0      
ref|XP_010431711.1|  PREDICTED: equilibrative nucleotide transpor...    537   0.0      
ref|XP_010431705.1|  PREDICTED: equilibrative nucleotide transpor...    538   0.0      
ref|XP_010035647.1|  PREDICTED: equilibrative nucleotide transpor...    537   0.0      
ref|XP_008341935.1|  PREDICTED: equilibrative nucleotide transpor...    536   0.0      
ref|XP_010052413.1|  PREDICTED: equilibrative nucleotide transpor...    535   0.0      
ref|XP_004293471.1|  PREDICTED: equilibrative nucleotide transpor...    535   0.0      
ref|XP_009350452.1|  PREDICTED: equilibrative nucleotide transpor...    534   0.0      
ref|XP_010904666.1|  PREDICTED: equilibrative nucleotide transpor...    534   0.0      
ref|XP_002874832.1|  hypothetical protein ARALYDRAFT_490161             534   0.0      
gb|KFK23995.1|  hypothetical protein AALP_AAs70229U000100               534   0.0      
ref|XP_010054390.1|  PREDICTED: equilibrative nucleotide transpor...    533   0.0      
ref|XP_010422384.1|  PREDICTED: equilibrative nucleotide transpor...    534   0.0      
ref|XP_003547130.1|  PREDICTED: equilibrative nucleotide transpor...    533   0.0      
ref|XP_004507230.1|  PREDICTED: equilibrative nucleotide transpor...    532   0.0      
ref|XP_004485694.1|  PREDICTED: equilibrative nucleotide transpor...    532   0.0      
ref|XP_007148256.1|  hypothetical protein PHAVU_006G193100g             532   0.0      
ref|XP_009626442.1|  PREDICTED: equilibrative nucleotide transpor...    531   0.0      
ref|XP_010455852.1|  PREDICTED: equilibrative nucleotide transpor...    530   0.0      
ref|XP_009778592.1|  PREDICTED: equilibrative nucleotide transpor...    529   0.0      
ref|XP_010455845.1|  PREDICTED: equilibrative nucleotide transpor...    529   0.0      
ref|XP_010316658.1|  PREDICTED: equilibrative nucleotide transpor...    526   0.0      
ref|XP_003635072.1|  PREDICTED: equilibrative nucleotide transpor...    528   0.0      
ref|XP_010431740.1|  PREDICTED: equilibrative nucleotide transpor...    529   0.0      
ref|XP_008349225.1|  PREDICTED: equilibrative nucleotide transpor...    527   0.0      
ref|XP_009374004.1|  PREDICTED: equilibrative nucleotide transpor...    527   0.0      
gb|KHN33640.1|  Equilibrative nucleoside transporter 4                  526   0.0      
ref|XP_010533854.1|  PREDICTED: equilibrative nucleotide transpor...    526   0.0      
ref|XP_011047487.1|  PREDICTED: equilibrative nucleotide transpor...    526   0.0      
gb|EEC82260.1|  hypothetical protein OsI_26455                          526   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006657824.1|  PREDICTED: equilibrative nucleotide transpor...    525   0.0      
ref|XP_003543367.1|  PREDICTED: equilibrative nucleotide transpor...    525   0.0      
ref|XP_010268895.1|  PREDICTED: equilibrative nucleotide transpor...    525   0.0      
ref|XP_006594866.1|  PREDICTED: equilibrative nucleotide transpor...    526   0.0      
ref|XP_008800349.1|  PREDICTED: equilibrative nucleotide transpor...    525   0.0      
ref|NP_001275018.1|  equilibrative nucleotide transporter 3-like        525   0.0      
gb|KHN36590.1|  Equilibrative nucleoside transporter 4                  524   0.0      
ref|XP_006371645.1|  hypothetical protein POPTR_0019s14090g             524   0.0      
ref|XP_003547129.1|  PREDICTED: equilibrative nucleotide transpor...    524   0.0      
ref|NP_001059965.1|  Os07g0557100                                       523   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004231487.1|  PREDICTED: equilibrative nucleotide transpor...    523   0.0      
ref|XP_007148261.1|  hypothetical protein PHAVU_006G193400g             521   2e-180   
ref|XP_009417267.1|  PREDICTED: equilibrative nucleotide transpor...    522   2e-180   
ref|XP_003597087.1|  Equilibrative nucleoside transporter               521   5e-180   
gb|KEH17554.1|  equilibrative nucleoside transporter 6                  520   7e-180   
ref|XP_009417268.1|  PREDICTED: equilibrative nucleotide transpor...    520   8e-180   
ref|XP_007132618.1|  hypothetical protein PHAVU_011G110200g             520   9e-180   
emb|CDP11897.1|  unnamed protein product                                519   1e-179   
ref|XP_007132619.1|  hypothetical protein PHAVU_011G110200g             521   1e-179   
ref|XP_009417262.1|  PREDICTED: equilibrative nucleotide transpor...    520   2e-179   
ref|XP_006592409.1|  PREDICTED: equilibrative nucleotide transpor...    520   2e-179   
gb|KDP24205.1|  hypothetical protein JCGZ_25862                         520   2e-179   
ref|XP_010422412.1|  PREDICTED: equilibrative nucleotide transpor...    518   4e-179   
ref|XP_002317251.2|  equilibrative nucleoside transporter family ...    517   1e-178   Populus trichocarpa [western balsam poplar]
ref|XP_010095856.1|  Equilibrative nucleoside transporter 4             517   2e-178   
ref|XP_009348012.1|  PREDICTED: equilibrative nucleotide transpor...    516   2e-178   
ref|XP_006582336.1|  PREDICTED: equilibrative nucleotide transpor...    516   3e-178   
ref|XP_004485692.1|  PREDICTED: equilibrative nucleotide transpor...    516   4e-178   
ref|NP_192420.2|  equilibrative nucleoside transporter 6                515   7e-178   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192423.1|  nucleoside transporter family protein                 515   7e-178   Arabidopsis thaliana [mouse-ear cress]
gb|KHG28896.1|  Equilibrative nucleoside transporter 4                  514   1e-177   
ref|XP_006383999.1|  equilibrative nucleoside transporter family ...    513   2e-177   
ref|XP_003562929.1|  PREDICTED: equilibrative nucleotide transpor...    514   3e-177   
ref|XP_006383998.1|  hypothetical protein POPTR_0004s03260g             513   3e-177   
gb|KEH17552.1|  equilibrative nucleoside transporter 6                  513   5e-177   
ref|XP_010667964.1|  PREDICTED: equilibrative nucleotide transpor...    513   8e-177   
ref|XP_011001157.1|  PREDICTED: equilibrative nucleotide transpor...    511   2e-176   
dbj|BAJ86894.1|  predicted protein                                      511   4e-176   
emb|CAN71841.1|  hypothetical protein VITISV_013398                     510   6e-176   Vitis vinifera
ref|XP_010431738.1|  PREDICTED: equilibrative nucleotide transpor...    510   8e-176   
ref|XP_008458960.1|  PREDICTED: equilibrative nucleotide transpor...    510   9e-176   
ref|XP_008458961.1|  PREDICTED: equilibrative nucleotide transpor...    509   1e-175   
ref|XP_008651542.1|  PREDICTED: nucleoside transporter isoform X2       509   4e-175   
ref|XP_008651543.1|  PREDICTED: nucleoside transporter isoform X1       508   4e-175   
ref|XP_009114508.1|  PREDICTED: equilibrative nucleotide transpor...    508   5e-175   
ref|XP_010422388.1|  PREDICTED: equilibrative nucleotide transpor...    508   8e-175   
gb|KEH36496.1|  equilibrative nucleoside transporter 6                  506   1e-174   
ref|XP_004957995.1|  PREDICTED: equilibrative nucleotide transpor...    507   1e-174   
ref|XP_004487344.1|  PREDICTED: equilibrative nucleotide transpor...    507   1e-174   
ref|XP_009353210.1|  PREDICTED: equilibrative nucleotide transpor...    507   2e-174   
ref|XP_009114501.1|  PREDICTED: equilibrative nucleotide transpor...    506   2e-174   
ref|XP_006286514.1|  hypothetical protein CARUB_v10001118mg             505   4e-174   
ref|XP_004957994.1|  PREDICTED: equilibrative nucleotide transpor...    506   4e-174   
ref|NP_001151494.1|  nucleoside transporter                             505   5e-174   Zea mays [maize]
ref|XP_009144518.1|  PREDICTED: equilibrative nucleotide transpor...    507   5e-174   
ref|XP_010431720.1|  PREDICTED: equilibrative nucleotide transpor...    505   6e-174   
emb|CDY46378.1|  BnaA09g19920D                                          505   8e-174   
ref|XP_006833131.1|  hypothetical protein AMTR_s00072p00092230          504   1e-173   
ref|XP_009626444.1|  PREDICTED: equilibrative nucleotide transpor...    503   1e-173   
emb|CDY46381.1|  BnaA09g19950D                                          504   3e-173   
gb|AFK42107.1|  unknown                                                 502   4e-173   
ref|XP_010538224.1|  PREDICTED: LOW QUALITY PROTEIN: equilibrativ...    503   7e-173   
ref|XP_009778597.1|  PREDICTED: equilibrative nucleotide transpor...    501   9e-173   
ref|XP_002874834.1|  hypothetical protein ARALYDRAFT_911782             502   9e-173   
ref|XP_010455846.1|  PREDICTED: equilibrative nucleotide transpor...    500   3e-172   
ref|XP_004507231.1|  PREDICTED: equilibrative nucleotide transpor...    501   3e-172   
gb|KCW76376.1|  hypothetical protein EUGRSUZ_D00755                     499   3e-172   
ref|XP_008379582.1|  PREDICTED: equilibrative nucleotide transpor...    500   4e-172   
ref|XP_004487345.1|  PREDICTED: equilibrative nucleotide transpor...    499   4e-172   
emb|CAB81053.1|  putative protein                                       500   4e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008379581.1|  PREDICTED: equilibrative nucleotide transpor...    499   7e-172   
ref|XP_010054388.1|  PREDICTED: equilibrative nucleotide transpor...    498   9e-172   
gb|KDO55800.1|  hypothetical protein CISIN_1g016029mg                   498   2e-171   
ref|XP_006447406.1|  hypothetical protein CICLE_v10015212mg             499   2e-171   
gb|KEH37809.1|  equilibrative nucleoside transporter 6                  500   3e-171   
ref|NP_192422.1|  equilibrative nucleoside transporter 4                498   4e-171   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396630.1|  hypothetical protein EUTSA_v10029389mg             498   5e-171   
ref|XP_010422386.1|  PREDICTED: equilibrative nucleotide transpor...    498   6e-171   
ref|XP_008357821.1|  PREDICTED: equilibrative nucleotide transpor...    497   9e-171   
ref|XP_004957997.1|  PREDICTED: equilibrative nucleotide transpor...    496   2e-170   
ref|XP_008813360.1|  PREDICTED: equilibrative nucleotide transpor...    494   6e-170   
gb|EPS58927.1|  hypothetical protein M569_15884                         493   6e-170   
ref|NP_001059966.1|  Os07g0557200                                       494   1e-169   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010455847.1|  PREDICTED: equilibrative nucleotide transpor...    493   3e-169   
emb|CDY59576.1|  BnaAnng16090D                                          492   9e-169   
emb|CAN67514.1|  hypothetical protein VITISV_012081                     502   1e-168   Vitis vinifera
gb|KEH36499.1|  equilibrative nucleoside transporter 6                  490   1e-168   
gb|KHN22884.1|  Equilibrative nucleoside transporter 4                  493   2e-168   
ref|XP_009112695.1|  PREDICTED: equilibrative nucleotide transpor...    490   3e-168   
ref|XP_010315560.1|  PREDICTED: equilibrative nucleotide transpor...    491   4e-168   
ref|XP_006657825.1|  PREDICTED: equilibrative nucleotide transpor...    490   5e-168   
ref|XP_009114505.1|  PREDICTED: equilibrative nucleotide transpor...    489   1e-167   
gb|KFK32223.1|  hypothetical protein AALP_AA6G213800                    489   2e-167   
ref|XP_002518004.1|  nucleoside transporter, putative                   488   2e-167   Ricinus communis
emb|CDY46380.1|  BnaA09g19940D                                          487   8e-167   
ref|XP_004309571.1|  PREDICTED: equilibrative nucleotide transpor...    486   4e-166   
ref|XP_010646356.1|  PREDICTED: equilibrative nucleotide transpor...    484   7e-166   
gb|KDO35790.1|  hypothetical protein CISIN_1g036062mg                   480   2e-165   
gb|KHG30348.1|  Equilibrative nucleoside transporter 1                  479   8e-165   
ref|XP_006407617.1|  hypothetical protein EUTSA_v10021957mg             481   2e-164   
ref|XP_004958001.1|  PREDICTED: equilibrative nucleotide transpor...    479   4e-164   
ref|XP_004957998.1|  PREDICTED: equilibrative nucleotide transpor...    480   6e-164   
ref|XP_006447407.1|  hypothetical protein CICLE_v10015212mg             481   1e-163   
ref|XP_010473376.1|  PREDICTED: equilibrative nucleotide transpor...    480   2e-163   
ref|XP_010418132.1|  PREDICTED: equilibrative nucleotide transpor...    478   2e-163   
ref|XP_010646358.1|  PREDICTED: equilibrative nucleotide transpor...    477   1e-162   
ref|XP_002888077.1|  hypothetical protein ARALYDRAFT_475164             476   3e-162   
ref|XP_010431739.1|  PREDICTED: equilibrative nucleotide transpor...    474   5e-162   
ref|XP_006301000.1|  hypothetical protein CARUB_v10021390mg             474   8e-162   
ref|XP_006391987.1|  hypothetical protein EUTSA_v10023866mg             474   1e-161   
ref|XP_010430177.1|  PREDICTED: equilibrative nucleotide transpor...    471   1e-160   
emb|CDX97307.1|  BnaA02g20980D                                          469   2e-160   
ref|XP_009348013.1|  PREDICTED: equilibrative nucleotide transpor...    468   4e-160   
ref|XP_008653214.1|  PREDICTED: equilibrative nucleotide transpor...    471   4e-160   
ref|XP_004485693.1|  PREDICTED: equilibrative nucleotide transpor...    468   6e-160   
emb|CDX91229.1|  BnaC02g26400D                                          469   8e-160   
tpg|DAA63091.1|  TPA: hypothetical protein ZEAMMB73_574425              469   3e-159   
ref|XP_009104893.1|  PREDICTED: equilibrative nucleotide transpor...    468   3e-159   
ref|NP_176357.2|  equilibrative nucleoside transporter 7                468   4e-159   Arabidopsis thaliana [mouse-ear cress]
gb|EEC82261.1|  hypothetical protein OsI_26456                          484   1e-158   Oryza sativa Indica Group [Indian rice]
emb|CDY48835.1|  BnaC01g43430D                                          466   2e-158   
gb|EMT16335.1|  Equilibrative nucleoside transporter 2                  463   4e-155   
gb|EEE67396.1|  hypothetical protein OsJ_24710                          455   1e-154   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010455849.1|  PREDICTED: equilibrative nucleotide transpor...    455   2e-154   
ref|XP_009114506.1|  PREDICTED: equilibrative nucleotide transpor...    453   1e-153   
ref|XP_010464659.1|  PREDICTED: equilibrative nucleotide transpor...    454   1e-153   
ref|XP_006300244.1|  hypothetical protein CARUB_v10016484mg             452   4e-153   
gb|KDP33783.1|  hypothetical protein JCGZ_07354                         449   2e-152   
ref|XP_010479616.1|  PREDICTED: equilibrative nucleotide transpor...    449   6e-152   
ref|XP_002982809.1|  hypothetical protein SELMODRAFT_179838             447   6e-151   
ref|XP_010052415.1|  PREDICTED: equilibrative nucleotide transpor...    442   4e-150   
ref|XP_002981842.1|  hypothetical protein SELMODRAFT_154779             444   5e-150   
ref|XP_007148260.1|  hypothetical protein PHAVU_006G193300g             441   6e-150   
ref|XP_002884769.1|  hypothetical protein ARALYDRAFT_478326             443   2e-149   
gb|KFK32224.1|  hypothetical protein AALP_AA6G213900                    438   5e-148   
ref|XP_006833132.1|  hypothetical protein AMTR_s00072p00094460          432   1e-146   
gb|AAL25095.1|AF426399_1  putative equilibrative nucleoside trans...    436   1e-146   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187610.1|  equilibrative nucleotide transporter 2                434   5e-146   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287796.1|  hypothetical protein CARUB_v10001007mg             434   1e-145   
gb|AAD25545.1|AC005850_2  Hypothetical protein                          430   8e-145   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010418131.1|  PREDICTED: equilibrative nucleotide transpor...    425   7e-143   
ref|XP_006396629.1|  hypothetical protein EUTSA_v10029294mg             421   4e-141   
ref|XP_010489734.1|  PREDICTED: equilibrative nucleotide transpor...    422   4e-141   
ref|XP_004492293.1|  PREDICTED: equilibrative nucleotide transpor...    423   5e-141   
gb|EMT28617.1|  Equilibrative nucleoside transporter 4                  425   6e-140   
ref|XP_009104859.1|  PREDICTED: equilibrative nucleotide transpor...    415   5e-139   
ref|XP_009104851.1|  PREDICTED: equilibrative nucleotide transpor...    415   4e-138   
gb|EEE67397.1|  hypothetical protein OsJ_24711                          408   3e-135   Oryza sativa Japonica Group [Japonica rice]
gb|KFK40683.1|  hypothetical protein AALP_AA2G027800                    405   6e-135   
ref|XP_006301710.1|  hypothetical protein CARUB_v10022167mg             402   2e-134   
ref|XP_001753057.1|  predicted protein                                  397   2e-131   
gb|AES60810.2|  equilibrative nucleoside transporter 6                  395   2e-130   
gb|KGN65073.1|  hypothetical protein Csa_1G192700                       389   2e-130   
ref|XP_010096801.1|  Equilibrative nucleoside transporter 4             388   3e-130   
ref|XP_008651747.1|  PREDICTED: hypothetical protein isoform X1         389   5e-128   
ref|XP_003590559.1|  Equilibrative nucleoside transporter               387   2e-127   
ref|XP_002992499.1|  hypothetical protein SELMODRAFT_135322             383   5e-126   
ref|XP_002990188.1|  hypothetical protein SELMODRAFT_185136             382   1e-125   
ref|XP_011015970.1|  PREDICTED: equilibrative nucleotide transpor...    388   6e-125   
gb|KEH17900.1|  equilibrative nucleoside transporter 6                  375   2e-123   
ref|XP_010473372.1|  PREDICTED: equilibrative nucleotide transpor...    374   2e-123   
ref|XP_010473371.1|  PREDICTED: equilibrative nucleotide transpor...    374   6e-123   
gb|KCW76379.1|  hypothetical protein EUGRSUZ_D00758                     367   2e-121   
ref|XP_010455851.1|  PREDICTED: equilibrative nucleotide transpor...    364   1e-120   
ref|XP_011047490.1|  PREDICTED: equilibrative nucleotide transpor...    363   9e-120   
ref|XP_001770741.1|  predicted protein                                  349   1e-112   
gb|AFN53707.1|  hypothetical protein                                    362   2e-112   
emb|CDY59577.1|  BnaAnng16100D                                          345   7e-112   
ref|XP_010473373.1|  PREDICTED: equilibrative nucleotide transpor...    340   5e-110   
emb|CDY15039.1|  BnaCnng04420D                                          338   3e-109   
gb|KCW76375.1|  hypothetical protein EUGRSUZ_D00754                     333   1e-104   
ref|XP_010473374.1|  PREDICTED: equilibrative nucleotide transpor...    323   5e-104   
ref|XP_010473375.1|  PREDICTED: equilibrative nucleotide transpor...    281   1e-87    
ref|XP_002980483.1|  hypothetical protein SELMODRAFT_112350             277   3e-85    
ref|XP_002962603.1|  hypothetical protein SELMODRAFT_78893              276   3e-85    
ref|XP_003636177.1|  Equilibrative nucleoside transporter               260   8e-81    
ref|XP_011043341.1|  PREDICTED: equilibrative nucleotide transpor...    258   1e-80    
ref|XP_004155658.1|  PREDICTED: equilibrative nucleotide transpor...    251   5e-78    
ref|NP_001059967.1|  Os07g0557400                                       254   7e-78    
dbj|BAD30919.1|  equilibrative nucleoside transporter(ENT3)-like ...    252   9e-78    
ref|NP_001169901.1|  hypothetical protein                               250   3e-76    
ref|XP_009345130.1|  PREDICTED: equilibrative nucleotide transpor...    243   1e-74    
gb|EEE67398.1|  hypothetical protein OsJ_24712                          226   2e-68    
emb|CDY48831.1|  BnaC01g43390D                                          221   4e-63    
emb|CDP19721.1|  unnamed protein product                                211   4e-62    
ref|XP_004487347.1|  PREDICTED: equilibrative nucleotide transpor...    207   3e-61    
ref|XP_002463011.1|  hypothetical protein SORBIDRAFT_02g036190          199   2e-57    
gb|KHN41173.1|  hypothetical protein glysoja_017217                     199   2e-56    
gb|KHG00701.1|  putative carboxylesterase 7 -like protein               187   4e-54    
emb|CDY70875.1|  BnaCnng70130D                                          187   3e-53    
gb|KGN49173.1|  hypothetical protein Csa_6G516810                       183   1e-52    
gb|KDP41895.1|  hypothetical protein JCGZ_26913                         184   4e-51    
gb|KDD75636.1|  hypothetical protein H632_c579p1                        184   9e-49    
gb|ACU18192.1|  unknown                                                 174   5e-48    
gb|ACU23814.1|  unknown                                                 165   7e-46    
gb|ABK96786.1|  unknown                                                 161   2e-44    
ref|XP_005843836.1|  hypothetical protein CHLNCDRAFT_37317              168   5e-44    
ref|XP_002319932.1|  hypothetical protein POPTR_0013s14510g             158   8e-43    
ref|XP_001760028.1|  predicted protein                                  162   2e-41    
ref|XP_002263287.1|  PREDICTED: equilibrative nucleotide transpor...    160   7e-41    
gb|KHN20421.1|  hypothetical protein glysoja_045898                     153   1e-40    
ref|XP_004228548.1|  PREDICTED: equilibrative nucleotide transpor...    160   1e-40    
gb|KHG27277.1|  Equilibrative nucleoside transporter 3                  159   2e-40    
ref|XP_004164886.1|  PREDICTED: equilibrative nucleotide transpor...    158   8e-40    
ref|XP_002985301.1|  hypothetical protein SELMODRAFT_446206             157   1e-39    
gb|EPS69876.1|  equilibrative nucleoside transporter 1                  157   1e-39    
ref|XP_004147175.1|  PREDICTED: equilibrative nucleotide transpor...    156   3e-39    
ref|XP_007222552.1|  hypothetical protein PRUPE_ppa006225mg             155   6e-39    
ref|XP_003636167.1|  Equilibrative nucleoside transporter               149   6e-39    
ref|XP_010037834.1|  PREDICTED: equilibrative nucleotide transpor...    155   6e-39    
gb|KEH17662.1|  equilibrative nucleoside transporter 6                  155   6e-39    
ref|XP_003539892.1|  PREDICTED: equilibrative nucleotide transpor...    155   7e-39    
ref|XP_008460712.1|  PREDICTED: equilibrative nucleotide transpor...    154   1e-38    
ref|XP_010100477.1|  Equilibrative nucleoside transporter 4             153   4e-38    
ref|XP_002970111.1|  hypothetical protein SELMODRAFT_92948              153   4e-38    
ref|XP_009363535.1|  PREDICTED: equilibrative nucleotide transpor...    152   7e-38    
ref|XP_006295563.1|  hypothetical protein CARUB_v10024670mg             151   2e-37    
ref|XP_008805174.1|  PREDICTED: equilibrative nucleotide transpor...    151   2e-37    
emb|CBX87929.1|  equilibrative nucleoside transporter 1                 151   2e-37    
ref|XP_003534378.1|  PREDICTED: equilibrative nucleotide transpor...    151   2e-37    
ref|XP_007131437.1|  hypothetical protein PHAVU_011G013500g             150   4e-37    
ref|XP_008221792.1|  PREDICTED: equilibrative nucleotide transpor...    150   4e-37    
ref|XP_008389631.1|  PREDICTED: equilibrative nucleotide transpor...    150   4e-37    
ref|XP_002525347.1|  nucleoside transporter, putative                   150   7e-37    
ref|XP_004139236.1|  PREDICTED: equilibrative nucleotide transpor...    149   1e-36    
ref|XP_007044544.1|  Nucleoside transporter, putative                   149   1e-36    
ref|XP_009781570.1|  PREDICTED: equilibrative nucleotide transpor...    149   1e-36    
ref|XP_006348522.1|  PREDICTED: equilibrative nucleotide transpor...    149   1e-36    
ref|XP_004516473.1|  PREDICTED: equilibrative nucleotide transpor...    149   1e-36    
ref|XP_010250136.1|  PREDICTED: equilibrative nucleotide transpor...    147   3e-36    
ref|XP_009625619.1|  PREDICTED: equilibrative nucleotide transpor...    147   3e-36    
ref|XP_006659926.1|  PREDICTED: equilibrative nucleotide transpor...    147   5e-36    
ref|XP_010510104.1|  PREDICTED: equilibrative nucleotide transpor...    147   5e-36    
gb|KFK41453.1|  hypothetical protein AALP_AA2G132400                    147   5e-36    
ref|XP_011008963.1|  PREDICTED: equilibrative nucleotide transpor...    147   7e-36    
ref|XP_004297638.1|  PREDICTED: equilibrative nucleotide transpor...    147   9e-36    
ref|XP_010471028.1|  PREDICTED: equilibrative nucleotide transpor...    146   1e-35    
gb|ACF86088.1|  unknown                                                 146   1e-35    
ref|NP_001148456.1|  nucleoside transporter                             146   1e-35    
ref|XP_004164395.1|  PREDICTED: LOW QUALITY PROTEIN: equilibrativ...    145   2e-35    
ref|XP_009127788.1|  PREDICTED: equilibrative nucleotide transpor...    145   3e-35    
ref|XP_010250408.1|  PREDICTED: equilibrative nucleotide transpor...    145   3e-35    
ref|XP_010908746.1|  PREDICTED: equilibrative nucleotide transpor...    144   5e-35    
ref|XP_010905297.1|  PREDICTED: equilibrative nucleotide transpor...    144   6e-35    
ref|XP_004135240.1|  PREDICTED: equilibrative nucleotide transpor...    144   6e-35    
dbj|BAD05331.1|  putative equilibrative nucleoside transporter EN...    142   8e-35    
ref|XP_010254429.1|  PREDICTED: equilibrative nucleotide transpor...    144   8e-35    
ref|XP_002887293.1|  hypothetical protein ARALYDRAFT_476156             144   1e-34    
ref|NP_001061232.2|  Os08g0205200                                       143   1e-34    
gb|EYU31275.1|  hypothetical protein MIMGU_mgv1a006999mg                143   2e-34    
ref|XP_010682571.1|  PREDICTED: equilibrative nucleotide transpor...    143   2e-34    
emb|CDY03754.1|  BnaA02g14830D                                          142   2e-34    
ref|XP_006302287.1|  hypothetical protein CARUB_v10020331mg             142   3e-34    
emb|CDY57306.1|  BnaCnng31790D                                          142   3e-34    
ref|XP_003573527.1|  PREDICTED: equilibrative nucleotide transpor...    142   3e-34    
ref|XP_008446220.1|  PREDICTED: equilibrative nucleotide transpor...    142   4e-34    
ref|XP_010427805.1|  PREDICTED: equilibrative nucleotide transpor...    142   4e-34    
ref|XP_006390897.1|  hypothetical protein EUTSA_v10018596mg             142   5e-34    
ref|XP_001758353.1|  predicted protein                                  141   5e-34    
ref|XP_010415710.1|  PREDICTED: equilibrative nucleotide transpor...    141   6e-34    
gb|KEH36492.1|  equilibrative nucleoside transporter                    132   6e-34    
ref|XP_006842057.1|  hypothetical protein AMTR_s00078p00034680          140   1e-33    
gb|KDP26570.1|  hypothetical protein JCGZ_17728                         140   1e-33    
ref|XP_008345953.1|  PREDICTED: uncharacterized protein LOC103408913    141   2e-33    
ref|XP_002445204.1|  hypothetical protein SORBIDRAFT_07g005850          139   4e-33    
gb|AAC18807.1|  Contains similarity to equilibratiave nucleoside ...    139   6e-33    
gb|EMT04125.1|  hypothetical protein F775_52121                         139   6e-33    
ref|NP_564987.2|  equilibrative nucleotide transporter 1                139   7e-33    
ref|XP_009591156.1|  PREDICTED: equilibrative nucleotide transpor...    138   7e-33    
ref|XP_008242783.1|  PREDICTED: equilibrative nucleotide transpor...    138   7e-33    
ref|XP_006305036.1|  hypothetical protein CARUB_v10009401mg             137   8e-33    
ref|XP_009381099.1|  PREDICTED: equilibrative nucleotide transpor...    139   9e-33    
ref|XP_009409002.1|  PREDICTED: equilibrative nucleotide transpor...    138   9e-33    
ref|XP_010533125.1|  PREDICTED: equilibrative nucleotide transpor...    138   1e-32    
ref|XP_011086552.1|  PREDICTED: equilibrative nucleotide transpor...    138   1e-32    
emb|CDP10423.1|  unnamed protein product                                137   1e-32    
gb|EMS65737.1|  Equilibrative nucleoside transporter 4                  136   2e-32    
ref|XP_009783593.1|  PREDICTED: equilibrative nucleotide transpor...    137   2e-32    
ref|XP_010457245.1|  PREDICTED: equilibrative nucleotide transpor...    136   3e-32    
ref|XP_002282211.1|  PREDICTED: equilibrative nucleotide transpor...    136   3e-32    
gb|AAF26446.1|AF220759_1  putative nucleoside transporter               136   3e-32    
ref|XP_010551565.1|  PREDICTED: equilibrative nucleotide transpor...    136   3e-32    
ref|XP_002525348.1|  nucleoside transporter, putative                   136   3e-32    
ref|XP_010682572.1|  PREDICTED: equilibrative nucleotide transpor...    136   4e-32    
ref|XP_006844766.1|  hypothetical protein AMTR_s00016p00258200          135   5e-32    
ref|XP_007203882.1|  hypothetical protein PRUPE_ppa006678mg             135   6e-32    
gb|ABK92442.1|  unknown                                                 135   8e-32    
ref|XP_006659925.1|  PREDICTED: equilibrative nucleotide transpor...    134   1e-31    
ref|XP_010474673.1|  PREDICTED: equilibrative nucleotide transpor...    134   1e-31    
ref|XP_010654791.1|  PREDICTED: equilibrative nucleotide transpor...    134   2e-31    
ref|XP_006438419.1|  hypothetical protein CICLE_v10031626mg             134   3e-31    
ref|XP_003057437.1|  equilibrative nucleoside transporter family        133   3e-31    
ref|XP_006483831.1|  PREDICTED: equilibrative nucleotide transpor...    134   3e-31    
ref|XP_010431470.1|  PREDICTED: equilibrative nucleotide transpor...    130   4e-31    
gb|ABK95492.1|  unknown                                                 126   5e-31    
emb|CDP00175.1|  unnamed protein product                                132   5e-31    
ref|XP_010535863.1|  PREDICTED: equilibrative nucleotide transpor...    132   8e-31    
ref|XP_008342009.1|  PREDICTED: equilibrative nucleotide transpor...    132   9e-31    
gb|EPS72984.1|  hypothetical protein M569_01770                         131   1e-30    
ref|XP_008376976.1|  PREDICTED: equilibrative nucleotide transpor...    125   2e-30    
ref|XP_010047954.1|  PREDICTED: equilibrative nucleotide transpor...    130   2e-30    
ref|XP_010048077.1|  PREDICTED: equilibrative nucleotide transpor...    130   2e-30    
gb|KHN11717.1|  Equilibrative nucleoside transporter 4                  127   3e-30    
ref|XP_010501287.1|  PREDICTED: equilibrative nucleotide transpor...    130   3e-30    
gb|KFM22472.1|  Equilibrative nucleoside transporter 4                  130   4e-30    
ref|XP_009364017.1|  PREDICTED: equilibrative nucleotide transpor...    129   5e-30    
ref|XP_006475859.1|  PREDICTED: equilibrative nucleotide transpor...    129   5e-30    
ref|XP_006450911.1|  hypothetical protein CICLE_v10008549mg             129   6e-30    
ref|XP_009368865.1|  PREDICTED: equilibrative nucleotide transpor...    129   8e-30    
ref|XP_008456013.1|  PREDICTED: equilibrative nucleotide transpor...    129   1e-29    
ref|XP_004150028.1|  PREDICTED: equilibrative nucleotide transpor...    128   1e-29    
ref|XP_008443982.1|  PREDICTED: equilibrative nucleotide transpor...    128   2e-29    
gb|KEH34150.1|  equilibrative nucleoside transporter                    128   2e-29    
ref|XP_006418322.1|  hypothetical protein EUTSA_v10007870mg             127   2e-29    
ref|XP_002318561.1|  equilibrative nucleotide transporter 1 famil...    127   3e-29    
ref|XP_004972610.1|  PREDICTED: equilibrative nucleotide transpor...    127   4e-29    
gb|KDO82479.1|  hypothetical protein CISIN_1g014329mg                   127   4e-29    
ref|XP_006438417.1|  hypothetical protein CICLE_v10031626mg             127   4e-29    
ref|NP_171763.1|  equilibrative nucleotide transporter 8                126   7e-29    
gb|KFK42619.1|  hypothetical protein AALP_AA1G018900                    126   7e-29    
ref|XP_002502098.1|  equilibrative nucleoside transporter family        125   1e-28    
ref|XP_004243031.1|  PREDICTED: equilibrative nucleotide transpor...    125   1e-28    
ref|XP_008376977.1|  PREDICTED: equilibrative nucleotide transpor...    120   1e-28    
ref|XP_002892115.1|  hypothetical protein ARALYDRAFT_470221             125   2e-28    
ref|XP_010105223.1|  Equilibrative nucleoside transporter 4             125   2e-28    
ref|XP_008366687.1|  PREDICTED: equilibrative nucleotide transpor...    119   3e-28    
ref|XP_006358278.1|  PREDICTED: equilibrative nucleotide transpor...    124   5e-28    
ref|XP_009111194.1|  PREDICTED: equilibrative nucleotide transpor...    122   1e-27    
ref|XP_004972611.1|  PREDICTED: equilibrative nucleotide transpor...    122   2e-27    
ref|XP_004288800.1|  PREDICTED: equilibrative nucleotide transpor...    122   2e-27    
emb|CDY51304.1|  BnaCnng20490D                                          122   2e-27    
ref|XP_008337283.1|  PREDICTED: equilibrative nucleotide transpor...    121   3e-27    
ref|XP_007013475.1|  Equilibrative nucleoside transporter               121   4e-27    
gb|KHN32391.1|  Equilibrative nucleoside transporter 4                  121   5e-27    
ref|XP_009788468.1|  PREDICTED: equilibrative nucleotide transpor...    120   6e-27    
ref|XP_008385508.1|  PREDICTED: equilibrative nucleotide transpor...    120   8e-27    
emb|CDY15043.1|  BnaCnng04460D                                          114   8e-27    
ref|XP_009625266.1|  PREDICTED: equilibrative nucleotide transpor...    120   1e-26    
gb|KGN60805.1|  hypothetical protein Csa_2G010400                       112   6e-25    
gb|AAG10625.1|AC022521_3  Hypothetical protein                          114   6e-25    
ref|XP_004346040.1|  Solute carrier family 29 (nucleoside transpo...    114   1e-24    
ref|XP_002324649.2|  hypothetical protein POPTR_0018s13010g             113   1e-24    
ref|XP_002308075.2|  equilibrative nucleoside transporter family ...    112   4e-24    
ref|XP_011020142.1|  PREDICTED: equilibrative nucleotide transpor...    110   1e-23    
ref|XP_011017774.1|  PREDICTED: equilibrative nucleotide transpor...    110   1e-23    
ref|XP_011015555.1|  PREDICTED: equilibrative nucleotide transpor...    109   3e-23    
ref|XP_004508483.1|  PREDICTED: equilibrative nucleotide transpor...    108   6e-23    
ref|XP_011078404.1|  PREDICTED: equilibrative nucleotide transpor...    107   1e-22    
ref|XP_003609351.1|  Equilibrative nucleoside transporter               105   6e-22    
ref|XP_007155016.1|  hypothetical protein PHAVU_003G166000g             104   2e-21    
ref|XP_002527203.1|  nucleoside transporter, putative                   102   3e-21    
ref|XP_003541496.1|  PREDICTED: equilibrative nucleotide transpor...    103   4e-21    
gb|EPS72985.1|  equilibrative nucleoside transporter 1                  103   5e-21    
ref|XP_003549756.1|  PREDICTED: equilibrative nucleotide transpor...    102   8e-21    
ref|XP_009119776.1|  PREDICTED: LOW QUALITY PROTEIN: equilibrativ...    100   7e-20    
gb|KEH36493.1|  equilibrative nucleoside transporter, putative        94.7    1e-19    
ref|XP_010687963.1|  PREDICTED: equilibrative nucleotide transpor...  99.0    2e-19    
ref|XP_004362528.1|  equilibrative nucleoside transporter family ...  95.1    8e-18    
ref|XP_003294313.1|  hypothetical protein DICPUDRAFT_84795            88.2    8e-16    
gb|KFM22471.1|  Equilibrative nucleoside transporter 4                88.6    1e-15    
gb|EAZ05971.1|  hypothetical protein OsI_28212                        83.2    3e-15    
emb|CDX89956.1|  BnaA10g01260D                                        86.3    3e-15    
emb|CDY15254.1|  BnaC05g01330D                                        85.5    6e-15    
gb|KDO82477.1|  hypothetical protein CISIN_1g014329mg                 82.8    6e-14    
ref|XP_006438418.1|  hypothetical protein CICLE_v10031626mg           82.8    6e-14    
ref|XP_002673797.1|  equilibrative nucleoside transporter             82.0    2e-13    
emb|CBI32138.3|  unnamed protein product                              79.7    2e-13    
gb|KHN43760.1|  hypothetical protein glysoja_041027                   75.5    2e-12    
gb|KDP32421.1|  hypothetical protein JCGZ_13346                       73.6    8e-12    
gb|KEH36494.1|  transmembrane protein, putative                       71.6    2e-11    
gb|KGN65072.1|  hypothetical protein Csa_1G192690                     70.5    2e-11    
gb|EJY77029.1|  Equilibrative nucleoside transporter family protein   75.9    2e-11    
gb|AFK40599.1|  unknown                                               72.8    2e-11    
gb|KEH36495.1|  equilibrative nucleoside transporter                  68.6    7e-11    
ref|XP_010457246.1|  PREDICTED: equilibrative nucleotide transpor...  72.4    1e-10    
gb|EPS66756.1|  hypothetical protein M569_08020                       67.0    2e-10    
ref|XP_010474674.1|  PREDICTED: equilibrative nucleotide transpor...  71.6    2e-10    
dbj|GAM23167.1|  hypothetical protein SAMD00019534_063420             72.0    3e-10    
ref|XP_004365054.1|  predicted protein                                72.0    3e-10    
ref|XP_002953588.1|  hypothetical protein VOLCADRAFT_94371            72.4    3e-10    
ref|NP_001016110.1|  solute carrier family 29 (equilibrative nucl...  70.9    6e-10    
emb|CBI28212.3|  unnamed protein product                              70.1    7e-10    
ref|XP_816601.1|  nucleoside transporter-like                         70.9    7e-10    
ref|NP_001085988.1|  solute carrier family 29 (equilibrative nucl...  70.1    1e-09    
gb|EFA85029.1|  equilibrative nucleoside transporter family protein   68.9    2e-09    
ref|XP_819804.1|  nucleoside transporter-like                         67.4    7e-09    
gb|AFW62139.1|  hypothetical protein ZEAMMB73_644506                  66.6    8e-09    
ref|NP_001030934.1|  equilibrative nucleotide transporter 8           66.6    1e-08    
ref|XP_001638970.1|  predicted protein                                66.6    1e-08    
ref|XP_002590170.1|  hypothetical protein BRAFLDRAFT_90905            65.5    3e-08    
gb|EKG07196.1|  nucleoside transporter-like, putative                 65.1    5e-08    
ref|XP_010133502.1|  PREDICTED: equilibrative nucleoside transpor...  64.7    6e-08    
ref|XP_005844901.1|  hypothetical protein CHLNCDRAFT_138452           63.9    6e-08    
gb|EMS55997.1|  hypothetical protein TRIUR3_24154                     59.7    7e-08    
gb|ESL09448.1|  nucleobase transporter                                64.3    7e-08    
ref|XP_002324650.1|  equilibrative nucleoside transporter family ...  61.2    1e-07    
ref|XP_009842791.1|  hypothetical protein H257_16142                  63.9    1e-07    
emb|CBH09655.1|  adenosine transporter 2, putative                    63.2    2e-07    
emb|CDO74637.1|  hypothetical protein BN946_scf184325.g24             63.2    2e-07    



>ref|XP_009790594.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009790595.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009790596.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Nicotiana sylvestris]
Length=421

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/390 (79%), Positives = 350/390 (90%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNS+L+IGDYYY L+P YHPSRVLTLVYQPFA+GT+A+LAY   K++TR RNLAGY
Sbjct  32    SLVSWNSLLSIGDYYYALYPNYHPSRVLTLVYQPFALGTMALLAYNEAKVDTRMRNLAGY  91

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              +F L TF+L++LDL TSGKGGLGNYIG+C IV +FGVADAHVQGG+VGDLSFMCPEF+Q
Sbjct  92    TVFTLSTFSLIVLDLATSGKGGLGNYIGVCAIVGTFGVADAHVQGGMVGDLSFMCPEFIQ  151

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFLAGLAASG LTSGLRL+TKAAFE+SSNGLRKGV+LFLA+STFFEFLCI+LYAF+FPKL
Sbjct  152   SFLAGLAASGALTSGLRLMTKAAFENSSNGLRKGVMLFLAISTFFEFLCILLYAFIFPKL  211

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPS--ESVDDAKHVERVSNKKLFMENIDYALD  714
              IVK+YR KAA EGS TVAADLAAAGI      ++ DDAK ++R+S K+LF +NIDYALD
Sbjct  212   PIVKHYRTKAAGEGSTTVAADLAAAGIQTQQIEKAGDDAKQLQRLSTKQLFFQNIDYALD  271

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             LYLIYV+TLSIFPGFLYENTGTH LGSWY  VL+AMYN+WDLI+RYIPLI+K++LKSRKG
Sbjct  272   LYLIYVLTLSIFPGFLYENTGTHKLGSWYALVLIAMYNVWDLIARYIPLIEKIKLKSRKG  331

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LMIA  SRFLLIPCFYFTAKYGDQGWMI LVSFLGLTNGYLTVCV+T AP+GYKGP  NA
Sbjct  332   LMIATLSRFLLIPCFYFTAKYGDQGWMIFLVSFLGLTNGYLTVCVMTVAPQGYKGPEQNA  391

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGNILVL LL GIFSGVALDWLW+IGN  F
Sbjct  392   LGNILVLFLLGGIFSGVALDWLWIIGNGKF  421



>ref|XP_009790593.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Nicotiana sylvestris]
Length=459

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/390 (79%), Positives = 350/390 (90%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNS+L+IGDYYY L+P YHPSRVLTLVYQPFA+GT+A+LAY   K++TR RNLAGY
Sbjct  70    SLVSWNSLLSIGDYYYALYPNYHPSRVLTLVYQPFALGTMALLAYNEAKVDTRMRNLAGY  129

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              +F L TF+L++LDL TSGKGGLGNYIG+C IV +FGVADAHVQGG+VGDLSFMCPEF+Q
Sbjct  130   TVFTLSTFSLIVLDLATSGKGGLGNYIGVCAIVGTFGVADAHVQGGMVGDLSFMCPEFIQ  189

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFLAGLAASG LTSGLRL+TKAAFE+SSNGLRKGV+LFLA+STFFEFLCI+LYAF+FPKL
Sbjct  190   SFLAGLAASGALTSGLRLMTKAAFENSSNGLRKGVMLFLAISTFFEFLCILLYAFIFPKL  249

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPS--ESVDDAKHVERVSNKKLFMENIDYALD  714
              IVK+YR KAA EGS TVAADLAAAGI      ++ DDAK ++R+S K+LF +NIDYALD
Sbjct  250   PIVKHYRTKAAGEGSTTVAADLAAAGIQTQQIEKAGDDAKQLQRLSTKQLFFQNIDYALD  309

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             LYLIYV+TLSIFPGFLYENTGTH LGSWY  VL+AMYN+WDLI+RYIPLI+K++LKSRKG
Sbjct  310   LYLIYVLTLSIFPGFLYENTGTHKLGSWYALVLIAMYNVWDLIARYIPLIEKIKLKSRKG  369

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LMIA  SRFLLIPCFYFTAKYGDQGWMI LVSFLGLTNGYLTVCV+T AP+GYKGP  NA
Sbjct  370   LMIATLSRFLLIPCFYFTAKYGDQGWMIFLVSFLGLTNGYLTVCVMTVAPQGYKGPEQNA  429

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGNILVL LL GIFSGVALDWLW+IGN  F
Sbjct  430   LGNILVLFLLGGIFSGVALDWLWIIGNGKF  459



>ref|XP_009589135.1| PREDICTED: equilibrative nucleotide transporter 3-like [Nicotiana 
tomentosiformis]
 ref|XP_009589136.1| PREDICTED: equilibrative nucleotide transporter 3-like [Nicotiana 
tomentosiformis]
Length=421

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/390 (80%), Positives = 349/390 (89%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNS+L+IGDYYY L+P YHPSRVLTLVYQPFA+GT+A+LAY   K++TR RNLAGY
Sbjct  32    SLVSWNSLLSIGDYYYALYPNYHPSRVLTLVYQPFALGTMALLAYNEAKVDTRMRNLAGY  91

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LF L TF L++LDL TSGKGGLGNYIG+C IV +FGVADAHVQGG+VGDLSFMCPEF+Q
Sbjct  92    TLFTLSTFLLIVLDLATSGKGGLGNYIGVCAIVGTFGVADAHVQGGMVGDLSFMCPEFIQ  151

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFLAGLAASG LTSGLRL+TKAAFE+SSNGLRKGV+LFLA+STFFEFLCI+LYAF+FPKL
Sbjct  152   SFLAGLAASGALTSGLRLLTKAAFENSSNGLRKGVMLFLAISTFFEFLCILLYAFIFPKL  211

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESV-DDAKHVERVSNKKLFMENIDYALD  714
              IVK+YR KAA EGS TVAADLAAAGI T P E   DDAK ++R+S K+LF +NIDYALD
Sbjct  212   PIVKHYRTKAAGEGSTTVAADLAAAGIQTQPIEKAGDDAKQLQRLSTKQLFFQNIDYALD  271

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             LYLIYV+TLSIFPGFLYEN+GTH LGSWY  VL+AMYN+WDLI+R IPLI+K++LKSRKG
Sbjct  272   LYLIYVLTLSIFPGFLYENSGTHKLGSWYALVLIAMYNVWDLIARCIPLIEKIKLKSRKG  331

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LMIA  SRFLLIPCFYFTAKYGDQGWMI LVSFLGLTNGYLTVCV+T AP+GYKGP  NA
Sbjct  332   LMIATLSRFLLIPCFYFTAKYGDQGWMIFLVSFLGLTNGYLTVCVMTVAPQGYKGPEQNA  391

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGNILVL LL GIFSGV+LDWLW+IGN  F
Sbjct  392   LGNILVLFLLGGIFSGVSLDWLWIIGNGKF  421



>emb|CDO99651.1| unnamed protein product [Coffea canephora]
Length=420

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/389 (81%), Positives = 349/389 (90%), Gaps = 1/389 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTIGDYYY LFP YHPSRVLTLVYQPFA+GT+A LAY   +++TRKRNLAGY
Sbjct  32    SLVSWNSMLTIGDYYYALFPHYHPSRVLTLVYQPFAVGTVATLAYNEARIDTRKRNLAGY  91

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFFL T ALLLLDLGTSGKGGLGNYIGIC++VA+FGVADAHVQGG+VGDLS MCPEF+Q
Sbjct  92    TLFFLSTLALLLLDLGTSGKGGLGNYIGICILVAAFGVADAHVQGGMVGDLSLMCPEFIQ  151

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFLAGLAASG LTS LRL+TKAAFE+S+NGLRKGVILFLA+S FFEFLCI+LYAF+FPKL
Sbjct  152   SFLAGLAASGALTSALRLMTKAAFENSNNGLRKGVILFLAISIFFEFLCILLYAFIFPKL  211

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDL  717
              IVK+YRAKAASEGSKTV+ADLAAAGI T  +E+VDD K+ ER+S K+L  +N DYALD+
Sbjct  212   PIVKHYRAKAASEGSKTVSADLAAAGIQTEANETVDDDKYPERLSTKQLLFQNFDYALDV  271

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             YLIYV+TLSIFPGFLYENTG H LGSWY  VL+AMYN WDL+SRYIPL++ ++LKSRKGL
Sbjct  272   YLIYVLTLSIFPGFLYENTGHHKLGSWYAVVLIAMYNAWDLVSRYIPLMECLKLKSRKGL  331

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             M+A  SRF LIPCFYFTAKYGDQGWMI L SFLGLTNGYLTVCVLTAAPKGYKGP  NAL
Sbjct  332   MLATLSRFFLIPCFYFTAKYGDQGWMIFLTSFLGLTNGYLTVCVLTAAPKGYKGPEQNAL  391

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             GN+LV+ LL GIFSGVALDWLWLIGN  F
Sbjct  392   GNLLVVFLLGGIFSGVALDWLWLIGNRKF  420



>ref|XP_011086142.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Sesamum indicum]
Length=419

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/389 (80%), Positives = 346/389 (89%), Gaps = 2/389 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTIGDYYYQLFP YHPSRVLTLVYQPFA+GTIAILAY   K++TRKRNL GY
Sbjct  32    SLVSWNSMLTIGDYYYQLFPDYHPSRVLTLVYQPFALGTIAILAYNEAKIDTRKRNLFGY  91

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILFFL TF LLL+DLGTSGKGG+ NYIGICV VA+FGVADAHVQGG+VGDLSFM PEF+Q
Sbjct  92    ILFFLSTFGLLLIDLGTSGKGGIANYIGICVFVAAFGVADAHVQGGMVGDLSFMSPEFMQ  151

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGLAASG LTSGLRL+TKAAF+   NGLRKGV+LFLA+STFFEFLCI+LYAFVF +L
Sbjct  152   SFFAGLAASGALTSGLRLITKAAFDKLDNGLRKGVMLFLAISTFFEFLCILLYAFVFGRL  211

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVD-DAKHVERVSNKKLFMENIDYALDL  717
              IVKY+R KAASEGSKTV ADLAAAG+     S D DAKH ER+SNK+L  +NIDYAL+L
Sbjct  212   PIVKYFRKKAASEGSKTVKADLAAAGVQKTESSADGDAKH-ERLSNKQLLRQNIDYALNL  270

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             YLIYV+TLSIFPGFLYENTG H LGSWY  VL+AMYN+WDLISRYIPLI+ + L+SRKGL
Sbjct  271   YLIYVLTLSIFPGFLYENTGHHQLGSWYAVVLIAMYNVWDLISRYIPLIECIRLESRKGL  330

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             MI+  +RFLLIPCFYFTAKYGDQGWMIMLVSFLGL+NGYLTVCVLTAAPKGYK P  NAL
Sbjct  331   MISCLARFLLIPCFYFTAKYGDQGWMIMLVSFLGLSNGYLTVCVLTAAPKGYKAPEQNAL  390

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             GN+LV+ LL+GIFSGVALDWLW+IGN  F
Sbjct  391   GNLLVMFLLAGIFSGVALDWLWIIGNGTF  419



>ref|XP_011086138.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Sesamum indicum]
 ref|XP_011086139.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Sesamum indicum]
 ref|XP_011086140.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Sesamum indicum]
 ref|XP_011086141.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Sesamum indicum]
Length=425

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/395 (79%), Positives = 348/395 (88%), Gaps = 8/395 (2%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTIGDYYYQLFP YHPSRVLTLVYQPFA+GTIAILAY   K++TRKRNL GY
Sbjct  32    SLVSWNSMLTIGDYYYQLFPDYHPSRVLTLVYQPFALGTIAILAYNEAKIDTRKRNLFGY  91

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILFFL TF LLL+DLGTSGKGG+ NYIGICV VA+FGVADAHVQGG+VGDLSFM PEF+Q
Sbjct  92    ILFFLSTFGLLLIDLGTSGKGGIANYIGICVFVAAFGVADAHVQGGMVGDLSFMSPEFMQ  151

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGLAASG LTSGLRL+TKAAF+   NGLRKGV+LFLA+STFFEFLCI+LYAFVF +L
Sbjct  152   SFFAGLAASGALTSGLRLITKAAFDKLDNGLRKGVMLFLAISTFFEFLCILLYAFVFGRL  211

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-----TAP--SESVDDAKHVERVSNKKLFMENI  699
              IVKY+R KAASEGSKTV ADLAAAG+     +AP  S    DAKH ER+SNK+L  +NI
Sbjct  212   PIVKYFRKKAASEGSKTVKADLAAAGVQKTESSAPLLSSQDGDAKH-ERLSNKQLLRQNI  270

Query  700   DYALDLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVEL  879
             DYAL+LYLIYV+TLSIFPGFLYENTG H LGSWY  VL+AMYN+WDLISRYIPLI+ + L
Sbjct  271   DYALNLYLIYVLTLSIFPGFLYENTGHHQLGSWYAVVLIAMYNVWDLISRYIPLIECIRL  330

Query  880   KSRKGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKG  1059
             +SRKGLMI+  +RFLLIPCFYFTAKYGDQGWMIMLVSFLGL+NGYLTVCVLTAAPKGYK 
Sbjct  331   ESRKGLMISCLARFLLIPCFYFTAKYGDQGWMIMLVSFLGLSNGYLTVCVLTAAPKGYKA  390

Query  1060  PAANALGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             P  NALGN+LV+ LL+GIFSGVALDWLW+IGN  F
Sbjct  391   PEQNALGNLLVMFLLAGIFSGVALDWLWIIGNGTF  425



>emb|CDO99653.1| unnamed protein product [Coffea canephora]
Length=420

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/389 (79%), Positives = 345/389 (89%), Gaps = 1/389 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTIGDYYY LFP YHPSRVLTLVYQPFA+GT+A LAY   +++TR RNLAGY
Sbjct  32    SLVSWNSMLTIGDYYYALFPHYHPSRVLTLVYQPFAVGTVATLAYNEARIDTRMRNLAGY  91

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFFL T ALLLLDLGTSGKGGLGNYIGIC++VA+FGVADAHVQGG+VGDLS MCPEF+Q
Sbjct  92    TLFFLSTLALLLLDLGTSGKGGLGNYIGICILVAAFGVADAHVQGGMVGDLSLMCPEFIQ  151

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S+LAG AASG LTS LRL+TKAAFE+S+NGLRKGVILFLA+STFFEFLCI+LYAF FPKL
Sbjct  152   SYLAGHAASGALTSTLRLMTKAAFENSNNGLRKGVILFLAISTFFEFLCILLYAFFFPKL  211

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDL  717
              IVK+YRAKAASEGSKTV ADLAAAGI T  +E+VDD K+ ER+S K+L  +N DYALDL
Sbjct  212   PIVKHYRAKAASEGSKTVLADLAAAGIQTEANETVDDDKYPERLSTKQLLFQNFDYALDL  271

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             YLIYV+TLSIFPGFLYENTG H LGSWY  VL+AMYN WDL+SRYIPL++ ++LKSRKGL
Sbjct  272   YLIYVLTLSIFPGFLYENTGHHKLGSWYAVVLIAMYNAWDLVSRYIPLMECLKLKSRKGL  331

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             M+A  SRF LIPCFYFTAKYGDQGWMI L SFLGLTNGYLTVCVLTAAPKG+KGP  NAL
Sbjct  332   MLATLSRFFLIPCFYFTAKYGDQGWMIFLTSFLGLTNGYLTVCVLTAAPKGHKGPEQNAL  391

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             GN+LV+ LL G+ SGVAL+WLWLIGN  F
Sbjct  392   GNLLVVFLLGGVCSGVALNWLWLIGNGKF  420



>ref|XP_006347157.1| PREDICTED: equilibrative nucleotide transporter 3-like [Solanum 
tuberosum]
Length=421

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/390 (79%), Positives = 347/390 (89%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNS+L+IGDYYY LFP YHPSRVLTLVYQPFA+GT+AILAY   K++TRKRNLAGY
Sbjct  32    SLVSWNSLLSIGDYYYALFPDYHPSRVLTLVYQPFALGTMAILAYNEAKVDTRKRNLAGY  91

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF L T AL++LDL TSG GG+GNYIGIC IV  FGVADAHVQGG+VGDL+FMCPEF+Q
Sbjct  92    ILFTLSTVALIVLDLATSGTGGIGNYIGICFIVGCFGVADAHVQGGMVGDLAFMCPEFMQ  151

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF  GLAASG LTSGLRL+TKAAF +S++G RKGV+LFLA+S FFEFLCI+LYAF+FPKL
Sbjct  152   SFFGGLAASGALTSGLRLITKAAFGNSNHGFRKGVMLFLAISAFFEFLCILLYAFIFPKL  211

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVD-DAKHVERVSNKKLFMENIDYALD  714
              IVK+YR+KAA+EGS TVAADLAAAGI   P E  + DAK  ER++ K+L ++NIDY L+
Sbjct  212   PIVKHYRSKAAAEGSTTVAADLAAAGIGIQPMEKANNDAKQSERLTTKQLLLKNIDYELN  271

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             LYLIYV+TLSIFPGFLYENTGTH LGSWYP VL+AMYN+WDLI RY+PLIKK+ELKSRKG
Sbjct  272   LYLIYVLTLSIFPGFLYENTGTHQLGSWYPLVLIAMYNVWDLIGRYVPLIKKIELKSRKG  331

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LMIA  SRFLLIPCFYFTAKYGDQGWMI LVSFLGLTNGYLTVCV+TAAPKGYKGP ANA
Sbjct  332   LMIATLSRFLLIPCFYFTAKYGDQGWMIFLVSFLGLTNGYLTVCVMTAAPKGYKGPEANA  391

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN+LVL LL+GIFSGVALDWLW+IGN  F
Sbjct  392   LGNLLVLFLLAGIFSGVALDWLWIIGNGKF  421



>ref|XP_004232785.1| PREDICTED: equilibrative nucleotide transporter 3-like [Solanum 
lycopersicum]
 ref|XP_010316651.1| PREDICTED: equilibrative nucleotide transporter 3-like [Solanum 
lycopersicum]
 ref|XP_010316652.1| PREDICTED: equilibrative nucleotide transporter 3-like [Solanum 
lycopersicum]
 ref|XP_010316653.1| PREDICTED: equilibrative nucleotide transporter 3-like [Solanum 
lycopersicum]
 ref|XP_010316654.1| PREDICTED: equilibrative nucleotide transporter 3-like [Solanum 
lycopersicum]
 ref|XP_010316655.1| PREDICTED: equilibrative nucleotide transporter 3-like [Solanum 
lycopersicum]
 ref|XP_010316656.1| PREDICTED: equilibrative nucleotide transporter 3-like [Solanum 
lycopersicum]
 ref|XP_010316657.1| PREDICTED: equilibrative nucleotide transporter 3-like [Solanum 
lycopersicum]
Length=421

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/390 (78%), Positives = 348/390 (89%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNS+L+IGDYYY LFP YHPSRVLTLVYQPFA+GT+AILAY   K++TRKRNLAGY
Sbjct  32    SLVSWNSLLSIGDYYYALFPDYHPSRVLTLVYQPFALGTMAILAYNEAKVDTRKRNLAGY  91

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             +LF L T AL++LDL TSG+GG+GNYIGIC IV  FGVADAHVQGG+VGD++FMCPEF+Q
Sbjct  92    VLFTLSTVALIVLDLATSGRGGIGNYIGICFIVGCFGVADAHVQGGMVGDIAFMCPEFMQ  151

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF  G+AASG LTSGLRL+TKAAFE+S+NGLRKGV+LFLA+S FFEFLCI+LY+FVFPKL
Sbjct  152   SFFGGVAASGALTSGLRLITKAAFENSNNGLRKGVMLFLAISAFFEFLCILLYSFVFPKL  211

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVD-DAKHVERVSNKKLFMENIDYALD  714
              IVK+YR+KAA+EGS TVAADLAAAGI   P E  + DAK  ER++ K+L ++NIDY L+
Sbjct  212   PIVKHYRSKAAAEGSTTVAADLAAAGIGIQPMEKANNDAKQSERLTTKQLLLQNIDYELN  271

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             LYLIYV+TLSIFPGFLYENTGTH LGSWYP VL+AMYN+WDLI RY+PLIKK+EL+SRKG
Sbjct  272   LYLIYVLTLSIFPGFLYENTGTHQLGSWYPLVLIAMYNVWDLIGRYVPLIKKIELQSRKG  331

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             L+IA  SRF  IPCFYFTAKYGDQGWMI LVSFLGLTNGYLTVCV+TAAPKGYKGP ANA
Sbjct  332   LIIATLSRFSFIPCFYFTAKYGDQGWMIFLVSFLGLTNGYLTVCVMTAAPKGYKGPEANA  391

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN+LVL LL+GIFSGVALDWLW+IGN  F
Sbjct  392   LGNLLVLFLLAGIFSGVALDWLWIIGNGKF  421



>ref|XP_002304988.2| equilibrative nucleoside transporter family protein [Populus 
trichocarpa]
 gb|EEE85499.2| equilibrative nucleoside transporter family protein [Populus 
trichocarpa]
Length=426

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/396 (74%), Positives = 337/396 (85%), Gaps = 11/396 (3%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNS+LTI DYYY LFPKYHPSRVLTLVYQPFA+GT+A+L Y   K+NTRKRN+AGY
Sbjct  31    SLVSWNSILTIEDYYYDLFPKYHPSRVLTLVYQPFALGTMALLTYNEAKINTRKRNIAGY  90

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             +LF   T  L+++DL TSGKGG+G YIGIC +VA+ GVADAHVQGG+VGDLSFMCPEF+Q
Sbjct  91    MLFTASTLMLIVVDLVTSGKGGVGPYIGICAVVAALGVADAHVQGGMVGDLSFMCPEFVQ  150

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGLAASG LTS LRL+TKA FE S NGLRKGVILFLA+STF EFL ++LYAF+FP+L
Sbjct  151   SFFAGLAASGALTSALRLLTKAVFEKSKNGLRKGVILFLAISTFLEFLSVLLYAFLFPRL  210

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPS-----------ESVDDAKHVERVSNKKLF  687
              IVKYYRAKAASEGSKTV+ADLAAAGI  P             + DD K  ER+SNK+LF
Sbjct  211   PIVKYYRAKAASEGSKTVSADLAAAGILKPENQEASQFRALLHAADDDKPPERLSNKELF  270

Query  688   MENIDYALDLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIK  867
             ++N DYALDL+LIYV+TLSIFPGFLYE+TG H LGSWY  VLVAM+N+WDLISRYIPL++
Sbjct  271   LQNTDYALDLFLIYVLTLSIFPGFLYEDTGKHQLGSWYSLVLVAMFNVWDLISRYIPLVE  330

Query  868   KVELKSRKGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPK  1047
              ++L+SRKGLMIA  SR+LL+P FYFTAKYGDQGWMIML SFLGLTNGYL+VCVLT APK
Sbjct  331   CLKLESRKGLMIASLSRYLLVPAFYFTAKYGDQGWMIMLTSFLGLTNGYLSVCVLTEAPK  390

Query  1048  GYKGPAANALGNILVLCLLSGIFSGVALDWLWLIGN  1155
             GYKGP  NALGN+LVLCL +GIFSGV LDWLWLIG 
Sbjct  391   GYKGPEQNALGNLLVLCLFAGIFSGVVLDWLWLIGK  426



>ref|XP_006352598.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Solanum tuberosum]
Length=421

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/390 (80%), Positives = 351/390 (90%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFA+ T+AIL Y   ++NTRKRNL G+
Sbjct  32    SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFALATMAILVYNEARINTRKRNLTGF  91

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFFL TFALL+LDL TSG GGLGNYIGIC IVA+FGVADA V+GG+VGDLSFMCPEF+Q
Sbjct  92    TLFFLSTFALLVLDLATSGAGGLGNYIGICAIVAAFGVADAFVEGGMVGDLSFMCPEFIQ  151

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S+LAGLAASG LTS LRLVTKAAFE +SNGLRKGV+LFLA+STFFEFLCI+LYAFVFPKL
Sbjct  152   SYLAGLAASGALTSALRLVTKAAFERASNGLRKGVMLFLAISTFFEFLCILLYAFVFPKL  211

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGIT--APSESVDDAKHVERVSNKKLFMENIDYALD  714
              IVKYYR KAA+EGSKTVAADLAAAGI   A   +  +AK +ER+SNK+LF +NIDY LD
Sbjct  212   PIVKYYRTKAAAEGSKTVAADLAAAGIQTEATERAGANAKQLERLSNKQLFFQNIDYLLD  271

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+LIYV+TLSIFPGFLYENTG+H LGSWY  VL+A+YN++DLI+RYIPLI+K++LKSRKG
Sbjct  272   LFLIYVLTLSIFPGFLYENTGSHKLGSWYALVLIAVYNMFDLIARYIPLIEKIKLKSRKG  331

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LMIA  SRFL IPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLT AP+GYKGP  NA
Sbjct  332   LMIATLSRFLFIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTVAPQGYKGPEQNA  391

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN+LVLCLL+G+FSGVALDWLW+IGN  F
Sbjct  392   LGNLLVLCLLAGLFSGVALDWLWIIGNGKF  421



>ref|XP_010327232.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Solanum lycopersicum]
Length=421

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/390 (80%), Positives = 351/390 (90%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFA+ T+ IL Y   ++NTRKRNL G+
Sbjct  32    SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFALATMVILVYNEARINTRKRNLTGF  91

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFFL TFALL+LDL TSG GGLGNYIGIC IVA+FGVADA V+GG+VGDLSFMCPEF+Q
Sbjct  92    TLFFLSTFALLVLDLATSGAGGLGNYIGICAIVAAFGVADAFVEGGMVGDLSFMCPEFIQ  151

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S+LAGLAASG LTS LRLVTKAAFE +SNGLRKGV+LFLA+STFFEFLCI+LYAFVFPKL
Sbjct  152   SYLAGLAASGALTSALRLVTKAAFERASNGLRKGVMLFLAISTFFEFLCILLYAFVFPKL  211

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVD-DAKHVERVSNKKLFMENIDYALD  714
              IVKYYR KAA+EGSKTVAADLAAAGI T  +E VD +AK +ER+SNK+LF +NIDY LD
Sbjct  212   PIVKYYRTKAAAEGSKTVAADLAAAGIQTEATERVDANAKQLERLSNKQLFFQNIDYLLD  271

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+LIYV+TLSIFPGFLYENTG+H LGSWY  VL+A+YN++DLI+RYIPLI+K++LKSR G
Sbjct  272   LFLIYVLTLSIFPGFLYENTGSHKLGSWYALVLIAVYNMFDLIARYIPLIEKIKLKSRNG  331

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LMIA  SRFL IPCFYFTAKYGDQGWMIMLVS LGLTNGYLTVCVLT AP+GYKGP  NA
Sbjct  332   LMIATLSRFLFIPCFYFTAKYGDQGWMIMLVSVLGLTNGYLTVCVLTVAPQGYKGPEQNA  391

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN+LVLCLL+G+FSGVALDWLW+IGN  F
Sbjct  392   LGNLLVLCLLAGLFSGVALDWLWIIGNDKF  421



>ref|XP_004233814.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Solanum lycopersicum]
Length=415

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/390 (75%), Positives = 335/390 (86%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL++WNS+++IGDYYY LFP YHPSRVLTLVYQPFA+GTI ILAY   K++TRKR LAGY
Sbjct  26    SLIAWNSLMSIGDYYYALFPNYHPSRVLTLVYQPFALGTIVILAYNEAKVDTRKRILAGY  85

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             IL+ L TF L+LLDL TS +GG+GNYIG+C IV  FG+ DA VQGG+ GDLSFMCPEF+Q
Sbjct  86    ILYTLSTFTLILLDLATSVRGGIGNYIGVCAIVGCFGIGDAVVQGGMTGDLSFMCPEFIQ  145

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGLAASG LTSGLRL+TKAAFE+S+NGLRKGV+L+LA+S FFEFLCI+LYAF+FPKL
Sbjct  146   SFFAGLAASGALTSGLRLITKAAFENSNNGLRKGVMLYLAISVFFEFLCILLYAFIFPKL  205

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPS--ESVDDAKHVERVSNKKLFMENIDYALD  714
              IVK+YR KAA EGS TVAADLAAAGI   S  ++  DAK  ER+S K+L  +NIDY LD
Sbjct  206   PIVKHYRTKAAVEGSTTVAADLAAAGIKTQSIEKTNSDAKQSERLSTKQLLFQNIDYELD  265

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             LYLIYV TLSIFPGFLYENTGTH LGSWY  VL+AMYN+WDLI RY+PLI K++LKS KG
Sbjct  266   LYLIYVATLSIFPGFLYENTGTHKLGSWYALVLIAMYNVWDLIGRYVPLIDKIKLKSPKG  325

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LMIA  SRFLL+PCFYFTAKYGDQGWMI LVSFLGLTNG+LTVCV+TAAPKGYKGP  NA
Sbjct  326   LMIATLSRFLLVPCFYFTAKYGDQGWMIFLVSFLGLTNGHLTVCVMTAAPKGYKGPEQNA  385

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN+LV+ +L GI SGVALDWLW+IGN  F
Sbjct  386   LGNLLVVFILCGICSGVALDWLWIIGNGKF  415



>ref|XP_009787357.1| PREDICTED: equilibrative nucleotide transporter 3-like [Nicotiana 
sylvestris]
Length=421

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/390 (79%), Positives = 352/390 (90%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WNSMLTIGDYYY +FPKYHPSRVLTLVYQPFA+ T+AILAY   +++TRKRNLAG+
Sbjct  32    SLVAWNSMLTIGDYYYAIFPKYHPSRVLTLVYQPFALATMAILAYNEARIDTRKRNLAGF  91

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFFL TFALL+LDL TSGKGGLGNYIG+C IVA+FGVADA V+GG+VGDLSFMCPEF+Q
Sbjct  92    TLFFLTTFALLVLDLTTSGKGGLGNYIGLCAIVAAFGVADAFVEGGMVGDLSFMCPEFIQ  151

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S+LAGLAASG LTS LRLVTKAAFE +SNGLRKGV+LFLA+STFFEFLCI+LYAF+FPKL
Sbjct  152   SYLAGLAASGALTSALRLVTKAAFEKASNGLRKGVMLFLAISTFFEFLCILLYAFIFPKL  211

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDD-AKHVERVSNKKLFMENIDYALD  714
              IVKYYR KAA+EGSKTVAADLAAAGI T  ++  D+ AK +ER+SNK+LF +NIDY LD
Sbjct  212   PIVKYYRTKAAAEGSKTVAADLAAAGIQTEATKRADNSAKQLERLSNKQLFFQNIDYLLD  271

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+LIYV+TLSIFPGFLYENTGTH LGSWY  VL+A+YN++DLI+RYIPLI++++LKSRKG
Sbjct  272   LFLIYVLTLSIFPGFLYENTGTHKLGSWYALVLIAVYNMFDLIARYIPLIERIKLKSRKG  331

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LMIA  SRFL IPCFYFTAKYGDQGWMIMLVS LGLTNGYLTVCVLT AP+GYKGP  NA
Sbjct  332   LMIATLSRFLFIPCFYFTAKYGDQGWMIMLVSVLGLTNGYLTVCVLTVAPQGYKGPEQNA  391

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN+LVLCLL+GI  GVALDWLW+IGN  F
Sbjct  392   LGNLLVLCLLAGILCGVALDWLWIIGNGTF  421



>ref|XP_006347184.1| PREDICTED: equilibrative nucleotide transporter 3-like [Solanum 
tuberosum]
Length=415

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/390 (75%), Positives = 335/390 (86%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL++WNS+++IGDYYY LFP YHPSRVLTLVYQPFA+GTI ILAY   K++TRKR L GY
Sbjct  26    SLIAWNSLMSIGDYYYALFPNYHPSRVLTLVYQPFALGTIVILAYNEAKVDTRKRILVGY  85

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              L+ L T  L+LLDL +SG+GG+GNYIG+C IV  FG+ DA VQGG+ GDLSFMCPEF+Q
Sbjct  86    TLYTLSTLTLILLDLASSGRGGIGNYIGVCAIVGCFGIGDAIVQGGMTGDLSFMCPEFIQ  145

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGLAASG +TSGLRL+ KAAFE+S+NGLRKGV+LFLA+S FFEFLCI+LYAF+FPKL
Sbjct  146   SFFAGLAASGAVTSGLRLMAKAAFENSNNGLRKGVMLFLAISVFFEFLCILLYAFIFPKL  205

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPS--ESVDDAKHVERVSNKKLFMENIDYALD  714
              IVK+YR KAA EGS TVAADLAAAGI   S  ++ +DAK  ER+S K+LF +NIDY LD
Sbjct  206   PIVKHYRTKAALEGSTTVAADLAAAGIETQSIEKANNDAKQSERLSTKQLFFQNIDYELD  265

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             LYLIYV TLSIFPGFLYENTGTH LGSWY  VL+AMYN+WDLI RY+PLI K++LKSRKG
Sbjct  266   LYLIYVATLSIFPGFLYENTGTHTLGSWYALVLIAMYNVWDLIGRYVPLIDKIKLKSRKG  325

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LMIA  SRFLL+PCFYFTAKYGDQGWMI LVSFLGLTNG+LTVCV+TAAPKGYKGP  NA
Sbjct  326   LMIATLSRFLLVPCFYFTAKYGDQGWMIFLVSFLGLTNGHLTVCVMTAAPKGYKGPEQNA  385

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN+LVL +L GI SGVALDWLW+IGN  F
Sbjct  386   LGNLLVLFILCGICSGVALDWLWIIGNGKF  415



>ref|XP_002524704.1| nucleoside transporter, putative [Ricinus communis]
 gb|EEF37723.1| nucleoside transporter, putative [Ricinus communis]
Length=419

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/387 (74%), Positives = 332/387 (86%), Gaps = 3/387 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPK-YHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAG  177
             SL SWNSMLTIGDYYY LFPK YHPSRVLTLVYQPFA+GT+AILAY   K+NTRKRN+AG
Sbjct  32    SLASWNSMLTIGDYYYNLFPKSYHPSRVLTLVYQPFALGTVAILAYYESKINTRKRNIAG  91

Query  178   YIlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFL  357
             YILF L T  L+++ + T GK G+G++ GIC IVA FG+ADAHVQGG+VGDLS MCPEF+
Sbjct  92    YILFALSTLMLMVMAIVTPGKAGIGSFTGICAIVAVFGLADAHVQGGMVGDLSLMCPEFI  151

Query  358   QSFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPK  537
             QSF  G+AA+G LTSGLRL+TKAAF+  ++GLRKGV+LFLA+ST  EFLC+I+YAF+FPK
Sbjct  152   QSFFGGMAAAGALTSGLRLITKAAFDKVNDGLRKGVMLFLAISTLVEFLCVIMYAFLFPK  211

Query  538   LAIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDL  717
             L IVKYYRAKAASEGSKTV+ADLAAAGI   S+  DD K  ER+SNK+L ++NIDYALDL
Sbjct  212   LPIVKYYRAKAASEGSKTVSADLAAAGIQ--SQGADDPKLYERLSNKQLVLQNIDYALDL  269

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIYV+TLSIFPGFLYENTG H LG WY  VLVAMYN WDLI RY+PL+K ++L+SRKGL
Sbjct  270   FLIYVLTLSIFPGFLYENTGEHKLGEWYAVVLVAMYNFWDLIGRYVPLVKCIKLESRKGL  329

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
              IAI +R+LLIP FYFTAKY DQGWMIML SFLG+TNGYLTVCV+T APKGYKGP  NAL
Sbjct  330   TIAILARYLLIPAFYFTAKYADQGWMIMLTSFLGITNGYLTVCVMTVAPKGYKGPEQNAL  389

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNS  1158
             GNILV+ LL GIF+GVALDWLWLIG  
Sbjct  390   GNILVVFLLGGIFAGVALDWLWLIGKK  416



>gb|KDP20869.1| hypothetical protein JCGZ_21340 [Jatropha curcas]
Length=421

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/388 (75%), Positives = 335/388 (86%), Gaps = 2/388 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTIGDYYY++FP YHPSR LTLVYQPFA+GT+ +LAY   K+NTRKRN+AGY
Sbjct  31    SLVSWNSMLTIGDYYYKIFPSYHPSRALTLVYQPFALGTMTLLAYNESKINTRKRNIAGY  90

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF   T  LL+LDL TSGKGG+G Y+GIC +VA FG++DA VQGG+VGDLSFMC EF+Q
Sbjct  91    ILFTTSTLMLLVLDLATSGKGGVGPYLGICGLVALFGISDALVQGGVVGDLSFMCSEFIQ  150

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFLAGLAASG LTS LRL+TKAAFE +SNGLR G +LFLA+STF EFLC++LYAF FPKL
Sbjct  151   SFLAGLAASGALTSALRLITKAAFEKASNGLRIGTMLFLAISTFLEFLCVLLYAFCFPKL  210

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI--TAPSESVDDAKHVERVSNKKLFMENIDYALD  714
              IVKYYRAKAA+EGSKTV+ADLAAAGI  +A  E  +D K  ER+SNK+LF +NIDYALD
Sbjct  211   PIVKYYRAKAAAEGSKTVSADLAAAGIQTSATQEDENDPKQFERLSNKELFFQNIDYALD  270

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+LIY +TLSIFPGFLYENTG H LG WY  VL+AMYNIWDLI+RYIPLI  ++L+SRKG
Sbjct  271   LFLIYALTLSIFPGFLYENTGKHKLGEWYAVVLIAMYNIWDLIARYIPLIGSLKLESRKG  330

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             +MIAI SRFL IP FYFTAKYGD+GWMIML+S LGLTNGYLTVCVLT APKGYKGP  NA
Sbjct  331   IMIAILSRFLFIPAFYFTAKYGDEGWMIMLISVLGLTNGYLTVCVLTVAPKGYKGPEQNA  390

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNS  1158
             LGN+LV+ L  GIF+GVALDWLWLIG++
Sbjct  391   LGNLLVVFLAGGIFAGVALDWLWLIGSN  418



>ref|XP_006352597.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Solanum tuberosum]
Length=448

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/417 (76%), Positives = 353/417 (85%), Gaps = 29/417 (7%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFA+ T+AIL Y   ++NTRKRNL G+
Sbjct  32    SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFALATMAILVYNEARINTRKRNLTGF  91

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFFL TFALL+LDL TSG GGLGNYIGIC IVA+FGVADA V+GG+VGDLSFMCPEF+Q
Sbjct  92    TLFFLSTFALLVLDLATSGAGGLGNYIGICAIVAAFGVADAFVEGGMVGDLSFMCPEFIQ  151

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S+LAGLAASG LTS LRLVTKAAFE +SNGLRKGV+LFLA+STFFEFLCI+LYAFVFPKL
Sbjct  152   SYLAGLAASGALTSALRLVTKAAFERASNGLRKGVMLFLAISTFFEFLCILLYAFVFPKL  211

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESV-------------------------  642
              IVKYYR KAA+EGSKTVAADLAAAGI T  +E V                         
Sbjct  212   PIVKYYRTKAAAEGSKTVAADLAAAGIQTEATERVCNLLLTNEFVTDFLTLTFDMLLSTE  271

Query  643   ---DDAKHVERVSNKKLFMENIDYALDLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVL  813
                 +AK +ER+SNK+LF +NIDY LDL+LIYV+TLSIFPGFLYENTG+H LGSWY  VL
Sbjct  272   QAGANAKQLERLSNKQLFFQNIDYLLDLFLIYVLTLSIFPGFLYENTGSHKLGSWYALVL  331

Query  814   VAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSF  993
             +A+YN++DLI+RYIPLI+K++LKSRKGLMIA  SRFL IPCFYFTAKYGDQGWMIMLVSF
Sbjct  332   IAVYNMFDLIARYIPLIEKIKLKSRKGLMIATLSRFLFIPCFYFTAKYGDQGWMIMLVSF  391

Query  994   LGLTNGYLTVCVLTAAPKGYKGPAANALGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGLTNGYLTVCVLT AP+GYKGP  NALGN+LVLCLL+G+FSGVALDWLW+IGN  F
Sbjct  392   LGLTNGYLTVCVLTVAPQGYKGPEQNALGNLLVLCLLAGLFSGVALDWLWIIGNGKF  448



>ref|XP_004232782.1| PREDICTED: equilibrative nucleotide transporter 3-like [Solanum 
lycopersicum]
 ref|XP_010316645.1| PREDICTED: equilibrative nucleotide transporter 3-like [Solanum 
lycopersicum]
 ref|XP_010316646.1| PREDICTED: equilibrative nucleotide transporter 3-like [Solanum 
lycopersicum]
 ref|XP_010316647.1| PREDICTED: equilibrative nucleotide transporter 3-like [Solanum 
lycopersicum]
 ref|XP_010316648.1| PREDICTED: equilibrative nucleotide transporter 3-like [Solanum 
lycopersicum]
 ref|XP_010316649.1| PREDICTED: equilibrative nucleotide transporter 3-like [Solanum 
lycopersicum]
 ref|XP_010316650.1| PREDICTED: equilibrative nucleotide transporter 3-like [Solanum 
lycopersicum]
Length=421

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/390 (77%), Positives = 344/390 (88%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             S VSWNS+L+IGDYYY LFP YHPSRVLTLVYQPFA+GT+AILAY   K++TRKR LAGY
Sbjct  32    SFVSWNSLLSIGDYYYALFPDYHPSRVLTLVYQPFALGTMAILAYNEAKVDTRKRILAGY  91

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             +LF L T AL++LDL TSG+GG+GNYIGIC IV  FGVA+AHVQGG+VGD++FMCPEF+Q
Sbjct  92    VLFTLSTVALIVLDLATSGRGGIGNYIGICFIVGCFGVANAHVQGGMVGDIAFMCPEFMQ  151

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF  GLAASG LTSGLRL+TKAAF +S+NGLRKGV+LFLA+S FFEFLCI+LY+FVFPKL
Sbjct  152   SFFGGLAASGALTSGLRLITKAAFGNSNNGLRKGVMLFLAISAFFEFLCILLYSFVFPKL  211

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVD-DAKHVERVSNKKLFMENIDYALD  714
              IVK+YR+KAA+EGS TVAADLAAAGI   P E  + DAK  ER++ K+L ++NIDY L+
Sbjct  212   PIVKHYRSKAAAEGSTTVAADLAAAGIGIQPMEKANNDAKQSERLTTKQLLLQNIDYVLN  271

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             LYLIYV+TLSIFPGFLYENTGTH LGSWYP VL+AMYN+WDLI RY+PLIKK+EL+SRKG
Sbjct  272   LYLIYVLTLSIFPGFLYENTGTHQLGSWYPLVLIAMYNVWDLIGRYVPLIKKIELQSRKG  331

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             L+IA  SRF  IPCFYFTAKYGDQGWMI LVSFLGLTNGYLTVCV+TAAPKGYKGP ANA
Sbjct  332   LIIATLSRFSFIPCFYFTAKYGDQGWMIFLVSFLGLTNGYLTVCVMTAAPKGYKGPEANA  391

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN+LVL LL+GIFSGVALDWLW+ GN  F
Sbjct  392   LGNLLVLFLLAGIFSGVALDWLWIFGNGKF  421



>gb|KDP20868.1| hypothetical protein JCGZ_21339 [Jatropha curcas]
Length=425

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/392 (75%), Positives = 344/392 (88%), Gaps = 6/392 (2%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFP--KYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLA  174
             SLVSWNS+LTIGDYYY+LFP  KYHPSRVLTLVYQPFA+GTIAILAY   K+NTRKRN+A
Sbjct  31    SLVSWNSLLTIGDYYYKLFPEGKYHPSRVLTLVYQPFALGTIAILAYNESKINTRKRNMA  90

Query  175   GYIlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEF  354
             GYILF   T  LL+LDL TSGKGG+G ++GIC +VA FG++DAHVQGG+VGDLS MCPEF
Sbjct  91    GYILFTASTLMLLVLDLATSGKGGIGPFLGICALVALFGISDAHVQGGMVGDLSLMCPEF  150

Query  355   LQSFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFP  534
             +QSFLAGLAASG LTS LRL+TKAAFE +SNGLRKGV+LFLA+ST  EFLC++LYAF FP
Sbjct  151   IQSFLAGLAASGALTSALRLITKAAFEKASNGLRKGVMLFLAISTLLEFLCVLLYAFYFP  210

Query  535   KLAIVKYYRAKAASEGSKTVAADLAAAGI--TAPSESVDDAKHVERVSNKKLFMENIDYA  708
             KL IVKYYRAKAA+EGSKTV+ADLAAAGI  +A  E  +D K +ER+SNK+LF +NIDYA
Sbjct  211   KLPIVKYYRAKAAAEGSKTVSADLAAAGIQTSATQEGENDPKELERLSNKELFFQNIDYA  270

Query  709   LDLYLIYVVTLSIFPGFLYENTGTH-NLGS-WYPTVLVAMYNIWDLISRYIPLIKKVELK  882
             +DL+LIYV+TLSIFPGF++ENTG H NLG+ WYP VL+AMYNIWDLI+RYIPL++ ++L+
Sbjct  271   IDLFLIYVLTLSIFPGFIFENTGHHHNLGTTWYPLVLIAMYNIWDLIARYIPLVESLKLE  330

Query  883   SRKGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGP  1062
             SRKG+M+AI  RFLLIP FYFTAKY DQGWMI+L SFLGLTNGYLTVCVLT APKGYKGP
Sbjct  331   SRKGIMVAILWRFLLIPAFYFTAKYADQGWMIILTSFLGLTNGYLTVCVLTVAPKGYKGP  390

Query  1063  AANALGNILVLCLLSGIFSGVALDWLWLIGNS  1158
               NALGN+LV+ L+ GIF+GVAL WLWLIG+ 
Sbjct  391   EQNALGNLLVVFLVGGIFAGVALGWLWLIGSK  422



>ref|XP_002304987.1| equilibrative nucleoside transporter family protein [Populus 
trichocarpa]
 gb|EEE85498.1| equilibrative nucleoside transporter family protein [Populus 
trichocarpa]
Length=423

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/388 (77%), Positives = 344/388 (89%), Gaps = 2/388 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL+SWNSMLTIGDYYY LFPKYHPSRVLTLVYQPFAIGT+AILAY   K+NTRKRN+AGY
Sbjct  33    SLISWNSMLTIGDYYYTLFPKYHPSRVLTLVYQPFAIGTMAILAYNEAKINTRKRNIAGY  92

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF   T  L+++DL TSG+GG+G +IGIC IVA+FGVADAHVQGG+VGD++FMCPEF+Q
Sbjct  93    ILFTASTLMLMVVDLATSGRGGVGPFIGICAIVAAFGVADAHVQGGMVGDMAFMCPEFMQ  152

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGLAASG LTSGLRL+TKAAF+ S NG RKGV+LFL +STF EFLC++LYA++FPKL
Sbjct  153   SFFAGLAASGALTSGLRLITKAAFDKSKNGPRKGVMLFLGISTFAEFLCVLLYAYLFPKL  212

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPS--ESVDDAKHVERVSNKKLFMENIDYALD  714
              IVKYYR+KAASEGSKTV+ADLAAAGI  P+  ++ D AK  ER+SNK+L  +NIDYALD
Sbjct  213   PIVKYYRSKAASEGSKTVSADLAAAGIQTPADHQASDVAKSPERLSNKQLLFQNIDYALD  272

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             LYLIYV+TLSIFPGFLYENTG H LG+WYP VL+A+YN+ DLISRY+PL+  ++L+SRKG
Sbjct  273   LYLIYVLTLSIFPGFLYENTGEHQLGTWYPLVLIAVYNVLDLISRYLPLVPWLKLESRKG  332

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LMIAI SRFLL+P FYFTAKYGDQGWMI LVSFLGLTNGYLTVCVLT AP+GYKGP ANA
Sbjct  333   LMIAILSRFLLVPAFYFTAKYGDQGWMIFLVSFLGLTNGYLTVCVLTIAPRGYKGPEANA  392

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNS  1158
             LGN+LVLCLL GIFSGVALDWLWLIG  
Sbjct  393   LGNLLVLCLLGGIFSGVALDWLWLIGKK  420



>ref|XP_010327231.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Solanum lycopersicum]
Length=446

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/415 (75%), Positives = 350/415 (84%), Gaps = 27/415 (7%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFA+ T+ IL Y   ++NTRKRNL G+
Sbjct  32    SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFALATMVILVYNEARINTRKRNLTGF  91

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFFL TFALL+LDL TSG GGLGNYIGIC IVA+FGVADA V+GG+VGDLSFMCPEF+Q
Sbjct  92    TLFFLSTFALLVLDLATSGAGGLGNYIGICAIVAAFGVADAFVEGGMVGDLSFMCPEFIQ  151

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S+LAGLAASG LTS LRLVTKAAFE +SNGLRKGV+LFLA+STFFEFLCI+LYAFVFPKL
Sbjct  152   SYLAGLAASGALTSALRLVTKAAFERASNGLRKGVMLFLAISTFFEFLCILLYAFVFPKL  211

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAP--------------------------SESV  642
              IVKYYR KAA+EGSKTVAADLAAAGI                             +E V
Sbjct  212   PIVKYYRTKAAAEGSKTVAADLAAAGIQTEATERVSNLSLTKKFVYGFLILINILSTEQV  271

Query  643   D-DAKHVERVSNKKLFMENIDYALDLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVA  819
             D +AK +ER+SNK+LF +NIDY LDL+LIYV+TLSIFPGFLYENTG+H LGSWY  VL+A
Sbjct  272   DANAKQLERLSNKQLFFQNIDYLLDLFLIYVLTLSIFPGFLYENTGSHKLGSWYALVLIA  331

Query  820   MYNIWDLISRYIPLIKKVELKSRKGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLG  999
             +YN++DLI+RYIPLI+K++LKSR GLMIA  SRFL IPCFYFTAKYGDQGWMIMLVS LG
Sbjct  332   VYNMFDLIARYIPLIEKIKLKSRNGLMIATLSRFLFIPCFYFTAKYGDQGWMIMLVSVLG  391

Query  1000  LTNGYLTVCVLTAAPKGYKGPAANALGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LTNGYLTVCVLT AP+GYKGP  NALGN+LVLCLL+G+FSGVALDWLW+IGN  F
Sbjct  392   LTNGYLTVCVLTVAPQGYKGPEQNALGNLLVLCLLAGLFSGVALDWLWIIGNDKF  446



>ref|XP_011001160.1| PREDICTED: equilibrative nucleotide transporter 3-like [Populus 
euphratica]
Length=426

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/387 (77%), Positives = 341/387 (88%), Gaps = 2/387 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL+SWNSMLTIGDYYY LFPKYHPSRVLTLVYQPFAIGT+AILAY   K+NTRKRN+AGY
Sbjct  36    SLISWNSMLTIGDYYYTLFPKYHPSRVLTLVYQPFAIGTMAILAYNEAKINTRKRNIAGY  95

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF   T  L+++DL TSG+GG+G +I IC IVA+FGVADAHVQGG+VGD++FMCPEF+Q
Sbjct  96    ILFTASTLMLMVVDLATSGRGGVGPFIAICAIVAAFGVADAHVQGGMVGDMAFMCPEFMQ  155

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGLAASG LTSGLRL+TKAAF+ S NG RKGV+LFL +STF EFLC++LYA +FPKL
Sbjct  156   SFFAGLAASGALTSGLRLITKAAFDKSKNGPRKGVMLFLGISTFAEFLCVLLYAHLFPKL  215

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPS--ESVDDAKHVERVSNKKLFMENIDYALD  714
              IVKYYR+KAASEGSKTV+ADLAAAGI  P+  ++ D AK  ER+SNK+L  +NIDYALD
Sbjct  216   PIVKYYRSKAASEGSKTVSADLAAAGIQTPADHQASDVAKSPERLSNKQLLFQNIDYALD  275

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             LYLIYV+TLSIFPGFLYENTG H LG+WYP VL+AMYN+ DLISRY+PL+  ++L+SRKG
Sbjct  276   LYLIYVLTLSIFPGFLYENTGEHQLGTWYPLVLIAMYNVLDLISRYLPLVPWLKLESRKG  335

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LMIA+ SRFLL+P FYFTAKYGDQGWMI LVSFLGLTNGYLTVCVLT AP+GYKGP ANA
Sbjct  336   LMIAVLSRFLLVPAFYFTAKYGDQGWMIFLVSFLGLTNGYLTVCVLTIAPRGYKGPEANA  395

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGN  1155
             LGN+LVL LL GIFSGVALDWLWL+G 
Sbjct  396   LGNLLVLWLLGGIFSGVALDWLWLVGK  422



>gb|KHG13228.1| Equilibrative nucleoside transporter 1 [Gossypium arboreum]
Length=415

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/385 (75%), Positives = 332/385 (86%), Gaps = 3/385 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL+SWNSMLT+GDYYY LFP YHPSRVLTLVYQPFA GT++ILAY   K+NTR+RN+ GY
Sbjct  30    SLISWNSMLTMGDYYYNLFPDYHPSRVLTLVYQPFAFGTMSILAYNESKINTRRRNIFGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LF   TF LL+LDL TSG+GGLG++IGICVIVA FGVADA VQGGIVGDLSFM P+F+Q
Sbjct  90    SLFVASTFMLLVLDLATSGRGGLGSFIGICVIVAFFGVADACVQGGIVGDLSFMLPDFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGLAASG LTS LRL+TKAAFE S+NGLRKG +LFLA ST FEFLC++LY + FPKL
Sbjct  150   SFFAGLAASGALTSALRLITKAAFEKSNNGLRKGAMLFLATSTLFEFLCVLLYTYFFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKY+R+KAA EGSKTV ADLAAAGI       D  +  ER+SNK+LF++NIDYALDL+
Sbjct  210   PIVKYFRSKAALEGSKTVQADLAAAGIQTKE---DHNEQNERLSNKQLFIQNIDYALDLF  266

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LG+WYP VL+A YN+WDLISRY+PL+K ++++SRKGL 
Sbjct  267   LIYVLTLSIFPGFLYENTGEHKLGTWYPLVLIASYNVWDLISRYLPLVKFLKIESRKGLT  326

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IAI SRFLLIP FYFTAKYGDQGWMI+LVSFLGLTNG+LTVCV+TAAPK YKGP  NALG
Sbjct  327   IAILSRFLLIPAFYFTAKYGDQGWMILLVSFLGLTNGHLTVCVMTAAPKCYKGPEQNALG  386

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             NILVLCLL GIF+GV+LDWLW IG 
Sbjct  387   NILVLCLLIGIFAGVSLDWLWFIGK  411



>gb|EYU33943.1| hypothetical protein MIMGU_mgv1a007099mg [Erythranthe guttata]
Length=419

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/389 (75%), Positives = 340/389 (87%), Gaps = 2/389 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYY LFP+YHP+RVLTLVYQPFA+GT+ +LAY+   ++TRKRN+ GY
Sbjct  32    SLVSWNSMLTIADYYYNLFPEYHPARVLTLVYQPFALGTMLVLAYREANIDTRKRNIFGY  91

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LF + TFALLL+DL TSGKGGLGN++ ICV V +FGVADAHVQGG+VGDLS MCPEF+Q
Sbjct  92    TLFCISTFALLLIDLCTSGKGGLGNFLAICVFVGAFGVADAHVQGGLVGDLSHMCPEFIQ  151

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AG+AASG LTSGLRLVTKAAF+ +++GLRKGVILFLA+STFFEFLCI LYA+VF KL
Sbjct  152   SFFAGMAASGVLTSGLRLVTKAAFDKTNHGLRKGVILFLAISTFFEFLCIFLYAYVFGKL  211

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDL  717
              IVK++R KA+SEGSKTV+ADLAAAGI T+ +++V+D K + R+S KKL  +NIDYALDL
Sbjct  212   PIVKHFRKKASSEGSKTVSADLAAAGIETSDNQTVNDVKFI-RLSTKKLLKQNIDYALDL  270

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             YLIYV+TLSIFPGFLYENTG H LGSWY  VL+AMYN+ DLI RYIPLI  + L+SRKGL
Sbjct  271   YLIYVLTLSIFPGFLYENTGNHQLGSWYAVVLIAMYNVGDLIGRYIPLIDFIRLESRKGL  330

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             +IA+ SRFL+IPCFYFTAKYGDQG+MI LV+FLG+TNGYLTVCVLT AP+GYK P  NAL
Sbjct  331   VIAVLSRFLMIPCFYFTAKYGDQGYMIFLVTFLGITNGYLTVCVLTVAPRGYKAPEQNAL  390

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             GN+LV+ LL GIFSGVALDWLWLIG+  F
Sbjct  391   GNVLVVFLLGGIFSGVALDWLWLIGHESF  419



>ref|XP_007043445.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOX99276.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=443

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/385 (74%), Positives = 332/385 (86%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP YHPSRVLTLVYQPFA+GT+AILAY   K+NTR+RNL GYI
Sbjct  29    LFSWNSMLTIEDYYGYLFPHYHPSRVLTLVYQPFALGTLAILAYNEAKINTRRRNLFGYI  88

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL + A+L+LDL TSGKGG+G +IGICV+  +FGVADAHVQGG++GDLS+M PEF+QS
Sbjct  89    LFFLSSLAVLILDLATSGKGGIGTFIGICVVSGAFGVADAHVQGGMIGDLSYMNPEFIQS  148

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             F+AGLAASG +TSGLRL+TKAAFE+S +GLR G ILF A+S FFE LC++LYA+VFPKL 
Sbjct  149   FVAGLAASGVITSGLRLITKAAFENSQDGLRNGAILFFAISAFFELLCVLLYAYVFPKLP  208

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR+KAASEGSKTVAADLAA GI T P  + +D KH ER+SNKKL +ENIDYALD++
Sbjct  209   IVKYYRSKAASEGSKTVAADLAAGGIQTLPQTAEEDQKHQERLSNKKLLLENIDYALDMF  268

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFL E+TG H+LG+WY  VL+AMYN+WDLI RYIPL+K ++L+SR+GL 
Sbjct  269   LIYVLTLSIFPGFLSEDTGKHSLGTWYALVLIAMYNVWDLIGRYIPLVKFLKLESRRGLT  328

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
               I  RFLLIP FYFTAKYGDQGWMIML  FLGLTNGYLTVCVLT+APKGYKGP  NALG
Sbjct  329   TVILFRFLLIPAFYFTAKYGDQGWMIMLTCFLGLTNGYLTVCVLTSAPKGYKGPEQNALG  388

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LVL L+ GIF+GV LDWLWLIG 
Sbjct  389   NLLVLFLIGGIFAGVTLDWLWLIGK  413



>ref|XP_002270728.2| PREDICTED: equilibrative nucleotide transporter 3-like [Vitis 
vinifera]
 ref|XP_010646361.1| PREDICTED: equilibrative nucleotide transporter 3-like [Vitis 
vinifera]
 ref|XP_010646362.1| PREDICTED: equilibrative nucleotide transporter 3-like [Vitis 
vinifera]
 ref|XP_010646363.1| PREDICTED: equilibrative nucleotide transporter 3-like [Vitis 
vinifera]
 ref|XP_010646364.1| PREDICTED: equilibrative nucleotide transporter 3-like [Vitis 
vinifera]
 ref|XP_010646365.1| PREDICTED: equilibrative nucleotide transporter 3-like [Vitis 
vinifera]
Length=417

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/389 (76%), Positives = 334/389 (86%), Gaps = 2/389 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTIGDYYY LFP+YHPSRVLTLVYQPFA+GT+A+LAY   K++TRKRNLAGY
Sbjct  30    SLVSWNSMLTIGDYYYNLFPRYHPSRVLTLVYQPFALGTMALLAYNEAKIDTRKRNLAGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF   TF L++LDL TSG+GG+  YIGICVIV +FGVADAHVQGG+VGDLSFMCPEF+Q
Sbjct  90    ILFCASTFLLVVLDLATSGRGGIAPYIGICVIVGAFGVADAHVQGGMVGDLSFMCPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFLAGLAASG LTS LRL+TKAAF+ S+ G RKG +LFL +STF EFLCIILYAF FPKL
Sbjct  150   SFLAGLAASGALTSALRLMTKAAFDKSAGGERKGAMLFLGISTFLEFLCIILYAFFFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDL  717
              IVK+YR KAA EGSKTV+ADLA  GI T  S  VDD K  ER+SNK+LF +NIDYAL+L
Sbjct  210   PIVKHYRRKAALEGSKTVSADLAVVGIQTQQSREVDDTKQQERLSNKQLFFQNIDYALEL  269

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIYV+TLSIFPGFL+ENTG H LGSWYP VL+AMYN+WD ISRYIPL+K + L  RKGL
Sbjct  270   FLIYVLTLSIFPGFLFENTGKHQLGSWYPLVLIAMYNVWDFISRYIPLVKCLRL-PRKGL  328

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             M+ + +RFL IP FYFTAKYGDQGWMIML SFLG++NGYLTVC+LT APKGYKGP  NAL
Sbjct  329   MVGVLARFLFIPAFYFTAKYGDQGWMIMLTSFLGVSNGYLTVCILTNAPKGYKGPEQNAL  388

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             GN+LVLCLL GIFSGVALDWLWLIG   F
Sbjct  389   GNLLVLCLLGGIFSGVALDWLWLIGKQSF  417



>ref|XP_009607302.1| PREDICTED: equilibrative nucleotide transporter 3-like [Nicotiana 
tomentosiformis]
Length=411

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/380 (79%), Positives = 340/380 (89%), Gaps = 2/380 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WNSMLTIGDYYY LFPKYHPSRVLTLVYQPFA+ T+AILAY   +++TRKRNLAG+
Sbjct  32    SLVAWNSMLTIGDYYYTLFPKYHPSRVLTLVYQPFALATMAILAYNEARIDTRKRNLAGF  91

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFFL TFALL+LDL TSGKGGLGNYIGIC I+A+FGVADA V+GG+VGDLSFMCPEF+Q
Sbjct  92    TLFFLTTFALLVLDLATSGKGGLGNYIGICAIIAAFGVADAFVEGGMVGDLSFMCPEFIQ  151

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S+LAGL ASG LTS LRLVTKAAFE SSNGL KGV+LFLA+STFFEFLCI+LYAF+FPKL
Sbjct  152   SYLAGLVASGALTSALRLVTKAAFEKSSNGLHKGVMLFLAISTFFEFLCILLYAFIFPKL  211

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGIT--APSESVDDAKHVERVSNKKLFMENIDYALD  714
              IVKYYR KAA+EGSKTVAADLAAAGI   A   +V+ A  +ER+SNK+LF +NIDY+LD
Sbjct  212   PIVKYYRTKAAAEGSKTVAADLAAAGIQTEATKRAVNSAIQLERLSNKQLFFQNIDYSLD  271

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+LIYV+TLSIFPGFLYENTGTH LGSWY  VL+A+YN+ DLI+RYIPLI+K++LKSRKG
Sbjct  272   LFLIYVLTLSIFPGFLYENTGTHKLGSWYALVLIAVYNMLDLIARYIPLIEKIKLKSRKG  331

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LMIA  SRFL IPCFYFTAKYGDQGWMI+LVS LGLTNGYLTVCVLT AP+GYKGP  NA
Sbjct  332   LMIATLSRFLFIPCFYFTAKYGDQGWMIILVSVLGLTNGYLTVCVLTVAPQGYKGPEQNA  391

Query  1075  LGNILVLCLLSGIFSGVALD  1134
             LGN+LVLCLL+GI  GVALD
Sbjct  392   LGNLLVLCLLAGILCGVALD  411



>ref|XP_007025839.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY28461.1| Major facilitator superfamily protein [Theobroma cacao]
Length=420

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/388 (75%), Positives = 338/388 (87%), Gaps = 2/388 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WNSMLTIGDYYY LFP YHPSRVLTLVYQPFA+GT+AILAY   +++TR+RNL GY
Sbjct  30    SLVAWNSMLTIGDYYYNLFPTYHPSRVLTLVYQPFALGTMAILAYNESRIDTRQRNLVGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             +LFF  TF L++LDL TSG+GG+G +IGIC  V  FG+ADAHVQGG+VGDLSFM PEF+Q
Sbjct  90    LLFFASTFMLIVLDLATSGRGGVGPFIGICAFVGGFGIADAHVQGGMVGDLSFMLPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFLAGLAASG LTS LRL+TKAAFE S++GLRKG +LFL +STFFE LC++LYAF FPKL
Sbjct  150   SFLAGLAASGALTSALRLITKAAFEKSNDGLRKGTMLFLGISTFFELLCVLLYAFFFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSES--VDDAKHVERVSNKKLFMENIDYALD  714
              IVKY+R+KAASEGSKTV ADLAAAGI    +    D+AK  +R+SNK+LF +NIDYALD
Sbjct  210   PIVKYFRSKAASEGSKTVKADLAAAGIQTKEDQGDEDNAKQTDRLSNKQLFFQNIDYALD  269

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+LIYV+TLSIFPGFLYENTG H LG+WYP VL+A YN+WDLISRY+PL+K + ++SRKG
Sbjct  270   LFLIYVLTLSIFPGFLYENTGEHKLGTWYPLVLIASYNLWDLISRYLPLVKFLMIESRKG  329

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             L IAI SRFLLIP FYFTA YGDQGWMI+LVSFLGLTNG+LTVCVLTAAPKGYKGP  NA
Sbjct  330   LTIAILSRFLLIPAFYFTANYGDQGWMILLVSFLGLTNGHLTVCVLTAAPKGYKGPEQNA  389

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNS  1158
             LGN+LVLCLL+GIF+GVALDWLWLIG  
Sbjct  390   LGNLLVLCLLAGIFAGVALDWLWLIGKK  417



>ref|XP_007043444.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX99275.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=471

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/385 (74%), Positives = 332/385 (86%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP YHPSRVLTLVYQPFA+GT+AILAY   K+NTR+RNL GYI
Sbjct  29    LFSWNSMLTIEDYYGYLFPHYHPSRVLTLVYQPFALGTLAILAYNEAKINTRRRNLFGYI  88

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL + A+L+LDL TSGKGG+G +IGICV+  +FGVADAHVQGG++GDLS+M PEF+QS
Sbjct  89    LFFLSSLAVLILDLATSGKGGIGTFIGICVVSGAFGVADAHVQGGMIGDLSYMNPEFIQS  148

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             F+AGLAASG +TSGLRL+TKAAFE+S +GLR G ILF A+S FFE LC++LYA+VFPKL 
Sbjct  149   FVAGLAASGVITSGLRLITKAAFENSQDGLRNGAILFFAISAFFELLCVLLYAYVFPKLP  208

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR+KAASEGSKTVAADLAA GI T P  + +D KH ER+SNKKL +ENIDYALD++
Sbjct  209   IVKYYRSKAASEGSKTVAADLAAGGIQTLPQTAEEDQKHQERLSNKKLLLENIDYALDMF  268

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFL E+TG H+LG+WY  VL+AMYN+WDLI RYIPL+K ++L+SR+GL 
Sbjct  269   LIYVLTLSIFPGFLSEDTGKHSLGTWYALVLIAMYNVWDLIGRYIPLVKFLKLESRRGLT  328

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
               I  RFLLIP FYFTAKYGDQGWMIML  FLGLTNGYLTVCVLT+APKGYKGP  NALG
Sbjct  329   TVILFRFLLIPAFYFTAKYGDQGWMIMLTCFLGLTNGYLTVCVLTSAPKGYKGPEQNALG  388

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LVL L+ GIF+GV LDWLWLIG 
Sbjct  389   NLLVLFLIGGIFAGVTLDWLWLIGK  413



>ref|XP_006396631.1| hypothetical protein EUTSA_v10028692mg [Eutrema salsugineum]
 ref|XP_006396632.1| hypothetical protein EUTSA_v10028692mg [Eutrema salsugineum]
 gb|ESQ38084.1| hypothetical protein EUTSA_v10028692mg [Eutrema salsugineum]
 gb|ESQ38085.1| hypothetical protein EUTSA_v10028692mg [Eutrema salsugineum]
Length=418

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/386 (72%), Positives = 331/386 (86%), Gaps = 0/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             +LVSWNSMLTI DYYYQ+FP YHPSRVLTLVYQPFA+GTI ILAY   K+NTR RNL GY
Sbjct  30    ALVSWNSMLTIADYYYQVFPDYHPSRVLTLVYQPFALGTIVILAYHESKINTRTRNLFGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + TF L++LDL T G+GG+G YIG+CVIVASFG+ADA VQGG++GDLS MCPEF+Q
Sbjct  90    ILFTISTFLLIVLDLTTKGRGGIGPYIGLCVIVASFGLADATVQGGMIGDLSLMCPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+ GLA +G LTS LRL+TKAAFE+S++G RKG ++FLA+STF EFLC++LYA+VFPKL
Sbjct  150   SFMGGLAVAGALTSALRLITKAAFENSNDGQRKGAMIFLAISTFIEFLCVMLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYYR KAASEGSKTV+ADLAAAGI   S+  +D    +R+SNK+L ++NIDYA++L 
Sbjct  210   PIVKYYRRKAASEGSKTVSADLAAAGIQNQSDLSNDDSKNQRLSNKELLLQNIDYAVNLS  269

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LG+WY  VLVAMYN WDL+ RY PL+K +++++RKGL 
Sbjct  270   LIYVLTLSIFPGFLYENTGQHGLGAWYALVLVAMYNCWDLVGRYTPLVKWLKIENRKGLT  329

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
              A+ SRFLLIP FYFTAKYGDQGWMIMLVS LGL+NG+LTVC+LTAAPKGYKGP  NALG
Sbjct  330   FAVLSRFLLIPAFYFTAKYGDQGWMIMLVSVLGLSNGHLTVCILTAAPKGYKGPEQNALG  389

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N+LV+ LL GIF+GVALDWLWLIG  
Sbjct  390   NLLVIFLLGGIFAGVALDWLWLIGKK  415



>ref|XP_002276682.1| PREDICTED: equilibrative nucleotide transporter 3 [Vitis vinifera]
 ref|XP_010657382.1| PREDICTED: equilibrative nucleotide transporter 3 [Vitis vinifera]
 emb|CBI18007.3| unnamed protein product [Vitis vinifera]
Length=417

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/384 (75%), Positives = 328/384 (85%), Gaps = 1/384 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTIGDYY  LFP YHPSRVLTLVYQPFA+ TIAIL YK  K+NTR RNL GY 
Sbjct  33    LFSWNSMLTIGDYYAYLFPDYHPSRVLTLVYQPFALVTIAILTYKEAKINTRLRNLFGYT  92

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ T  +L+LDL TSGKGGLG +IGICV+ A+FG+ADAHVQGG+VGDLSFM PEF+QS
Sbjct  93    LFFISTLLVLVLDLATSGKGGLGTFIGICVLSAAFGLADAHVQGGMVGDLSFMLPEFMQS  152

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG +TSGLRL+TKAAFE+S +G RKG ILFL++STFFE  C+ILYAFVFPKL 
Sbjct  153   FLAGLAASGAITSGLRLITKAAFENSRDGFRKGAILFLSISTFFELFCVILYAFVFPKLP  212

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYL  723
             IVKY+RAKAASEGSKTV+ADLAA GI   + +  D +  ER+SNK+L ++NIDYA+DL+L
Sbjct  213   IVKYFRAKAASEGSKTVSADLAAGGIQT-TGAEKDPEQPERLSNKQLLLQNIDYAIDLFL  271

Query  724   IYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMI  903
             IY++TLSIFPGFL E+TG+H+LGSWY  VL+AMYN WDLI RYIPLIK ++LKSRKGLMI
Sbjct  272   IYILTLSIFPGFLSEDTGSHSLGSWYSLVLIAMYNGWDLIGRYIPLIKCIKLKSRKGLMI  331

Query  904   AIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGN  1083
              I +RFLLIP FYFTAKYGDQGWMIML SFLGLTNGY TVCVLT APKGYKGP  NALGN
Sbjct  332   GILTRFLLIPAFYFTAKYGDQGWMIMLTSFLGLTNGYFTVCVLTEAPKGYKGPEQNALGN  391

Query  1084  ILVLCLLSGIFSGVALDWLWLIGN  1155
             ILV  LL G+F+GV  DWLWLIG 
Sbjct  392   ILVFFLLGGLFAGVTADWLWLIGK  415



>gb|KEH36498.1| equilibrative nucleoside transporter 6 [Medicago truncatula]
Length=424

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/391 (73%), Positives = 328/391 (84%), Gaps = 3/391 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WNSMLTIGDYYY LFPKYHPSRVLTLVYQP AIGTI IL Y   K+NTR RNLAG+
Sbjct  34    SLVAWNSMLTIGDYYYNLFPKYHPSRVLTLVYQPVAIGTIVILTYYESKINTRLRNLAGF  93

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFF  TF +L+LDL TSG+GG+G YIGICV+VA FG+ADAH++GG+VGDL FMCPEF+Q
Sbjct  94    TLFFAATFLVLILDLATSGRGGIGPYIGICVLVACFGIADAHIEGGMVGDLYFMCPEFVQ  153

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S+LAGL+ASG L S LR++TK AFE S NGLRKG +LF A+S F EFLCI LYA  F KL
Sbjct  154   SYLAGLSASGALISLLRMLTKFAFEKSHNGLRKGALLFFAISAFIEFLCIFLYAIYFTKL  213

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI---TAPSESVDDAKHVERVSNKKLFMENIDYAL  711
              IVKYYR+KAASEGSKTVAADLAAAGI   T   ++  D K +ER+S K+LF++NIDYA 
Sbjct  214   PIVKYYRSKAASEGSKTVAADLAAAGIQTKTINDQAEYDNKQMERLSTKQLFLDNIDYAA  273

Query  712   DLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRK  891
             DL LIYVVTLSIFPGFLYENTGTH LG+WYP VL+AMYN+ D I+RYIPL+  ++L+SRK
Sbjct  274   DLVLIYVVTLSIFPGFLYENTGTHQLGTWYPIVLIAMYNVVDFIARYIPLVPWLKLESRK  333

Query  892   GLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAAN  1071
             GLMIA  SRFLL+P FYFTAKYGDQGWMI L SFLGLTNGYLTVCV+T AP+GYKGP  N
Sbjct  334   GLMIATLSRFLLVPAFYFTAKYGDQGWMIFLTSFLGLTNGYLTVCVMTVAPRGYKGPEQN  393

Query  1072  ALGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             ALGN+LVLCLL+GIF+G  LDWLW+IG   F
Sbjct  394   ALGNVLVLCLLTGIFTGAVLDWLWIIGKDSF  424



>ref|XP_008224922.1| PREDICTED: equilibrative nucleotide transporter 3-like [Prunus 
mume]
Length=421

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/392 (74%), Positives = 331/392 (84%), Gaps = 4/392 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFP-KYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAG  177
             SLV+WNSMLTIGDYYY LFP  YHPSRVLTLVYQPFA+ T+  LAY   KLNTRKRNL G
Sbjct  30    SLVAWNSMLTIGDYYYNLFPASYHPSRVLTLVYQPFALITMVTLAYHEAKLNTRKRNLIG  89

Query  178   YIlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFL  357
             Y LFFLGT  L+++DL TSG+G +G YIGIC  V +FGVADAHVQGG+VGDLSFM PEF+
Sbjct  90    YALFFLGTLMLIVVDLATSGRGAIGPYIGICACVGAFGVADAHVQGGMVGDLSFMHPEFI  149

Query  358   QSFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPK  537
             QSF AGLAASG LTSG+RL+TKAAFE   NGLRKG ++FLA+ST  EFLCI+LYA  FP+
Sbjct  150   QSFFAGLAASGALTSGMRLMTKAAFEKYHNGLRKGAMMFLAISTLIEFLCILLYAIYFPR  209

Query  538   LAIVKYYRAKAASEGSKTVAADLAAAGIT--APSESVDDAKHV-ERVSNKKLFMENIDYA  708
             L IVKYYR+KAASEGSKTV+ADLAAAGI   A  E  +D K +  R+S K+LFM+NIDYA
Sbjct  210   LPIVKYYRSKAASEGSKTVSADLAAAGIQTQADIEVSNDTKILPTRLSTKQLFMQNIDYA  269

Query  709   LDLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSR  888
             LDL+LIYV+TLSIFPGF++ENTG H LG+WYP VLVAMYN+ DLISRYIPL+K ++++SR
Sbjct  270   LDLFLIYVLTLSIFPGFIFENTGKHQLGTWYPLVLVAMYNVLDLISRYIPLVKCLKIESR  329

Query  889   KGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAA  1068
             KGLMI I SRFL +P +YFT KYGDQGWMI+L S LGLTNGYLTVCV+T APKGYKGP  
Sbjct  330   KGLMITILSRFLFVPAYYFTGKYGDQGWMILLTSVLGLTNGYLTVCVMTVAPKGYKGPEQ  389

Query  1069  NALGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             NALGNILVLCLL GIF+GV+LDWLWLIG S F
Sbjct  390   NALGNILVLCLLCGIFAGVSLDWLWLIGKSKF  421



>emb|CDO99652.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/395 (74%), Positives = 344/395 (87%), Gaps = 7/395 (2%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             +LV+WN+MLT+GDYYY LFP+YHP+RVLTLVY+PFA+GTIAILAYK  K++TRKRNLAG+
Sbjct  30    TLVAWNTMLTVGDYYYALFPRYHPARVLTLVYEPFALGTIAILAYKEAKIDTRKRNLAGF  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFFL TFALL+LDL TSGKGG+GNYIGIC+IVA FG+ADAH++GG+VGDLS MCPEF+Q
Sbjct  90    TLFFLSTFALLILDLATSGKGGIGNYIGICIIVAVFGIADAHIEGGMVGDLSLMCPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGLAASG LTS LR++TKAAF+ +++GLRKGVILFLA+STF E LCI LYAFVFPKL
Sbjct  150   SFFAGLAASGALTSALRIMTKAAFDKTNHGLRKGVILFLAISTFIELLCIFLYAFVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESV-------DDAKHVERVSNKKLFMENI  699
              IVK++RAKAASEGSKTV ADLAAAGI   ++++       +D K + R+SNK+LF +NI
Sbjct  210   PIVKHFRAKAASEGSKTVTADLAAAGIQTQAKNLLLSVKGDNDDKQLNRLSNKQLFFQNI  269

Query  700   DYALDLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVEL  879
             DYAL ++L YV+TLSIFPGFLYENTG H LGSWY  VL+AMYN+WDLI+RYIPLI+ +++
Sbjct  270   DYALGVFLTYVLTLSIFPGFLYENTGNHKLGSWYAIVLIAMYNVWDLIARYIPLIECLKI  329

Query  880   KSRKGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKG  1059
             +SRKGLM+AI SR L IP FYFTAKYGDQGWMIML S LGLTNGYLTVCV TAAPKGYKG
Sbjct  330   ESRKGLMVAILSRLLFIPAFYFTAKYGDQGWMIMLTSLLGLTNGYLTVCVFTAAPKGYKG  389

Query  1060  PAANALGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             P  NALGN+LVL LL GIF+GVALDWLWLIGN  F
Sbjct  390   PEQNALGNLLVLFLLGGIFAGVALDWLWLIGNGSF  424



>ref|XP_010268890.1| PREDICTED: equilibrative nucleotide transporter 3-like [Nelumbo 
nucifera]
 ref|XP_010268891.1| PREDICTED: equilibrative nucleotide transporter 3-like [Nelumbo 
nucifera]
 ref|XP_010268892.1| PREDICTED: equilibrative nucleotide transporter 3-like [Nelumbo 
nucifera]
 ref|XP_010268893.1| PREDICTED: equilibrative nucleotide transporter 3-like [Nelumbo 
nucifera]
 ref|XP_010268894.1| PREDICTED: equilibrative nucleotide transporter 3-like [Nelumbo 
nucifera]
Length=417

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/385 (75%), Positives = 338/385 (88%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP YHP+RVLTLVYQPFA+GT+AILAYK  K+NTR+RNL GYI
Sbjct  31    LFSWNSMLTIEDYYVYLFPNYHPTRVLTLVYQPFALGTLAILAYKEAKINTRRRNLTGYI  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ +  +L+LDL TSGKGG+G YIGICVI  +FG+ADAHVQGG+VGDLSFMC EF+QS
Sbjct  91    LFFISSLLVLILDLATSGKGGIGTYIGICVISGAFGIADAHVQGGMVGDLSFMCSEFIQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAG+AASG LTSGLRL+TKA FE+S +GLRKG ILF  +S FFE LC++LYAF+FPK+ 
Sbjct  151   FLAGMAASGALTSGLRLITKAIFENSKDGLRKGAILFFGISAFFELLCVLLYAFIFPKIP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR+KAASEGSKTV+ADLAA GI T PS+  +D K ++R+SNK+LF++NIDYA+D++
Sbjct  211   IVKYYRSKAASEGSKTVSADLAAGGIQTKPSQDEEDPKRLDRLSNKQLFLQNIDYAVDMF  270

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFL E+TG+H+LGSWY  VL+AMYN+WDLI RYIPLIK + LKSRKGLM
Sbjct  271   LIYVLTLSIFPGFLSEDTGSHSLGSWYALVLIAMYNVWDLIGRYIPLIKSLTLKSRKGLM  330

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             + + SRF+LIP FYFTAKYGDQGWMI+L SFLGLTNGYLTVCVLTAAPKGYKGP  NALG
Sbjct  331   VVVLSRFVLIPAFYFTAKYGDQGWMILLTSFLGLTNGYLTVCVLTAAPKGYKGPEQNALG  390

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LVLCLL G+F+GV LDWLWLIG 
Sbjct  391   NLLVLCLLGGLFAGVTLDWLWLIGK  415



>ref|XP_007211738.1| hypothetical protein PRUPE_ppa006222mg [Prunus persica]
 gb|EMJ12937.1| hypothetical protein PRUPE_ppa006222mg [Prunus persica]
Length=421

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/392 (73%), Positives = 330/392 (84%), Gaps = 4/392 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFP-KYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAG  177
             SLV+WNS+LTIGDYYY LFP  YHPSRVLTLVYQPFA+ T+  LAY   KLNTRKRNL G
Sbjct  30    SLVAWNSLLTIGDYYYNLFPASYHPSRVLTLVYQPFALITMVTLAYHEAKLNTRKRNLIG  89

Query  178   YIlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFL  357
             Y LFFLGT  L+++DL TSG G +G YIGIC  V +FGVADAHVQGG+VGDLSFM PEF+
Sbjct  90    YALFFLGTLMLIVVDLATSGSGAIGPYIGICACVGAFGVADAHVQGGMVGDLSFMHPEFI  149

Query  358   QSFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPK  537
             QSF AGLAASG LTSG+RL+TKAAFE   NGLRKG ++FLA+ST  EFLCI+LYA  FP+
Sbjct  150   QSFFAGLAASGALTSGMRLMTKAAFEKYHNGLRKGAMMFLAISTLIEFLCILLYAIYFPR  209

Query  538   LAIVKYYRAKAASEGSKTVAADLAAAGIT--APSESVDDAKHV-ERVSNKKLFMENIDYA  708
             L IVKYYR+KAASEGSKTV+ADLAAAGI   A  E  +D K +  R+S K+LFM+NIDYA
Sbjct  210   LPIVKYYRSKAASEGSKTVSADLAAAGIQTQADIEVSNDTKILPTRLSTKQLFMQNIDYA  269

Query  709   LDLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSR  888
             LDL+LIYV+TLSIFPGF++ENTG H LG+WYP VLVAMYN+ DLISRYIPL+K ++++SR
Sbjct  270   LDLFLIYVLTLSIFPGFIFENTGKHQLGTWYPLVLVAMYNVLDLISRYIPLVKCLKIESR  329

Query  889   KGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAA  1068
             KGLMI I SRFL +P +YFT KYGDQGWMI+L S LGLTNGYLTVCV+T APKGYKGP  
Sbjct  330   KGLMITILSRFLFVPAYYFTGKYGDQGWMILLTSVLGLTNGYLTVCVMTVAPKGYKGPEQ  389

Query  1069  NALGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             NALGNILVLCLL GIF+GV+LDWLWLIG S F
Sbjct  390   NALGNILVLCLLCGIFAGVSLDWLWLIGKSKF  421



>gb|EPS58545.1| equilibrative nucleoside transporter [Genlisea aurea]
Length=415

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/389 (75%), Positives = 335/389 (86%), Gaps = 5/389 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL+SWNSMLTI DYYYQ+FP YHPSRVLTLVYQPFA+GT+AILAY   K+NTRKRN+ GY
Sbjct  31    SLISWNSMLTISDYYYQVFPHYHPSRVLTLVYQPFAVGTMAILAYHESKINTRKRNIFGY  90

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF L T  L+L+DLGTSGKGG+ NYIGICV VA FG+ADAHVQGG+VGDL+FM PEF Q
Sbjct  91    ILFALSTLGLILIDLGTSGKGGIANYIGICVFVACFGLADAHVQGGMVGDLAFMHPEFNQ  150

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF  GLAASG LTSGLRL+TKAAF+ + NGLRKGVILFL++STFFEFLC++LYAFVF KL
Sbjct  151   SFFCGLAASGALTSGLRLITKAAFDKTDNGLRKGVILFLSISTFFEFLCVLLYAFVFGKL  210

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDL  717
              IVKY+R KAASEGSKTV ADL A GI T+  E+V      ER++ K+L ++N+DYA+DL
Sbjct  211   PIVKYFRKKAASEGSKTVRADLVAVGIHTSDKETVKQ----ERLTTKQLLVQNVDYAIDL  266

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             Y+IYV+TLSIFPGFLYENTG H LGSWY  VL+AMYN+WDLI RY+PLIK ++L+SRKGL
Sbjct  267   YVIYVLTLSIFPGFLYENTGHHQLGSWYAVVLIAMYNVWDLIGRYVPLIKAIKLRSRKGL  326

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             +I+  SRFLLIPCFYFTAKYGDQGWMI+LVSFLGLTNGYLTVCVLTAAP GYK P  NAL
Sbjct  327   LISCFSRFLLIPCFYFTAKYGDQGWMILLVSFLGLTNGYLTVCVLTAAPSGYKAPEQNAL  386

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             GN+LVL LL GIFSGVALDWLW+IG   F
Sbjct  387   GNLLVLFLLGGIFSGVALDWLWIIGKQSF  415



>ref|XP_006467916.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Citrus sinensis]
 ref|XP_006467917.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Citrus sinensis]
 ref|XP_006467918.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X3 [Citrus sinensis]
Length=419

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/387 (76%), Positives = 335/387 (87%), Gaps = 1/387 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL+SWNSMLTIGDYY  LF KYHP+R L LVYQPFA+GT+AILAY   K++TRKRN+ GY
Sbjct  30    SLISWNSMLTIGDYYNNLFKKYHPTRALALVYQPFALGTMAILAYNESKIDTRKRNITGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             I+FF  T ALLLLDL TSG+GGLG ++G+CV VA FGVADAHVQGGIVGDLSFM PEF+Q
Sbjct  90    IIFFASTLALLLLDLATSGEGGLGPFLGVCVFVALFGVADAHVQGGIVGDLSFMYPEFMQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGLAASG LTSGLRL+TKAAFE S +GLRKGV+LFLA+ T FEF+CI+LYAF FPKL
Sbjct  150   SFFAGLAASGALTSGLRLLTKAAFEKSHDGLRKGVMLFLAICTSFEFVCILLYAFFFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDL  717
              IVKY+R+KAASEGSKTV+ADLAAAGI T  +++ D+AK  ER+SNK+LF++N DYALDL
Sbjct  210   PIVKYFRSKAASEGSKTVSADLAAAGIQTKAAQAEDEAKQYERLSNKQLFIQNFDYALDL  269

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIYV+TLSIFPGFLYENTG H LG WY  VL+A YN+WDLI+RYIPL+K V+L+SRKGL
Sbjct  270   FLIYVLTLSIFPGFLYENTGQHRLGEWYSLVLIASYNVWDLIARYIPLVKCVKLESRKGL  329

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             MI I  RFLL+P FYFTAKYGDQGWMI L SFLGLTNGYLTVCV+T APKGYKGP  NAL
Sbjct  330   MITILCRFLLVPAFYFTAKYGDQGWMIFLTSFLGLTNGYLTVCVMTVAPKGYKGPEQNAL  389

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNS  1158
             GNILVL LL G+F+GVALDWLWLIG  
Sbjct  390   GNILVLFLLGGLFAGVALDWLWLIGKK  416



>ref|XP_010924037.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Elaeis guineensis]
Length=418

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/386 (72%), Positives = 331/386 (86%), Gaps = 2/386 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP+YHP+RVLTLVYQPFA+GT+AILAY   K+NTRKRNLAGY 
Sbjct  31    LFSWNSMLTIEDYYVYLFPRYHPTRVLTLVYQPFALGTLAILAYNESKINTRKRNLAGYT  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL +  L++LD+ TSG+GG+G +IGIC I  +FGVADAHVQGG+VGDL  MCPEF QS
Sbjct  91    LFFLSSLLLIVLDVATSGRGGIGVFIGICAISGAFGVADAHVQGGMVGDLFLMCPEFTQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE++ +GLRKG ++F A+S FFE LC++LYAF+FPKL+
Sbjct  151   FLAGLAASGVLTSALRLITKAAFENTQDGLRKGAMMFFAISAFFELLCVLLYAFIFPKLS  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSE--SVDDAKHVERVSNKKLFMENIDYALDL  717
             IVKYYR+KAASEGS TVAADLAAAG+    +  + +D K ++R+SNK+L  +N DYA+D+
Sbjct  211   IVKYYRSKAASEGSMTVAADLAAAGVQKQHDQGAEEDPKLLDRLSNKQLLSQNSDYAIDI  270

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIYV+TLSIFPGFL E+TG+H+LGSWY  VL+AMYN+WDLI RY+PL+K+++L  RK L
Sbjct  271   FLIYVLTLSIFPGFLSEDTGSHSLGSWYALVLIAMYNVWDLIGRYVPLVKQLKLTPRKVL  330

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             M+AI SRFLLIP FYFTAKYGDQGWMIML SFLGL+NGYLTVCVLTAAPKGYKGP  NAL
Sbjct  331   MVAIISRFLLIPAFYFTAKYGDQGWMIMLTSFLGLSNGYLTVCVLTAAPKGYKGPEQNAL  390

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LV+ LL GIFSGV LDWLWLIG 
Sbjct  391   GNLLVVFLLGGIFSGVTLDWLWLIGK  416



>ref|XP_006467919.1| PREDICTED: equilibrative nucleotide transporter 3-like [Citrus 
sinensis]
Length=419

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/387 (76%), Positives = 334/387 (86%), Gaps = 1/387 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL+SWNSML IGDYY  LF KYHP+R L LVYQPFA+GT+AILAY   K++TRKRN+ GY
Sbjct  30    SLISWNSMLIIGDYYNNLFKKYHPTRALALVYQPFALGTMAILAYNESKIDTRKRNITGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             I+FF  T ALLLLDL TSG+GGLG ++G+CV VA FGVADAHVQGGIVGDLSFM PEF+Q
Sbjct  90    IIFFASTLALLLLDLATSGEGGLGPFLGVCVFVALFGVADAHVQGGIVGDLSFMYPEFMQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGLAASG LTSGLRL+TKAAFE S +GLRKGV+LFLA+ T FEF+CI+LYAF FPKL
Sbjct  150   SFFAGLAASGALTSGLRLLTKAAFEKSHDGLRKGVMLFLAICTSFEFVCILLYAFFFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDL  717
              IVKY+R+KAASEGSKTV+ADLAAAGI T  +++ D+AK  ER+SNK+LF++N DYALDL
Sbjct  210   PIVKYFRSKAASEGSKTVSADLAAAGIQTKAAQAEDEAKQYERLSNKQLFIQNFDYALDL  269

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIYV+TLSIFPGFLYENTG H LG WY  VL+A YN+WDLI+RYIPL+K VEL+SRKGL
Sbjct  270   FLIYVLTLSIFPGFLYENTGQHRLGEWYSLVLIASYNVWDLIARYIPLVKCVELESRKGL  329

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             MI I  RFLL+P FYFTAKYGDQGWMI L SFLGLTNGYLTVCV+T APKGYKGP  NAL
Sbjct  330   MITILCRFLLVPAFYFTAKYGDQGWMIFLTSFLGLTNGYLTVCVMTVAPKGYKGPEQNAL  389

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNS  1158
             GNILVL LL G+F+GVALDWLWLIG  
Sbjct  390   GNILVLFLLGGLFAGVALDWLWLIGKK  416



>ref|XP_004134737.1| PREDICTED: equilibrative nucleotide transporter 3-like [Cucumis 
sativus]
 ref|XP_004155587.1| PREDICTED: equilibrative nucleotide transporter 3-like [Cucumis 
sativus]
Length=415

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/388 (73%), Positives = 326/388 (84%), Gaps = 3/388 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQLFP YHPSRVLTLVYQPFA GTIAILAY   K++TR+RN+ GY
Sbjct  31    SLVSWNSMLTISDYYYQLFPHYHPSRVLTLVYQPFAFGTIAILAYHEAKIDTRRRNIRGY  90

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFF+ T  L++LDL TSGKGG+G YI +CVIV SFGVADA VQGG+VGDLS MCPEF+Q
Sbjct  91    SLFFISTLLLIVLDLVTSGKGGIGPYIALCVIVGSFGVADAFVQGGMVGDLSLMCPEFIQ  150

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLAASG LTSGLRL+TKAAFE   +GLRKG ILFLA+S  FEFLC+ILYA VFPK+
Sbjct  151   SFMAGLAASGALTSGLRLITKAAFEDFHSGLRKGTILFLAISAAFEFLCVILYAIVFPKI  210

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              +VK+YR KAASEGSKTV++DLAAAGI   S   D     E +  K+LF +N DY   ++
Sbjct  211   PLVKFYRKKAASEGSKTVSSDLAAAGIQIQSNQEDK---TELLGKKQLFQKNADYLFGVF  267

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LGSWYP VL+AMYN+WDL+ RY+PLI  ++L+SRKGL+
Sbjct  268   LIYVLTLSIFPGFLYENTGEHQLGSWYPLVLIAMYNVWDLVGRYVPLINWLKLESRKGLL  327

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IAI SRFLLIP FYFTAKYGDQGWMI+LVSFLGL+NG+LTVCV TAAPKGYK P  NALG
Sbjct  328   IAILSRFLLIPAFYFTAKYGDQGWMILLVSFLGLSNGHLTVCVFTAAPKGYKAPEQNALG  387

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             N+LV+ LL GIF+GVALDWLW+IGN  F
Sbjct  388   NLLVMFLLGGIFTGVALDWLWIIGNGSF  415



>ref|XP_010106728.1| Equilibrative nucleoside transporter 4 [Morus notabilis]
 gb|EXC11596.1| Equilibrative nucleoside transporter 4 [Morus notabilis]
Length=422

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/388 (73%), Positives = 326/388 (84%), Gaps = 5/388 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WNSMLTIGDYYY+LFPKYHPSRVLTLVYQPFA+GT+AILA    K+NTR+RN+ GY
Sbjct  40    SLVAWNSMLTIGDYYYELFPKYHPSRVLTLVYQPFAVGTMAILACNEAKINTRRRNICGY  99

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFF+ TF L+++DL T G GG+  YIGICV+VASFGVADA VQGG+VGDL+FM PEF+Q
Sbjct  100   ALFFISTFLLIVVDLATHGNGGVVPYIGICVLVASFGVADALVQGGMVGDLAFMLPEFIQ  159

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLA SG LTSGLRLVT+AAF+ + +GLRKG +LFLA+S F EF+CI LYAFVFPKL
Sbjct  160   SFMAGLAGSGVLTSGLRLVTRAAFDKTDHGLRKGTLLFLAISAFSEFICIFLYAFVFPKL  219

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVK++R KAA EGSKTVA+DLAA GI   S+ +     V R+S KKL +ENIDYAL LY
Sbjct  220   PIVKHFRKKAALEGSKTVASDLAAVGIETQSDQL-----VVRMSKKKLILENIDYALGLY  274

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LG+WYP VL+AMYN+ DL+ R IPL+K + L+SRKG+ 
Sbjct  275   LIYVITLSIFPGFLYENTGNHQLGTWYPLVLMAMYNVLDLVGRCIPLVKCLNLESRKGIF  334

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
              +I +RFL IP FYFTAKY DQGWMIML S LGLTNGYLTVCVLTAAPKGYKGP  NALG
Sbjct  335   TSIIARFLFIPAFYFTAKYADQGWMIMLTSLLGLTNGYLTVCVLTAAPKGYKGPEQNALG  394

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             NILV+ LL GIFSGVALDWLWLIGN  F
Sbjct  395   NILVVFLLGGIFSGVALDWLWLIGNRSF  422



>ref|XP_002874833.1| hypothetical protein ARALYDRAFT_911781 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51092.1| hypothetical protein ARALYDRAFT_911781 [Arabidopsis lyrata subsp. 
lyrata]
Length=418

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/386 (71%), Positives = 326/386 (84%), Gaps = 0/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQ+FP YHPSRVLTLVYQPFA+GTI ILAY   K+NTRKRNL GY
Sbjct  30    SLVSWNSMLTIADYYYQVFPDYHPSRVLTLVYQPFALGTIVILAYHESKINTRKRNLIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + TF L++LDL T G+GG+G YIG+C +VASFG+ADA VQGG++GDLS MCPE +Q
Sbjct  90    ILFTISTFLLIVLDLATKGRGGIGPYIGLCAVVASFGLADATVQGGMIGDLSLMCPELVQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+ GLA +G LTS LRL+TKAAFE  ++GLRKG ++FLA+STF EFLC++LYA+VFPKL
Sbjct  150   SFMGGLAVAGALTSALRLITKAAFEKKNDGLRKGAMMFLAISTFIEFLCVMLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYYR KAASEGSKTV+ADLAAAGI   S+  DD    +R+SNK+L ++NIDYA++L+
Sbjct  210   PIVKYYRRKAASEGSKTVSADLAAAGIQNQSDLTDDDSKNQRLSNKELLIQNIDYAVNLF  269

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV TLSIFPGFLYENTG H LG+WY  VLVAMYN WDL+ RY  L+K +++++RK + 
Sbjct  270   LIYVCTLSIFPGFLYENTGQHGLGAWYALVLVAMYNCWDLVGRYTQLVKWLKIENRKLIT  329

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IA+ SR+LLIP FYFTAKYGDQGWMIMLVS LGLTNG+LTVC+LT AP GYKGP  NALG
Sbjct  330   IAVLSRYLLIPAFYFTAKYGDQGWMIMLVSVLGLTNGHLTVCILTTAPNGYKGPEQNALG  389

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N+LV+ LL GIF+GVALDWLWLIG  
Sbjct  390   NLLVIFLLGGIFAGVALDWLWLIGKK  415



>ref|XP_010924032.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010924033.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010924034.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010924036.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Elaeis guineensis]
Length=424

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/392 (71%), Positives = 331/392 (84%), Gaps = 8/392 (2%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP+YHP+RVLTLVYQPFA+GT+AILAY   K+NTRKRNLAGY 
Sbjct  31    LFSWNSMLTIEDYYVYLFPRYHPTRVLTLVYQPFALGTLAILAYNESKINTRKRNLAGYT  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL +  L++LD+ TSG+GG+G +IGIC I  +FGVADAHVQGG+VGDL  MCPEF QS
Sbjct  91    LFFLSSLLLIVLDVATSGRGGIGVFIGICAISGAFGVADAHVQGGMVGDLFLMCPEFTQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE++ +GLRKG ++F A+S FFE LC++LYAF+FPKL+
Sbjct  151   FLAGLAASGVLTSALRLITKAAFENTQDGLRKGAMMFFAISAFFELLCVLLYAFIFPKLS  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSE--------SVDDAKHVERVSNKKLFMENI  699
             IVKYYR+KAASEGS TVAADLAAAG+    +        + +D K ++R+SNK+L  +N 
Sbjct  211   IVKYYRSKAASEGSMTVAADLAAAGVQKQHDQGVCIFLKAEEDPKLLDRLSNKQLLSQNS  270

Query  700   DYALDLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVEL  879
             DYA+D++LIYV+TLSIFPGFL E+TG+H+LGSWY  VL+AMYN+WDLI RY+PL+K+++L
Sbjct  271   DYAIDIFLIYVLTLSIFPGFLSEDTGSHSLGSWYALVLIAMYNVWDLIGRYVPLVKQLKL  330

Query  880   KSRKGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKG  1059
               RK LM+AI SRFLLIP FYFTAKYGDQGWMIML SFLGL+NGYLTVCVLTAAPKGYKG
Sbjct  331   TPRKVLMVAIISRFLLIPAFYFTAKYGDQGWMIMLTSFLGLSNGYLTVCVLTAAPKGYKG  390

Query  1060  PAANALGNILVLCLLSGIFSGVALDWLWLIGN  1155
             P  NALGN+LV+ LL GIFSGV LDWLWLIG 
Sbjct  391   PEQNALGNLLVVFLLGGIFSGVTLDWLWLIGK  422



>ref|XP_006449192.1| hypothetical protein CICLE_v10017611mg, partial [Citrus clementina]
 gb|ESR62432.1| hypothetical protein CICLE_v10017611mg, partial [Citrus clementina]
Length=413

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/384 (76%), Positives = 333/384 (87%), Gaps = 1/384 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL+SWNSMLTIGDYY  LF KYHP+R LTLVYQPFA+GT+A LAY   K++TRKRN+ GY
Sbjct  30    SLISWNSMLTIGDYYNNLFKKYHPTRALTLVYQPFALGTMATLAYNESKIDTRKRNITGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              +FF  T ALLLLDL TSG+GGLG ++G+CV VA FGVADAHVQGGIVGDLSFM PEF+Q
Sbjct  90    TIFFASTLALLLLDLATSGEGGLGPFLGVCVFVALFGVADAHVQGGIVGDLSFMYPEFMQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGLAASG LTSGLRL+TKAAFE S +GLRKGV+LFLA+ T FEFLCI+LYAF FPKL
Sbjct  150   SFFAGLAASGALTSGLRLLTKAAFEKSHDGLRKGVMLFLAICTSFEFLCILLYAFFFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDL  717
              IVKY+R+KAASEGSKTV+ADLAAAGI T  +++ D+AK  ER+SNK+LF++N DYALDL
Sbjct  210   PIVKYFRSKAASEGSKTVSADLAAAGIQTKAAQAEDEAKQYERLSNKQLFIQNFDYALDL  269

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIYV+TLSIFPGFLYENTG H LG WY  VL+A YN+WDLI+RYIPL+K V+L+SRKGL
Sbjct  270   FLIYVLTLSIFPGFLYENTGQHRLGEWYSLVLIASYNVWDLIARYIPLVKCVKLESRKGL  329

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             MI I  RFLL+P FYFTAKYGDQGWMI L SFLGLTNGYLTVCV+T APKGYKGP  NAL
Sbjct  330   MITILCRFLLVPAFYFTAKYGDQGWMIFLTSFLGLTNGYLTVCVMTVAPKGYKGPEQNAL  389

Query  1078  GNILVLCLLSGIFSGVALDWLWLI  1149
             GNILVL LL G+F+GVALDWLWLI
Sbjct  390   GNILVLFLLGGLFAGVALDWLWLI  413



>ref|XP_008439926.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X7 [Cucumis melo]
Length=416

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/388 (73%), Positives = 326/388 (84%), Gaps = 3/388 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQLFP YHPSRVLTLVYQPFA+G IAILAY   K++TR RN+ GY
Sbjct  32    SLVSWNSMLTISDYYYQLFPHYHPSRVLTLVYQPFALGVIAILAYHEAKIDTRWRNIRGY  91

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFF+ T  L++LDL TSGKGG+G YI +CVIV SFGVADA VQGG+VGDLS MCPEF+Q
Sbjct  92    ALFFISTVLLIVLDLVTSGKGGIGPYIALCVIVGSFGVADAFVQGGMVGDLSLMCPEFIQ  151

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLAASG LTSGLRL+TKAAFE   +GLRKG ILFL++S  FEFLC++LYA VFPK+
Sbjct  152   SFMAGLAASGALTSGLRLITKAAFEDFHSGLRKGTILFLSISAAFEFLCVVLYAIVFPKI  211

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              +VK+YR KAASEGSKTV++DLAAAGI   S   D     E +S K+LF +N+DY   +Y
Sbjct  212   PLVKFYRKKAASEGSKTVSSDLAAAGIQIQSNQEDK---TEILSKKQLFQKNMDYLFGVY  268

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LGSWYP VL+AMYN+WDL+ RY+PLI  ++L+SRKGL+
Sbjct  269   LIYVLTLSIFPGFLYENTGEHQLGSWYPLVLIAMYNVWDLVGRYVPLINCLKLESRKGLL  328

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IAI SRFLL+P FYFTAKYGDQGWMI+L SFLGL+NG+LTVCV TAAPKGYK P  NALG
Sbjct  329   IAILSRFLLVPAFYFTAKYGDQGWMILLTSFLGLSNGHLTVCVFTAAPKGYKAPEQNALG  388

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             N+LV+ LL GIFSGVALDWLW+IGN  F
Sbjct  389   NLLVMFLLGGIFSGVALDWLWIIGNGSF  416



>ref|XP_008439927.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X8 [Cucumis melo]
Length=415

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/388 (73%), Positives = 326/388 (84%), Gaps = 3/388 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQLFP YHPSRVLTLVYQPFA+G IAILAY   K++TR RN+ GY
Sbjct  31    SLVSWNSMLTISDYYYQLFPHYHPSRVLTLVYQPFALGVIAILAYHEAKIDTRWRNIRGY  90

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFF+ T  L++LDL TSGKGG+G YI +CVIV SFGVADA VQGG+VGDLS MCPEF+Q
Sbjct  91    ALFFISTVLLIVLDLVTSGKGGIGPYIALCVIVGSFGVADAFVQGGMVGDLSLMCPEFIQ  150

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLAASG LTSGLRL+TKAAFE   +GLRKG ILFL++S  FEFLC++LYA VFPK+
Sbjct  151   SFMAGLAASGALTSGLRLITKAAFEDFHSGLRKGTILFLSISAAFEFLCVVLYAIVFPKI  210

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              +VK+YR KAASEGSKTV++DLAAAGI   S   D     E +S K+LF +N+DY   +Y
Sbjct  211   PLVKFYRKKAASEGSKTVSSDLAAAGIQIQSNQEDK---TEILSKKQLFQKNMDYLFGVY  267

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LGSWYP VL+AMYN+WDL+ RY+PLI  ++L+SRKGL+
Sbjct  268   LIYVLTLSIFPGFLYENTGEHQLGSWYPLVLIAMYNVWDLVGRYVPLINCLKLESRKGLL  327

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IAI SRFLL+P FYFTAKYGDQGWMI+L SFLGL+NG+LTVCV TAAPKGYK P  NALG
Sbjct  328   IAILSRFLLVPAFYFTAKYGDQGWMILLTSFLGLSNGHLTVCVFTAAPKGYKAPEQNALG  387

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             N+LV+ LL GIFSGVALDWLW+IGN  F
Sbjct  388   NLLVMFLLGGIFSGVALDWLWIIGNGSF  415



>ref|XP_008439925.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X6 [Cucumis melo]
Length=430

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/388 (73%), Positives = 326/388 (84%), Gaps = 3/388 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQLFP YHPSRVLTLVYQPFA+G IAILAY   K++TR RN+ GY
Sbjct  46    SLVSWNSMLTISDYYYQLFPHYHPSRVLTLVYQPFALGVIAILAYHEAKIDTRWRNIRGY  105

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFF+ T  L++LDL TSGKGG+G YI +CVIV SFGVADA VQGG+VGDLS MCPEF+Q
Sbjct  106   ALFFISTVLLIVLDLVTSGKGGIGPYIALCVIVGSFGVADAFVQGGMVGDLSLMCPEFIQ  165

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLAASG LTSGLRL+TKAAFE   +GLRKG ILFL++S  FEFLC++LYA VFPK+
Sbjct  166   SFMAGLAASGALTSGLRLITKAAFEDFHSGLRKGTILFLSISAAFEFLCVVLYAIVFPKI  225

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              +VK+YR KAASEGSKTV++DLAAAGI   S   D     E +S K+LF +N+DY   +Y
Sbjct  226   PLVKFYRKKAASEGSKTVSSDLAAAGIQIQSNQEDK---TEILSKKQLFQKNMDYLFGVY  282

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LGSWYP VL+AMYN+WDL+ RY+PLI  ++L+SRKGL+
Sbjct  283   LIYVLTLSIFPGFLYENTGEHQLGSWYPLVLIAMYNVWDLVGRYVPLINCLKLESRKGLL  342

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IAI SRFLL+P FYFTAKYGDQGWMI+L SFLGL+NG+LTVCV TAAPKGYK P  NALG
Sbjct  343   IAILSRFLLVPAFYFTAKYGDQGWMILLTSFLGLSNGHLTVCVFTAAPKGYKAPEQNALG  402

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             N+LV+ LL GIFSGVALDWLW+IGN  F
Sbjct  403   NLLVMFLLGGIFSGVALDWLWIIGNGSF  430



>ref|XP_008439924.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X5 [Cucumis melo]
Length=431

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/388 (73%), Positives = 326/388 (84%), Gaps = 3/388 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQLFP YHPSRVLTLVYQPFA+G IAILAY   K++TR RN+ GY
Sbjct  47    SLVSWNSMLTISDYYYQLFPHYHPSRVLTLVYQPFALGVIAILAYHEAKIDTRWRNIRGY  106

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFF+ T  L++LDL TSGKGG+G YI +CVIV SFGVADA VQGG+VGDLS MCPEF+Q
Sbjct  107   ALFFISTVLLIVLDLVTSGKGGIGPYIALCVIVGSFGVADAFVQGGMVGDLSLMCPEFIQ  166

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLAASG LTSGLRL+TKAAFE   +GLRKG ILFL++S  FEFLC++LYA VFPK+
Sbjct  167   SFMAGLAASGALTSGLRLITKAAFEDFHSGLRKGTILFLSISAAFEFLCVVLYAIVFPKI  226

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              +VK+YR KAASEGSKTV++DLAAAGI   S   D     E +S K+LF +N+DY   +Y
Sbjct  227   PLVKFYRKKAASEGSKTVSSDLAAAGIQIQSNQEDK---TEILSKKQLFQKNMDYLFGVY  283

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LGSWYP VL+AMYN+WDL+ RY+PLI  ++L+SRKGL+
Sbjct  284   LIYVLTLSIFPGFLYENTGEHQLGSWYPLVLIAMYNVWDLVGRYVPLINCLKLESRKGLL  343

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IAI SRFLL+P FYFTAKYGDQGWMI+L SFLGL+NG+LTVCV TAAPKGYK P  NALG
Sbjct  344   IAILSRFLLVPAFYFTAKYGDQGWMILLTSFLGLSNGHLTVCVFTAAPKGYKAPEQNALG  403

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             N+LV+ LL GIFSGVALDWLW+IGN  F
Sbjct  404   NLLVMFLLGGIFSGVALDWLWIIGNGSF  431



>gb|KGN49174.1| hypothetical protein Csa_6G516820 [Cucumis sativus]
Length=415

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/388 (73%), Positives = 326/388 (84%), Gaps = 3/388 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQLFP YHPSRVLTLVYQPFA GTIAILAY   K++TR+RN+ GY
Sbjct  31    SLVSWNSMLTISDYYYQLFPHYHPSRVLTLVYQPFAFGTIAILAYHEAKIDTRRRNIRGY  90

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFF+ T  L++LDL TSGKGG+G YI +CVIV SFGVADA VQGG+VGDLS MCPEF+Q
Sbjct  91    SLFFISTLLLIVLDLVTSGKGGIGPYIALCVIVGSFGVADAFVQGGMVGDLSLMCPEFIQ  150

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLAASG LTSGLRL+TKAAFE   +GLRKG ILFLA+S  FEFLC+ILYA VFPK+
Sbjct  151   SFMAGLAASGALTSGLRLITKAAFEDFHSGLRKGTILFLAISAAFEFLCVILYAIVFPKI  210

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              +VK+YR KAASEGSKTV++DLAAAGI   S   D     E +  K+LF +N DY   ++
Sbjct  211   PLVKFYRKKAASEGSKTVSSDLAAAGIQIQSNQEDK---TELLGKKQLFQKNADYLFGVF  267

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LGSWYP VL+AMYN+WDL+ RY+PLI  ++L+SRKGL+
Sbjct  268   LIYVLTLSIFPGFLYENTGEHQLGSWYPLVLIAMYNVWDLVGRYVPLINWLKLESRKGLL  327

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IAI SRFLLIP FYFTAKYGDQGWMI+LVSFLGL+NG+LTVCV TAAPKGYK P  NALG
Sbjct  328   IAILSRFLLIPAFYFTAKYGDQGWMILLVSFLGLSNGHLTVCVFTAAPKGYKAPEQNALG  387

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             N+LV+ L+ GIF+GV+LDWLW+IGN  F
Sbjct  388   NLLVIFLVGGIFTGVSLDWLWIIGNGSF  415



>ref|XP_006449191.1| hypothetical protein CICLE_v10015491mg [Citrus clementina]
 gb|ESR62431.1| hypothetical protein CICLE_v10015491mg [Citrus clementina]
Length=400

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/387 (75%), Positives = 334/387 (86%), Gaps = 1/387 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL+SW+SML IGDYY  LF KYHP+R LTLVYQPFA+GT+AILAY   K++TRKRN+ GY
Sbjct  11    SLISWSSMLIIGDYYNNLFKKYHPTRALTLVYQPFALGTMAILAYNESKIDTRKRNITGY  70

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             I+FF  T ALLLLDL TSG+GGLG ++G+CV VA FGVADAHV+GGIVGDLSFM PEF+Q
Sbjct  71    IIFFASTLALLLLDLATSGEGGLGPFLGVCVFVALFGVADAHVRGGIVGDLSFMYPEFMQ  130

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGLAASG LTSGLRL+TKAAFE S +GLRKGV+LFLA+ T FEFLCI+LYAF FPKL
Sbjct  131   SFFAGLAASGALTSGLRLLTKAAFEKSHDGLRKGVMLFLAICTSFEFLCILLYAFFFPKL  190

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDL  717
              IVKY+R+KAASEGSKTV+ADLAAAGI T   ++ D+AK  ER+SNK+LF++N DYALDL
Sbjct  191   PIVKYFRSKAASEGSKTVSADLAAAGIQTKAVQAEDEAKQYERLSNKQLFIQNFDYALDL  250

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIYV+TLSIFPGFLYENTG H LG WY  VL+A YN+WDLI+RYIPL+K V+L+SRKGL
Sbjct  251   FLIYVLTLSIFPGFLYENTGQHRLGEWYSLVLIASYNVWDLIARYIPLVKCVKLESRKGL  310

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             MI I  RFLL+P FYFTAKYGDQGWMI L SFLGLTNGYLTVCV+T APKGYKGP  NAL
Sbjct  311   MITILCRFLLVPAFYFTAKYGDQGWMIFLTSFLGLTNGYLTVCVMTVAPKGYKGPEQNAL  370

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNS  1158
             GNILVL LL G+F+GVALDWLWLIG  
Sbjct  371   GNILVLFLLGGLFAGVALDWLWLIGKK  397



>ref|XP_008439923.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X4 [Cucumis melo]
Length=436

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/388 (73%), Positives = 326/388 (84%), Gaps = 3/388 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQLFP YHPSRVLTLVYQPFA+G IAILAY   K++TR RN+ GY
Sbjct  52    SLVSWNSMLTISDYYYQLFPHYHPSRVLTLVYQPFALGVIAILAYHEAKIDTRWRNIRGY  111

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFF+ T  L++LDL TSGKGG+G YI +CVIV SFGVADA VQGG+VGDLS MCPEF+Q
Sbjct  112   ALFFISTVLLIVLDLVTSGKGGIGPYIALCVIVGSFGVADAFVQGGMVGDLSLMCPEFIQ  171

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLAASG LTSGLRL+TKAAFE   +GLRKG ILFL++S  FEFLC++LYA VFPK+
Sbjct  172   SFMAGLAASGALTSGLRLITKAAFEDFHSGLRKGTILFLSISAAFEFLCVVLYAIVFPKI  231

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              +VK+YR KAASEGSKTV++DLAAAGI   S   D     E +S K+LF +N+DY   +Y
Sbjct  232   PLVKFYRKKAASEGSKTVSSDLAAAGIQIQSNQEDKT---EILSKKQLFQKNMDYLFGVY  288

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LGSWYP VL+AMYN+WDL+ RY+PLI  ++L+SRKGL+
Sbjct  289   LIYVLTLSIFPGFLYENTGEHQLGSWYPLVLIAMYNVWDLVGRYVPLINCLKLESRKGLL  348

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IAI SRFLL+P FYFTAKYGDQGWMI+L SFLGL+NG+LTVCV TAAPKGYK P  NALG
Sbjct  349   IAILSRFLLVPAFYFTAKYGDQGWMILLTSFLGLSNGHLTVCVFTAAPKGYKAPEQNALG  408

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             N+LV+ LL GIFSGVALDWLW+IGN  F
Sbjct  409   NLLVMFLLGGIFSGVALDWLWIIGNGSF  436



>ref|XP_008439922.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X3 [Cucumis melo]
Length=437

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/388 (73%), Positives = 326/388 (84%), Gaps = 3/388 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQLFP YHPSRVLTLVYQPFA+G IAILAY   K++TR RN+ GY
Sbjct  53    SLVSWNSMLTISDYYYQLFPHYHPSRVLTLVYQPFALGVIAILAYHEAKIDTRWRNIRGY  112

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFF+ T  L++LDL TSGKGG+G YI +CVIV SFGVADA VQGG+VGDLS MCPEF+Q
Sbjct  113   ALFFISTVLLIVLDLVTSGKGGIGPYIALCVIVGSFGVADAFVQGGMVGDLSLMCPEFIQ  172

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLAASG LTSGLRL+TKAAFE   +GLRKG ILFL++S  FEFLC++LYA VFPK+
Sbjct  173   SFMAGLAASGALTSGLRLITKAAFEDFHSGLRKGTILFLSISAAFEFLCVVLYAIVFPKI  232

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              +VK+YR KAASEGSKTV++DLAAAGI   S   D     E +S K+LF +N+DY   +Y
Sbjct  233   PLVKFYRKKAASEGSKTVSSDLAAAGIQIQSNQEDKT---EILSKKQLFQKNMDYLFGVY  289

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LGSWYP VL+AMYN+WDL+ RY+PLI  ++L+SRKGL+
Sbjct  290   LIYVLTLSIFPGFLYENTGEHQLGSWYPLVLIAMYNVWDLVGRYVPLINCLKLESRKGLL  349

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IAI SRFLL+P FYFTAKYGDQGWMI+L SFLGL+NG+LTVCV TAAPKGYK P  NALG
Sbjct  350   IAILSRFLLVPAFYFTAKYGDQGWMILLTSFLGLSNGHLTVCVFTAAPKGYKAPEQNALG  409

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             N+LV+ LL GIFSGVALDWLW+IGN  F
Sbjct  410   NLLVMFLLGGIFSGVALDWLWIIGNGSF  437



>ref|XP_007149910.1| hypothetical protein PHAVU_005G109300g [Phaseolus vulgaris]
 ref|XP_007149911.1| hypothetical protein PHAVU_005G109300g [Phaseolus vulgaris]
 gb|ESW21904.1| hypothetical protein PHAVU_005G109300g [Phaseolus vulgaris]
 gb|ESW21905.1| hypothetical protein PHAVU_005G109300g [Phaseolus vulgaris]
Length=414

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/385 (73%), Positives = 328/385 (85%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFPKYHPSRVLTLVYQPFA+GT+AILAY   K+NTR RN+ GYI
Sbjct  28    LFSWNSMLTIEDYYIYLFPKYHPSRVLTLVYQPFAVGTLAILAYNEAKINTRIRNMFGYI  87

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ T  +L+++  TSGKGGLG +I IC I  +FGVADAHVQGG+VGDLS+M PEF+QS
Sbjct  88    LFFISTLLVLIVNSATSGKGGLGIFIVICAISGAFGVADAHVQGGMVGDLSYMHPEFIQS  147

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAF+HSS+GLRKG ILF A+STFFE LC++LYAF+FPKL 
Sbjct  148   FLAGLAASGVLTSALRLITKAAFDHSSDGLRKGAILFFAISTFFELLCVVLYAFIFPKLP  207

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR+KAASEGSKTV+ADLAA GI T P    ++ K  ER  NK+L +ENIDYALD++
Sbjct  208   IVKYYRSKAASEGSKTVSADLAAGGIRTLPGTDKENTKDPERKGNKQLLLENIDYALDMF  267

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIY++TLSIFPGFL E+TG+H+LG+WY  VL+AMYN+ DLI RYIPL+K ++L+SRK + 
Sbjct  268   LIYLLTLSIFPGFLSEDTGSHSLGTWYALVLIAMYNVSDLIGRYIPLLKCLKLESRKLIT  327

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             + I SRFLL+P FYFTAKYGDQGWMIML SFLGL+NGYLTVCVLT+APKGYKGP  NALG
Sbjct  328   VTILSRFLLVPAFYFTAKYGDQGWMIMLTSFLGLSNGYLTVCVLTSAPKGYKGPEQNALG  387

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             NILVL LL GIF+GV LDWLWLIG 
Sbjct  388   NILVLFLLGGIFAGVTLDWLWLIGK  412



>ref|XP_009402883.1| PREDICTED: equilibrative nucleotide transporter 3-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009402886.1| PREDICTED: equilibrative nucleotide transporter 3-like [Musa 
acuminata subsp. malaccensis]
Length=418

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/387 (72%), Positives = 326/387 (84%), Gaps = 2/387 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL SWNSMLTI DYY  LFPKYHP+RVLTLVYQPFA+ T A+LAY   K NTR RNLAGY
Sbjct  30    SLFSWNSMLTIEDYYANLFPKYHPTRVLTLVYQPFALVTTAVLAYHEAKTNTRLRNLAGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILFF+ + AL++LD+ TSGKGG+G +IG+C++ A+FG AD HVQGG+VGDLS M PEF+Q
Sbjct  90    ILFFVSSLALVVLDVATSGKGGIGAFIGVCIVSAAFGTADGHVQGGMVGDLSLMSPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLAASGTLTS LRL+TKAAF+ S +GLRKG  LF AVS FFE LC+ LYAFVFPKL
Sbjct  150   SFMAGLAASGTLTSALRLITKAAFDGSQDGLRKGATLFFAVSAFFELLCVFLYAFVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITA--PSESVDDAKHVERVSNKKLFMENIDYALD  714
              IVKYYRAKAASEGS+TVAADLAAAGI A   + + +D K +ER+SNK+L  +NIDYA+D
Sbjct  210   PIVKYYRAKAASEGSRTVAADLAAAGIEALPDTGTEEDPKRLERLSNKQLLAQNIDYAID  269

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             +YLIYV+TLSIFPGFL E+TG+HNLGSWY  VL+AMYN+WDLI RY+PLIK ++L SRKG
Sbjct  270   IYLIYVLTLSIFPGFLSEDTGSHNLGSWYALVLIAMYNVWDLIGRYVPLIKCLKLTSRKG  329

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LM A  +RFL IP FYFT+KYG +GWMIML S LGLTNGYLTVCVLT AP GYKGP  NA
Sbjct  330   LMAATLARFLFIPAFYFTSKYGAEGWMIMLTSVLGLTNGYLTVCVLTDAPNGYKGPEQNA  389

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGN  1155
             LGN+LV  L++G+FSGVALDWLWLIG 
Sbjct  390   LGNLLVAFLIAGLFSGVALDWLWLIGK  416



>ref|XP_008439921.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Cucumis melo]
Length=446

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/388 (73%), Positives = 326/388 (84%), Gaps = 3/388 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQLFP YHPSRVLTLVYQPFA+G IAILAY   K++TR RN+ GY
Sbjct  62    SLVSWNSMLTISDYYYQLFPHYHPSRVLTLVYQPFALGVIAILAYHEAKIDTRWRNIRGY  121

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFF+ T  L++LDL TSGKGG+G YI +CVIV SFGVADA VQGG+VGDLS MCPEF+Q
Sbjct  122   ALFFISTVLLIVLDLVTSGKGGIGPYIALCVIVGSFGVADAFVQGGMVGDLSLMCPEFIQ  181

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLAASG LTSGLRL+TKAAFE   +GLRKG ILFL++S  FEFLC++LYA VFPK+
Sbjct  182   SFMAGLAASGALTSGLRLITKAAFEDFHSGLRKGTILFLSISAAFEFLCVVLYAIVFPKI  241

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              +VK+YR KAASEGSKTV++DLAAAGI   S   D     E +S K+LF +N+DY   +Y
Sbjct  242   PLVKFYRKKAASEGSKTVSSDLAAAGIQIQSNQEDKT---EILSKKQLFQKNMDYLFGVY  298

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LGSWYP VL+AMYN+WDL+ RY+PLI  ++L+SRKGL+
Sbjct  299   LIYVLTLSIFPGFLYENTGEHQLGSWYPLVLIAMYNVWDLVGRYVPLINCLKLESRKGLL  358

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IAI SRFLL+P FYFTAKYGDQGWMI+L SFLGL+NG+LTVCV TAAPKGYK P  NALG
Sbjct  359   IAILSRFLLVPAFYFTAKYGDQGWMILLTSFLGLSNGHLTVCVFTAAPKGYKAPEQNALG  418

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             N+LV+ LL GIFSGVALDWLW+IGN  F
Sbjct  419   NLLVMFLLGGIFSGVALDWLWIIGNGSF  446



>ref|XP_008439920.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Cucumis melo]
Length=447

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/388 (73%), Positives = 326/388 (84%), Gaps = 3/388 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQLFP YHPSRVLTLVYQPFA+G IAILAY   K++TR RN+ GY
Sbjct  63    SLVSWNSMLTISDYYYQLFPHYHPSRVLTLVYQPFALGVIAILAYHEAKIDTRWRNIRGY  122

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFF+ T  L++LDL TSGKGG+G YI +CVIV SFGVADA VQGG+VGDLS MCPEF+Q
Sbjct  123   ALFFISTVLLIVLDLVTSGKGGIGPYIALCVIVGSFGVADAFVQGGMVGDLSLMCPEFIQ  182

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLAASG LTSGLRL+TKAAFE   +GLRKG ILFL++S  FEFLC++LYA VFPK+
Sbjct  183   SFMAGLAASGALTSGLRLITKAAFEDFHSGLRKGTILFLSISAAFEFLCVVLYAIVFPKI  242

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              +VK+YR KAASEGSKTV++DLAAAGI   S   D     E +S K+LF +N+DY   +Y
Sbjct  243   PLVKFYRKKAASEGSKTVSSDLAAAGIQIQSNQEDKT---EILSKKQLFQKNMDYLFGVY  299

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LGSWYP VL+AMYN+WDL+ RY+PLI  ++L+SRKGL+
Sbjct  300   LIYVLTLSIFPGFLYENTGEHQLGSWYPLVLIAMYNVWDLVGRYVPLINCLKLESRKGLL  359

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IAI SRFLL+P FYFTAKYGDQGWMI+L SFLGL+NG+LTVCV TAAPKGYK P  NALG
Sbjct  360   IAILSRFLLVPAFYFTAKYGDQGWMILLTSFLGLSNGHLTVCVFTAAPKGYKAPEQNALG  419

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             N+LV+ LL GIFSGVALDWLW+IGN  F
Sbjct  420   NLLVMFLLGGIFSGVALDWLWIIGNGSF  447



>gb|KDP24206.1| hypothetical protein JCGZ_25863 [Jatropha curcas]
Length=418

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/386 (72%), Positives = 325/386 (84%), Gaps = 2/386 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP+YHP+RVLTLVYQPFA GT+AILAY   KLNTRKRN++GYI
Sbjct  31    LFSWNSMLTIEDYYGYLFPRYHPARVLTLVYQPFAFGTLAILAYNEAKLNTRKRNVSGYI  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ +  +L+LDL TSG+GGLG +IGICVI  +FGVADAHVQGG++GDLS M PE LQS
Sbjct  91    LFFISSLLVLILDLATSGRGGLGTFIGICVISGTFGVADAHVQGGMIGDLSLMKPELLQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAG+AASG +TSGLR +TKAAFE S +GLRKG I+F A+S FFEFLC+ LYA+VFPKL 
Sbjct  151   FLAGMAASGIITSGLRFITKAAFEDSKDGLRKGAIVFFAISAFFEFLCVFLYAYVFPKLP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITA--PSESVDDAKHVERVSNKKLFMENIDYALDL  717
             IVKYYR+KAASEGSKTV+ADLAAAGI      E+ +D K +ER+SNK L +ENIDY +D+
Sbjct  211   IVKYYRSKAASEGSKTVSADLAAAGIRTFLKEEAEEDPKKLERLSNKALLLENIDYVVDM  270

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             + IYV+TLSIFPGFL E+TG+H+LG+WY  VL+AM+N+WDLI R IPL+K ++L+SRKGL
Sbjct  271   FSIYVLTLSIFPGFLSEDTGSHSLGAWYALVLIAMFNLWDLIGRNIPLVKSLKLESRKGL  330

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             MIAI SRFLLIP FYFTAK  DQGWMIML SFLGLTNGY TVCVLT+APKGYKGP  NAL
Sbjct  331   MIAILSRFLLIPAFYFTAKNADQGWMIMLTSFLGLTNGYFTVCVLTSAPKGYKGPEQNAL  390

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN L L LL GIF+G  LDWLWLIG 
Sbjct  391   GNFLALSLLGGIFAGAMLDWLWLIGK  416



>ref|XP_008230198.1| PREDICTED: equilibrative nucleotide transporter 3-like [Prunus 
mume]
Length=417

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/385 (72%), Positives = 330/385 (86%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP+YHP+RVLTLVYQPFA+GTI IL+Y   K+NTRKRNL GY+
Sbjct  31    LFSWNSMLTIEDYYVDLFPRYHPARVLTLVYQPFALGTIIILSYHEAKMNTRKRNLFGYV  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ +  +L+LDL TSG+GGLG +IGIC I A+FG+ADAHVQGG+VGDLSFM  E +QS
Sbjct  91    LFFITSLLVLVLDLATSGRGGLGTFIGICAISAAFGIADAHVQGGMVGDLSFMSGELIQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE+S NGLRKG ILF A+S+ FE LC+ILYAF FPKL 
Sbjct  151   FLAGLAASGALTSALRLITKAAFENSHNGLRKGAILFFAISSIFELLCVILYAFAFPKLP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR+KAASEGSKTV+ADLAA GI T P    ++ + +ER+ NK+L ++NIDYALD++
Sbjct  211   IVKYYRSKAASEGSKTVSADLAAGGIQTLPEADEEEQRDLERLGNKQLLLQNIDYALDMF  270

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIY +TLSIFPGFL+E+TG+H+LG+WY  VL+AMYN+ DLI RYIPL+K ++L++R+GLM
Sbjct  271   LIYALTLSIFPGFLFEDTGSHSLGAWYALVLIAMYNVSDLIGRYIPLVKFLKLENRRGLM  330

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             + I SRFLL+P FYFTAKYGDQGWMIML SFLGL+NGYLTVCVLT+APKGYKGP  NALG
Sbjct  331   VVILSRFLLVPAFYFTAKYGDQGWMIMLTSFLGLSNGYLTVCVLTSAPKGYKGPEQNALG  390

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LV+ LL GIF+GV LDWLWLIG 
Sbjct  391   NLLVVFLLVGIFAGVTLDWLWLIGK  415



>ref|XP_007216101.1| hypothetical protein PRUPE_ppa018615mg [Prunus persica]
 gb|EMJ17300.1| hypothetical protein PRUPE_ppa018615mg [Prunus persica]
Length=417

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/385 (72%), Positives = 329/385 (85%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP+YHP+RVLTLVYQPFA+GTI IL+Y   K+NTRKRNL GY+
Sbjct  31    LFSWNSMLTIEDYYVDLFPRYHPARVLTLVYQPFALGTIIILSYHEAKMNTRKRNLFGYV  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ +  +L+LDL TSG+GGLG +IGIC I A+FG+ADAHVQGG+VGDLSFM  E +QS
Sbjct  91    LFFITSLLVLVLDLATSGRGGLGTFIGICAISAAFGIADAHVQGGMVGDLSFMSGELIQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE+S NGLRKG ILF A+S+ FE LC+ILYAF FPKL 
Sbjct  151   FLAGLAASGALTSALRLITKAAFENSHNGLRKGAILFFAISSIFELLCVILYAFAFPKLP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR+KAASEGSKTV+ADLAA GI T P    ++ + +ER+ NK+L ++NIDYALD++
Sbjct  211   IVKYYRSKAASEGSKTVSADLAAGGIQTLPEADEEEQRDLERLGNKQLLLQNIDYALDMF  270

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIY +TLSIFPGFL E+TG+H+LG+WY  VL+AMYN+ DLI RYIPL+K ++L++R+GLM
Sbjct  271   LIYALTLSIFPGFLSEDTGSHSLGTWYALVLIAMYNVSDLIGRYIPLVKFLKLENRRGLM  330

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             + I SRFLL+P FYFTAKYGDQGWMIML SFLGL+NGYLTVCVLT+APKGYKGP  NALG
Sbjct  331   VVILSRFLLVPAFYFTAKYGDQGWMIMLTSFLGLSNGYLTVCVLTSAPKGYKGPEQNALG  390

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LV+ LL GIF+GV LDWLWLIG 
Sbjct  391   NLLVVFLLVGIFAGVTLDWLWLIGK  415



>emb|CDY46379.1| BnaA09g19930D [Brassica napus]
Length=418

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/386 (70%), Positives = 330/386 (85%), Gaps = 0/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             +LVSWNS+LTI DYYY +FP YHPSRVL LVYQPFA+GTI ILAY   K++TRKRNL GY
Sbjct  30    ALVSWNSILTIADYYYLVFPDYHPSRVLPLVYQPFALGTIVILAYHESKIDTRKRNLFGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + TF L++LDL T G+GG+G YIG+C+IVASFG++DA VQGG++GDLS MCPEF+Q
Sbjct  90    ILFTISTFLLIVLDLATKGRGGVGPYIGLCLIVASFGLSDATVQGGMIGDLSLMCPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLA +G LTSGLRL+TKAAF++S++G RKG ++FL +STF EFLC++LYA+VFPKL
Sbjct  150   SFMAGLAVAGALTSGLRLITKAAFDNSNDGQRKGAMIFLGISTFIEFLCVMLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYYR KAA EGSKTV+ADLAAAGI   S+  DD    +R+SNK+L +ENIDYA++L 
Sbjct  210   PIVKYYRRKAALEGSKTVSADLAAAGIQNQSDLTDDDSKNQRLSNKELLLENIDYAVNLA  269

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LG+WY  VLVAMYN WDL+ RY PL+K +++++RK L 
Sbjct  270   LIYVLTLSIFPGFLYENTGQHGLGAWYALVLVAMYNCWDLVGRYTPLVKWLKIENRKLLT  329

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             +A+ SR+LL+P FYFTAKYGDQGWMIML+S LGLTNG+LTVC+LTAAPKGYKGP  NALG
Sbjct  330   VAVLSRYLLVPAFYFTAKYGDQGWMIMLISVLGLTNGHLTVCILTAAPKGYKGPEQNALG  389

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N+LV+ LL GIF+GVALDWLWLIG  
Sbjct  390   NLLVIFLLGGIFAGVALDWLWLIGKK  415



>ref|XP_010431742.1| PREDICTED: equilibrative nucleotide transporter 3 isoform X2 
[Camelina sativa]
Length=418

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/386 (70%), Positives = 324/386 (84%), Gaps = 0/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WNSMLTI DYYYQ+FP YHPSRVLTLVYQPFA+GTI IL Y   K+NTRKRNL GY
Sbjct  30    SLVAWNSMLTIADYYYQVFPDYHPSRVLTLVYQPFALGTIVILTYHESKMNTRKRNLIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LF + TF L++LDL T G+GG+G YIG+C +VASFG+ADA VQGG++GDLS MCPE +Q
Sbjct  90    TLFTISTFLLIVLDLATKGRGGVGPYIGLCAVVASFGLADATVQGGMIGDLSLMCPELVQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+ GLA +G LTS LRL TKAAFE S++GLRKG ++FLA+STF E LC++LYA+VFPKL
Sbjct  150   SFMVGLAVAGALTSALRLTTKAAFEKSNDGLRKGAMIFLAISTFIELLCVLLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYYR KAASEGSKTV+ADLAAAGI  PS+  DD    +R+SNK+L ++NIDYA++L+
Sbjct  210   PIVKYYRRKAASEGSKTVSADLAAAGIQNPSDLTDDDSKNQRLSNKELLLQNIDYAVNLF  269

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV TLSIFPGFLYENTG H LG WY  VLVAMYN WDL+ RY PL+K ++ ++RK + 
Sbjct  270   LIYVCTLSIFPGFLYENTGKHGLGDWYALVLVAMYNCWDLVGRYTPLLKWLKFENRKLIT  329

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IA+ SR+LLIP FYFTAKYGDQG+MIML+S LGLTNG+LTVC++T APKGYKGP  NALG
Sbjct  330   IAVLSRYLLIPAFYFTAKYGDQGYMIMLISVLGLTNGHLTVCIMTIAPKGYKGPEQNALG  389

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N+LV+ LL GIF+GVALDWLWLIG  
Sbjct  390   NLLVIFLLGGIFAGVALDWLWLIGKK  415



>ref|XP_009114502.1| PREDICTED: equilibrative nucleotide transporter 3 [Brassica rapa]
 ref|XP_009114503.1| PREDICTED: equilibrative nucleotide transporter 3 [Brassica rapa]
 ref|XP_009114504.1| PREDICTED: equilibrative nucleotide transporter 3 [Brassica rapa]
Length=418

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/386 (70%), Positives = 329/386 (85%), Gaps = 0/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             +LVSWNS+LTI DYYY +FP YHPSRVL LVYQPFA+GTI ILAY   K++TRKRNL GY
Sbjct  30    ALVSWNSILTIADYYYLVFPDYHPSRVLPLVYQPFALGTIVILAYHESKIDTRKRNLFGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + TF L++LDL T G+GG+G YIG+C+IVASFG++DA VQGG++GDLS MCPEF+Q
Sbjct  90    ILFTISTFLLIVLDLATKGRGGVGPYIGLCLIVASFGLSDATVQGGMIGDLSLMCPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLA +G LTSGLRL+TKAAF++S++G RKG ++FL +STF EFLC++LYA+VFPKL
Sbjct  150   SFMAGLAVAGALTSGLRLITKAAFDNSNDGQRKGAMIFLGISTFIEFLCVMLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYYR KAA EGSKTV+ADLAAAGI   S+  DD    +R+SNK+L +ENIDYA++L 
Sbjct  210   PIVKYYRRKAALEGSKTVSADLAAAGIQNQSDLTDDDSKNQRLSNKELLLENIDYAVNLA  269

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LG+WY  VLVAMYN WDL+ RY PL+K + +++RK L 
Sbjct  270   LIYVLTLSIFPGFLYENTGQHGLGAWYALVLVAMYNCWDLVGRYTPLVKWLNIENRKLLT  329

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             +A+ SR+LL+P FYFTAKYGDQGWMIML+S LGLTNG+LTVC+LTAAPKGYKGP  NALG
Sbjct  330   VAVLSRYLLVPAFYFTAKYGDQGWMIMLISVLGLTNGHLTVCILTAAPKGYKGPEQNALG  389

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N+LV+ LL GIF+GVALDWLWLIG  
Sbjct  390   NLLVIFLLGGIFAGVALDWLWLIGKK  415



>ref|XP_006287835.1| hypothetical protein CARUB_v10001055mg [Capsella rubella]
 gb|EOA20733.1| hypothetical protein CARUB_v10001055mg [Capsella rubella]
Length=418

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/386 (70%), Positives = 324/386 (84%), Gaps = 0/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYY +FP YHPSRVLTLVYQPFA+GTI I AY   K+NTRKRNL GY
Sbjct  30    SLVSWNSMLTITDYYYHVFPDYHPSRVLTLVYQPFALGTIVIFAYHESKINTRKRNLIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + TF L++LDL T G+GG+G YIG+C +VASFG+ADA VQGG++GDLS MCPE +Q
Sbjct  90    ILFTVSTFLLIVLDLATKGRGGVGPYIGLCAVVASFGLADATVQGGMIGDLSLMCPELVQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+ GLA +G LTS LRL+TKAAFE S++GLRKG ++FLA+STF E LC++LYA+VFPKL
Sbjct  150   SFIVGLAVAGALTSALRLITKAAFEKSNDGLRKGAMIFLAISTFIELLCVMLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYYR KAASEGSKTV+ADLAAAGI   SE  DD    +R+ NK+L ++NIDYA++L+
Sbjct  210   PIVKYYRRKAASEGSKTVSADLAAAGIQNTSELTDDDSKNQRLGNKELLLQNIDYAVNLF  269

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV TLSIFPGFLYENTG H LG WY  VL+AMYN WDL+ RY PL+K +++++RK + 
Sbjct  270   LIYVCTLSIFPGFLYENTGQHGLGDWYALVLIAMYNCWDLVGRYTPLMKWLKIENRKLIT  329

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             +A+ SR+LLIP FYFTAKYGDQG+MIML+S LGLTNG+LTVC+LT APKGYKGP  NALG
Sbjct  330   VAVLSRYLLIPAFYFTAKYGDQGYMIMLISVLGLTNGHLTVCILTTAPKGYKGPEQNALG  389

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N+LV+ LL GIF+GVALDWLWLIG  
Sbjct  390   NLLVIFLLGGIFAGVALDWLWLIGKK  415



>ref|XP_009348006.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009348007.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009348008.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009348009.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009348011.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Pyrus x bretschneideri]
Length=420

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/391 (72%), Positives = 324/391 (83%), Gaps = 3/391 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WNSMLTIGDYYY LFP YHPSRVLTLVYQPFA+ T+A LAY   K++TRKRNL GY
Sbjct  30    SLVAWNSMLTIGDYYYNLFPTYHPSRVLTLVYQPFALVTMATLAYHEAKVDTRKRNLIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFFL T  L+++D+ TS  GG+G YIGIC  VA+FGVADAHVQGG+VGDLS M PEF+Q
Sbjct  90    ALFFLATLMLIIVDVATSAGGGVGPYIGICACVAAFGVADAHVQGGMVGDLSLMRPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGLAASG LTSGLRL+TKAAFE S +GLRKG +LFL +STF EFLCI+LYAF FP+L
Sbjct  150   SFFAGLAASGALTSGLRLMTKAAFEKSHDGLRKGTMLFLTISTFTEFLCILLYAFYFPRL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGIT--APSESVDDAKHV-ERVSNKKLFMENIDYAL  711
              IVKYYR+KAASEGSKTV ADLAAAG+   A  E  +DAK V  R+S  ++F +NID+ L
Sbjct  210   PIVKYYRSKAASEGSKTVTADLAAAGVQTQADIEVSNDAKAVPTRLSTMQIFKQNIDFCL  269

Query  712   DLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRK  891
             DL+LIYV+TLSIFPGF++ENTG H LG+WYP VLVAMYN+ DLISRYIPLIK ++++SRK
Sbjct  270   DLFLIYVLTLSIFPGFIFENTGNHQLGTWYPLVLVAMYNVLDLISRYIPLIKCLKIESRK  329

Query  892   GLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAAN  1071
             GL+IAI  RFL +P +YFT KY DQGWMI+L S LGLTNGYLTVCV+T APKGY GP  N
Sbjct  330   GLLIAILLRFLFVPAYYFTGKYADQGWMILLTSILGLTNGYLTVCVMTVAPKGYNGPEQN  389

Query  1072  ALGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             ALGNILVL LL GIF+GV LDWLWLIG   F
Sbjct  390   ALGNILVLFLLGGIFAGVCLDWLWLIGRDKF  420



>emb|CDY69920.1| BnaCnng65950D [Brassica napus]
Length=418

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/386 (70%), Positives = 329/386 (85%), Gaps = 0/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             +LVSWNS+LTI DYYY +FP YHPSRVL LVYQPFA+GTI ILA    K++TRKRNL GY
Sbjct  30    ALVSWNSILTIADYYYLVFPDYHPSRVLPLVYQPFALGTIVILACHESKIDTRKRNLFGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + TF L++LDL T G+GG+G YIG+C+IVASFG++DA VQGG++GDLS MCPEF+Q
Sbjct  90    ILFTISTFLLIVLDLATKGRGGVGPYIGLCLIVASFGLSDATVQGGMIGDLSLMCPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLA +G LTSGLRL+TKAAF++S++G RKG ++FL +STF EFLC++LYA+VFPKL
Sbjct  150   SFMAGLAVAGALTSGLRLITKAAFDNSNDGQRKGAMIFLGISTFIEFLCVMLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYYR KAA EGSKTV+ADLAAAGI   SE  DD    +R+SNK+L +ENIDYA++L 
Sbjct  210   PIVKYYRRKAALEGSKTVSADLAAAGIQNQSELTDDDSKNQRLSNKELLLENIDYAVNLA  269

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LG+WY  VLVAMYN WDL+ RY PL+K +++++RK L 
Sbjct  270   LIYVLTLSIFPGFLYENTGQHGLGAWYALVLVAMYNCWDLVGRYTPLVKWLKIENRKLLT  329

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             +A+ SR+LL+P FYFTAKYGDQGWM+ML+S LGLTNG+LTVC+LTAAPKGYKGP  NALG
Sbjct  330   VAVLSRYLLVPAFYFTAKYGDQGWMVMLISVLGLTNGHLTVCILTAAPKGYKGPEQNALG  389

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N+LV+ LL GIF+GVALDWLWLIG  
Sbjct  390   NLLVIFLLGGIFAGVALDWLWLIGKK  415



>ref|NP_192421.1| equilibrative nucleotide transporter 3 [Arabidopsis thaliana]
 sp|Q9M0Y3.1|ENT3_ARATH RecName: Full=Equilibrative nucleotide transporter 3; Short=AtENT3; 
AltName: Full=Nucleoside transporter ENT3; AltName: Full=Protein 
FLUOROURIDINE RESISTANT 1 [Arabidopsis thaliana]
 gb|AAL25096.1|AF426400_1 putative equilibrative nucleoside transporter ENT3 [Arabidopsis 
thaliana]
 emb|CAB81054.1| putative protein [Arabidopsis thaliana]
 dbj|BAD43516.1| putative protein [Arabidopsis thaliana]
 gb|AEE82481.1| equilibrative nucleotide transporter 3 [Arabidopsis thaliana]
Length=418

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/386 (70%), Positives = 324/386 (84%), Gaps = 0/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYY++FP YHPSRVLTLVYQPFA+GTI ILAY   K+NTRKRNL GY
Sbjct  30    SLVSWNSMLTIADYYYKVFPDYHPSRVLTLVYQPFALGTILILAYHESKINTRKRNLIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + TF L++LDL T G+GG+G YIG+C +VASFG+ADA VQGG++GDLS MCPE +Q
Sbjct  90    ILFTISTFLLIVLDLATKGRGGIGPYIGLCAVVASFGLADATVQGGMIGDLSLMCPELVQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+ GLA SG LTS LRL+TKAAFE +++G RKG ++FLA+ST  E LC+ LYA+VFPKL
Sbjct  150   SFMGGLAVSGALTSALRLITKAAFEKTNDGPRKGAMMFLAISTCIELLCVFLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYYR KAASEGSKTV+ADLAAAGI   S+  DD    +R+SNK+L ++NIDYA++L+
Sbjct  210   PIVKYYRRKAASEGSKTVSADLAAAGIQNQSDLTDDDSKNQRLSNKELLIQNIDYAVNLF  269

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV TLSIFPGFLYENTG H LG WY  VLVAMYN WDL+ RY PL+K +++++RK + 
Sbjct  270   LIYVCTLSIFPGFLYENTGQHGLGDWYALVLVAMYNCWDLVGRYTPLVKWLKIENRKLIT  329

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IA+ SR+LLIP FYFTAKYGDQGWMIML+S LGLTNG+LTVC++T APKGYKGP  NALG
Sbjct  330   IAVLSRYLLIPAFYFTAKYGDQGWMIMLISVLGLTNGHLTVCIMTIAPKGYKGPEQNALG  389

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N+LV+ LL GIF+GVALDWLWLIG  
Sbjct  390   NLLVIFLLGGIFAGVALDWLWLIGKK  415



>ref|XP_009112694.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Brassica rapa]
Length=430

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/391 (70%), Positives = 324/391 (83%), Gaps = 7/391 (2%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQ+FP YHPSRVLTLVYQPFA+GTI ILAY   K+NTRKRNL GY
Sbjct  30    SLVSWNSMLTIADYYYQIFPDYHPSRVLTLVYQPFALGTILILAYHESKINTRKRNLFGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + TF L++LD  T G GG+G YIG+C IVASFG+ADA VQGG++GDL+ MCPE +Q
Sbjct  90    ILFTISTFLLIILDFLTKGHGGIGPYIGLCAIVASFGLADATVQGGMIGDLALMCPELIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+ GLA +G LTS LRL+TKAAF++S++G RKG ++FLA+STF EFLC++ YA+VFPKL
Sbjct  150   SFMGGLAVAGALTSALRLITKAAFDNSNDGQRKGAMIFLAISTFIEFLCVLHYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSE-------SVDDAKHVERVSNKKLFMENI  699
              IVKYYR KAASEGSKTV+ADLAAAGI   S+         DD    +R+SNK+L ++NI
Sbjct  210   PIVKYYRRKAASEGSKTVSADLAAAGIQNQSDVLLDSSMGTDDDSKNQRLSNKELLLQNI  269

Query  700   DYALDLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVEL  879
             DYAL+L LIYV+TLSIFPGFLYENTG H LG WY  VLVAMYN WDLI RY PL+K ++L
Sbjct  270   DYALNLALIYVLTLSIFPGFLYENTGQHGLGPWYTLVLVAMYNSWDLIGRYTPLVKWLKL  329

Query  880   KSRKGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKG  1059
             ++RKGL +A+ SR+ LIP FYFTAKY DQGWMIML S LGLTNG+LTVC+L+AAPKGYKG
Sbjct  330   ENRKGLTVAVLSRYFLIPAFYFTAKYADQGWMIMLTSVLGLTNGHLTVCILSAAPKGYKG  389

Query  1060  PAANALGNILVLCLLSGIFSGVALDWLWLIG  1152
             P  NALGN+LV+ LL GIF+GVALDWLWLIG
Sbjct  390   PEQNALGNLLVIFLLGGIFAGVALDWLWLIG  420



>ref|XP_010422385.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Camelina sativa]
Length=418

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/386 (70%), Positives = 324/386 (84%), Gaps = 0/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WNSMLTI DYYYQ+FP YHPSRVLTLVYQPFA+GTI IL Y   K+NTRKRNL GY
Sbjct  30    SLVAWNSMLTIADYYYQVFPDYHPSRVLTLVYQPFALGTIVILTYHESKMNTRKRNLIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LF + TF L++LDL T G+GG+G YIG+C +VASFG+ADA VQGG++GDLS MCPE +Q
Sbjct  90    TLFTISTFLLIVLDLATKGRGGVGPYIGLCTVVASFGLADATVQGGMIGDLSLMCPELVQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLA +G LTS LRL TKAAFE S+ G RKG ++FLA+STF EFLC++LYA+VFPKL
Sbjct  150   SFMAGLAVAGALTSALRLTTKAAFEKSNGGQRKGAMIFLAISTFIEFLCVLLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYYR KAASEGSKTV+ADLAAAGI   S+  DD    +R++NK+L ++NIDYA++L+
Sbjct  210   PIVKYYRRKAASEGSKTVSADLAAAGIQNTSDLTDDDSKNQRLTNKELLLQNIDYAVNLF  269

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV TLSIFPGFLYENTG H LG WY  VLVAMYN WDL+ RY PL+K +++++RK + 
Sbjct  270   LIYVCTLSIFPGFLYENTGKHGLGDWYALVLVAMYNCWDLVGRYTPLLKWLKIENRKLIT  329

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IA+ SR+LLIP FYFTAKYGDQG+MIML+S LGLTNG+LTVC++T APKGYKGP  NALG
Sbjct  330   IAVLSRYLLIPAFYFTAKYGDQGYMIMLISVLGLTNGHLTVCIMTIAPKGYKGPEQNALG  389

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N+LV+ LL GIF+GVALDWLWLIG  
Sbjct  390   NLLVIFLLGGIFAGVALDWLWLIGKK  415



>emb|CBI40869.3| unnamed protein product [Vitis vinifera]
Length=920

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/388 (76%), Positives = 334/388 (86%), Gaps = 2/388 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTIGDYYY LFP+YHPSRVLTLVYQPFA+GT+A+LAY   K++TRKRNLAGY
Sbjct  30    SLVSWNSMLTIGDYYYNLFPRYHPSRVLTLVYQPFALGTMALLAYNEAKIDTRKRNLAGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF   TF L++LDL TSG+GG+  YIGICVIV +FGVADAHVQGG+VGDLSFMCPEF+Q
Sbjct  90    ILFCASTFLLVVLDLATSGRGGIAPYIGICVIVGAFGVADAHVQGGMVGDLSFMCPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFLAGLAASG LTS LRL+TKAAF+ S+ G RKG +LFL +STF EFLCIILYAF FPKL
Sbjct  150   SFLAGLAASGALTSALRLMTKAAFDKSAGGERKGAMLFLGISTFLEFLCIILYAFFFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDL  717
              IVK+YR KAA EGSKTV+ADLA  GI T  S  VDD K  ER+SNK+LF +NIDYAL+L
Sbjct  210   PIVKHYRRKAALEGSKTVSADLAVVGIQTQQSREVDDTKQQERLSNKQLFFQNIDYALEL  269

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIYV+TLSIFPGFL+ENTG H LGSWYP VL+AMYN+WD ISRYIPL+K + L  RKGL
Sbjct  270   FLIYVLTLSIFPGFLFENTGKHQLGSWYPLVLIAMYNVWDFISRYIPLVKCLRL-PRKGL  328

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             M+ + +RFL IP FYFTAKYGDQGWMIML SFLG++NGYLTVC+LT APKGYKGP  NAL
Sbjct  329   MVGVLARFLFIPAFYFTAKYGDQGWMIMLTSFLGVSNGYLTVCILTNAPKGYKGPEQNAL  388

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNSG  1161
             GN+LVLCLL GIFSGVALDWLWLI N G
Sbjct  389   GNLLVLCLLGGIFSGVALDWLWLIENIG  416


 Score =   528 bits (1361),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 264/390 (68%), Positives = 319/390 (82%), Gaps = 3/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             S +SWNS++TIGDYYY+LFP+YHP RVLT+V QPFA+GT+AIL YK   +NTRKRNL GY
Sbjct  532   SAISWNSLMTIGDYYYKLFPRYHPERVLTIVLQPFALGTMAILFYKEATINTRKRNLIGY  591

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF   T  L++LDL TSG+GG+  YIGIC IV +FGVA A VQGG+ GDLSFMCPEF++
Sbjct  592   ILFCTSTLMLIVLDLATSGRGGITPYIGICAIVGAFGVASALVQGGMTGDLSFMCPEFIR  651

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFLAGLAASG LTS LRLVTKA F  S++G R G +LFL ++TF EFLC +LYAF FPKL
Sbjct  652   SFLAGLAASGVLTSALRLVTKAVFRKSNDGERNGAMLFLGITTFVEFLCTLLYAFFFPKL  711

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAP--SESVDDAKHVERVSNKKLFMENIDYALD  714
              IVK+YR+KAA EGS+TV+ADLA  GI      E  DD +  ER+SNK+LF +NIDYAL+
Sbjct  712   PIVKFYRSKAALEGSQTVSADLAVVGIQTEQNEEDGDDTQQQERLSNKQLFFQNIDYALE  771

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             ++L ++VTLSIFPGFL+ENTG H LGSWYP VL+ MYN+WD++SRYIP++K + L SR+G
Sbjct  772   VFLGHLVTLSIFPGFLFENTGKHQLGSWYPLVLITMYNVWDMLSRYIPIVKCLRL-SRRG  830

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LM+ + ++FLLIP FYFTAKYGDQGWMI+L SFLG++NGYLTVC+ T APKGYKGP  NA
Sbjct  831   LMVGVLAQFLLIPAFYFTAKYGDQGWMILLTSFLGVSNGYLTVCIFTDAPKGYKGPEQNA  890

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN+L LCLL GIF+G AL WLWLIGN  F
Sbjct  891   LGNMLTLCLLCGIFAGGALGWLWLIGNESF  920



>ref|XP_010455844.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Camelina sativa]
Length=425

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/393 (69%), Positives = 324/393 (82%), Gaps = 7/393 (2%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQ+FP YHPSRVLTLVYQPFA+GTI IL Y   K+NTRKRNL GY
Sbjct  30    SLVSWNSMLTIADYYYQVFPDYHPSRVLTLVYQPFALGTIVILTYHESKMNTRKRNLIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LF + TF L++LDL T G+GG+G YIG+C +VASFG+ADA VQGG++GDLS MCPE +Q
Sbjct  90    TLFTISTFLLIVLDLATKGRGGVGPYIGLCAVVASFGLADATVQGGMIGDLSLMCPELVQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+ GLA +G LTS LRL TKAAFE S+NGLRKG ++FLA+STF E LC++LYA+VFPKL
Sbjct  150   SFMVGLAVAGALTSALRLTTKAAFEKSNNGLRKGAMIFLAISTFIELLCVLLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPS-------ESVDDAKHVERVSNKKLFMENI  699
              IVKYYR KAASEGSKTV+ADLAAAGI   S       ++ DD    +R++NK+L ++NI
Sbjct  210   PIVKYYRRKAASEGSKTVSADLAAAGIQNTSDLLLDSMQTDDDDSKNQRLTNKELLLQNI  269

Query  700   DYALDLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVEL  879
             DYA++L+LIYV TLSIFPGFLYENTG H LG WY  VLVAMYN WDL+ RY PL+K +++
Sbjct  270   DYAVNLFLIYVCTLSIFPGFLYENTGKHGLGDWYALVLVAMYNCWDLVGRYTPLLKWLKI  329

Query  880   KSRKGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKG  1059
             ++RK + IA+ SR+ LIP FYFTAKYGDQGWMIML+S LGLTNG+LTVC+LT APKGYKG
Sbjct  330   ENRKLITIAVLSRYFLIPAFYFTAKYGDQGWMIMLISILGLTNGHLTVCILTIAPKGYKG  389

Query  1060  PAANALGNILVLCLLSGIFSGVALDWLWLIGNS  1158
             P  NALGN+LV+ LL GIF+GVALDWLWLIG  
Sbjct  390   PEQNALGNLLVIFLLGGIFAGVALDWLWLIGKK  422



>ref|XP_010431711.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Camelina sativa]
Length=418

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/386 (67%), Positives = 325/386 (84%), Gaps = 0/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             +++SWNSMLTIGDYYY +FP YHPSRVLT+VYQPFA+GTI I AY+  K+NTRKRN+ GY
Sbjct  30    TIISWNSMLTIGDYYYYVFPDYHPSRVLTVVYQPFALGTIMIFAYRESKINTRKRNMIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             +L  + TF L++LDL T G GG+  YIG+C IVASFG+ADA V+GG++GDLSFMCPE +Q
Sbjct  90    MLSTISTFLLIVLDLATKGHGGMLPYIGLCAIVASFGLADATVRGGMMGDLSFMCPELIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S++AGLA SG LTS +RL+TKAAFE S +GLRKG ++FLA +TF EF+C+ILYA+VFPKL
Sbjct  150   SYMAGLAISGALTSAIRLITKAAFEKSHDGLRKGAMIFLATATFIEFMCVILYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              I+KYYR+KAASEGSKTV+ADL AAGI   SES +D    +R+SNK+L ++N DYA++++
Sbjct  210   PIIKYYRSKAASEGSKTVSADLIAAGILNQSESTNDDSKNQRLSNKELLLQNTDYAMNIF  269

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             L+Y++TLSI PGFLYENTG H LG+WY  VL+AMYN WD++ RY PL+K +++++RKGL 
Sbjct  270   LLYLLTLSIVPGFLYENTGQHGLGTWYALVLIAMYNCWDMVGRYTPLVKWLKIENRKGLT  329

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IA+  RF LIP FYFTAKYGDQGWMIML+S LGLTNG+L+VC+LT APKGYKGP  NALG
Sbjct  330   IAVLLRFFLIPTFYFTAKYGDQGWMIMLISILGLTNGHLSVCILTVAPKGYKGPEQNALG  389

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N+LV+ LL G+F+GVALDWLWLIG  
Sbjct  390   NLLVMFLLGGVFAGVALDWLWLIGKK  415



>ref|XP_010431705.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Camelina sativa]
Length=430

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/386 (67%), Positives = 325/386 (84%), Gaps = 0/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             +++SWNSMLTIGDYYY +FP YHPSRVLT+VYQPFA+GTI I AY+  K+NTRKRN+ GY
Sbjct  42    TIISWNSMLTIGDYYYYVFPDYHPSRVLTVVYQPFALGTIMIFAYRESKINTRKRNMIGY  101

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             +L  + TF L++LDL T G GG+  YIG+C IVASFG+ADA V+GG++GDLSFMCPE +Q
Sbjct  102   MLSTISTFLLIVLDLATKGHGGMLPYIGLCAIVASFGLADATVRGGMMGDLSFMCPELIQ  161

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S++AGLA SG LTS +RL+TKAAFE S +GLRKG ++FLA +TF EF+C+ILYA+VFPKL
Sbjct  162   SYMAGLAISGALTSAIRLITKAAFEKSHDGLRKGAMIFLATATFIEFMCVILYAYVFPKL  221

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              I+KYYR+KAASEGSKTV+ADL AAGI   SES +D    +R+SNK+L ++N DYA++++
Sbjct  222   PIIKYYRSKAASEGSKTVSADLIAAGILNQSESTNDDSKNQRLSNKELLLQNTDYAMNIF  281

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             L+Y++TLSI PGFLYENTG H LG+WY  VL+AMYN WD++ RY PL+K +++++RKGL 
Sbjct  282   LLYLLTLSIVPGFLYENTGQHGLGTWYALVLIAMYNCWDMVGRYTPLVKWLKIENRKGLT  341

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IA+  RF LIP FYFTAKYGDQGWMIML+S LGLTNG+L+VC+LT APKGYKGP  NALG
Sbjct  342   IAVLLRFFLIPTFYFTAKYGDQGWMIMLISILGLTNGHLSVCILTVAPKGYKGPEQNALG  401

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N+LV+ LL G+F+GVALDWLWLIG  
Sbjct  402   NLLVMFLLGGVFAGVALDWLWLIGKK  427



>ref|XP_010035647.1| PREDICTED: equilibrative nucleotide transporter 3-like [Eucalyptus 
grandis]
 ref|XP_010035648.1| PREDICTED: equilibrative nucleotide transporter 3-like [Eucalyptus 
grandis]
 gb|KCW47090.1| hypothetical protein EUGRSUZ_K00896 [Eucalyptus grandis]
Length=416

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/386 (74%), Positives = 335/386 (87%), Gaps = 2/386 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSM+TI DYY  LFPKYHPSRVLTLVYQPFA+GT+A+LAY   K+NTR+RNL GY+
Sbjct  29    LFSWNSMVTIEDYYVYLFPKYHPSRVLTLVYQPFALGTLAVLAYNEAKINTRRRNLFGYL  88

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ T  +L+LDL TSGKGG+G +IGIC I  +FGVADAHVQGG+VGDLSFM PEF+QS
Sbjct  89    LFFISTLLVLVLDLATSGKGGIGTFIGICAISGAFGVADAHVQGGMVGDLSFMRPEFIQS  148

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE+S +GLRKG I+F A+S+FFE LC++LYAF+FPKL 
Sbjct  149   FLAGLAASGALTSALRLITKAAFENSKDGLRKGAIMFFAISSFFELLCVLLYAFIFPKLP  208

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAP-SESVDDAKHVERVSNKKLFMENIDYALDL  717
             IVKYYR+KAASEGSKTV+ADLAA G+ T P  E+ +D K +ER+SNK+L + NIDYALD+
Sbjct  209   IVKYYRSKAASEGSKTVSADLAAGGVQTLPHQEAEEDPKQLERLSNKELLIRNIDYALDM  268

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIYV+TLSIFPGFL E+TG+H LG+WY  VL AMYN+WDLI RYIPLIK ++++SRKGL
Sbjct  269   FLIYVLTLSIFPGFLSEDTGSHGLGAWYALVLFAMYNVWDLIGRYIPLIKFLKMESRKGL  328

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             M+ I SRFLLIP FYFTAKYGDQGWMIML SFLGL+NGYLTVCVLT+APKGYKGP  NAL
Sbjct  329   MMVILSRFLLIPAFYFTAKYGDQGWMIMLTSFLGLSNGYLTVCVLTSAPKGYKGPEQNAL  388

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LVL LL GIF+GV LDWLWLIG 
Sbjct  389   GNLLVLFLLGGIFAGVTLDWLWLIGK  414



>ref|XP_008341935.1| PREDICTED: equilibrative nucleotide transporter 3-like [Malus 
domestica]
 ref|XP_008341936.1| PREDICTED: equilibrative nucleotide transporter 3-like [Malus 
domestica]
Length=418

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/386 (72%), Positives = 324/386 (84%), Gaps = 2/386 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP+YHPSRVLTLVYQPFA+ TI  L+Y   K+NTRKRNL GYI
Sbjct  31    LFSWNSMLTIQDYYVNLFPRYHPSRVLTLVYQPFALLTIFALSYHEAKINTRKRNLLGYI  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL +  +L+LDL TSGKGGLG +IGIC I A+FG+ADAHVQGG+VGDLSFM  E +QS
Sbjct  91    LFFLSSLLVLVLDLATSGKGGLGTFIGICAISAAFGIADAHVQGGMVGDLSFMPVELIQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAG AASG LTS LRL+TKAAFE+S NGLRKG ILF A+S+FFE LC+ LYAF FPKL 
Sbjct  151   FLAGSAASGALTSALRLITKAAFENSQNGLRKGAILFFAISSFFELLCVFLYAFSFPKLP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDA--KHVERVSNKKLFMENIDYALDL  717
             IVKYYR+KAASEGSKTV+ADLAA GI    ES D+   K  +R+ NK+L ++NIDYAL +
Sbjct  211   IVKYYRSKAASEGSKTVSADLAAGGIQKLPESTDEENRKEPDRLGNKQLLLQNIDYALGM  270

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIY +TLSIFPGFL E+TG+H+LG+WY  VL+ MYN+ DLI RYIPL+K ++++SR+GL
Sbjct  271   FLIYTLTLSIFPGFLSEDTGSHSLGTWYALVLITMYNVCDLIGRYIPLVKFLKMESRRGL  330

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             MI I SRFLL+PCFYFTAKYGDQGWMIML SFLGLTNGYLTVCVLT+APKGYKGP  NAL
Sbjct  331   MIVILSRFLLVPCFYFTAKYGDQGWMIMLTSFLGLTNGYLTVCVLTSAPKGYKGPEQNAL  390

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LV+ LL GIF+GV LDWLWLIG 
Sbjct  391   GNLLVMFLLGGIFAGVTLDWLWLIGK  416



>ref|XP_010052413.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010052414.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW76378.1| hypothetical protein EUGRSUZ_D00758 [Eucalyptus grandis]
Length=413

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/388 (73%), Positives = 334/388 (86%), Gaps = 4/388 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WNSMLTIGDYYY++FP YHPSRVLT+VYQPFAIGT+AIL Y   K++TRKRN+ GY
Sbjct  30    SLVAWNSMLTIGDYYYKVFPHYHPSRVLTIVYQPFAIGTMAILTYHESKVDTRKRNIIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF L T  LL+LDL TSGKGG+  Y GICV+VA FGVADAHVQGG+VGDLSFMCPEF+Q
Sbjct  90    ILFTLSTLFLLVLDLATSGKGGVWPYFGICVLVACFGVADAHVQGGMVGDLSFMCPEFMQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AG+AASG LTSG+RL+TKAAF+ + +GLRKG +LFLA+STFFEF+CIILYA  F K+
Sbjct  150   SFFAGIAASGALTSGMRLITKAAFDKAHDGLRKGAMLFLAISTFFEFICIILYATWFAKI  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVK+YR+KAASEGSKTV+ADLAAAGI    ++ D     +R+S K+L  +NIDYA+DLY
Sbjct  210   PIVKHYRSKAASEGSKTVSADLAAAGI----QTQDGDSKEDRLSKKQLLFQNIDYAIDLY  265

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TL+IFPGFLYENTGTH LGSWY  VL+AMYN+WDLISRYIPLI  ++L+SRKGL+
Sbjct  266   LIYVLTLTIFPGFLYENTGTHQLGSWYALVLIAMYNVWDLISRYIPLIGWLKLESRKGLL  325

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             I I +RFLL+P FYFTAKYGDQGWMIMLVSFLGL+NGYLTVCV+T APKGYKGP  NALG
Sbjct  326   IVILARFLLVPAFYFTAKYGDQGWMIMLVSFLGLSNGYLTVCVMTVAPKGYKGPEQNALG  385

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             N+LVL LL GIFSGV+L WLW+I +  F
Sbjct  386   NLLVLFLLGGIFSGVSLGWLWIIHHDKF  413



>ref|XP_004293471.1| PREDICTED: equilibrative nucleotide transporter 3-like [Fragaria 
vesca subsp. vesca]
Length=415

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/385 (72%), Positives = 323/385 (84%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP YHPSRVLTLVYQPFA+ T+ +L+Y   K+NTRKRNL GY 
Sbjct  29    LFSWNSMLTITDYYDALFPSYHPSRVLTLVYQPFALSTLIVLSYHEAKINTRKRNLFGYT  88

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL T  +L+LDL TSGKGGLG YIGIC I  +FGVADAHVQGG++GDLSFM PEF+QS
Sbjct  89    LFFLSTLLVLVLDLATSGKGGLGTYIGICAISGAFGVADAHVQGGMIGDLSFMKPEFIQS  148

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTSGLRLVTKA FE+S NGLRKG I+F ++ST FE LC+ LYA VFPKL 
Sbjct  149   FLAGLAASGALTSGLRLVTKAIFENSQNGLRKGAIMFFSISTLFELLCVFLYAVVFPKLP  208

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             IVK+YR+KAASEGSKTV+ADLAA GI T P   V+D   ++R+ NK+L  +NIDYA+D++
Sbjct  209   IVKFYRSKAASEGSKTVSADLAAGGIQTLPEGDVEDPTKMQRLGNKQLLFQNIDYAIDMF  268

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIY +TLSIFPGFL E+TG+H+LG+WY  VL+AMYN+WDLI RYIP +  ++L+SRK LM
Sbjct  269   LIYALTLSIFPGFLSEDTGSHSLGAWYALVLIAMYNVWDLIGRYIPCLDCLKLESRKWLM  328

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             +AI +RFLL+P FYFTA YGDQGWMIML SFLGLTNGYLTVCVLT+APKGYKGP  NALG
Sbjct  329   VAIVARFLLVPAFYFTANYGDQGWMIMLTSFLGLTNGYLTVCVLTSAPKGYKGPEQNALG  388

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LV+ L+ GIF+GV LDWLWLIG 
Sbjct  389   NLLVVFLILGIFAGVTLDWLWLIGK  413



>ref|XP_009350452.1| PREDICTED: equilibrative nucleotide transporter 3-like [Pyrus 
x bretschneideri]
 ref|XP_009350460.1| PREDICTED: equilibrative nucleotide transporter 3-like [Pyrus 
x bretschneideri]
Length=418

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/386 (72%), Positives = 324/386 (84%), Gaps = 2/386 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP+YHPSRVLTLVYQPFA+ TI  L+Y   K+NTRKRNL GYI
Sbjct  31    LFSWNSMLTIQDYYVNLFPRYHPSRVLTLVYQPFALLTIFALSYHEAKINTRKRNLFGYI  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL +  +L+LDL TSGKGG G +IGIC I A+FG+ADAHVQGG+VGDLSFM  E +QS
Sbjct  91    LFFLSSLLVLVLDLATSGKGGFGTFIGICAISAAFGIADAHVQGGMVGDLSFMPVELIQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAG AASG LTS LRL+TKAAFE+S NGLRKG ILF A+S+FFE LC++LYAF FPKL 
Sbjct  151   FLAGSAASGALTSALRLITKAAFENSQNGLRKGAILFFAISSFFELLCVLLYAFSFPKLP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVD--DAKHVERVSNKKLFMENIDYALDL  717
             IVKYYR+KAASEGSKTV+ADLAA GI    E+ D  + K  +R+ NK+L ++NIDYAL +
Sbjct  211   IVKYYRSKAASEGSKTVSADLAAGGIQKLPEATDVENRKEPDRLGNKQLLLQNIDYALGM  270

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIY +TLSIFPGFL E+TG+H+LG+WY  VL+ MYN+ DLI RYIPL+K ++++SR+GL
Sbjct  271   FLIYTLTLSIFPGFLSEDTGSHSLGTWYALVLITMYNVCDLIGRYIPLVKFLKMESRRGL  330

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             MI I SRFLL+PCFYFTAKYGDQGWMIML SFLGLTNGYLTVCVLT+APKGYKGP  NAL
Sbjct  331   MIVILSRFLLVPCFYFTAKYGDQGWMIMLTSFLGLTNGYLTVCVLTSAPKGYKGPEQNAL  390

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LV+ LL GIF+GV LDWLWLIG 
Sbjct  391   GNLLVMFLLGGIFAGVTLDWLWLIGK  416



>ref|XP_010904666.1| PREDICTED: equilibrative nucleotide transporter 3-like [Elaeis 
guineensis]
 ref|XP_010904673.1| PREDICTED: equilibrative nucleotide transporter 3-like [Elaeis 
guineensis]
 ref|XP_010904683.1| PREDICTED: equilibrative nucleotide transporter 3-like [Elaeis 
guineensis]
 ref|XP_010904689.1| PREDICTED: equilibrative nucleotide transporter 3-like [Elaeis 
guineensis]
Length=418

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/387 (73%), Positives = 330/387 (85%), Gaps = 2/387 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WNSMLTI DYY  LFP+YHP+RVLTLVYQPFA+GT+AIL Y   KLNTRKRNL GY
Sbjct  30    SLVAWNSMLTIEDYYSNLFPRYHPTRVLTLVYQPFALGTLAILTYNEAKLNTRKRNLIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFFL +  L++LD+ T+GKGG+G +IGIC I  +FGVADAHVQGG+VGDL  MCPEF Q
Sbjct  90    TLFFLSSLLLIVLDVATAGKGGIGVFIGICAITGAFGVADAHVQGGMVGDLFLMCPEFNQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFLAGLAASG LTS LRL+TKAAFE+S +GLRKG ++F A+S FFE LC++LYAF+FPK+
Sbjct  150   SFLAGLAASGALTSALRLITKAAFENSQDGLRKGAMMFFAISAFFELLCVLLYAFIFPKV  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSE--SVDDAKHVERVSNKKLFMENIDYALD  714
              IVKYYR KAASEGS TV+ADLAAAG+       + +D K  ER++NK+L ++N DYALD
Sbjct  210   PIVKYYRLKAASEGSMTVSADLAAAGVQKQRHQGAEEDPKLFERLTNKQLLLQNTDYALD  269

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             +YLIYV+TLSIFPGFL E+TG+H+LGSWY  VL+AMYN+WDLI RY+PL+K ++L SRKG
Sbjct  270   VYLIYVLTLSIFPGFLSEDTGSHSLGSWYALVLIAMYNVWDLIGRYLPLLKWIKLTSRKG  329

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LM+AI  RFLLIP FYFTAKYGDQGWMIML S+LGL+NGYLTVCVLTAAPKGYKGP  NA
Sbjct  330   LMVAILLRFLLIPAFYFTAKYGDQGWMIMLTSYLGLSNGYLTVCVLTAAPKGYKGPEQNA  389

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGN  1155
             LGN+LVL LL+GIFSGVALDWLWLIG 
Sbjct  390   LGNLLVLFLLAGIFSGVALDWLWLIGK  416



>ref|XP_002874832.1| hypothetical protein ARALYDRAFT_490161 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51091.1| hypothetical protein ARALYDRAFT_490161 [Arabidopsis lyrata subsp. 
lyrata]
Length=418

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/386 (69%), Positives = 323/386 (84%), Gaps = 0/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSML+I DYYYQ+FP YHPSRVLTLVYQPFA+GTI ILAY   K++TRKRNL GY
Sbjct  30    SLVSWNSMLSIADYYYQVFPDYHPSRVLTLVYQPFALGTIVILAYHESKISTRKRNLIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             IL+ + TF+L++LD  T G+GG+G YIG+C +VASFG+ADA VQGG++GDLS MCPE +Q
Sbjct  90    ILYTISTFSLIVLDSATKGRGGIGPYIGLCAVVASFGLADATVQGGMIGDLSLMCPELVQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+ GLA +G LTS LRL+TKAAFE ++NGLRKG ++FLA+STF + LC++LY +V PKL
Sbjct  150   SFMGGLAVAGALTSALRLITKAAFEKTNNGLRKGAMMFLAISTFIDLLCVMLYTYVLPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYYR KAASEGSKTV+ADLAAAGI   S   DD    +R+S K+L ++NIDYA++L+
Sbjct  210   PIVKYYRRKAASEGSKTVSADLAAAGIQNQSGLTDDDSKNQRLSKKELLIQNIDYAVNLF  269

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV TLSIFPGFLYENTG H LG+WY  VLVAMYN WDL+ RY PL+K +++++RK + 
Sbjct  270   LIYVCTLSIFPGFLYENTGHHGLGAWYALVLVAMYNFWDLVGRYTPLVKWLKIENRKLIT  329

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
              A+ SR+LLIP FYFTAKYGDQGWMIMLVS LGLTNG+LTVC++T APKGYKGP  NALG
Sbjct  330   SAVLSRYLLIPAFYFTAKYGDQGWMIMLVSALGLTNGHLTVCIMTIAPKGYKGPEQNALG  389

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N+LV+ LL GIF+GVALDWLWLIG  
Sbjct  390   NLLVIFLLGGIFAGVALDWLWLIGKK  415



>gb|KFK23995.1| hypothetical protein AALP_AAs70229U000100 [Arabis alpina]
Length=418

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/386 (69%), Positives = 323/386 (84%), Gaps = 0/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQ+FP YHPSRVLTLVYQPFA+GTI ILAY   K+NTRKR L GY
Sbjct  30    SLVSWNSMLTIADYYYQVFPAYHPSRVLTLVYQPFALGTILILAYHESKINTRKRILIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + TF L+ LDL + G+GG+GNYIG+C IVASFGVADA V+GG++GDLS MCPE +Q
Sbjct  90    ILFTISTFLLIFLDLTSKGQGGIGNYIGLCAIVASFGVADATVKGGMIGDLSLMCPELIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLA +G LTS LRL+TKAAFE S+N LRKG I+FLA+STF EF+C++LYA+VFPKL
Sbjct  150   SFIAGLAVAGALTSALRLITKAAFEKSNNRLRKGAIIFLAMSTFIEFICVMLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYYR KAASEGSKTV ADLAAAGI   S+  DD    + +S ++L ++NIDYA++L+
Sbjct  210   PIVKYYRRKAASEGSKTVVADLAAAGIQKQSDLTDDDSKNQTLSKRELLLQNIDYAINLF  269

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LG+WY  VLVAMYN WDL+ RY+PL+K +++++RKGLM
Sbjct  270   LIYVLTLSIFPGFLYENTGQHGLGTWYALVLVAMYNFWDLVGRYMPLVKWLKVENRKGLM  329

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IA+ SRF LIP FYFTAK GD+GWMIML+S LGL+ G+LTVC+LT APKGYKGP  NALG
Sbjct  330   IAVLSRFFLIPAFYFTAKCGDKGWMIMLISVLGLSTGHLTVCILTIAPKGYKGPEKNALG  389

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N+LV+ +L G  +G++L WLWLIG  
Sbjct  390   NLLVIFILGGALTGISLGWLWLIGKE  415



>ref|XP_010054390.1| PREDICTED: equilibrative nucleotide transporter 3-like [Eucalyptus 
grandis]
 gb|KCW76380.1| hypothetical protein EUGRSUZ_D00759 [Eucalyptus grandis]
Length=413

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/388 (73%), Positives = 335/388 (86%), Gaps = 4/388 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WNSMLTIGDYYY++FP YHPSRVLT+VYQPFAIGT+ IL Y+  K++TRKRN+ GY
Sbjct  30    SLVAWNSMLTIGDYYYKVFPHYHPSRVLTIVYQPFAIGTMTILTYQESKVDTRKRNIIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF L T  LL+LDL TSGKGG+  Y GICV+VA FGVA+AHVQGG+VGDLSFMCPEF+Q
Sbjct  90    ILFTLSTLFLLVLDLATSGKGGVWPYFGICVLVACFGVANAHVQGGMVGDLSFMCPEFMQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AG+AASG LTSG+RL+TKAAF+ + +GLRKG +LF+A+STFFEF+CIILYA  F K+
Sbjct  150   SFFAGIAASGALTSGMRLITKAAFDKAHDGLRKGAMLFMAISTFFEFICIILYATWFAKI  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVK+YR+KAASEGSKTV+ADLAAAGI    ++ D     +R+SNK+L ++NIDYA+DLY
Sbjct  210   PIVKHYRSKAASEGSKTVSADLAAAGI----QTQDGDSKEDRLSNKQLLLQNIDYAIDLY  265

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LI+V+TL+I PGFLYENTGTH LGSWY  VL+AMYN+WDLISRYIPLI  ++L+SRKGL+
Sbjct  266   LIHVLTLTILPGFLYENTGTHQLGSWYTLVLIAMYNVWDLISRYIPLIGWLKLESRKGLL  325

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IAI +RFLL+P FYFTAKY DQGWMIMLVSFLGL+NGYLTVCV+T APKGYKGP  NALG
Sbjct  326   IAIVTRFLLVPAFYFTAKYADQGWMIMLVSFLGLSNGYLTVCVMTVAPKGYKGPEQNALG  385

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             N+LVL LL GIFSGV+L WLW+I N  F
Sbjct  386   NLLVLFLLGGIFSGVSLGWLWIIHNDKF  413



>ref|XP_010422384.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Camelina sativa]
Length=424

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/392 (69%), Positives = 324/392 (83%), Gaps = 6/392 (2%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WNSMLTI DYYYQ+FP YHPSRVLTLVYQPFA+GTI IL Y   K+NTRKRNL GY
Sbjct  30    SLVAWNSMLTIADYYYQVFPDYHPSRVLTLVYQPFALGTIVILTYHESKMNTRKRNLIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LF + TF L++LDL T G+GG+G YIG+C +VASFG+ADA VQGG++GDLS MCPE +Q
Sbjct  90    TLFTISTFLLIVLDLATKGRGGVGPYIGLCTVVASFGLADATVQGGMIGDLSLMCPELVQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLA +G LTS LRL TKAAFE S+ G RKG ++FLA+STF EFLC++LYA+VFPKL
Sbjct  150   SFMAGLAVAGALTSALRLTTKAAFEKSNGGQRKGAMIFLAISTFIEFLCVLLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSE------SVDDAKHVERVSNKKLFMENID  702
              IVKYYR KAASEGSKTV+ADLAAAGI   S+        DD    +R++NK+L ++NID
Sbjct  210   PIVKYYRRKAASEGSKTVSADLAAAGIQNTSDLLLDSMQTDDDSKNQRLTNKELLLQNID  269

Query  703   YALDLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELK  882
             YA++L+LIYV TLSIFPGFLYENTG H LG WY  VLVAMYN WDL+ RY PL+K ++++
Sbjct  270   YAVNLFLIYVCTLSIFPGFLYENTGKHGLGDWYALVLVAMYNCWDLVGRYTPLLKWLKIE  329

Query  883   SRKGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGP  1062
             +RK + IA+ SR+LLIP FYFTAKYGDQG+MIML+S LGLTNG+LTVC++T APKGYKGP
Sbjct  330   NRKLITIAVLSRYLLIPAFYFTAKYGDQGYMIMLISVLGLTNGHLTVCIMTIAPKGYKGP  389

Query  1063  AANALGNILVLCLLSGIFSGVALDWLWLIGNS  1158
               NALGN+LV+ LL GIF+GVALDWLWLIG  
Sbjct  390   EQNALGNLLVIFLLGGIFAGVALDWLWLIGKK  421



>ref|XP_003547130.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Glycine max]
 ref|XP_006597386.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Glycine max]
 ref|XP_006597387.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X3 [Glycine max]
 ref|XP_006597388.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X4 [Glycine max]
Length=419

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/390 (74%), Positives = 333/390 (85%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTIGDYYY LFPKYHP+RVLTLVYQPFAIGT+ ILAY   K+NTR RNLAG+
Sbjct  30    SLVSWNSMLTIGDYYYILFPKYHPARVLTLVYQPFAIGTMLILAYYESKINTRMRNLAGF  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFF  TF +L++DL +SGKGGLG YIGICV+ A FG+ADA V+GGI+G+L FMCPEF+Q
Sbjct  90    TLFFFSTFFVLVVDLASSGKGGLGPYIGICVLAACFGIADAQVEGGIIGELCFMCPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S+LAGLAASG L S LR++TK AFE S+NGLRKG ILFLA+STF E +CIILYA  F KL
Sbjct  150   SYLAGLAASGALISILRMLTKVAFEKSNNGLRKGAILFLAISTFIELVCIILYAICFTKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVD--DAKHVERVSNKKLFMENIDYALD  714
              IVKYYR+KAA EGSKTVAADLAAAGI   +      D+K  ER+SNK+LF+EN+DYA+D
Sbjct  210   PIVKYYRSKAALEGSKTVAADLAAAGIQTKTNDQGGYDSKKEERLSNKQLFVENLDYAVD  269

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+LIYVVTLSIFPGFLYENTGTH LG+WYP VL+AMYN+ D I+RYIPL+  ++L+SRKG
Sbjct  270   LFLIYVVTLSIFPGFLYENTGTHQLGTWYPVVLIAMYNVVDFIARYIPLVPWLKLESRKG  329

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             L+IA+ SRFLLIP FYFTAKYGDQGWMI+L SFLGLTNGYLTVCVLT AP+GYKGP  NA
Sbjct  330   LLIAVFSRFLLIPAFYFTAKYGDQGWMILLTSFLGLTNGYLTVCVLTVAPRGYKGPEQNA  389

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN+LVLCLLSGIF+G  LDWLW+IG   F
Sbjct  390   LGNLLVLCLLSGIFAGAVLDWLWIIGKGTF  419



>ref|XP_004507230.1| PREDICTED: equilibrative nucleotide transporter 3-like [Cicer 
arietinum]
Length=414

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/385 (72%), Positives = 326/385 (85%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFPKYHPSRVLTLVYQPFA  T+AILAY  EK+NTR RNL GY 
Sbjct  28    LFSWNSMLTIVDYYIYLFPKYHPSRVLTLVYQPFAFITLAILAYNEEKINTRLRNLFGYT  87

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             +FF G  ALL+LDL TSGKGG+G +IGIC++ A FG+ADAHVQGG+VGDLS+M PEF+QS
Sbjct  88    VFFFGILALLILDLATSGKGGIGTFIGICIVSAVFGMADAHVQGGMVGDLSYMIPEFIQS  147

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAG AASG LTS LRL+TKA FE+S +GLRKG ILF A+S+FFE LC+ILYAFVFPKL 
Sbjct  148   FLAGSAASGALTSALRLITKAVFENSPDGLRKGAILFFALSSFFELLCVILYAFVFPKLP  207

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITA-PSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             I+KYYR+KAASEGSKTV+ADLAAAGI A P  + +D+K  ER   K+L +ENIDYALDL+
Sbjct  208   IIKYYRSKAASEGSKTVSADLAAAGIKASPGGASEDSKQQERKGIKQLLLENIDYALDLF  267

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFL E+TG+H+LG+WY  VL+AM+N+ DLI RYIPL K ++++SRK + 
Sbjct  268   LIYVLTLSIFPGFLSEDTGSHSLGTWYALVLIAMFNVCDLIGRYIPLAKILKMESRKLIT  327

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
              A+ SRFLLIP FYFTAKYG QGWMIML SFLGL+NGYLT+CV T+APKGYKGP  NALG
Sbjct  328   TAVISRFLLIPAFYFTAKYGKQGWMIMLTSFLGLSNGYLTICVFTSAPKGYKGPEQNALG  387

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LVLCLL G+F+GV LDWLWLIG 
Sbjct  388   NMLVLCLLGGLFAGVILDWLWLIGK  412



>ref|XP_004485694.1| PREDICTED: equilibrative nucleotide transporter 3-like [Cicer 
arietinum]
Length=419

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/389 (74%), Positives = 328/389 (84%), Gaps = 2/389 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIG + IL Y   K+NTR RNLAGY 
Sbjct  31    LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGIMLILTYHESKINTRLRNLAGYT  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+  F +L+LDL TSGKGGLG YIG+C++ A FGVADA V+GG+VGDL FMCPEF+QS
Sbjct  91    LFFVSIFLVLILDLATSGKGGLGPYIGVCLLSACFGVADAFVEGGMVGDLCFMCPEFMQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAG+AASG L S LR++TK AFE S NGLRKG ILF A+STF EF+CI LYA  F KL 
Sbjct  151   FLAGMAASGGLISSLRMLTKLAFEKSDNGLRKGAILFFAISTFIEFVCIFLYAIYFTKLP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESV--DDAKHVERVSNKKLFMENIDYALDL  717
             IVKYYR+KAASEGSKTVAADLAAAGI   +     DD K V+R+SNK+LF+ENIDYA DL
Sbjct  211   IVKYYRSKAASEGSKTVAADLAAAGIQTNTNDQIGDDNKQVKRLSNKQLFLENIDYAADL  270

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             + IY +TLSIFPGFLYENTG H LG+WYPTVL+AMYN+ D+I R IPL++ ++++SRKGL
Sbjct  271   FFIYSITLSIFPGFLYENTGQHQLGTWYPTVLIAMYNVLDVIGRNIPLVEWLKMESRKGL  330

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             +IAI SRFLLIP FYFTAKYGDQG+MI LVSFLGLTNGYLTVCV+T AP+GYKGP  NAL
Sbjct  331   LIAILSRFLLIPAFYFTAKYGDQGYMIFLVSFLGLTNGYLTVCVMTVAPRGYKGPEQNAL  390

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             GN+LVLCLL GIF+GV LDWLWLIG   F
Sbjct  391   GNLLVLCLLIGIFAGVVLDWLWLIGKDSF  419



>ref|XP_007148256.1| hypothetical protein PHAVU_006G193100g [Phaseolus vulgaris]
 ref|XP_007148257.1| hypothetical protein PHAVU_006G193100g [Phaseolus vulgaris]
 gb|ESW20250.1| hypothetical protein PHAVU_006G193100g [Phaseolus vulgaris]
 gb|ESW20251.1| hypothetical protein PHAVU_006G193100g [Phaseolus vulgaris]
Length=419

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/390 (73%), Positives = 331/390 (85%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTIGDYYY LFPKYHP+RVLTLVYQPFAIGT+ ILAY   K+NTRKRNLAG+
Sbjct  30    SLVSWNSMLTIGDYYYTLFPKYHPARVLTLVYQPFAIGTMIILAYYESKINTRKRNLAGF  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFF+  F +L++DL TSGKGG+G YIGICV+ A FG+ADA V+GG+VG+L FMCPEF+Q
Sbjct  90    TLFFISIFFVLVVDLATSGKGGIGPYIGICVLAACFGIADAQVEGGMVGELCFMCPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S+LAGLAASG L S LR+VTKAAFE S+NGLRKG ILFLA+S+F E +CI LYA  F KL
Sbjct  150   SYLAGLAASGALISVLRMVTKAAFEKSNNGLRKGAILFLAISSFIELVCIFLYAIYFTKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESV--DDAKHVERVSNKKLFMENIDYALD  714
              IVKYYR+KAA EGSKTVAADLAAAGI+  ++    DD K  ER+SNK+LF+EN+DYA+D
Sbjct  210   PIVKYYRSKAALEGSKTVAADLAAAGISTKTKDQGGDDDKQQERLSNKRLFLENLDYAVD  269

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             ++ IY VTLSIFPGFLYENTGTH LG+WYP VL+AMYN+ DLISRYIP++  ++L+SRKG
Sbjct  270   IFFIYAVTLSIFPGFLYENTGTHGLGTWYPVVLIAMYNVVDLISRYIPIVPCLKLESRKG  329

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             L+IA+ SRFLLIP FYFTAKYG QGWMI L SFLGLTNGYLTVCVLT AP+GYKGP  NA
Sbjct  330   LLIAVFSRFLLIPAFYFTAKYGAQGWMIFLTSFLGLTNGYLTVCVLTVAPRGYKGPEQNA  389

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN+LVLCLLSGI  G  LDWLW+IG   F
Sbjct  390   LGNLLVLCLLSGICVGAVLDWLWIIGKGTF  419



>ref|XP_009626442.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009626443.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=418

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/388 (73%), Positives = 332/388 (86%), Gaps = 4/388 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP YHPSRVLTL+YQPFA+GT+AILAY   K+NTRKRNL GY 
Sbjct  29    LFSWNSMLTIEDYYVYLFPDYHPSRVLTLIYQPFALGTLAILAYNEAKMNTRKRNLFGYS  88

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ T  +L+LDL TSGKGGLG +IGIC I  +FGVADAHVQGG++GDL++M PEF+QS
Sbjct  89    LFFISTLLVLVLDLATSGKGGLGTFIGICAISGAFGVADAHVQGGMIGDLAYMLPEFMQS  148

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE+S +GLR G ILF +VSTFFE LC++LYAFVFPKL 
Sbjct  149   FLAGLAASGALTSVLRLITKAAFENSKDGLRNGAILFFSVSTFFELLCVLLYAFVFPKLP  208

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI----TAPSESVDDAKHVERVSNKKLFMENIDYAL  711
             IVKYYRAKAASEGSKTVA DLAA G+     + ++S    +HVER++NK+L ++NIDYA+
Sbjct  209   IVKYYRAKAASEGSKTVAGDLAAGGVYKQEGSETKSKHGPEHVERLNNKQLLLQNIDYAI  268

Query  712   DLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRK  891
             DL+LIY +TLSIFPGFL E+TG+H+LGSWY  VL+AMYN+WDLI RY+PLIK ++L+SRK
Sbjct  269   DLFLIYALTLSIFPGFLSEDTGSHSLGSWYALVLIAMYNVWDLIGRYVPLIKCLKLESRK  328

Query  892   GLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAAN  1071
             GLM+ I SRFLLIP FYFTAKYGDQGWMIML SFLGL+NGYLTVCVLT+APKGYKGP  N
Sbjct  329   GLMLVILSRFLLIPAFYFTAKYGDQGWMIMLTSFLGLSNGYLTVCVLTSAPKGYKGPEQN  388

Query  1072  ALGNILVLCLLSGIFSGVALDWLWLIGN  1155
             ALGN+LVL LL GIF+GV LDWLWLIG 
Sbjct  389   ALGNLLVLFLLGGIFAGVTLDWLWLIGK  416



>ref|XP_010455852.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
Length=417

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/386 (67%), Positives = 326/386 (84%), Gaps = 1/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             +++SWNSMLTIGDYYY +FP YHPSRVLT+VYQP A+GTI I AY+  K+NTRKRN+ GY
Sbjct  30    TIISWNSMLTIGDYYYYVFPDYHPSRVLTVVYQPLALGTIMIFAYRESKINTRKRNMIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             +L  + TF L++LDL T G GG+  YIG+C IVA FG+ADA V+GG++GDLSFMCPE +Q
Sbjct  90    MLSTISTFLLIVLDLATKGHGGMLPYIGLCAIVALFGLADATVRGGMMGDLSFMCPELIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S++AGLA SG LTS +RL+TKAAFE S +GLRKG ++FLA +T  EFLC+ILYA+VFPKL
Sbjct  150   SYMAGLAISGALTSAIRLITKAAFEKSHDGLRKGAMIFLATATLIEFLCVILYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              I+KYYR+KAASEGS+TV+ADL AAGI   SES +D+++ +R+SNK+L ++NIDYA++++
Sbjct  210   PIIKYYRSKAASEGSQTVSADLVAAGILNQSESTNDSQN-QRLSNKELLLQNIDYAMNIF  268

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             L+Y++TLSI PGFLYENTG H LG+WY  VL+AMYN WDL+ RY PL+K +++++RKGL 
Sbjct  269   LLYLLTLSIVPGFLYENTGQHGLGTWYALVLIAMYNCWDLVGRYTPLVKWLKIENRKGLT  328

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IA+  RF LIP FYFTAKYGDQGWMIML+S LGLTNG+L+VC+LT APKGYKGP  NALG
Sbjct  329   IAVLLRFFLIPAFYFTAKYGDQGWMIMLISILGLTNGHLSVCILTIAPKGYKGPEQNALG  388

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N++V+ LL G+F+GVALDWLWLIG  
Sbjct  389   NLMVMFLLGGVFAGVALDWLWLIGKK  414



>ref|XP_009778592.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009778593.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009778594.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009778595.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009778596.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Nicotiana sylvestris]
Length=418

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/388 (73%), Positives = 331/388 (85%), Gaps = 4/388 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP YHPSRVLTL+YQPFA+GT+AILAY   K+NTRKRNL GY 
Sbjct  29    LFSWNSMLTIEDYYVYLFPDYHPSRVLTLIYQPFALGTLAILAYNEAKMNTRKRNLFGYS  88

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ T  +L+LDL TSGKGGLG +IGIC I  +FGVADAHVQGG++GDL++M PEF+QS
Sbjct  89    LFFISTLLVLVLDLATSGKGGLGTFIGICAISGAFGVADAHVQGGMIGDLAYMLPEFIQS  148

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE+S +GLR G ILF +VSTFFE LC++LYAFVFPKL 
Sbjct  149   FLAGLAASGVLTSALRLITKAAFENSKDGLRNGAILFFSVSTFFELLCVLLYAFVFPKLP  208

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI----TAPSESVDDAKHVERVSNKKLFMENIDYAL  711
             IVKYYRAKAASEGSKTVA DLAA G+     + ++S    +HVER++NK+L ++NIDYA+
Sbjct  209   IVKYYRAKAASEGSKTVAGDLAAGGVFKHEGSETKSKHGPEHVERLNNKQLLLQNIDYAI  268

Query  712   DLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRK  891
             DL+LIY +TLSIFPGFL E+TG+H+LGSWY  VL+AMYN+WDLI RY+PLIK ++L+SRK
Sbjct  269   DLFLIYALTLSIFPGFLSEDTGSHSLGSWYALVLIAMYNVWDLIGRYVPLIKCLKLESRK  328

Query  892   GLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAAN  1071
             GLM+ I  RFLLIP FYFTAKYGDQGWMIML SFLGL+NGYLTVCVLT+APKGYKGP  N
Sbjct  329   GLMLVILLRFLLIPAFYFTAKYGDQGWMIMLTSFLGLSNGYLTVCVLTSAPKGYKGPEQN  388

Query  1072  ALGNILVLCLLSGIFSGVALDWLWLIGN  1155
             ALGN+LVL LL GIF+GV LDWLWLIG 
Sbjct  389   ALGNLLVLFLLGGIFAGVTLDWLWLIGK  416



>ref|XP_010455845.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Camelina sativa]
Length=419

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/387 (70%), Positives = 322/387 (83%), Gaps = 1/387 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQ+FP YHPSRVLTLVYQPFA+GTI IL Y   K+NTRKRNL GY
Sbjct  30    SLVSWNSMLTIADYYYQVFPDYHPSRVLTLVYQPFALGTIVILTYHESKMNTRKRNLIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LF + TF L++LDL T G+GG+G YIG+C +VASFG+ADA VQGG++GDLS MCPE +Q
Sbjct  90    TLFTISTFLLIVLDLATKGRGGVGPYIGLCAVVASFGLADATVQGGMIGDLSLMCPELVQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+ GLA +G LTS LRL TKAAFE S+NGLRKG ++FLA+STF E LC++LYA+VFPKL
Sbjct  150   SFMVGLAVAGALTSALRLTTKAAFEKSNNGLRKGAMIFLAISTFIELLCVLLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDL  717
              IVKYYR KAASEGSKTV+ADLAAAGI      + DD    +R++NK+L ++NIDYA++L
Sbjct  210   PIVKYYRRKAASEGSKTVSADLAAAGIQNTSDLTDDDDSKNQRLTNKELLLQNIDYAVNL  269

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIYV TLSIFPGFLYENTG H LG WY  VLVAMYN WDL+ RY PL+K +++++RK +
Sbjct  270   FLIYVCTLSIFPGFLYENTGKHGLGDWYALVLVAMYNCWDLVGRYTPLLKWLKIENRKLI  329

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
              IA+ SR+ LIP FYFTAKYGDQGWMIML+S LGLTNG+LTVC+LT APKGYKGP  NAL
Sbjct  330   TIAVLSRYFLIPAFYFTAKYGDQGWMIMLISILGLTNGHLTVCILTIAPKGYKGPEQNAL  389

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNS  1158
             GN+LV+ LL GIF+GVALDWLWLIG  
Sbjct  390   GNLLVIFLLGGIFAGVALDWLWLIGKK  416



>ref|XP_010316658.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Solanum lycopersicum]
Length=369

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/382 (72%), Positives = 315/382 (82%), Gaps = 15/382 (4%)
 Frame = +1

Query  25    LTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYIlfflgtf  204
             ++IGDYYY LFP             PFA+GTI ILAY   K++TRKR LAGYIL+ L TF
Sbjct  1     MSIGDYYYALFP-------------PFALGTIVILAYNEAKVDTRKRILAGYILYTLSTF  47

Query  205   alllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSFLAGLAA  384
              L+LLDL TS +GG+GNYIG+C IV  FG+ DA VQGG+ GDLSFMCPEF+QSF AGLAA
Sbjct  48    TLILLDLATSVRGGIGNYIGVCAIVGCFGIGDAVVQGGMTGDLSFMCPEFIQSFFAGLAA  107

Query  385   SGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAIVKYYRA  564
             SG LTSGLRL+TKAAFE+S+NGLRKGV+L+LA+S FFEFLCI+LYAF+FPKL IVK+YR 
Sbjct  108   SGALTSGLRLITKAAFENSNNGLRKGVMLYLAISVFFEFLCILLYAFIFPKLPIVKHYRT  167

Query  565   KAASEGSKTVAADLAAAGITAPS--ESVDDAKHVERVSNKKLFMENIDYALDLYLIYVVT  738
             KAA EGS TVAADLAAAGI   S  ++  DAK  ER+S K+L  +NIDY LDLYLIYV T
Sbjct  168   KAAVEGSTTVAADLAAAGIKTQSIEKTNSDAKQSERLSTKQLLFQNIDYELDLYLIYVAT  227

Query  739   LSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQSR  918
             LSIFPGFLYENTGTH LGSWY  VL+AMYN+WDLI RY+PLI K++LKS KGLMIA  SR
Sbjct  228   LSIFPGFLYENTGTHKLGSWYALVLIAMYNVWDLIGRYVPLIDKIKLKSPKGLMIATLSR  287

Query  919   FLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGNILVLC  1098
             FLL+PCFYFTAKYGDQGWMI LVSFLGLTNG+LTVCV+TAAPKGYKGP  NALGN+LV+ 
Sbjct  288   FLLVPCFYFTAKYGDQGWMIFLVSFLGLTNGHLTVCVMTAAPKGYKGPEQNALGNLLVVF  347

Query  1099  LLSGIFSGVALDWLWLIGNSGF  1164
             +L GI SGVALDWLW+IGN  F
Sbjct  348   ILCGICSGVALDWLWIIGNGKF  369



>ref|XP_003635072.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Vitis vinifera]
Length=414

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/390 (68%), Positives = 319/390 (82%), Gaps = 3/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             S +SWNS++TIGDYYY+LFP+YHP RVLT+V QPFA+GT+AIL YK   +NTRKRNL GY
Sbjct  26    SAISWNSLMTIGDYYYKLFPRYHPERVLTIVLQPFALGTMAILFYKEATINTRKRNLIGY  85

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF   T  L++LDL TSG+GG+  YIGIC IV +FGVA A VQGG+ GDLSFMCPEF++
Sbjct  86    ILFCTSTLMLIVLDLATSGRGGITPYIGICAIVGAFGVASALVQGGMTGDLSFMCPEFIR  145

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFLAGLAASG LTS LRLVTKA F  S++G R G +LFL ++TF EFLC +LYAF FPKL
Sbjct  146   SFLAGLAASGVLTSALRLVTKAVFRKSNDGERNGAMLFLGITTFVEFLCTLLYAFFFPKL  205

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAP--SESVDDAKHVERVSNKKLFMENIDYALD  714
              IVK+YR+KAA EGS+TV+ADLA  GI      E  DD +  ER+SNK+LF +NIDYAL+
Sbjct  206   PIVKFYRSKAALEGSQTVSADLAVVGIQTEQNEEDGDDTQQQERLSNKQLFFQNIDYALE  265

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             ++L ++VTLSIFPGFL+ENTG H LGSWYP VL+ MYN+WD++SRYIP++K + L SR+G
Sbjct  266   VFLGHLVTLSIFPGFLFENTGKHQLGSWYPLVLITMYNVWDMLSRYIPIVKCLRL-SRRG  324

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LM+ + ++FLLIP FYFTAKYGDQGWMI+L SFLG++NGYLTVC+ T APKGYKGP  NA
Sbjct  325   LMVGVLAQFLLIPAFYFTAKYGDQGWMILLTSFLGVSNGYLTVCIFTDAPKGYKGPEQNA  384

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN+L LCLL GIF+G AL WLWLIGN  F
Sbjct  385   LGNMLTLCLLCGIFAGGALGWLWLIGNESF  414



>ref|XP_010431740.1| PREDICTED: equilibrative nucleotide transporter 3 isoform X1 
[Camelina sativa]
 ref|XP_010431741.1| PREDICTED: equilibrative nucleotide transporter 3 isoform X1 
[Camelina sativa]
Length=449

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/417 (65%), Positives = 325/417 (78%), Gaps = 31/417 (7%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WNSMLTI DYYYQ+FP YHPSRVLTLVYQPFA+GTI IL Y   K+NTRKRNL GY
Sbjct  30    SLVAWNSMLTIADYYYQVFPDYHPSRVLTLVYQPFALGTIVILTYHESKMNTRKRNLIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LF + TF L++LDL T G+GG+G YIG+C +VASFG+ADA VQGG++GDLS MCPE +Q
Sbjct  90    TLFTISTFLLIVLDLATKGRGGVGPYIGLCAVVASFGLADATVQGGMIGDLSLMCPELVQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+ GLA +G LTS LRL TKAAFE S++GLRKG ++FLA+STF E LC++LYA+VFPKL
Sbjct  150   SFMVGLAVAGALTSALRLTTKAAFEKSNDGLRKGAMIFLAISTFIELLCVLLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESV--------------------------  642
              IVKYYR KAASEGSKTV+ADLAAAGI  PS+ V                          
Sbjct  210   PIVKYYRRKAASEGSKTVSADLAAAGIQNPSDLVTSENLSFLTFLLFKKYYSLLNSLKLL  269

Query  643   -----DDAKHVERVSNKKLFMENIDYALDLYLIYVVTLSIFPGFLYENTGTHNLGSWYPT  807
                  DD    +R+SNK+L ++NIDYA++L+LIYV TLSIFPGFLYENTG H LG WY  
Sbjct  270   DSMQTDDDSKNQRLSNKELLLQNIDYAVNLFLIYVCTLSIFPGFLYENTGKHGLGDWYAL  329

Query  808   VLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLV  987
             VLVAMYN WDL+ RY PL+K ++ ++RK + IA+ SR+LLIP FYFTAKYGDQG+MIML+
Sbjct  330   VLVAMYNCWDLVGRYTPLLKWLKFENRKLITIAVLSRYLLIPAFYFTAKYGDQGYMIMLI  389

Query  988   SFLGLTNGYLTVCVLTAAPKGYKGPAANALGNILVLCLLSGIFSGVALDWLWLIGNS  1158
             S LGLTNG+LTVC++T APKGYKGP  NALGN+LV+ LL GIF+GVALDWLWLIG  
Sbjct  390   SVLGLTNGHLTVCIMTIAPKGYKGPEQNALGNLLVIFLLGGIFAGVALDWLWLIGKK  446



>ref|XP_008349225.1| PREDICTED: equilibrative nucleotide transporter 3-like [Malus 
domestica]
Length=420

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/391 (71%), Positives = 317/391 (81%), Gaps = 3/391 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+W SM  IGDYYY LFP YHPSRVLTLVYQPFA  T+A LAY   K++TRKRNL GY
Sbjct  30    SLVAWXSMJXIGDYYYNLFPTYHPSRVLTLVYQPFAFXTMATLAYHEAKVDTRKRNLIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFFL T  L+++D+ TS  GG+G YIGIC  VA+FGVADAHVQGG+VGDLS M PEF+Q
Sbjct  90    ALFFLATLMLIIVDVATSAGGGVGPYIGICACVAAFGVADAHVQGGMVGDLSLMRPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGL ASG LTSGLRL+TKAAFE S +GLRKG +LFL +STF EFLCI+LYAF FP+L
Sbjct  150   SFFAGLXASGALTSGLRLMTKAAFEKSHDGLRKGTMLFLTISTFTEFLCILLYAFYFPRL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGIT--APSESVDDAKHVE-RVSNKKLFMENIDYAL  711
              IVK YR+KAASEGSKTV ADLAAAG+   A  E  +DAK V  R+S  ++F +NID+ L
Sbjct  210   PIVKXYRSKAASEGSKTVTADLAAAGVQTQADIEVSNDAKVVPTRLSTMQIFKQNIDFCL  269

Query  712   DLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRK  891
             DL+LIYV+TLSIFPGF+YENTG H LG+WYP VL AMYN+ DLISRYIPLIK ++++SRK
Sbjct  270   DLFLIYVLTLSIFPGFIYENTGNHQLGTWYPLVLXAMYNVLDLISRYIPLIKCLKIESRK  329

Query  892   GLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAAN  1071
             GL+IAI  RFL +P +YFT KY DQGWMI+L S LGLTNGYLTVCV+T APKGY GP  N
Sbjct  330   GLLIAILLRFLFVPAYYFTGKYADQGWMILLTSILGLTNGYLTVCVMTVAPKGYNGPEQN  389

Query  1072  ALGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             ALGNILVL LL GIF+GV LDWLWLIG   F
Sbjct  390   ALGNILVLFLLGGIFAGVCLDWLWLIGKEKF  420



>ref|XP_009374004.1| PREDICTED: equilibrative nucleotide transporter 3-like [Pyrus 
x bretschneideri]
 ref|XP_009374070.1| PREDICTED: equilibrative nucleotide transporter 3-like [Pyrus 
x bretschneideri]
Length=420

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/391 (71%), Positives = 321/391 (82%), Gaps = 3/391 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+W+SML+I DYYY LFP YHPSRVLT+VYQPFA+ T+A LAY   K++TRKRNL GY
Sbjct  30    SLVAWSSMLSISDYYYNLFPTYHPSRVLTIVYQPFALVTMATLAYHEAKVDTRKRNLIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFFL T  L+++D+ TS  GG+G YIGIC  V  FGVADAHVQGG+VGDLSFM PEF+Q
Sbjct  90    ALFFLATLMLIIVDVATSAGGGIGPYIGICTCVGVFGVADAHVQGGMVGDLSFMRPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGLAASG LTSGLRL+TKAAFE S +GLRKG +LFL +STF EFLCI+LYA  F +L
Sbjct  150   SFFAGLAASGALTSGLRLITKAAFEKSHDGLRKGTMLFLTISTFIEFLCILLYAIYFSRL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPS--ESVDDAKHV-ERVSNKKLFMENIDYAL  711
              IVKYYR+KAASEGSKTV ADLAAAGI      E  +DAK V  R+S  ++F +NID+ L
Sbjct  210   PIVKYYRSKAASEGSKTVTADLAAAGIQTQEDIEVSNDAKVVPTRLSTMQIFKQNIDFCL  269

Query  712   DLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRK  891
             DL+LIYV+TLSIFPGF++ENTG H LGSWYP VL+AMYN+ DLISRYIPLIK ++++SRK
Sbjct  270   DLFLIYVLTLSIFPGFIFENTGKHQLGSWYPLVLIAMYNVLDLISRYIPLIKCLKIESRK  329

Query  892   GLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAAN  1071
             GL+IAI SRFL +P +YFT KY DQGWMI+L S LGLTNGYLTVCV+T APKGY GP  N
Sbjct  330   GLLIAILSRFLFVPAYYFTGKYADQGWMILLTSILGLTNGYLTVCVMTVAPKGYNGPEQN  389

Query  1072  ALGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             ALGNILVLCLL GIF+GV LDWLWLIG   F
Sbjct  390   ALGNILVLCLLGGIFAGVCLDWLWLIGKGTF  420



>gb|KHN33640.1| Equilibrative nucleoside transporter 4 [Glycine soja]
Length=425

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/396 (73%), Positives = 333/396 (84%), Gaps = 8/396 (2%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTIGDYYY LFPKYHP+RVLTLVYQPFAIGT+ ILAY   K+NTR RNLAG+
Sbjct  30    SLVSWNSMLTIGDYYYILFPKYHPARVLTLVYQPFAIGTMLILAYYESKINTRMRNLAGF  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFF  TF +L++DL +SGKGGLG YIGICV+ A FG+ADA V+GGI+G+L FMCPEF+Q
Sbjct  90    TLFFFSTFFVLVVDLASSGKGGLGPYIGICVLAACFGIADAQVEGGIIGELCFMCPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S+LAGLAASG L S LR++TK AFE S+NGLRKG ILFLA+STF E +CIILYA  F KL
Sbjct  150   SYLAGLAASGALISILRMLTKVAFEKSNNGLRKGAILFLAISTFIELVCIILYAICFTKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVD--DAKHVERVSNKKLFMENIDYALD  714
              IVKYYR+KAA EGSKTVAADLAAAGI   +      D+K  ER+SNK+LF+EN+DYA+D
Sbjct  210   PIVKYYRSKAALEGSKTVAADLAAAGIQTKTNDQGGYDSKKEERLSNKQLFVENLDYAVD  269

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+LIYVVTLSIFPGFLYENTGTH LG+WYP VL+AMYN+ D I+RYIPL+  ++L+SRKG
Sbjct  270   LFLIYVVTLSIFPGFLYENTGTHQLGTWYPVVLIAMYNVVDFIARYIPLVPWLKLESRKG  329

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYK------  1056
             L+IA+ SRFLLIP FYFTAKYGDQGWMI+L SFLGLTNGYLTVCVLT AP+GYK      
Sbjct  330   LLIAVFSRFLLIPAFYFTAKYGDQGWMILLTSFLGLTNGYLTVCVLTVAPRGYKASYKAF  389

Query  1057  GPAANALGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             GP  NALGN+LVLCLLSGIF+G  LDWLW+IG   F
Sbjct  390   GPEQNALGNLLVLCLLSGIFAGAVLDWLWIIGKGTF  425



>ref|XP_010533854.1| PREDICTED: equilibrative nucleotide transporter 3 [Tarenaya hassleriana]
 ref|XP_010533855.1| PREDICTED: equilibrative nucleotide transporter 3 [Tarenaya hassleriana]
Length=422

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/385 (70%), Positives = 315/385 (82%), Gaps = 2/385 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WNSMLTI DYYYQ+FP YHPSRVLTLVYQPFA  TIAILAY   K+NTRKRN+ GY
Sbjct  32    SLVAWNSMLTIADYYYQVFPDYHPSRVLTLVYQPFACATIAILAYYEAKINTRKRNIFGY  91

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              L+ + TF L++LDL T G+GG+  Y+ +C+IVASFG+ADAHVQGG+VGDLSFMCPEF+Q
Sbjct  92    ALYTVSTFLLIVLDLATKGQGGVIPYVLLCLIVASFGLADAHVQGGMVGDLSFMCPEFIQ  151

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+ GL  SG LTS LRL+TKA F+ S NGLRKG +LFLA+ST  E LCI LYA+VFPKL
Sbjct  152   SFMGGLGISGALTSCLRLMTKAIFDKSPNGLRKGALLFLAISTLIELLCIFLYAYVFPKL  211

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVD--DAKHVERVSNKKLFMENIDYALD  714
              IVKYYRAKAA+EG+KTV+ADL AAG+   +  V   D   ++R SNK+L  ENID+ ++
Sbjct  212   PIVKYYRAKAAAEGAKTVSADLMAAGLQDKAAQVAELDQSKIQRRSNKQLLRENIDHGIN  271

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             LYL+YVVTLSIFPGFLYENTG H LG+WYP VLVA YN WD +SRYIP+IK + L+SRK 
Sbjct  272   LYLVYVVTLSIFPGFLYENTGEHQLGTWYPLVLVAAYNCWDTVSRYIPMIKCLALESRKW  331

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             L + + +RF L+P FYFTAKY DQGWMI L SFLGLTNGYLTVC+L+AAPKGY GP +NA
Sbjct  332   LTVCVLARFALVPAFYFTAKYADQGWMIFLTSFLGLTNGYLTVCILSAAPKGYNGPESNA  391

Query  1075  LGNILVLCLLSGIFSGVALDWLWLI  1149
             LGN+LV  LL GIFSGV LDWLWLI
Sbjct  392   LGNLLVGFLLGGIFSGVCLDWLWLI  416



>ref|XP_011047487.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Populus euphratica]
 ref|XP_011047488.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Populus euphratica]
 ref|XP_011047489.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Populus euphratica]
Length=418

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/386 (73%), Positives = 330/386 (85%), Gaps = 2/386 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  +FP YHPSRVLTLVYQPFA+GTIA+L Y   K+NTR RNL GY 
Sbjct  31    LFSWNSMLTIEDYYVYIFPHYHPSRVLTLVYQPFALGTIAVLTYNEAKINTRLRNLFGYA  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL T  +L+LDL TSGKGG+G +IG+C I  +FGVADAHVQGG+VGDLSFM PEF+QS
Sbjct  91    LFFLSTLLVLVLDLATSGKGGIGTFIGVCAISGAFGVADAHVQGGMVGDLSFMQPEFIQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAF++S +GLRKG ILF A+ TFFE LC++LYA++FPKL 
Sbjct  151   FLAGLAASGALTSALRLITKAAFDNSQDGLRKGAILFFAICTFFELLCVLLYAYIFPKLD  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITA--PSESVDDAKHVERVSNKKLFMENIDYALDL  717
             IVK+YR+KAASEGSKTV+ADLAA GI      E+ +D K +ER+S+K+L ++NIDYA+D+
Sbjct  211   IVKHYRSKAASEGSKTVSADLAAGGIQTLLKPEAQEDPKQLERLSSKELLLQNIDYAIDM  270

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIYV+TLSIFPGFL E+TGTH+LG WY  VL+AMYN+ DLI RYIPL+K ++L+SRKGL
Sbjct  271   FLIYVLTLSIFPGFLSEDTGTHSLGGWYALVLIAMYNVCDLIGRYIPLLKFLKLESRKGL  330

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             MIAI SRFLL+P FYFTAKYGDQGWMIML SFLGLTNGYLTVCVLT+APKGYKGP  NAL
Sbjct  331   MIAILSRFLLVPAFYFTAKYGDQGWMIMLTSFLGLTNGYLTVCVLTSAPKGYKGPEQNAL  390

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LVL LL GIF+GV LDWLWLIG 
Sbjct  391   GNLLVLFLLGGIFAGVTLDWLWLIGK  416



>gb|EEC82260.1| hypothetical protein OsI_26455 [Oryza sativa Indica Group]
Length=418

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/387 (70%), Positives = 321/387 (83%), Gaps = 2/387 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL +WNSMLTI DYY  LFP YHP+RVLT+ YQPFA G   IL Y   KLNTRKRNL G+
Sbjct  30    SLFAWNSMLTIEDYYSILFPTYHPTRVLTIAYQPFAFGITCILTYHEAKLNTRKRNLIGF  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LF + +FAL++LD+GT G+GGLG +IG+C+I A FG ADA VQGG+VGDLSFMCPEF+Q
Sbjct  90    ALFLVSSFALIMLDIGTKGRGGLGPFIGVCIISALFGTADASVQGGLVGDLSFMCPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFLAGLAASG LTS LRL+TKAAFE+S NGLR G ILF +++ FFE +C++LYA+VFPKL
Sbjct  150   SFLAGLAASGVLTSALRLITKAAFENSQNGLRNGAILFFSITCFFELVCLLLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPS--ESVDDAKHVERVSNKKLFMENIDYALD  714
              IVKYYR+KAA+EGSKTVA+DLAAAGI+     ++ +D K  +R+S K+L ++NIDYA D
Sbjct  210   PIVKYYRSKAAAEGSKTVASDLAAAGISNEHSIQAEEDPKKCDRLSTKELLIQNIDYAFD  269

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             ++LIYV+TLSIFPGFL E+TG H+LG+WY   L+AMYN+WDLI RY+PLIK ++L SRKG
Sbjct  270   IFLIYVLTLSIFPGFLSEDTGAHSLGTWYALTLIAMYNVWDLIGRYLPLIKCIKLTSRKG  329

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             L  AI +RFL IP FYFTAKYGDQG+MI L SFLGLTNG+LTVCVLT APKGYKGP  NA
Sbjct  330   LTGAILARFLFIPAFYFTAKYGDQGYMIFLTSFLGLTNGFLTVCVLTEAPKGYKGPEQNA  389

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGN  1155
             LGN+LV+CLL GIFSGV LDWLWLIG 
Sbjct  390   LGNVLVVCLLGGIFSGVVLDWLWLIGK  416



>ref|XP_006657824.1| PREDICTED: equilibrative nucleotide transporter 3-like [Oryza 
brachyantha]
Length=418

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/387 (69%), Positives = 320/387 (83%), Gaps = 2/387 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL +WNSMLTI DYY  LFP YHP+RVLTL YQPFA G   IL Y   KLNTRKRNL G+
Sbjct  30    SLFAWNSMLTIEDYYQILFPTYHPTRVLTLAYQPFAFGITCILTYHEAKLNTRKRNLFGF  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LF + +FAL++LD+GT G+GGLG +IG+C+I A FG ADA VQGG+VGDLSFMCPEF+Q
Sbjct  90    ALFLVSSFALIILDVGTKGRGGLGAFIGVCIISALFGTADASVQGGLVGDLSFMCPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFLAGLAASG LTS LRL+TKAAFE+S NGLR G ILF +++ FFE +C++LYA+VFPKL
Sbjct  150   SFLAGLAASGVLTSSLRLITKAAFENSKNGLRNGAILFFSITCFFELVCLLLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPS--ESVDDAKHVERVSNKKLFMENIDYALD  714
              IVKYYR+KAASEGSKTVA+DLAAAG+      +  +D K  +R+S K+L ++NIDYALD
Sbjct  210   PIVKYYRSKAASEGSKTVASDLAAAGLNTEQAGQVEEDPKKFDRLSTKQLLVQNIDYALD  269

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             ++LIYV+TLSIFPGFL E+TG+H+LG+WY   L+ MYN+WDLI RY+PL+K ++L SRKG
Sbjct  270   IFLIYVLTLSIFPGFLSEDTGSHSLGTWYVLTLIVMYNVWDLIGRYLPLVKCIKLTSRKG  329

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             L  AI +RFL +P FYFTAKYGDQG+MI L SFLGLTNG+LTVCVLT APKGYKGP  NA
Sbjct  330   LTAAILARFLFVPAFYFTAKYGDQGYMIFLTSFLGLTNGFLTVCVLTEAPKGYKGPEQNA  389

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGN  1155
             LGN+LV+CLL GIFSGV LDWLWLIG 
Sbjct  390   LGNVLVVCLLGGIFSGVVLDWLWLIGK  416



>ref|XP_003543367.1| PREDICTED: equilibrative nucleotide transporter 3 isoform X1 
[Glycine max]
 ref|XP_006594867.1| PREDICTED: equilibrative nucleotide transporter 3 isoform X3 
[Glycine max]
 ref|XP_006594868.1| PREDICTED: equilibrative nucleotide transporter 3 isoform X4 
[Glycine max]
 ref|XP_006594869.1| PREDICTED: equilibrative nucleotide transporter 3 isoform X5 
[Glycine max]
Length=414

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/385 (74%), Positives = 327/385 (85%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFPKYHPSRVLTLVYQPFA+GT+AILAY   KLNTR RNL GYI
Sbjct  28    LFSWNSMLTIEDYYGYLFPKYHPSRVLTLVYQPFAVGTLAILAYNEAKLNTRLRNLFGYI  87

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ T  +L+L+  TSGKGGLG +IGIC +  +FGVADAHVQGG+VGDLS+M PEF+QS
Sbjct  88    LFFISTLLVLILNSATSGKGGLGTFIGICALSGAFGVADAHVQGGMVGDLSYMKPEFIQS  147

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRLVTKAAFE+S +GLRKG ILF A+STFFE LC++LYAF+FPK+ 
Sbjct  148   FLAGLAASGVLTSALRLVTKAAFENSKDGLRKGAILFFAISTFFELLCVVLYAFIFPKIP  207

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR+KAASEGSKTV+ADLAA GI T P    +  K  ER  NK+L +ENIDYALD +
Sbjct  208   IVKYYRSKAASEGSKTVSADLAAGGIRTLPGTEKEYTKDPERKGNKQLLLENIDYALDTF  267

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIY++TLSIFPGFL E+TG+H+LG+WY  VL+AMYN+WDLI RYIPL+K ++L+SRK + 
Sbjct  268   LIYMLTLSIFPGFLLEDTGSHSLGTWYALVLIAMYNVWDLIGRYIPLLKCLKLESRKLIT  327

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             I I SRFLL+P FYFTAKYGDQGWMI+L SFLGL+NGYLTVCVLT+APKGYKGP  NALG
Sbjct  328   ITILSRFLLVPAFYFTAKYGDQGWMIVLTSFLGLSNGYLTVCVLTSAPKGYKGPEQNALG  387

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LVL LL GIF+GV LDWLWLIG 
Sbjct  388   NLLVLFLLGGIFAGVTLDWLWLIGK  412



>ref|XP_010268895.1| PREDICTED: equilibrative nucleotide transporter 3-like [Nelumbo 
nucifera]
 ref|XP_010268896.1| PREDICTED: equilibrative nucleotide transporter 3-like [Nelumbo 
nucifera]
 ref|XP_010268897.1| PREDICTED: equilibrative nucleotide transporter 3-like [Nelumbo 
nucifera]
 ref|XP_010268899.1| PREDICTED: equilibrative nucleotide transporter 3-like [Nelumbo 
nucifera]
 ref|XP_010268900.1| PREDICTED: equilibrative nucleotide transporter 3-like [Nelumbo 
nucifera]
 ref|XP_010268901.1| PREDICTED: equilibrative nucleotide transporter 3-like [Nelumbo 
nucifera]
 ref|XP_010268902.1| PREDICTED: equilibrative nucleotide transporter 3-like [Nelumbo 
nucifera]
Length=417

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/386 (73%), Positives = 326/386 (84%), Gaps = 1/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL++WNSMLTI DYY  LFP YHP RVLTL+YQPFA+GT+AILAY   K+NTR+RNL GY
Sbjct  30    SLLAWNSMLTIEDYYEYLFPHYHPVRVLTLIYQPFALGTVAILAYNEAKINTRRRNLTGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFF+ +  +L+LDL TSGKGG+G +IGIC I  SFGVADA VQGG+VGDLSFMCPEF+Q
Sbjct  90    TLFFISSLLVLILDLATSGKGGIGTFIGICSISCSFGVADAFVQGGMVGDLSFMCPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFLAGLAASG L+SGLRL+TKA F +S +G RKG +LF  +S F E LC++LYAF+FPKL
Sbjct  150   SFLAGLAASGALSSGLRLITKAIFNNSKDGFRKGAMLFFGISAFSELLCVLLYAFIFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDL  717
              IVKYYR+KAASEGSKTVAADLAA GI T PS   +D K +ER+SNK+LF +NIDYA+D+
Sbjct  210   TIVKYYRSKAASEGSKTVAADLAAGGIHTQPSLDEEDPKQLERLSNKQLFFQNIDYAVDI  269

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIYV+TLSIFPGF+ E+TG+HNLGSWY  VL+A YN+WDLI+RYIPLIK + L SRKGL
Sbjct  270   FLIYVLTLSIFPGFISEDTGSHNLGSWYILVLIASYNVWDLIARYIPLIKCLTLTSRKGL  329

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             M A  SRFL IP FYFTAKYGDQGWMIML S LGLTNGYLTVCVLTAAPKGYKGP  NAL
Sbjct  330   MNATLSRFLFIPAFYFTAKYGDQGWMIMLTSLLGLTNGYLTVCVLTAAPKGYKGPEQNAL  389

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LVLCLL G+F+GV LDWLW IG 
Sbjct  390   GNLLVLCLLGGLFAGVTLDWLWRIGK  415



>ref|XP_006594866.1| PREDICTED: equilibrative nucleotide transporter 3 isoform X2 
[Glycine max]
Length=431

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/385 (74%), Positives = 327/385 (85%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFPKYHPSRVLTLVYQPFA+GT+AILAY   KLNTR RNL GYI
Sbjct  45    LFSWNSMLTIEDYYGYLFPKYHPSRVLTLVYQPFAVGTLAILAYNEAKLNTRLRNLFGYI  104

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ T  +L+L+  TSGKGGLG +IGIC +  +FGVADAHVQGG+VGDLS+M PEF+QS
Sbjct  105   LFFISTLLVLILNSATSGKGGLGTFIGICALSGAFGVADAHVQGGMVGDLSYMKPEFIQS  164

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRLVTKAAFE+S +GLRKG ILF A+STFFE LC++LYAF+FPK+ 
Sbjct  165   FLAGLAASGVLTSALRLVTKAAFENSKDGLRKGAILFFAISTFFELLCVVLYAFIFPKIP  224

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR+KAASEGSKTV+ADLAA GI T P    +  K  ER  NK+L +ENIDYALD +
Sbjct  225   IVKYYRSKAASEGSKTVSADLAAGGIRTLPGTEKEYTKDPERKGNKQLLLENIDYALDTF  284

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIY++TLSIFPGFL E+TG+H+LG+WY  VL+AMYN+WDLI RYIPL+K ++L+SRK + 
Sbjct  285   LIYMLTLSIFPGFLLEDTGSHSLGTWYALVLIAMYNVWDLIGRYIPLLKCLKLESRKLIT  344

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             I I SRFLL+P FYFTAKYGDQGWMI+L SFLGL+NGYLTVCVLT+APKGYKGP  NALG
Sbjct  345   ITILSRFLLVPAFYFTAKYGDQGWMIVLTSFLGLSNGYLTVCVLTSAPKGYKGPEQNALG  404

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LVL LL GIF+GV LDWLWLIG 
Sbjct  405   NLLVLFLLGGIFAGVTLDWLWLIGK  429



>ref|XP_008800349.1| PREDICTED: equilibrative nucleotide transporter 3-like [Phoenix 
dactylifera]
 ref|XP_008800350.1| PREDICTED: equilibrative nucleotide transporter 3-like [Phoenix 
dactylifera]
 ref|XP_008800351.1| PREDICTED: equilibrative nucleotide transporter 3-like [Phoenix 
dactylifera]
 ref|XP_008800352.1| PREDICTED: equilibrative nucleotide transporter 3-like [Phoenix 
dactylifera]
Length=418

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/386 (71%), Positives = 328/386 (85%), Gaps = 2/386 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  +FP+YHP+RVLTLVYQPFA+GT+AILAY   K+NTR RNL GY 
Sbjct  31    LFSWNSMLTIEDYYVYVFPRYHPTRVLTLVYQPFALGTLAILAYNESKINTRSRNLTGYT  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL +  L++LD+ TSG+GG+G +IGIC I  +FGVADAH QGG+VGDL  M PEF+QS
Sbjct  91    LFFLSSLLLIVLDVATSGRGGIGVFIGICAISGAFGVADAHAQGGMVGDLFLMRPEFMQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE++ +GLRKG ++F A+S FFE LC++LYAF+FP+L 
Sbjct  151   FLAGLAASGALTSALRLITKAAFENTQDGLRKGAMMFFAISAFFELLCVLLYAFIFPELP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSE--SVDDAKHVERVSNKKLFMENIDYALDL  717
             IVKYYR+KAASEGS TVAADLAAAGI    +  + +D   +ER++NK+L ++N DYA+D+
Sbjct  211   IVKYYRSKAASEGSMTVAADLAAAGIQKQRDQGAEEDPNLLERLTNKQLLLQNSDYAIDI  270

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             YLIYV+TLSIFPGFL E+TG+H+LGSWY  VL+AMYN+WDLI RY+PL+  ++L SR+GL
Sbjct  271   YLIYVLTLSIFPGFLSEDTGSHSLGSWYALVLIAMYNVWDLIGRYVPLVNWLKLTSREGL  330

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             M+AI SRFLLIP FYFTAKYGDQGWMIML SFLGLTNGYLTVCVLTAAPKGYKGP  NAL
Sbjct  331   MVAILSRFLLIPAFYFTAKYGDQGWMIMLTSFLGLTNGYLTVCVLTAAPKGYKGPEQNAL  390

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LVL LL+GIFSGV LDWLWLIG 
Sbjct  391   GNLLVLFLLAGIFSGVTLDWLWLIGK  416



>ref|NP_001275018.1| equilibrative nucleotide transporter 3-like [Solanum tuberosum]
 emb|CBX87930.1| equilibrative nucleoside transporter 3 [Solanum tuberosum]
Length=418

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/387 (73%), Positives = 330/387 (85%), Gaps = 3/387 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP YHPSRVLTL+YQPFA+GT+AILAY   K+NTRKRNL GY 
Sbjct  30    LFSWNSMLTIQDYYVALFPNYHPSRVLTLIYQPFALGTLAILAYNEAKINTRKRNLFGYT  89

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ TF +L+LDL TSGKGGLG++IGICVI  +FGVADAHVQGG++GDLSFM PEFLQS
Sbjct  90    LFFIATFIVLVLDLATSGKGGLGSFIGICVISGAFGVADAHVQGGMIGDLSFMLPEFLQS  149

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAF++S +GLRKG ILF AVST FE LC++LYAFVFPKL 
Sbjct  150   FLAGLAASGALTSSLRLITKAAFDNSQDGLRKGAILFFAVSTLFELLCVLLYAFVFPKLP  209

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI---TAPSESVDDAKHVERVSNKKLFMENIDYALD  714
             IVK+YRAKAASEGSKTVA+DLAAAG+      ++   D + VER++NK+L ++NIDYA+D
Sbjct  210   IVKFYRAKAASEGSKTVASDLAAAGVYKQGPETKDEHDPQQVERLNNKELLLQNIDYAID  269

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+LIY +TLSIFPGFL E+TG+H+LGSWY  VL+AMYN+WDLI RYIPLIK ++L+SRKG
Sbjct  270   LFLIYALTLSIFPGFLSEDTGSHSLGSWYALVLIAMYNVWDLIGRYIPLIKCLKLESRKG  329

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LM+ I  R L +P FYFTAKYGDQGWMIML S LG++NG+LTVCVLT APKGYKGP  NA
Sbjct  330   LMVVILLRSLFVPAFYFTAKYGDQGWMIMLTSLLGVSNGHLTVCVLTCAPKGYKGPEQNA  389

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGN  1155
             LGN+LVL LL GIF+GV LDWLWLIG 
Sbjct  390   LGNLLVLFLLGGIFTGVTLDWLWLIGK  416



>gb|KHN36590.1| Equilibrative nucleoside transporter 4 [Glycine soja]
Length=414

 Score =   524 bits (1349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/385 (74%), Positives = 326/385 (85%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFPKYHPSRVLTLVYQPFA GT+AILAY   KLNTR RNL GYI
Sbjct  28    LFSWNSMLTIEDYYGYLFPKYHPSRVLTLVYQPFAFGTLAILAYNEAKLNTRLRNLFGYI  87

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ T  +L+L+  TSGKGGLG +IGIC +  +FGVADAHVQGG+VGDLS+M PEF+QS
Sbjct  88    LFFISTLLVLILNSATSGKGGLGTFIGICALSGAFGVADAHVQGGMVGDLSYMKPEFIQS  147

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRLVTKAAFE+S +GLRKG ILF A+STFFE LC++LYAF+FPK+ 
Sbjct  148   FLAGLAASGALTSALRLVTKAAFENSKDGLRKGAILFFAISTFFELLCVVLYAFIFPKIP  207

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR+KAASEGSKTV+ADLAA GI T P    +  K  ER  NK+L +ENIDYALD +
Sbjct  208   IVKYYRSKAASEGSKTVSADLAAGGIRTLPGTEKEYTKDPERKGNKQLLLENIDYALDTF  267

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIY++TLSIFPGFL E+TG+H+LG+WY  VL+AMYN+WDLI RYIPL+K ++L+SRK + 
Sbjct  268   LIYMLTLSIFPGFLLEDTGSHSLGTWYALVLIAMYNVWDLIGRYIPLLKCLKLESRKLIT  327

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             I I SRFLL+P FYFTAKYGDQGWMI+L SFLGL+NGYLTVCVLT+APKGYKGP  NALG
Sbjct  328   ITILSRFLLVPAFYFTAKYGDQGWMIVLTSFLGLSNGYLTVCVLTSAPKGYKGPEQNALG  387

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LVL LL GIF+GV LDWLWLIG 
Sbjct  388   NLLVLFLLGGIFAGVTLDWLWLIGK  412



>ref|XP_006371645.1| hypothetical protein POPTR_0019s14090g [Populus trichocarpa]
 ref|XP_002325685.2| hypothetical protein POPTR_0019s14090g [Populus trichocarpa]
 gb|ERP49442.1| hypothetical protein POPTR_0019s14090g [Populus trichocarpa]
 gb|EEF00067.2| hypothetical protein POPTR_0019s14090g [Populus trichocarpa]
Length=418

 Score =   524 bits (1349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/386 (73%), Positives = 328/386 (85%), Gaps = 2/386 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  +FP YHPSRVLTLVYQPFA+GTIA+L Y   K+NTR RNL GY 
Sbjct  31    LFSWNSMLTIEDYYVYIFPHYHPSRVLTLVYQPFALGTIAVLTYNEAKINTRLRNLFGYA  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL T  +L+LDL TSGKGG+G +IG+C I  +FGVADAHVQGG+VGDLSFM PEF+QS
Sbjct  91    LFFLSTLLVLVLDLATSGKGGIGTFIGVCAISGAFGVADAHVQGGMVGDLSFMQPEFIQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAF++S +G RKG ILF A+ TFFE LC++LYA++FPKL 
Sbjct  151   FLAGLAASGALTSALRLITKAAFDNSQDGFRKGAILFFAICTFFELLCVLLYAYIFPKLD  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITA--PSESVDDAKHVERVSNKKLFMENIDYALDL  717
             IVK+YR+KAASEGSKTV+ADLAA GI      E+ +D K +ER+SNK+L ++NIDYA+D+
Sbjct  211   IVKHYRSKAASEGSKTVSADLAAGGIQTLLKPEAQEDPKQLERLSNKELLLQNIDYAIDM  270

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIYV+TLSIFPGFL E+TGTH+LG WY  VL+AMYN+ DLI RYIPL+K ++L+SRK L
Sbjct  271   FLIYVLTLSIFPGFLSEDTGTHSLGGWYALVLIAMYNVCDLIGRYIPLLKFLKLESRKSL  330

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             MIAI SRFLL+P FYFTAKYGDQGWMIML SFLGLTNGYLTVCVLT+APKGYKGP  NAL
Sbjct  331   MIAILSRFLLVPAFYFTAKYGDQGWMIMLTSFLGLTNGYLTVCVLTSAPKGYKGPEQNAL  390

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LVL LL GIF+GV LDWLWLIG 
Sbjct  391   GNLLVLFLLGGIFAGVTLDWLWLIGK  416



>ref|XP_003547129.1| PREDICTED: equilibrative nucleotide transporter 3-like [Glycine 
max]
 gb|KHN33639.1| Equilibrative nucleoside transporter 4 [Glycine soja]
Length=419

 Score =   524 bits (1349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/390 (74%), Positives = 335/390 (86%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WNSMLT+GDYYY LFP YHPSRVLTL+YQPFA+ T+AILAY   ++NTRKRNL GY
Sbjct  30    SLVAWNSMLTVGDYYYNLFPTYHPSRVLTLIYQPFALVTMAILAYNESRINTRKRNLIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LF + T  +L+LDL TSGKGG+G YIG+C + A FGVADAHVQGG+VGDLSFMCPEF+Q
Sbjct  90    TLFSISTLLVLVLDLATSGKGGIGPYIGLCALSACFGVADAHVQGGMVGDLSFMCPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGLAASG L SGLRL+TK  FE S +GLRKG +LF A+ST FEF C+ILYA  FPKL
Sbjct  150   SFFAGLAASGALASGLRLLTKVGFEKSDHGLRKGAMLFFAISTLFEFFCVILYAIYFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPS--ESVDDAKHVERVSNKKLFMENIDYALD  714
             +IVKYYR+KAASEGSKTV+ADLAAAGI   +  +   DAK  ER+SNK+L ++N+DYA D
Sbjct  210   SIVKYYRSKAASEGSKTVSADLAAAGIHNDTNLQVGFDAKQQERLSNKQLILQNMDYAAD  269

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+LIYV+TLSIFPGFL+ENTG+H LG+WYP VL+AMYN+ DLISRYIPLIK ++L+SRKG
Sbjct  270   LFLIYVLTLSIFPGFLFENTGSHQLGTWYPLVLIAMYNLLDLISRYIPLIKCLKLESRKG  329

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             L+IA+ SRFLL+P FYFTAKYGDQGWMI+LVSFLGLTNGYLTVCV T AP+GYKGP  NA
Sbjct  330   LLIAVLSRFLLVPAFYFTAKYGDQGWMILLVSFLGLTNGYLTVCVFTVAPQGYKGPEQNA  389

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN+LVL LL GIFSGVALDWLWLIG SGF
Sbjct  390   LGNLLVLFLLIGIFSGVALDWLWLIGKSGF  419



>ref|NP_001059965.1| Os07g0557100 [Oryza sativa Japonica Group]
 dbj|BAD30917.1| putative equilibrative nucleoside transporter ENT8 splice variant 
[Oryza sativa Japonica Group]
 dbj|BAF21879.1| Os07g0557100 [Oryza sativa Japonica Group]
 dbj|BAG95361.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86721.1| unnamed protein product [Oryza sativa Japonica Group]
Length=418

 Score =   523 bits (1348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/387 (69%), Positives = 320/387 (83%), Gaps = 2/387 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL +WNSMLTI DYY  LFP YHP+RVLT+ YQPFA G   IL Y   KLNTRKRNL G+
Sbjct  30    SLFAWNSMLTIEDYYSILFPTYHPTRVLTIAYQPFAFGITCILTYHEAKLNTRKRNLIGF  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LF + +FAL++LD+GT G+GGLG +IG+C+I A FG ADA VQGG+VGDLSFMCPEF+Q
Sbjct  90    ALFLISSFALIMLDIGTKGRGGLGPFIGVCIISALFGTADASVQGGLVGDLSFMCPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFLAGLAASG LTS LRL+TKAAFE+S NGLR G ILF +++ FFE +C++LYA+VFPKL
Sbjct  150   SFLAGLAASGVLTSALRLITKAAFENSQNGLRNGAILFFSITCFFELVCLLLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPS--ESVDDAKHVERVSNKKLFMENIDYALD  714
              IVK+YR+KAA+EGSKTVA+DLAAAGI+     ++ +D K  +R+S K L ++NIDYA D
Sbjct  210   PIVKHYRSKAAAEGSKTVASDLAAAGISNEHSIQAEEDPKKCDRLSTKDLLIQNIDYAFD  269

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             ++LIYV+TLSIFPGFL E+TG H+LG+WY   L+AMYN+WDLI RY+PLIK ++L SRKG
Sbjct  270   IFLIYVLTLSIFPGFLSEDTGAHSLGTWYALTLIAMYNVWDLIGRYLPLIKCIKLTSRKG  329

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             L  AI +RFL IP FYFTAKYGDQG+MI L SFLGLTNG+LTVCVLT APKGYKGP  NA
Sbjct  330   LTGAILARFLFIPAFYFTAKYGDQGYMIFLTSFLGLTNGFLTVCVLTEAPKGYKGPEQNA  389

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGN  1155
             LGN+LV+CLL GIFSGV LDWLWLIG 
Sbjct  390   LGNVLVVCLLGGIFSGVVLDWLWLIGK  416



>ref|XP_004231487.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Solanum lycopersicum]
Length=418

 Score =   523 bits (1347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/387 (73%), Positives = 330/387 (85%), Gaps = 3/387 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP YH SRVLTL+YQPFA+GT+A+LAY   K+NTRKRNL GY 
Sbjct  30    LFSWNSMLTIQDYYVALFPNYHSSRVLTLIYQPFALGTLAMLAYNEAKINTRKRNLFGYS  89

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ TF +LLLDL TS KGGLG++IGICVI  +FGVADAHVQGG++GDLSFM PEFLQS
Sbjct  90    LFFIATFIVLLLDLATSAKGGLGSFIGICVISGAFGVADAHVQGGMIGDLSFMLPEFLQS  149

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE+S +GLRKG ILF A+ST FE LC++LYAFVFPKL 
Sbjct  150   FLAGLAASGALTSSLRLITKAAFENSQDGLRKGAILFFAISTLFELLCVLLYAFVFPKLP  209

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI--TAP-SESVDDAKHVERVSNKKLFMENIDYALD  714
             IVKYYRAKAASEGSKTVA+DLAAAG+    P +++  D + VER++NK+L ++NIDYA+D
Sbjct  210   IVKYYRAKAASEGSKTVASDLAAAGVYKQGPDTKNEHDPQQVERLNNKELLLQNIDYAID  269

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+LIY +TLSIFPGFL E+TG+H+LGSWY  VL+AMYN+WDLI RYIPLIK ++L+SRKG
Sbjct  270   LFLIYALTLSIFPGFLSEDTGSHSLGSWYALVLIAMYNVWDLIGRYIPLIKCLKLESRKG  329

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LM+ I  R L +P FYFTAKYGDQGWMIML S LGL+NG+LTVCVLT APKGYKGP  NA
Sbjct  330   LMVVILLRSLFVPAFYFTAKYGDQGWMIMLTSLLGLSNGHLTVCVLTCAPKGYKGPEQNA  389

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGN  1155
             LGN+LVL LL GIF+GV LDWLWLIG 
Sbjct  390   LGNLLVLFLLGGIFAGVTLDWLWLIGK  416



>ref|XP_007148261.1| hypothetical protein PHAVU_006G193400g [Phaseolus vulgaris]
 gb|ESW20255.1| hypothetical protein PHAVU_006G193400g [Phaseolus vulgaris]
Length=410

 Score =   521 bits (1343),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 283/390 (73%), Positives = 327/390 (84%), Gaps = 11/390 (3%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+W+SMLT+GDYYY LFP+YHPSRVLTLVYQPFA+GT+AIL Y   ++NTR RNL GY
Sbjct  30    SLVAWSSMLTVGDYYYTLFPRYHPSRVLTLVYQPFALGTMAILTYNESRINTRLRNLIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
                F     LL + + TSGKGG+G YI +C++ A FG+ADAHVQGG+VGDLS+MCPEF+Q
Sbjct  90    -SLFSVGTLLLFVFVATSGKGGIGPYIVVCLLSACFGIADAHVQGGMVGDLSYMCPEFIQ  148

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGLAASG L SGLRLVTK  FE+S NGL KG I        FEF CIILYAF FPKL
Sbjct  149   SFFAGLAASGALASGLRLVTKVGFENSKNGLGKGTI--------FEFFCIILYAFYFPKL  200

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVD-DAKHVERVSNKKLFMENIDYALD  714
             +IVKYYR+KAA EGSKTV+ADLAAAGI    ++ V+ DAK++ER+SNK+LF++NID A D
Sbjct  201   SIVKYYRSKAALEGSKTVSADLAAAGIHDQTNQQVEFDAKNLERLSNKQLFLQNIDLAAD  260

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+LIYV+TLSIFPGFLYENTG+H LG+WYP VL+AMYN+ DLISRYIPLIK + L+SRKG
Sbjct  261   LFLIYVLTLSIFPGFLYENTGSHQLGTWYPLVLIAMYNVLDLISRYIPLIKCLTLESRKG  320

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             L+IA+ SRF+LIP FYFTAKYGDQGWMIMLVSFLGLTNGYLTVCV T APKGYKGP  NA
Sbjct  321   LVIAVVSRFVLIPAFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVFTMAPKGYKGPEQNA  380

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN+LVL L SGIF+GVALDWLWLIG SGF
Sbjct  381   LGNLLVLFLFSGIFAGVALDWLWLIGKSGF  410



>ref|XP_009417267.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=418

 Score =   522 bits (1344),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 281/386 (73%), Positives = 331/386 (86%), Gaps = 2/386 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP YHP+RVLTLVYQPFA+GTIAILAY   K+NTR+RNLAGY 
Sbjct  31    LFSWNSMLTIEDYYVYLFPSYHPTRVLTLVYQPFALGTIAILAYHEAKINTRRRNLAGYS  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL + AL++LD+ TSGKGG+G +IG+CV+  +FGVADAHVQGG+VGDLS M PE +QS
Sbjct  91    LFFLSSLALIVLDVATSGKGGIGVFIGVCVVSGAFGVADAHVQGGMVGDLSLMSPELIQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE+S +GLRKG ++F A+S FFE LC+ LYA VFPKL 
Sbjct  151   FLAGLAASGALTSALRLITKAAFENSQDGLRKGAMMFFAISCFFELLCVFLYAIVFPKLP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVD-DAKHVERVSNKKLFMENIDYALDL  717
             IVK+YRAKAASEGS TV+ADLAA GI T  ++ V+ D K  ER++N++L ++NIDYA+D+
Sbjct  211   IVKFYRAKAASEGSMTVSADLAAGGIQTHHAQGVEEDPKLEERLNNRQLLLQNIDYAVDI  270

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIYV+TLSIFPGFL E+TG+H LGSWY  VL+AMYN+WDLI RYIPL+K+ +L SRK L
Sbjct  271   FLIYVLTLSIFPGFLSEDTGSHGLGSWYALVLIAMYNVWDLIGRYIPLLKRFKLASRKCL  330

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             M AI SRF+LIP FYFTAKYGDQGWMI+L SFLGL+NGYLTVCVLTAAPKGYKGP  NAL
Sbjct  331   MAAILSRFILIPAFYFTAKYGDQGWMIVLTSFLGLSNGYLTVCVLTAAPKGYKGPEQNAL  390

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LVLCLL+GIF+GV LDWLWLIG 
Sbjct  391   GNLLVLCLLAGIFAGVTLDWLWLIGK  416



>ref|XP_003597087.1| Equilibrative nucleoside transporter [Medicago truncatula]
 ref|XP_003606026.1| Equilibrative nucleoside transporter [Medicago truncatula]
 gb|AES67338.1| equilibrative nucleoside transporter 6 [Medicago truncatula]
 gb|AES88223.1| equilibrative nucleoside transporter 6 [Medicago truncatula]
Length=414

 Score =   521 bits (1341),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 282/385 (73%), Positives = 325/385 (84%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP YHPSRVLTLVYQPFA+GT+AIL+Y   K+NTR RNL GY 
Sbjct  28    LFSWNSMLTIEDYYIYLFPDYHPSRVLTLVYQPFAVGTLAILSYNEAKVNTRLRNLFGYT  87

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ TF +L+LDL TSGKGGLG +IGIC I  +FGVADAHVQGG+VGDLS+M PEF+QS
Sbjct  88    LFFITTFLVLILDLATSGKGGLGTFIGICAISGAFGVADAHVQGGMVGDLSYMKPEFIQS  147

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FL GLAASG LTSGLRL+TKAAF++S +GLRKG ILF A+STFFE LC++LYAFVFPK+ 
Sbjct  148   FLCGLAASGALTSGLRLITKAAFDNSKDGLRKGAILFFAISTFFELLCVLLYAFVFPKIP  207

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR KAASEGSKTV+ADLAA GI T P E  D A   ER  NK+LF ENIDY LD++
Sbjct  208   IVKYYRTKAASEGSKTVSADLAAGGIQTIPKEDEDHAHKHERKGNKELFFENIDYLLDMF  267

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIY +TLSIFPGFL E+TG H+LG+WY  VL+AMYN+WDLI RYIPL++ ++L+SRK + 
Sbjct  268   LIYALTLSIFPGFLSEDTGAHSLGTWYALVLIAMYNVWDLIGRYIPLLEFLKLESRKMIT  327

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             +AI  RFLL+P FYFTAKYGDQGWMIML SFLGL+NGYLTVCV+T+APKGYKGP  NALG
Sbjct  328   VAILCRFLLVPAFYFTAKYGDQGWMIMLTSFLGLSNGYLTVCVMTSAPKGYKGPEQNALG  387

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LVL LL GIF+GV LDWLWLIG 
Sbjct  388   NLLVLFLLGGIFAGVTLDWLWLIGK  412



>gb|KEH17554.1| equilibrative nucleoside transporter 6 [Medicago truncatula]
Length=414

 Score =   520 bits (1340),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 272/385 (71%), Positives = 318/385 (83%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFPKYHPSRVLTLVYQPFA+GT+AIL Y   K+NTRKR L GY 
Sbjct  28    LFSWNSMLTIEDYYVYLFPKYHPSRVLTLVYQPFAVGTLAILTYYEAKINTRKRILFGYT  87

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL   A+L+LDL TSGKGG+G +IGIC++  +FG+ADAH QGG++GDLS+M PEF+QS
Sbjct  88    LFFLAVLAVLILDLATSGKGGIGTFIGICIVSGAFGLADAHAQGGMIGDLSYMNPEFIQS  147

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FL G AASG LTS LRL+TKA FE+S +GLRKG ILF ++ST FE LC++LYAFVFPKL 
Sbjct  148   FLGGAAASGALTSALRLITKAIFENSKDGLRKGAILFFSLSTLFELLCVVLYAFVFPKLP  207

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR+KAASEGSKTV+ADLAAAGI T   E+ ++ K  ER   K+L  EN DYALDL+
Sbjct  208   IVKYYRSKAASEGSKTVSADLAAAGIQTELREATEELKQFERKGMKQLLSENKDYALDLF  267

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LI+ +TLSIFPGFL E+TG H+LG+WY  VL+AMYN+WDLI RYIPLIK ++L+SRK + 
Sbjct  268   LIFALTLSIFPGFLSEDTGKHSLGTWYALVLIAMYNVWDLIGRYIPLIKILKLESRKLIT  327

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
              A+ SR LL+P FYFTAKYG QGWMIML SFLG++NGYL VCVLT+APKGYKGP  NALG
Sbjct  328   TAVISRVLLVPAFYFTAKYGTQGWMIMLTSFLGISNGYLAVCVLTSAPKGYKGPEQNALG  387

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             NILVL LL GIF+GV LDWLWLIG 
Sbjct  388   NILVLFLLGGIFAGVTLDWLWLIGK  412



>ref|XP_009417268.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=404

 Score =   520 bits (1339),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 279/389 (72%), Positives = 328/389 (84%), Gaps = 5/389 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP YHP+RVLTLVYQPFA+GTIAILAY   K+NTR+RNLAGY 
Sbjct  14    LFSWNSMLTIEDYYVYLFPSYHPTRVLTLVYQPFALGTIAILAYHEAKINTRRRNLAGYS  73

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL + AL++LD+ TSGKGG+G +IG+CV+  +FGVADAHVQGG+VGDLS M PE +QS
Sbjct  74    LFFLSSLALIVLDVATSGKGGIGVFIGVCVVSGAFGVADAHVQGGMVGDLSLMSPELIQS  133

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE+S +GLRKG ++F A+S FFE LC+ LYA VFPKL 
Sbjct  134   FLAGLAASGALTSALRLITKAAFENSQDGLRKGAMMFFAISCFFELLCVFLYAIVFPKLP  193

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPS-----ESVDDAKHVERVSNKKLFMENIDYA  708
             IVK+YRAKAASEGS TV+ADLAA GI         +  +D K  ER++N++L ++NIDYA
Sbjct  194   IVKFYRAKAASEGSMTVSADLAAGGIQTHHAQGLLQVEEDPKLEERLNNRQLLLQNIDYA  253

Query  709   LDLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSR  888
             +D++LIYV+TLSIFPGFL E+TG+H LGSWY  VL+AMYN+WDLI RYIPL+K+ +L SR
Sbjct  254   VDIFLIYVLTLSIFPGFLSEDTGSHGLGSWYALVLIAMYNVWDLIGRYIPLLKRFKLASR  313

Query  889   KGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAA  1068
             K LM AI SRF+LIP FYFTAKYGDQGWMI+L SFLGL+NGYLTVCVLTAAPKGYKGP  
Sbjct  314   KCLMAAILSRFILIPAFYFTAKYGDQGWMIVLTSFLGLSNGYLTVCVLTAAPKGYKGPEQ  373

Query  1069  NALGNILVLCLLSGIFSGVALDWLWLIGN  1155
             NALGN+LVLCLL+GIF+GV LDWLWLIG 
Sbjct  374   NALGNLLVLCLLAGIFAGVTLDWLWLIGK  402



>ref|XP_007132618.1| hypothetical protein PHAVU_011G110200g [Phaseolus vulgaris]
 gb|ESW04612.1| hypothetical protein PHAVU_011G110200g [Phaseolus vulgaris]
Length=414

 Score =   520 bits (1339),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 280/385 (73%), Positives = 323/385 (84%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFPKYHPSRVLTLVYQPFA+GT+AILAYK +K+NTR RNL GY 
Sbjct  28    LFSWNSMLTIEDYYVHLFPKYHPSRVLTLVYQPFAVGTLAILAYKEDKINTRIRNLFGYT  87

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ T ++L+LDL TSGKGGLG +IGIC+I  +FG+ADAH QGG+VGDLS+M PEF+QS
Sbjct  88    LFFISTLSVLILDLATSGKGGLGTFIGICIISGAFGIADAHTQGGMVGDLSYMLPEFIQS  147

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE+S NGL KG I F  +STFFE LC +LYAFVFPKL 
Sbjct  148   FLAGLAASGALTSALRLITKAAFENSKNGLHKGAITFFVISTFFELLCFLLYAFVFPKLP  207

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESV-DDAKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR+KAASEGSKTV++DLAA GI  PS  V +D K +ER  NK+L +ENIDYALDL+
Sbjct  208   IVKYYRSKAASEGSKTVSSDLAAGGIQTPSRRVNEDDKRLERKGNKQLLLENIDYALDLF  267

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIY +TLSIFPGFL E+TG+H+LG+WY  VL+AMYN+ DLI RYIPL+K ++L+SRK L 
Sbjct  268   LIYALTLSIFPGFLSEDTGSHSLGTWYSLVLIAMYNVCDLIGRYIPLLKTLKLESRKMLT  327

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
               I SR L +P FYFTAKYG QGWMIML  FLGL+NGYLTVCVLT+APKGYKGP  NALG
Sbjct  328   TVIVSRLLFVPAFYFTAKYGSQGWMIMLTCFLGLSNGYLTVCVLTSAPKGYKGPEQNALG  387

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LVL LL GIF+GV LDWLWLIG 
Sbjct  388   NLLVLFLLGGIFAGVTLDWLWLIGK  412



>emb|CDP11897.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   519 bits (1336),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 275/385 (71%), Positives = 317/385 (82%), Gaps = 13/385 (3%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP YHPSRVLTLVYQPFA+GT+A+LAY   K++TRKRNL GY 
Sbjct  12    LFSWNSMLTIEDYYVYLFPSYHPSRVLTLVYQPFALGTLAVLAYNEAKIDTRKRNLFGYS  71

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ T  +L+LDL TSG+GG+G +IGICV+  +FG+ADAHVQGG+VGDLSFM PEF+QS
Sbjct  72    LFFVSTLLVLVLDLATSGRGGIGTFIGICVVSGAFGIADAHVQGGMVGDLSFMLPEFIQS  131

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE+S +GLRKG ILF AVSTFFE LC++LYAFVFPKL 
Sbjct  132   FLAGLAASGALTSALRLITKAAFENSKDGLRKGAILFFAVSTFFELLCVLLYAFVFPKLP  191

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESV-DDAKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR+KAASEGSKTV+ADLAA GI    E V  D K  ER+SNK+L ++NIDYALD++
Sbjct  192   IVKYYRSKAASEGSKTVSADLAAGGIHRQPEQVGQDPKQPERLSNKQLLVQNIDYALDMF  251

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFL E+TG+H+LGSWY  VL+AMYN+WDLI R IPL K+++L+SR+GL 
Sbjct  252   LIYVLTLSIFPGFLSEDTGSHSLGSWYALVLIAMYNVWDLIGRCIPLWKRIKLESRRGLT  311

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
              AI SRFLLIP FYFTAKYGDQGWMI L SFLGL+NGYLT            GP  NALG
Sbjct  312   TAILSRFLLIPAFYFTAKYGDQGWMITLTSFLGLSNGYLT------------GPEQNALG  359

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             NILVL LL GI +GV LDWLWLIG 
Sbjct  360   NILVLFLLGGISAGVTLDWLWLIGK  384



>ref|XP_007132619.1| hypothetical protein PHAVU_011G110200g [Phaseolus vulgaris]
 gb|ESW04613.1| hypothetical protein PHAVU_011G110200g [Phaseolus vulgaris]
Length=455

 Score =   521 bits (1342),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 280/385 (73%), Positives = 323/385 (84%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFPKYHPSRVLTLVYQPFA+GT+AILAYK +K+NTR RNL GY 
Sbjct  69    LFSWNSMLTIEDYYVHLFPKYHPSRVLTLVYQPFAVGTLAILAYKEDKINTRIRNLFGYT  128

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ T ++L+LDL TSGKGGLG +IGIC+I  +FG+ADAH QGG+VGDLS+M PEF+QS
Sbjct  129   LFFISTLSVLILDLATSGKGGLGTFIGICIISGAFGIADAHTQGGMVGDLSYMLPEFIQS  188

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE+S NGL KG I F  +STFFE LC +LYAFVFPKL 
Sbjct  189   FLAGLAASGALTSALRLITKAAFENSKNGLHKGAITFFVISTFFELLCFLLYAFVFPKLP  248

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESV-DDAKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR+KAASEGSKTV++DLAA GI  PS  V +D K +ER  NK+L +ENIDYALDL+
Sbjct  249   IVKYYRSKAASEGSKTVSSDLAAGGIQTPSRRVNEDDKRLERKGNKQLLLENIDYALDLF  308

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIY +TLSIFPGFL E+TG+H+LG+WY  VL+AMYN+ DLI RYIPL+K ++L+SRK L 
Sbjct  309   LIYALTLSIFPGFLSEDTGSHSLGTWYSLVLIAMYNVCDLIGRYIPLLKTLKLESRKMLT  368

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
               I SR L +P FYFTAKYG QGWMIML  FLGL+NGYLTVCVLT+APKGYKGP  NALG
Sbjct  369   TVIVSRLLFVPAFYFTAKYGSQGWMIMLTCFLGLSNGYLTVCVLTSAPKGYKGPEQNALG  428

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LVL LL GIF+GV LDWLWLIG 
Sbjct  429   NLLVLFLLGGIFAGVTLDWLWLIGK  453



>ref|XP_009417262.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009417263.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009417264.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009417266.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=421

 Score =   520 bits (1338),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 279/389 (72%), Positives = 328/389 (84%), Gaps = 5/389 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP YHP+RVLTLVYQPFA+GTIAILAY   K+NTR+RNLAGY 
Sbjct  31    LFSWNSMLTIEDYYVYLFPSYHPTRVLTLVYQPFALGTIAILAYHEAKINTRRRNLAGYS  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL + AL++LD+ TSGKGG+G +IG+CV+  +FGVADAHVQGG+VGDLS M PE +QS
Sbjct  91    LFFLSSLALIVLDVATSGKGGIGVFIGVCVVSGAFGVADAHVQGGMVGDLSLMSPELIQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE+S +GLRKG ++F A+S FFE LC+ LYA VFPKL 
Sbjct  151   FLAGLAASGALTSALRLITKAAFENSQDGLRKGAMMFFAISCFFELLCVFLYAIVFPKLP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPS-----ESVDDAKHVERVSNKKLFMENIDYA  708
             IVK+YRAKAASEGS TV+ADLAA GI         +  +D K  ER++N++L ++NIDYA
Sbjct  211   IVKFYRAKAASEGSMTVSADLAAGGIQTHHAQGLLQVEEDPKLEERLNNRQLLLQNIDYA  270

Query  709   LDLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSR  888
             +D++LIYV+TLSIFPGFL E+TG+H LGSWY  VL+AMYN+WDLI RYIPL+K+ +L SR
Sbjct  271   VDIFLIYVLTLSIFPGFLSEDTGSHGLGSWYALVLIAMYNVWDLIGRYIPLLKRFKLASR  330

Query  889   KGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAA  1068
             K LM AI SRF+LIP FYFTAKYGDQGWMI+L SFLGL+NGYLTVCVLTAAPKGYKGP  
Sbjct  331   KCLMAAILSRFILIPAFYFTAKYGDQGWMIVLTSFLGLSNGYLTVCVLTAAPKGYKGPEQ  390

Query  1069  NALGNILVLCLLSGIFSGVALDWLWLIGN  1155
             NALGN+LVLCLL+GIF+GV LDWLWLIG 
Sbjct  391   NALGNLLVLCLLAGIFAGVTLDWLWLIGK  419



>ref|XP_006592409.1| PREDICTED: equilibrative nucleotide transporter 3-like [Glycine 
max]
Length=439

 Score =   520 bits (1340),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 280/385 (73%), Positives = 325/385 (84%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L +WNSMLTI DYY  LFPKYHPSRVLTLVYQPFA+GT+AILAYK +++NTR RNL GY 
Sbjct  53    LFAWNSMLTIEDYYVYLFPKYHPSRVLTLVYQPFAVGTLAILAYKEDRINTRIRNLFGYT  112

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ T ++L+LDL TSGKGGLG +IGICVI  +FG+ADAH QGG+VGDLS+M PEF+QS
Sbjct  113   LFFISTLSILILDLATSGKGGLGTFIGICVISGAFGIADAHTQGGMVGDLSYMLPEFIQS  172

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE+S NGLRKG I+F A+STFFE LC++LYAFVFPKL 
Sbjct  173   FLAGLAASGALTSALRLITKAAFENSKNGLRKGAIMFFAISTFFELLCVLLYAFVFPKLP  232

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDD-AKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR+KAASEGSKTV+ADLAA GI  PS   +   K ++R  NKKL +ENIDYALDL+
Sbjct  233   IVKYYRSKAASEGSKTVSADLAAGGIQIPSGRANQYEKEIDRKGNKKLLLENIDYALDLF  292

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIY +TLSIFPGFL E+TG+H+LG+WY  VL+AMYN+ DLI RYIPL+K ++L+SRK L 
Sbjct  293   LIYALTLSIFPGFLSEDTGSHSLGTWYALVLIAMYNVCDLIGRYIPLLKFLKLESRKKLT  352

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
              AI SR L +P FYFTAKYG QGWMIML SFLGL+NGY TVCVLT+APKGYKGP  NALG
Sbjct  353   TAIVSRLLFVPAFYFTAKYGTQGWMIMLTSFLGLSNGYFTVCVLTSAPKGYKGPEQNALG  412

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LVL LL GIF+GV LDW WLIG 
Sbjct  413   NLLVLFLLGGIFAGVTLDWFWLIGK  437



>gb|KDP24205.1| hypothetical protein JCGZ_25862 [Jatropha curcas]
Length=432

 Score =   520 bits (1338),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 267/386 (69%), Positives = 320/386 (83%), Gaps = 1/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL+SWN M+TI DYY  LFP+YHPSRVLT+VYQPFA+GT+AILAY   KLNTRKRNL GY
Sbjct  32    SLLSWNCMVTIEDYYGYLFPQYHPSRVLTVVYQPFAVGTLAILAYNEAKLNTRKRNLFGY  91

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILFF+G+  +++LDL TSGKGGLG +IGIC +   FG ADA VQGG++GDLS M  EF+Q
Sbjct  92    ILFFIGSLIIIVLDLATSGKGGLGTFIGICAVTGLFGFADAFVQGGMIGDLSLMQTEFIQ  151

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFL+G A SGTLTS LRLVTKAAFE+S NGLRKG ILF ++S F E LC++LYA+ FPKL
Sbjct  152   SFLSGSAVSGTLTSALRLVTKAAFENSKNGLRKGAILFFSISAFSELLCVLLYAYTFPKL  211

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDL  717
              +VKYYR+KAA EGS+TV  DLAA GI T P E  +D K  ER+SN++L  +NIDYA+DL
Sbjct  212   PVVKYYRSKAALEGSRTVLDDLAAGGIQTLPQEMEEDPKQQERLSNRELLKQNIDYAVDL  271

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LI+V+TLSIFPGFL E+TG+H+LG+WY  VL+AM+N+WDLI R IPL++ ++L+SRKGL
Sbjct  272   FLIFVITLSIFPGFLSEDTGSHSLGTWYSLVLIAMFNVWDLIGRNIPLLQSLKLQSRKGL  331

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             M+A+  RFLLIP FY+TAKYGDQGWMIML SFLGLTNGYLTVCVLT+APKGYKGP  NAL
Sbjct  332   MVAVLFRFLLIPAFYYTAKYGDQGWMIMLTSFLGLTNGYLTVCVLTSAPKGYKGPEQNAL  391

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LV  +  GI SG  LDWLWLIG 
Sbjct  392   GNLLVFFIFGGILSGAILDWLWLIGK  417



>ref|XP_010422412.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
Length=418

 Score =   518 bits (1335),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 257/386 (67%), Positives = 321/386 (83%), Gaps = 0/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             +++SWNSMLTIGDYYY + P YHPSRVLT+VYQPFA+GTI I AY+  K+NTRKRN+ GY
Sbjct  30    TIISWNSMLTIGDYYYYVIPDYHPSRVLTVVYQPFALGTIMIFAYRESKINTRKRNMIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             +L  + TF L+ LDL T G G +  YIG+C IVA FG+ADA V+GG++GDLSFMCPE +Q
Sbjct  90    MLSTISTFLLIALDLATKGHGVMLPYIGLCAIVALFGLADATVRGGMMGDLSFMCPELIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S++AGL  SG LTS +RL+TKAAFE S +GLRKG ++FLA +TF EF+C+ILYA++FPKL
Sbjct  150   SYMAGLDISGALTSAIRLITKAAFEKSHDGLRKGAMIFLATATFIEFICVILYAYLFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              I+KYYR+KAASEGSKTV+ADL AAGI   SES +D    +R+SNK+L ++NIDYA++L+
Sbjct  210   PIIKYYRSKAASEGSKTVSADLVAAGILNQSESTNDDSKNQRLSNKELLLQNIDYAMNLF  269

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             L+Y++TLSI PGFLYENTG H LG+WY  VL+AMYN WDL+ RY PL+K +++++RKGL 
Sbjct  270   LLYLLTLSIVPGFLYENTGQHGLGTWYALVLIAMYNCWDLVGRYTPLVKWLKIENRKGLT  329

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IA+  RF LIP FYFTAKYGDQGWMIML+S LGLTNG+L+VC+LT APKGYKGP  NALG
Sbjct  330   IAVLLRFFLIPAFYFTAKYGDQGWMIMLISILGLTNGHLSVCILTIAPKGYKGPEQNALG  389

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N+LV+ LL G+F+GVALDWLWLIG  
Sbjct  390   NLLVMFLLGGVFAGVALDWLWLIGKK  415



>ref|XP_002317251.2| equilibrative nucleoside transporter family protein [Populus 
trichocarpa]
 gb|EEE97863.2| equilibrative nucleoside transporter family protein [Populus 
trichocarpa]
Length=410

 Score =   517 bits (1331),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 284/389 (73%), Positives = 326/389 (84%), Gaps = 16/389 (4%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTIGDYYY LFPKYHPSRVLTLVYQPFA+GT+AILAY   K+NTRKRN+AGY
Sbjct  32    SLVSWNSMLTIGDYYYCLFPKYHPSRVLTLVYQPFALGTMAILAYNEAKINTRKRNIAGY  91

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF   T  L+++DL TSG GG+G +IGIC IVA+FGVADAHVQGG+VGD++FMCPEF+Q
Sbjct  92    ILFAASTLMLMVVDLATSGGGGIGPFIGICAIVAAFGVADAHVQGGMVGDMAFMCPEFMQ  151

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGLAASG LT  LRL+TKA             +LFL +S F EFLC++LYA++FPKL
Sbjct  152   SFFAGLAASGALTYALRLITKA-------------LLFLGISIFLEFLCVLLYAYLFPKL  198

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPS--ESVDDAKHVERVSNKKLFMENIDYALD  714
              IVKYYR+KAASEGSKTV+ADLAAAGI  P+  E+ D AK  ER+SNK+L  +NIDYALD
Sbjct  199   PIVKYYRSKAASEGSKTVSADLAAAGIQTPANQEAADVAKPPERLSNKQLIFQNIDYALD  258

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGS-WYPTVLVAMYNIWDLISRYIPLIKKVELKSRK  891
             LYLIYV+TLSIFPGF++ENTG H L + WYP VL+AMYN+ DLISRYIPL+  ++L+SR 
Sbjct  259   LYLIYVLTLSIFPGFVFENTGKHKLSNKWYPLVLIAMYNVLDLISRYIPLVPSLKLESRN  318

Query  892   GLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAAN  1071
             GL+IA+ SRFLLIP FYFTAKYGDQGWMI LVSFLGLTNGYLTVCVLT AP+GY GP AN
Sbjct  319   GLLIAVLSRFLLIPAFYFTAKYGDQGWMIFLVSFLGLTNGYLTVCVLTIAPRGYTGPEAN  378

Query  1072  ALGNILVLCLLSGIFSGVALDWLWLIGNS  1158
             ALGN+LVL LL GIFSGVALDWLWLIG  
Sbjct  379   ALGNLLVLFLLGGIFSGVALDWLWLIGKK  407



>ref|XP_010095856.1| Equilibrative nucleoside transporter 4 [Morus notabilis]
 gb|EXB62324.1| Equilibrative nucleoside transporter 4 [Morus notabilis]
Length=417

 Score =   517 bits (1331),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 277/385 (72%), Positives = 331/385 (86%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY +LFP YH SRVLTLVYQPFA+GT+AILAY   K+NTR RNL+GY 
Sbjct  31    LFSWNSMLTIEDYYGELFPHYHSSRVLTLVYQPFALGTLAILAYNEAKINTRLRNLSGYF  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFLG+  +L+LDL TSGKGGLG +IGIC +   FGVADAHVQGG++GDLSF  P+ +QS
Sbjct  91    LFFLGSLLVLVLDLATSGKGGLGTFIGICALSGLFGVADAHVQGGMIGDLSFTRPQLIQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             +LAG+AASG LTS LRL+TKAAFE+S +GLRKG ILFLA+S  FE LC+ILYA++FPKL 
Sbjct  151   YLAGMAASGALTSALRLITKAAFENSKDGLRKGAILFLAISVVFELLCVILYAYIFPKLP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             ++KYYR+KA+SEGSKTV+ADLAAAGI T   E+ +D K  ER+ NK+L ++NIDYA+D++
Sbjct  211   VIKYYRSKASSEGSKTVSADLAAAGIHTLHEEAEEDLKKHERLGNKELLLQNIDYAVDMF  270

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIY +TLSIFPGFL E+TG+H+LG+WY  VL+AMYN+WDLI RYIPL+K ++L+SRKGL+
Sbjct  271   LIYALTLSIFPGFLSEDTGSHSLGTWYALVLIAMYNVWDLIGRYIPLLKFLKLESRKGLV  330

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IAI SRFLL+P FYFTAKYGDQGWMIML SFLGL+NGYLTVCVLT+APKGYKGP  NALG
Sbjct  331   IAILSRFLLVPAFYFTAKYGDQGWMIMLTSFLGLSNGYLTVCVLTSAPKGYKGPEQNALG  390

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LVL LL GIF+GV LDWLWLIG 
Sbjct  391   NLLVLFLLGGIFAGVTLDWLWLIGK  415



>ref|XP_009348012.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Pyrus x bretschneideri]
Length=397

 Score =   516 bits (1328),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 263/391 (67%), Positives = 302/391 (77%), Gaps = 26/391 (7%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WNSMLTIGDYYY LFP YHPSRVLTLVYQPFA+ T+A LAY   K++       G 
Sbjct  30    SLVAWNSMLTIGDYYYNLFPTYHPSRVLTLVYQPFALVTMATLAYHEAKVDVATSAGGG-  88

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
                                   +G YIGIC  VA+FGVADAHVQGG+VGDLS M PEF+Q
Sbjct  89    ----------------------VGPYIGICACVAAFGVADAHVQGGMVGDLSLMRPEFIQ  126

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGLAASG LTSGLRL+TKAAFE S +GLRKG +LFL +STF EFLCI+LYAF FP+L
Sbjct  127   SFFAGLAASGALTSGLRLMTKAAFEKSHDGLRKGTMLFLTISTFTEFLCILLYAFYFPRL  186

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGIT--APSESVDDAKHVE-RVSNKKLFMENIDYAL  711
              IVKYYR+KAASEGSKTV ADLAAAG+   A  E  +DAK V  R+S  ++F +NID+ L
Sbjct  187   PIVKYYRSKAASEGSKTVTADLAAAGVQTQADIEVSNDAKAVPTRLSTMQIFKQNIDFCL  246

Query  712   DLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRK  891
             DL+LIYV+TLSIFPGF++ENTG H LG+WYP VLVAMYN+ DLISRYIPLIK ++++SRK
Sbjct  247   DLFLIYVLTLSIFPGFIFENTGNHQLGTWYPLVLVAMYNVLDLISRYIPLIKCLKIESRK  306

Query  892   GLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAAN  1071
             GL+IAI  RFL +P +YFT KY DQGWMI+L S LGLTNGYLTVCV+T APKGY GP  N
Sbjct  307   GLLIAILLRFLFVPAYYFTGKYADQGWMILLTSILGLTNGYLTVCVMTVAPKGYNGPEQN  366

Query  1072  ALGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             ALGNILVL LL GIF+GV LDWLWLIG   F
Sbjct  367   ALGNILVLFLLGGIFAGVCLDWLWLIGRDKF  397



>ref|XP_006582336.1| PREDICTED: equilibrative nucleotide transporter 3-like [Glycine 
max]
Length=414

 Score =   516 bits (1329),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 276/385 (72%), Positives = 324/385 (84%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L +WNSMLTI DYY  LFPKYHPSRVLTLVYQPFA+GT+AILAYK +++NTR RNL GY 
Sbjct  28    LFAWNSMLTIEDYYVHLFPKYHPSRVLTLVYQPFAVGTLAILAYKEDRINTRIRNLFGYT  87

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ T ++L+LDL TSGKGGLG ++G CVI  +FG+ADAH QGG+VGDLS+M PEF+QS
Sbjct  88    LFFISTLSILILDLATSGKGGLGTFVGTCVISGAFGIADAHTQGGMVGDLSYMLPEFIQS  147

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE + NGLRKG I+F A+STFFE LC++LY+FVFPKLA
Sbjct  148   FLAGLAASGVLTSALRLITKAAFEKTKNGLRKGAIMFFAISTFFELLCVLLYSFVFPKLA  207

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDD-AKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR+KAASEGSKTV+ADLAA GI  PS   +   K ++R  NKKL +ENIDYALDL+
Sbjct  208   IVKYYRSKAASEGSKTVSADLAAGGIQIPSGGANQYEKEIDRKGNKKLLLENIDYALDLF  267

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIY +TLSIFPGFL E+TG+H+LG+WY  VL+AMYN+ DLI RYIPL+K ++++SRK L 
Sbjct  268   LIYALTLSIFPGFLSEDTGSHSLGTWYALVLIAMYNVCDLIGRYIPLLKFLKVESRKKLT  327

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
              AI SR L +P FYFTAKYG QGWMIML  FLGL+NGY TVCVLT+APKGYKGP  NALG
Sbjct  328   TAIVSRLLFVPAFYFTAKYGTQGWMIMLTCFLGLSNGYFTVCVLTSAPKGYKGPEQNALG  387

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LVL LL GIF+GV LDWLWLIG 
Sbjct  388   NLLVLFLLGGIFAGVTLDWLWLIGK  412



>ref|XP_004485692.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Cicer arietinum]
Length=421

 Score =   516 bits (1329),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 272/388 (70%), Positives = 321/388 (83%), Gaps = 2/388 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WNSMLTIGDYYY+LFP+YHPSRVLT+ Y PF+IGT+ IL +   ++NTR R + GY
Sbjct  31    SLVAWNSMLTIGDYYYKLFPRYHPSRVLTIFYLPFSIGTLMILTHNESRINTRMRVITGY  90

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              +FF+ T  +L+LDL TSGKGG+G+Y+G+C + ASFGVADA VQGG+VGD+S MCPEF+Q
Sbjct  91    FIFFVCTLLVLVLDLATSGKGGIGHYVGLCALSASFGVADALVQGGMVGDMSRMCPEFIQ  150

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFLAG AASG L SGLR +TK AFE S NGLRKG +LF A STFFEFLCIILYA  FPKL
Sbjct  151   SFLAGSAASGLLASGLRFLTKIAFEKSDNGLRKGALLFFATSTFFEFLCIILYAIYFPKL  210

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAP-SESVD-DAKHVERVSNKKLFMENIDYALD  714
             +IVKYYR+KAASEGSKTV+ADLAA GI    ++ V  DAK  E ++NK+LF +NIDYA D
Sbjct  211   SIVKYYRSKAASEGSKTVSADLAAVGIQNEINQQVGLDAKQHEHLNNKELFHQNIDYAAD  270

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+LIYV+TL I PGFLYENTG+H+LG WY  VL+A+YN+ DL SRYIP+IK ++L+SRK 
Sbjct  271   LFLIYVLTLFIVPGFLYENTGSHHLGKWYTLVLIAVYNVSDLTSRYIPMIKFMKLESRKW  330

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             L+ AI SRFLLIP FYFTAKYGDQGWMI+LVSFLGLTNGYLTVCV   APKGYKGP  NA
Sbjct  331   LLTAIISRFLLIPAFYFTAKYGDQGWMIVLVSFLGLTNGYLTVCVFIVAPKGYKGPEQNA  390

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNS  1158
             LGN+LVL +  GI +G ALDWLWLIG S
Sbjct  391   LGNLLVLFVECGILAGGALDWLWLIGKS  418



>ref|NP_192420.2| equilibrative nucleoside transporter 6 [Arabidopsis thaliana]
 sp|Q944N8.1|ENT6_ARATH RecName: Full=Equilibrative nucleotide transporter 6; Short=AtENT6; 
AltName: Full=Nucleoside transporter ENT6 [Arabidopsis 
thaliana]
 gb|AAL25098.1|AF426402_1 putative equilibrative nucleoside transporter ENT6 [Arabidopsis 
thaliana]
 gb|AEE82480.1| equilibrative nucleoside transporter 6 [Arabidopsis thaliana]
Length=418

 Score =   515 bits (1327),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 260/386 (67%), Positives = 314/386 (81%), Gaps = 0/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL+SWNSMLT  DYYY++FP YHPSRVLTLVYQPFA G I ILAY   K +TRKRNL GY
Sbjct  30    SLISWNSMLTTADYYYKVFPDYHPSRVLTLVYQPFAFGAIVILAYHESKTSTRKRNLIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             IL+ + TF L++LDL T G+GG G Y G+C +VA+FG+ADA VQGG+ GDLS MCPE +Q
Sbjct  90    ILYTISTFLLIVLDLATKGRGGFGPYTGLCAVVAAFGLADATVQGGMFGDLSLMCPELVQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S++ G+A +G LTS LRL+TKAAFE S+NGLRKG ++FLA+ST  E L ++LYA+V PKL
Sbjct  150   SYMGGMAVAGALTSALRLITKAAFEKSNNGLRKGAMMFLAISTCIELLSVMLYAYVLPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IV YYR KAAS+GSKTV+ADLAAAGI   S+  DD    +R+S K+L  +NID+A++L+
Sbjct  210   PIVMYYRRKAASQGSKTVSADLAAAGIQNQSDLSDDDSKNQRLSKKELLFQNIDHAVNLF  269

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV TLSIFPGFLYENTG H LG+WY  VLVAMYN WDL+ RY PL+K + +++RK + 
Sbjct  270   LIYVCTLSIFPGFLYENTGQHGLGAWYALVLVAMYNCWDLVGRYTPLVKWLNIENRKLIT  329

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IA+ SR+LLIP FYFTAKYGDQGWMIMLVS LGLTNG+LTVC++T APKGYKGP  NALG
Sbjct  330   IAVLSRYLLIPAFYFTAKYGDQGWMIMLVSVLGLTNGHLTVCIMTIAPKGYKGPEQNALG  389

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N+LV+ LL GIF+GVALDWLWLIG  
Sbjct  390   NLLVIFLLGGIFAGVALDWLWLIGKK  415



>ref|NP_192423.1| nucleoside transporter family protein [Arabidopsis thaliana]
 sp|Q9M0Y1.1|ENT5_ARATH RecName: Full=Equilibrative nucleotide transporter 5; Short=AtENT5; 
AltName: Full=Nucleoside transporter ENT5 [Arabidopsis 
thaliana]
 emb|CAB81056.1| putative protein [Arabidopsis thaliana]
 gb|AAY78793.1| equilibrative nucleoside transporter family protein [Arabidopsis 
thaliana]
 gb|AEE82484.1| nucleoside transporter family protein [Arabidopsis thaliana]
Length=419

 Score =   515 bits (1327),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 258/387 (67%), Positives = 314/387 (81%), Gaps = 1/387 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNS+L++GDYYYQ+FP YHPSRVLT VYQPF+IGTI I AY   K+NTRKRNL GY
Sbjct  30    SLVSWNSLLSVGDYYYQVFPDYHPSRVLTFVYQPFSIGTIVIFAYNESKINTRKRNLIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             I+F    F L++LDL T G GG+G YI +C IV SFG ADA V+GG++GDLS MCPE +Q
Sbjct  90    IVFTTSIFLLIILDLATKGHGGIGPYIVLCAIVGSFGFADASVRGGMIGDLSLMCPELIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLA +G LTS  RL+TKAAFE + +GLRKG ++FLA+ST  EFLC++LYA+VFPKL
Sbjct  150   SFVAGLAVAGALTSAFRLITKAAFEKTHDGLRKGAMIFLAISTLVEFLCVLLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSE-SVDDAKHVERVSNKKLFMENIDYALDL  717
              IVKYYR+KAASEGSKTV ADLAAAGI   S  + DD    +R++NK+L +EN+DY ++L
Sbjct  210   PIVKYYRSKAASEGSKTVYADLAAAGIQNQSVLTADDVSKDKRLNNKELLLENVDYVVNL  269

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIYV+TLSI PGFLYENTG H LGSWY  VL+AMYN WDL+ RYIP++K + +++RKGL
Sbjct  270   FLIYVLTLSILPGFLYENTGQHGLGSWYALVLIAMYNWWDLVGRYIPMVKWLNVENRKGL  329

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
              +A+ +RFLL+P FYFTAKYGDQGWMI+LVS LGLTNG+LTVC+L  AP+GY GP  NAL
Sbjct  330   TVAVLTRFLLVPAFYFTAKYGDQGWMILLVSILGLTNGHLTVCILAKAPRGYTGPEKNAL  389

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNS  1158
             GN+LVL +L G F G AL WLWLIG  
Sbjct  390   GNLLVLFILWGAFVGCALGWLWLIGKK  416



>gb|KHG28896.1| Equilibrative nucleoside transporter 4 [Gossypium arboreum]
Length=415

 Score =   514 bits (1325),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 277/385 (72%), Positives = 329/385 (85%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP YHPSRVLTLVYQPFA+GT+AILAY   K+NTR+RNL GYI
Sbjct  29    LFSWNSMLTIEDYYVYLFPNYHPSRVLTLVYQPFALGTLAILAYHEAKINTRRRNLFGYI  88

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL + A+L+LDL TSGKGGLG +IGIC+I   FGVADA+VQGG+VGDLS+M PEF+QS
Sbjct  89    LFFLSSLAILVLDLATSGKGGLGTFIGICIISGVFGVADANVQGGMVGDLSYMRPEFIQS  148

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             ++AGLAASG +TS LRL+TKAAFE+S  GLRKG ILF A+S+FFEFLC++LYA+VF KL 
Sbjct  149   YVAGLAASGVITSALRLITKAAFENSQGGLRKGAILFFAISSFFEFLCVLLYAYVFAKLP  208

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVD-DAKHVERVSNKKLFMENIDYALDLY  720
             +VKYYR+KAASEGSKTVA+DLAA GI A  E+ D ++K+ ER+SNK+L ++NIDYA+D++
Sbjct  209   VVKYYRSKAASEGSKTVASDLAAGGIQALPETDDVESKNQERLSNKELLLQNIDYAIDMF  268

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIY +TLSIFPGFL E+TG H+LGSWY  VL++MYN+WDLI RYIPLIK ++L+SRK L 
Sbjct  269   LIYALTLSIFPGFLSEDTGKHSLGSWYALVLISMYNVWDLIGRYIPLIKPLKLESRKALT  328

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
               I SR LL+P FYF +KYGDQGWMIML S LGL+NGYLTVCVLT+APKGYKGP  NALG
Sbjct  329   TVIISRVLLVPAFYFMSKYGDQGWMIMLTSILGLSNGYLTVCVLTSAPKGYKGPEQNALG  388

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LVL LL GIF+GV LDWLWLIG 
Sbjct  389   NLLVLFLLGGIFAGVTLDWLWLIGK  413



>ref|XP_006383999.1| equilibrative nucleoside transporter family protein [Populus 
trichocarpa]
 gb|ERP61796.1| equilibrative nucleoside transporter family protein [Populus 
trichocarpa]
Length=392

 Score =   513 bits (1322),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 272/382 (71%), Positives = 324/382 (85%), Gaps = 0/382 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             +LV+WN MLTI DYYY+LFPKYHP+R+LTL+Y PFA+ ++AIL Y   K++TRKRNL+G 
Sbjct  11    TLVAWNCMLTIEDYYYKLFPKYHPARLLTLIYMPFAVVSMAILTYYESKIDTRKRNLSGL  70

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             +LFFL +  LLLLDL +SGKGG+GN+IGI  I  SFGVADA +QGG+VGDL FMCPEFLQ
Sbjct  71    VLFFLSSLLLLLLDLASSGKGGIGNFIGIGAIAGSFGVADALLQGGMVGDLFFMCPEFLQ  130

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S+LAG+AASG L S LRL+TKAAFE   NGLRKGVILFL +S FFEF CI++YAF+FPKL
Sbjct  131   SYLAGIAASGFLISALRLLTKAAFEKFPNGLRKGVILFLVISIFFEFQCILVYAFLFPKL  190

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYYR KA++EGS TV+ADLAA GI    E  ++AK  ER+SNK+LF ENIDYA+DL 
Sbjct  191   PIVKYYRLKASTEGSNTVSADLAAGGIHINQEDENEAKRHERLSNKELFFENIDYAVDLI  250

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LI+V+TLSI PGF+YE+TG+H L SWY  VL+ MYN  DLISRYIPL++ ++LKSRKGLM
Sbjct  251   LIFVLTLSIVPGFIYEDTGSHQLHSWYALVLITMYNACDLISRYIPLVEFLKLKSRKGLM  310

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IA+ SRFLLIP FYFTAKY DQGWMI+L+SFLGLTNGYLTVCV+T APKGYKGP  NALG
Sbjct  311   IAVLSRFLLIPAFYFTAKYSDQGWMILLISFLGLTNGYLTVCVITEAPKGYKGPEQNALG  370

Query  1081  NILVLCLLSGIFSGVALDWLWL  1146
             N+LVLC+L G+F+GVALDWLWL
Sbjct  371   NLLVLCVLCGVFAGVALDWLWL  392



>ref|XP_003562929.1| PREDICTED: equilibrative nucleotide transporter 3-like [Brachypodium 
distachyon]
 ref|XP_010237136.1| PREDICTED: equilibrative nucleotide transporter 3-like [Brachypodium 
distachyon]
Length=418

 Score =   514 bits (1323),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 268/387 (69%), Positives = 316/387 (82%), Gaps = 2/387 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL +WNSMLTI DYY  LFP YHP+RVLTLVYQPFA G   IL Y   KLNTR+RNL G+
Sbjct  30    SLFAWNSMLTIEDYYVSLFPNYHPTRVLTLVYQPFAFGITCILTYHEAKLNTRRRNLLGF  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFFL +FAL+LLD+GT G+GG+  YIG+C+I A FG +DA VQGG+VGDLS MCPEF+Q
Sbjct  90    ALFFLSSFALILLDVGTKGRGGIAVYIGVCIISAFFGTSDALVQGGLVGDLSLMCPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S+LAGLAASG LTS LRL+TKAAFE+S NGLR G +LF +++  FE +C++LYA+VFPKL
Sbjct  150   SYLAGLAASGVLTSVLRLITKAAFENSQNGLRNGAMLFFSITCIFELVCLVLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESV--DDAKHVERVSNKKLFMENIDYALD  714
              IVKYYRAKAASEGSKTV +DLAAAG+    +    +D +  ER S K+L M+NIDYALD
Sbjct  210   PIVKYYRAKAASEGSKTVGSDLAAAGLKTDQDRQVEEDPQKHERYSTKQLLMQNIDYALD  269

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             ++LIY++TLSIFPGFL E+TGTH LG+WY  VL+ MYN  DLI RY+PLIK ++L +RKG
Sbjct  270   IFLIYILTLSIFPGFLSEDTGTHGLGTWYVLVLIVMYNGLDLIGRYVPLIKCLKLTNRKG  329

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LM AI +RFL IP FYFTAKYGDQG+MI L SFLGLTNGYLTVCVLT AP GYKGP  NA
Sbjct  330   LMAAILARFLFIPAFYFTAKYGDQGYMIFLTSFLGLTNGYLTVCVLTDAPSGYKGPEQNA  389

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGN  1155
             LGN+LV+CLL+GIFSGV LDWLWLIG 
Sbjct  390   LGNVLVVCLLAGIFSGVVLDWLWLIGK  416



>ref|XP_006383998.1| hypothetical protein POPTR_0004s03260g [Populus trichocarpa]
 ref|XP_002304989.2| hypothetical protein POPTR_0004s03260g [Populus trichocarpa]
 ref|XP_006384000.1| hypothetical protein POPTR_0004s03260g [Populus trichocarpa]
 gb|ERP61795.1| hypothetical protein POPTR_0004s03260g [Populus trichocarpa]
 gb|EEE85500.2| hypothetical protein POPTR_0004s03260g [Populus trichocarpa]
 gb|ERP61797.1| hypothetical protein POPTR_0004s03260g [Populus trichocarpa]
Length=411

 Score =   513 bits (1322),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 272/382 (71%), Positives = 324/382 (85%), Gaps = 0/382 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             +LV+WN MLTI DYYY+LFPKYHP+R+LTL+Y PFA+ ++AIL Y   K++TRKRNL+G 
Sbjct  30    TLVAWNCMLTIEDYYYKLFPKYHPARLLTLIYMPFAVVSMAILTYYESKIDTRKRNLSGL  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             +LFFL +  LLLLDL +SGKGG+GN+IGI  I  SFGVADA +QGG+VGDL FMCPEFLQ
Sbjct  90    VLFFLSSLLLLLLDLASSGKGGIGNFIGIGAIAGSFGVADALLQGGMVGDLFFMCPEFLQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S+LAG+AASG L S LRL+TKAAFE   NGLRKGVILFL +S FFEF CI++YAF+FPKL
Sbjct  150   SYLAGIAASGFLISALRLLTKAAFEKFPNGLRKGVILFLVISIFFEFQCILVYAFLFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYYR KA++EGS TV+ADLAA GI    E  ++AK  ER+SNK+LF ENIDYA+DL 
Sbjct  210   PIVKYYRLKASTEGSNTVSADLAAGGIHINQEDENEAKRHERLSNKELFFENIDYAVDLI  269

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LI+V+TLSI PGF+YE+TG+H L SWY  VL+ MYN  DLISRYIPL++ ++LKSRKGLM
Sbjct  270   LIFVLTLSIVPGFIYEDTGSHQLHSWYALVLITMYNACDLISRYIPLVEFLKLKSRKGLM  329

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IA+ SRFLLIP FYFTAKY DQGWMI+L+SFLGLTNGYLTVCV+T APKGYKGP  NALG
Sbjct  330   IAVLSRFLLIPAFYFTAKYSDQGWMILLISFLGLTNGYLTVCVITEAPKGYKGPEQNALG  389

Query  1081  NILVLCLLSGIFSGVALDWLWL  1146
             N+LVLC+L G+F+GVALDWLWL
Sbjct  390   NLLVLCVLCGVFAGVALDWLWL  411



>gb|KEH17552.1| equilibrative nucleoside transporter 6 [Medicago truncatula]
Length=414

 Score =   513 bits (1321),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 269/385 (70%), Positives = 318/385 (83%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L +W+SMLTI DYY  LFP YHPSRVLTLVYQPFA GT+AILAY   KLNTRKRNL+GYI
Sbjct  28    LFTWSSMLTIIDYYLILFPNYHPSRVLTLVYQPFAFGTMAILAYHEAKLNTRKRNLSGYI  87

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL + A+L+LDL +SGKGGLG +IGIC++   FG+ADA  QGG++GD+S M P+F+QS
Sbjct  88    LFFLSSMAVLILDLASSGKGGLGTFIGICIVSGVFGIADALAQGGMIGDISLMHPDFMQS  147

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAG AASG LTS LRL+TKA FE+S +GLRKG I+F A+S  FE LC ILYAFVFPKL 
Sbjct  148   FLAGEAASGALTSVLRLITKAIFENSKDGLRKGAIMFFAISVLFELLCAILYAFVFPKLP  207

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR+KAASEGSKTVAADLAAAGI T+  ES  ++K  ER   K+L  EN DYALDL+
Sbjct  208   IVKYYRSKAASEGSKTVAADLAAAGIQTSLGESTGESKQFERKGMKQLLWENKDYALDLF  267

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIY++TL+I+PGFL E+TG H+LG+WY  VL+AMYN WDL+ RYIPLIK + ++SRK + 
Sbjct  268   LIYILTLAIYPGFLSEDTGKHSLGTWYALVLIAMYNAWDLVGRYIPLIKILNMESRKWIT  327

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             +++ +RF+LIP FY TAKYG QGWMIML SFLGLTNGYLTVCVLT+APKGYKGP  NALG
Sbjct  328   VSVCARFVLIPAFYVTAKYGTQGWMIMLTSFLGLTNGYLTVCVLTSAPKGYKGPEQNALG  387

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             NILVL +L GIF+GV  DWLWLIG 
Sbjct  388   NILVLFILGGIFAGVTADWLWLIGK  412



>ref|XP_010667964.1| PREDICTED: equilibrative nucleotide transporter 3-like [Beta 
vulgaris subsp. vulgaris]
Length=413

 Score =   513 bits (1320),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 265/384 (69%), Positives = 313/384 (82%), Gaps = 4/384 (1%)
 Frame = +1

Query  13    WNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYIlff  192
             WN+MLT+GDYYY++FP YHPSRVLTLVYQPFA+GT AILAY   +++TR R + G+IL+F
Sbjct  34    WNTMLTLGDYYYKVFPDYHPSRVLTLVYQPFAVGTTAILAYNEARIDTRWRIIGGFILYF  93

Query  193   lgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSFLA  372
             + T   LLLDLGTSG  G+G Y+G+C++VA+FGVAD HVQGG+ GDL+FM PEF+QSF  
Sbjct  94    ISTLGCLLLDLGTSGATGVGPYVGLCILVAAFGVADGHVQGGMCGDLAFMLPEFIQSFFV  153

Query  373   GLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAIVK  552
             GLAASG LTSGLRLVTKAAFE S +GLRKG +LFLA+ T  EFLCI LYAF FPKL +VK
Sbjct  154   GLAASGALTSGLRLVTKAAFEKSHDGLRKGALLFLAICTGIEFLCIFLYAFYFPKLPVVK  213

Query  553   YYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYLIYV  732
             Y+RAKAASEGSKTV +DLAAAGI    +  +    +ER++ K+L   N DY L LYLIYV
Sbjct  214   YFRAKAASEGSKTVTSDLAAAGI----KQDESGAKLERLTLKQLLRLNWDYFLGLYLIYV  269

Query  733   VTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQ  912
             +TLSIFPGFLYENTGTH LGSWYP VL+AMYN+ DL+ RY P IK + L+SRKGLMIAI 
Sbjct  270   LTLSIFPGFLYENTGTHRLGSWYPLVLIAMYNVLDLVGRYTPRIKCLNLESRKGLMIAIL  329

Query  913   SRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGNILV  1092
             +RFL +P FYFTAKY D+GWMIML S LG TNG+LTVCV+TAAPKGY GP  NA+GN+LV
Sbjct  330   ARFLFVPAFYFTAKYADEGWMIMLTSLLGYTNGHLTVCVMTAAPKGYTGPEQNAMGNLLV  389

Query  1093  LCLLSGIFSGVALDWLWLIGNSGF  1164
             + LL GIFSGV LDWLWLIG+  F
Sbjct  390   VFLLCGIFSGVCLDWLWLIGHESF  413



>ref|XP_011001157.1| PREDICTED: equilibrative nucleotide transporter 3-like [Populus 
euphratica]
 ref|XP_011001158.1| PREDICTED: equilibrative nucleotide transporter 3-like [Populus 
euphratica]
 ref|XP_011001159.1| PREDICTED: equilibrative nucleotide transporter 3-like [Populus 
euphratica]
Length=417

 Score =   511 bits (1317),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 269/388 (69%), Positives = 326/388 (84%), Gaps = 0/388 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             +LV+WN MLTI DYYY+LFPKYHP+R+LTL+Y PFA+ ++AIL Y   K++TRKRNL+G 
Sbjct  30    TLVAWNCMLTIEDYYYKLFPKYHPARLLTLIYMPFAVVSMAILTYYESKIDTRKRNLSGL  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             +LFFL +  LLLLDL +SGKGG+GN+IGI  I  SFGVADA +QGG+VGDL FMCPEFLQ
Sbjct  90    VLFFLSSLLLLLLDLASSGKGGIGNFIGIGAIAGSFGVADALLQGGMVGDLFFMCPEFLQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S+LAG+AASG L S LRL+TKAAFE   NGLRKGVILFL +STFFEFLCI++YAF+FPKL
Sbjct  150   SYLAGIAASGFLISALRLLTKAAFEKFPNGLRKGVILFLVISTFFEFLCILVYAFLFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYYR KA++EGS TV+ADL A GI    E  ++AK  ER+SNK+L  ENIDYA+DL 
Sbjct  210   PIVKYYRLKASTEGSNTVSADLEAGGIHINQEDENEAKRHERLSNKELLFENIDYAVDLI  269

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LI+V+TLSI PGF+YE+TG+H L SWY  VL+ ++N  D+ISRYIPL++ ++LKSRKGLM
Sbjct  270   LIFVLTLSIVPGFIYEDTGSHQLHSWYAIVLITVFNACDMISRYIPLVEFLKLKSRKGLM  329

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IA+ +RFLLIP FYFTAKY DQGWMI+L+SFLGLT GYLTVCV+T APKGYKGP  NALG
Sbjct  330   IAVLTRFLLIPAFYFTAKYSDQGWMILLISFLGLTTGYLTVCVVTEAPKGYKGPEQNALG  389

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             N+LVLC+L G+F+GVALDWLWL+G   F
Sbjct  390   NLLVLCVLCGVFAGVALDWLWLVGKKEF  417



>dbj|BAJ86894.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=418

 Score =   511 bits (1315),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 265/387 (68%), Positives = 312/387 (81%), Gaps = 2/387 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL +WNSMLTI DYY  LFP YHP+RVLTLVYQPFA G     AY    +NTRKRNLAG+
Sbjct  30    SLFAWNSMLTIEDYYVSLFPDYHPTRVLTLVYQPFAFGLTCFFAYYEATMNTRKRNLAGF  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFFL +FAL+LLD+GT G GG+  YIG+C+I A FG +DA VQGG+VGDLS MCPEF+Q
Sbjct  90    ALFFLSSFALILLDVGTKGHGGIPAYIGVCIISALFGTSDALVQGGLVGDLSLMCPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFL+GLAASG +TS LRL+TKAAFE+S NGLR G +LF +V+  FE  C +LYA VFPKL
Sbjct  150   SFLSGLAASGVITSALRLITKAAFENSQNGLRNGAMLFFSVTCIFELACFLLYALVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESV--DDAKHVERVSNKKLFMENIDYALD  714
              IVKYYR KAASEGSKTV +DLAAAGI    +    +D +  ER+S K+L M+NIDYALD
Sbjct  210   PIVKYYRQKAASEGSKTVGSDLAAAGIKTDQDRQVEEDPQKHERLSTKELLMQNIDYALD  269

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             ++LIYV+TLSIFPGFL E+TG+H LG+WY  VL++MYN+ DLI RY+PLIK ++L +RKG
Sbjct  270   IFLIYVLTLSIFPGFLSEDTGSHGLGTWYALVLISMYNVLDLIGRYLPLIKCLKLTNRKG  329

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LM AI +RFL IP FYFTAKYGDQG+MI L SFLGLTNGYLTVCVL  AP GYKGP  NA
Sbjct  330   LMAAILARFLFIPAFYFTAKYGDQGYMIFLTSFLGLTNGYLTVCVLAEAPNGYKGPEQNA  389

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGN  1155
             LGN+LV+CLL+GIFSGV LDW+WLIG 
Sbjct  390   LGNVLVVCLLAGIFSGVVLDWMWLIGK  416



>emb|CAN71841.1| hypothetical protein VITISV_013398 [Vitis vinifera]
Length=401

 Score =   510 bits (1313),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 272/384 (71%), Positives = 313/384 (82%), Gaps = 3/384 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTIGDYY  LFP YHPSRVLTLVYQPFA+ TIAIL YK  K+NTR RNL GY 
Sbjct  19    LFSWNSMLTIGDYYAYLFPDYHPSRVLTLVYQPFALVTIAILTYKEAKINTRLRNLFGYT  78

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ T  +L+LDL TSGKGGLG +IGICV+ A+FG+ADAHVQGG+VGDLSFM PEF+QS
Sbjct  79    LFFISTLLVLVLDLATSGKGGLGTFIGICVLSAAFGLADAHVQGGMVGDLSFMLPEFMQS  138

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG +TSGLRL+TKAAFE+S +G RKG ILFL++STFFE  C+ILYAFVFPKL 
Sbjct  139   FLAGLAASGAITSGLRLITKAAFENSRDGFRKGAILFLSISTFFELFCVILYAFVFPKLP  198

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYL  723
             IVKY+RAKAASEGSKTV+ADLAA GI   + +  D +  ER+SNK+L ++NIDYA+DL+L
Sbjct  199   IVKYFRAKAASEGSKTVSADLAAGGIQT-TGAEKDPEQPERLSNKQLLLQNIDYAIDLFL  257

Query  724   IYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMI  903
             IY++TLSIFPGFL E+TG+H+LGSWY  VL+AMYN WDLI RYIPLIK ++LKSRKGLMI
Sbjct  258   IYILTLSIFPGFLSEDTGSHSLGSWYSLVLIAMYNGWDLIGRYIPLIKCIKLKSRKGLMI  317

Query  904   AIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGN  1083
              I +RFLLIP FYFTAKYGDQGWMIML SFLGLTNGY TVCVLT APKG        + +
Sbjct  318   GILTRFLLIPAFYFTAKYGDQGWMIMLTSFLGLTNGYFTVCVLTEAPKGDPNKTHWEISS  377

Query  1084  ILVLCLLSGIFSGVALDWLWLIGN  1155
                   L     G+  DWLWLIG 
Sbjct  378   CFF--SLEDCLQGLTADWLWLIGK  399



>ref|XP_010431738.1| PREDICTED: equilibrative nucleotide transporter 4 isoform X1 
[Camelina sativa]
Length=418

 Score =   510 bits (1313),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 256/386 (66%), Positives = 313/386 (81%), Gaps = 0/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQ+FP YHPSRVLTLVYQP A+GT+ I AY   K++TRKR L GY
Sbjct  30    SLVSWNSMLTIADYYYQIFPDYHPSRVLTLVYQPIALGTVMIFAYHESKISTRKRVLTGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + TF L++LDL T G GG+GNYI +C IVASFG+ADA V+GG++GDLS M PE +Q
Sbjct  90    ILFTISTFLLIVLDLATKGHGGIGNYIVLCTIVASFGLADATVKGGLIGDLSLMSPELIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S++AG   +G LTS LRL+TKAAFE S+N LRKG ++FLA+STF EFLC++LYA+VFPKL
Sbjct  150   SYMAGSGMAGVLTSVLRLITKAAFEKSNNHLRKGAMIFLAISTFIEFLCVMLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYYR KAASEGSKTV ADLAAAGI   S+  DD    +R+S K+L ++NIDYA+ L+
Sbjct  210   PIVKYYRTKAASEGSKTVVADLAAAGIQNQSDMTDDDSKNQRLSKKELLLQNIDYAVSLF  269

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LGSWY  +LVAMYN WDL+ RY+PL+  +++++RK L 
Sbjct  270   LIYVLTLSIFPGFLYENTGQHGLGSWYALILVAMYNFWDLVGRYVPLVNWLKVENRKALT  329

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IA+ SR+ L+P FYFTAKYGD+GWM+MLVS LGLT G+LTVC++T APK YKGP  NALG
Sbjct  330   IAVLSRYFLVPAFYFTAKYGDKGWMMMLVSVLGLTTGHLTVCIMTIAPKEYKGPEKNALG  389

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N+LV+ +L G   G++L WLWLIG  
Sbjct  390   NLLVVFILGGAVVGISLGWLWLIGKK  415



>ref|XP_008458960.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Cucumis melo]
Length=425

 Score =   510 bits (1314),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 268/385 (70%), Positives = 319/385 (83%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFPKYH SRVLTLVYQPFA+ TI+IL Y   K+NTRKRNL GY+
Sbjct  39    LFSWNSMLTIEDYYGYLFPKYHSSRVLTLVYQPFALVTISILTYWEAKINTRKRNLFGYL  98

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ +  +L+LDL TSGKGGLG +IGICVI   FG+ADAHVQGG+VGDLSFM P  +QS
Sbjct  99    LFFICSLFVLILDLATSGKGGLGPFIGICVISGGFGIADAHVQGGMVGDLSFMHPRLMQS  158

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAG AASG LTS LRL+TK AFE+S NGLRKG +LF A+S FFE LC+ILYAF FPKL 
Sbjct  159   FLAGCAASGALTSILRLITKGAFENSKNGLRKGALLFFAISAFFELLCVILYAFTFPKLP  218

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             IVK++RAKAA EGSKTV+ADLAAAGI    +E+      V R+SNK+L ++N+DYA+ L+
Sbjct  219   IVKHFRAKAALEGSKTVSADLAAAGIHRVANEAEGKTTEVGRLSNKELLLQNVDYAIGLF  278

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIY +TLSIFPGFL E+TG+H+LG+WY  VL+A YN++DL+ RYIPLIK ++L+SRK LM
Sbjct  279   LIYALTLSIFPGFLSEDTGSHSLGTWYALVLIAAYNVFDLVGRYIPLIKCIKLESRKWLM  338

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             ++I +R LL+P FYFTAKYG+QGWMI+L SFLGLTNGYLTVC+LT APKGYKGP  NALG
Sbjct  339   VSILARILLVPAFYFTAKYGNQGWMILLTSFLGLTNGYLTVCLLTTAPKGYKGPEQNALG  398

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LV+ LL GIF+GV LDWLWLIG 
Sbjct  399   NLLVMFLLGGIFAGVTLDWLWLIGK  423



>ref|XP_008458961.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Cucumis melo]
Length=417

 Score =   509 bits (1312),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 268/385 (70%), Positives = 319/385 (83%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFPKYH SRVLTLVYQPFA+ TI+IL Y   K+NTRKRNL GY+
Sbjct  31    LFSWNSMLTIEDYYGYLFPKYHSSRVLTLVYQPFALVTISILTYWEAKINTRKRNLFGYL  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ +  +L+LDL TSGKGGLG +IGICVI   FG+ADAHVQGG+VGDLSFM P  +QS
Sbjct  91    LFFICSLFVLILDLATSGKGGLGPFIGICVISGGFGIADAHVQGGMVGDLSFMHPRLMQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAG AASG LTS LRL+TK AFE+S NGLRKG +LF A+S FFE LC+ILYAF FPKL 
Sbjct  151   FLAGCAASGALTSILRLITKGAFENSKNGLRKGALLFFAISAFFELLCVILYAFTFPKLP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             IVK++RAKAA EGSKTV+ADLAAAGI    +E+      V R+SNK+L ++N+DYA+ L+
Sbjct  211   IVKHFRAKAALEGSKTVSADLAAAGIHRVANEAEGKTTEVGRLSNKELLLQNVDYAIGLF  270

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIY +TLSIFPGFL E+TG+H+LG+WY  VL+A YN++DL+ RYIPLIK ++L+SRK LM
Sbjct  271   LIYALTLSIFPGFLSEDTGSHSLGTWYALVLIAAYNVFDLVGRYIPLIKCIKLESRKWLM  330

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             ++I +R LL+P FYFTAKYG+QGWMI+L SFLGLTNGYLTVC+LT APKGYKGP  NALG
Sbjct  331   VSILARILLVPAFYFTAKYGNQGWMILLTSFLGLTNGYLTVCLLTTAPKGYKGPEQNALG  390

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LV+ LL GIF+GV LDWLWLIG 
Sbjct  391   NLLVMFLLGGIFAGVTLDWLWLIGK  415



>ref|XP_008651542.1| PREDICTED: nucleoside transporter isoform X2 [Zea mays]
Length=427

 Score =   509 bits (1310),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 263/387 (68%), Positives = 315/387 (81%), Gaps = 2/387 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL +WNS+LTI DYY  LFP YHP+RVLTLVYQPFA G   I+ Y   K+NTR RNLAG+
Sbjct  39    SLFAWNSILTIEDYYSHLFPDYHPTRVLTLVYQPFAFGITLIMTYYEAKMNTRLRNLAGF  98

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFFLG+FAL++LD+ T G GGLG ++G+C+I A FG ADA+ QG +VGDLS MCPEF+Q
Sbjct  99    SLFFLGSFALIILDVATKGHGGLGVFVGVCIISAIFGTADANCQGALVGDLSLMCPEFIQ  158

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLAASG LTS LRLVTKAAFE S +GLR G ILF +++  FE +C++LY FVF KL
Sbjct  159   SFMAGLAASGVLTSALRLVTKAAFESSKDGLRIGAILFFSITCLFELVCLLLYTFVFGKL  218

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESV--DDAKHVERVSNKKLFMENIDYALD  714
              IVKYYRAKAA+EGSKTVA+DLAAAGI +  +    +D +  +R++ K+L M+NIDYALD
Sbjct  219   PIVKYYRAKAAAEGSKTVASDLAAAGIISEQQGQMEEDPEKYKRLTTKELLMQNIDYALD  278

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             +YLIYV+TLSIFPGFL E+TG HNLG+WY  VL+AMYN+WDLI RY+PLI  ++L SRKG
Sbjct  279   IYLIYVLTLSIFPGFLSEDTGAHNLGTWYALVLIAMYNVWDLIGRYVPLIPCLKLTSRKG  338

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
              + A+ +RFL IP FYFTAKYGDQG+MI L SFLGLTNGYLTVCVL  APKGYKGP  NA
Sbjct  339   TLAAVLARFLFIPAFYFTAKYGDQGYMIFLTSFLGLTNGYLTVCVLMEAPKGYKGPEQNA  398

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGN  1155
             LGN+LV+CLL G+FSGV LDWLWLIG 
Sbjct  399   LGNVLVVCLLGGLFSGVVLDWLWLIGK  425



>ref|XP_008651543.1| PREDICTED: nucleoside transporter isoform X1 [Zea mays]
 gb|ACF87510.1| unknown [Zea mays]
 tpg|DAA63093.1| TPA: nucleoside transporter isoform 1 [Zea mays]
 tpg|DAA63094.1| TPA: nucleoside transporter isoform 2 [Zea mays]
Length=417

 Score =   508 bits (1309),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 263/387 (68%), Positives = 315/387 (81%), Gaps = 2/387 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL +WNS+LTI DYY  LFP YHP+RVLTLVYQPFA G   I+ Y   K+NTR RNLAG+
Sbjct  29    SLFAWNSILTIEDYYSHLFPDYHPTRVLTLVYQPFAFGITLIMTYYEAKMNTRLRNLAGF  88

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFFLG+FAL++LD+ T G GGLG ++G+C+I A FG ADA+ QG +VGDLS MCPEF+Q
Sbjct  89    SLFFLGSFALIILDVATKGHGGLGVFVGVCIISAIFGTADANCQGALVGDLSLMCPEFIQ  148

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLAASG LTS LRLVTKAAFE S +GLR G ILF +++  FE +C++LY FVF KL
Sbjct  149   SFMAGLAASGVLTSALRLVTKAAFESSKDGLRIGAILFFSITCLFELVCLLLYTFVFGKL  208

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESV--DDAKHVERVSNKKLFMENIDYALD  714
              IVKYYRAKAA+EGSKTVA+DLAAAGI +  +    +D +  +R++ K+L M+NIDYALD
Sbjct  209   PIVKYYRAKAAAEGSKTVASDLAAAGIISEQQGQMEEDPEKYKRLTTKELLMQNIDYALD  268

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             +YLIYV+TLSIFPGFL E+TG HNLG+WY  VL+AMYN+WDLI RY+PLI  ++L SRKG
Sbjct  269   IYLIYVLTLSIFPGFLSEDTGAHNLGTWYALVLIAMYNVWDLIGRYVPLIPCLKLTSRKG  328

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
              + A+ +RFL IP FYFTAKYGDQG+MI L SFLGLTNGYLTVCVL  APKGYKGP  NA
Sbjct  329   TLAAVLARFLFIPAFYFTAKYGDQGYMIFLTSFLGLTNGYLTVCVLMEAPKGYKGPEQNA  388

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGN  1155
             LGN+LV+CLL G+FSGV LDWLWLIG 
Sbjct  389   LGNVLVVCLLGGLFSGVVLDWLWLIGK  415



>ref|XP_009114508.1| PREDICTED: equilibrative nucleotide transporter 3-like [Brassica 
rapa]
 ref|XP_009114509.1| PREDICTED: equilibrative nucleotide transporter 3-like [Brassica 
rapa]
Length=418

 Score =   508 bits (1308),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 253/383 (66%), Positives = 312/383 (81%), Gaps = 0/383 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYYY +FP YHPSRVLT+VYQPFA+GTI ILAY   K+NTRKRNL GYI
Sbjct  31    LASWNSMLTIADYYYHVFPDYHPSRVLTVVYQPFALGTIVILAYHESKINTRKRNLIGYI  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             +F + T  L++LDL T G+GG+G YIG+C IVASFG+A+A V GG++GDLS MCPE +QS
Sbjct  91    IFTISTLLLIVLDLTTRGRGGIGPYIGLCAIVASFGLAEATVHGGMIGDLSLMCPELIQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             F+AG+ A+G LTS  RL+TKAAFE+S++GLRKG ++FLA+S   +FLC+ILYA+VFPKL 
Sbjct  151   FVAGMGAAGALTSAFRLMTKAAFENSNDGLRKGAMIFLAISALIQFLCVILYAYVFPKLP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYL  723
             IV YYR KAASEGSKTV ADLAA GI   S S DD  + +R+SNK+L ++NIDYA++L L
Sbjct  211   IVNYYRRKAASEGSKTVNADLAAGGIQNQSYSTDDVSNNQRLSNKELLVQNIDYAVNLAL  270

Query  724   IYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMI  903
             IY+++LSIFPGFLYENTG H LGSWY  VLVAMYN  +++ RY PL++ +++++RKGL +
Sbjct  271   IYLISLSIFPGFLYENTGQHGLGSWYALVLVAMYNCGNMVGRYTPLVEWLKIENRKGLTL  330

Query  904   AIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGN  1083
             A+ SRFL IP FYFTAKYGDQGWMIMLVS LGLT G+  VC+L  APKGY GP  NALGN
Sbjct  331   AVLSRFLFIPAFYFTAKYGDQGWMIMLVSLLGLTTGHFNVCILITAPKGYNGPEKNALGN  390

Query  1084  ILVLCLLSGIFSGVALDWLWLIG  1152
             +LV+ L+ GI +G +L WLWLIG
Sbjct  391   LLVVFLIGGIVAGTSLGWLWLIG  413



>ref|XP_010422388.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422389.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422390.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422391.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422392.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422393.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422394.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422395.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422396.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422397.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422398.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422399.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422400.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422401.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422402.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422403.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422404.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422405.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422406.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422407.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422408.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422409.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422410.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
 ref|XP_010422411.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
Length=415

 Score =   508 bits (1307),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 256/387 (66%), Positives = 309/387 (80%), Gaps = 1/387 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQ+FP YHPSRVLTLVYQP    TI    Y   K++TRKR + GY
Sbjct  26    SLVSWNSMLTIADYYYQVFPDYHPSRVLTLVYQPIGFATIMTFTYHESKISTRKRIMTGY  85

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + TF L++LDL T G+GG+G YI +C +VASFG ADA V GG++GDLS MCPE +Q
Sbjct  86    ILFTISTFLLIVLDLTTKGRGGVGPYICLCAVVASFGFADATVHGGMIGDLSLMCPELVQ  145

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+ G+A +G LTS LRL+ KAAFE S++GLRKG ++FLA++T    LC++LYA+VFPK 
Sbjct  146   SFMGGMAVAGALTSALRLMAKAAFEKSNDGLRKGAMIFLAIATVIVLLCVMLYAYVFPKF  205

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSE-SVDDAKHVERVSNKKLFMENIDYALDL  717
              IVKYYR KAASEGSKTV+ADLAAAGI  PS+ + DD    +R+SNKKL ++NIDYA+ L
Sbjct  206   PIVKYYRRKAASEGSKTVSADLAAAGIQNPSDLTDDDDSKNQRLSNKKLLLQNIDYAVSL  265

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +L YV TLSIFPGFLYENTG H LG WY  VLVAMYN WDL+ RY PL+K +++++RK +
Sbjct  266   FLTYVCTLSIFPGFLYENTGKHRLGDWYALVLVAMYNCWDLVGRYTPLVKCLKIENRKAI  325

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
               A+ SR+ LIP FYFTAKYGDQGWMIMLVS LGLTNG+LTVC++T APKGYKGP  NAL
Sbjct  326   NFAVLSRYFLIPAFYFTAKYGDQGWMIMLVSVLGLTNGHLTVCIMTIAPKGYKGPEQNAL  385

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNS  1158
             GN+L + LL GIF+GVALDWLW+IG  
Sbjct  386   GNLLAMFLLGGIFAGVALDWLWIIGKK  412



>gb|KEH36496.1| equilibrative nucleoside transporter 6 [Medicago truncatula]
Length=384

 Score =   506 bits (1303),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 265/381 (70%), Positives = 311/381 (82%), Gaps = 2/381 (1%)
 Frame = +1

Query  22    MLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYIlfflgt  201
             MLT GDYYY+LFP+YHPSRVLT++Y PF + T+ IL +   ++NTR R L GY LFF+ T
Sbjct  1     MLTTGDYYYKLFPRYHPSRVLTIIYLPFTLVTLIILTHNESRINTRMRILVGYTLFFVCT  60

Query  202   falllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSFLAGLA  381
               +L+LDL TSGKGG+ +YIG+C I ASFGVADA VQGG+VGD+S MCPEF+QSFLAGLA
Sbjct  61    LLVLVLDLATSGKGGIRHYIGLCSISASFGVADALVQGGMVGDMSLMCPEFMQSFLAGLA  120

Query  382   ASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAIVKYYR  561
             ASG LTS LR +TK  FE S +GLR+G +LF  +STFFEFLCIILYA  FPKL IVKYYR
Sbjct  121   ASGVLTSCLRFLTKVVFEKSEDGLRRGALLFFGISTFFEFLCIILYAIYFPKLTIVKYYR  180

Query  562   AKAASEGSKTVAADLAAAGITAP-SESVD-DAKHVERVSNKKLFMENIDYALDLYLIYVV  735
             +KAASEGSKTV+ADL AAGI    S+ V  D K  ER++NK+L ++NIDY+  L+LIY++
Sbjct  181   SKAASEGSKTVSADLTAAGIQNEISQQVGFDHKQHERINNKQLLLQNIDYSTGLFLIYML  240

Query  736   TLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQS  915
             TLSI PGFLYENTG+H LG WY  VL+A++N+ DLISRYIPL+K ++L+SRK L+ AI S
Sbjct  241   TLSIVPGFLYENTGSHQLGKWYALVLIAVFNVSDLISRYIPLLKFLKLESRKCLLAAILS  300

Query  916   RFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGNILVL  1095
             R LLIP FYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLT APKGYK P  NALGNILVL
Sbjct  301   RLLLIPAFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTVAPKGYKAPEQNALGNILVL  360

Query  1096  CLLSGIFSGVALDWLWLIGNS  1158
              L+ GIF G ALDWLWLIG S
Sbjct  361   FLMCGIFVGDALDWLWLIGKS  381



>ref|XP_004957995.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Setaria italica]
 ref|XP_004957996.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Setaria italica]
Length=419

 Score =   507 bits (1306),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 264/387 (68%), Positives = 313/387 (81%), Gaps = 2/387 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL +WNSMLTI DYY  LFP YHP+RVLTL YQPFA G   I+ Y   K+NTR+RNLAG+
Sbjct  31    SLFAWNSMLTIEDYYVHLFPDYHPTRVLTLAYQPFAFGITLIMTYYEAKMNTRRRNLAGF  90

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFFLG+FAL++LD+ T G+GGLG ++G+C+I A FG ADA+ QG +VGDLS MCPEF+Q
Sbjct  91    SLFFLGSFALIILDVATKGRGGLGVFVGVCIISAIFGTADANCQGALVGDLSLMCPEFVQ  150

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLAASG LTS LRLVTKAAFE S +GLR G ILF +++  FE +C++LY FVF KL
Sbjct  151   SFMAGLAASGVLTSALRLVTKAAFESSKDGLRIGAILFFSITCLFELVCLLLYTFVFGKL  210

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESV--DDAKHVERVSNKKLFMENIDYALD  714
              IVKYYR+KAA+EGSKTVA+DLAAAGI A  ++   +D +  +R++ K+L MENIDY  D
Sbjct  211   PIVKYYRSKAAAEGSKTVASDLAAAGIVAEQQAQVEEDPQKYKRLTTKELVMENIDYMFD  270

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             +YLIYV+TLSIFPGFL E+TG H+LGSWY  VL+AMYN+WDLI RY+PLI  ++L SRKG
Sbjct  271   IYLIYVLTLSIFPGFLSEDTGAHSLGSWYALVLIAMYNVWDLIGRYVPLIPCLKLISRKG  330

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
              M AI +RFL IP FYFTAKYGDQG+MI L SFLGLTNGYLTVCVL  APKGYK P  NA
Sbjct  331   TMAAILARFLFIPAFYFTAKYGDQGYMIFLTSFLGLTNGYLTVCVLMEAPKGYKAPEQNA  390

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGN  1155
             LGN LV+CLL GIFSGV LDWLWLIG 
Sbjct  391   LGNALVVCLLGGIFSGVVLDWLWLIGK  417



>ref|XP_004487344.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Cicer arietinum]
Length=414

 Score =   507 bits (1305),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 276/385 (72%), Positives = 319/385 (83%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SW+SMLT+ D+Y  LFPKYHPSRVLTLVYQPFA GT+AIL+Y   K+NTR RNL GY 
Sbjct  28    LFSWSSMLTVEDFYGYLFPKYHPSRVLTLVYQPFAFGTLAILSYNEAKVNTRLRNLFGYT  87

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ T  +L+L+  TSGKGGLG +IGIC +   FGVADAHVQGG+VGDLS+M PEF+QS
Sbjct  88    LFFISTLLVLILNSATSGKGGLGTFIGICAMSGCFGVADAHVQGGMVGDLSYMQPEFIQS  147

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRLVTKAAFE+S +GLRKG ILF A+STFFE LC++LYAFVFPK+ 
Sbjct  148   FLAGLAASGALTSTLRLVTKAAFENSKDGLRKGAILFFAISTFFELLCVLLYAFVFPKIP  207

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR+KAASEGSKTV+ADLAA GI T   +  D  K  ER  NK+L  ENIDY LD++
Sbjct  208   IVKYYRSKAASEGSKTVSADLAAGGIQTILKQDEDYGKEQERKGNKQLLFENIDYLLDMF  267

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFL E+TG H LG+WY  VL+AMYN+ DLI RYIPLI+ ++L+SRK   
Sbjct  268   LIYVLTLSIFPGFLIEDTGAHKLGTWYALVLIAMYNVGDLIGRYIPLIELLKLESRKLTT  327

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             +AI  RFLL+P FYFTAKYGDQGWMIML SFLGL+NGYLTVCV+T+APKGYKGP  NALG
Sbjct  328   VAILCRFLLVPAFYFTAKYGDQGWMIMLTSFLGLSNGYLTVCVMTSAPKGYKGPEQNALG  387

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LVL LL GIF+GV LDWLWLIG 
Sbjct  388   NLLVLFLLGGIFAGVTLDWLWLIGK  412



>ref|XP_009353210.1| PREDICTED: equilibrative nucleotide transporter 3-like [Pyrus 
x bretschneideri]
Length=418

 Score =   507 bits (1305),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 275/386 (71%), Positives = 325/386 (84%), Gaps = 2/386 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP+YHPSRVLT+VYQPFA+ TI +L+Y   K+NTRKRNL GYI
Sbjct  31    LFSWNSMLTIVDYYVYLFPRYHPSRVLTVVYQPFAVLTIIVLSYHEAKINTRKRNLLGYI  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL +  +L+LDL TSGKGGLG +IGIC I A FG+ADAHV GG+VGDLSFM  E +QS
Sbjct  91    LFFLSSLLVLVLDLATSGKGGLGTFIGICAISAVFGIADAHVLGGMVGDLSFMPVELIQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE+S NGLRKG ILF A+++FFE LCI+LYAF FPKL 
Sbjct  151   FLAGLAASGALTSALRLITKAAFENSQNGLRKGAILFFAITSFFELLCILLYAFSFPKLP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDA--KHVERVSNKKLFMENIDYALDL  717
             IVKYYR+KAASEGSKTV+ADLAA GI   +E+ D+   +  +R+ NK+L ++NIDYALD+
Sbjct  211   IVKYYRSKAASEGSKTVSADLAAGGIQTLAEATDEENLRECDRLGNKQLLLQNIDYALDM  270

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIY +TLSI PGFL E+TG+H+LG+WY  VL+A+YN+ DLI RYIPL+K ++L+SR+GL
Sbjct  271   FLIYTLTLSISPGFLSEDTGSHSLGTWYALVLIALYNVCDLIGRYIPLVKFLKLESRRGL  330

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             M  I SRFLL+PCFYFTAKYGDQGWMIML SFLGLTNGYLTVCVLT+APKGY+GP  NAL
Sbjct  331   MTVILSRFLLVPCFYFTAKYGDQGWMIMLTSFLGLTNGYLTVCVLTSAPKGYRGPEQNAL  390

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LVL LL GI +GV LDWLWLIG 
Sbjct  391   GNLLVLFLLGGILAGVVLDWLWLIGK  416



>ref|XP_009114501.1| PREDICTED: equilibrative nucleotide transporter 4 [Brassica rapa]
Length=418

 Score =   506 bits (1304),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 253/385 (66%), Positives = 312/385 (81%), Gaps = 0/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             LVSWNSMLTI DYYYQ+FP YHPSRVL L+YQPFA+ TIAILAY   K+NTRKR L GY 
Sbjct  31    LVSWNSMLTIADYYYQVFPAYHPSRVLPLIYQPFAVATIAILAYHESKINTRKRILIGYT  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LF + TF L++LDL T G GG+G YIG+C IVASFG+ADA V+GG+VGDLS MCPE +QS
Sbjct  91    LFTISTFLLIVLDLTTKGHGGIGPYIGLCTIVASFGIADATVKGGLVGDLSLMCPEIMQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
              +AG A +G LT+ LRL+TKA FE S+  LRKG ++FLA+STF E LC+ILYA++FPKL 
Sbjct  151   LMAGSALAGGLTTALRLITKAVFEKSNGSLRKGAMIFLAISTFIELLCVILYAYIFPKLP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYL  723
             IVKYYR+KAASEGSKTVAADLAAAGI   S+  +D    +R+S K+L ++NID+A++L+L
Sbjct  211   IVKYYRSKAASEGSKTVAADLAAAGIQNQSDLTNDYSKNQRLSKKELLLQNIDHAVNLFL  270

Query  724   IYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMI  903
             IYV+TLSIFPGFLYENTG H LG+WY  +LVA+YN WDL+ RY PL+K + L++RK L I
Sbjct  271   IYVLTLSIFPGFLYENTGQHGLGTWYALILVAVYNFWDLVGRYFPLVKWLNLENRKALTI  330

Query  904   AIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGN  1083
              + SR+ L+P FYFTAKYGD+GWMIML+S LGLT G+LTVC++T APKGY GP  NALGN
Sbjct  331   VVLSRYFLVPAFYFTAKYGDKGWMIMLISVLGLTTGHLTVCIITIAPKGYMGPEKNALGN  390

Query  1084  ILVLCLLSGIFSGVALDWLWLIGNS  1158
             +LV  +L G F+G++L WLWL+G  
Sbjct  391   LLVTFILGGAFTGISLGWLWLVGKK  415



>ref|XP_006286514.1| hypothetical protein CARUB_v10001118mg [Capsella rubella]
 gb|EOA19412.1| hypothetical protein CARUB_v10001118mg [Capsella rubella]
Length=400

 Score =   505 bits (1301),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 252/386 (65%), Positives = 315/386 (82%), Gaps = 0/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+W+SMLTI DYYYQ+FP YHPSRVLTLVYQP A+ TI I AY   K++TRKR L GY
Sbjct  11    SLVAWSSMLTIADYYYQVFPDYHPSRVLTLVYQPIALATIMIFAYHESKISTRKRVLTGY  70

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + TF L++LDL T G+GG+G+YI +C IVASFG+ADA V+GG++GDLS MCPE +Q
Sbjct  71    ILFTISTFLLIVLDLSTKGQGGIGHYIVLCTIVASFGLADATVKGGLIGDLSLMCPELIQ  130

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S++AG   +G LTS LRL+TKAAFE S+N LRKG ++FLA+STF EFLC++LYA++FPKL
Sbjct  131   SYIAGSGMAGVLTSVLRLITKAAFEKSNNHLRKGAMIFLAISTFIEFLCVMLYAYMFPKL  190

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYYR KAASEGSKTV ADL AAGI   S+ +DD    +R+S K L ++NIDYA+ L+
Sbjct  191   PIVKYYRRKAASEGSKTVVADLGAAGIQNQSDLIDDDSKNQRLSKKDLLLQNIDYAMGLF  250

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LGSWY  +LVAMYN WDL+ RY+PL+  +++++RK L 
Sbjct  251   LIYVLTLSIFPGFLYENTGQHGLGSWYALILVAMYNFWDLVGRYVPLVNWLKVENRKALT  310

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IA+ SR+ L+P FYFTAKYGD+GWM+ML+S LGLT G+LTVC++T APKGYKGP  NALG
Sbjct  311   IAVVSRYFLVPAFYFTAKYGDKGWMMMLISILGLTTGHLTVCIMTIAPKGYKGPEKNALG  370

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N+LV+ +L G   G++L WLWLIG +
Sbjct  371   NLLVVFILGGAVVGISLGWLWLIGKN  396



>ref|XP_004957994.1| PREDICTED: equilibrative nucleotide transporter 3-like [Setaria 
italica]
Length=415

 Score =   506 bits (1302),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 254/386 (66%), Positives = 316/386 (82%), Gaps = 4/386 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFPK HP+RVLTLVYQPFA+G  A+LAY   K+NTR RNL GY 
Sbjct  30    LFSWNSMLTIEDYYVYLFPKNHPTRVLTLVYQPFALGVTALLAYHEAKINTRLRNLTGYT  89

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             L+FL   A+++LD+ T G+GG+G ++G+CVI A+ G+ DAHVQGG+VGDLS MCPEF+QS
Sbjct  90    LYFLSNLAIIILDVATKGQGGVGAFVGVCVISAALGIGDAHVQGGMVGDLSLMCPEFIQS  149

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             +LAGLAASG +TS LRL+TKAAFE S +GLRKG +LF +++ FFE LC++LY  VFP L 
Sbjct  150   YLAGLAASGAITSALRLITKAAFESSQDGLRKGAMLFFSIACFFELLCVLLYTSVFPTLP  209

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESV--DDAKHVERVSNKKLFMENIDYALDL  717
             IVKYYR+KAASEGSKTVA DLAAAG+    + +  ++ +  ER+S K+L ++N+DYALD+
Sbjct  210   IVKYYRSKAASEGSKTVAGDLAAAGVPTEQDEIVEEEPERYERLSTKQLLLQNMDYALDI  269

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +L+YV+TLSIFPGFL E+TG+H+LG+WY  VL+AM+N+WDLI RY+P I  V++ SRK +
Sbjct  270   FLVYVLTLSIFPGFLSEDTGSHSLGAWYALVLIAMFNVWDLIGRYVPFI--VKMTSRKCI  327

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             M A  +RF LIP FYFTAKYGDQG+MI+L SFLGL+NGYLTVCVLT APKGYKGP  NAL
Sbjct  328   MAAALARFFLIPAFYFTAKYGDQGYMIVLTSFLGLSNGYLTVCVLTEAPKGYKGPEQNAL  387

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LV+ LL G+FSGV LDWLWLIG 
Sbjct  388   GNVLVVFLLIGLFSGVVLDWLWLIGK  413



>ref|NP_001151494.1| nucleoside transporter [Zea mays]
 gb|ACG43078.1| nucleoside transporter [Zea mays]
Length=417

 Score =   505 bits (1301),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 261/387 (67%), Positives = 315/387 (81%), Gaps = 2/387 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL +WNS+LTI DYY  LFP YHP+RVLTLVYQPFA G   I+ Y   K+NTR RNLAG+
Sbjct  29    SLFAWNSILTIEDYYSHLFPDYHPTRVLTLVYQPFAFGITLIMTYYEAKMNTRLRNLAGF  88

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFFLG+FAL++LD+ T G GGLG ++G+C+I A FG ADA+ QG +VGDLS MCP+F+Q
Sbjct  89    SLFFLGSFALIILDVATKGHGGLGVFVGVCIISAIFGTADANCQGALVGDLSLMCPQFIQ  148

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLAASG LTS LRLVTKAAFE S +GLR G ILF +++  FE +C++LY FVF KL
Sbjct  149   SFMAGLAASGVLTSALRLVTKAAFESSKDGLRIGAILFFSITCMFELVCLLLYTFVFGKL  208

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESV--DDAKHVERVSNKKLFMENIDYALD  714
              IVKYYRAKAA+EGSKTVA+DLAAAGI +  +    +D +  +R++ K+L M+NIDYALD
Sbjct  209   PIVKYYRAKAAAEGSKTVASDLAAAGIISEQQGQMEEDPEKYKRLTTKELLMQNIDYALD  268

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             +YLIYV+TLSIFPGFL E+TG H+LG+WY  VL+AMYN+WDLI RY+PLI  ++L SRKG
Sbjct  269   IYLIYVLTLSIFPGFLSEDTGAHSLGTWYALVLIAMYNVWDLIGRYVPLIPCLKLTSRKG  328

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
              + A+ +RFL IP FYFTAKYGDQG+MI L SFLGLTNGYLTVCVL  APKGYKGP  NA
Sbjct  329   TLAAVLARFLFIPAFYFTAKYGDQGYMIFLTSFLGLTNGYLTVCVLMEAPKGYKGPEQNA  388

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGN  1155
             LGN+LV+CLL G+FSGV LDWLWLIG 
Sbjct  389   LGNVLVVCLLGGLFSGVVLDWLWLIGK  415



>ref|XP_009144518.1| PREDICTED: equilibrative nucleotide transporter 3-like [Brassica 
rapa]
Length=455

 Score =   507 bits (1305),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 253/386 (66%), Positives = 315/386 (82%), Gaps = 0/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQ+FP YHPSRVL LVYQPFA+GTI ILAY   K+NTRKR L GY
Sbjct  67    SLVSWNSMLTIADYYYQVFPVYHPSRVLPLVYQPFAVGTIVILAYHESKINTRKRILVGY  126

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + TF L++LDL T G+GG+G YIG+C +V+ FG+ADA V+GG++GDLS MCPE +Q
Sbjct  127   ILFTISTFLLIMLDLTTKGQGGIGPYIGLCAVVSLFGIADATVKGGMIGDLSLMCPELIQ  186

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLA +G LTS LRL+TKAAFE S++ LRKG ++FL +STF EFLC++LYA+VFPKL
Sbjct  187   SFMAGLAVAGALTSALRLITKAAFEKSNDRLRKGAMIFLVISTFIEFLCVMLYAYVFPKL  246

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVK YR KAASEGS+TV+ADLAAAGI   S+  +     +R+S K L ++NID+A++L+
Sbjct  247   PIVKCYRQKAASEGSQTVSADLAAAGIQYQSDMTNYDSKSQRLSKKDLLLQNIDHAVNLF  306

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LG+WY  VLVA+YN WDL+ RY+PL+K ++ K+RK L 
Sbjct  307   LIYVLTLSIFPGFLYENTGQHGLGTWYALVLVAVYNFWDLVGRYMPLVKWLQTKNRKALT  366

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             I + SR+LL+P FYFTAKYGD+GWMIML+S LGL+ G+LTVC+LT APKGY GP  NALG
Sbjct  367   IVVLSRYLLVPAFYFTAKYGDKGWMIMLISILGLSTGHLTVCILTVAPKGYMGPEKNALG  426

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N+LV  +L G  +G++L WLWL+G  
Sbjct  427   NLLVTFILGGALTGISLGWLWLVGKK  452



>ref|XP_010431720.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
Length=415

 Score =   505 bits (1301),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 254/387 (66%), Positives = 308/387 (80%), Gaps = 1/387 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQ+FP YHPSRVLTLVYQP    TI    Y   K++TRKR + GY
Sbjct  26    SLVSWNSMLTIADYYYQVFPDYHPSRVLTLVYQPIGFATIMTFTYHESKISTRKRIMTGY  85

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + T  L++LDL T G+GG+G YI +C +VASFG ADA V GG++GDLS MCPE +Q
Sbjct  86    ILFTISTLLLIVLDLTTKGRGGVGPYICLCAVVASFGFADATVHGGMIGDLSLMCPELVQ  145

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+ G+A +G LTS LRL+ KAAF+ S++GLRKG ++FLA++T    LC++LYA+VFPK 
Sbjct  146   SFMGGMAVAGALTSALRLMAKAAFDKSNDGLRKGAMIFLAIATVIVLLCVMLYAYVFPKF  205

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSE-SVDDAKHVERVSNKKLFMENIDYALDL  717
              IVKYYR KAASEGSKTV+ADLAAAGI  PS+ + DD    +R+SNKKL ++NIDYA+ L
Sbjct  206   PIVKYYRRKAASEGSKTVSADLAAAGIQNPSDLTDDDDSKNQRLSNKKLLIQNIDYAVSL  265

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +L YV TLSIFPGFLYENTG H LG WY  VLVAMYN WDL+ RY PL+K +++++RK +
Sbjct  266   FLTYVCTLSIFPGFLYENTGKHGLGDWYALVLVAMYNCWDLVGRYTPLVKWLKIENRKAI  325

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
               A+ SR+ LIP FYFTAKYGDQGWMIMLVS LGLTNG+LTVC++T APKGYKGP  NAL
Sbjct  326   NFAVLSRYFLIPAFYFTAKYGDQGWMIMLVSVLGLTNGHLTVCIMTIAPKGYKGPEQNAL  385

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNS  1158
             GN+L + LL GIF+GVALDWLW+IG  
Sbjct  386   GNLLAMFLLGGIFAGVALDWLWIIGKK  412



>emb|CDY46378.1| BnaA09g19920D [Brassica napus]
Length=418

 Score =   505 bits (1300),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 252/385 (65%), Positives = 311/385 (81%), Gaps = 0/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             LVSWNSMLTI DYYYQ+FP YHPSRVL L+YQPFA+ TI ILAY   K+NTRKR L GY 
Sbjct  31    LVSWNSMLTIADYYYQVFPAYHPSRVLPLIYQPFAVATITILAYHESKINTRKRILIGYT  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LF + TF L++LDL T G GG+G YIG+C IVASFG+ADA V+GG+VGDLS MCPE +QS
Sbjct  91    LFTISTFLLIVLDLTTKGHGGIGPYIGLCTIVASFGIADATVKGGLVGDLSLMCPEIMQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
              +AG A +G LT+ LRL+TKA FE S+  LRKG ++FLA+STF E LC+ILYA++FPKL 
Sbjct  151   LMAGSALAGGLTTALRLITKAVFEKSNGSLRKGAMIFLAISTFIELLCVILYAYIFPKLP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYL  723
             IVKYYR+KAASEGSKTVAADLAAAGI   S+  +D    +R+S K+L ++NID+A++L+L
Sbjct  211   IVKYYRSKAASEGSKTVAADLAAAGIQNQSDLTNDYSKNQRLSKKELLLQNIDHAVNLFL  270

Query  724   IYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMI  903
             IYV+TLSIFPGFLYENTG H LG+WY  +LVA+YN WDL+ RY PL+K + L++RK L I
Sbjct  271   IYVLTLSIFPGFLYENTGQHGLGTWYALILVAVYNFWDLVGRYFPLVKWLNLENRKALTI  330

Query  904   AIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGN  1083
              + SR+ L+P FYFTAKYGD+GWMIML+S LGLT G+LTVC++T APKGY GP  NALGN
Sbjct  331   VVLSRYFLVPAFYFTAKYGDKGWMIMLISVLGLTTGHLTVCIITIAPKGYMGPEKNALGN  390

Query  1084  ILVLCLLSGIFSGVALDWLWLIGNS  1158
             +LV  +L G F+G++L WLWL+G  
Sbjct  391   LLVTFILGGAFTGISLGWLWLVGKK  415



>ref|XP_006833131.1| hypothetical protein AMTR_s00072p00092230 [Amborella trichopoda]
 gb|ERM98409.1| hypothetical protein AMTR_s00072p00092230 [Amborella trichopoda]
Length=419

 Score =   504 bits (1299),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 269/386 (70%), Positives = 315/386 (82%), Gaps = 2/386 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY QLFPKYHP+RVL+LVYQPFA+GT+AIL Y    +NTR+RNL GY 
Sbjct  32    LFSWNSMLTIEDYYSQLFPKYHPTRVLSLVYQPFALGTLAILTYNEATINTRRRNLTGYF  91

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF  +  +L++DL TSG GG+G ++GIC++  +FGVADAHVQGG+VGDLSFM  EF+QS
Sbjct  92    LFFCSSLLVLVIDLATSGAGGIGPFLGICIVSGAFGVADAHVQGGMVGDLSFMRSEFVQS  151

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE++ +GLRKG I+F A+S  FE LC++LYAFVFPKL 
Sbjct  152   FLAGLAASGALTSALRLITKAAFENTKDGLRKGAIIFFAISVLFELLCLLLYAFVFPKLP  211

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSE--SVDDAKHVERVSNKKLFMENIDYALDL  717
             IVKYYR+KAASEGSKTV+ADLAA GI  P       D K+ ER+SNK L  +N DYA+D+
Sbjct  212   IVKYYRSKAASEGSKTVSADLAAGGIEIPQSLGVAGDLKNPERLSNKDLLFQNKDYAIDM  271

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
              LIY+VTLSIFPGFL E+TG+H+LGSWY  VL+AMYN +DLI RYIPLI K+++ SR  L
Sbjct  272   ALIYIVTLSIFPGFLAEDTGSHSLGSWYALVLIAMYNGFDLIGRYIPLINKLKVTSRPTL  331

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             M+A   RFLLIP FYFT+KYG+QGWMIML + LGLTNGYLTV VLT APKGYKGP  NAL
Sbjct  332   MVATLCRFLLIPAFYFTSKYGEQGWMIMLTALLGLTNGYLTVSVLTVAPKGYKGPEQNAL  391

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GNILVL LL GIFSG  LDWLWLIG 
Sbjct  392   GNILVLSLLVGIFSGAVLDWLWLIGK  417



>ref|XP_009626444.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=379

 Score =   503 bits (1295),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 270/369 (73%), Positives = 317/369 (86%), Gaps = 4/369 (1%)
 Frame = +1

Query  61    KYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYIlfflgtfalllldlgtsgk  240
              YHPSRVLTL+YQPFA+GT+AILAY   K+NTRKRNL GY LFF+ T  +L+LDL TSGK
Sbjct  9     DYHPSRVLTLIYQPFALGTLAILAYNEAKMNTRKRNLFGYSLFFISTLLVLVLDLATSGK  68

Query  241   gglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSFLAGLAASGTLTSGLRLVT  420
             GGLG +IGIC I  +FGVADAHVQGG++GDL++M PEF+QSFLAGLAASG LTS LRL+T
Sbjct  69    GGLGTFIGICAISGAFGVADAHVQGGMIGDLAYMLPEFMQSFLAGLAASGALTSVLRLIT  128

Query  421   KAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAIVKYYRAKAASEGSKTVAA  600
             KAAFE+S +GLR G ILF +VSTFFE LC++LYAFVFPKL IVKYYRAKAASEGSKTVA 
Sbjct  129   KAAFENSKDGLRNGAILFFSVSTFFELLCVLLYAFVFPKLPIVKYYRAKAASEGSKTVAG  188

Query  601   DLAAAGI----TAPSESVDDAKHVERVSNKKLFMENIDYALDLYLIYVVTLSIFPGFLYE  768
             DLAA G+     + ++S    +HVER++NK+L ++NIDYA+DL+LIY +TLSIFPGFL E
Sbjct  189   DLAAGGVYKQEGSETKSKHGPEHVERLNNKQLLLQNIDYAIDLFLIYALTLSIFPGFLSE  248

Query  769   NTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQSRFLLIPCFYFT  948
             +TG+H+LGSWY  VL+AMYN+WDLI RY+PLIK ++L+SRKGLM+ I SRFLLIP FYFT
Sbjct  249   DTGSHSLGSWYALVLIAMYNVWDLIGRYVPLIKCLKLESRKGLMLVILSRFLLIPAFYFT  308

Query  949   AKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGNILVLCLLSGIFSGVA  1128
             AKYGDQGWMIML SFLGL+NGYLTVCVLT+APKGYKGP  NALGN+LVL LL GIF+GV 
Sbjct  309   AKYGDQGWMIMLTSFLGLSNGYLTVCVLTSAPKGYKGPEQNALGNLLVLFLLGGIFAGVT  368

Query  1129  LDWLWLIGN  1155
             LDWLWLIG 
Sbjct  369   LDWLWLIGK  377



>emb|CDY46381.1| BnaA09g19950D [Brassica napus]
Length=441

 Score =   504 bits (1298),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 249/383 (65%), Positives = 310/383 (81%), Gaps = 0/383 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYYY +FP YHPSRVLT+VYQPFA+GTI ILAY   K+NTRKRNL GYI
Sbjct  54    LASWNSMLTIADYYYHVFPDYHPSRVLTVVYQPFALGTIVILAYHESKINTRKRNLIGYI  113

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             +F + T  L++LDL T G+GG+  YIG+C IVASFG+A+A+V GG++GDLS MCPE +QS
Sbjct  114   IFTISTLLLIVLDLTTRGRGGIRPYIGLCAIVASFGLAEANVHGGMIGDLSLMCPELIQS  173

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             F+AG+ A+G LTS  RL+TKAAFE+S++GLRKG ++FLA+S   +FLC++LYA+VFPKL 
Sbjct  174   FVAGMGAAGALTSAFRLMTKAAFENSNDGLRKGAMIFLAISALIQFLCVMLYAYVFPKLP  233

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYL  723
             IV YYR KAASEGSKTV ADLAA GI   S S DD  + +R+SNK+L ++NIDYA++L L
Sbjct  234   IVNYYRRKAASEGSKTVNADLAAGGIQNQSYSTDDVSNNQRLSNKELLVQNIDYAVNLAL  293

Query  724   IYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMI  903
             IY+++LSIFPGFLYENTG H LGSWY  VLVA YN  +++ RY PL++ +++++RKGL +
Sbjct  294   IYLISLSIFPGFLYENTGQHGLGSWYALVLVATYNCGNMVGRYTPLVEWLKIENRKGLTL  353

Query  904   AIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGN  1083
             A+ SRFL IP FYFT KYGDQGWMIMLVS LGLT G+  VC+L  APKGY GP  NALGN
Sbjct  354   AVLSRFLFIPAFYFTEKYGDQGWMIMLVSLLGLTTGHFNVCILITAPKGYNGPEKNALGN  413

Query  1084  ILVLCLLSGIFSGVALDWLWLIG  1152
             +LV+ L+ GI +G +L WLWLIG
Sbjct  414   LLVVFLIGGIVAGTSLGWLWLIG  436



>gb|AFK42107.1| unknown [Lotus japonicus]
Length=383

 Score =   502 bits (1292),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 261/368 (71%), Positives = 307/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  52    LFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYIlfflgtfalllldlgt  231
             LFPKYHPSRVL+LVYQPFAIGT+AILAY   K+NT++RNL GY  FF+ T  +L+L+L T
Sbjct  14    LFPKYHPSRVLSLVYQPFAIGTLAILAYNEAKINTQRRNLFGYTPFFITTLLVLILNLAT  73

Query  232   sgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSFLAGLAASGTLTSGLR  411
             SGKGGL  +I IC I  +FGVADAHVQGG+VGDLS+M PEFLQSFLAG AASG LTS LR
Sbjct  74    SGKGGLETFIVICAISGAFGVADAHVQGGMVGDLSYMQPEFLQSFLAGSAASGALTSALR  133

Query  412   LVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAIVKYYRAKAASEGSKT  591
             L+TKAA E+S +GLRKG ILF A+STFFE LC++LYA VFPKL IVKYYR KAASEGSKT
Sbjct  134   LITKAASENSKDGLRKGAILFFAISTFFELLCVLLYASVFPKLPIVKYYRLKAASEGSKT  193

Query  592   VAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYLIYVVTLSIFPGFLYEN  771
             V+ADLAA  I    E  + AK  +R   K+L +ENIDYALD++LIYV+TLSIFPGFL E+
Sbjct  194   VSADLAAGLIQTLPEGEEYAKEQKRRGIKQLLLENIDYALDIFLIYVLTLSIFPGFLSED  253

Query  772   TGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQSRFLLIPCFYFTA  951
             TG+H+LGSWY  VL+AMYN+WDLI RYIPL+K ++L++RK + +AI  RFLL+P FYFTA
Sbjct  254   TGSHSLGSWYALVLIAMYNVWDLIGRYIPLLKCLKLENRKMITVAILCRFLLVPAFYFTA  313

Query  952   KYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGNILVLCLLSGIFSGVAL  1131
             KYGDQGWMIML SFLGL+NG+LTVCVLT+APKGYKGP  NALGN+LVL L  GIF+G+ L
Sbjct  314   KYGDQGWMIMLTSFLGLSNGHLTVCVLTSAPKGYKGPEQNALGNLLVLFLFGGIFAGLTL  373

Query  1132  DWLWLIGN  1155
             DWLWLIG 
Sbjct  374   DWLWLIGK  381



>ref|XP_010538224.1| PREDICTED: LOW QUALITY PROTEIN: equilibrative nucleotide transporter 
3-like [Tarenaya hassleriana]
Length=424

 Score =   503 bits (1295),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 281/392 (72%), Positives = 334/392 (85%), Gaps = 8/392 (2%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSM+TIGDYYYQ+FP YHPSRVLTLVYQPFA+GTIAILAY   K++TR+RNL GY
Sbjct  30    SLVSWNSMVTIGDYYYQVFPDYHPSRVLTLVYQPFALGTIAILAYHESKIDTRRRNLIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             +LF +GTF L+LLD+ T G GG+G YIG+C IVASFG+ADA VQGG+VGDLS MCPE +Q
Sbjct  90    VLFSIGTFLLILLDMATRGGGGIGPYIGLCAIVASFGLADATVQGGMVGDLSLMCPELIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLAA+G LTS LRL+TKAAF+ S+ GLRKG +LFLA+STF E +C+ LYA+VFPKL
Sbjct  150   SFMAGLAAAGALTSTLRLLTKAAFKSSNEGLRKGAMLFLAISTFIELVCVFLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSES---VDDAKHVERVSNKKLFMENIDYAL  711
              IVKYYR KAASEGSKTV+ADLAAAGI   ++S    DD+K++ R+SNK+L ++NIDYA+
Sbjct  210   PIVKYYRRKAASEGSKTVSADLAAAGIQNQNQSEVAEDDSKNL-RLSNKELLLQNIDYAV  268

Query  712   DLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYI----PLIKKVEL  879
             DL+LIYV+TLSIFPGFLYENTG H LG WY  VL+AMYN WDLI +Y      L+K ++L
Sbjct  269   DLFLIYVLTLSIFPGFLYENTGEHGLGDWYALVLIAMYNFWDLIGKYTHNTSSLVKFLKL  328

Query  880   KSRKGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKG  1059
             +SRKG+ +A+ SRFLL+P FYFTAKYGDQGWMIML SFLGLTNG+LTVC+LT AP+GYKG
Sbjct  329   ESRKGITLAVVSRFLLVPAFYFTAKYGDQGWMIMLTSFLGLTNGHLTVCILTTAPRGYKG  388

Query  1060  PAANALGNILVLCLLSGIFSGVALDWLWLIGN  1155
             P  NALGN+LVL LL GIF+GVALDWLWLIG 
Sbjct  389   PEQNALGNLLVLFLLGGIFAGVALDWLWLIGK  420



>ref|XP_009778597.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Nicotiana sylvestris]
Length=379

 Score =   501 bits (1290),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 269/369 (73%), Positives = 316/369 (86%), Gaps = 4/369 (1%)
 Frame = +1

Query  61    KYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYIlfflgtfalllldlgtsgk  240
              YHPSRVLTL+YQPFA+GT+AILAY   K+NTRKRNL GY LFF+ T  +L+LDL TSGK
Sbjct  9     DYHPSRVLTLIYQPFALGTLAILAYNEAKMNTRKRNLFGYSLFFISTLLVLVLDLATSGK  68

Query  241   gglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSFLAGLAASGTLTSGLRLVT  420
             GGLG +IGIC I  +FGVADAHVQGG++GDL++M PEF+QSFLAGLAASG LTS LRL+T
Sbjct  69    GGLGTFIGICAISGAFGVADAHVQGGMIGDLAYMLPEFIQSFLAGLAASGVLTSALRLIT  128

Query  421   KAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAIVKYYRAKAASEGSKTVAA  600
             KAAFE+S +GLR G ILF +VSTFFE LC++LYAFVFPKL IVKYYRAKAASEGSKTVA 
Sbjct  129   KAAFENSKDGLRNGAILFFSVSTFFELLCVLLYAFVFPKLPIVKYYRAKAASEGSKTVAG  188

Query  601   DLAAAGI----TAPSESVDDAKHVERVSNKKLFMENIDYALDLYLIYVVTLSIFPGFLYE  768
             DLAA G+     + ++S    +HVER++NK+L ++NIDYA+DL+LIY +TLSIFPGFL E
Sbjct  189   DLAAGGVFKHEGSETKSKHGPEHVERLNNKQLLLQNIDYAIDLFLIYALTLSIFPGFLSE  248

Query  769   NTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQSRFLLIPCFYFT  948
             +TG+H+LGSWY  VL+AMYN+WDLI RY+PLIK ++L+SRKGLM+ I  RFLLIP FYFT
Sbjct  249   DTGSHSLGSWYALVLIAMYNVWDLIGRYVPLIKCLKLESRKGLMLVILLRFLLIPAFYFT  308

Query  949   AKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGNILVLCLLSGIFSGVA  1128
             AKYGDQGWMIML SFLGL+NGYLTVCVLT+APKGYKGP  NALGN+LVL LL GIF+GV 
Sbjct  309   AKYGDQGWMIMLTSFLGLSNGYLTVCVLTSAPKGYKGPEQNALGNLLVLFLLGGIFAGVT  368

Query  1129  LDWLWLIGN  1155
             LDWLWLIG 
Sbjct  369   LDWLWLIGK  377



>ref|XP_002874834.1| hypothetical protein ARALYDRAFT_911782 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51093.1| hypothetical protein ARALYDRAFT_911782 [Arabidopsis lyrata subsp. 
lyrata]
Length=418

 Score =   502 bits (1293),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 255/386 (66%), Positives = 311/386 (81%), Gaps = 0/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQ+FP YHPSRVLTLVYQP A+GTI ILAY   K++TRKR L GY
Sbjct  30    SLVSWNSMLTIADYYYQVFPDYHPSRVLTLVYQPIALGTIMILAYHESKISTRKRILTGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + TF L++LDL T G GG+G+YI +C IVASFG+ADA V+GG+VGDLS MCPE +Q
Sbjct  90    ILFTISTFLLIVLDLTTKGHGGIGHYIVLCTIVASFGLADATVKGGLVGDLSLMCPELIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S++AG   +G LTS LRL+TKAAFE S+N LRKG ++FLA+STF EFLC++LYA+VFPKL
Sbjct  150   SYIAGSGMAGALTSVLRLITKAAFEKSNNRLRKGAMMFLAISTFIEFLCVMLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYYR KAASEGSKTV ADLAAAGI   S+  DD    +R+S K+L ++NID+A++L+
Sbjct  210   PIVKYYRRKAASEGSKTVVADLAAAGIQNQSDLSDDNSKNQRLSKKELLLQNIDHAVNLF  269

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LG WY  +LVA YN WDL+ RY PL+  +++++R  L 
Sbjct  270   LIYVLTLSIFPGFLYENTGQHGLGDWYALILVATYNFWDLVGRYAPLLNWLKVENRTALT  329

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IA+ SR+ L+P FYFTAKYGD+GWMIMLVS LG+T G+LTVC++T APKGY GP  NALG
Sbjct  330   IAVLSRYFLVPAFYFTAKYGDKGWMIMLVSILGITTGHLTVCIMTIAPKGYTGPEKNALG  389

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N+LV+ +L G   G+ L WLWLIG  
Sbjct  390   NLLVVFILGGAVVGIYLGWLWLIGKK  415



>ref|XP_010455846.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X3 [Camelina sativa]
Length=390

 Score =   500 bits (1287),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 258/387 (67%), Positives = 311/387 (80%), Gaps = 11/387 (3%)
 Frame = +1

Query  31    IGDYYYQLFPK----YHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYIlfflg  198
             +G+ Y    P+    YHPSRVLTLVYQPFA+GTI IL Y   K+NTRKRNL GY LF + 
Sbjct  1     MGETYENQPPEKLQDYHPSRVLTLVYQPFALGTIVILTYHESKMNTRKRNLIGYTLFTIS  60

Query  199   tfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSFLAGL  378
             TF L++LDL T G+GG+G YIG+C +VASFG+ADA VQGG++GDLS MCPE +QSF+ GL
Sbjct  61    TFLLIVLDLATKGRGGVGPYIGLCAVVASFGLADATVQGGMIGDLSLMCPELVQSFMVGL  120

Query  379   AASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAIVKYY  558
             A +G LTS LRL TKAAFE S+NGLRKG ++FLA+STF E LC++LYA+VFPKL IVKYY
Sbjct  121   AVAGALTSALRLTTKAAFEKSNNGLRKGAMIFLAISTFIELLCVLLYAYVFPKLPIVKYY  180

Query  559   RAKAASEGSKTVAADLAAAGITAPS-------ESVDDAKHVERVSNKKLFMENIDYALDL  717
             R KAASEGSKTV+ADLAAAGI   S       ++ DD    +R++NK+L ++NIDYA++L
Sbjct  181   RRKAASEGSKTVSADLAAAGIQNTSDLLLDSMQTDDDDSKNQRLTNKELLLQNIDYAVNL  240

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIYV TLSIFPGFLYENTG H LG WY  VLVAMYN WDL+ RY PL+K +++++RK +
Sbjct  241   FLIYVCTLSIFPGFLYENTGKHGLGDWYALVLVAMYNCWDLVGRYTPLLKWLKIENRKLI  300

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
              IA+ SR+ LIP FYFTAKYGDQGWMIML+S LGLTNG+LTVC+LT APKGYKGP  NAL
Sbjct  301   TIAVLSRYFLIPAFYFTAKYGDQGWMIMLISILGLTNGHLTVCILTIAPKGYKGPEQNAL  360

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNS  1158
             GN+LV+ LL GIF+GVALDWLWLIG  
Sbjct  361   GNLLVIFLLGGIFAGVALDWLWLIGKK  387



>ref|XP_004507231.1| PREDICTED: equilibrative nucleotide transporter 3-like [Cicer 
arietinum]
Length=414

 Score =   501 bits (1290),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 280/385 (73%), Positives = 325/385 (84%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFPKYHPSRVLTLVYQPFA GT+AIL Y   K+NTRKRNL GY 
Sbjct  28    LFSWNSMLTIEDYYVSLFPKYHPSRVLTLVYQPFAFGTLAILTYYEAKINTRKRNLFGYT  87

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFLG  A+L+LDL TSGKGG+G YIG+C++   FG+ADAH QGG+VGDLS+M P+F+QS
Sbjct  88    LFFLGILAVLILDLATSGKGGIGTYIGVCIVSGVFGIADAHAQGGMVGDLSYMDPDFIQS  147

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAG AASG LTS LRL+TKA FE+S NGLRKG I F A+STFFE LC+ILYAFVFPKL 
Sbjct  148   FLAGAAASGALTSALRLITKAVFENSQNGLRKGAITFFAISTFFELLCVILYAFVFPKLP  207

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR+KAA+EGSKTV+ADLA AGI T+   + +D++ VER  NK+L MENIDYALDL+
Sbjct  208   IVKYYRSKAAAEGSKTVSADLAVAGIQTSTGGATEDSRLVERKGNKQLLMENIDYALDLF  267

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             +I+ +TLSIFPGFL E+TG+H+LG+WY  VL+AMYN+WDLI RYIPLIK ++L+SRK + 
Sbjct  268   MIFALTLSIFPGFLSEDTGSHSLGTWYALVLIAMYNVWDLIGRYIPLIKILKLESRKLIT  327

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IA+ SR LLIP FYFTAKYG QGWMI+L SFLGL+NGYLTVCVLT APKGYKGP  NALG
Sbjct  328   IAVISRLLLIPAFYFTAKYGTQGWMILLTSFLGLSNGYLTVCVLTEAPKGYKGPEQNALG  387

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LVL LL GIF+GV LDWLWLIG 
Sbjct  388   NLLVLFLLGGIFAGVTLDWLWLIGK  412



>gb|KCW76376.1| hypothetical protein EUGRSUZ_D00755, partial [Eucalyptus grandis]
Length=364

 Score =   499 bits (1284),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 257/367 (70%), Positives = 307/367 (84%), Gaps = 4/367 (1%)
 Frame = +1

Query  64    YHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYIlfflgtfalllldlgtsgkg  243
             YHPSRVLT+VYQPFAIG +AIL Y   K++TRKRN+ GY+ F L T  LL+LDL TSGKG
Sbjct  2     YHPSRVLTIVYQPFAIGMMAILTYHKSKVDTRKRNIIGYMFFTLSTLLLLVLDLATSGKG  61

Query  244   glgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSFLAGLAASGTLTSGLRLVTK  423
             G+  Y  ICV+VASFGV DAHVQGG++GDLSFMCPEF+QSF A +AASG LTSG+RL+TK
Sbjct  62    GVWPYFDICVLVASFGVTDAHVQGGMIGDLSFMCPEFMQSFFARIAASGALTSGMRLITK  121

Query  424   AAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAIVKYYRAKAASEGSKTVAAD  603
             AAF+ + +GLRKG +LFLA+STFFEF+CIILYA  F K+ IVK+YR+KAASEGSK V+AD
Sbjct  122   AAFDKAHDGLRKGAMLFLAISTFFEFICIILYATWFAKIPIVKHYRSKAASEGSKIVSAD  181

Query  604   LAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYLIYVVTLSIFPGFLYENTGTH  783
             LAAA I    ++ D     +R+SNK+L ++NIDYA DLYLIYV+TL+IFPGFLYENTGTH
Sbjct  182   LAAAVI----QTQDGDSKEDRLSNKQLLLQNIDYATDLYLIYVLTLTIFPGFLYENTGTH  237

Query  784   NLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQSRFLLIPCFYFTAKYGD  963
              LGSWY  VL+AMYN+WDLISRYIPLI  ++L+SRKGL+I I +RFLL+P FYFTA+YGD
Sbjct  238   QLGSWYALVLIAMYNVWDLISRYIPLIGWLKLESRKGLLIVILARFLLVPAFYFTARYGD  297

Query  964   QGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGNILVLCLLSGIFSGVALDWLW  1143
             QGWMIMLVSFLGL+ GYLTVCV+T APKGYKGP  NALGN+LVL +L G+FSGV+L W W
Sbjct  298   QGWMIMLVSFLGLSKGYLTVCVMTVAPKGYKGPEQNALGNLLVLFILGGLFSGVSLVWQW  357

Query  1144  LIGNSGF  1164
             +I N  F
Sbjct  358   IIHNDKF  364



>ref|XP_008379582.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Malus domestica]
Length=399

 Score =   500 bits (1287),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 274/386 (71%), Positives = 324/386 (84%), Gaps = 2/386 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSM+TI DYY  LFP YHPSRVLT+VYQPFA+ TI +L+Y   K+NTRKRNL GYI
Sbjct  12    LFSWNSMITIVDYYVYLFPWYHPSRVLTVVYQPFAVLTIIVLSYHEAKINTRKRNLLGYI  71

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL +  +L+LDL TSGKGGLG +IGIC I A+FG+ADAHV GG+VGDLSFM  E +QS
Sbjct  72    LFFLSSLLVLVLDLATSGKGGLGTFIGICAISAAFGIADAHVLGGMVGDLSFMPGELIQS  131

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE+S NGLRKG ILF A+++FFE LCI+LYAF FPKL 
Sbjct  132   FLAGLAASGALTSALRLITKAAFENSQNGLRKGAILFFAITSFFELLCILLYAFSFPKLP  191

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVE--RVSNKKLFMENIDYALDL  717
             IVKYYR+KAASEGSKTV+ADLAA GI   +E+ D+    E  R+ NK+L ++NIDYALD+
Sbjct  192   IVKYYRSKAASEGSKTVSADLAAGGIQTLAEATDEENPREPNRLGNKQLLLQNIDYALDI  251

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIY +TLSI PGFL E+TG+H+LG+WY  VL+A+YN+ DLI RYIPL+K ++L+SR+GL
Sbjct  252   FLIYTLTLSISPGFLSEDTGSHSLGTWYALVLIALYNVCDLIGRYIPLVKFLKLESRRGL  311

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             M  I SRFLL+PCFYFTAKYG+QGWMIML SFLGLTNGYLTVCVLT+APKGY+GP  NAL
Sbjct  312   MTVILSRFLLVPCFYFTAKYGEQGWMIMLTSFLGLTNGYLTVCVLTSAPKGYRGPEQNAL  371

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LVL LL GI +GV LDWLWLIG 
Sbjct  372   GNLLVLFLLGGILAGVLLDWLWLIGK  397



>ref|XP_004487345.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Cicer arietinum]
Length=381

 Score =   499 bits (1285),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 272/379 (72%), Positives = 314/379 (83%), Gaps = 1/379 (0%)
 Frame = +1

Query  22    MLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYIlfflgt  201
             MLT+ D+Y  LFPKYHPSRVLTLVYQPFA GT+AIL+Y   K+NTR RNL GY LFF+ T
Sbjct  1     MLTVEDFYGYLFPKYHPSRVLTLVYQPFAFGTLAILSYNEAKVNTRLRNLFGYTLFFIST  60

Query  202   falllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSFLAGLA  381
               +L+L+  TSGKGGLG +IGIC +   FGVADAHVQGG+VGDLS+M PEF+QSFLAGLA
Sbjct  61    LLVLILNSATSGKGGLGTFIGICAMSGCFGVADAHVQGGMVGDLSYMQPEFIQSFLAGLA  120

Query  382   ASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAIVKYYR  561
             ASG LTS LRLVTKAAFE+S +GLRKG ILF A+STFFE LC++LYAFVFPK+ IVKYYR
Sbjct  121   ASGALTSTLRLVTKAAFENSKDGLRKGAILFFAISTFFELLCVLLYAFVFPKIPIVKYYR  180

Query  562   AKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLYLIYVVT  738
             +KAASEGSKTV+ADLAA GI T   +  D  K  ER  NK+L  ENIDY LD++LIYV+T
Sbjct  181   SKAASEGSKTVSADLAAGGIQTILKQDEDYGKEQERKGNKQLLFENIDYLLDMFLIYVLT  240

Query  739   LSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQSR  918
             LSIFPGFL E+TG H LG+WY  VL+AMYN+ DLI RYIPLI+ ++L+SRK   +AI  R
Sbjct  241   LSIFPGFLIEDTGAHKLGTWYALVLIAMYNVGDLIGRYIPLIELLKLESRKLTTVAILCR  300

Query  919   FLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGNILVLC  1098
             FLL+P FYFTAKYGDQGWMIML SFLGL+NGYLTVCV+T+APKGYKGP  NALGN+LVL 
Sbjct  301   FLLVPAFYFTAKYGDQGWMIMLTSFLGLSNGYLTVCVMTSAPKGYKGPEQNALGNLLVLF  360

Query  1099  LLSGIFSGVALDWLWLIGN  1155
             LL GIF+GV LDWLWLIG 
Sbjct  361   LLGGIFAGVTLDWLWLIGK  379



>emb|CAB81053.1| putative protein [Arabidopsis thaliana]
Length=394

 Score =   500 bits (1287),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 245/386 (63%), Positives = 295/386 (76%), Gaps = 24/386 (6%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL+SWNSMLT  DYYY++FP YHPSRVLTLVYQPFA G I ILAY   K +TRKR   G+
Sbjct  30    SLISWNSMLTTADYYYKVFPDYHPSRVLTLVYQPFAFGAIVILAYHESKTSTRKRR-GGF  88

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
                                    G Y G+C +VA+FG+ADA VQGG+ GDLS MCPE +Q
Sbjct  89    -----------------------GPYTGLCAVVAAFGLADATVQGGMFGDLSLMCPELVQ  125

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S++ G+A +G LTS LRL+TKAAFE S+NGLRKG ++FLA+ST  E L ++LYA+V PKL
Sbjct  126   SYMGGMAVAGALTSALRLITKAAFEKSNNGLRKGAMMFLAISTCIELLSVMLYAYVLPKL  185

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IV YYR KAAS+GSKTV+ADLAAAGI   S+  DD    +R+S K+L  +NID+A++L+
Sbjct  186   PIVMYYRRKAASQGSKTVSADLAAAGIQNQSDLSDDDSKNQRLSKKELLFQNIDHAVNLF  245

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV TLSIFPGFLYENTG H LG+WY  VLVAMYN WDL+ RY PL+K + +++RK + 
Sbjct  246   LIYVCTLSIFPGFLYENTGQHGLGAWYALVLVAMYNCWDLVGRYTPLVKWLNIENRKLIT  305

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IA+ SR+LLIP FYFTAKYGDQGWMIMLVS LGLTNG+LTVC++T APKGYKGP  NALG
Sbjct  306   IAVLSRYLLIPAFYFTAKYGDQGWMIMLVSVLGLTNGHLTVCIMTIAPKGYKGPEQNALG  365

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N+LV+ LL GIF+GVALDWLWLIG  
Sbjct  366   NLLVIFLLGGIFAGVALDWLWLIGKK  391



>ref|XP_008379581.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Malus domestica]
Length=400

 Score =   499 bits (1285),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 273/387 (71%), Positives = 323/387 (83%), Gaps = 3/387 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSM+TI DYY  LFP YHPSRVLT+VYQPFA+ TI +L+Y   K+NTRKRNL GYI
Sbjct  12    LFSWNSMITIVDYYVYLFPWYHPSRVLTVVYQPFAVLTIIVLSYHEAKINTRKRNLLGYI  71

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL +  +L+LDL TSGKGGLG +IGIC I A+FG+ADAHV GG+VGDLSFM  E +QS
Sbjct  72    LFFLSSLLVLVLDLATSGKGGLGTFIGICAISAAFGIADAHVLGGMVGDLSFMPGELIQS  131

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE+S NGLRKG ILF A+++FFE LCI+LYAF FPKL 
Sbjct  132   FLAGLAASGALTSALRLITKAAFENSQNGLRKGAILFFAITSFFELLCILLYAFSFPKLP  191

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDA---KHVERVSNKKLFMENIDYALD  714
             IVKYYR+KAASEGSKTV+ADLAA GI   +E+  D    +   R+ NK+L ++NIDYALD
Sbjct  192   IVKYYRSKAASEGSKTVSADLAAGGIQTLAEATQDEENPREPNRLGNKQLLLQNIDYALD  251

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             ++LIY +TLSI PGFL E+TG+H+LG+WY  VL+A+YN+ DLI RYIPL+K ++L+SR+G
Sbjct  252   IFLIYTLTLSISPGFLSEDTGSHSLGTWYALVLIALYNVCDLIGRYIPLVKFLKLESRRG  311

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LM  I SRFLL+PCFYFTAKYG+QGWMIML SFLGLTNGYLTVCVLT+APKGY+GP  NA
Sbjct  312   LMTVILSRFLLVPCFYFTAKYGEQGWMIMLTSFLGLTNGYLTVCVLTSAPKGYRGPEQNA  371

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGN  1155
             LGN+LVL LL GI +GV LDWLWLIG 
Sbjct  372   LGNLLVLFLLGGILAGVLLDWLWLIGK  398



>ref|XP_010054388.1| PREDICTED: equilibrative nucleotide transporter 3-like [Eucalyptus 
grandis]
Length=374

 Score =   498 bits (1282),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 257/367 (70%), Positives = 307/367 (84%), Gaps = 4/367 (1%)
 Frame = +1

Query  64    YHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYIlfflgtfalllldlgtsgkg  243
             YHPSRVLT+VYQPFAIG +AIL Y   K++TRKRN+ GY+ F L T  LL+LDL TSGKG
Sbjct  12    YHPSRVLTIVYQPFAIGMMAILTYHKSKVDTRKRNIIGYMFFTLSTLLLLVLDLATSGKG  71

Query  244   glgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSFLAGLAASGTLTSGLRLVTK  423
             G+  Y  ICV+VASFGV DAHVQGG++GDLSFMCPEF+QSF A +AASG LTSG+RL+TK
Sbjct  72    GVWPYFDICVLVASFGVTDAHVQGGMIGDLSFMCPEFMQSFFARIAASGALTSGMRLITK  131

Query  424   AAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAIVKYYRAKAASEGSKTVAAD  603
             AAF+ + +GLRKG +LFLA+STFFEF+CIILYA  F K+ IVK+YR+KAASEGSK V+AD
Sbjct  132   AAFDKAHDGLRKGAMLFLAISTFFEFICIILYATWFAKIPIVKHYRSKAASEGSKIVSAD  191

Query  604   LAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYLIYVVTLSIFPGFLYENTGTH  783
             LAAA I    ++ D     +R+SNK+L ++NIDYA DLYLIYV+TL+IFPGFLYENTGTH
Sbjct  192   LAAAVI----QTQDGDSKEDRLSNKQLLLQNIDYATDLYLIYVLTLTIFPGFLYENTGTH  247

Query  784   NLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQSRFLLIPCFYFTAKYGD  963
              LGSWY  VL+AMYN+WDLISRYIPLI  ++L+SRKGL+I I +RFLL+P FYFTA+YGD
Sbjct  248   QLGSWYALVLIAMYNVWDLISRYIPLIGWLKLESRKGLLIVILARFLLVPAFYFTARYGD  307

Query  964   QGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGNILVLCLLSGIFSGVALDWLW  1143
             QGWMIMLVSFLGL+ GYLTVCV+T APKGYKGP  NALGN+LVL +L G+FSGV+L W W
Sbjct  308   QGWMIMLVSFLGLSKGYLTVCVMTVAPKGYKGPEQNALGNLLVLFILGGLFSGVSLVWQW  367

Query  1144  LIGNSGF  1164
             +I N  F
Sbjct  368   IIHNDKF  374



>gb|KDO55800.1| hypothetical protein CISIN_1g016029mg [Citrus sinensis]
Length=396

 Score =   498 bits (1282),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 272/384 (71%), Positives = 321/384 (84%), Gaps = 1/384 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLT+ DYY  LFP+YHPSR+LTLVYQPFA+ T+AILAY   K++TR+R + GYI
Sbjct  12    LFSWNSMLTVVDYYVFLFPQYHPSRILTLVYQPFALITLAILAYHEAKIDTRRRIIFGYI  71

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF  +  +L+LDL TSGKGGLG +IGICVI  +FGVADA+VQGG+VGDLSFM  E +QS
Sbjct  72    LFFASSLLVLVLDLATSGKGGLGTFIGICVISGAFGVADANVQGGMVGDLSFMTSELIQS  131

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG +TS LRL+TKAAFE+S +GLRKG +LF A+S+FFEFLC+ILYAFVFPK+ 
Sbjct  132   FLAGLAASGAITSALRLITKAAFENSKDGLRKGALLFFAISSFFEFLCVILYAFVFPKIP  191

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYL  723
             IVKYYR KAASEGSKTVAADLAA GI   S+  +  K  ER SNK+L ++NIDYA+D+++
Sbjct  192   IVKYYRNKAASEGSKTVAADLAAGGIQMLSKE-EVEKCSERFSNKQLLLQNIDYAIDMFV  250

Query  724   IYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMI  903
             IY +TLSIFPGFL E+TG+H+LG WY  VL+AMYN+ DLI RYIPL+K  +L+SRK +  
Sbjct  251   IYTLTLSIFPGFLSEDTGSHSLGGWYAVVLIAMYNVGDLIGRYIPLLKFFKLESRKYITA  310

Query  904   AIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGN  1083
             A  SRFLL+P FYFTAKYGDQGWMIML SFLGL+NGYLTVCVLTAAPKGYKGP  NALGN
Sbjct  311   ATLSRFLLVPAFYFTAKYGDQGWMIMLTSFLGLSNGYLTVCVLTAAPKGYKGPEQNALGN  370

Query  1084  ILVLCLLSGIFSGVALDWLWLIGN  1155
             +LVL LL GIF+G  LDWLWLIG 
Sbjct  371   LLVLFLLGGIFAGATLDWLWLIGK  394



>ref|XP_006447406.1| hypothetical protein CICLE_v10015212mg [Citrus clementina]
 ref|XP_006469817.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Citrus sinensis]
 gb|ESR60646.1| hypothetical protein CICLE_v10015212mg [Citrus clementina]
Length=413

 Score =   499 bits (1284),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 274/385 (71%), Positives = 322/385 (84%), Gaps = 3/385 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLT+ DYY  LFP+YHPSR+LTLVYQPFA+ T+AILAY   K++TR+R + GYI
Sbjct  29    LFSWNSMLTVVDYYVFLFPQYHPSRILTLVYQPFALITLAILAYHEAKIDTRRRIIFGYI  88

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF  +  +L+LDL TSGKGGLG +IGICVI  +FGVADA+VQGG+VGDLSFM  E +QS
Sbjct  89    LFFASSLLVLVLDLATSGKGGLGTFIGICVISGAFGVADANVQGGMVGDLSFMTSELIQS  148

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG +TS LRL+TKAAFE+S +GLRKG +LF A+S+FFEFLC+ILYAFVFPK+ 
Sbjct  149   FLAGLAASGAITSALRLITKAAFENSKDGLRKGALLFFAISSFFEFLCVILYAFVFPKIP  208

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR KAASEGSKTVAADLAA GI T   E V+  K  ER SNK+L ++NIDYA+D++
Sbjct  209   IVKYYRNKAASEGSKTVAADLAAGGIQTLSKEEVE--KCSERFSNKQLLLQNIDYAIDMF  266

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             +IY +TLSIFPGFL E+TG+H+LG WY  VL+AMYN+ DLI RYIPL+K  +L+SRK + 
Sbjct  267   VIYTLTLSIFPGFLSEDTGSHSLGGWYAVVLIAMYNVGDLIGRYIPLLKFFKLESRKYIT  326

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
              A  SRFLL+P FYFTAKYGDQGWMIML SFLGL+NGYLTVCVLTAAPKGYKGP  NALG
Sbjct  327   AATLSRFLLVPAFYFTAKYGDQGWMIMLTSFLGLSNGYLTVCVLTAAPKGYKGPEQNALG  386

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LVL LL GIF+G  LDWLWLIG 
Sbjct  387   NLLVLFLLGGIFAGATLDWLWLIGK  411



>gb|KEH37809.1| equilibrative nucleoside transporter 6 [Medicago truncatula]
Length=449

 Score =   500 bits (1287),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 266/383 (69%), Positives = 318/383 (83%), Gaps = 1/383 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L +WNSMLTI DYY  LFPKYHPSRVLT+VYQPF   T AILAY   K++TR RNL GY 
Sbjct  28    LFAWNSMLTIVDYYIYLFPKYHPSRVLTIVYQPFVFATQAILAYNEAKISTRIRNLFGYT  87

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             + F G  ALL+LDL TSGKGG+G +IGIC++   FG+ADAHVQGG+VGDLS+M PEF+QS
Sbjct  88    VVFFGILALLILDLATSGKGGIGTFIGICIVSGVFGIADAHVQGGMVGDLSYMLPEFIQS  147

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAG AASG LTS LRL+TKA FE+S  GLRKG ILF A+S+FFE LC+ILYAF+FPKL 
Sbjct  148   FLAGSAASGALTSALRLITKAVFENSPGGLRKGAILFFAISSFFELLCVILYAFIFPKLP  207

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR+KAASEGSKTV ADLAAAGI T+P   ++D+K  +R   K+L  ENIDYA+DL+
Sbjct  208   IVKYYRSKAASEGSKTVTADLAAAGIKTSPGIDMEDSKQQDRKGIKQLLSENIDYAVDLF  267

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFL E+TG+H+LG+WY  VL+A +N++DLI+RYIPL+K ++++SRK + 
Sbjct  268   LIYVLTLSIFPGFLSEDTGSHSLGTWYALVLIATFNVFDLIARYIPLVKILKMESRKMIT  327

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
              A+ SRFLLIP FYFTAKYG QGWMI L SFLGL+NGYLT+CV T+APKGYKGP  NALG
Sbjct  328   TAVISRFLLIPAFYFTAKYGKQGWMIFLTSFLGLSNGYLTICVFTSAPKGYKGPEQNALG  387

Query  1081  NILVLCLLSGIFSGVALDWLWLI  1149
             N+L+LCLL G+F GV LDWLWLI
Sbjct  388   NMLMLCLLGGLFVGVTLDWLWLI  410



>ref|NP_192422.1| equilibrative nucleoside transporter 4 [Arabidopsis thaliana]
 sp|Q9M0Y2.1|ENT4_ARATH RecName: Full=Equilibrative nucleotide transporter 4; Short=AtENT4; 
AltName: Full=Nucleoside transporter ENT4 [Arabidopsis 
thaliana]
 gb|AAL25097.1|AF426401_1 putative equilibrative nucleoside transporter ENT4 [Arabidopsis 
thaliana]
 emb|CAB81055.1| putative protein [Arabidopsis thaliana]
 gb|AEE82482.1| equilibrative nucleoside transporter 4 [Arabidopsis thaliana]
Length=418

 Score =   498 bits (1283),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 253/386 (66%), Positives = 309/386 (80%), Gaps = 0/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL SWNSMLTI DYYYQ+FP YHPSRV TL+YQP A+GTI ILAY+  K++TRKR L GY
Sbjct  30    SLFSWNSMLTIADYYYQVFPDYHPSRVFTLIYQPIALGTIMILAYRESKISTRKRILTGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + TF L++LDL T G GG+G+YI +C IVASFG+ADA V+GG+VGDLS MCPE +Q
Sbjct  90    ILFTISTFLLIVLDLTTKGHGGIGHYIVLCTIVASFGLADATVKGGLVGDLSLMCPELIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S++AG   +G LTS LRL+TKAAFE S+N LRKG ++FLA+STF E LC+ILYA+VFPKL
Sbjct  150   SYMAGSGMAGALTSVLRLITKAAFEKSNNSLRKGAMIFLAISTFIELLCVILYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYYR KAASEGSKTV ADLAAAGI   S+  DD    + +  K+L ++NID+A++L+
Sbjct  210   PIVKYYRRKAASEGSKTVVADLAAAGIQNLSDLSDDDSKNQMLRKKELLLQNIDHAVNLF  269

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LG WY  +LVA YN WDL  RY PL+K ++L++RK L 
Sbjct  270   LIYVLTLSIFPGFLYENTGQHGLGDWYALILVATYNFWDLFGRYAPLVKWLKLENRKALT  329

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IA+ +R+ L+P FYFTAKYGD+GWMIMLVS LGLT G+LTVC++T AP GYKGP  NALG
Sbjct  330   IAVLTRYFLVPAFYFTAKYGDKGWMIMLVSILGLTTGHLTVCIMTIAPNGYKGPEKNALG  389

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N+LV+ +L G   G++L WLWLIG  
Sbjct  390   NLLVVFILGGAVVGISLGWLWLIGKK  415



>ref|XP_006396630.1| hypothetical protein EUTSA_v10029389mg, partial [Eutrema salsugineum]
 gb|ESQ38083.1| hypothetical protein EUTSA_v10029389mg, partial [Eutrema salsugineum]
Length=410

 Score =   498 bits (1281),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 249/383 (65%), Positives = 312/383 (81%), Gaps = 2/383 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNS+LTIGDYYY++FP YHPSRVL  VY PFA+GTI IL+Y   K++TRKRN+ GY
Sbjct  30    SLVSWNSLLTIGDYYYRVFPDYHPSRVLIFVYLPFALGTILILSYHESKISTRKRNMIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + TF L++LDL T G GG+G Y GIC I+A FG+AD+ V+GG++GDLS MCPE +Q
Sbjct  90    ILFTVSTFLLIVLDLTTKGHGGIGPYTGICAIIALFGIADSAVRGGMIGDLSLMCPELIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF  GLA +G +TS  RL+TKAAFE S +GLRKG ++FLA+STF EFLC++LYA+VFPKL
Sbjct  150   SFTGGLAVAGVITSAFRLITKAAFEKSHDGLRKGAMIFLAISTFIEFLCVMLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IV YYR KAASEGSKTV+ADLA AGI   S+  DD  + ER+SN++L ++NIDYA++L+
Sbjct  210   PIVMYYRRKAASEGSKTVSADLAVAGIQ--SQLTDDDLNNERLSNRELLLQNIDYAVNLF  267

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             L+YV+TLSI PGFLYENTG H LG+WY  VL+A+ N WDL+ RY PL+K ++L++RKGL+
Sbjct  268   LVYVLTLSILPGFLYENTGQHGLGAWYALVLIAVCNWWDLVGRYAPLVKWLKLENRKGLV  327

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             +A+ +RFLL+P FYFTA+YGDQGWMIML+S  G +NGYLTVC+LT APK Y GP  NALG
Sbjct  328   VAVLARFLLVPAFYFTARYGDQGWMIMLISIFGFSNGYLTVCILTTAPKEYTGPEKNALG  387

Query  1081  NILVLCLLSGIFSGVALDWLWLI  1149
             N+LV+ +  G FSG AL WLWLI
Sbjct  388   NLLVIFITGGAFSGSALGWLWLI  410



>ref|XP_010422386.1| PREDICTED: equilibrative nucleotide transporter 4-like [Camelina 
sativa]
Length=416

 Score =   498 bits (1281),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 255/388 (66%), Positives = 316/388 (81%), Gaps = 2/388 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQ+FP YHPSRVLTLVYQP A+GT+ I AY   K++TRKR L GY
Sbjct  26    SLVSWNSMLTIADYYYQIFPDYHPSRVLTLVYQPIALGTVMIFAYHESKISTRKRVLTGY  85

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + TF L++LD+ T G GG+GNYI +C IVASFG+ADA V+GG++GDLS M PE +Q
Sbjct  86    ILFTISTFLLIVLDMATKGHGGIGNYIVLCTIVASFGLADATVKGGLIGDLSLMSPELIQ  145

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S++AG   +G LTS LRL+TKAAF+ S+N LRKG ++FLA+STF EFLC++LYA+VFPKL
Sbjct  146   SYMAGSGMAGVLTSVLRLITKAAFDKSNNHLRKGAMIFLAISTFIEFLCVMLYAYVFPKL  205

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHV--ERVSNKKLFMENIDYALD  714
              IVKYYR KAASEGSKTVAADLAAAGI   S+  DD  +   +R+S K+L ++NIDYA+ 
Sbjct  206   PIVKYYRTKAASEGSKTVAADLAAAGIQNQSDLSDDDSNSKNQRLSKKELLLQNIDYAVS  265

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+LIYV+TLSIFPGFLYENTG H LG+WY  +LVAMYN WDL+ RY+PL+  +++++RK 
Sbjct  266   LFLIYVLTLSIFPGFLYENTGQHGLGAWYALILVAMYNFWDLVGRYVPLVSWLKVENRKA  325

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             L IA+ SR+ L+P FYFTAKYGD+GWM+MLVS LGLT G+LTVC++T APKGYKGP  NA
Sbjct  326   LTIAVLSRYFLVPAFYFTAKYGDKGWMMMLVSVLGLTTGHLTVCIMTIAPKGYKGPEKNA  385

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNS  1158
             LGN+LV+ +L G   G++L WLWLIG  
Sbjct  386   LGNLLVVFILGGAVVGISLGWLWLIGKK  413



>ref|XP_008357821.1| PREDICTED: equilibrative nucleotide transporter 3-like [Malus 
domestica]
Length=416

 Score =   497 bits (1280),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 273/386 (71%), Positives = 323/386 (84%), Gaps = 2/386 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSM+TI DYY  LFP YHPSRVLT+VYQPFA+ TI +L+Y   K+NTRKRNL GYI
Sbjct  29    LFSWNSMITIVDYYVYLFPWYHPSRVLTVVYQPFAVLTIIVLSYHEAKINTRKRNLLGYI  88

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL +  +L+LDL TSGKGGLG +IGIC I A+FG+ADAHV GG+VGDLSFM  E +QS
Sbjct  89    LFFLSSLLVLVLDLATSGKGGLGTFIGICAISAAFGIADAHVLGGMVGDLSFMPGELIQS  148

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE+S NGLRKG ILF A+++FFE LCI+LYAF FPKL 
Sbjct  149   FLAGLAASGALTSALRLITKAAFENSQNGLRKGAILFFAITSFFELLCILLYAFSFPKLP  208

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVE--RVSNKKLFMENIDYALDL  717
             IV YYR+KAASEGSKTV+ADLAA GI   +E+ D+    E  R+ NK+L ++NIDYALD+
Sbjct  209   IVXYYRSKAASEGSKTVSADLAAGGIQTLAEATDEENPREPNRLGNKQLLLQNIDYALDI  268

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIY +TLSI PGFL E+TG+H+LG+WY  VL+A+YN+ DLI RYIPL+K ++L+SR+GL
Sbjct  269   FLIYTLTLSISPGFLSEDTGSHSLGTWYALVLIALYNVCDLIGRYIPLVKFLKLESRRGL  328

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             M  I SRFLL+PCFYFTAKYG+QGWMIML SFLGLTNGYLTVCVLT+APKGY+GP  NAL
Sbjct  329   MTVILSRFLLVPCFYFTAKYGEQGWMIMLTSFLGLTNGYLTVCVLTSAPKGYRGPEQNAL  388

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LVL LL GI +GV LDWLWLIG 
Sbjct  389   GNLLVLFLLGGILAGVLLDWLWLIGK  414



>ref|XP_004957997.1| PREDICTED: equilibrative nucleotide transporter 3-like [Setaria 
italica]
Length=418

 Score =   496 bits (1278),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 261/386 (68%), Positives = 321/386 (83%), Gaps = 2/386 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L  +NSMLTI DYY  LFPKYHP+RV+TL YQPF + T AI  Y   K+NTR RNLAGY 
Sbjct  31    LFGFNSMLTIEDYYMYLFPKYHPTRVITLTYQPFVLATTAIFTYHEAKVNTRLRNLAGYT  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL +FA +++D+ TSG+GG+  ++GIC+I A FG+AD HVQGG+ GDLS MCPEF+QS
Sbjct  91    LFFLSSFAAIIMDVATSGRGGIAPFLGICIIAAVFGIADGHVQGGMTGDLSLMCPEFIQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             F AGLAASG +TS LR VTKAAFE+S +GLR+GV+LF ++S FFE LC++LYAF+FPKL 
Sbjct  151   FFAGLAASGAITSALRFVTKAAFENSRDGLRRGVMLFSSISCFFELLCVLLYAFIFPKLP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPS-ESVDDAKHVERVSNKKLFMENIDYALDL  717
             IVKYYR+KAASEGS TV+ADLAA GI   P+ +S +D   VER+S K+L ++NIDYALD+
Sbjct  211   IVKYYRSKAASEGSLTVSADLAAGGIQNRPNPKSEEDPACVERLSTKQLLLQNIDYALDM  270

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIY++TLSIFPGFL E+TG+H+LGSWY  VL+A YN+WDLI RY+PLI++++L+SRKGL
Sbjct  271   FLIYILTLSIFPGFLAEDTGSHSLGSWYALVLIASYNVWDLIGRYVPLIEQIKLRSRKGL  330

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             ++A+ SR LLIP FY+TAKYGDQGWMIML S LGL+NGYLTVC+LT APKGYKGP  NAL
Sbjct  331   LVAVVSRLLLIPAFYYTAKYGDQGWMIMLTSLLGLSNGYLTVCILTEAPKGYKGPEQNAL  390

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LVLCLL GIF G  LDW+WLIG 
Sbjct  391   GNLLVLCLLGGIFCGAVLDWVWLIGK  416



>ref|XP_008813360.1| PREDICTED: equilibrative nucleotide transporter 3-like, partial 
[Phoenix dactylifera]
Length=383

 Score =   494 bits (1271),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 254/354 (72%), Positives = 301/354 (85%), Gaps = 2/354 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL +WNSMLTI DYY  LFP+YHP+RVLTLVYQPFA+GT+AILAY   KLNTRKRNL GY
Sbjct  30    SLFAWNSMLTIEDYYIYLFPRYHPTRVLTLVYQPFALGTVAILAYNEAKLNTRKRNLIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFFL +  L++LD+ TSGKGG+G +IG+C I A+FGVADAHVQGG+VGDL  MC EF Q
Sbjct  90    TLFFLSSLLLIVLDVATSGKGGIGVFIGVCAISAAFGVADAHVQGGMVGDLFLMCSEFNQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFLAGLAASG LTS LRL+TKAAFE+S +GLRKG ++F A+S FFE L ++LYAF+FPK+
Sbjct  150   SFLAGLAASGALTSALRLITKAAFENSQDGLRKGAMMFFAISGFFELLSVLLYAFIFPKV  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSE--SVDDAKHVERVSNKKLFMENIDYALD  714
              IVKYYR KAA+EGS TV+ADLAAAGI       + +D K  ER++NK+L ++NIDYA+D
Sbjct  210   PIVKYYRLKAAAEGSMTVSADLAAAGIQKQRHQGAEEDPKLSERLTNKQLLLQNIDYAID  269

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             +YLIYV+TLSIFPGFL E+TG+H+LGSWY  VL+AMYN+WDLI RY+PL+K ++L SRKG
Sbjct  270   VYLIYVLTLSIFPGFLSEDTGSHSLGSWYALVLIAMYNVWDLIGRYLPLLKWLKLTSRKG  329

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYK  1056
             LM+AI SRFL IP FYFTAKYGDQGWMIML SFLGL+NGYLTVCVLTAAPKGYK
Sbjct  330   LMVAILSRFLFIPAFYFTAKYGDQGWMIMLTSFLGLSNGYLTVCVLTAAPKGYK  383



>gb|EPS58927.1| hypothetical protein M569_15884, partial [Genlisea aurea]
Length=370

 Score =   493 bits (1270),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 251/352 (71%), Positives = 296/352 (84%), Gaps = 0/352 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             +LVSWNSMLTI DYYY++FPKYHPSRVLTLVYQPFA+GT+ IL Y   +++TR RNL GY
Sbjct  19    ALVSWNSMLTISDYYYEVFPKYHPSRVLTLVYQPFALGTMVILTYNEARVDTRIRNLFGY  78

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF L T  +LL+D+GTSGKGG+ NYIGICV+VA+FG+ADA VQGG++GDLSFM PEF+Q
Sbjct  79    ILFCLSTLGILLIDVGTSGKGGIANYIGICVLVAAFGIADAFVQGGMIGDLSFMSPEFIQ  138

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLAASG LTSGLRL+TKAAF+   NGLRKGV+LFL +ST F+ +CI LYAFVF KL
Sbjct  139   SFIAGLAASGALTSGLRLMTKAAFDKQRNGLRKGVVLFLLISTVFQLVCIFLYAFVFGKL  198

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             +IVKY+R KAA EGSKTV+ADLAA GI     +       ER++NK+L   NIDYALD+Y
Sbjct  199   SIVKYFRKKAAFEGSKTVSADLAAVGIHPSDTTTVKEIKCERLTNKELLFRNIDYALDIY  258

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
              IYV+TLSIFPGFLYENTG H LGSWYP VL+AMYN++DLI RYIPLI  ++L+ R GLM
Sbjct  259   AIYVLTLSIFPGFLYENTGAHQLGSWYPVVLIAMYNVFDLIGRYIPLINSIKLEHRYGLM  318

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYK  1056
             IA  +RF L+PCFYFTAKYGDQGWM+ LVSFLG++NGYLTVCVLT APKGYK
Sbjct  319   IACFARFFLVPCFYFTAKYGDQGWMLFLVSFLGISNGYLTVCVLTGAPKGYK  370



>ref|NP_001059966.1| Os07g0557200 [Oryza sativa Japonica Group]
 dbj|BAD30918.1| putative equilibrative nucleoside transporter ENT8 splice variant 
[Oryza sativa Japonica Group]
 dbj|BAF21880.1| Os07g0557200 [Oryza sativa Japonica Group]
 dbj|BAG94913.1| unnamed protein product [Oryza sativa Japonica Group]
Length=418

 Score =   494 bits (1273),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 264/386 (68%), Positives = 317/386 (82%), Gaps = 2/386 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L  +NSMLTI DYY  LFP YHP+RV+TL YQPF + T AI  Y   K+NTR RNLAGY 
Sbjct  31    LFGFNSMLTIEDYYTFLFPNYHPTRVVTLTYQPFVLRTTAIFTYHEAKVNTRLRNLAGYT  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL +FA ++LD+ TSG+GG+  ++G+C+I A+FGVAD HVQGG+ GDLS MCPEF+QS
Sbjct  91    LFFLSSFAAIVLDVATSGRGGITPFVGVCIIAAAFGVADGHVQGGMTGDLSLMCPEFIQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             F AGLAASG +TS LRL+TKAAFE+S +GLRKG +LF ++S FFE LC++LYAF+FPKL 
Sbjct  151   FFAGLAASGMITSALRLITKAAFENSRDGLRKGAMLFSSISCFFELLCVLLYAFIFPKLP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGIT--APSESVDDAKHVERVSNKKLFMENIDYALDL  717
             IVK+YR+KAASEGS TVAADLAA GI   A   S +D   VER+S K+L ++N DYALDL
Sbjct  211   IVKFYRSKAASEGSLTVAADLAAGGIQNRANPLSEEDPSCVERLSTKQLLLQNTDYALDL  270

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIY++TLSIFPGFL ENTG+H+LGSWY  VL+A YN+WDLI RYIPLI++V+L+SRK +
Sbjct  271   FLIYLLTLSIFPGFLAENTGSHSLGSWYALVLIASYNVWDLIGRYIPLIEQVKLRSRKVI  330

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             +IA+ SRFLLIP FY+TAKY DQGWMIML SFLGL+NGYLTVC+LT APKGYKGP  NAL
Sbjct  331   LIAVVSRFLLIPAFYYTAKYSDQGWMIMLTSFLGLSNGYLTVCILTEAPKGYKGPEQNAL  390

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LVL LL GIF G  LDWLWLIG 
Sbjct  391   GNLLVLSLLGGIFCGAILDWLWLIGK  416



>ref|XP_010455847.1| PREDICTED: equilibrative nucleotide transporter 4-like isoform 
X1 [Camelina sativa]
 ref|XP_010455848.1| PREDICTED: equilibrative nucleotide transporter 4-like isoform 
X1 [Camelina sativa]
Length=411

 Score =   493 bits (1269),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 252/385 (65%), Positives = 307/385 (80%), Gaps = 7/385 (2%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQ+FP YHPSRVLTLVYQP A+GT+ I AY   K++TRKR L GY
Sbjct  30    SLVSWNSMLTIADYYYQIFPDYHPSRVLTLVYQPIALGTVMIFAYHESKISTRKRVLTGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + TF L++LDL T G GG+GNYI +C IVASFG+AD  V+GG++GDLS M PE +Q
Sbjct  90    ILFTISTFLLIVLDLATKGHGGIGNYIVLCTIVASFGLADTTVKGGLIGDLSLMSPELIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             S++AGL  +G LTS LRL+TKAAFE S+N LRKG ++FLA+STF EFLC++LYA+VFPKL
Sbjct  150   SYMAGLGMAGVLTSVLRLITKAAFEKSNNHLRKGAMIFLAISTFIEFLCVMLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYYR KAASEGSKTVAADLAAAGI   S+  DD    +R+S K+L ++NI YA+ L+
Sbjct  210   PIVKYYRTKAASEGSKTVAADLAAAGIQNQSDLSDDDSKNQRLSKKELLLQNIGYAVSLF  269

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIYV+TLSIFPGFLYENTG H LG WY  +LVAMYN WDL+ RY+PL+  +++++RK L 
Sbjct  270   LIYVLTLSIFPGFLYENTGQHGLGVWYALILVAMYNFWDLVGRYVPLVNSLKVENRKALT  329

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IA+ SR+ L+P FYFTAKYGD+GWM+MLVS LGLT G+LT       PKGYKGP  NALG
Sbjct  330   IAVLSRYFLVPAFYFTAKYGDKGWMMMLVSVLGLTTGHLT-------PKGYKGPEKNALG  382

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LV+ +L G   G++L WLWLIG 
Sbjct  383   NLLVVFILGGAVVGISLGWLWLIGK  407



>emb|CDY59576.1| BnaAnng16090D [Brassica napus]
Length=418

 Score =   492 bits (1267),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 247/385 (64%), Positives = 304/385 (79%), Gaps = 0/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             LV+WNS+LTI DYYY +FP YHPSRVLTLVYQPFA+ T+ ILAY   K+NTRKRN+ GY 
Sbjct  31    LVAWNSLLTIADYYYHVFPDYHPSRVLTLVYQPFALVTVVILAYHESKINTRKRNMIGYT  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             +F + T  L+ LDL T G+GG+G Y+G+C IVAS G+ADA VQGG++GDLS MCPE +QS
Sbjct  91    IFTISTLLLIALDLATKGRGGIGPYLGLCTIVASLGLADATVQGGMIGDLSLMCPELIQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             ++AGL  +G LTS  RL+TKAAFE+S+ GLRKG ++FL +S   +FLC++LYA+VFPKL 
Sbjct  151   YMAGLGVAGALTSAFRLMTKAAFENSNGGLRKGALIFLTISALIQFLCVMLYAYVFPKLP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYL  723
             IVKYYR KAASEGSKTV ADLAAAGI +PS   DD    +R++ K++  +NIDYA++L L
Sbjct  211   IVKYYRRKAASEGSKTVTADLAAAGIKSPSYLTDDVSSYQRLNKKEILHQNIDYAMNLSL  270

Query  724   IYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMI  903
              Y+++LSIFPGFLYENTG H LGSWY  VLVAMYN  +LI RY PL+K +  ++RK + I
Sbjct  271   TYILSLSIFPGFLYENTGQHGLGSWYALVLVAMYNCGNLIGRYTPLVKWLMFENRKWITI  330

Query  904   AIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGN  1083
             A  SRFLLIP FYFTAKYGDQGWMIMLV+FLG T G+L VC+L  APKGYKGP  NALGN
Sbjct  331   ATLSRFLLIPAFYFTAKYGDQGWMIMLVTFLGWTTGHLNVCILIIAPKGYKGPEKNALGN  390

Query  1084  ILVLCLLSGIFSGVALDWLWLIGNS  1158
             +LV+ +  GI  G +L WLWLIG +
Sbjct  391   LLVVFVTGGIVVGTSLGWLWLIGKN  415



>emb|CAN67514.1| hypothetical protein VITISV_012081 [Vitis vinifera]
Length=697

 Score =   502 bits (1292),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 274/399 (69%), Positives = 313/399 (78%), Gaps = 15/399 (4%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAI---GTIAILAYKGEKLNTRKRNL  171
             SLVSWNSMLTIGDYYY LFP+YHPSRVLTLVYQP      GT ++   K          +
Sbjct  30    SLVSWNSMLTIGDYYYNLFPRYHPSRVLTLVYQPICSWYNGTTSLQRGKDRHPKEEPSRI  89

Query  172   AGYIlfflgtfal----------llldlgtsgkgglgNYIGICVIVASFGVADAHVQGGI  321
               ++   L   +             LDL TSG+GG+  YIGICVIV +FGVADAHVQGG+
Sbjct  90    YSFLCKHLFACSKLQFTYYYLQPAQLDLATSGRGGIAPYIGICVIVGAFGVADAHVQGGM  149

Query  322   VGDLSFMCPEFLQSFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEF  501
             VGDLSFMCPEF+QSFLAGLAASG LTS LRL+TKAAF+ S+ G RKG +LFL +STF EF
Sbjct  150   VGDLSFMCPEFIQSFLAGLAASGALTSALRLMTKAAFDKSAGGERKGAMLFLGISTFLEF  209

Query  502   LCIILYAFVFPKLAIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNK  678
             LCIILYAF FPKL IVK+YR KAA EGSKTV+ADLA  GI T  S+ VDD K  ER+SNK
Sbjct  210   LCIILYAFFFPKLPIVKHYRRKAALEGSKTVSADLAVVGIQTQQSQEVDDTKQQERLSNK  269

Query  679   KLFMENIDYALDLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIP  858
             +LF +NIDYAL+L+LIYV+TLSIFPGFL+ENTG H LGSWYP VL+AMYN+WD ISRYIP
Sbjct  270   QLFFQNIDYALELFLIYVLTLSIFPGFLFENTGKHQLGSWYPLVLIAMYNVWDFISRYIP  329

Query  859   LIKKVELKSRKGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTA  1038
             L+K + L  RKGLM+ +  RFLLIP FYFTAKYGDQGWMIML SFLG++NGYLTVC+LT 
Sbjct  330   LVKCLRL-PRKGLMVGVLVRFLLIPAFYFTAKYGDQGWMIMLTSFLGVSNGYLTVCILTN  388

Query  1039  APKGYKGPAANALGNILVLCLLSGIFSGVALDWLWLIGN  1155
             APKGYKGP  NALGN+LVLCLL GIF+GVALDWLWLI +
Sbjct  389   APKGYKGPEQNALGNLLVLCLLGGIFAGVALDWLWLIDD  427



>gb|KEH36499.1| equilibrative nucleoside transporter 6 [Medicago truncatula]
Length=373

 Score =   490 bits (1261),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 258/371 (70%), Positives = 302/371 (81%), Gaps = 3/371 (1%)
 Frame = +1

Query  61    KYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYIlfflgtfalllldlgtsgk  240
             ++   R L L + P AIGTI IL Y   K+NTR RNLAG+ LFF  TF +L+LDL TSG+
Sbjct  3     QHVDHRRLLLQFVPVAIGTIVILTYYESKINTRLRNLAGFTLFFAATFLVLILDLATSGR  62

Query  241   gglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSFLAGLAASGTLTSGLRLVT  420
             GG+G YIGICV+VA FG+ADAH++GG+VGDL FMCPEF+QS+LAGL+ASG L S LR++T
Sbjct  63    GGIGPYIGICVLVACFGIADAHIEGGMVGDLYFMCPEFVQSYLAGLSASGALISLLRMLT  122

Query  421   KAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAIVKYYRAKAASEGSKTVAA  600
             K AFE S NGLRKG +LF A+S F EFLCI LYA  F KL IVKYYR+KAASEGSKTVAA
Sbjct  123   KFAFEKSHNGLRKGALLFFAISAFIEFLCIFLYAIYFTKLPIVKYYRSKAASEGSKTVAA  182

Query  601   DLAAAGI---TAPSESVDDAKHVERVSNKKLFMENIDYALDLYLIYVVTLSIFPGFLYEN  771
             DLAAAGI   T   ++  D K +ER+S K+LF++NIDYA DL LIYVVTLSIFPGFLYEN
Sbjct  183   DLAAAGIQTKTINDQAEYDNKQMERLSTKQLFLDNIDYAADLVLIYVVTLSIFPGFLYEN  242

Query  772   TGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQSRFLLIPCFYFTA  951
             TGTH LG+WYP VL+AMYN+ D I+RYIPL+  ++L+SRKGLMIA  SRFLL+P FYFTA
Sbjct  243   TGTHQLGTWYPIVLIAMYNVVDFIARYIPLVPWLKLESRKGLMIATLSRFLLVPAFYFTA  302

Query  952   KYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGNILVLCLLSGIFSGVAL  1131
             KYGDQGWMI L SFLGLTNGYLTVCV+T AP+GYKGP  NALGN+LVLCLL+GIF+G  L
Sbjct  303   KYGDQGWMIFLTSFLGLTNGYLTVCVMTVAPRGYKGPEQNALGNVLVLCLLTGIFTGAVL  362

Query  1132  DWLWLIGNSGF  1164
             DWLW+IG   F
Sbjct  363   DWLWIIGKDSF  373



>gb|KHN22884.1| Equilibrative nucleoside transporter 4 [Glycine soja]
Length=459

 Score =   493 bits (1268),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 256/352 (73%), Positives = 299/352 (85%), Gaps = 1/352 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L +WNSMLTI DYY  LFPKYHPSRVLTLVYQPFA+GT+AILAYK +++NTR RNL GY 
Sbjct  53    LFAWNSMLTIEDYYVYLFPKYHPSRVLTLVYQPFAVGTLAILAYKEDRINTRIRNLFGYT  112

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ T ++L+LDL TSGKGGLG +IGICVI  +FG+ADAH QGG+VGDLS+M PEF+QS
Sbjct  113   LFFISTLSILILDLATSGKGGLGTFIGICVISGAFGIADAHTQGGMVGDLSYMLPEFIQS  172

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE+S NGLRKG I+F A+STFFE LC++LYAFVFPKL 
Sbjct  173   FLAGLAASGALTSALRLITKAAFENSKNGLRKGAIMFFAISTFFELLCVLLYAFVFPKLP  232

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDD-AKHVERVSNKKLFMENIDYALDLY  720
             IVKYYR+KAASEGSKTV+ADLAA GI  PS   +   K ++R  NKKL +ENIDYALDL+
Sbjct  233   IVKYYRSKAASEGSKTVSADLAAGGIQIPSGRANQYEKEIDRKGNKKLLLENIDYALDLF  292

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIY +TLSIFPGFL E+TG+H+LG+WY  VL+AMYN+ DLI RYIPL+K ++L+SRK L 
Sbjct  293   LIYALTLSIFPGFLSEDTGSHSLGTWYALVLIAMYNVCDLIGRYIPLLKFLKLESRKKLT  352

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYK  1056
              AI SR L +P FYFTAKYG QGWMIML SFLGL+NGY TVCVLT+APKGYK
Sbjct  353   TAIVSRLLFVPAFYFTAKYGTQGWMIMLTSFLGLSNGYFTVCVLTSAPKGYK  404



>ref|XP_009112695.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Brassica rapa]
Length=394

 Score =   490 bits (1261),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 250/359 (70%), Positives = 296/359 (82%), Gaps = 7/359 (2%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLVSWNSMLTI DYYYQ+FP YHPSRVLTLVYQPFA+GTI ILAY   K+NTRKRNL GY
Sbjct  30    SLVSWNSMLTIADYYYQIFPDYHPSRVLTLVYQPFALGTILILAYHESKINTRKRNLFGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + TF L++LD  T G GG+G YIG+C IVASFG+ADA VQGG++GDL+ MCPE +Q
Sbjct  90    ILFTISTFLLIILDFLTKGHGGIGPYIGLCAIVASFGLADATVQGGMIGDLALMCPELIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+ GLA +G LTS LRL+TKAAF++S++G RKG ++FLA+STF EFLC++ YA+VFPKL
Sbjct  150   SFMGGLAVAGALTSALRLITKAAFDNSNDGQRKGAMIFLAISTFIEFLCVLHYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSE-------SVDDAKHVERVSNKKLFMENI  699
              IVKYYR KAASEGSKTV+ADLAAAGI   S+         DD    +R+SNK+L ++NI
Sbjct  210   PIVKYYRRKAASEGSKTVSADLAAAGIQNQSDVLLDSSMGTDDDSKNQRLSNKELLLQNI  269

Query  700   DYALDLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVEL  879
             DYAL+L LIYV+TLSIFPGFLYENTG H LG WY  VLVAMYN WDLI RY PL+K ++L
Sbjct  270   DYALNLALIYVLTLSIFPGFLYENTGQHGLGPWYTLVLVAMYNSWDLIGRYTPLVKWLKL  329

Query  880   KSRKGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYK  1056
             ++RKGL +A+ SR+ LIP FYFTAKY DQGWMIML S LGLTNG+LTVC+L+AAPKGYK
Sbjct  330   ENRKGLTVAVLSRYFLIPAFYFTAKYADQGWMIMLTSVLGLTNGHLTVCILSAAPKGYK  388



>ref|XP_010315560.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Solanum lycopersicum]
Length=425

 Score =   491 bits (1263),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 257/354 (73%), Positives = 302/354 (85%), Gaps = 3/354 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP YH SRVLTL+YQPFA+GT+A+LAY   K+NTRKRNL GY 
Sbjct  30    LFSWNSMLTIQDYYVALFPNYHSSRVLTLIYQPFALGTLAMLAYNEAKINTRKRNLFGYS  89

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ TF +LLLDL TS KGGLG++IGICVI  +FGVADAHVQGG++GDLSFM PEFLQS
Sbjct  90    LFFIATFIVLLLDLATSAKGGLGSFIGICVISGAFGVADAHVQGGMIGDLSFMLPEFLQS  149

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTS LRL+TKAAFE+S +GLRKG ILF A+ST FE LC++LYAFVFPKL 
Sbjct  150   FLAGLAASGALTSSLRLITKAAFENSQDGLRKGAILFFAISTLFELLCVLLYAFVFPKLP  209

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI--TAP-SESVDDAKHVERVSNKKLFMENIDYALD  714
             IVKYYRAKAASEGSKTVA+DLAAAG+    P +++  D + VER++NK+L ++NIDYA+D
Sbjct  210   IVKYYRAKAASEGSKTVASDLAAAGVYKQGPDTKNEHDPQQVERLNNKELLLQNIDYAID  269

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+LIY +TLSIFPGFL E+TG+H+LGSWY  VL+AMYN+WDLI RYIPLIK ++L+SRKG
Sbjct  270   LFLIYALTLSIFPGFLSEDTGSHSLGSWYALVLIAMYNVWDLIGRYIPLIKCLKLESRKG  329

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYK  1056
             LM+ I  R L +P FYFTAKYGDQGWMIML S LGL+NG+LTVCVLT APKG +
Sbjct  330   LMVVILLRSLFVPAFYFTAKYGDQGWMIMLTSLLGLSNGHLTVCVLTCAPKGTR  383



>ref|XP_006657825.1| PREDICTED: equilibrative nucleotide transporter 3-like [Oryza 
brachyantha]
Length=413

 Score =   490 bits (1262),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 266/386 (69%), Positives = 314/386 (81%), Gaps = 2/386 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L  +NSMLTI DYY  LFPKYHP+RV+TL YQPF + T AI  Y   K+NTR RNLAGY+
Sbjct  26    LFGFNSMLTIEDYYTFLFPKYHPTRVVTLTYQPFVLTTTAIFTYHEAKVNTRLRNLAGYM  85

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL +FA ++LD+ TSGKGG+  ++G+C+I A+FGVAD HVQGG+ GDLS MCPEF+QS
Sbjct  86    LFFLSSFAAIILDVATSGKGGIAPFVGVCIIAAAFGVADGHVQGGMTGDLSLMCPEFIQS  145

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             F AGLAASG +TS LRL+TKAAFE+S +GLRKG +LF ++S FFE LC++LYAFVFPKL 
Sbjct  146   FFAGLAASGMITSALRLITKAAFENSRDGLRKGAMLFSSISCFFELLCVLLYAFVFPKLP  205

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSE-SVDDAKHVERVSNKKLFMENIDYALDL  717
             IVK+YR+KAASEGS TVAADLAA GI   P+  S +D   VER S K+L  +N DYALDL
Sbjct  206   IVKFYRSKAASEGSLTVAADLAAGGIQNRPNPLSEEDPSCVERWSTKQLLFQNTDYALDL  265

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIY++TLSIFPGFL ENTG+H+LGSWY  VL+A YN+WDLI RYIPLI+ V+L+SRK L
Sbjct  266   FLIYILTLSIFPGFLAENTGSHSLGSWYALVLIASYNVWDLIGRYIPLIEHVKLRSRKCL  325

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             +IA  SRF LIP  Y+TAKY DQGWMIML SFLGL+NGYLTVC+LT APKGYKGP  NAL
Sbjct  326   LIAAVSRFFLIPALYYTAKYSDQGWMIMLTSFLGLSNGYLTVCILTEAPKGYKGPEQNAL  385

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LVL LL GIF G  LDWLWLIG 
Sbjct  386   GNLLVLSLLGGIFCGAILDWLWLIGK  411



>ref|XP_009114505.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Brassica rapa]
Length=418

 Score =   489 bits (1259),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 245/388 (63%), Positives = 305/388 (79%), Gaps = 1/388 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             LV+WNS+LTI DYYY +FP YHPSRVLTLVYQPFA+ T+ ILAY   K+NTRKRN+ GY 
Sbjct  31    LVAWNSLLTIADYYYHVFPNYHPSRVLTLVYQPFALVTVVILAYHESKINTRKRNMIGYT  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             +F + +  L++LDL T G+GG+  Y+G+C IVAS G+ADA VQGG++GDLS MCPE +QS
Sbjct  91    IFTISSLLLIVLDLATKGRGGIEPYLGLCTIVASLGLADATVQGGMIGDLSLMCPELIQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             ++AGL  +G LTS  RL+TKAAFE+S+ GLRKG ++FL +S   +FLC++LYA+VFPKL 
Sbjct  151   YMAGLGVAGALTSAFRLMTKAAFENSNGGLRKGALIFLTISALIQFLCVMLYAYVFPKLP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYL  723
             IVKYYR KAASEGSKTV ADLAAAGI +PS   DD    +R++ K++  +NIDYA++L L
Sbjct  211   IVKYYRRKAASEGSKTVTADLAAAGIKSPSYLTDDVSSYQRLNKKEILHQNIDYAMNLSL  270

Query  724   IYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMI  903
              Y+++LSIFPGFLYENTG H LGSWY  VLVAMYN  +LI RY PL+K +  ++RK + I
Sbjct  271   TYILSLSIFPGFLYENTGQHGLGSWYALVLVAMYNCGNLIGRYTPLVKWLMFENRKWITI  330

Query  904   AIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGN  1083
             A  SRFLLIP FYFTAKYGDQGWMIMLV+FLG T G++ VC+L  APK YKGP  NALGN
Sbjct  331   ATLSRFLLIPAFYFTAKYGDQGWMIMLVTFLGWTTGHINVCILIIAPKDYKGPEKNALGN  390

Query  1084  ILVLCLLSGIFSGVALDWLWLIG-NSGF  1164
             +LV+ +  GI  G +L WLWLIG N+ F
Sbjct  391   LLVVFVTGGIVVGTSLGWLWLIGKNNAF  418



>gb|KFK32223.1| hypothetical protein AALP_AA6G213800 [Arabis alpina]
Length=421

 Score =   489 bits (1258),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 248/386 (64%), Positives = 308/386 (80%), Gaps = 0/386 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             +LVSW S+LT+GDYYYQ+FP YHP+RVLT VY PFA+G I +L+Y   K++TRKRNL GY
Sbjct  33    NLVSWYSLLTVGDYYYQVFPDYHPARVLTFVYTPFALGAIMVLSYYESKISTRKRNLTGY  92

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + +F L++LDL T G GG+G YIGIC I+A  G+ DA V+GG++GDLS MCPE +Q
Sbjct  93    ILFTISSFLLIVLDLTTKGHGGIGPYIGICAIIALLGIGDAVVRGGMLGDLSLMCPELIQ  152

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGL  +G LTS  RL+TKAAF  S +GLRKG I+FLA+STF EFLC+ILYA+VFPKL
Sbjct  153   SFTAGLGVAGVLTSAFRLITKAAFAKSDDGLRKGAIIFLAISTFIEFLCVILYAYVFPKL  212

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYYR KAASEGSKTV+ADLAA GI + S+  DD    +R+SNK+LF+E+ DYA +L+
Sbjct  213   PIVKYYRKKAASEGSKTVSADLAAGGIQSQSDLSDDDSGNQRLSNKELFLESRDYATNLF  272

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             L Y +T+SI PGFLYENTG H LG WY  VL+A+ N WDL+ RY PL+K +++++RKGL 
Sbjct  273   LTYALTMSILPGFLYENTGQHGLGEWYALVLIAVGNCWDLVGRYAPLVKWLKVENRKGLT  332

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             I + SR+LL+P FYFTAKYGDQGWMIML+S  G TNGYLTVC+LT APKGYKGP  NALG
Sbjct  333   ITVLSRYLLVPAFYFTAKYGDQGWMIMLISVFGFTNGYLTVCILTIAPKGYKGPEKNALG  392

Query  1081  NILVLCLLSGIFSGVALDWLWLIGNS  1158
             N++V+ + +G F+G AL WLWLIG  
Sbjct  393   NLMVIFIAAGAFAGSALGWLWLIGKE  418



>ref|XP_002518004.1| nucleoside transporter, putative [Ricinus communis]
 gb|EEF44522.1| nucleoside transporter, putative [Ricinus communis]
Length=406

 Score =   488 bits (1256),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 269/386 (70%), Positives = 313/386 (81%), Gaps = 15/386 (4%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLTI DYY  LFP             PFA GT+++LAY   KLNTRKRNL GY 
Sbjct  32    LFSWNSMLTIEDYYSFLFP-------------PFAFGTLSVLAYNEAKLNTRKRNLFGYN  78

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ +  +L+LDL TSG+GGLG +IGIC I  +FGVADAHVQGG++GDLS+M PEFLQS
Sbjct  79    LFFISSLLVLILDLATSGRGGLGTFIGICAISGAFGVADAHVQGGMIGDLSYMQPEFLQS  138

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAG+AASGTLTSGLRL+TKAAFE+S NGLRKG ILF A+S FFE LC+ LYA  FPKL 
Sbjct  139   FLAGMAASGTLTSGLRLITKAAFENSKNGLRKGAILFFAISAFFELLCVFLYAHAFPKLP  198

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITA--PSESVDDAKHVERVSNKKLFMENIDYALDL  717
             IVKYYR+KAA+EGSKTV+ADLAA G+ A    E+ +D K +ER+ NK L ++NIDYA+DL
Sbjct  199   IVKYYRSKAAAEGSKTVSADLAAGGLRALPQQEAEEDPKRLERLGNKDLLLQNIDYAIDL  258

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
              LIYV+TLSIFPGFL E+TG+H+LG+WY  VL+AMYN+ DLI R IPLIK ++L+SRKGL
Sbjct  259   LLIYVLTLSIFPGFLSEDTGSHSLGTWYALVLIAMYNVCDLIGRNIPLIKSLKLESRKGL  318

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             MIA+ SRFLLIP FYFTAKY DQGWMIML SFLG+TNGYLTVCVLT+APKGYKGP  NAL
Sbjct  319   MIAVLSRFLLIPAFYFTAKYADQGWMIMLTSFLGITNGYLTVCVLTSAPKGYKGPEQNAL  378

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+L L LL GIF+G  LDWLWLIG 
Sbjct  379   GNLLTLFLLGGIFAGNVLDWLWLIGK  404



>emb|CDY46380.1| BnaA09g19940D [Brassica napus]
Length=418

 Score =   487 bits (1254),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 246/388 (63%), Positives = 305/388 (79%), Gaps = 1/388 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             LV+WNS+LTI DYYY +FP YHPSRVLTLVYQPFA+ T+ ILAY   K+NTRKRN+ GY 
Sbjct  31    LVAWNSLLTIADYYYHVFPDYHPSRVLTLVYQPFALVTVVILAYHESKINTRKRNMIGYT  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             +F + +  L++LDL T G+GG+G Y+G+C IVAS G+ADA VQ G++GDLS MCPE +QS
Sbjct  91    IFTISSLLLIVLDLATKGRGGIGPYLGLCTIVASLGLADATVQRGMIGDLSLMCPELIQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             ++AGL  +G LTS  RL+TKAAFE+S+ GLRKG ++FL +S   +FLC++LYA+VFPKL 
Sbjct  151   YMAGLGVAGALTSAFRLMTKAAFENSNGGLRKGALIFLTISALIQFLCVMLYAYVFPKLP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYL  723
             IVKYYR KAASEGSKTV ADLAAAGI +PS   DD    + ++ K++  +NIDYA++L L
Sbjct  211   IVKYYRRKAASEGSKTVTADLAAAGIKSPSYLTDDVSSYQSLNKKEILHQNIDYAMNLSL  270

Query  724   IYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMI  903
              Y+++LSIFPGFLYENTG H LGSWY  VLVAMYN  +LI RY PL+K +  ++RK + I
Sbjct  271   TYILSLSIFPGFLYENTGQHGLGSWYALVLVAMYNCGNLIGRYTPLVKWLRFENRKWITI  330

Query  904   AIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGN  1083
             A  SRFLLIP FYFTAKYGDQGWMIMLV+FLG T G+L VC+L  APKGYKGP  NALGN
Sbjct  331   ATLSRFLLIPAFYFTAKYGDQGWMIMLVTFLGWTTGHLNVCILIIAPKGYKGPEKNALGN  390

Query  1084  ILVLCLLSGIFSGVALDWLWLIG-NSGF  1164
             +LV+ +  GI  G +L WLWLIG N+ F
Sbjct  391   LLVVFVTGGIVVGTSLGWLWLIGKNNAF  418



>ref|XP_004309571.1| PREDICTED: equilibrative nucleotide transporter 3-like [Fragaria 
vesca subsp. vesca]
Length=433

 Score =   486 bits (1251),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 249/384 (65%), Positives = 309/384 (80%), Gaps = 2/384 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             +L +WNS++TIGDYYY LFPKYHPSRVLTL+YQPFA+  +A LAY   K+NT+KR LAGY
Sbjct  47    TLFAWNSVVTIGDYYYILFPKYHPSRVLTLIYQPFALIAMAALAYNEAKVNTQKRILAGY  106

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              +FFLGT  L+++DL TSG GG+  YIGIC IV + GVA AHV+GGIVGDLSFMCPEF+Q
Sbjct  107   SIFFLGTLMLIVVDLATSGSGGVRPYIGICAIVGALGVAGAHVEGGIVGDLSFMCPEFIQ  166

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFL+GLAA+G LTS +RL+TKA F+  +NGLRKG +LFL++STF + +CI+LYA  FP+L
Sbjct  167   SFLSGLAAAGALTSVMRLITKALFDKYNNGLRKGAMLFLSISTFIQLVCILLYAIYFPRL  226

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI--TAPSESVDDAKHVERVSNKKLFMENIDYALD  714
              IVKYYR+KAASEGSKTV+ADLA AGI   A  E  ++A  ++R+SNK+LF +N+DY L 
Sbjct  227   PIVKYYRSKAASEGSKTVSADLATAGIQTNADIEVQNNAARLQRLSNKQLFKQNLDYGLG  286

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+L Y +TLSIFPGFLYENT  H LGSWYP VL+ +YN  DL SRYIPL+K + ++SRKG
Sbjct  287   LFLTYALTLSIFPGFLYENTQNHKLGSWYPLVLITVYNAVDLASRYIPLVKCLTMESRKG  346

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             LMI I  R L +P FYFTAKYGD GWM+ML S LG +NGY TVCV+  AP+GY+G   NA
Sbjct  347   LMIGILLRMLFVPAFYFTAKYGDLGWMMMLTSLLGFSNGYFTVCVMIVAPRGYQGSEQNA  406

Query  1075  LGNILVLCLLSGIFSGVALDWLWL  1146
             LGN+LVL L  G+F+G+++DWLWL
Sbjct  407   LGNLLVLWLFFGVFAGLSIDWLWL  430



>ref|XP_010646356.1| PREDICTED: equilibrative nucleotide transporter 3 [Vitis vinifera]
 emb|CBI40864.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   484 bits (1245),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 254/389 (65%), Positives = 305/389 (78%), Gaps = 4/389 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             S VSWN+ML IGDYYY+LFP+YHP RVLT++ Q FAIG++AIL YK    NT KRN+ GY
Sbjct  11    SAVSWNTMLIIGDYYYKLFPRYHPERVLTVICQTFAIGSMAILTYKEAITNTPKRNIIGY  70

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LF + T  L++LDL TSG+GG+G YIGICVIV +FGVA A VQGG  GDLSFM PEF++
Sbjct  71    TLFCVSTLILIVLDLATSGQGGIGPYIGICVIVVAFGVATALVQGGGTGDLSFMSPEFVR  130

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGLAASG LTS LRL+TKA F  S +G R G +LFL +  F   LC  L AF+FPKL
Sbjct  131   SFIAGLAASGVLTSALRLMTKAVFGKSDDGERNGAMLFLGIPAFVGLLCTFLCAFIFPKL  190

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDL  717
             + VKYYR KAASEGS+TV+ADLA  GI T  S++ DD +  ER+SNK+LF +NIDYAL+ 
Sbjct  191   STVKYYRMKAASEGSQTVSADLAVVGIQTEQSQAGDDTQ--ERLSNKQLFFQNIDYALEA  248

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +L ++VTLSIFPGFL+ENTG H LGSWYP VL+ ++N+WD+ISRY P++K + L  R+GL
Sbjct  249   FLGHLVTLSIFPGFLFENTGKHQLGSWYPLVLITVFNVWDMISRYFPVVKCLRLP-RRGL  307

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             M+ I  +FL IP FYFTAKYGDQGWMI+L SFLG+ NGYLTVCV T APKGYKGP  NAL
Sbjct  308   MVGILIQFLFIPVFYFTAKYGDQGWMILLTSFLGIFNGYLTVCVFTNAPKGYKGPEQNAL  367

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             GN+L LCL  GIF+GVA DWLWLIG   F
Sbjct  368   GNMLTLCLHCGIFAGVACDWLWLIGKESF  396



>gb|KDO35790.1| hypothetical protein CISIN_1g036062mg, partial [Citrus sinensis]
Length=333

 Score =   480 bits (1236),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 251/333 (75%), Positives = 291/333 (87%), Gaps = 1/333 (0%)
 Frame = +1

Query  61    KYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYIlfflgtfalllldlgtsgk  240
             KYHP+R LTLVYQPFA+GT+AILAY   K++TRKRN+ GYI+FF  T ALLLLDL TSG+
Sbjct  1     KYHPTRALTLVYQPFALGTMAILAYNESKIDTRKRNITGYIIFFASTLALLLLDLATSGE  60

Query  241   gglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSFLAGLAASGTLTSGLRLVT  420
             GGLG ++G+CV VA FGVADAHV+GGIVGDLSFM PEF+QSF AGLAASG LTSGLRL+T
Sbjct  61    GGLGPFLGVCVFVALFGVADAHVRGGIVGDLSFMYPEFMQSFFAGLAASGALTSGLRLLT  120

Query  421   KAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAIVKYYRAKAASEGSKTVAA  600
             KAAFE S +GLRKGV+LFLA+ T FEF+CI+LYAF FPKL IVKY+R+KAASEGSKTV+A
Sbjct  121   KAAFEKSHDGLRKGVMLFLAICTSFEFVCILLYAFFFPKLPIVKYFRSKAASEGSKTVSA  180

Query  601   DLAAAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLYLIYVVTLSIFPGFLYENTG  777
             DLAAAGI T  +++ D+AK  ER+SNK+LF++N DYALDL+LIYV+TLSIFPGFLYENTG
Sbjct  181   DLAAAGIQTKAAQAEDEAKQYERLSNKQLFIQNFDYALDLFLIYVLTLSIFPGFLYENTG  240

Query  778   THNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQSRFLLIPCFYFTAKY  957
              H LG WY  VL+A YN+WDLI+RYIPL+K V+L+SRKGLMI I  RFLL+P FYFTAKY
Sbjct  241   QHRLGEWYSLVLIASYNVWDLIARYIPLVKCVKLESRKGLMITILCRFLLVPAFYFTAKY  300

Query  958   GDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYK  1056
             GDQGWMI L SFLGLTNGYLTVCV+T APKGYK
Sbjct  301   GDQGWMIFLTSFLGLTNGYLTVCVMTVAPKGYK  333



>gb|KHG30348.1| Equilibrative nucleoside transporter 1 [Gossypium arboreum]
Length=347

 Score =   479 bits (1234),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 252/347 (73%), Positives = 293/347 (84%), Gaps = 3/347 (1%)
 Frame = +1

Query  118   IAILAYKGEKLNTRKRNLAGYIlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVA  297
             ++ILAY   K+NTR+RN+ GY LF   TF LL+LDL TSG+GGLG++IGIC IVA  GV 
Sbjct  1     MSILAYNESKINTRRRNIFGYSLFVASTFMLLVLDLATSGRGGLGSFIGICAIVAFLGVV  60

Query  298   DAHVQGGIVGDLSFMCPEFLQSFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFL  477
             DA VQGGIVGDLSFM P+F+QSF AGLAASG LTS LRL+TKAAFE S+NGLRKG +LFL
Sbjct  61    DACVQGGIVGDLSFMLPDFIQSFFAGLAASGALTSALRLITKAAFEKSNNGLRKGAMLFL  120

Query  478   AVSTFFEFLCIILYAFVFPKLAIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKH  657
             A+ST FEFLC++LY + FPKL IVKY+R+KAA EGSKTV ADLAAAGI       D  + 
Sbjct  121   AISTLFEFLCVLLYTYFFPKLPIVKYFRSKAALEGSKTVQADLAAAGIQTKD---DHHEQ  177

Query  658   VERVSNKKLFMENIDYALDLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWD  837
              ER+SNK+L ++NIDYALDL+LIYV+TLSIFPGFLYENTG H LG+WYP VL+A YN+WD
Sbjct  178   NERLSNKQLVIQNIDYALDLFLIYVLTLSIFPGFLYENTGEHKLGTWYPLVLIASYNVWD  237

Query  838   LISRYIPLIKKVELKSRKGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYL  1017
             LISRY+PL+K ++++SRKGL IAI SRFLLIP FYFTAKYGDQGWMI+LVSFLGLTNG+L
Sbjct  238   LISRYLPLVKFLKIESRKGLTIAILSRFLLIPAFYFTAKYGDQGWMILLVSFLGLTNGHL  297

Query  1018  TVCVLTAAPKGYKGPAANALGNILVLCLLSGIFSGVALDWLWLIGNS  1158
             TVCV+TAAPK YKGP  NALGNILVLCLL GIF+GV+LDWLW IG  
Sbjct  298   TVCVMTAAPKCYKGPEQNALGNILVLCLLIGIFAGVSLDWLWFIGKK  344



>ref|XP_006407617.1| hypothetical protein EUTSA_v10021957mg [Eutrema salsugineum]
 gb|ESQ49070.1| hypothetical protein EUTSA_v10021957mg [Eutrema salsugineum]
Length=409

 Score =   481 bits (1238),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 242/386 (63%), Positives = 308/386 (80%), Gaps = 8/386 (2%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L++W+SMLTI DYY  LFP+YHPSR+LTL+YQ FAIG + +L YK  KLNTR RNL GY 
Sbjct  28    LLAWSSMLTIVDYYAYLFPRYHPSRILTLIYQSFAIGALTVLTYKEAKLNTRLRNLFGY-  86

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
                  +    LLDL TSG+GG+G+++G+CVI A+FG+ADA+VQGG+ GDLS M PEF+QS
Sbjct  87    -----SLFFSLLDLATSGRGGIGSFLGVCVISATFGLADANVQGGMTGDLSLMRPEFVQS  141

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FL GLAASG LTSGLRL+TKAAF++S +GLRKG  LF A+S  FE LC++LYA+VFPKL 
Sbjct  142   FLGGLAASGALTSGLRLITKAAFKNSRDGLRKGATLFFAISALFELLCVLLYAYVFPKLP  201

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITA-PSESVDDA-KHVERVSNKKLFMENIDYALDL  717
             IVKYYRA+AA++GSKTV+ADLAA GI   P    ++     +R+SNK+L  +N+DYA++L
Sbjct  202   IVKYYRARAAAQGSKTVSADLAAGGIQGLPVTHAEEVPTSNQRLSNKQLLYKNLDYAVNL  261

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +L+Y++TLSIFPGFL E+TG H+L  WY  VL+AM+N+WDL+ RYIP+++ ++++SRKGL
Sbjct  262   FLVYLLTLSIFPGFLSEDTGKHSLRDWYALVLIAMFNVWDLVGRYIPVVESLKMESRKGL  321

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
              IA   RFL IP FYF AKYG+QGWMI L SFLGL+NGY+TVC+LT+APKGY  P  NAL
Sbjct  322   TIAALGRFLFIPAFYFAAKYGNQGWMIFLTSFLGLSNGYMTVCILTSAPKGYMAPEQNAL  381

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LVL L  G+F+GV  DWLWLIG 
Sbjct  382   GNLLVLFLSGGMFAGVTSDWLWLIGK  407



>ref|XP_004958001.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X4 [Setaria italica]
 ref|XP_004958002.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X5 [Setaria italica]
Length=382

 Score =   479 bits (1233),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 249/380 (66%), Positives = 310/380 (82%), Gaps = 2/380 (1%)
 Frame = +1

Query  22    MLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYIlfflgt  201
             MLTI DYY  LFPKYHP+R++TL YQPF + T AI  Y   K+NTR RNLAGY+LFFL +
Sbjct  1     MLTIEDYYTYLFPKYHPTRIITLTYQPFVLATTAIFTYHEAKVNTRVRNLAGYVLFFLSS  60

Query  202   falllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSFLAGLA  381
             F +++LD+ +SG GG+  +IG+C+I A+ GVAD HVQGG+ GDLS MCPEF+QSF AG+A
Sbjct  61    FGVIILDVLSSGGGGIAPFIGVCIIAAALGVADGHVQGGMTGDLSLMCPEFVQSFFAGIA  120

Query  382   ASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAIVKYYR  561
             ASG +TS LR  TKA FE+S +GLRKG +LF ++S FFE LC++LYAFVFPKL IVK+YR
Sbjct  121   ASGAITSALRFFTKAVFENSRDGLRKGAMLFSSISCFFELLCVLLYAFVFPKLPIVKFYR  180

Query  562   AKAASEGSKTVAADLAAAGI-TAPSESVDDAK-HVERVSNKKLFMENIDYALDLYLIYVV  735
             ++AASEGS TV ADLAA GI + P+   ++A  H ER+SNK+L  +N+DYALD++LIY++
Sbjct  181   SRAASEGSLTVTADLAAGGIKSQPNSLAEEAPAHAERLSNKQLLHQNMDYALDIFLIYIL  240

Query  736   TLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQS  915
             TLSIFPGFL E+TG+H+LGSWY  VL+A +N+ DLI RY+PL++ ++L SRKGL+IA+ S
Sbjct  241   TLSIFPGFLAEDTGSHSLGSWYVLVLIASFNVSDLIGRYLPLLEPIKLTSRKGLLIAVIS  300

Query  916   RFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGNILVL  1095
             RFLLIP FYFTAKYG+QGWMIML S LGL+NG+LTVCVLT APKGYKGP  NALGN+LVL
Sbjct  301   RFLLIPAFYFTAKYGNQGWMIMLTSLLGLSNGHLTVCVLTEAPKGYKGPEQNALGNLLVL  360

Query  1096  CLLSGIFSGVALDWLWLIGN  1155
              LL+GIF G   DWLWLIG 
Sbjct  361   FLLAGIFVGAVSDWLWLIGK  380



>ref|XP_004957998.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Setaria italica]
 ref|XP_004957999.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Setaria italica]
 ref|XP_004958000.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X3 [Setaria italica]
Length=418

 Score =   480 bits (1235),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 251/386 (65%), Positives = 313/386 (81%), Gaps = 2/386 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L  +N MLTI DYY  LFPKYHP+R++TL YQPF + T AI  Y   K+NTR RNLAGY+
Sbjct  31    LFGFNGMLTIEDYYTYLFPKYHPTRIITLTYQPFVLATTAIFTYHEAKVNTRVRNLAGYV  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL +F +++LD+ +SG GG+  +IG+C+I A+ GVAD HVQGG+ GDLS MCPEF+QS
Sbjct  91    LFFLSSFGVIILDVLSSGGGGIAPFIGVCIIAAALGVADGHVQGGMTGDLSLMCPEFVQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             F AG+AASG +TS LR  TKA FE+S +GLRKG +LF ++S FFE LC++LYAFVFPKL 
Sbjct  151   FFAGIAASGAITSALRFFTKAVFENSRDGLRKGAMLFSSISCFFELLCVLLYAFVFPKLP  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI-TAPSESVDDAK-HVERVSNKKLFMENIDYALDL  717
             IVK+YR++AASEGS TV ADLAA GI + P+   ++A  H ER+SNK+L  +N+DYALD+
Sbjct  211   IVKFYRSRAASEGSLTVTADLAAGGIKSQPNSLAEEAPAHAERLSNKQLLHQNMDYALDI  270

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LIY++TLSIFPGFL E+TG+H+LGSWY  VL+A +N+ DLI RY+PL++ ++L SRKGL
Sbjct  271   FLIYILTLSIFPGFLAEDTGSHSLGSWYVLVLIASFNVSDLIGRYLPLLEPIKLTSRKGL  330

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             +IA+ SRFLLIP FYFTAKYG+QGWMIML S LGL+NG+LTVCVLT APKGYKGP  NAL
Sbjct  331   LIAVISRFLLIPAFYFTAKYGNQGWMIMLTSLLGLSNGHLTVCVLTEAPKGYKGPEQNAL  390

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LVL LL+GIF G   DWLWLIG 
Sbjct  391   GNLLVLFLLAGIFVGAVSDWLWLIGK  416



>ref|XP_006447407.1| hypothetical protein CICLE_v10015212mg [Citrus clementina]
 ref|XP_006469816.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Citrus sinensis]
 gb|ESR60647.1| hypothetical protein CICLE_v10015212mg [Citrus clementina]
Length=451

 Score =   481 bits (1237),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 274/423 (65%), Positives = 322/423 (76%), Gaps = 41/423 (10%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L SWNSMLT+ DYY  LFP+YHPSR+LTLVYQPFA+ T+AILAY   K++TR+R + GYI
Sbjct  29    LFSWNSMLTVVDYYVFLFPQYHPSRILTLVYQPFALITLAILAYHEAKIDTRRRIIFGYI  88

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF  +  +L+LDL TSGKGGLG +IGICVI  +FGVADA+VQGG+VGDLSFM  E +QS
Sbjct  89    LFFASSLLVLVLDLATSGKGGLGTFIGICVISGAFGVADANVQGGMVGDLSFMTSELIQS  148

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKG---------------------------  462
             FLAGLAASG +TS LRL+TKAAFE+S +GLRKG                           
Sbjct  149   FLAGLAASGAITSALRLITKAAFENSKDGLRKGARKFEFFLLICSLRKGEKKKDSFYLLS  208

Query  463   -----------VILFLAVSTFFEFLCIILYAFVFPKLAIVKYYRAKAASEGSKTVAADLA  609
                         +LF A+S+FFEFLC+ILYAFVFPK+ IVKYYR KAASEGSKTVAADLA
Sbjct  209   IWLILMTSLFFAVLFFAISSFFEFLCVILYAFVFPKIPIVKYYRNKAASEGSKTVAADLA  268

Query  610   AAGI-TAPSESVDDAKHVERVSNKKLFMENIDYALDLYLIYVVTLSIFPGFLYENTGTHN  786
             A GI T   E V+  K  ER SNK+L ++NIDYA+D+++IY +TLSIFPGFL E+TG+H+
Sbjct  269   AGGIQTLSKEEVE--KCSERFSNKQLLLQNIDYAIDMFVIYTLTLSIFPGFLSEDTGSHS  326

Query  787   LGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQSRFLLIPCFYFTAKYGDQ  966
             LG WY  VL+AMYN+ DLI RYIPL+K  +L+SRK +  A  SRFLL+P FYFTAKYGDQ
Sbjct  327   LGGWYAVVLIAMYNVGDLIGRYIPLLKFFKLESRKYITAATLSRFLLVPAFYFTAKYGDQ  386

Query  967   GWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGNILVLCLLSGIFSGVALDWLWL  1146
             GWMIML SFLGL+NGYLTVCVLTAAPKGYKGP  NALGN+LVL LL GIF+G  LDWLWL
Sbjct  387   GWMIMLTSFLGLSNGYLTVCVLTAAPKGYKGPEQNALGNLLVLFLLGGIFAGATLDWLWL  446

Query  1147  IGN  1155
             IG 
Sbjct  447   IGK  449



>ref|XP_010473376.1| PREDICTED: equilibrative nucleotide transporter 7-like [Camelina 
sativa]
Length=457

 Score =   480 bits (1236),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 242/390 (62%), Positives = 301/390 (77%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WN+MLTI DYYYQ+FPKYHPSRVLT+VYQ FA   I  LA+K  KLNTR RN+ GY
Sbjct  68    SLVAWNAMLTITDYYYQIFPKYHPSRVLTIVYQLFANVFIITLAFKEAKLNTRFRNIFGY  127

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              L+  GTF L++LDL + G G +  Y+ +C+IVA FGVADA VQG +VGDLS+MCPEF+Q
Sbjct  128   SLYTAGTFCLIILDLASHGSGSVAAYVVLCLIVAVFGVADAVVQGAMVGDLSYMCPEFIQ  187

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             +F+ GL  +G LTSGLRL+TKA F+ S +GLRKG +LF+ ++T  +  C+ LY  VF KL
Sbjct  188   AFMGGLGIAGVLTSGLRLITKAIFDKSHDGLRKGALLFIGIATLIQLACVFLYTLVFAKL  247

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVD--DAKHVERVSNKKLFMENIDYALD  714
              IVKYYRAKA  EG+KTV+ADLAAAG+   +E V   D   +++++ K+L  ENID  ++
Sbjct  248   PIVKYYRAKAGKEGAKTVSADLAAAGLQDQAEQVQQMDESKIQKLTKKQLLRENIDLEIN  307

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+LIYVVTLSIFPGFLYENTG H LG WY  VLVAMYN WD I+R+IP IK + ++SRK 
Sbjct  308   LFLIYVVTLSIFPGFLYENTGEHRLGDWYAPVLVAMYNGWDAIARFIPSIKVLAIESRKW  367

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             + + + +RFLL+P FYFTAKY DQGWM+ L SFLGLTNGYLTVC+ + APKGY GP ANA
Sbjct  368   ITVCVVARFLLVPAFYFTAKYADQGWMLFLTSFLGLTNGYLTVCIFSTAPKGYNGPEANA  427

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN++ + LL GIF+GV L WLWLIGN  F
Sbjct  428   LGNLMCVFLLGGIFAGVCLGWLWLIGNDSF  457



>ref|XP_010418132.1| PREDICTED: equilibrative nucleotide transporter 7 [Camelina sativa]
Length=417

 Score =   478 bits (1231),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 243/390 (62%), Positives = 301/390 (77%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WN+MLTI DYYYQ+FPKYHPSRVLT+VYQ FA   I  LA+K  KLNTR RN+ GY
Sbjct  28    SLVAWNAMLTITDYYYQIFPKYHPSRVLTIVYQLFANVFIITLAFKEAKLNTRFRNIFGY  87

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              L+  GTF LL+LDL + G G +  Y+ +C+IVA FG+ADA VQG +VGDLS+MCPEF+Q
Sbjct  88    SLYTAGTFCLLILDLASRGSGSVVAYVVLCLIVAVFGLADAVVQGAMVGDLSYMCPEFIQ  147

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             +F+ GL  +G LTSGLRL+TKA F+ S +GLRKG +LF+ ++T  +  CI LY  VF KL
Sbjct  148   AFMGGLGIAGVLTSGLRLITKAIFDKSHDGLRKGALLFIGIATLIQLACIFLYTLVFAKL  207

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVD--DAKHVERVSNKKLFMENIDYALD  714
              IVKYYRAKA  EG+KTV+ADLAAAG+   +E V   D   +++++ K+L  ENID  ++
Sbjct  208   PIVKYYRAKAGKEGAKTVSADLAAAGLQDQAEQVQQMDESKIQKLTKKQLLRENIDLEIN  267

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+LIYVVTLSIFPGFLYENTG H LG WY  VLVAMYN WD I+R+IP IK + ++SRK 
Sbjct  268   LFLIYVVTLSIFPGFLYENTGEHRLGDWYAPVLVAMYNGWDAIARFIPSIKGLAVESRKW  327

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             + + + +RFLL+P FYFTAKY DQGWM+ L SFLGLTNGYLTVC+ + APKGY GP ANA
Sbjct  328   ITVCVVARFLLVPAFYFTAKYADQGWMLFLTSFLGLTNGYLTVCIFSTAPKGYNGPEANA  387

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN++ + LL GIF+GV L WLWLIGN  F
Sbjct  388   LGNLMCVFLLGGIFAGVCLGWLWLIGNDSF  417



>ref|XP_010646358.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Vitis vinifera]
 ref|XP_010646359.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Vitis vinifera]
 ref|XP_010646360.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Vitis vinifera]
Length=415

 Score =   477 bits (1227),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 240/357 (67%), Positives = 293/357 (82%), Gaps = 4/357 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             S +SWNS++TIGDYYY+LFP+YHP RVLT+V QPFA+GT+AIL YK   +NTRKRNL GY
Sbjct  26    SAISWNSLMTIGDYYYKLFPRYHPERVLTIVLQPFALGTMAILFYKEATINTRKRNLIGY  85

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF   T  L++LDL TSG+GG+  YIGIC IV +FGVA A VQGG+ GDLSFMCPEF++
Sbjct  86    ILFCTSTLMLIVLDLATSGRGGITPYIGICAIVGAFGVASALVQGGMTGDLSFMCPEFIR  145

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFLAGLAASG LTS LRLVTKA F  S++G R G +LFL ++TF EFLC +LYAF FPKL
Sbjct  146   SFLAGLAASGVLTSALRLVTKAVFRKSNDGERNGAMLFLGITTFVEFLCTLLYAFFFPKL  205

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAP--SESVDDAKHVERVSNKKLFMENIDYALD  714
              IVK+YR+KAA EGS+TV+ADLA  GI      E  DD +  ER+SNK+LF +NIDYAL+
Sbjct  206   PIVKFYRSKAALEGSQTVSADLAVVGIQTEQNEEDGDDTQQQERLSNKQLFFQNIDYALE  265

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             ++L ++VTLSIFPGFL+ENTG H LGSWYP VL+ MYN+WD++SRYIP++K + L SR+G
Sbjct  266   VFLGHLVTLSIFPGFLFENTGKHQLGSWYPLVLITMYNVWDMLSRYIPIVKCLRL-SRRG  324

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYK-GP  1062
             LM+ + ++FLLIP FYFTAKYGDQGWMI+L SFLG++NGYLTVC+ T APKGYK GP
Sbjct  325   LMVGVLAQFLLIPAFYFTAKYGDQGWMILLTSFLGVSNGYLTVCIFTDAPKGYKVGP  381



>ref|XP_002888077.1| hypothetical protein ARALYDRAFT_475164 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64336.1| hypothetical protein ARALYDRAFT_475164 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score =   476 bits (1224),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 240/390 (62%), Positives = 299/390 (77%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WN+MLTI DYYYQ+FPKYHPSRVLT+VYQ  A   I  LA K  KLNTR RN+ GY
Sbjct  28    SLVAWNAMLTITDYYYQIFPKYHPSRVLTIVYQLVANVFIITLATKEAKLNTRLRNILGY  87

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              ++ + TF L++LDL + G G +  Y+ +C+IVA FG+ADA VQG +VGDLSFMCP+F+Q
Sbjct  88    SIYTVSTFCLIILDLASHGSGSVVAYVVLCLIVALFGLADAFVQGAMVGDLSFMCPDFIQ  147

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             +F+AGL  +G LTSGLRL+TKA F+ S +GLRKG +LF+ ++T  E  C+ LY  VF KL
Sbjct  148   AFMAGLGIAGALTSGLRLITKAIFDKSPDGLRKGALLFIGIATLIELACVFLYTLVFAKL  207

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVD--DAKHVERVSNKKLFMENIDYALD  714
              IVKYYR KAA EG+KTV+ADLAAAG+   +E V   D   +++++ K+L  +NID  ++
Sbjct  208   PIVKYYRTKAAKEGAKTVSADLAAAGLQEQAEQVHQMDESKIQKLTKKQLLRQNIDLGIN  267

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L LIYVVTLSIFPGFLYENTG H LG WY  VLVAMYN WD ISR+IP IK + L+SRK 
Sbjct  268   LSLIYVVTLSIFPGFLYENTGEHRLGDWYAPVLVAMYNGWDAISRFIPSIKGLALESRKW  327

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             + + + +RFLL+P FYFTAKY DQGWM+ L SFLGL+NGYLTVC+ + APKGY GP ANA
Sbjct  328   ITVCVVARFLLVPAFYFTAKYADQGWMLFLTSFLGLSNGYLTVCIFSTAPKGYNGPEANA  387

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN++ + LL GIF+GV L WLWLIGN  F
Sbjct  388   LGNLMCVFLLGGIFAGVCLGWLWLIGNDSF  417



>ref|XP_010431739.1| PREDICTED: equilibrative nucleotide transporter 4 isoform X2 
[Camelina sativa]
Length=378

 Score =   474 bits (1219),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 239/368 (65%), Positives = 295/368 (80%), Gaps = 0/368 (0%)
 Frame = +1

Query  55    FPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYIlfflgtfalllldlgts  234
             F  YHPSRVLTLVYQP A+GT+ I AY   K++TRKR L GYILF + TF L++LDL T 
Sbjct  8     FKDYHPSRVLTLVYQPIALGTVMIFAYHESKISTRKRVLTGYILFTISTFLLIVLDLATK  67

Query  235   gkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSFLAGLAASGTLTSGLRL  414
             G GG+GNYI +C IVASFG+ADA V+GG++GDLS M PE +QS++AG   +G LTS LRL
Sbjct  68    GHGGIGNYIVLCTIVASFGLADATVKGGLIGDLSLMSPELIQSYMAGSGMAGVLTSVLRL  127

Query  415   VTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAIVKYYRAKAASEGSKTV  594
             +TKAAFE S+N LRKG ++FLA+STF EFLC++LYA+VFPKL IVKYYR KAASEGSKTV
Sbjct  128   ITKAAFEKSNNHLRKGAMIFLAISTFIEFLCVMLYAYVFPKLPIVKYYRTKAASEGSKTV  187

Query  595   AADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYLIYVVTLSIFPGFLYENT  774
              ADLAAAGI   S+  DD    +R+S K+L ++NIDYA+ L+LIYV+TLSIFPGFLYENT
Sbjct  188   VADLAAAGIQNQSDMTDDDSKNQRLSKKELLLQNIDYAVSLFLIYVLTLSIFPGFLYENT  247

Query  775   GTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQSRFLLIPCFYFTAK  954
             G H LGSWY  +LVAMYN WDL+ RY+PL+  +++++RK L IA+ SR+ L+P FYFTAK
Sbjct  248   GQHGLGSWYALILVAMYNFWDLVGRYVPLVNWLKVENRKALTIAVLSRYFLVPAFYFTAK  307

Query  955   YGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGNILVLCLLSGIFSGVALD  1134
             YGD+GWM+MLVS LGLT G+LTVC++T APK YKGP  NALGN+LV+ +L G   G++L 
Sbjct  308   YGDKGWMMMLVSVLGLTTGHLTVCIMTIAPKEYKGPEKNALGNLLVVFILGGAVVGISLG  367

Query  1135  WLWLIGNS  1158
             WLWLIG  
Sbjct  368   WLWLIGKK  375



>ref|XP_006301000.1| hypothetical protein CARUB_v10021390mg [Capsella rubella]
 gb|EOA33898.1| hypothetical protein CARUB_v10021390mg [Capsella rubella]
Length=417

 Score =   474 bits (1221),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 236/390 (61%), Positives = 298/390 (76%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WN+MLTI DYYYQ+FPKYHPSRVLT+VYQ FA   I  LAYK  KLNTR RN+ GY
Sbjct  28    SLVAWNAMLTITDYYYQVFPKYHPSRVLTIVYQLFANVFIITLAYKESKLNTRLRNILGY  87

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              ++   TF L++LDL + G G +  Y+ +C+IVA FG+ADA VQG +VGDLSFM P+F+Q
Sbjct  88    SIYAASTFCLIILDLASHGSGSVLAYVVLCLIVALFGLADAFVQGAMVGDLSFMSPDFIQ  147

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             +F+ GL  +G LTSGLRL+TKA F+ S +GLRKG +LF+ ++T  E  C+ LY  VF KL
Sbjct  148   AFMGGLGIAGALTSGLRLITKAIFDKSHDGLRKGALLFIGIATLIELACVFLYTLVFAKL  207

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVD--DAKHVERVSNKKLFMENIDYALD  714
              IVKYYRAKA  EG+KTV ADL AAG+   +E +   D   +++++ K+L  ENID  ++
Sbjct  208   PIVKYYRAKAGKEGAKTVYADLVAAGLQEQAEQIQHMDESKIQKLTKKQLLRENIDLGIN  267

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+L+Y+VTLSIFPGFLYENTG H LG WY  VLVAM+N+ D ISR+IP IK++ ++SRK 
Sbjct  268   LFLVYIVTLSIFPGFLYENTGEHRLGDWYTPVLVAMFNVLDAISRFIPSIKRLAMESRKW  327

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             + + + +RFLL+P FYFTAKY DQGWM+ L SFLGLTNGYLTVC+ + APKGY GP ANA
Sbjct  328   ITVCVVARFLLVPAFYFTAKYADQGWMLFLTSFLGLTNGYLTVCIFSTAPKGYNGPEANA  387

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGNI+ + LL GIF+GV L WLWLIGN  F
Sbjct  388   LGNIMCVFLLGGIFAGVCLGWLWLIGNDSF  417



>ref|XP_006391987.1| hypothetical protein EUTSA_v10023866mg [Eutrema salsugineum]
 gb|ESQ29273.1| hypothetical protein EUTSA_v10023866mg [Eutrema salsugineum]
Length=417

 Score =   474 bits (1220),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 245/390 (63%), Positives = 300/390 (77%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WN+MLTI DYYY +FPKYHPSRVLT+VYQ  A   I+ LAYK  KLNTRKRN+ GY
Sbjct  28    SLVAWNAMLTITDYYYHVFPKYHPSRVLTIVYQLVANVFISTLAYKEAKLNTRKRNIFGY  87

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              L+  GTF L++LDL + G G +G Y+ +C+IVA FG ADA VQGG+VGDLSFMCPEF+Q
Sbjct  88    GLYTFGTFLLIVLDLASHGSGSVGAYVALCLIVALFGFADAFVQGGMVGDLSFMCPEFIQ  147

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             +F+ GL  +G LTS LRL+TKA F+ SS+GLRKG +LF+ ++T  E  C+ILY  VF KL
Sbjct  148   AFMGGLGIAGALTSVLRLITKAIFDKSSDGLRKGALLFIGIATLIELACLILYVSVFAKL  207

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVD--DAKHVERVSNKKLFMENIDYALD  714
              IVKYYRAKA  EG+K+VAADLAA G+   +  V   D   + R + K+L  +N+D+ L+
Sbjct  208   PIVKYYRAKAGKEGAKSVAADLAAGGLQEQAAQVQQMDETKIIRQTKKQLLRQNVDHMLN  267

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+LIYVVTLSIFPGFLYENTG H LG WY  VLVAMYN WD ISR+IP IK++ L+SRK 
Sbjct  268   LFLIYVVTLSIFPGFLYENTGEHRLGDWYAPVLVAMYNGWDSISRFIPSIKRLALESRKW  327

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             + + + +RFLL+P FYFTAKY DQGWMI L SFLGL+NGYLTV + + APKGY GP +NA
Sbjct  328   ITVCVVARFLLVPAFYFTAKYADQGWMIFLTSFLGLSNGYLTVSIFSIAPKGYNGPDSNA  387

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN+L + LL GIF+GV L WLWLIGN  F
Sbjct  388   LGNLLCVFLLGGIFAGVCLGWLWLIGNDSF  417



>ref|XP_010430177.1| PREDICTED: equilibrative nucleotide transporter 7-like [Camelina 
sativa]
Length=417

 Score =   471 bits (1213),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 241/390 (62%), Positives = 301/390 (77%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WN+MLTI DYYYQ+FPKYHPSRVLT+VYQ FA   I  LAYK  KLNTR RN+ GY
Sbjct  28    SLVAWNAMLTITDYYYQIFPKYHPSRVLTIVYQLFANVFIITLAYKEAKLNTRFRNILGY  87

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              L+  GTF L++LDL + G G +  Y+ +C+IVA FG+ADA VQG +VGDLS+MCPEF+Q
Sbjct  88    SLYTAGTFCLIILDLASHGSGSVAAYVVLCLIVAVFGLADAVVQGAMVGDLSYMCPEFIQ  147

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             +F+ GL  +G LTSGLRL+TKA F+ S +GLRKG +LF+ ++T  +  C+ LY  VF KL
Sbjct  148   AFMGGLGIAGVLTSGLRLITKAIFDKSHDGLRKGPLLFIGIATLIQLACVFLYTLVFAKL  207

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVD--DAKHVERVSNKKLFMENIDYALD  714
              IVKYYRAKA  EG+KTV+ADLAAAG+   ++ V   D   +++++ K+L  ENID  ++
Sbjct  208   PIVKYYRAKAGKEGAKTVSADLAAAGLQDQAQQVQQMDESKIQKLTKKQLLRENIDLEIN  267

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+LIYVVTLSIFPGFLYENTG H LG WY  VLVAMYN WD I+R+IP IK + ++SRK 
Sbjct  268   LFLIYVVTLSIFPGFLYENTGEHRLGDWYAPVLVAMYNGWDAIARFIPSIKGLTIESRKW  327

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             + + + +RFLL+P FYFTAKY DQGWM+ L SFLGLTNGYLTVC+ + APKGY GP ANA
Sbjct  328   ITVCVVARFLLVPAFYFTAKYADQGWMLFLTSFLGLTNGYLTVCIFSTAPKGYNGPEANA  387

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN++ + LL GIF+GV L WLWLIGN  F
Sbjct  388   LGNLMCVFLLGGIFAGVCLGWLWLIGNDSF  417



>emb|CDX97307.1| BnaA02g20980D [Brassica napus]
Length=384

 Score =   469 bits (1208),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 235/365 (64%), Positives = 296/365 (81%), Gaps = 0/365 (0%)
 Frame = +1

Query  64    YHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYIlfflgtfalllldlgtsgkg  243
             YHPSRVL LVYQPFA+GTI ILAY   K+NTRKR L GYILF + TF L++LDL T G+G
Sbjct  17    YHPSRVLPLVYQPFAVGTIVILAYHESKINTRKRILVGYILFTISTFLLIMLDLTTKGQG  76

Query  244   glgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSFLAGLAASGTLTSGLRLVTK  423
             G+G YIG+C +V+ FG+ADA V+GG++GDLS MCPE +QSF+AGLA +G LTS LRL+TK
Sbjct  77    GIGPYIGLCAVVSLFGIADATVKGGMIGDLSLMCPELIQSFMAGLAVAGALTSALRLITK  136

Query  424   AAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAIVKYYRAKAASEGSKTVAAD  603
             AAFE S++ LRKG ++FL +STF EFLC++LYA+VFPKL IVK YR KAASEGS+TV+AD
Sbjct  137   AAFEKSNDRLRKGAMIFLVISTFIEFLCVMLYAYVFPKLPIVKCYRQKAASEGSQTVSAD  196

Query  604   LAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYLIYVVTLSIFPGFLYENTGTH  783
             LAAAGI   S+  +     +R+S K L ++NID+A++L+LIYV+TLSIFPGFLYENTG H
Sbjct  197   LAAAGIQYQSDMTNYDSKSQRLSKKDLLLQNIDHAVNLFLIYVLTLSIFPGFLYENTGQH  256

Query  784   NLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQSRFLLIPCFYFTAKYGD  963
              LG+WY  VLVA+YN WDL+ RY+PL+K ++ K+RK L I + SR+LL+P FYFTAKYGD
Sbjct  257   GLGTWYALVLVAVYNFWDLVGRYMPLVKWLQTKNRKALTIVVLSRYLLVPAFYFTAKYGD  316

Query  964   QGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGNILVLCLLSGIFSGVALDWLW  1143
             +GWMIML+S LGL+ G+LTVC+LT APKGY GP  NALGN+LV  +L G  +G++L WLW
Sbjct  317   KGWMIMLISILGLSTGHLTVCILTVAPKGYMGPEKNALGNLLVTFILGGALTGISLGWLW  376

Query  1144  LIGNS  1158
             L+G  
Sbjct  377   LVGKK  381



>ref|XP_009348013.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X3 [Pyrus x bretschneideri]
Length=352

 Score =   468 bits (1204),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 247/352 (70%), Positives = 288/352 (82%), Gaps = 3/352 (1%)
 Frame = +1

Query  118   IAILAYKGEKLNTRKRNLAGYIlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVA  297
             +A LAY   K++TRKRNL GY LFFL T  L+++D+ TS  GG+G YIGIC  VA+FGVA
Sbjct  1     MATLAYHEAKVDTRKRNLIGYALFFLATLMLIIVDVATSAGGGVGPYIGICACVAAFGVA  60

Query  298   DAHVQGGIVGDLSFMCPEFLQSFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFL  477
             DAHVQGG+VGDLS M PEF+QSF AGLAASG LTSGLRL+TKAAFE S +GLRKG +LFL
Sbjct  61    DAHVQGGMVGDLSLMRPEFIQSFFAGLAASGALTSGLRLMTKAAFEKSHDGLRKGTMLFL  120

Query  478   AVSTFFEFLCIILYAFVFPKLAIVKYYRAKAASEGSKTVAADLAAAGIT--APSESVDDA  651
              +STF EFLCI+LYAF FP+L IVKYYR+KAASEGSKTV ADLAAAG+   A  E  +DA
Sbjct  121   TISTFTEFLCILLYAFYFPRLPIVKYYRSKAASEGSKTVTADLAAAGVQTQADIEVSNDA  180

Query  652   KHV-ERVSNKKLFMENIDYALDLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYN  828
             K V  R+S  ++F +NID+ LDL+LIYV+TLSIFPGF++ENTG H LG+WYP VLVAMYN
Sbjct  181   KAVPTRLSTMQIFKQNIDFCLDLFLIYVLTLSIFPGFIFENTGNHQLGTWYPLVLVAMYN  240

Query  829   IWDLISRYIPLIKKVELKSRKGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTN  1008
             + DLISRYIPLIK ++++SRKGL+IAI  RFL +P +YFT KY DQGWMI+L S LGLTN
Sbjct  241   VLDLISRYIPLIKCLKIESRKGLLIAILLRFLFVPAYYFTGKYADQGWMILLTSILGLTN  300

Query  1009  GYLTVCVLTAAPKGYKGPAANALGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             GYLTVCV+T APKGY GP  NALGNILVL LL GIF+GV LDWLWLIG   F
Sbjct  301   GYLTVCVMTVAPKGYNGPEQNALGNILVLFLLGGIFAGVCLDWLWLIGRDKF  352



>ref|XP_008653214.1| PREDICTED: equilibrative nucleotide transporter 3-like [Zea mays]
 ref|XP_008653215.1| PREDICTED: equilibrative nucleotide transporter 3-like [Zea mays]
Length=431

 Score =   471 bits (1211),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 245/385 (64%), Positives = 307/385 (80%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L  +N MLTI DYY  LFPKYHP+R++TL YQPF + T AI  Y   K+NTR RNLAGY 
Sbjct  45    LFGFNGMLTIEDYYVYLFPKYHPTRIITLTYQPFVLATTAIFTYHEAKVNTRVRNLAGYT  104

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL +F +++LD+ +SG GG+  ++GIC I A+FG+AD HVQGG+ GDLS MCPEF+QS
Sbjct  105   LFFLSSFGVIILDVLSSGSGGIAPFVGICTIAAAFGIADGHVQGGMTGDLSLMCPEFVQS  164

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             F  G+AASG +T+ LR  TKA FE+S +GLRKG +LF ++S FFE LC++LYA VFPKL 
Sbjct  165   FFGGVAASGAITAALRFFTKAVFENSRDGLRKGAMLFSSISCFFELLCVLLYALVFPKLP  224

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITA-PSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             IVK+YR+KAASEGS+TV ADLAA GI + P+   ++   VER++NK+L  EN+DYALD++
Sbjct  225   IVKFYRSKAASEGSQTVTADLAAGGIKSLPNPLAEEDGVVERLNNKQLLHENMDYALDMF  284

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             L+YV+TLSIFPGFL E+TG+H+LGSWY  VL+A +N+ DLI RY+PL+++++L SR GL+
Sbjct  285   LVYVLTLSIFPGFLAEDTGSHSLGSWYVLVLIASFNVSDLIGRYLPLVEQMKLTSRTGLL  344

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
              A  SRFLL+P FYFTAKYGDQGWMIML S LGL+NG+LTV VLT APKGYKGP  NALG
Sbjct  345   TAAISRFLLVPAFYFTAKYGDQGWMIMLTSLLGLSNGHLTVSVLTEAPKGYKGPEQNALG  404

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LVL LL+GIF G   DWLWLIG 
Sbjct  405   NLLVLFLLAGIFVGAVSDWLWLIGK  429



>ref|XP_004485693.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Cicer arietinum]
Length=383

 Score =   468 bits (1205),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 247/352 (70%), Positives = 293/352 (83%), Gaps = 2/352 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WNSMLTIGDYYY+LFP+YHPSRVLT+ Y PF+IGT+ IL +   ++NTR R + GY
Sbjct  31    SLVAWNSMLTIGDYYYKLFPRYHPSRVLTIFYLPFSIGTLMILTHNESRINTRMRVITGY  90

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              +FF+ T  +L+LDL TSGKGG+G+Y+G+C + ASFGVADA VQGG+VGD+S MCPEF+Q
Sbjct  91    FIFFVCTLLVLVLDLATSGKGGIGHYVGLCALSASFGVADALVQGGMVGDMSRMCPEFIQ  150

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFLAG AASG L SGLR +TK AFE S NGLRKG +LF A STFFEFLCIILYA  FPKL
Sbjct  151   SFLAGSAASGLLASGLRFLTKIAFEKSDNGLRKGALLFFATSTFFEFLCIILYAIYFPKL  210

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAP-SESVD-DAKHVERVSNKKLFMENIDYALD  714
             +IVKYYR+KAASEGSKTV+ADLAA GI    ++ V  DAK  E ++NK+LF +NIDYA D
Sbjct  211   SIVKYYRSKAASEGSKTVSADLAAVGIQNEINQQVGLDAKQHEHLNNKELFHQNIDYAAD  270

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L+LIYV+TL I PGFLYENTG+H+LG WY  VL+A+YN+ DL SRYIP+IK ++L+SRK 
Sbjct  271   LFLIYVLTLFIVPGFLYENTGSHHLGKWYTLVLIAVYNVSDLTSRYIPMIKFMKLESRKW  330

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKG  1050
             L+ AI SRFLLIP FYFTAKYGDQGWMI+LVSFLGLTNGYLTVCV   APKG
Sbjct  331   LLTAIISRFLLIPAFYFTAKYGDQGWMIVLVSFLGLTNGYLTVCVFIVAPKG  382



>emb|CDX91229.1| BnaC02g26400D [Brassica napus]
Length=405

 Score =   469 bits (1207),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 237/374 (63%), Positives = 300/374 (80%), Gaps = 3/374 (1%)
 Frame = +1

Query  46    YQLFPK---YHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYIlfflgtfalll  216
             +  FP+   YHPSRVL LVY+PFA+GTI ILAY   K+NTRKR L GYILF + TF L++
Sbjct  29    FNYFPQILVYHPSRVLPLVYEPFAVGTIVILAYHESKINTRKRILVGYILFTISTFLLIM  88

Query  217   ldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSFLAGLAASGTL  396
             LDL T G+GG+G YIG+C +V+ FG+ADA V+GG++GDLS MCPE +QSF+AGLA +G L
Sbjct  89    LDLTTKGQGGIGPYIGLCAVVSLFGIADATVKGGMIGDLSLMCPELIQSFMAGLAVAGAL  148

Query  397   TSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAIVKYYRAKAAS  576
             TS LRL+TKAAFE S++ LRKG ++FL +STF EFLC++LYA+VFPKL IVK YR KAAS
Sbjct  149   TSALRLITKAAFEKSNDRLRKGAMIFLVISTFIEFLCVMLYAYVFPKLPIVKCYRQKAAS  208

Query  577   EGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYLIYVVTLSIFPG  756
             EGS+TVAADLAAAGI   S+  +     +R+S K L ++NID+A++L+LIYV+TLSIFPG
Sbjct  209   EGSQTVAADLAAAGIQYQSDLTNYDSKSQRLSKKDLLLQNIDHAVNLFLIYVLTLSIFPG  268

Query  757   FLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQSRFLLIPC  936
             FLYENTG H LG+WY  VLVA+YN WDL+ RY+PL+K ++ K+RK L I + SR+LL+P 
Sbjct  269   FLYENTGQHGLGTWYALVLVAVYNFWDLVGRYMPLVKWLQTKNRKALTIVVLSRYLLVPA  328

Query  937   FYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGNILVLCLLSGIF  1116
             FYFTAKYGD+GWMIML+S LGL+ G+LTVC+LT APKGY GP  NALGN+LV  +L G  
Sbjct  329   FYFTAKYGDKGWMIMLISILGLSTGHLTVCILTVAPKGYMGPEKNALGNLLVTFILGGAL  388

Query  1117  SGVALDWLWLIGNS  1158
             +G++L WLWL+G  
Sbjct  389   TGISLGWLWLVGKK  402



>tpg|DAA63091.1| TPA: hypothetical protein ZEAMMB73_574425 [Zea mays]
Length=453

 Score =   469 bits (1207),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 245/385 (64%), Positives = 307/385 (80%), Gaps = 1/385 (0%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L  +N MLTI DYY  LFPKYHP+R++TL YQPF + T AI  Y   K+NTR RNLAGY 
Sbjct  67    LFGFNGMLTIEDYYVYLFPKYHPTRIITLTYQPFVLATTAIFTYHEAKVNTRVRNLAGYT  126

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL +F +++LD+ +SG GG+  ++GIC I A+FG+AD HVQGG+ GDLS MCPEF+QS
Sbjct  127   LFFLSSFGVIILDVLSSGSGGIAPFVGICTIAAAFGIADGHVQGGMTGDLSLMCPEFVQS  186

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             F  G+AASG +T+ LR  TKA FE+S +GLRKG +LF ++S FFE LC++LYA VFPKL 
Sbjct  187   FFGGVAASGAITAALRFFTKAVFENSRDGLRKGAMLFSSISCFFELLCVLLYALVFPKLP  246

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITA-PSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             IVK+YR+KAASEGS+TV ADLAA GI + P+   ++   VER++NK+L  EN+DYALD++
Sbjct  247   IVKFYRSKAASEGSQTVTADLAAGGIKSLPNPLAEEDGVVERLNNKQLLHENMDYALDMF  306

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             L+YV+TLSIFPGFL E+TG+H+LGSWY  VL+A +N+ DLI RY+PL+++++L SR GL+
Sbjct  307   LVYVLTLSIFPGFLAEDTGSHSLGSWYVLVLIASFNVSDLIGRYLPLVEQMKLTSRTGLL  366

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
              A  SRFLL+P FYFTAKYGDQGWMIML S LGL+NG+LTV VLT APKGYKGP  NALG
Sbjct  367   TAAISRFLLVPAFYFTAKYGDQGWMIMLTSLLGLSNGHLTVSVLTEAPKGYKGPEQNALG  426

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             N+LVL LL+GIF G   DWLWLIG 
Sbjct  427   NLLVLFLLAGIFVGAVSDWLWLIGK  451



>ref|XP_009104893.1| PREDICTED: equilibrative nucleotide transporter 7 [Brassica rapa]
 emb|CDY49033.1| BnaA01g22790D [Brassica napus]
Length=417

 Score =   468 bits (1204),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 241/390 (62%), Positives = 304/390 (78%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WN+MLTI DYYYQ+FPKYHPSRVLT+VYQ  A   I+ LAYK  KLNTR RN+ GY
Sbjct  28    SLVAWNAMLTITDYYYQVFPKYHPSRVLTIVYQLVANVFISTLAYKEAKLNTRFRNILGY  87

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              ++  GTF L++LDL + G G +G Y+ +C+IVA FG+ADA VQGG+VGDLSFMCPEF+Q
Sbjct  88    SIYTAGTFCLIILDLASHGSGSVGAYVVLCLIVALFGLADAFVQGGMVGDLSFMCPEFIQ  147

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             +F+ GL  +G LTSGLRL+TKA F+ SS+GLRKG +LF+ ++T  E  C+ILY  VF KL
Sbjct  148   AFMGGLGIAGALTSGLRLITKAIFDKSSDGLRKGALLFIGIATLIELGCLILYVTVFAKL  207

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVD--DAKHVERVSNKKLFMENIDYALD  714
              IVKYYR+KA  EG+K+VAADLAAAG+   ++ V   D   + R++ K+L  +NID+ ++
Sbjct  208   PIVKYYRSKAGKEGAKSVAADLAAAGLQEQAQQVQQMDETKIIRLTKKQLLRQNIDHGMN  267

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             +++IYVVTLSIFPGFLYENTG H LG WY  VL+AMYN WD I+R+IP IK + ++SRK 
Sbjct  268   IFMIYVVTLSIFPGFLYENTGEHRLGDWYAPVLIAMYNGWDSIARFIPSIKILAMESRKW  327

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             +   + +RFLL+P FYFTAKY DQGWMI L SFLGL+NGYLTVC+ + APKGY GP +NA
Sbjct  328   ITGCVIARFLLVPAFYFTAKYADQGWMIFLTSFLGLSNGYLTVCIFSIAPKGYNGPESNA  387

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN+L + LL GIF+GV L WLWLIGN  F
Sbjct  388   LGNLLCVFLLGGIFAGVCLGWLWLIGNGSF  417



>ref|NP_176357.2| equilibrative nucleoside transporter 7 [Arabidopsis thaliana]
 sp|Q944P0.1|ENT7_ARATH RecName: Full=Equilibrative nucleotide transporter 7; Short=AtENT7; 
AltName: Full=Nucleoside transporter ENT7 [Arabidopsis 
thaliana]
 gb|AAL25094.1|AF426398_1 putative equilibrative nucleoside transporter ENT7 [Arabidopsis 
thaliana]
 gb|ABE65731.1| equilibrative nucleoside transporter [Arabidopsis thaliana]
 gb|AEE33864.1| equilibrative nucleoside transporter 7 [Arabidopsis thaliana]
Length=417

 Score =   468 bits (1203),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 240/390 (62%), Positives = 297/390 (76%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WN+MLTI DYYYQLFPKYHPSRVLT+VYQ  A   I  LA K  KLNTR RN+ GY
Sbjct  28    SLVAWNAMLTITDYYYQLFPKYHPSRVLTIVYQLVANVFIITLATKEAKLNTRLRNIFGY  87

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              L+  GTF L++LDL + G G +  Y+ +C+IVA FG+ADA VQG +VGDLSFM P+F+Q
Sbjct  88    SLYTAGTFCLIILDLASHGSGSVVAYVLLCLIVALFGLADAFVQGAMVGDLSFMSPDFIQ  147

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             +F+AGL  +G LTS LRL+TKA F++S +GLRKG +LF+ ++T  E  C+ LY  VF KL
Sbjct  148   AFMAGLGIAGALTSVLRLITKAIFDNSPDGLRKGALLFIGIATLIELACVFLYTLVFAKL  207

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVD--DAKHVERVSNKKLFMENIDYALD  714
              IVKYYRAKA  EG+KTV+ADLAAAG+   +E V   D   +++++ K+L  ENID  ++
Sbjct  208   PIVKYYRAKAGKEGAKTVSADLAAAGLQEQAEQVHQMDESKIQKLTKKQLLRENIDLGIN  267

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L LIYVVTLSIFPGFLYENTG H LG WY  VLVAMYN WD ISR+IP IK + ++SRK 
Sbjct  268   LSLIYVVTLSIFPGFLYENTGEHRLGDWYAPVLVAMYNGWDAISRFIPSIKPLAMESRKW  327

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             + + + +R LL+P FYFTAKY DQGWM+ L SFLGL+NGYLTVC+ + APKGY GP ANA
Sbjct  328   ITVCVVARLLLVPAFYFTAKYADQGWMLFLTSFLGLSNGYLTVCIFSTAPKGYNGPEANA  387

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN++ + LL GIF+GV L WLWLIGN  F
Sbjct  388   LGNLMCVFLLGGIFAGVCLGWLWLIGNDSF  417



>gb|EEC82261.1| hypothetical protein OsI_26456 [Oryza sativa Indica Group]
Length=966

 Score =   484 bits (1247),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 241/387 (62%), Positives = 311/387 (80%), Gaps = 3/387 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L  +N M+TI DYY  LFP YHP+R++TLVYQPF + T A+ AY   K+NTR RNLAGY+
Sbjct  39    LFGFNGMVTIEDYYVYLFPNYHPTRMITLVYQPFVLTTTALFAYHEAKINTRMRNLAGYM  98

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL +F +++LD+ +SG+GG+  ++G+C+I  +FGVAD HVQGG+ GDLS MCPEF QS
Sbjct  99    LFFLSSFGVIVLDVASSGRGGIAPFVGLCLIATAFGVADGHVQGGMTGDLSLMCPEFNQS  158

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             F AG+AASG +TS LR +TKA FE+S +GLRKG ++F +++ FFE LC+ILYAFVFPKL 
Sbjct  159   FFAGIAASGAITSALRFLTKAIFENSRDGLRKGAMMFSSIACFFELLCVILYAFVFPKLP  218

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSES---VDDAKHVERVSNKKLFMENIDYALD  714
             IVK+YR KAASEGS TV ADLAA GI +  E+    +D    ER+SN++L  +N+DYALD
Sbjct  219   IVKFYRTKAASEGSLTVTADLAAGGIKSQPENPLDEEDQAFAERLSNRQLLNQNMDYALD  278

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             +++IYV+TLSIFPGFL E+TGTH+LGSWY  VL+A +N+ DLI RY+PLI++++L SRK 
Sbjct  279   VFMIYVLTLSIFPGFLAEDTGTHSLGSWYALVLIATFNVSDLIGRYMPLIEQIKLTSRKW  338

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             L+IA+ +RFL +P FYFT KY D+GW+IML SFLGL+NG+LTVCV+T AP+GYKGP  NA
Sbjct  339   LLIAVVARFLFVPAFYFTVKYCDEGWVIMLTSFLGLSNGHLTVCVITEAPRGYKGPEQNA  398

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGN  1155
             LGN+LV  LL+GIF GV LDW+WLIG 
Sbjct  399   LGNMLVFFLLAGIFCGVVLDWMWLIGK  425


 Score =   412 bits (1059),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 233/384 (61%), Positives = 285/384 (74%), Gaps = 25/384 (7%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L  +NSMLTI DYY  LFP YHP+RV+TL YQPF +GT AI  Y   K+NTR RNLAGY 
Sbjct  606   LFGFNSMLTIEDYYTSLFPNYHPTRVVTLTYQPFVLGTTAIFTYHEAKVNTRLRNLAGYT  665

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL +FA ++LD+ TSG+GG+  ++G+C+I A+FGVAD HVQGG+ GDLS MCPEF+QS
Sbjct  666   LFFLSSFAAIVLDVATSGRGGIAPFVGVCIIAAAFGVADGHVQGGMTGDLSLMCPEFIQS  725

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             F AGLAASG +TS LRL+TKAAFE+S +GLRKG +LF ++S FFE LC++LYAF+FPKL 
Sbjct  726   FFAGLAASGMITSALRLITKAAFENSRDGLRKGAMLFSSISCFFELLCVLLYAFIFPKLP  785

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYL  723
             IVK+YR+KAASEGS TVAADLAA GI              R +     +++  +AL   L
Sbjct  786   IVKFYRSKAASEGSLTVAADLAAGGIQ------------NRANPLLKTLDHTAWALGTVL  833

Query  724   IYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMI  903
              +V+                ++   Y  VL+A YN+WDLI RYIPLI++V+L+SRK ++I
Sbjct  834   TFVLDFG-------------SIIDRYALVLIASYNVWDLIGRYIPLIEQVKLRSRKVILI  880

Query  904   AIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGN  1083
             A+ SRFLLIP FY+TAKY DQGWMIML SFLGL+NGYLTVC+LT APKGYKGP  NALGN
Sbjct  881   AVVSRFLLIPAFYYTAKYSDQGWMIMLTSFLGLSNGYLTVCILTEAPKGYKGPEQNALGN  940

Query  1084  ILVLCLLSGIFSGVALDWLWLIGN  1155
             +LVL LL GIF G  LDWLWLIG 
Sbjct  941   LLVLSLLGGIFCGAILDWLWLIGK  964



>emb|CDY48835.1| BnaC01g43430D [Brassica napus]
Length=417

 Score =   466 bits (1199),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 240/390 (62%), Positives = 304/390 (78%), Gaps = 2/390 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SLV+WN+MLTI DYYYQ+FPKYHPSRVLT+VYQ  A   I+ LAYK  KLNTR RN+ GY
Sbjct  28    SLVAWNAMLTITDYYYQVFPKYHPSRVLTIVYQLVANVFISTLAYKEAKLNTRFRNILGY  87

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              ++  GTF L++LDL + G G +G Y+ +C+IVA FG+ADA VQGG+VGDLSFMCPEF+Q
Sbjct  88    SIYTAGTFCLIILDLASHGSGSVGAYVVLCLIVALFGLADAFVQGGMVGDLSFMCPEFIQ  147

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             +F+ GL  +G LTS LRL+TKA F+ SS+GLRKG +LF+ ++T  E  C+ILY  +F KL
Sbjct  148   AFMGGLGIAGALTSCLRLITKAIFDKSSDGLRKGALLFIGIATLIELGCLILYVTLFAKL  207

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVD--DAKHVERVSNKKLFMENIDYALD  714
              IVKYYR+KA  EG+K+VAADLAAAG+   ++ V   D   + R++ ++L  +NID+ ++
Sbjct  208   PIVKYYRSKAGKEGAKSVAADLAAAGLQEQAQQVQQMDETKIIRLTKRQLLRQNIDHGMN  267

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             L++IYVVTLSIFPGFLYENTG H LG WY  VL+AMYN WD I+R+IP IK + ++SRK 
Sbjct  268   LFMIYVVTLSIFPGFLYENTGEHRLGDWYAPVLIAMYNGWDSIARFIPSIKTLAMESRKW  327

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             +   + +RFLL+P FYFTAKY DQGWMI L SFLGL+NGYLTVC+ + APKGY GP +NA
Sbjct  328   ITGCVIARFLLVPAFYFTAKYADQGWMIFLTSFLGLSNGYLTVCIFSIAPKGYNGPESNA  387

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             LGN+L + LL GIF+GV L WLWLIGNS F
Sbjct  388   LGNLLCVFLLGGIFAGVCLGWLWLIGNSSF  417



>gb|EMT16335.1| Equilibrative nucleoside transporter 2 [Aegilops tauschii]
Length=571

 Score =   463 bits (1192),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 242/354 (68%), Positives = 285/354 (81%), Gaps = 2/354 (1%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL +WNSMLTI DYY  LFP YHP+RVLTLVYQPFA G     AY    +NTRKRNLAG+
Sbjct  123   SLFAWNSMLTIEDYYVSLFPNYHPTRVLTLVYQPFAFGLTCFFAYYEATMNTRKRNLAGF  182

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LFFL +FAL+LLD+GT G GG+  YIG+C+I A FG +DA VQGG+VGDLS MCPEF+Q
Sbjct  183   ALFFLSSFALILLDVGTKGHGGIPAYIGVCIISAFFGTSDALVQGGLVGDLSLMCPEFIQ  242

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFL+GLAASG +TS LRL+TKAAFE+S NGLR G +LF +V+  FE  C++LYAFVFPKL
Sbjct  243   SFLSGLAASGVITSALRLITKAAFENSQNGLRNGAMLFFSVTCMFELACLLLYAFVFPKL  302

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESV--DDAKHVERVSNKKLFMENIDYALD  714
              IVKYYR KAASEGSKTV +DLAAAGI    +    +D +  ER+S K+L M+NIDYALD
Sbjct  303   PIVKYYRQKAASEGSKTVGSDLAAAGIKTDQDRQVEEDTQKHERLSTKELLMQNIDYALD  362

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             ++LIYV+TLSIFPGFL E+TG+H LG+WY  VL+ MYN+ DLI RYIPLIK ++L +RKG
Sbjct  363   IFLIYVLTLSIFPGFLSEDTGSHGLGTWYALVLITMYNVLDLIGRYIPLIKCLKLTNRKG  422

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYK  1056
             LM+AI +RFL IP FYFTAKYGDQG+MI L SFLGLTNGYLTVCVL  AP GYK
Sbjct  423   LMVAILARFLFIPAFYFTAKYGDQGYMIFLTSFLGLTNGYLTVCVLAEAPNGYK  476



>gb|EEE67396.1| hypothetical protein OsJ_24710 [Oryza sativa Japonica Group]
Length=389

 Score =   455 bits (1171),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 246/387 (64%), Positives = 296/387 (76%), Gaps = 31/387 (8%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL +WNSMLTI DYY  LFP YHP+RVLT+ YQPFA G   IL Y   KLNTRKRNL G+
Sbjct  30    SLFAWNSMLTIEDYYSILFPTYHPTRVLTIAYQPFAFGITCILTYHEAKLNTRKRNLIGF  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              LF + +FAL++LD+GT G+GGLG +IG+C+I A FG ADA VQGG+VGDLSFMCPEF+Q
Sbjct  90    ALFLISSFALIMLDIGTKGRGGLGPFIGVCIISALFGTADASVQGGLVGDLSFMCPEFIQ  149

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SFLAGLAASG LTS LRL+TKAAFE+S NGLR G ILF +++ FFE +C++LYA+VFPKL
Sbjct  150   SFLAGLAASGVLTSALRLITKAAFENSQNGLRNGAILFFSITCFFELVCLLLYAYVFPKL  209

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPS--ESVDDAKHVERVSNKKLFMENIDYALD  714
              IVK+YR+KAA+EGSKTVA+DLAAAGI+     ++ +D K  +R+S K L ++NIDYA D
Sbjct  210   PIVKHYRSKAAAEGSKTVASDLAAAGISNEHSIQAEEDPKKCDRLSTKDLLIQNIDYAFD  269

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             ++LIYV+TLSIFPGFL E+TG H+LG+W                 Y+PLIK ++L SRKG
Sbjct  270   IFLIYVLTLSIFPGFLSEDTGAHSLGTW-----------------YLPLIKCIKLTSRKG  312

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANA  1074
             L  AI +RFL IP FYFTAKYGDQG+MI L SFLGLTNG+LT            GP  NA
Sbjct  313   LTGAILARFLFIPAFYFTAKYGDQGYMIFLTSFLGLTNGFLT------------GPEQNA  360

Query  1075  LGNILVLCLLSGIFSGVALDWLWLIGN  1155
             LGN+LV+CLL GIFSGV LDWLWLIG 
Sbjct  361   LGNVLVVCLLGGIFSGVVLDWLWLIGK  387



>ref|XP_010455849.1| PREDICTED: equilibrative nucleotide transporter 4-like isoform 
X2 [Camelina sativa]
Length=395

 Score =   455 bits (1170),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 234/364 (64%), Positives = 288/364 (79%), Gaps = 7/364 (2%)
 Frame = +1

Query  64    YHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYIlfflgtfalllldlgtsgkg  243
             YHPSRVLTLVYQP A+GT+ I AY   K++TRKR L GYILF + TF L++LDL T G G
Sbjct  35    YHPSRVLTLVYQPIALGTVMIFAYHESKISTRKRVLTGYILFTISTFLLIVLDLATKGHG  94

Query  244   glgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSFLAGLAASGTLTSGLRLVTK  423
             G+GNYI +C IVASFG+AD  V+GG++GDLS M PE +QS++AGL  +G LTS LRL+TK
Sbjct  95    GIGNYIVLCTIVASFGLADTTVKGGLIGDLSLMSPELIQSYMAGLGMAGVLTSVLRLITK  154

Query  424   AAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAIVKYYRAKAASEGSKTVAAD  603
             AAFE S+N LRKG ++FLA+STF EFLC++LYA+VFPKL IVKYYR KAASEGSKTVAAD
Sbjct  155   AAFEKSNNHLRKGAMIFLAISTFIEFLCVMLYAYVFPKLPIVKYYRTKAASEGSKTVAAD  214

Query  604   LAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYLIYVVTLSIFPGFLYENTGTH  783
             LAAAGI   S+  DD    +R+S K+L ++NI YA+ L+LIYV+TLSIFPGFLYENTG H
Sbjct  215   LAAAGIQNQSDLSDDDSKNQRLSKKELLLQNIGYAVSLFLIYVLTLSIFPGFLYENTGQH  274

Query  784   NLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQSRFLLIPCFYFTAKYGD  963
              LG WY  +LVAMYN WDL+ RY+PL+  +++++RK L IA+ SR+ L+P FYFTAKYGD
Sbjct  275   GLGVWYALILVAMYNFWDLVGRYVPLVNSLKVENRKALTIAVLSRYFLVPAFYFTAKYGD  334

Query  964   QGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGNILVLCLLSGIFSGVALDWLW  1143
             +GWM+MLVS LGLT G+LT       PKGYKGP  NALGN+LV+ +L G   G++L WLW
Sbjct  335   KGWMMMLVSVLGLTTGHLT-------PKGYKGPEKNALGNLLVVFILGGAVVGISLGWLW  387

Query  1144  LIGN  1155
             LIG 
Sbjct  388   LIGK  391



>ref|XP_009114506.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Brassica rapa]
Length=405

 Score =   453 bits (1166),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 233/388 (60%), Positives = 293/388 (76%), Gaps = 14/388 (4%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             LV+WNS+LTI DYYY +FP             PFA+ T+ ILAY   K+NTRKRN+ GY 
Sbjct  31    LVAWNSLLTIADYYYHVFP-------------PFALVTVVILAYHESKINTRKRNMIGYT  77

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             +F + +  L++LDL T G+GG+  Y+G+C IVAS G+ADA VQGG++GDLS MCPE +QS
Sbjct  78    IFTISSLLLIVLDLATKGRGGIEPYLGLCTIVASLGLADATVQGGMIGDLSLMCPELIQS  137

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             ++AGL  +G LTS  RL+TKAAFE+S+ GLRKG ++FL +S   +FLC++LYA+VFPKL 
Sbjct  138   YMAGLGVAGALTSAFRLMTKAAFENSNGGLRKGALIFLTISALIQFLCVMLYAYVFPKLP  197

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYL  723
             IVKYYR KAASEGSKTV ADLAAAGI +PS   DD    +R++ K++  +NIDYA++L L
Sbjct  198   IVKYYRRKAASEGSKTVTADLAAAGIKSPSYLTDDVSSYQRLNKKEILHQNIDYAMNLSL  257

Query  724   IYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMI  903
              Y+++LSIFPGFLYENTG H LGSWY  VLVAMYN  +LI RY PL+K +  ++RK + I
Sbjct  258   TYILSLSIFPGFLYENTGQHGLGSWYALVLVAMYNCGNLIGRYTPLVKWLMFENRKWITI  317

Query  904   AIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGN  1083
             A  SRFLLIP FYFTAKYGDQGWMIMLV+FLG T G++ VC+L  APK YKGP  NALGN
Sbjct  318   ATLSRFLLIPAFYFTAKYGDQGWMIMLVTFLGWTTGHINVCILIIAPKDYKGPEKNALGN  377

Query  1084  ILVLCLLSGIFSGVALDWLWLIG-NSGF  1164
             +LV+ +  GI  G +L WLWLIG N+ F
Sbjct  378   LLVVFVTGGIVVGTSLGWLWLIGKNNAF  405



>ref|XP_010464659.1| PREDICTED: equilibrative nucleotide transporter 2-like [Camelina 
sativa]
Length=417

 Score =   454 bits (1167),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 229/386 (59%), Positives = 306/386 (79%), Gaps = 2/386 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L++WN+MLT+ DYY  +FP+YHPSR+L ++YQ FAIG +++L YK   LNTR+RNL GY 
Sbjct  29    LLAWNTMLTVVDYYAYMFPRYHPSRILAIIYQSFAIGALSVLVYKEASLNTRRRNLFGYS  88

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LF LG+ ALL+LDL  SG+GG+G++IG+CVI A+FG+ADAHV GG++GDLS M PEF+QS
Sbjct  89    LFALGSLALLVLDLSNSGRGGIGSFIGVCVISAAFGLADAHVLGGMIGDLSLMAPEFVQS  148

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLA+SG LTSGLRLVTKA F++S +GLRKG +LF A+S  FE +C++LYA+VFPKL+
Sbjct  149   FLAGLASSGALTSGLRLVTKAVFKNSRDGLRKGAMLFFAISVVFELVCVMLYAYVFPKLS  208

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITA-PSESVDDAKHV-ERVSNKKLFMENIDYALDL  717
             IVKYYRA+A  +GS TV  DLAA GI   P   V++A  + +R SNK LF+ N+D A++L
Sbjct  209   IVKYYRAQAVPQGSTTVWGDLAAGGIQELPRRQVEEALEISDRFSNKVLFLLNLDNAINL  268

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +L+Y+VT   FP FL E+ G ++LG WYP VL+A++N+ DL+ RY+PL+KK++++S KGL
Sbjct  269   FLVYLVTFRFFPRFLLEDMGKYSLGDWYPLVLIAVFNVSDLVGRYVPLVKKLKMESGKGL  328

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             M+    RF L+P FYFTA YG++GWMI L S LGL+NGYLTVC+L +A +G+  P  NAL
Sbjct  329   MLTTFGRFWLVPAFYFTATYGNEGWMIFLTSVLGLSNGYLTVCILISATEGHLAPEQNAL  388

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LVLC+  G+F+GV  DW+WLIG 
Sbjct  389   GNMLVLCMSGGMFAGVICDWIWLIGK  414



>ref|XP_006300244.1| hypothetical protein CARUB_v10016484mg, partial [Capsella rubella]
 gb|EOA33142.1| hypothetical protein CARUB_v10016484mg, partial [Capsella rubella]
Length=408

 Score =   452 bits (1163),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 233/389 (60%), Positives = 302/389 (78%), Gaps = 6/389 (2%)
 Frame = +1

Query  7     VSWNSMLTIGDYYYQLFP---KYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAG  177
             ++WN+MLTI  YY  LFP   +YHPSR+ T++YQ FAIG +++L YK   LNTR+RNL G
Sbjct  18    LAWNNMLTIASYYAYLFPLKLRYHPSRIPTIIYQSFAIGALSVLVYKEASLNTRRRNLFG  77

Query  178   YIlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFL  357
             Y LF LG+ A+L+LDL TSG+GG+G++IG+C+I A FG+ADAHV GG++GDLS M PEF+
Sbjct  78    YGLFSLGSLAILVLDLATSGRGGIGSFIGVCIISAVFGLADAHVLGGMIGDLSLMAPEFV  137

Query  358   QSFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPK  537
             QSFLAGLAASG LTSGLRLVTK AF+ S NGLRK  +LF A+S  FE LC+ILYA+VFPK
Sbjct  138   QSFLAGLAASGALTSGLRLVTKVAFKDSRNGLRKEAMLFFAISVIFELLCVILYAYVFPK  197

Query  538   LAIVKYYRAKAASEGSKTVAADLAAAGITA-PSESVDDAKHV--ERVSNKKLFMENIDYA  708
             L IVK+YRA+A ++GSKTV+ADL A GI   P+   ++   +   R SNK LF+ NIDY 
Sbjct  198   LVIVKFYRAQAVAQGSKTVSADLVAGGIQELPTRQAEEEPIILDHRFSNKVLFLLNIDYG  257

Query  709   LDLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSR  888
             + L+L+Y++T SIFPG L +++G H+LG WYP +L+A++N+ DL+ RY+PL+KK++++  
Sbjct  258   ISLFLVYLLTFSIFPGVLSKDSGKHSLGDWYPLMLIAVFNVSDLVGRYVPLVKKLKMELG  317

Query  889   KGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAA  1068
              GLMI   +RFLL+P FY+TA+YG+QGWMI L S LG +NGYLTVC+LT AP GY  P  
Sbjct  318   IGLMITSFARFLLVPAFYYTARYGNQGWMIFLTSVLGSSNGYLTVCILTVAPMGYSAPER  377

Query  1069  NALGNILVLCLLSGIFSGVALDWLWLIGN  1155
             N LGNILVLCL  G+F+GV  DWLW IG 
Sbjct  378   NGLGNILVLCLSGGMFAGVMCDWLWFIGK  406



>gb|KDP33783.1| hypothetical protein JCGZ_07354 [Jatropha curcas]
Length=377

 Score =   449 bits (1154),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 246/367 (67%), Positives = 291/367 (79%), Gaps = 2/367 (1%)
 Frame = +1

Query  61    KYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYIlfflgtfalllldlgtsgk  240
             +YH SR+LTLVYQ  A  T+AILA    KLNTRKRNL GY L F+G+  +L++DL TSG+
Sbjct  9     RYHSSRILTLVYQLCAFVTLAILANHEAKLNTRKRNLLGYSLLFIGSLLILVVDLATSGR  68

Query  241   gglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSFLAGLAASGTLTSGLRLVT  420
             GGL  +IGICV+ A+FGVADAHVQGG+VGDLSFM PEFLQS+LAG+AASG +TSGLRL+ 
Sbjct  69    GGLETFIGICVVNAAFGVADAHVQGGMVGDLSFMKPEFLQSYLAGMAASGIITSGLRLII  128

Query  421   KAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAIVKYYRAKAASEGSKTVAA  600
             KAAF+ S NGLRKG ILF A+S FFE LC+ LYA+ FP+L  VK+YR+KAASEGSKTV A
Sbjct  129   KAAFQDSKNGLRKGAILFFALSAFFELLCVFLYAYAFPRLPTVKHYRSKAASEGSKTVTA  188

Query  601   DLAAAGITA--PSESVDDAKHVERVSNKKLFMENIDYALDLYLIYVVTLSIFPGFLYENT  774
             DLAAAG       E+ +  +  ER SNK+L  +NIDYA+DL+L YV+T+SI PGFL ENT
Sbjct  189   DLAAAGNRTFQQEEAEEKPERFERRSNKELLSQNIDYAIDLFLTYVITMSIMPGFLSENT  248

Query  775   GTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQSRFLLIPCFYFTAK  954
             G+HNLG WY  VL+AMYN+W+LI R I L+K ++L+SRKGLMI I SRFLL+P FYFTAK
Sbjct  249   GSHNLGDWYALVLIAMYNLWNLIGRNIILVKSLKLESRKGLMIIIISRFLLVPAFYFTAK  308

Query  955   YGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGNILVLCLLSGIFSGVALD  1134
             Y D+G MIML S LGLT GY TVCVLT+APKGYKGP  NALGN+L L LL GI  G ALD
Sbjct  309   YADEGLMIMLTSVLGLTTGYFTVCVLTSAPKGYKGPEQNALGNLLTLFLLCGISVGSALD  368

Query  1135  WLWLIGN  1155
              LWLIG 
Sbjct  369   LLWLIGK  375



>ref|XP_010479616.1| PREDICTED: equilibrative nucleotide transporter 2-like [Camelina 
sativa]
Length=411

 Score =   449 bits (1155),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 229/386 (59%), Positives = 304/386 (79%), Gaps = 2/386 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L++WN+MLT+ DYY  +FP+YHPSR+L ++YQ FAIG +++L YK   LNTR+RNL GY 
Sbjct  23    LLAWNTMLTVVDYYAYMFPRYHPSRILAIIYQSFAIGALSVLVYKEASLNTRRRNLFGYS  82

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LF LG+ A+L+LDL TSG+GG+G++IG+CVI A+FG+ADAHV GG++GDLS M PEF+QS
Sbjct  83    LFALGSLAILVLDLSTSGRGGIGSFIGVCVISAAFGLADAHVLGGMIGDLSLMEPEFVQS  142

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTSGLRLVTK  F++S +GLRKG +LF A+S  FE +C++LYA+VFPKL+
Sbjct  143   FLAGLAASGALTSGLRLVTKEVFKNSRDGLRKGAMLFFAISVVFELVCVMLYAYVFPKLS  202

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITA-PSESVDDAKHV-ERVSNKKLFMENIDYALDL  717
             IVKYYRA+A  +GS TV  DLAA GI   P    ++A  + +  SNK LF+ N+  A++L
Sbjct  203   IVKYYRAQAVPQGSTTVWGDLAAGGIQELPRRLAEEALEISDPFSNKVLFLLNLGNAINL  262

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +L+Y+VT   FP FL E+ G H+LG WYP +L+A++N+ DL+ RY+PL+KK++++S KGL
Sbjct  263   FLVYLVTFRFFPRFLLEDMGKHSLGDWYPLMLIAVFNVSDLVGRYVPLVKKLKMESEKGL  322

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             MI    RF L+P FYFTA YG+QGWMI L S LGL+NGYLTVC+LT+A +G+  P  NAL
Sbjct  323   MITSFGRFWLVPAFYFTATYGNQGWMIFLTSVLGLSNGYLTVCILTSATEGHLAPEQNAL  382

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LVLC+  G+F+GV  DW+WLIG 
Sbjct  383   GNMLVLCMSGGMFAGVICDWIWLIGK  408



>ref|XP_002982809.1| hypothetical protein SELMODRAFT_179838 [Selaginella moellendorffii]
 gb|EFJ16054.1| hypothetical protein SELMODRAFT_179838 [Selaginella moellendorffii]
Length=419

 Score =   447 bits (1149),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 239/385 (62%), Positives = 293/385 (76%), Gaps = 0/385 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL +WNSMLT+ DYY  +FP YHPSRVLTLVYQPFA+ T+ IL Y   K++TR R L G+
Sbjct  33    SLFTWNSMLTVMDYYSHVFPDYHPSRVLTLVYQPFAVITVGILTYYEAKVDTRFRILFGF  92

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              +FF+ +  + +LDL TSG GG+G YIG+C + A FG+ADA VQGGIVGDLS+M P FLQ
Sbjct  93    SVFFVSSTLVPILDLATSGHGGIGPYIGVCALSACFGLADAFVQGGIVGDLSYMHPNFLQ  152

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGLAASG  TSGLRL+TKA+F  +  GLRKG + F  +S FFE LC+ILYA VFPKL
Sbjct  153   SFSAGLAASGAATSGLRLITKASFPDTKVGLRKGALTFFFISAFFELLCLILYAVVFPKL  212

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              +VK+YR  AA EG+ TV ADLAAAG+       D  K   R+S+  L  +N+DYA DL+
Sbjct  213   DMVKHYRKTAALEGATTVNADLAAAGVVVNDLERDSEKGNTRLSSLALLSQNVDYAFDLF  272

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
              IYV+TLSIFPGFL E+TG+H+LGSWY  VL+ MYN+ DL+ RY+PLIK +++KSR G++
Sbjct  273   AIYVLTLSIFPGFLAEDTGSHSLGSWYVVVLITMYNLGDLVGRYLPLIKAIKIKSRVGIL  332

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
              A+ +RF  IP FY TAKYGDQGWM+ML   LG+TNG+LTVCVL  AP+GYKGP  NA+G
Sbjct  333   AAVVARFAFIPAFYLTAKYGDQGWMLMLCILLGITNGHLTVCVLVEAPRGYKGPEQNAIG  392

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             NILV  LL GIF+GV LDWLWLIG 
Sbjct  393   NILVFFLLGGIFAGVTLDWLWLIGK  417



>ref|XP_010052415.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Eucalyptus grandis]
Length=361

 Score =   442 bits (1138),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 223/303 (74%), Positives = 262/303 (86%), Gaps = 4/303 (1%)
 Frame = +1

Query  256   YIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSFLAGLAASGTLTSGLRLVTKAAFE  435
             Y GICV+VA FGVADAHVQGG+VGDLSFMCPEF+QSF AG+AASG LTSG+RL+TKAAF+
Sbjct  63    YFGICVLVACFGVADAHVQGGMVGDLSFMCPEFMQSFFAGIAASGALTSGMRLITKAAFD  122

Query  436   HSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAIVKYYRAKAASEGSKTVAADLAAA  615
              + +GLRKG +LFLA+STFFEF+CIILYA  F K+ IVK+YR+KAASEGSKTV+ADLAAA
Sbjct  123   KAHDGLRKGAMLFLAISTFFEFICIILYATWFAKIPIVKHYRSKAASEGSKTVSADLAAA  182

Query  616   GITAPSESVDDAKHVERVSNKKLFMENIDYALDLYLIYVVTLSIFPGFLYENTGTHNLGS  795
             GI    ++ D     +R+S K+L  +NIDYA+DLYLIYV+TL+IFPGFLYENTGTH LGS
Sbjct  183   GI----QTQDGDSKEDRLSKKQLLFQNIDYAIDLYLIYVLTLTIFPGFLYENTGTHQLGS  238

Query  796   WYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQSRFLLIPCFYFTAKYGDQGWM  975
             WY  VL+AMYN+WDLISRYIPLI  ++L+SRKGL+I I +RFLL+P FYFTAKYGDQGWM
Sbjct  239   WYALVLIAMYNVWDLISRYIPLIGWLKLESRKGLLIVILARFLLVPAFYFTAKYGDQGWM  298

Query  976   IMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGNILVLCLLSGIFSGVALDWLWLIGN  1155
             IMLVSFLGL+NGYLTVCV+T APKGYKGP  NALGN+LVL LL GIFSGV+L WLW+I +
Sbjct  299   IMLVSFLGLSNGYLTVCVMTVAPKGYKGPEQNALGNLLVLFLLGGIFSGVSLGWLWIIHH  358

Query  1156  SGF  1164
               F
Sbjct  359   DKF  361



>ref|XP_002981842.1| hypothetical protein SELMODRAFT_154779 [Selaginella moellendorffii]
 gb|EFJ16935.1| hypothetical protein SELMODRAFT_154779 [Selaginella moellendorffii]
Length=419

 Score =   444 bits (1143),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 238/385 (62%), Positives = 292/385 (76%), Gaps = 0/385 (0%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             SL +WNSMLT+ DYY  +FP YHPSRVLTLVYQPFA  T+ IL Y   K++TR R L G+
Sbjct  33    SLFTWNSMLTVMDYYSHVFPDYHPSRVLTLVYQPFAFITVGILTYYEAKVDTRFRILFGF  92

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              +FF+ +  + +LDL TSG GG+G YIG+CV+ A FG+ADA VQGGIVGDLS+M P FLQ
Sbjct  93    SVFFVSSTLVPILDLATSGHGGIGPYIGVCVLSACFGLADAFVQGGIVGDLSYMHPNFLQ  152

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGLAASG  TS LRL+TKA+F  +  GLRKG + F  +S FFE LC+ILYA VFPKL
Sbjct  153   SFSAGLAASGAATSSLRLITKASFPDTKVGLRKGALTFFFISAFFELLCLILYAVVFPKL  212

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              +VK+YR  AA EG+ TV ADLAAAG+       D  K   R+S+  L  +N+DYA D++
Sbjct  213   EMVKHYRKTAALEGATTVNADLAAAGVVVTDLEKDSEKGNTRLSSLALLSQNVDYAFDVF  272

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
              IYV+TLSIFPGFL E+TG+H+LGSWY  VL+ MYN+ DL+ RY+PLIK +++KSR G++
Sbjct  273   AIYVLTLSIFPGFLAEDTGSHSLGSWYVVVLITMYNLGDLVGRYLPLIKAIKIKSRVGIL  332

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
              A+ +RF  IP FY TAKYGDQGWM+ML   LG+TNG+LTVCVL  AP+GYKGP  NA+G
Sbjct  333   AAVVARFAFIPAFYLTAKYGDQGWMLMLCILLGITNGHLTVCVLVEAPRGYKGPEQNAIG  392

Query  1081  NILVLCLLSGIFSGVALDWLWLIGN  1155
             NILV  LL GIF+GV LDWLWLIG 
Sbjct  393   NILVFFLLGGIFAGVTLDWLWLIGK  417



>ref|XP_007148260.1| hypothetical protein PHAVU_006G193300g [Phaseolus vulgaris]
 gb|ESW20254.1| hypothetical protein PHAVU_006G193300g [Phaseolus vulgaris]
Length=349

 Score =   441 bits (1135),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 243/347 (70%), Positives = 286/347 (82%), Gaps = 0/347 (0%)
 Frame = +1

Query  124   ILAYKGEKLNTRKRNLAGYIlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADA  303
             ILAY   K+NTRKRNLAG+ LFF+  F +L++DL TSGKGG+G YIGICV+ A FG+ADA
Sbjct  3     ILAYYESKINTRKRNLAGFTLFFISIFLVLVVDLATSGKGGIGPYIGICVLAACFGIADA  62

Query  304   HVQGGIVGDLSFMCPEFLQSFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAV  483
              V+GG+VG+L FMCPEF+QS+LAGLAASG L S LR+VTKAAFE S++GLRKG ILFLA+
Sbjct  63    QVEGGMVGELYFMCPEFIQSYLAGLAASGALISVLRMVTKAAFEKSNDGLRKGAILFLAI  122

Query  484   STFFEFLCIILYAFVFPKLAIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVE  663
             S+  E +CI LYA  F KL IVKYYR+KAA EGSKTVAADLAAAGI+  ++     K  E
Sbjct  123   SSLIELVCIFLYAIYFTKLPIVKYYRSKAAVEGSKTVAADLAAAGISTETKDQGGDKQQE  182

Query  664   RVSNKKLFMENIDYALDLYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLI  843
             R+SNK LF EN+DYA+D++ IY VTL+IFPGFLYENTGTH LG+WY  VL+AMYN+ DLI
Sbjct  183   RLSNKILFHENLDYAVDIFFIYAVTLAIFPGFLYENTGTHGLGTWYSVVLIAMYNVMDLI  242

Query  844   SRYIPLIKKVELKSRKGLMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTV  1023
             SRYIP++  ++L+SRKGL+IA+ SRFLLIP FYFTAKYG QGWMI L SFLGLTNGYLTV
Sbjct  243   SRYIPIVPWLKLESRKGLLIAVFSRFLLIPAFYFTAKYGAQGWMIFLTSFLGLTNGYLTV  302

Query  1024  CVLTAAPKGYKGPAANALGNILVLCLLSGIFSGVALDWLWLIGNSGF  1164
             CVLT AP+GYKGP  NALGN+LVLCLLSGI  G  LDWLW+IG   F
Sbjct  303   CVLTVAPRGYKGPEQNALGNLLVLCLLSGICVGAVLDWLWIIGKGTF  349



>ref|XP_002884769.1| hypothetical protein ARALYDRAFT_478326 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61028.1| hypothetical protein ARALYDRAFT_478326 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score =   443 bits (1139),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 229/387 (59%), Positives = 302/387 (78%), Gaps = 2/387 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L++WNSMLTI DYY  LFP+YHPS ++T++YQ FAIG +++L +K  +LNTR+RNL GY 
Sbjct  30    LLAWNSMLTIVDYYAYLFPRYHPSNIITIIYQSFAIGALSVLVHKEARLNTRRRNLFGYS  89

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LF LG+ A+L+LDL TSG+GG+G++IG+CVI A+FG+ DAHV GG++GDLS M P+FLQS
Sbjct  90    LFSLGSLAVLVLDLATSGRGGIGSFIGVCVISAAFGLGDAHVLGGMIGDLSMMTPKFLQS  149

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTSGLRLVTKAAF++S +GLRKG ILF AVS  FE +C++LYAFVFP++ 
Sbjct  150   FLAGLAASGALTSGLRLVTKAAFKNSRDGLRKGAILFFAVSASFELVCVLLYAFVFPRIP  209

Query  544   IVKYYRAKAASEGSKTVAADLAAAGIT--APSESVDDAKHVERVSNKKLFMENIDYALDL  717
             IVKYYR +A  +G++TVAADLAA G T  AP++ V+  ++V R++ + L +   D A+ L
Sbjct  210   IVKYYRGEAILQGAETVAADLAAGGGTQVAPTQDVEAPRYVRRLNKRDLMLLYSDLAVTL  269

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             + +YV+T SIFPGFL E+TG H+LG WY  VL+A++N+ DL+ RY+P++KK+++KSR+GL
Sbjct  270   FSVYVLTFSIFPGFLSEDTGKHSLGDWYALVLIAVFNVSDLVGRYVPVVKKLKMKSRRGL  329

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             +I    R LLIP F  T  YG QGWMI L+S LG +NGYLTVCV+T+A      P  NAL
Sbjct  330   LITSLGRLLLIPAFNITGIYGSQGWMISLMSVLGFSNGYLTVCVITSATHDLLAPEQNAL  389

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNS  1158
             GN+LV  +  G+F GVA DWLWLIG  
Sbjct  390   GNLLVFFISGGMFVGVACDWLWLIGKD  416



>gb|KFK32224.1| hypothetical protein AALP_AA6G213900, partial [Arabis alpina]
Length=374

 Score =   438 bits (1126),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 228/363 (63%), Positives = 277/363 (76%), Gaps = 18/363 (5%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
             +LVSWNS+LTIGDYYYQ+FP YHPSRVLT VYQP A+GTI +L+Y   +++TRKRNL GY
Sbjct  30    TLVSWNSLLTIGDYYYQVFPDYHPSRVLTFVYQPLALGTIMVLSYFESEISTRKRNLIGY  89

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
             ILF + TF L++LDL T G GG+  YIGIC IV+ FG++DA                   
Sbjct  90    ILFTISTFLLIILDLTTKGHGGIIPYIGICAIVSLFGISDA------------------V  131

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
              F AGL  +G LTS  RL+TKAAF  S +GLRKG ++FLA+STF EFLC+ILYA+VFPKL
Sbjct  132   PFTAGLGVAGVLTSAFRLITKAAFAKSDDGLRKGAMIFLAISTFIEFLCVILYAYVFPKL  191

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYYR KAA EGSKTV+ADLAAAG+   S   DD    +R+S K+L +EN DYA +L+
Sbjct  192   PIVKYYRRKAAFEGSKTVSADLAAAGVQNKSILSDDDSKNQRLSKKELCLENTDYAANLF  251

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             L YV+T+SI PGFLYENTG H LG WY  VLVAMYN  DL+ RYIPL+K +++++RKGL 
Sbjct  252   LTYVLTVSILPGFLYENTGQHGLGKWYALVLVAMYNCLDLVGRYIPLVKWLKIENRKGLT  311

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALG  1080
             IA+ SR+LL+P FYFTAKYGDQGWMIML+S  G TNGY+TVC+LT APKGYKGP  NALG
Sbjct  312   IAVLSRYLLVPAFYFTAKYGDQGWMIMLISVFGFTNGYITVCILTIAPKGYKGPEKNALG  371

Query  1081  NIL  1089
             N++
Sbjct  372   NLM  374



>ref|XP_006833132.1| hypothetical protein AMTR_s00072p00094460 [Amborella trichopoda]
 gb|ERM98410.1| hypothetical protein AMTR_s00072p00094460 [Amborella trichopoda]
Length=337

 Score =   432 bits (1112),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 225/334 (67%), Positives = 272/334 (81%), Gaps = 2/334 (1%)
 Frame = +1

Query  61    KYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYIlfflgtfalllldlgtsgk  240
             KYHP+RVL LV+QPFA+GT+AIL Y   K+NTR RNL GY +FF+ +    +LDL TSGK
Sbjct  2     KYHPTRVLPLVFQPFALGTLAILTYNEAKINTRCRNLTGYFVFFISSLLAPVLDLATSGK  61

Query  241   gglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSFLAGLAASGTLTSGLRLVT  420
             GG+G YIGIC+I  +FGVA AHVQGG++GDLS M  +F+QSFLAGLAASG LTS LRL+T
Sbjct  62    GGIGPYIGICIISGAFGVAGAHVQGGMIGDLSCMRSDFVQSFLAGLAASGVLTSALRLIT  121

Query  421   KAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAIVKYYRAKAASEGSKTVAA  600
             KAAFE + +GLRKG I+F A+S  FE LC+++YAF+FP+L IVKYYR+KAASEGSKTV+A
Sbjct  122   KAAFESTKDGLRKGAIIFFAISVLFELLCLLVYAFLFPRLPIVKYYRSKAASEGSKTVSA  181

Query  601   DLAAAGITAPSE--SVDDAKHVERVSNKKLFMENIDYALDLYLIYVVTLSIFPGFLYENT  774
             DLAA GI          D K+ ER++NK+L  +NIDYALD  LIYV+TLSIFPGFL E+T
Sbjct  182   DLAAGGIEIQQSFGVAGDLKYAERLNNKELLFQNIDYALDTALIYVLTLSIFPGFLAEDT  241

Query  775   GTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQSRFLLIPCFYFTAK  954
             G+H+LGSWY  VL+AM+N +DLI RYIPLI  +++ SR+ LMIA  SRFLL+P FYF AK
Sbjct  242   GSHSLGSWYALVLIAMFNGFDLIGRYIPLINNLKITSRRPLMIATISRFLLVPAFYFAAK  301

Query  955   YGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYK  1056
             YGDQGWMIMLV+ LGL+NGYLTVCVLTAAPKGYK
Sbjct  302   YGDQGWMIMLVALLGLSNGYLTVCVLTAAPKGYK  335



>gb|AAL25095.1|AF426399_1 putative equilibrative nucleoside transporter ENT2 [Arabidopsis 
thaliana]
Length=417

 Score =   436 bits (1120),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 227/387 (59%), Positives = 301/387 (78%), Gaps = 2/387 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L++WNSMLTI DYY  LFP YHPSR+LT++YQ F+IG +++L +K  +LNTR+RNL GY 
Sbjct  30    LLAWNSMLTIVDYYAYLFPWYHPSRILTIIYQSFSIGALSVLVHKEARLNTRRRNLFGYS  89

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LF LG+ A+L+L+L TSG+GG+G++IG+CVI A+FG+ADAHV GG++GDLS M PEFLQS
Sbjct  90    LFSLGSLAVLVLNLATSGRGGIGSFIGVCVISAAFGLADAHVYGGMIGDLSMMTPEFLQS  149

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTSGLRLV KAAF++S +GLRKG  LFLA+S  FE +C++LYA+VFP++ 
Sbjct  150   FLAGLAASGALTSGLRLVIKAAFKNSRDGLRKGATLFLAMSASFELVCVLLYAYVFPRIP  209

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDA--KHVERVSNKKLFMENIDYALDL  717
             +VKYYRAKA  +GS+TV ADLAA GI     + D+   ++  R++   L +   D A+ L
Sbjct  210   VVKYYRAKAIIQGSRTVWADLAAGGIQVQPITQDEEALRYDHRLNKGDLMLLYSDLAVTL  269

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +L+Y++T SIFPGFL E+TG ++LG WY  VL+A++N+ DL+ RY+P++KK+++KSRK L
Sbjct  270   FLVYLLTFSIFPGFLSEDTGKYSLGDWYALVLIAVFNVSDLVGRYVPMVKKLKMKSRKCL  329

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             +I    R LLIP F  T  YG QGWMI L+S LGL+NGYLTVCV+T+AP     P  NAL
Sbjct  330   LITSLGRLLLIPAFNITGIYGSQGWMIFLMSVLGLSNGYLTVCVITSAPYDLLAPEQNAL  389

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNS  1158
             GN+LVL +  G+F+GVA DWLWL+G  
Sbjct  390   GNLLVLYICGGMFAGVACDWLWLVGKD  416



>ref|NP_187610.1| equilibrative nucleotide transporter 2 [Arabidopsis thaliana]
 sp|Q9SR64.1|ENT2_ARATH RecName: Full=Equilibrative nucleotide transporter 2; Short=AtENT2; 
AltName: Full=Nucleoside transporter ENT2 [Arabidopsis 
thaliana]
 gb|AAF04424.1|AC010927_17 hypothetical protein [Arabidopsis thaliana]
 gb|AEE74845.1| equilibrative nucleotide transporter 2 [Arabidopsis thaliana]
Length=417

 Score =   434 bits (1116),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 226/387 (58%), Positives = 300/387 (78%), Gaps = 2/387 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L++WNSMLTI DYY  LFP YHPSR+LT++YQ F+IG +++L +K  +LNTR+RNL GY 
Sbjct  30    LLAWNSMLTIVDYYAYLFPWYHPSRILTIIYQSFSIGALSVLVHKEARLNTRRRNLFGYS  89

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LF LG+ A+L+L+L TSG+GG+G++IG+CVI A+FG+ADAHV GG++GDLS M PEFLQS
Sbjct  90    LFSLGSLAVLVLNLATSGRGGIGSFIGVCVISAAFGLADAHVYGGMIGDLSMMTPEFLQS  149

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTSGLRLV KAAF++S +GLRKG  LF A+S  FE +C++LYA+VFP++ 
Sbjct  150   FLAGLAASGALTSGLRLVIKAAFKNSRDGLRKGATLFFAMSASFELVCVLLYAYVFPRIP  209

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDA--KHVERVSNKKLFMENIDYALDL  717
             +VKYYRAKA  +GS+TV ADLAA GI     + D+   ++  R++   L +   D A+ L
Sbjct  210   VVKYYRAKAIIQGSRTVWADLAAGGIQVQPITQDEEALRYDHRLNKGDLMLLYSDLAVTL  269

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +L+Y++T SIFPGFL E+TG ++LG WY  VL+A++N+ DL+ RY+P++KK+++KSRK L
Sbjct  270   FLVYLLTFSIFPGFLSEDTGKYSLGDWYALVLIAVFNVSDLVGRYVPMVKKLKMKSRKCL  329

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             +I    R LLIP F  T  YG QGWMI L+S LGL+NGYLTVCV+T+AP     P  NAL
Sbjct  330   LITSLGRLLLIPAFNITGIYGSQGWMIFLMSVLGLSNGYLTVCVITSAPYDLLAPEQNAL  389

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNS  1158
             GN+LVL +  G+F+GVA DWLWL+G  
Sbjct  390   GNLLVLYICGGMFAGVACDWLWLVGKD  416



>ref|XP_006287796.1| hypothetical protein CARUB_v10001007mg, partial [Capsella rubella]
 gb|EOA20694.1| hypothetical protein CARUB_v10001007mg, partial [Capsella rubella]
Length=432

 Score =   434 bits (1116),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 223/386 (58%), Positives = 286/386 (74%), Gaps = 6/386 (2%)
 Frame = +1

Query  13    WNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY--Il  186
             W +M+T  D Y  LFP YH SR+LTL+YQ   IG +++L YK   LNTR RNL GY    
Sbjct  46    WTTMVTTIDSYANLFP-YHTSRILTLIYQSITIGVLSVLVYKEASLNTRLRNLFGYSLFA  104

Query  187   fflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSF  366
             F      +  LDL T G+G + ++IG+C+I   FGVA+AHVQGG++GD S M PEF+QSF
Sbjct  105   FCSLAVLVWQLDLSTLGRGSISSFIGLCIISVVFGVANAHVQGGMIGDFSMMAPEFVQSF  164

Query  367   LAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAI  546
             LAGLAASG LTSGLRLVTKA F++S   LRKG +L  A+S FFEF+CIILYA++FPKLAI
Sbjct  165   LAGLAASGALTSGLRLVTKATFKNSREDLRKGAMLLFAISVFFEFVCIILYAYIFPKLAI  224

Query  547   VKYYRAKAASEGSKTVAADLAAAGITA-PSESVDDAKHV--ERVSNKKLFMENIDYALDL  717
             VKYYRA+A ++GSKTV ADLAA GI   P+E   +AK +  +R SNK LF+ N+DYA++L
Sbjct  225   VKYYRAQAMAQGSKTVLADLAAGGIQGLPTEKAKEAKMILDQRFSNKVLFLMNMDYAINL  284

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +L+Y++T SIF GFL ++ G HNLG W+  VL+A++N  DL+ RY+PL+KK++++S+K L
Sbjct  285   FLVYLLTTSIFHGFLSKDMGKHNLGDWFLLVLIAVFNFSDLVGRYVPLVKKLKIRSQKVL  344

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             MI    RFLL+P  YFTAKYG+QGW+I L S LG +NGYLTVC+LT AP+G+  P  NAL
Sbjct  345   MIISCGRFLLVPALYFTAKYGNQGWIIFLTSVLGSSNGYLTVCILTTAPEGHLAPEQNAL  404

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GNILVLCL  G+F+GV  D    IG 
Sbjct  405   GNILVLCLSGGMFAGVICDLALFIGK  430



>gb|AAD25545.1|AC005850_2 Hypothetical protein [Arabidopsis thaliana]
Length=382

 Score =   430 bits (1105),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 223/370 (60%), Positives = 278/370 (75%), Gaps = 2/370 (1%)
 Frame = +1

Query  61    KYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYIlfflgtfalllldlgtsgk  240
             KYHPSRVLT+VYQ  A   I  LA K  KLNTR RN+ GY L+  GTF L++LDL + G 
Sbjct  13    KYHPSRVLTIVYQLVANVFIITLATKEAKLNTRLRNIFGYSLYTAGTFCLIILDLASHGS  72

Query  241   gglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQSFLAGLAASGTLTSGLRLVT  420
             G +  Y+ +C+IVA FG+ADA VQG +VGDLSFM P+F+Q+F+AGL  +G LTS LRL+T
Sbjct  73    GSVVAYVLLCLIVALFGLADAFVQGAMVGDLSFMSPDFIQAFMAGLGIAGALTSVLRLIT  132

Query  421   KAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLAIVKYYRAKAASEGSKTVAA  600
             KA F++S +GLRKG +LF+ ++T  E  C+ LY  VF KL IVKYYRAKA  EG+KTV+A
Sbjct  133   KAIFDNSPDGLRKGALLFIGIATLIELACVFLYTLVFAKLPIVKYYRAKAGKEGAKTVSA  192

Query  601   DLAAAGITAPSESVD--DAKHVERVSNKKLFMENIDYALDLYLIYVVTLSIFPGFLYENT  774
             DLAAAG+   +E V   D   +++++ K+L  ENID  ++L LIYVVTLSIFPGFLYENT
Sbjct  193   DLAAAGLQEQAEQVHQMDESKIQKLTKKQLLRENIDLGINLSLIYVVTLSIFPGFLYENT  252

Query  775   GTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMIAIQSRFLLIPCFYFTAK  954
             G H LG WY  VLVAMYN WD ISR+IP IK + ++SRK + + + +R LL+P FYFTAK
Sbjct  253   GEHRLGDWYAPVLVAMYNGWDAISRFIPSIKPLAMESRKWITVCVVARLLLVPAFYFTAK  312

Query  955   YGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGNILVLCLLSGIFSGVALD  1134
             Y DQGWM+ L SFLGL+NGYLTVC+ + APKGY GP ANALGN++ + LL GIF+GV L 
Sbjct  313   YADQGWMLFLTSFLGLSNGYLTVCIFSTAPKGYNGPEANALGNLMCVFLLGGIFAGVCLG  372

Query  1135  WLWLIGNSGF  1164
             WLWLIGN  F
Sbjct  373   WLWLIGNDSF  382



>ref|XP_010418131.1| PREDICTED: equilibrative nucleotide transporter 3-like [Camelina 
sativa]
Length=382

 Score =   425 bits (1092),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 226/387 (58%), Positives = 278/387 (72%), Gaps = 19/387 (5%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
              LV+WN++LTI DYYYQ+FP+YHPSRVLTLVYQPF +GTI IL + G+    +KR   GY
Sbjct  11    QLVAWNTILTISDYYYQVFPEYHPSRVLTLVYQPFVLGTICILVFMGKTNKNQKRITIGY  70

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              +FF+GT  L++LDL T G G L  YI +C IVA FG+A+AHV+G +VG+LSFMCPEF+Q
Sbjct  71    TIFFIGTLLLIILDLVTKGAGDLSVYIVLCSIVACFGIANAHVEGAMVGELSFMCPEFIQ  130

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGL  +G +TS LRL+TKA F+ S NGLRKG +LFLA ST  EF+CI+LY  +FPKL
Sbjct  131   SFIAGLGIAGAITSALRLLTKAVFDRSPNGLRKGALLFLAFSTLIEFICIVLYVHIFPKL  190

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
             ++VKYY AKA S   +                   + K   R+SNK+L  +N + A++L+
Sbjct  191   SLVKYYYAKAESIHREA------------------EEKQTSRLSNKELLYQNRNLAINLF  232

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIY +TLSIFPGFLYENTG H LGSWYP VLVA YN WD  SRYIPLI+ ++LKS K + 
Sbjct  233   LIYTLTLSIFPGFLYENTGEHKLGSWYPLVLVASYNGWDAFSRYIPLIEHLKLKSEKWIT  292

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPK-GYKGPAANAL  1077
               +  RFL +P FYFTAK  DQGWMI L SFLGLTNGYLTVCV+   PK  Y     NAL
Sbjct  293   ACVLMRFLFVPAFYFTAKNADQGWMISLTSFLGLTNGYLTVCVMAVTPKSNYNVLETNAL  352

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNS  1158
             GN+LV  +L GIF+GV L WLWL+G S
Sbjct  353   GNLLVGFMLGGIFAGVCLGWLWLLGTS  379



>ref|XP_006396629.1| hypothetical protein EUTSA_v10029294mg [Eutrema salsugineum]
 gb|ESQ38082.1| hypothetical protein EUTSA_v10029294mg [Eutrema salsugineum]
Length=388

 Score =   421 bits (1081),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 224/385 (58%), Positives = 283/385 (74%), Gaps = 32/385 (8%)
 Frame = +1

Query  1     SLVSWNSMLTIGDY-YYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAG  177
             SLVSWNS+LT   +  +     YHP RVLT VYQPFA+GTI ILAY   KLNTR RNL G
Sbjct  30    SLVSWNSLLTNTKFSRFGFNSDYHPLRVLTFVYQPFALGTITILAYHESKLNTRTRNLVG  89

Query  178   YIlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFL  357
             YI+F + TF +++LDL T G GG+G YI +C IVASFG+ADA V+GG++GDLS M PE +
Sbjct  90    YIVFTISTFLIIVLDLSTKGHGGIGPYIVLCTIVASFGLADAAVRGGMIGDLSLMSPELI  149

Query  358   QSFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPK  537
             QSF+AGL+ +G LTS LRL++KAAFE S +GLR G ++FLA+STF EFLC++LYA+VFP 
Sbjct  150   QSFMAGLSVAGALTSALRLISKAAFEKSHDGLRIGAMIFLAISTFIEFLCVMLYAYVFPT  209

Query  538   LAIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDL  717
             L I                                DD+ +  R+S K+L ++NIDY ++L
Sbjct  210   LPIGN------------------------------DDSNN-RRLSKKELLLQNIDYDMNL  238

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +LI+V+T+SIFPGFLYENTG H LG+WY  +L+A+ N WDL+ RY PL+  +++++RKGL
Sbjct  239   FLIFVLTISIFPGFLYENTGQHGLGTWYALILIAVCNWWDLVGRYAPLVNWLKVENRKGL  298

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
              IA+ S +LLIP FYFTAKYGDQGWMIMLVS LGLTNGYL+VC+LT APKGYKGP  NAL
Sbjct  299   TIAVLSHYLLIPAFYFTAKYGDQGWMIMLVSVLGLTNGYLSVCILTIAPKGYKGPEQNAL  358

Query  1078  GNILVLCLLSGIFSGVALDWLWLIG  1152
             G +L + L  GIF+G+ALDWLWLIG
Sbjct  359   GKLLAMFLSGGIFAGIALDWLWLIG  383



>ref|XP_010489734.1| PREDICTED: equilibrative nucleotide transporter 2-like [Camelina 
sativa]
Length=418

 Score =   422 bits (1084),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 219/386 (57%), Positives = 294/386 (76%), Gaps = 10/386 (3%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L++WN+MLT+ DYY  +FP+YHPSR+L ++YQ FAIG +++L YK   LNTR+RNL GY 
Sbjct  38    LLAWNTMLTVVDYYAYMFPRYHPSRILAIIYQSFAIGALSVLVYKEASLNTRRRNLFGYS  97

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LF LG+ A+L+++L TSG+GG+G++IG+CVI A+FG+ADAHV GG++GDLS M PEF+QS
Sbjct  98    LFALGSLAVLVVNLSTSGRGGIGSFIGVCVISAAFGLADAHVLGGMIGDLSLMAPEFVQS  157

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             FLAGLAASG LTSGLR VTKA F++S +GLRKG +LF A+S  FE +C++LYA+VFPKL+
Sbjct  158   FLAGLAASGALTSGLRQVTKAVFKNSRDGLRKGAMLFFAISVVFELVCVMLYAYVFPKLS  217

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITA-PSESVDDAKHV-ERVSNKKLFMENIDYALDL  717
             IVKYYRA+A  +GS TV  DLAA GI   P    ++A  + +R SNK LF+ N+  A++L
Sbjct  218   IVKYYRAQAVPQGSTTVWGDLAAGGIQELPRRQAEEALEISDRFSNKVLFLLNLGNAINL  277

Query  718   YLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGL  897
             +L+Y+VT   FP     N         YP +L+A++N+  L+ RY+PL+KK++++S KGL
Sbjct  278   FLVYLVTFRFFPRKTAWNR--------YPLMLIAVFNVSHLVGRYVPLVKKLKMESEKGL  329

Query  898   MIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANAL  1077
             MI    RF L+P FYFTA YG+Q WMI L S LGL+NGYLTVC+LT+A +G+  P  NAL
Sbjct  330   MITTFGRFWLVPAFYFTATYGNQVWMIFLTSVLGLSNGYLTVCILTSATEGHLAPEQNAL  389

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGN  1155
             GN+LVLC+  G+F+GV  DW+WLIG 
Sbjct  390   GNMLVLCISGGMFAGVICDWIWLIGK  415



>ref|XP_004492293.1| PREDICTED: equilibrative nucleotide transporter 3-like [Cicer 
arietinum]
Length=459

 Score =   423 bits (1087),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 233/385 (61%), Positives = 295/385 (77%), Gaps = 5/385 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L++ N+M T+GDYYY++FP YHP  V T++YQPF++ T  ILA+   ++N+R RNL GY 
Sbjct  31    LIALNNMWTMGDYYYKVFPSYHPLLVFTIIYQPFSLTTTFILAHYESRINSRIRNLCGYT  90

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFF+ +  +LLLDL TSGKGG+G +IG+ V+ A FGV  A VQGG+ G+L+FMCPEF+QS
Sbjct  91    LFFILSSLVLLLDLATSGKGGIGPFIGLNVLFACFGVTHAFVQGGVSGELAFMCPEFIQS  150

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             F+ G+ ASG +  GLR+ TK  FE  +NGLRKG +L LA+STFF+ L +ILYAF F KL+
Sbjct  151   FIGGMTASGAVACGLRIFTKYNFEKYNNGLRKGALLSLAISTFFQLLSLILYAFYFSKLS  210

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYL  723
             IVKYYR+KAASEG+KT   +     +    +    A   + +S+KKLF+ENIDY   +++
Sbjct  211   IVKYYRSKAASEGAKTYIQN-----VDTNQQVGFVANQQDGLSHKKLFIENIDYFAIIFM  265

Query  724   IYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMI  903
              YV+TLSI PGFLYE+TG H LG+WYP VL+ MYNI DLIS YIPLIK ++L+SRKGL++
Sbjct  266   TYVLTLSIMPGFLYEDTGIHKLGTWYPLVLMTMYNIMDLISSYIPLIKCLKLESRKGLLV  325

Query  904   AIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGN  1083
                SRFLL+P FYFTAKYGDQGWMI+LVS+LGLTNGY+TVCV T  PKGYKG   NALGN
Sbjct  326   TTLSRFLLVPAFYFTAKYGDQGWMILLVSYLGLTNGYVTVCVYTVVPKGYKGSEQNALGN  385

Query  1084  ILVLCLLSGIFSGVALDWLWLIGNS  1158
             +L L LLSG+F GV L WLWLIGNS
Sbjct  386   MLALWLLSGVFVGVVLGWLWLIGNS  410



>gb|EMT28617.1| Equilibrative nucleoside transporter 4 [Aegilops tauschii]
Length=609

 Score =   425 bits (1093),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 224/359 (62%), Positives = 283/359 (79%), Gaps = 4/359 (1%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L  +NSMLTI DY+  LFP YHP RV+TL YQPF +   A+ AY   K+NTR RNL GY 
Sbjct  117   LFGYNSMLTIEDYFVHLFPNYHPVRVITLTYQPFVLVVAAVFAYHEAKVNTRVRNLVGYS  176

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFLG+ AL++LDL TSG+GG+  +IG+C +VA FGVA+ HV+G + GDLS MCPEF+QS
Sbjct  177   LFFLGSLALIILDLATSGRGGIATFIGVCTVVAVFGVAEGHVEGAMTGDLSLMCPEFIQS  236

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             F AG+AASG +TS LRL+TKAAFE S +GLR+G +LF + S FFE LC++LYA VFPKL 
Sbjct  237   FSAGMAASGAITSALRLITKAAFEKSRDGLRRGAMLFFSASCFFELLCVVLYAHVFPKLP  296

Query  544   IVKYYRAKAASEGSKTVAADLAAAGI---TAPSESVDDAKHVERVSNKKLFMENIDYALD  714
             IVK+YRAKAASEGS TVAADLAAAG+   T PS + DD    ER+SNK+L M+N+DYALD
Sbjct  297   IVKFYRAKAASEGSLTVAADLAAAGLQRHTKPS-AEDDPAIPERLSNKQLLMQNMDYALD  355

Query  715   LYLIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKG  894
             ++LIY++TLSIFPGFL E+ G+H+LGSWY  VL+A YN  DLI RY PL++ +++ SR+G
Sbjct  356   MFLIYLLTLSIFPGFLAEDLGSHSLGSWYALVLIASYNGSDLIGRYAPLVESIKVTSRRG  415

Query  895   LMIAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAAN  1071
             L+ A+ +R+LL+P FY+ A+YG + WMI+LVS LGL+NGYLTVCVLT AP+ YK P A 
Sbjct  416   LLAAVLARYLLLPAFYYAARYGGEAWMIVLVSALGLSNGYLTVCVLTEAPRPYKIPKAR  474



>ref|XP_009104859.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Brassica rapa]
 ref|XP_009104881.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X2 [Brassica rapa]
Length=382

 Score =   415 bits (1067),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 218/387 (56%), Positives = 279/387 (72%), Gaps = 19/387 (5%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
              LV+WN++LTI DYYYQ+FP+YHPSRVLTLVYQPF +GTI IL + G+K   +K+   GY
Sbjct  11    QLVAWNTILTISDYYYQVFPEYHPSRVLTLVYQPFVLGTIFILVFMGKKKKNQKQIAIGY  70

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              +FF+G+  L++LD+ T G+G L  YI +C IVA FG+A+AHV+G ++G+LSFMCPEF+Q
Sbjct  71    TIFFIGSLLLIILDVATKGEGTLLAYIFLCSIVACFGMANAHVEGAMLGELSFMCPEFIQ  130

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGL  +G +TS LRLVTKA F+ S NGLRKG +LFLA ST  EF+C++LY ++FPKL
Sbjct  131   SFVAGLGVAGAITSALRLVTKAVFDKSPNGLRKGALLFLAFSTLIEFICMLLYIYMFPKL  190

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVK+Y AKA S   +                   D   + ++SNK+L  +N+  A++L+
Sbjct  191   PIVKHYYAKAESNHVEA------------------DETKITQLSNKELLDQNMGLAINLF  232

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIY +TLSIFPGFLYENTG H LGSWYP VLVA YN+WD  SRYIPL K ++++S K + 
Sbjct  233   LIYALTLSIFPGFLYENTGEHKLGSWYPLVLVASYNVWDAFSRYIPLSKHLKIESIKWIT  292

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKG-YKGPAANAL  1077
               +  RFL +P FYFTAK  DQGWM++L S LGLTNGYLTVCVL   PK  Y     +AL
Sbjct  293   SCVLVRFLFVPAFYFTAKSADQGWMVLLTSLLGLTNGYLTVCVLANKPKSKYNVLETDAL  352

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNS  1158
             GN+LV  +L GIF+GV L WLWLIG  
Sbjct  353   GNLLVSFMLGGIFAGVCLGWLWLIGTK  379



>ref|XP_009104851.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Brassica rapa]
 ref|XP_009104875.1| PREDICTED: equilibrative nucleotide transporter 3-like isoform 
X1 [Brassica rapa]
Length=435

 Score =   415 bits (1066),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 218/387 (56%), Positives = 279/387 (72%), Gaps = 19/387 (5%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
              LV+WN++LTI DYYYQ+FP+YHPSRVLTLVYQPF +GTI IL + G+K   +K+   GY
Sbjct  64    QLVAWNTILTISDYYYQVFPEYHPSRVLTLVYQPFVLGTIFILVFMGKKKKNQKQIAIGY  123

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              +FF+G+  L++LD+ T G+G L  YI +C IVA FG+A+AHV+G ++G+LSFMCPEF+Q
Sbjct  124   TIFFIGSLLLIILDVATKGEGTLLAYIFLCSIVACFGMANAHVEGAMLGELSFMCPEFIQ  183

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF+AGL  +G +TS LRLVTKA F+ S NGLRKG +LFLA ST  EF+C++LY ++FPKL
Sbjct  184   SFVAGLGVAGAITSALRLVTKAVFDKSPNGLRKGALLFLAFSTLIEFICMLLYIYMFPKL  243

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVK+Y AKA S   +                   D   + ++SNK+L  +N+  A++L+
Sbjct  244   PIVKHYYAKAESNHVEA------------------DETKITQLSNKELLDQNMGLAINLF  285

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             LIY +TLSIFPGFLYENTG H LGSWYP VLVA YN+WD  SRYIPL K ++++S K + 
Sbjct  286   LIYALTLSIFPGFLYENTGEHKLGSWYPLVLVASYNVWDAFSRYIPLSKHLKIESIKWIT  345

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKG-YKGPAANAL  1077
               +  RFL +P FYFTAK  DQGWM++L S LGLTNGYLTVCVL   PK  Y     +AL
Sbjct  346   SCVLVRFLFVPAFYFTAKSADQGWMVLLTSLLGLTNGYLTVCVLANKPKSKYNVLETDAL  405

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNS  1158
             GN+LV  +L GIF+GV L WLWLIG  
Sbjct  406   GNLLVSFMLGGIFAGVCLGWLWLIGTK  432



>gb|EEE67397.1| hypothetical protein OsJ_24711 [Oryza sativa Japonica Group]
Length=463

 Score =   408 bits (1049),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 232/384 (60%), Positives = 284/384 (74%), Gaps = 25/384 (7%)
 Frame = +1

Query  4     LVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGYI  183
             L  +NSMLTI DYY  LFP YHP+RV+TL YQPF + T AI  Y   K+NTR RNLAGY 
Sbjct  103   LFGFNSMLTIEDYYTFLFPNYHPTRVVTLTYQPFVLRTTAIFTYHEAKVNTRLRNLAGYT  162

Query  184   lfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQS  363
             LFFL +FA ++LD+ TSG+GG+  ++G+C+I A+FGVAD HVQGG+ GDLS MCPEF+QS
Sbjct  163   LFFLSSFAAIVLDVATSGRGGITPFVGVCIIAAAFGVADGHVQGGMTGDLSLMCPEFIQS  222

Query  364   FLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKLA  543
             F AGLAASG +TS LRL+TKAAFE+S +GLRKG +LF ++S FFE LC++LYAF+FPKL 
Sbjct  223   FFAGLAASGMITSALRLITKAAFENSRDGLRKGAMLFSSISCFFELLCVLLYAFIFPKLP  282

Query  544   IVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLYL  723
             IVK+YR+KAASEGS TVAADLAA GI              R +     +++  +AL   L
Sbjct  283   IVKFYRSKAASEGSLTVAADLAAGGIQ------------NRANPLLKTLDHTAWALGTVL  330

Query  724   IYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLMI  903
              +V+                ++   Y  VL+A YN+WDLI RYIPLI++V+L+SRK ++I
Sbjct  331   TFVLDFG-------------SIIDRYALVLIASYNVWDLIGRYIPLIEQVKLRSRKVILI  377

Query  904   AIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPKGYKGPAANALGN  1083
             A+ SRFLLIP FY+TAKY DQGWMIML SFLGL+NGYLTVC+LT APKGYKGP  NALGN
Sbjct  378   AVVSRFLLIPAFYYTAKYSDQGWMIMLTSFLGLSNGYLTVCILTEAPKGYKGPEQNALGN  437

Query  1084  ILVLCLLSGIFSGVALDWLWLIGN  1155
             +LVL LL GIF G  LDWLWLIG 
Sbjct  438   LLVLSLLGGIFCGAILDWLWLIGK  461



>gb|KFK40683.1| hypothetical protein AALP_AA2G027800 [Arabis alpina]
Length=400

 Score =   405 bits (1041),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 219/387 (57%), Positives = 274/387 (71%), Gaps = 19/387 (5%)
 Frame = +1

Query  1     SLVSWNSMLTIGDYYYQLFPKYHPSRVLTLVYQPFAIGTIAILAYKGEKLNTRKRNLAGY  180
              LV+WN++LTI DYYY++FP+YHPSRVLTLVYQPF +GT+ IL + G+    RKR + GY
Sbjct  29    QLVAWNTILTISDYYYKVFPEYHPSRVLTLVYQPFVVGTMLILIFMGKTNKNRKRIMTGY  88

Query  181   IlfflgtfalllldlgtsgkgglgNYIGICVIVASFGVADAHVQGGIVGDLSFMCPEFLQ  360
              +FF+GT  L+ LDL T G+GGL  YI +C IVA  G+ +AHV+G +VG+LSFMCPEF+Q
Sbjct  89    GIFFIGTLLLITLDLATKGEGGLSTYILLCSIVACLGIGNAHVEGAMVGELSFMCPEFIQ  148

Query  361   SFLAGLAASGTLTSGLRLVTKAAFEHSSNGLRKGVILFLAVSTFFEFLCIILYAFVFPKL  540
             SF AGL  +G +TS LRL TKA FE + NGLRKG +LFLA S   EF C++LY  +FPKL
Sbjct  149   SFFAGLGIAGAMTSALRLFTKAVFEKTPNGLRKGALLFLAFSVLIEFACMVLYICIFPKL  208

Query  541   AIVKYYRAKAASEGSKTVAADLAAAGITAPSESVDDAKHVERVSNKKLFMENIDYALDLY  720
              IVKYY AKA S   +    +L                   R+SNK L  +N++ A++L+
Sbjct  209   QIVKYYYAKARSNHLEAEETNLV------------------RLSNKDLIYQNMELAINLF  250

Query  721   LIYVVTLSIFPGFLYENTGTHNLGSWYPTVLVAMYNIWDLISRYIPLIKKVELKSRKGLM  900
             L+YV+TLSIFPGFLYENTG H+LGSWY  VL+A YN  D  SRYIPLIK ++++SRK + 
Sbjct  251   LVYVLTLSIFPGFLYENTGEHDLGSWYSLVLIASYNGCDAFSRYIPLIKHLKIESRKWIT  310

Query  901   IAIQSRFLLIPCFYFTAKYGDQGWMIMLVSFLGLTNGYLTVCVLTAAPK-GYKGPAANAL  1077
               +  RFL +P FYFTAK  DQGWMI+L S LGLTNGYLTVCVL   PK  Y     +AL
Sbjct  311   GCVLMRFLFVPAFYFTAKNADQGWMIILTSILGLTNGYLTVCVLAVKPKSNYNVLETDAL  370

Query  1078  GNILVLCLLSGIFSGVALDWLWLIGNS  1158
             GN+LV  +L GIF+GV L WLWLIG +
Sbjct  371   GNLLVSFMLGGIFAGVCLGWLWLIGTN  397



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3249488224448