BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25500_g2_i9 len=937 path=[12838:0-57 34252:58-68 34263:69-72
255:73-88 34284:89-96 34292:97-112 30743:113-160 6031:161-196
6067:197-323 6194:324-393 6264:394-419 32675:420-436 6304:437-574
34612:575-583 6451:584-626 6494:627-632 6500:633-658 6526:659-680
6548:681-686 6554:687-733 34750:734-734 34751:735-752 30456:753-907
30611:908-936]

Length=937
                                                                      Score     E

ref|XP_011092043.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    242   2e-72   
ref|XP_011077685.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    239   2e-71   
ref|XP_009628063.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    237   1e-70   
ref|XP_009787025.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    236   2e-70   
ref|XP_002325143.2|  transferase family protein                         236   3e-70   Populus trichocarpa [western balsam poplar]
ref|XP_011018001.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    233   5e-69   
ref|XP_006359722.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    232   1e-68   
ref|XP_007161968.1|  hypothetical protein PHAVU_001G112900g             231   2e-68   
gb|KHN17617.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    229   9e-68   
ref|XP_002521543.1|  Anthranilate N-benzoyltransferase protein, p...    229   1e-67   Ricinus communis
ref|XP_003550654.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    229   1e-67   
ref|XP_004243059.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    229   2e-67   
gb|KDO61846.1|  hypothetical protein CISIN_1g036315mg                   229   2e-67   
ref|XP_006453312.1|  hypothetical protein CICLE_v10008265mg             228   4e-67   
ref|XP_010050942.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    228   8e-67   
ref|XP_002269790.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    226   2e-66   Vitis vinifera
ref|XP_004301782.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    224   1e-65   
ref|XP_006381775.1|  hypothetical protein POPTR_0006s17880g             224   1e-65   
ref|XP_007211620.1|  hypothetical protein PRUPE_ppa005563mg             224   2e-65   
ref|XP_006409088.1|  hypothetical protein EUTSA_v10022690mg             223   3e-65   
ref|XP_010050943.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    222   8e-65   
gb|KCW80900.1|  hypothetical protein EUGRSUZ_C02269                     222   9e-65   
ref|NP_179497.1|  spermidine hydroxycinnamoyl transferase               222   9e-65   Arabidopsis thaliana [mouse-ear cress]
gb|KFK40283.1|  hypothetical protein AALP_AA3G354800                    221   1e-64   
gb|KHN17616.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    218   5e-64   
ref|XP_007154735.1|  hypothetical protein PHAVU_003G143100g             220   8e-64   
ref|XP_006296658.1|  hypothetical protein CARUB_v10015907mg             218   2e-63   
ref|XP_009358743.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    219   2e-63   
ref|XP_010489453.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    218   2e-63   
ref|XP_002884178.1|  transferase family protein                         218   2e-63   
gb|ACC68164.1|  unknown                                                 218   3e-63   Arabidopsis halleri subsp. halleri
ref|XP_008223799.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    218   4e-63   
gb|AFF57840.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    218   5e-63   
ref|XP_003550655.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    218   5e-63   
ref|XP_010548604.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    217   5e-63   
ref|XP_008372277.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    217   5e-63   
ref|XP_010467740.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    217   8e-63   
ref|XP_010414994.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    216   1e-62   
gb|EPS69670.1|  hypothetical protein M569_05094                         214   8e-62   
ref|XP_010673351.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    211   1e-60   
emb|CDY62143.1|  BnaCnng39330D                                          208   3e-60   
emb|CDY56515.1|  BnaCnng30570D                                          208   4e-60   
ref|XP_009150708.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    209   8e-60   
ref|XP_008223800.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    209   1e-59   
ref|XP_009112574.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    207   3e-59   
ref|XP_004507883.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    207   4e-59   
ref|XP_003610074.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    207   6e-59   
emb|CDY03367.1|  BnaC09g09810D                                          206   9e-59   
emb|CDY66506.1|  BnaAnng22360D                                          204   3e-58   
gb|AES90726.2|  spermidine hydroxycinnamoyl transferase                 204   4e-58   
gb|KCW82842.1|  hypothetical protein EUGRSUZ_C04213                     204   5e-58   
ref|XP_010051711.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    204   7e-58   
ref|XP_010541075.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    204   4e-57   
ref|XP_010034869.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    200   2e-56   
ref|XP_008231463.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    198   1e-55   
ref|XP_011076842.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    198   3e-55   
ref|XP_007161967.1|  hypothetical protein PHAVU_001G112800g             197   4e-55   
ref|XP_007214780.1|  hypothetical protein PRUPE_ppa023555mg             195   1e-54   
ref|XP_002274695.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    194   4e-54   Vitis vinifera
gb|EYU26551.1|  hypothetical protein MIMGU_mgv1a006988mg                192   6e-54   
emb|CBI36554.3|  unnamed protein product                                192   2e-53   
ref|XP_010094198.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    192   3e-53   
ref|XP_010656623.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    191   5e-53   
ref|XP_008231492.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    189   2e-52   
ref|XP_010110725.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    187   1e-51   
ref|XP_002276550.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    185   5e-51   Vitis vinifera
emb|CAN72449.1|  hypothetical protein VITISV_011069                     182   1e-49   Vitis vinifera
gb|AFD64619.1|  putative hydroxycinnamoyl-CoA:shikimate/quinate h...    182   1e-49   
emb|CAT00087.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    174   2e-48   Coffea arabica [arabica coffee]
emb|CDP21167.1|  unnamed protein product                                176   1e-47   
ref|XP_003608529.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    177   2e-47   
emb|CDP18830.1|  unnamed protein product                                176   3e-47   
ref|XP_010265516.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    174   1e-46   
gb|EPS68189.1|  hypothetical protein M569_06582                         171   1e-45   
ref|XP_011083883.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    169   9e-45   
gb|ADD71921.1|  BAHD-type hydroxycinnamoyltransferase                   165   2e-43   Actaea racemosa
ref|XP_007219083.1|  hypothetical protein PRUPE_ppa014960mg             164   6e-43   
ref|XP_010669430.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    164   1e-42   
emb|CDP05692.1|  unnamed protein product                                163   2e-42   
ref|XP_011069658.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    161   5e-42   
ref|XP_004166134.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    160   1e-41   
gb|EYU25632.1|  hypothetical protein MIMGU_mgv1a006215mg                159   3e-41   
ref|XP_010669388.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    159   4e-41   
ref|XP_004149124.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    157   1e-40   
gb|KHN29832.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    157   2e-40   
ref|XP_003551937.2|  PREDICTED: spermidine hydroxycinnamoyl trans...    157   3e-40   
ref|XP_003532115.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    157   3e-40   
ref|XP_003599927.1|  Anthranilate N-benzoyltransferase protein          150   2e-39   
ref|XP_003548918.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    154   3e-39   
gb|KHN13395.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    153   5e-39   
gb|KHN35439.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    152   5e-39   
gb|ACU23734.1|  unknown                                                 153   5e-39   Glycine max [soybeans]
ref|XP_006605610.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    153   7e-39   
ref|XP_003555244.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    153   8e-39   
ref|XP_003553113.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    152   2e-38   
gb|KHN18130.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    152   2e-38   
ref|XP_008441993.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    151   2e-38   
ref|XP_009798536.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    150   4e-38   
ref|XP_010273688.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    150   5e-38   
gb|EPS67739.1|  hypothetical protein M569_07035                         150   7e-38   
ref|XP_009614241.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    149   8e-38   
ref|XP_007146248.1|  hypothetical protein PHAVU_006G024700g             149   1e-37   
gb|EPS73563.1|  hypothetical protein M569_01193                         146   1e-37   
ref|XP_010063583.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    149   2e-37   
gb|KDP38692.1|  hypothetical protein JCGZ_04045                         149   2e-37   
gb|KHM99609.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    148   2e-37   
ref|XP_010063590.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    148   3e-37   
ref|XP_010063586.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    148   3e-37   
ref|XP_003532110.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    148   4e-37   
ref|XP_011073311.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    147   4e-37   
emb|CDG56249.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...    147   7e-37   
gb|AFR67331.1|  hydroxycinnamoyl CoA shikimate hydroxycinnamoyl t...    143   2e-36   
ref|XP_003532111.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    146   2e-36   
ref|XP_004500023.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    146   2e-36   
emb|CDG56248.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...    145   2e-36   
dbj|BAA87043.1|  N-hydroxycinnamoyl/benzoyltransferase                  145   2e-36   Ipomoea batatas [batate]
ref|XP_003553115.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    146   2e-36   
ref|XP_004149125.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    146   3e-36   
gb|ADG46003.1|  hydroxycinnamoyl transferase                            145   4e-36   
gb|ACA64049.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    145   4e-36   
gb|KHN18128.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    145   4e-36   
gb|KHM99608.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    145   5e-36   
ref|XP_006382509.1|  hypothetical protein POPTR_0005s02820g             144   7e-36   
gb|EPS67512.1|  hypothetical protein M569_07262                         144   8e-36   
ref|XP_010545859.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    143   2e-35   
emb|CBI83579.1|  hydroxycinnamoyl transferase                           142   3e-35   
ref|XP_009800587.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    142   3e-35   
gb|AFK47698.1|  unknown                                                 139   3e-35   
emb|CBI25231.3|  unnamed protein product                                142   4e-35   
gb|AGA20364.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...    142   4e-35   
ref|XP_010273689.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    142   4e-35   
ref|XP_007146398.1|  hypothetical protein PHAVU_006G037000g             142   4e-35   
ref|XP_003604491.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    142   5e-35   
ref|XP_006840118.1|  hypothetical protein AMTR_s00727p00010990          139   5e-35   
ref|XP_002268988.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    142   6e-35   Vitis vinifera
ref|XP_010113235.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    142   6e-35   
emb|CAN82918.1|  hypothetical protein VITISV_023290                     141   7e-35   Vitis vinifera
ref|XP_003599928.1|  Anthranilate N-benzoyltransferase protein          142   7e-35   
ref|NP_001289240.1|  shikimate O-hydroxycinnamoyltransferase-like       141   8e-35   
gb|AHG97388.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    142   8e-35   
ref|XP_010094062.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    141   9e-35   
ref|XP_008466864.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    138   1e-34   
ref|XP_009624297.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    140   1e-34   
emb|CAE46932.1|  hydroxycinnamoyl CoA quinate transferase               140   1e-34   Nicotiana tabacum [American tobacco]
ref|XP_010244683.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    140   2e-34   
ref|XP_010063596.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    140   2e-34   
gb|AGE10615.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl tra...    137   2e-34   
gb|AFN85668.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    140   2e-34   
ref|XP_011036967.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    140   2e-34   
ref|XP_010265527.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    140   3e-34   
ref|XP_003599037.1|  Anthranilate N-benzoyltransferase protein          140   3e-34   
gb|AFS68800.1|  hydroxycinnamoyl transferase                            139   3e-34   
gb|AGE10614.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl tra...    135   4e-34   
gb|ACI16631.1|  malate O-hydroxycinnamoyl transferase                   139   4e-34   Trifolium pratense [peavine clover]
ref|XP_011082506.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    139   5e-34   
ref|XP_011036823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    139   5e-34   
ref|XP_010094061.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    139   7e-34   
ref|XP_011018051.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    139   7e-34   
ref|XP_007161962.1|  hypothetical protein PHAVU_001G112400g             139   8e-34   
gb|KDP38697.1|  hypothetical protein JCGZ_04050                         138   8e-34   
ref|XP_002512739.1|  Anthranilate N-benzoyltransferase protein, p...    139   8e-34   Ricinus communis
gb|AEM63675.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...    138   1e-33   
gb|ABO40491.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    138   1e-33   Coffea arabica [arabica coffee]
gb|AFL93687.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-tra...    138   1e-33   
ref|XP_006382508.1|  hypothetical protein POPTR_0005s02810g             138   1e-33   
ref|XP_002324530.2|  hypothetical protein POPTR_0018s11370g             138   1e-33   Populus trichocarpa [western balsam poplar]
ref|XP_009760608.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    137   2e-33   
ref|XP_009626780.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    137   2e-33   
gb|ABK79690.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    137   2e-33   Cynara cardunculus var. altilis [cultivated cardoon]
gb|ABK79689.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    137   2e-33   Cynara cardunculus var. scolymus [artichoke]
ref|XP_009626781.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    137   2e-33   
gb|AEM63676.1|  hydroxycinnamoyl CoA quinate hydroxycinnamoyl tra...    137   2e-33   
ref|XP_002529413.1|  Anthranilate N-benzoyltransferase protein, p...    137   2e-33   Ricinus communis
emb|CCC55431.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxyci...    137   2e-33   
gb|KDP38698.1|  hypothetical protein JCGZ_04051                         137   2e-33   
pdb|4G22|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    137   2e-33   
ref|XP_008342823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    137   3e-33   
pdb|4G2M|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    137   3e-33   
dbj|BAO20883.1|  hydroxycinnamoyl CoA: shikimate hydroxycinnamoyl...    137   3e-33   
gb|ABR17170.1|  unknown                                                 137   3e-33   Picea sitchensis
gb|EYU21749.1|  hypothetical protein MIMGU_mgv1a006630mg                137   3e-33   
ref|XP_004135880.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    137   3e-33   
gb|AEJ88365.1|  hydroxycinnamoyltransferase                             137   4e-33   
ref|XP_002324534.1|  hypothetical protein POPTR_0018s11450g             136   4e-33   Populus trichocarpa [western balsam poplar]
ref|XP_011018044.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    136   4e-33   
ref|XP_011018045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    136   5e-33   
ref|XP_010034043.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    137   5e-33   
gb|KCW53914.1|  hypothetical protein EUGRSUZ_J03126                     137   5e-33   
gb|AHA44839.1|  hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltr...    136   6e-33   
ref|XP_002529412.1|  Anthranilate N-benzoyltransferase protein, p...    136   6e-33   Ricinus communis
pdb|4G0B|A  Chain A, Structure Of Native Hct From Coffea Canephora      136   6e-33   
ref|XP_007027321.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    136   6e-33   
ref|XP_006493385.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    136   6e-33   
gb|ABO47805.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    136   6e-33   Coffea canephora [robusta coffee]
emb|CAJ40778.1|  hydroxycinnamoyl transferase                           136   6e-33   Coffea arabica [arabica coffee]
emb|CDO98242.1|  unnamed protein product                                136   6e-33   
gb|ABO77955.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    136   6e-33   Coffea canephora [robusta coffee]
gb|EYU25633.1|  hypothetical protein MIMGU_mgv1a006801mg                136   6e-33   
gb|AFZ78609.1|  hydroxycinnamoyl-CoA:shikimate/quinate hydroxycin...    136   6e-33   
ref|XP_004303231.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    136   7e-33   
ref|XP_010101376.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    136   7e-33   
dbj|BAJ14794.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    135   8e-33   
gb|ADB44897.1|  hydroxycinnamoyl transferase                            135   8e-33   Sinopodophyllum hexandrum [Himalayan mayapple]
gb|AHA14500.1|  hydroxycinnamoyl-coenzyme A quinate transperase         135   8e-33   
ref|XP_004158793.1|  PREDICTED: LOW QUALITY PROTEIN: shikimate O-...    135   9e-33   
gb|ABO52899.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltr...    135   9e-33   Pinus radiata
ref|XP_010244666.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    135   1e-32   
ref|XP_004500005.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    135   1e-32   
ref|XP_002303858.2|  hypothetical protein POPTR_0003s18210g             133   1e-32   Populus trichocarpa [western balsam poplar]
ref|XP_006368492.1|  transferase family protein                         135   1e-32   
ref|XP_009375480.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    135   1e-32   
ref|XP_006826688.1|  hypothetical protein AMTR_s00137p00072760          135   1e-32   
ref|XP_003580078.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    135   1e-32   
ref|NP_001145871.1|  uncharacterized protein LOC100279386               135   2e-32   Zea mays [maize]
ref|NP_001280198.1|  shikimate O-hydroxycinnamoyltransferase-like       135   2e-32   
gb|AID69225.1|  hydroxycinnamoyl coenzyme A shikimate hydroxycinn...    134   2e-32   
gb|AAZ80046.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    135   2e-32   Cynara cardunculus [cardoon]
gb|AGE10604.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl tra...    132   2e-32   
dbj|BAF49306.1|  putative acyltransferase                               135   2e-32   Clitoria ternatea
ref|XP_008381122.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    134   2e-32   
ref|XP_011034568.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    134   2e-32   
gb|ACZ52698.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    134   2e-32   Lonicera japonica [Japanese honeysuckle]
emb|CAT00081.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    134   2e-32   Coffea arabica [arabica coffee]
gb|AEN02914.1|  HCT1                                                    132   3e-32   
gb|ACI16630.1|  shikimate O-hydroxycinnamoyltransferase                 134   3e-32   Trifolium pratense [peavine clover]
gb|EYU24587.1|  hypothetical protein MIMGU_mgv1a006602mg                134   3e-32   
dbj|BAC78634.1|  hydroxyanthranilate hydroxycinnamoyltransferase 2      134   4e-32   Avena sativa [cultivated oat]
gb|ACG47161.1|  anthranilate N-benzoyltransferase protein 2             134   4e-32   Zea mays [maize]
gb|ACC63882.1|  quinate O-hydroxycinnamoyltransferase/shikimate O...    134   4e-32   Populus trichocarpa [western balsam poplar]
ref|XP_010538049.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    134   5e-32   
gb|KHN31873.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    134   5e-32   
ref|XP_003543709.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    134   5e-32   
gb|AFP49814.1|  caffeoyl-CoA quinic acid caffeoyl transferase 4         133   5e-32   
gb|ABO77956.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    133   5e-32   Coffea canephora [robusta coffee]
gb|KHG20214.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    133   5e-32   
ref|XP_002446745.1|  hypothetical protein SORBIDRAFT_06g021640          133   6e-32   Sorghum bicolor [broomcorn]
emb|CDP02827.1|  unnamed protein product                                134   6e-32   
ref|XP_007215401.1|  hypothetical protein PRUPE_ppa005910mg             133   6e-32   
dbj|BAJ95750.1|  predicted protein                                      133   7e-32   
dbj|BAJ93247.1|  predicted protein                                      133   8e-32   
gb|KEH28560.1|  shikimate/quinate hydroxycinnamoyltransferase           133   8e-32   
ref|XP_007023475.1|  Hydroxycinnamoyl-CoA shikimate/quinate hydro...    133   8e-32   
ref|NP_001234850.1|  hydroxycinnamoyl CoA quinate transferase           133   9e-32   
dbj|BAC78635.1|  hydroxyanthranilate hydroxycinnamoyltransferase 3      133   1e-31   Avena sativa [cultivated oat]
gb|AIG20957.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    132   1e-31   
gb|ACI28534.1|  shikimate O-hydroxycinnamoyl transferase                132   1e-31   Trifolium pratense [peavine clover]
gb|ABO77957.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    132   1e-31   Coffea canephora [robusta coffee]
gb|AEO00530.1|  hydroxycinnamoyl transferase                            132   1e-31   
ref|XP_010527105.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    132   1e-31   
ref|XP_007011895.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    132   2e-31   
gb|AFL93686.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    132   2e-31   
ref|XP_009789449.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    132   2e-31   
ref|XP_004976123.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    132   2e-31   
ref|XP_009366067.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    131   2e-31   
gb|EYU24588.1|  hypothetical protein MIMGU_mgv1a0237892mg               130   2e-31   
gb|AEK80405.1|  HQT                                                     132   2e-31   
ref|XP_009615699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    132   2e-31   
ref|XP_009354208.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    132   2e-31   
gb|AFK10218.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    132   2e-31   
ref|XP_011020577.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    131   2e-31   
gb|AFK40022.1|  unknown                                                 126   3e-31   
ref|XP_004507045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    132   3e-31   
ref|XP_004166135.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    127   3e-31   
ref|XP_004507046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    131   3e-31   
ref|XP_002324532.1|  hypothetical protein POPTR_0018s11380g             131   3e-31   Populus trichocarpa [western balsam poplar]
gb|KHN46761.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    127   3e-31   
ref|XP_007149788.1|  hypothetical protein PHAVU_005G0988001g            126   4e-31   
gb|KHN38057.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    128   4e-31   
emb|CAE01635.3|  OSJNBa0029H02.19                                       131   4e-31   Oryza sativa [red rice]
ref|XP_006652479.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    131   4e-31   
ref|XP_003575337.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    131   4e-31   
ref|XP_009366046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    130   5e-31   
dbj|BAJ87836.1|  predicted protein                                      130   5e-31   
dbj|BAK06288.1|  predicted protein                                      130   5e-31   
gb|KHN04193.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    130   5e-31   
ref|XP_003530223.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    130   6e-31   
ref|XP_006583083.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    130   6e-31   
ref|XP_007150819.1|  hypothetical protein PHAVU_005G183200g             130   6e-31   
ref|XP_006583082.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    130   7e-31   
gb|EMT31749.1|  Anthranilate N-benzoyltransferase protein 3             129   7e-31   
gb|AFF19203.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    130   7e-31   
dbj|BAC78633.1|  hydroxyanthranilate hydroxycinnamoyltransferase 1      130   8e-31   
ref|NP_001053225.1|  Os04g0500700                                       130   8e-31   
ref|XP_010500346.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    130   9e-31   
ref|XP_006343633.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    130   9e-31   
ref|XP_009409799.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    130   1e-30   
gb|ACF17657.1|  putative hydroxycinnamoyl transferase                   130   1e-30   
ref|XP_004493179.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    130   1e-30   
ref|XP_007149790.1|  hypothetical protein PHAVU_005G0989001g            126   1e-30   
gb|KDP41953.1|  hypothetical protein JCGZ_26971                         129   1e-30   
ref|NP_001047408.1|  Os02g0611800                                       129   1e-30   
ref|XP_007146396.1|  hypothetical protein PHAVU_006G036800g             129   1e-30   
gb|EAZ23787.1|  hypothetical protein OsJ_07497                          129   2e-30   
ref|XP_010479239.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    129   2e-30   
ref|XP_010533496.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    129   2e-30   
gb|ACF85468.1|  unknown                                                 126   2e-30   
gb|AFZ93419.1|  hydroxycinnamoyl-CoA:shikimate/quinate hydroxycin...    126   2e-30   
ref|XP_003624650.1|  Anthranilate N-benzoyltransferase protein          129   2e-30   
ref|XP_008790160.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    129   2e-30   
emb|CDY31956.1|  BnaA07g00390D                                          129   3e-30   
gb|KHN36436.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    126   3e-30   
gb|AFF57839.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    128   3e-30   
gb|AFR40387.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    123   3e-30   
gb|EPS64937.1|  hypothetical protein M569_09840                         128   3e-30   
ref|XP_010479238.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    128   3e-30   
ref|XP_008370591.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    127   3e-30   
ref|XP_003531748.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    128   3e-30   
gb|AFR40350.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    123   3e-30   
gb|ACF37072.1|  hydroxycinnamoyl CoA quinate transferase 1              128   4e-30   
gb|AGV54440.1|  shikimate O-hydroxycinnamoyltransferase                 128   4e-30   
ref|XP_007135841.1|  hypothetical protein PHAVU_010G162700g             128   4e-30   
ref|XP_004293648.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    128   4e-30   
ref|XP_004295153.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    128   4e-30   
ref|XP_004235891.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    128   4e-30   
gb|ADL62855.1|  hydroxycinnamoyl-CoA transferase 2                      128   5e-30   
ref|XP_006303737.1|  hypothetical protein CARUB_v10011876mg             128   5e-30   
ref|XP_004291518.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    128   5e-30   
ref|XP_006341413.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    128   5e-30   
ref|XP_009380783.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    128   5e-30   
ref|XP_011011266.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    127   6e-30   
ref|XP_008353756.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    127   7e-30   
gb|AFR40372.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    122   7e-30   
dbj|BAH57209.1|  AT5G48930                                              125   7e-30   
ref|XP_003548720.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    127   7e-30   
ref|XP_010462493.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    127   7e-30   
ref|XP_009102018.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    127   8e-30   
gb|ACF81845.1|  unknown                                                 125   8e-30   
emb|CDY05770.1|  BnaC07g00330D                                          127   8e-30   
ref|XP_003548723.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    127   9e-30   
ref|XP_007146394.1|  hypothetical protein PHAVU_006G036600g             127   9e-30   
ref|XP_010911018.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    125   1e-29   
gb|AEA36976.1|  rosmarinic acid synthase                                127   1e-29   
ref|XP_009409797.1|  PREDICTED: uncharacterized protein LOC103991972    130   1e-29   
gb|KHN46762.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    127   1e-29   
ref|XP_006392548.1|  hypothetical protein EUTSA_v10011497mg             126   1e-29   
ref|XP_006307576.1|  hypothetical protein CARUB_v10009198mg             126   1e-29   
ref|XP_002991534.1|  probable hydroxycinnamoyl transferase              127   1e-29   
ref|NP_001275483.1|  HQT                                                126   1e-29   
gb|KHG08871.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    126   2e-29   
ref|XP_007033668.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    126   2e-29   
gb|AFR40382.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    121   2e-29   
ref|XP_006474020.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    126   2e-29   
ref|XP_006474019.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    126   2e-29   
ref|XP_008228811.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    126   2e-29   
ref|XP_010480194.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    126   2e-29   
gb|AFF19202.1|  BAHD acyltransferase                                    126   2e-29   
ref|XP_010501253.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    126   2e-29   
gb|ABA46756.1|  hydroxycinnamoyl-CoA quinate-like protein               126   2e-29   
gb|AGM90558.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    126   2e-29   
ref|XP_007033659.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    126   2e-29   
gb|KHN22398.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    126   3e-29   
ref|XP_002894568.1|  transferase family protein                         125   3e-29   
gb|ACG29714.1|  anthranilate N-benzoyltransferase protein 1             125   3e-29   
ref|NP_001132890.1|  LOC100194386                                       125   3e-29   
sp|G0LD36.1|RAS_MELOI  RecName: Full=Rosmarinate synthase; Short=...    125   3e-29   
ref|XP_003629304.1|  Hydroxycinnamoyl-CoA quinate hydroxycinnamoy...    125   3e-29   
ref|XP_007217854.1|  hypothetical protein PRUPE_ppa024073mg             125   3e-29   
dbj|BAF49305.1|  putative acyltransferase                               125   4e-29   
gb|ACJ23164.1|  hydroxycinnamoyl CoA quinate transferase 2              125   4e-29   
ref|XP_004507047.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    125   4e-29   
ref|XP_002979061.1|  probable hydroxycinnamoyltransferase               125   4e-29   
gb|ADA60182.1|  rosmarinic acid synthase                                125   4e-29   
gb|AJA31666.1|  rosmarinic acid synthase                                125   5e-29   
ref|NP_199704.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyc...    125   5e-29   
gb|AAM61215.1|  anthranilate N-benzoyltransferase                       125   5e-29   
ref|XP_010500344.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    125   5e-29   
ref|XP_007027324.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    125   5e-29   
gb|KHN11007.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    125   6e-29   
ref|XP_003535207.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    125   6e-29   
ref|XP_008779303.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    124   6e-29   
ref|XP_002452435.1|  hypothetical protein SORBIDRAFT_04g025760          125   6e-29   
ref|XP_007156887.1|  hypothetical protein PHAVU_002G025600g             124   7e-29   
emb|CAR92145.1|  hydroxycinnamoyl CoA quinate transferase 2             124   7e-29   
ref|XP_006303767.1|  hypothetical protein CARUB_v10011977mg             124   8e-29   
ref|XP_002277474.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    124   8e-29   
ref|XP_004293649.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    124   8e-29   
ref|XP_008790158.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    124   8e-29   
gb|KHM99606.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    119   8e-29   
ref|XP_009366045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    124   8e-29   
gb|KHG19404.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    124   8e-29   
ref|XP_007215395.1|  hypothetical protein PRUPE_ppa005872mg             124   8e-29   
ref|XP_010479240.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    124   9e-29   
ref|XP_009146509.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    124   9e-29   
emb|CDY22880.1|  BnaA01g18180D                                          124   1e-28   
gb|KFK35521.1|  hypothetical protein AALP_AA4G001700                    124   1e-28   
emb|CDY44162.1|  BnaC01g22120D                                          124   1e-28   
ref|XP_008228810.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    124   1e-28   
gb|EMS64908.1|  Anthranilate N-benzoyltransferase protein 1             123   1e-28   
ref|XP_007215396.1|  hypothetical protein PRUPE_ppa005873mg             124   1e-28   
ref|XP_004953073.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    124   1e-28   
ref|XP_004956853.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    124   2e-28   
ref|XP_009399564.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    123   2e-28   
gb|AFR40375.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    118   2e-28   
ref|XP_008777439.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    123   2e-28   
ref|XP_004493180.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    123   2e-28   
gb|ABI48360.1|  putative alcohol acyltransferase 1                      123   2e-28   
gb|ADL62854.1|  hydroxycinnamoyl-CoA transferase 1                      123   3e-28   
gb|EEC84594.1|  hypothetical protein OsI_31407                          120   4e-28   
ref|XP_006598127.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    122   5e-28   
gb|KHN16248.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    122   6e-28   
ref|XP_010942060.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    122   6e-28   
gb|KGN53926.1|  hypothetical protein Csa_4G189000                       119   7e-28   
ref|XP_006464645.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    121   7e-28   
ref|XP_007027325.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    121   7e-28   
ref|XP_007216677.1|  hypothetical protein PRUPE_ppa1027182mg            121   8e-28   
gb|AFR40386.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    116   9e-28   
ref|XP_010911178.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    121   9e-28   
gb|AFR40374.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    116   1e-27   
gb|EAZ09138.1|  hypothetical protein OsI_31408                          121   1e-27   
tpg|DAA53440.1|  TPA: hypothetical protein ZEAMMB73_693497              120   1e-27   
ref|XP_008228829.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    120   2e-27   
ref|XP_008228828.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    120   2e-27   
ref|NP_001146402.1|  uncharacterized protein LOC100279982               120   2e-27   
dbj|BAJ89730.1|  predicted protein                                      120   2e-27   
gb|AES80862.2|  spermidine hydroxycinnamoyl transferase                 120   2e-27   
tpg|DAA53439.1|  TPA: hypothetical protein ZEAMMB73_693497              120   2e-27   
dbj|BAJ91746.1|  predicted protein                                      120   2e-27   
ref|XP_003624644.1|  Anthranilate N-benzoyltransferase protein          120   2e-27   
gb|AGW27208.1|  rosmarinic acid synthase 3                              120   2e-27   
ref|XP_007215406.1|  hypothetical protein PRUPE_ppa005955mg             120   2e-27   
gb|ACG32145.1|  anthranilate N-benzoyltransferase protein 1             120   2e-27   
ref|XP_010547371.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    120   3e-27   
emb|CDG56250.1|  hydroxycinnamoyl-CoA:hydroxyphenyllactate hydrox...    120   3e-27   
gb|EMT08585.1|  Anthranilate N-benzoyltransferase protein 1             120   3e-27   
gb|EYU21745.1|  hypothetical protein MIMGU_mgv1a006579mg                120   3e-27   
ref|XP_001756433.1|  predicted protein                                  119   3e-27   
ref|XP_004294955.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    120   3e-27   
ref|XP_008228885.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    119   4e-27   
gb|AGW27209.1|  rosmarinic acid synthase 4                              119   4e-27   
ref|XP_006465544.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    119   4e-27   
ref|XP_007027320.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    121   4e-27   
ref|XP_009394928.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    119   4e-27   
gb|ACF87435.1|  unknown                                                 119   5e-27   
ref|NP_001147464.1|  anthranilate N-benzoyltransferase protein 1        119   5e-27   
ref|NP_001063206.1|  Os09g0422000                                       119   6e-27   
gb|AFR40240.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    115   6e-27   
gb|AFR40245.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    115   6e-27   
gb|AFR40223.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    114   7e-27   
gb|EYU24606.1|  hypothetical protein MIMGU_mgv1a005249mg                119   9e-27   
gb|AFR40248.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    114   9e-27   
gb|AFR40238.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    114   9e-27   
gb|KEH38242.1|  shikimate/quinate hydroxycinnamoyltransferase           118   9e-27   
ref|XP_007161963.1|  hypothetical protein PHAVU_001G112500g             118   9e-27   
gb|AFR40241.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    114   1e-26   
gb|AFR40219.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    114   1e-26   
gb|AFR40246.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    114   1e-26   
ref|XP_003637275.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    118   1e-26   
gb|AFR40243.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    114   1e-26   
gb|AFR40216.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    114   1e-26   
gb|AFR40250.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    114   1e-26   
gb|AFR40233.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    114   1e-26   
ref|XP_010942061.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    118   1e-26   
ref|XP_004149123.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    115   1e-26   
gb|AFR40214.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    114   1e-26   
gb|AFR40230.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    114   1e-26   
gb|AFR40231.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    114   1e-26   
gb|AFR40239.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    114   1e-26   
gb|AFR40229.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    114   1e-26   
ref|XP_006471643.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    118   1e-26   
gb|KHN39742.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    117   1e-26   
ref|XP_009365251.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    117   2e-26   
gb|EYU24607.1|  hypothetical protein MIMGU_mgv1a006502mg                117   2e-26   
gb|AFR40251.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    113   2e-26   
gb|EMS65854.1|  Anthranilate N-benzoyltransferase protein 1             117   2e-26   
ref|XP_003539366.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    117   2e-26   
gb|AFR40264.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    113   2e-26   
gb|KEH39662.1|  shikimate/quinate hydroxycinnamoyltransferase           117   2e-26   
ref|XP_009403058.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    117   2e-26   
emb|CAR40185.1|  hydroxycinnamoyl-CoA shikimate hydroxycinnamoylt...    114   3e-26   
ref|XP_008777438.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    117   3e-26   
ref|XP_008223321.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    117   3e-26   
ref|NP_001146406.1|  hypothetical protein                               117   3e-26   
ref|XP_003624647.1|  Anthranilate N-benzoyltransferase protein          113   4e-26   
ref|XP_006474075.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    117   4e-26   
sp|A0PDV5.1|RAS_PLESU  RecName: Full=Rosmarinate synthase; Short=...    116   4e-26   
gb|EPS61292.1|  hydroxycinnamoyl transferase                            113   4e-26   
ref|XP_003578136.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    116   6e-26   
ref|XP_007214866.1|  hypothetical protein PRUPE_ppa019948mg             116   6e-26   
ref|XP_002457418.1|  hypothetical protein SORBIDRAFT_03g006970          116   6e-26   
ref|XP_007216058.1|  hypothetical protein PRUPE_ppa017691mg             116   6e-26   
gb|AFR40236.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    112   6e-26   
ref|XP_007216540.1|  hypothetical protein PRUPE_ppa027223mg             115   7e-26   
gb|AFR40242.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    112   7e-26   
gb|ACG34906.1|  anthranilate N-benzoyltransferase protein 1             115   7e-26   
emb|CDG56253.1|  hydroxycinnamoyltransferase 2                          115   8e-26   
ref|XP_006465262.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    115   8e-26   
gb|AGW27211.1|  rosmarinic acid synthase 6                              115   9e-26   
gb|AGH61997.1|  rosmarinic acid synthase                                115   1e-25   
ref|XP_011084630.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    115   1e-25   
ref|XP_002454696.1|  hypothetical protein SORBIDRAFT_04g035780          115   1e-25   
ref|XP_004956854.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    114   2e-25   
ref|XP_007011894.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    115   3e-25   
gb|KHM99605.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    112   3e-25   
ref|NP_001062400.1|  Os08g0543400                                       114   4e-25   
gb|EMS65855.1|  Anthranilate N-benzoyltransferase protein 1             113   4e-25   
gb|EAY99940.1|  hypothetical protein OsI_21943                          113   5e-25   
gb|EAZ07854.1|  hypothetical protein OsI_30113                          113   5e-25   
ref|NP_001169127.1|  hypothetical protein                               113   5e-25   
ref|XP_006486096.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    113   5e-25   
gb|EMS46676.1|  Anthranilate N-benzoyltransferase protein 1             113   5e-25   



>ref|XP_011092043.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Sesamum 
indicum]
Length=464

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 142/195 (73%), Gaps = 9/195 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE + AHIWRC+CKAR H  +QPT +  CVDIRRRM+PPLPD +FGNA++DV+    SG
Sbjct  264  RYESMAAHIWRCSCKARRHVHKQPTAMVICVDIRRRMKPPLPDKFFGNAVVDVIATSFSG  323

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVL-----FGGNPN  408
            E+++RPL   A KIR+AID VTSEYV+ AIDF +N  D  + Q++  +      F GNPN
Sbjct  324  ELMTRPLGYAAGKIREAIDSVTSEYVHSAIDFLKNLKDFSRLQDIHAITTNQGPFYGNPN  383

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            + VISW+ LP+QGLDFGWG EI M+PG HDCDGD L+LPG  G    DGSL+VA CLQ  
Sbjct  384  IGVISWMALPLQGLDFGWGREIFMAPGTHDCDGDSLVLPGYEG----DGSLVVALCLQAV  439

Query  227  HIQDFNKYFYQDINN  183
             + DF K+FY+DIN 
Sbjct  440  CMGDFKKFFYEDINE  454



>ref|XP_011077685.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Sesamum 
indicum]
Length=464

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 141/195 (72%), Gaps = 9/195 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE I AHIWRC+CKAR H  +QPT +  CVDIRRRM+PPLP+ +FGNAI+DV+    SG
Sbjct  264  RYESIAAHIWRCSCKARRHVHEQPTAMGICVDIRRRMKPPLPEKFFGNAIVDVIATSFSG  323

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVL-----FGGNPN  408
            E+++RPL   A KIR+AID VTSEYV+ AIDF +N  D    Q++  +      F GNPN
Sbjct  324  ELMTRPLGYAAGKIREAIDSVTSEYVHSAIDFLKNLKDFSMLQDIHTLRTNQGPFYGNPN  383

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            + V+SW+ LP+QGLDFGWG EI M+PG HDCDGD L+LPG  G    DGSL+VA CLQ  
Sbjct  384  IGVVSWMALPLQGLDFGWGREIFMAPGTHDCDGDSLVLPGYEG----DGSLVVALCLQAV  439

Query  227  HIQDFNKYFYQDINN  183
             + DF K+FY+DIN 
Sbjct  440  CMGDFKKFFYEDINE  454



>ref|XP_009628063.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Nicotiana 
tomentosiformis]
Length=448

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 140/193 (73%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYEV+TAHIWRC CKAR HK +QPTNL  CV+IR  M+PPLP SYFGNAI+DV+ +GVSG
Sbjct  258  RYEVVTAHIWRCVCKARGHKFEQPTNLCICVNIRNIMQPPLPKSYFGNAIVDVIANGVSG  317

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVL-----FGGNPN  408
            +I SRPL+ VA ++R AI  VTS+Y N  IDF +N+ D+ K Q++         F GNPN
Sbjct  318  DITSRPLEYVARRVRAAIKMVTSDYANSTIDFLKNQEDLSKYQDIHAFRSKEGPFYGNPN  377

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L VISW+ LP+ GLDFGWG+EIHMSPG H+ DGD +ILPG  G    DGSL VA  LQ  
Sbjct  378  LGVISWISLPLLGLDFGWGKEIHMSPGTHEYDGDCVILPGKEG----DGSLTVAIILQAV  433

Query  227  HIQDFNKYFYQDI  189
            H+  F  +FY++I
Sbjct  434  HVDAFKNFFYEEI  446



>ref|XP_009787025.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Nicotiana 
sylvestris]
Length=448

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 141/193 (73%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYEV+TAHIWRCACKAR HK +QPTNL  CV+IR+ M+P LP S+FGNAI+DV+ +GVSG
Sbjct  258  RYEVVTAHIWRCACKARGHKFEQPTNLCICVNIRKIMQPHLPKSFFGNAIVDVIANGVSG  317

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVL-----FGGNPN  408
            +I SRPL+  A ++R AI  VTS+Y N  IDF +N+ D+ K Q++         F GNPN
Sbjct  318  DITSRPLEYAARRVRAAIKIVTSDYANSTIDFLKNQEDLSKYQDIHAFRSKEGPFYGNPN  377

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L VISW+ LP+ GLDFGWG+EIHMSPG H+ DGD +ILPG  G    DGSL VA  LQ  
Sbjct  378  LGVISWISLPLLGLDFGWGKEIHMSPGTHEYDGDCVILPGNEG----DGSLTVAIILQAV  433

Query  227  HIQDFNKYFYQDI  189
            H+  F K+FY+DI
Sbjct  434  HVDAFKKFFYEDI  446



>ref|XP_002325143.2| transferase family protein [Populus trichocarpa]
 gb|EEF03708.2| transferase family protein [Populus trichocarpa]
Length=455

 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 143/193 (74%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T HIWR ACKAR HKP+QPT L  CVD R RM+PPLPD YFGNA +DV+    +G
Sbjct  260  RYETLTGHIWRSACKARRHKPEQPTALGVCVDSRGRMQPPLPDGYFGNASLDVIAVSQAG  319

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            E++S+PL   ASKIR+AI+ VT+EYV  AIDF +N+ D+ + Q++  +      F GNPN
Sbjct  320  ELLSKPLGYAASKIREAIETVTNEYVISAIDFLKNQPDLTRFQDIHALGGAEGPFYGNPN  379

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            ++V+SW+ LPI GLDFGWGEEI+M PG HD DGD L+LP PN    +DGS+++A CLQV 
Sbjct  380  IAVVSWLTLPIYGLDFGWGEEIYMGPGTHDFDGDSLLLPSPN----EDGSVILAICLQVA  435

Query  227  HIQDFNKYFYQDI  189
            H++ F K FY+DI
Sbjct  436  HMEAFKKCFYEDI  448



>ref|XP_011018001.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Populus euphratica]
Length=455

 Score =   233 bits (595),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 142/193 (74%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WR ACKAR HKP+QPT L  CVD R RM+PPLPD YFGNA +DV+    +G
Sbjct  260  RYETLTGHVWRSACKARRHKPEQPTALGVCVDSRGRMQPPLPDGYFGNASLDVIAVSQAG  319

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            E++S+PL   ASKIR+AI+ VT+EYV  AIDF +N+ D+ + Q++  +      F GNPN
Sbjct  320  ELLSKPLGYAASKIREAIETVTNEYVISAIDFLKNQPDLTRFQDIHALGGAEGPFCGNPN  379

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            ++V+SW+ LPI GLDFGWGEEI+M PG H  DGD L+LP PN    +DGS+++A CLQV 
Sbjct  380  IAVVSWLTLPIYGLDFGWGEEIYMGPGTHAFDGDSLLLPSPN----EDGSVILAICLQVA  435

Query  227  HIQDFNKYFYQDI  189
            H++ F K FY+DI
Sbjct  436  HMEAFKKCFYEDI  448



>ref|XP_006359722.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Solanum 
tuberosum]
Length=451

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 141/193 (73%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYEV+TAHIWRCACKAR HK +QPTNL  CV+IR++M+PPLP++YFGNAI+DV+  G SG
Sbjct  261  RYEVVTAHIWRCACKARGHKFEQPTNLCICVNIRKKMDPPLPNTYFGNAIVDVIATGASG  320

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVL-----FGGNPN  408
            +I S PL+  A ++R+AI+ VTS+Y N  I+F + + D+   Q++         F GNPN
Sbjct  321  DIASSPLECAAKRVREAINMVTSDYANSTINFLKKQEDLSIYQDIHAFRNKEGPFYGNPN  380

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L VISW+ LP+ GLDFGWG+EIHMSPG H+ DGD +ILP   G    DGSL VA  LQ+ 
Sbjct  381  LGVISWISLPVLGLDFGWGKEIHMSPGIHEYDGDCVILPENEG----DGSLTVAIVLQLA  436

Query  227  HIQDFNKYFYQDI  189
            H+  F K+FY+DI
Sbjct  437  HVNAFEKFFYEDI  449



>ref|XP_007161968.1| hypothetical protein PHAVU_001G112900g [Phaseolus vulgaris]
 gb|ESW33962.1| hypothetical protein PHAVU_001G112900g [Phaseolus vulgaris]
Length=455

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 140/193 (73%), Gaps = 8/193 (4%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WR ACKAR HK +QPT +  CVD R RMEPPLP  YFGNA +DV+   ++G
Sbjct  265  RYESVTGHVWRSACKARGHKEEQPTAVGICVDSRSRMEPPLPKEYFGNATLDVIASSLAG  324

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            +++S+PL   +S+IR+AI+ V  EYV   ++F +N+ D+ + Q+L  V      F GNPN
Sbjct  325  DLMSKPLGYASSRIREAIERVNDEYVRSGVEFLKNQEDLSRFQDLYAVGSEKGPFYGNPN  384

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L V+SW+ LPI G+DFGWG+E++M PG HD DGD L+LPGP   DGDDGSLL+A CLQV 
Sbjct  385  LGVVSWLTLPIYGVDFGWGKEVYMGPGTHDFDGDSLLLPGP---DGDDGSLLLALCLQVV  441

Query  227  HIQDFNKYFYQDI  189
            H+  F K+FY+DI
Sbjct  442  HMDAFKKHFYEDI  454



>gb|KHN17617.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=446

 Score =   229 bits (585),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 138/194 (71%), Gaps = 9/194 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WR ACKAR HK  QPT L  CVD R RMEPPLP  YFGNA +D V   ++G
Sbjct  250  RYESVTGHVWRTACKARGHKEDQPTALGVCVDSRSRMEPPLPKGYFGNATLDTVATSLAG  309

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            +++S+PL    S+IR+AI+ VT EYV   I+F +N+ D+ + Q+L  +      F GNPN
Sbjct  310  DLVSKPLGYACSRIREAIERVTDEYVRTGIEFLKNQEDLSRFQDLYAIGSEKGPFYGNPN  369

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L V+SW+ LPI G+DFGWG+E++M PG HD DGD L+LPGP+G    +GS+L+A CLQV 
Sbjct  370  LGVVSWLTLPIYGVDFGWGKEVYMGPGTHDFDGDSLLLPGPDG----EGSVLLALCLQVP  425

Query  227  HIQDFNKYFYQDIN  186
            H+  F K+FYQDIN
Sbjct  426  HMDTFKKHFYQDIN  439



>ref|XP_002521543.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF40814.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=449

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 139/193 (72%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WR ACKAR H+P QPT L  CVD+R+RM+P LPD YFGNA IDV+    SG
Sbjct  261  RYETLTGHVWRSACKARGHQPGQPTALGVCVDLRKRMQPHLPDGYFGNATIDVIAISTSG  320

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            E+I++PL   + KIR+AI+ VT+EYVN AI F + + D+ + Q+L  +      F GNPN
Sbjct  321  ELITKPLGYASGKIREAIEKVTNEYVNSAIAFLKKQKDLTRFQDLNAIGGVEGPFYGNPN  380

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L V+SW+ LP+ GLDFGWG+EI+M PG HD DGD L+L G      +DGSL++A CLQV 
Sbjct  381  LGVVSWLTLPMYGLDFGWGKEIYMGPGTHDFDGDSLLLRGLE----EDGSLVLAVCLQVA  436

Query  227  HIQDFNKYFYQDI  189
            H++ F KYFY+DI
Sbjct  437  HMEAFKKYFYEDI  449



>ref|XP_003550654.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=460

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 138/194 (71%), Gaps = 9/194 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WR ACKAR HK  QPT L  CVD R RMEPPLP  YFGNA +D V   ++G
Sbjct  264  RYESVTGHVWRTACKARGHKEDQPTALGVCVDSRSRMEPPLPKGYFGNATLDTVATSLAG  323

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            +++S+PL    S+IR+AI+ VT EYV   I+F +N+ D+ + Q+L  +      F GNPN
Sbjct  324  DLVSKPLGYACSRIREAIERVTDEYVRTGIEFLKNQEDLSRFQDLYAIGSEKGPFYGNPN  383

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L V+SW+ LPI G+DFGWG+E++M PG HD DGD L+LPGP+G    +GS+L+A CLQV 
Sbjct  384  LGVVSWLTLPIYGVDFGWGKEVYMGPGTHDFDGDSLLLPGPDG----EGSVLLALCLQVP  439

Query  227  HIQDFNKYFYQDIN  186
            H+  F K+FYQDIN
Sbjct  440  HMDTFKKHFYQDIN  453



>ref|XP_004243059.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Solanum lycopersicum]
Length=451

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 139/193 (72%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYEV+TAHIWRCACKAR HK +QPTNL  CV+IR++M PPLP++YFGNAI+DV+  G SG
Sbjct  261  RYEVVTAHIWRCACKARGHKFEQPTNLCICVNIRQKMNPPLPNTYFGNAIVDVIATGASG  320

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVL-----FGGNPN  408
            +I S PL+  A ++R+AI+ VTS+Y N  I+F + + D+   Q++         F GNPN
Sbjct  321  DIASSPLECAAKRVREAINMVTSDYANSTINFLKKQEDLSIYQDIHAFRNKEGPFYGNPN  380

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L VISW+ LP+ GLDFGWG+EIHMSPG H+ DGD +ILP   G    DGSL VA  LQ  
Sbjct  381  LGVISWISLPVLGLDFGWGKEIHMSPGIHEYDGDCVILPENEG----DGSLTVAIVLQHA  436

Query  227  HIQDFNKYFYQDI  189
            H+  F K+FY+DI
Sbjct  437  HVDAFEKFFYEDI  449



>gb|KDO61846.1| hypothetical protein CISIN_1g036315mg [Citrus sinensis]
Length=452

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 136/193 (70%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WRCACKAR HK +Q T L  CVD R RM+PPLP  YFGNA +DV+    SG
Sbjct  263  RYETVTGHLWRCACKARGHKAEQTTALGVCVDSRSRMQPPLPLGYFGNATLDVIALSRSG  322

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            E++S+PL   +SKIR AI  VT EYV   I++ +N+ D+ K Q+L  +      F GNPN
Sbjct  323  ELVSKPLGYASSKIRRAIVSVTEEYVRSGIEYLKNQPDLTKFQDLHALGGDEGPFYGNPN  382

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L V+SW+ LPI GLDFGWG+EIHM PG HD DGD LILP PN    +DG L+VA CLQV 
Sbjct  383  LGVVSWLTLPIYGLDFGWGKEIHMGPGTHDFDGDSLILPNPN----EDGGLIVALCLQVC  438

Query  227  HIQDFNKYFYQDI  189
            H++ F K+FY+DI
Sbjct  439  HMEAFKKHFYEDI  451



>ref|XP_006453312.1| hypothetical protein CICLE_v10008265mg [Citrus clementina]
 ref|XP_006474222.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Citrus 
sinensis]
 gb|ESR66552.1| hypothetical protein CICLE_v10008265mg [Citrus clementina]
Length=452

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 136/193 (70%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WRCACKAR HK +Q T L  CVD R RM+PPLP  YFGNA +DV+    SG
Sbjct  263  RYETVTGHLWRCACKARGHKAEQTTALGVCVDSRSRMQPPLPLGYFGNATLDVIALSRSG  322

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            E++S+PL   +SKIR AI  VT EYV   I++ +N+ D+ K Q+L  +      F GNPN
Sbjct  323  ELVSKPLGYASSKIRRAIVSVTEEYVRSGIEYLKNQPDLTKFQDLHALGGDEGPFYGNPN  382

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L V+SW+ LPI GLDFGWG+EIHM PG HD DGD LILP PN    ++G L+VA CLQV 
Sbjct  383  LGVVSWLTLPIYGLDFGWGKEIHMGPGTHDFDGDSLILPNPN----EEGGLIVALCLQVC  438

Query  227  HIQDFNKYFYQDI  189
            H++ F K+FY+DI
Sbjct  439  HMEAFKKHFYEDI  451



>ref|XP_010050942.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Eucalyptus 
grandis]
 gb|KCW80898.1| hypothetical protein EUGRSUZ_C02267 [Eucalyptus grandis]
Length=457

 Score =   228 bits (580),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 136/193 (70%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE + AHIWRCACKAR HKP+QPT L  CVD R R++PPL   YFGNA  DVV  G SG
Sbjct  267  RYETMAAHIWRCACKARKHKPEQPTVLCICVDARSRLQPPLKPGYFGNATFDVVAAGTSG  326

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            E++S PL+  +SKIR+AI+ VT E+V   I+  R + D+   Q+L  +     LF GNPN
Sbjct  327  ELVSSPLRCTSSKIREAIEAVTYEHVKSTIEHIRRQPDLTMFQDLHALGSTQGLFYGNPN  386

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L V+SW+ +P+ GLDFGWG EIHM PGNHD DGD L+LP  +    + G L+VA  LQ++
Sbjct  387  LGVVSWLTMPVYGLDFGWGREIHMGPGNHDFDGDCLVLPSSD----EAGGLVVAVGLQIE  442

Query  227  HIQDFNKYFYQDI  189
            H++DF K+FY+DI
Sbjct  443  HMEDFKKFFYEDI  455



>ref|XP_002269790.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Vitis vinifera]
 emb|CBI40129.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 137/193 (71%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE I AHIWRCAC AR HKP+QPT +  C+D R RM PPLP  YFGNA +DV+  G SG
Sbjct  262  RYETIAAHIWRCACNARGHKPEQPTAIGICIDSRSRMRPPLPQGYFGNATLDVIATGRSG  321

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            E++S+PL   +S+IR AI+ VT EYV  AIDF +N+ D+ + Q+L  +      F GNPN
Sbjct  322  ELVSKPLGYASSRIRAAIEKVTDEYVWSAIDFLKNQPDLSQFQDLHALGNDEGPFYGNPN  381

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L VISW+ LP+ G+DFGWG+E++M PG HD DGD LILPG +G    DGSL+VA CLQV 
Sbjct  382  LGVISWLTLPMYGIDFGWGKEVYMGPGPHDFDGDSLILPGHDG----DGSLVVALCLQVA  437

Query  227  HIQDFNKYFYQDI  189
            H+  F  +FY+ +
Sbjct  438  HMDAFKNFFYEAM  450



>ref|XP_004301782.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Fragaria 
vesca subsp. vesca]
Length=465

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 139/194 (72%), Gaps = 9/194 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE ++ HIWRCACKAR HK +QPT L  CVD R RM+PPLP  YFGNA  DV+    SG
Sbjct  275  RYETVSGHIWRCACKARKHKAEQPTALGVCVDSRSRMQPPLPQGYFGNATFDVIATSHSG  334

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            E++S+PL   AS+IR+AI+ V+++YV  AI+  +N+ D+ + Q+L  +      F GNPN
Sbjct  335  ELVSKPLGYAASRIREAIEKVSNDYVLSAIENMKNQPDLTRFQDLHALGSDEGPFYGNPN  394

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L V+SW+ LPI GLDFGWG+EI+M PG HD DGD LILP  +G    DGS++VA CLQV 
Sbjct  395  LGVVSWLTLPIYGLDFGWGKEIYMGPGTHDFDGDSLILPSSDG----DGSVVVALCLQVA  450

Query  227  HIQDFNKYFYQDIN  186
            H+  F K+FY+D++
Sbjct  451  HMDAFKKHFYEDLS  464



>ref|XP_006381775.1| hypothetical protein POPTR_0006s17880g, partial [Populus trichocarpa]
 gb|ERP59572.1| hypothetical protein POPTR_0006s17880g, partial [Populus trichocarpa]
Length=451

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 138/193 (72%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE ++ H+WR  CKAR H P+QPT L  CVD R+RM+ PLPD Y GNA ++V+    +G
Sbjct  263  RYETLSGHVWRSVCKARGHNPEQPTALGVCVDSRKRMQSPLPDGYLGNATLNVIAVSHAG  322

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            E++S+PL   A KIR+AI+ VT+ YV  AIDF +N+ ++ + Q++  +      F GNPN
Sbjct  323  ELMSKPLGYAARKIREAIETVTNAYVRSAIDFLKNQPNLTRFQDIHALGGTEGPFYGNPN  382

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            + V+SW+ LPI GLDFGWG+EI+M PG HD DGD L+LP PNG    DGS+++A CLQV 
Sbjct  383  IGVVSWLTLPIYGLDFGWGKEIYMGPGTHDFDGDSLLLPSPNG----DGSVILAICLQVA  438

Query  227  HIQDFNKYFYQDI  189
            H++ F KYFY+DI
Sbjct  439  HMEAFKKYFYEDI  451



>ref|XP_007211620.1| hypothetical protein PRUPE_ppa005563mg [Prunus persica]
 gb|EMJ12819.1| hypothetical protein PRUPE_ppa005563mg [Prunus persica]
Length=454

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 139/193 (72%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +  HIWRCA KAR H+ +QPT +  CVD R RM+PPLP  YFGNA  DV+   ++G
Sbjct  265  RYETVAGHIWRCASKARVHRNEQPTAMGVCVDSRSRMQPPLPQGYFGNATFDVIATSLAG  324

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            +++S+PL   +S+I++AI+ VT++YV  AID +RN+ D+ + Q+L  +      F GNPN
Sbjct  325  DLVSKPLGYASSRIKEAIEKVTNDYVMSAIDHFRNQPDLTRFQDLHALGSDQGPFYGNPN  384

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L V+SW+ LPI GLDFGWG+EI+M PG HD DGD L+LP PNG    DGS+++A CLQV 
Sbjct  385  LGVVSWLTLPIYGLDFGWGKEIYMGPGPHDFDGDSLLLPSPNG----DGSIVLALCLQVA  440

Query  227  HIQDFNKYFYQDI  189
            H+  F K+FY+DI
Sbjct  441  HMDAFKKHFYEDI  453



>ref|XP_006409088.1| hypothetical protein EUTSA_v10022690mg [Eutrema salsugineum]
 gb|ESQ50541.1| hypothetical protein EUTSA_v10022690mg [Eutrema salsugineum]
Length=451

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 135/193 (70%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +TAH+WRCACKAR H P+QPT L  C+D R R++PPLP  YFGNA +DVV    SG
Sbjct  263  RYETVTAHVWRCACKARGHSPEQPTALGICIDTRSRVQPPLPRGYFGNATLDVVAASTSG  322

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL--LGVL---FGGNPN  408
            E+IS  L   A KI  AI  VT+EYV   I++ + + D+ K Q+L  LG     F GNPN
Sbjct  323  ELISNELGFAAGKISKAIKNVTNEYVMTGIEYLKQQEDLKKFQDLHALGSTEGPFYGNPN  382

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L ++SW+ LP+ GLDFGWG+EI+M PG HD DGD L+LP  N    +DGSL++A CLQV 
Sbjct  383  LGLVSWLTLPLYGLDFGWGKEIYMGPGTHDFDGDSLLLPDQN----EDGSLILATCLQVA  438

Query  227  HIQDFNKYFYQDI  189
            H++ F K+FY+DI
Sbjct  439  HMEAFKKHFYEDI  451



>ref|XP_010050943.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Eucalyptus 
grandis]
Length=455

 Score =   222 bits (566),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 136/193 (70%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE + AHIWRCACKAR HKP+QPT +  CVD R R+ PPL   YFGNA +DVV  G+SG
Sbjct  265  RYETVAAHIWRCACKARKHKPEQPTAVGICVDSRHRLHPPLKLGYFGNATLDVVAAGMSG  324

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL--LGVL---FGGNPN  408
            E++S PL   +SKIR+AI+ VT ++V  AID  R + D+   Q++  LG     F GNPN
Sbjct  325  ELVSSPLGCTSSKIREAIERVTHDHVRSAIDHIRRQPDLTLFQDVHALGSTRGPFYGNPN  384

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L V+SW+ LPI G DFGWG E+HM PGNHD DGD L+LP       ++G L+VA CLQ+ 
Sbjct  385  LGVVSWLTLPIYGHDFGWGREVHMGPGNHDFDGDSLVLPSLE----EEGGLVVALCLQIA  440

Query  227  HIQDFNKYFYQDI  189
            H++DF K+FY+DI
Sbjct  441  HMEDFKKFFYEDI  453



>gb|KCW80900.1| hypothetical protein EUGRSUZ_C02269 [Eucalyptus grandis]
Length=457

 Score =   222 bits (566),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 136/193 (70%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE + AHIWRCACKAR HKP+QPT +  CVD R R+ PPL   YFGNA +DVV  G+SG
Sbjct  267  RYETVAAHIWRCACKARKHKPEQPTAVGICVDSRHRLHPPLKLGYFGNATLDVVAAGMSG  326

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL--LGVL---FGGNPN  408
            E++S PL   +SKIR+AI+ VT ++V  AID  R + D+   Q++  LG     F GNPN
Sbjct  327  ELVSSPLGCTSSKIREAIERVTHDHVRSAIDHIRRQPDLTLFQDVHALGSTRGPFYGNPN  386

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L V+SW+ LPI G DFGWG E+HM PGNHD DGD L+LP       ++G L+VA CLQ+ 
Sbjct  387  LGVVSWLTLPIYGHDFGWGREVHMGPGNHDFDGDSLVLPSLE----EEGGLVVALCLQIA  442

Query  227  HIQDFNKYFYQDI  189
            H++DF K+FY+DI
Sbjct  443  HMEDFKKFFYEDI  455



>ref|NP_179497.1| spermidine hydroxycinnamoyl transferase [Arabidopsis thaliana]
 sp|O64470.1|SHT_ARATH RecName: Full=Spermidine hydroxycinnamoyl transferase; AltName: 
Full=BAHD-like hydroxycinnamoyl transferase [Arabidopsis 
thaliana]
 gb|AAD12025.1| putative anthranilate N-hydroxycinnamoyl/benzoyltransferase [Arabidopsis 
thaliana]
 gb|AAO22784.1| putative anthranilate N-hydroxycinnamoyl/benzoyltransferase [Arabidopsis 
thaliana]
 gb|AAO42450.1| putative anthranilate N-hydroxycinnamoyl/benzoyltransferase [Arabidopsis 
thaliana]
 gb|AEC06845.1| spermidine hydroxycinnamoyl transferase [Arabidopsis thaliana]
Length=451

 Score =   222 bits (565),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 133/193 (69%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WRCACKAR H P+QPT L  C+D R RMEPPLP  YFGNA +DVV    SG
Sbjct  263  RYETVTGHVWRCACKARGHSPEQPTALGICIDTRSRMEPPLPRGYFGNATLDVVAASTSG  322

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL--LGVL---FGGNPN  408
            E+IS  L   AS I  AI  VT+EYV   I++ +N+ D+ K Q+L  LG     F GNPN
Sbjct  323  ELISNELGFAASLISKAIKNVTNEYVMIGIEYLKNQKDLKKFQDLHALGSTEGPFYGNPN  382

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L V+SW+ LP+ GLDFGWG+E +  PG HD DGD LILP  N    +DGS+++A CLQV 
Sbjct  383  LGVVSWLTLPMYGLDFGWGKEFYTGPGTHDFDGDSLILPDQN----EDGSVILATCLQVA  438

Query  227  HIQDFNKYFYQDI  189
            H++ F K+FY+DI
Sbjct  439  HMEAFKKHFYEDI  451



>gb|KFK40283.1| hypothetical protein AALP_AA3G354800 [Arabis alpina]
Length=451

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 135/193 (70%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WRCACKAR H P+QPT +  CVDIR RM+PPLP  YFGNA +DVV    SG
Sbjct  263  RYETVTGHVWRCACKARGHSPEQPTAIGICVDIRNRMQPPLPRGYFGNATLDVVAASTSG  322

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL--LGVL---FGGNPN  408
            E+IS  L   A KI  AI  VT+EYV   I++ +N+ D+ K Q+L  LG     F GNPN
Sbjct  323  ELISNELGFAAEKISKAIKNVTNEYVMIGIEYLKNQDDLKKFQDLHALGSTEGPFYGNPN  382

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L ++SW+ LP+ GLDFGWG+E++M PG HD DGD L+L   N    +DGS+++A CLQV 
Sbjct  383  LGLVSWLTLPMYGLDFGWGKEVYMGPGTHDFDGDSLLLTDQN----EDGSVILATCLQVA  438

Query  227  HIQDFNKYFYQDI  189
            H++ F K+FY+DI
Sbjct  439  HMEAFKKHFYEDI  451



>gb|KHN17616.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=364

 Score =   218 bits (554),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 137/198 (69%), Gaps = 12/198 (6%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE I  HIWR ACKAR HK  QPT L+  VD R RMEPPLP  YFGNA +D V   ++G
Sbjct  169  RYEAIAGHIWRSACKARGHKEDQPTTLTVIVDSRSRMEPPLPKGYFGNATLDTVATSLAG  228

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVL--------FGG  417
            +++S+PL   +S+IR+AI+ V+ EYV   I+F +N+ D+ +  + L  +        F G
Sbjct  229  DLVSKPLGYASSRIREAIERVSDEYVRSGIEFLKNQEDLRRFHQDLHAIESEKKEEPFYG  288

Query  416  NPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACL  237
            NPNL+V+SW+ LPI G+DFGWG+E++MSP  HD DGD ++LPGP+G    DGSLLV   L
Sbjct  289  NPNLAVVSWLTLPIYGVDFGWGKELYMSPATHDFDGDFVLLPGPDG----DGSLLVCLGL  344

Query  236  QVDHIQDFNKYFYQDINN  183
            QV+H+  F K+FY+DI +
Sbjct  345  QVEHMDAFKKHFYEDIES  362



>ref|XP_007154735.1| hypothetical protein PHAVU_003G143100g [Phaseolus vulgaris]
 gb|ESW26729.1| hypothetical protein PHAVU_003G143100g [Phaseolus vulgaris]
Length=469

 Score =   220 bits (560),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 137/195 (70%), Gaps = 10/195 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WR  CKAR H+ +QPT +  CVD R RMEPPLP  YFGNA + VV   ++G
Sbjct  265  RYESVTGHVWRSVCKARGHREEQPTGVGICVDSRSRMEPPLPKEYFGNATLYVVASSLAG  324

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            +++S+PL   +S+IR+AI+ V  EYV  A++F +N+ D+ + Q+L  V     LF GNPN
Sbjct  325  DLMSKPLGYASSRIREAIERVNDEYVRSAVEFLKNQEDLSRFQDLHAVESEKGLFYGNPN  384

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGN--HDCDGDVLILPGPNGIDGDDGSLLVAACLQ  234
            L V+SW+ LP  GLDFGWG+E++M PG   HD DGD L+LPGP   D DDGSLL+  CLQ
Sbjct  385  LGVVSWLTLPFYGLDFGWGKEVYMGPGTHVHDFDGDSLLLPGP---DEDDGSLLLHLCLQ  441

Query  233  VDHIQDFNKYFYQDI  189
            V H+  F K+FY+DI
Sbjct  442  VVHMDAFKKHFYEDI  456



>ref|XP_006296658.1| hypothetical protein CARUB_v10015907mg [Capsella rubella]
 gb|EOA29556.1| hypothetical protein CARUB_v10015907mg [Capsella rubella]
Length=451

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 132/193 (68%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WRCACKAR H  +QPT L  C+D RRRM+PPLP  YFGNA +DVV    SG
Sbjct  263  RYETVTGHVWRCACKARGHSREQPTALGICIDTRRRMQPPLPRGYFGNATLDVVAASTSG  322

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            E+IS  L   AS I  AI  VT+EYV   I++ +N+ D+ K Q+L  +      F GNPN
Sbjct  323  ELISNELGFAASLISKAIKNVTNEYVMIGIEYLKNQEDLKKFQDLHAMGSTEGPFYGNPN  382

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L ++SW+ LP+ GLDFGWG+E +  PG HD DGD LILP  N    +DGS+++A CLQV 
Sbjct  383  LGLVSWLTLPMYGLDFGWGKEFYTGPGTHDFDGDSLILPDQN----EDGSVILATCLQVA  438

Query  227  HIQDFNKYFYQDI  189
            H++ F K+FY+DI
Sbjct  439  HMEAFKKHFYEDI  451



>ref|XP_009358743.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Pyrus x bretschneideri]
Length=455

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 136/193 (70%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +  HIWRCA KAR HK +QPT +  CVD R RM+PPLP  YFGNA  DV+   ++G
Sbjct  266  RYESVAGHIWRCASKARDHKNEQPTAMGVCVDSRNRMQPPLPQGYFGNATFDVIATSLAG  325

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            +++++PL   +S+IR+AI+ VT++YV  AID  RN+ D+ + Q+L  +      F GNPN
Sbjct  326  DLVTKPLGYASSRIREAIEKVTNDYVLSAIDNLRNQPDLTRFQDLHALGSDQGPFYGNPN  385

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L V+SW+ LP+ GLDFGWG+EI+M PG HD DGD LILP P+G    +GS +VA CLQV 
Sbjct  386  LGVVSWLTLPLYGLDFGWGKEIYMGPGTHDFDGDSLILPSPDG----NGSAIVALCLQVA  441

Query  227  HIQDFNKYFYQDI  189
            H+  F K+FY DI
Sbjct  442  HMDAFKKHFYDDI  454



>ref|XP_010489453.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Camelina 
sativa]
Length=451

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 133/193 (69%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WRCACKAR H P+QPT L  C+D R RM+PPLP  YFGNA +DVV    SG
Sbjct  263  RYETVTGHVWRCACKARGHSPEQPTALGICIDTRSRMQPPLPRGYFGNATLDVVAASTSG  322

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL--LGVL---FGGNPN  408
            E+IS  L   AS I  AI  VT+EY+   I++ +N+ D+ K Q+L  LG     F GNPN
Sbjct  323  ELISNELGFAASLISKAIKNVTNEYMMIGIEYLKNQEDLKKFQDLHALGSTEGPFYGNPN  382

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L ++SW+ LP+ GLDFGWG+E +  PG HD DGD LILP  N    +DGS+++A CLQV 
Sbjct  383  LGLVSWLTLPMYGLDFGWGKEFYTGPGTHDFDGDSLILPDQN----EDGSVILATCLQVA  438

Query  227  HIQDFNKYFYQDI  189
            H++ F K+FY+DI
Sbjct  439  HMEAFKKHFYEDI  451



>ref|XP_002884178.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60437.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=451

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 132/193 (68%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WRCACKAR H P+QPT L  C+D R RM+PPLP  YFGNA +DVV    SG
Sbjct  263  RYETVTGHVWRCACKARGHSPEQPTALGICIDTRSRMQPPLPRGYFGNATLDVVAASTSG  322

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL--LGVL---FGGNPN  408
            E+IS  L   AS I  AI  VT+EYV   I++ +N+ D+ K Q+L  LG     F GNPN
Sbjct  323  ELISNELGFAASLISKAIKNVTNEYVMIGIEYLKNQEDLKKFQDLHALGSAEGPFYGNPN  382

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L ++SW+ LP+ GLDFGWG+E +  PG HD DGD LILP  N    +DGS+++A CLQV 
Sbjct  383  LGLVSWLTLPMYGLDFGWGKEFYTGPGTHDFDGDSLILPDQN----EDGSVILATCLQVA  438

Query  227  HIQDFNKYFYQDI  189
            H++ F K+FY DI
Sbjct  439  HMEAFKKHFYDDI  451



>gb|ACC68164.1| unknown [Arabidopsis halleri subsp. halleri]
Length=451

 Score =   218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 132/193 (68%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WRCACKAR H P+QPT L  C+D R RM+PPLP  YFGNA +DVV    SG
Sbjct  263  RYETVTGHVWRCACKARGHSPEQPTALGICIDTRSRMQPPLPRGYFGNATLDVVAASTSG  322

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL--LGVL---FGGNPN  408
            E+IS  L   AS I  AI  VT+EYV   I++ +N+ D+ K Q+L  LG     F GNPN
Sbjct  323  ELISNDLGFAASLISKAIKNVTNEYVMIGIEYLKNQKDLKKFQDLHALGSAEGPFYGNPN  382

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L ++SW+ LP+ GLDFGWG+E +  PG HD DGD LILP  N    +DGS+++A CLQV 
Sbjct  383  LGLVSWLTLPMYGLDFGWGKEFYTGPGTHDFDGDSLILPDQN----EDGSVILATCLQVA  438

Query  227  HIQDFNKYFYQDI  189
            H++ F K+FY DI
Sbjct  439  HMEAFKKHFYDDI  451



>ref|XP_008223799.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Prunus mume]
Length=454

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 138/193 (72%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +  HIWRCA KAR H+ +Q T +  CVD R RM+PPLP  YFGNA  DV+   ++G
Sbjct  265  RYETVAGHIWRCASKARVHRNEQSTAMGVCVDSRSRMQPPLPQGYFGNATFDVIATSLAG  324

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            +++S+PL   +S+I++AI+ VT++YV  AID +RN+ D+ + Q+L  +      F GNPN
Sbjct  325  DLVSKPLGYASSRIKEAIEKVTNDYVLSAIDHFRNQPDLTRFQDLHALGSDQGPFYGNPN  384

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L V+SW+ LPI GLDFGWG+EI+M PG HD DGD L+LP P+G    DGS+++A CLQV 
Sbjct  385  LGVVSWLTLPIYGLDFGWGKEIYMGPGPHDFDGDSLLLPSPDG----DGSIVLALCLQVA  440

Query  227  HIQDFNKYFYQDI  189
            H+  F K+FY+D+
Sbjct  441  HMDAFKKHFYEDL  453



>gb|AFF57840.1| hydroxycinnamoyl-coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
2 [Pyrus x bretschneideri]
Length=455

 Score =   218 bits (554),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 136/193 (70%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +  HIWRCA KAR HK +QPT +  CVD R RM+PPLP  YFGNA  DV+   ++G
Sbjct  266  RYESVAGHIWRCASKARDHKNEQPTAMGVCVDSRNRMQPPLPQGYFGNATFDVIATSLAG  325

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            +++++PL   +S+IR+AI+ VT++YV  AID  RN+ D+ + Q+L  +      F GNPN
Sbjct  326  DLVTKPLGYASSRIREAIEKVTNDYVLSAIDNLRNQPDLTRFQDLHALGSDQGPFYGNPN  385

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L V+SW+ LP+ GLDFGWG+EI+M PG HD DG  LILP P+G    +GS +VA CLQV 
Sbjct  386  LGVVSWLTLPLYGLDFGWGKEIYMGPGTHDFDGHSLILPSPDG----NGSAIVALCLQVA  441

Query  227  HIQDFNKYFYQDI  189
            H+  F K+FY+DI
Sbjct  442  HMDAFKKHFYEDI  454



>ref|XP_003550655.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=455

 Score =   218 bits (554),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 137/197 (70%), Gaps = 11/197 (6%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE I  HIWR ACKAR HK  QPT L+  VD R RMEPPLP  YFGNA +D V   ++G
Sbjct  261  RYEAIAGHIWRSACKARGHKEDQPTTLTVIVDSRSRMEPPLPKGYFGNATLDTVATSLAG  320

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVL-------FGGN  414
            +++S+PL   +S+IR+AI+ V+ EYV   I+F +N+ D+ +  + L  +       F GN
Sbjct  321  DLVSKPLGYASSRIREAIERVSDEYVRSGIEFLKNQEDLRRFHQDLHAIESEKKEPFYGN  380

Query  413  PNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQ  234
            PNL+V+SW+ LPI G+DFGWG+E++MSP  HD DGD ++LPGP+G    DGSLLV   LQ
Sbjct  381  PNLAVVSWLTLPIYGVDFGWGKELYMSPATHDFDGDFVLLPGPDG----DGSLLVCLGLQ  436

Query  233  VDHIQDFNKYFYQDINN  183
            V+H+  F K+FY+DI +
Sbjct  437  VEHMDAFKKHFYEDIES  453



>ref|XP_010548604.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Tarenaya 
hassleriana]
Length=447

 Score =   217 bits (553),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 132/193 (68%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WR ACKAR H PQQPT L  C+D R RM+PPLP  YFGNA +DV+    SG
Sbjct  259  RYEAVTGHVWRSACKARGHFPQQPTALGVCIDSRSRMQPPLPQGYFGNATLDVIAVSTSG  318

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL--LGVL---FGGNPN  408
            E+IS PL     KIR+AI  V  EYV   I++ +N+ D+ K Q+L  LG     F GNPN
Sbjct  319  ELISNPLGYAVRKIREAIKKVNDEYVRSEIEYLKNQEDLKKFQDLHALGSTEGPFYGNPN  378

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L V+SW+ LPI GLDFGWG+E++M PG HD DGD L+LP       D GS+++A CLQV 
Sbjct  379  LGVVSWLTLPIYGLDFGWGKEVYMGPGTHDFDGDSLLLPD----HEDAGSVVLALCLQVA  434

Query  227  HIQDFNKYFYQDI  189
            H++ F K+FY+DI
Sbjct  435  HMEAFKKHFYEDI  447



>ref|XP_008372277.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Malus domestica]
Length=455

 Score =   217 bits (553),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 136/193 (70%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +  HIWRCA KAR HK +QPT +  CVD R RM+PPLP  YFGNA  DV+   ++G
Sbjct  266  RYESVAGHIWRCASKARDHKNEQPTAMGVCVDSRSRMQPPLPQGYFGNATFDVIATSLAG  325

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            +++++PL   +S+IR+AI+ VT++YV  AID  RN+ D+ + Q+L  +      F GNPN
Sbjct  326  DLVTKPLGYASSRIREAIEKVTNDYVLSAIDNLRNQPDLTRFQDLQALGSDQGPFYGNPN  385

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L V+SW+ LP+ GLDFGWG+EI+M PG H  DGD LILP P+G    +GS +VA CLQV 
Sbjct  386  LGVVSWLTLPLYGLDFGWGKEIYMGPGTHGFDGDSLILPSPDG----NGSAIVALCLQVA  441

Query  227  HIQDFNKYFYQDI  189
            H+  F K+FY+DI
Sbjct  442  HMDAFKKHFYEDI  454



>ref|XP_010467740.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Camelina 
sativa]
Length=451

 Score =   217 bits (552),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 133/193 (69%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WRCACKAR H P+QPT L  C+D R RM+PPLP  YFGNA +DVV    SG
Sbjct  263  RYETVTGHVWRCACKARGHSPEQPTALGICIDTRSRMQPPLPRGYFGNATLDVVAASTSG  322

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL--LGVL---FGGNPN  408
            E+IS  L   AS I  AI  VT+EYV   I++ +N+ D+ K Q+L  LG     F GNPN
Sbjct  323  ELISNELGFAASLISKAIKNVTNEYVMIGIEYLKNQEDLKKFQDLHALGSTEGPFYGNPN  382

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L ++SW+ LP+ GLDFGWG+E +  PG HD DGD LILP  +    +DGS+++A CLQV 
Sbjct  383  LGLVSWLTLPMYGLDFGWGKEFYTGPGTHDFDGDSLILPDHD----EDGSVILATCLQVA  438

Query  227  HIQDFNKYFYQDI  189
            H++ F K+FY+DI
Sbjct  439  HMEAFKKHFYEDI  451



>ref|XP_010414994.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Camelina 
sativa]
Length=456

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 133/193 (69%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WRCACKAR H P+QPT L  C+D R RM+PPLP  YFGNA +DVV    SG
Sbjct  268  RYETVTGHVWRCACKARGHSPEQPTALGICIDTRSRMQPPLPRGYFGNATLDVVAASTSG  327

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL--LGVL---FGGNPN  408
            E+IS  L   AS I  AI  VT+EYV   I++ +N+ D+ K Q+L  LG     F GNPN
Sbjct  328  ELISNELGFAASLISKAIKNVTNEYVMIGIEYLKNQEDLKKFQDLHALGSTEGPFYGNPN  387

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L ++SW+ LP+ GLDFGWG+E +  PG HD DGD LILP  +    +DGS+++A CLQV 
Sbjct  388  LGLVSWLTLPMCGLDFGWGKEFYTGPGTHDFDGDSLILPDHD----EDGSVILATCLQVT  443

Query  227  HIQDFNKYFYQDI  189
            H++ F K+FY+DI
Sbjct  444  HMEAFKKHFYEDI  456



>gb|EPS69670.1| hypothetical protein M569_05094, partial [Genlisea aurea]
Length=445

 Score =   214 bits (545),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 135/196 (69%), Gaps = 12/196 (6%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +TAH+WR AC+AR+ + +QPTNL+ CV+IRRR+ P LP  +FGNAI+DV+    SG
Sbjct  254  RYEALTAHVWRSACRARALRDEQPTNLAICVEIRRRVSPNLPAKFFGNAIVDVIASSSSG  313

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVL--------FGG  417
            E+   PL   A K+++AI+ VT EYV+  ID+ +N  D+   Q++ G          F G
Sbjct  314  ELTGNPLGFAAGKVKEAIESVTGEYVDSVIDYLKNLEDLAAVQDVGGRRREKKEEGPFYG  373

Query  416  NPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACL  237
            NPN+ VISW+GLP+ GLDFGWG+EI+M PG HD DGD LILP P+     DG L+VA CL
Sbjct  374  NPNIGVISWMGLPLYGLDFGWGKEIYMGPGTHDSDGDSLILPAPD----SDGDLVVAICL  429

Query  236  QVDHIQDFNKYFYQDI  189
            QV+ +  F  +FYQDI
Sbjct  430  QVECMDAFKNFFYQDI  445



>ref|XP_010673351.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Beta vulgaris 
subsp. vulgaris]
Length=457

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 136/199 (68%), Gaps = 10/199 (5%)
 Frame = -3

Query  767  NLFEF-RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVV  591
            N++ + RYEVI AHIWR ACKAR H  +QPT L F VD+R R++PPLP  YFGNAI+DVV
Sbjct  258  NMYSYTRYEVIAAHIWRSACKAREHHLEQPTCLGFSVDVRNRLQPPLPPKYFGNAILDVV  317

Query  590  IHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL-----LGVL  426
                SG+I+++PL    +KIR AI+ V +EY+   IDF++   D+   Q+L     +   
Sbjct  318  ASSKSGDIMTKPLHYTCAKIRQAIEKVNNEYIWSNIDFWKKLPDLTPFQDLHARKSMDGP  377

Query  425  FGGNPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVA  246
            F GNPNL VISW+ LP+ GLDFGWG+EI+M PG HD DGD L+L GP     ++GS+ VA
Sbjct  378  FYGNPNLGVISWLTLPMYGLDFGWGKEIYMGPGTHDSDGDCLMLRGPI----NNGSVKVA  433

Query  245  ACLQVDHIQDFNKYFYQDI  189
             CLQ  H+  F KY Y+DI
Sbjct  434  ICLQEAHVDAFKKYLYEDI  452



>emb|CDY62143.1| BnaCnng39330D [Brassica napus]
Length=380

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 129/193 (67%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +  H+WRCA KAR H P+QPT+L  CVD R R++PPLP  YFGNA I+ V    SG
Sbjct  192  RYETVAGHVWRCASKARGHSPEQPTSLGICVDTRSRVQPPLPRGYFGNATINAVARSTSG  251

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL--LGVL---FGGNPN  408
            E+IS  L   A KI +AI  VT+EYV   I++ +N  D+   Q++  LG     F GNPN
Sbjct  252  ELISNGLGFAAEKISEAIKSVTNEYVMTGIEYLKNHEDLKTFQDIHALGSTDGPFYGNPN  311

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L ++SW+ LP+ GLDFGWG+E+HM P  HD DG  L+LP  N    DDGSL++A CLQV 
Sbjct  312  LGLVSWLTLPMYGLDFGWGKEVHMGPCTHDGDGGSLLLPDKN----DDGSLILATCLQVA  367

Query  227  HIQDFNKYFYQDI  189
            H++ F ++ Y+DI
Sbjct  368  HMEAFKQHLYEDI  380



>emb|CDY56515.1| BnaCnng30570D [Brassica napus]
Length=380

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 129/193 (67%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +  H+WRCA KAR H P+QPT+L  CVD R R++PPLP  YFGNA I+ V    SG
Sbjct  192  RYETVAGHVWRCASKARGHSPEQPTSLGICVDTRSRVQPPLPRGYFGNATINAVARSTSG  251

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL--LGVL---FGGNPN  408
            E+IS  L   A KI +AI  VT+EYV   I++ +N  D+   Q++  LG     F GNPN
Sbjct  252  ELISNGLGFAAEKISEAIKSVTNEYVMTGIEYLKNHEDLKTFQDIHALGSTDGPFYGNPN  311

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L ++SW+ LP+ GLDFGWG+E+HM P  HD DG  L+LP  N    DDGSL++A CLQV 
Sbjct  312  LGLVSWLTLPMYGLDFGWGKEVHMGPCTHDGDGGSLLLPDKN----DDGSLILATCLQVA  367

Query  227  HIQDFNKYFYQDI  189
            H++ F ++ Y+DI
Sbjct  368  HMEAFKQHLYEDI  380



>ref|XP_009150708.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Brassica 
rapa]
Length=451

 Score =   209 bits (531),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 129/193 (67%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +  H+WRCA KAR H P+QPT+L  CVD R R++PPLP  YFGNA I+ V    SG
Sbjct  263  RYETVAGHVWRCASKARGHSPEQPTSLGICVDTRSRVQPPLPRGYFGNATINAVARSTSG  322

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL--LGVL---FGGNPN  408
            E+IS  L   A KI +AI  VT+EYV   I++ +N  D+   Q++  LG     F GNPN
Sbjct  323  ELISNGLGFAAEKISEAIKSVTNEYVMTGIEYLKNHEDLKTFQDIHALGSTDGPFYGNPN  382

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L ++SW+ LP+ GLDFGWG+E+HM P  HD DG  L+LP  N    DDGSL++A CLQV 
Sbjct  383  LGLVSWLTLPMYGLDFGWGKEVHMGPCTHDGDGGSLLLPDKN----DDGSLILATCLQVA  438

Query  227  HIQDFNKYFYQDI  189
            H++ F K+ Y+DI
Sbjct  439  HMEAFKKHLYEDI  451



>ref|XP_008223800.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Prunus 
mume]
Length=462

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 135/193 (70%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +  HIWRCA KAR H+ +QPT +  CVD+R RM PPLP  YFGNA    V   ++G
Sbjct  265  RYETVAGHIWRCASKARVHRNEQPTAMGVCVDLRSRMLPPLPQGYFGNATFYGVARSLAG  324

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL--LGVL---FGGNPN  408
            +++S+PL   +S+IR+AI+ V+++YV  AID +RN+ D+ + Q+L  LG+    F GNPN
Sbjct  325  DLVSKPLGYASSRIREAIEKVSNDYVLSAIDHFRNQPDLTRFQDLHALGIAEGNFYGNPN  384

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L V+SW  LPI GLDFGWG+EI+M  G +D DG+  +LP P+G    DGS+++  CLQV 
Sbjct  385  LEVVSWSTLPIYGLDFGWGKEIYMGSGTYDFDGESFLLPSPDG----DGSMVLTLCLQVA  440

Query  227  HIQDFNKYFYQDI  189
            H+  F K+FY+DI
Sbjct  441  HMDAFKKHFYEDI  453



>ref|XP_009112574.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Brassica 
rapa]
Length=451

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 132/193 (68%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WRCACKAR H P+QPT L   VD R R++PPLP  YFGNA +DVV   +SG
Sbjct  263  RYETVTGHVWRCACKARGHSPEQPTGLVISVDARSRVQPPLPRGYFGNATLDVVAASISG  322

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL--LGVL---FGGNPN  408
            E+I+  L   A KI  AI  VT+EYV   I++ +N  D+ + Q++  LG     F GNPN
Sbjct  323  ELITNELGFAAGKISKAIKNVTNEYVMTGIEYLKNHEDLKEFQDIHTLGSTEGPFYGNPN  382

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L ++SW+ LP+ GLDFGWG+E++M PG +D DG+ L+LP       +DGSL++A C QV 
Sbjct  383  LGLVSWLTLPMYGLDFGWGQEVYMGPGTNDLDGNSLLLPDKT----EDGSLILATCQQVV  438

Query  227  HIQDFNKYFYQDI  189
            H++ F K+FY+DI
Sbjct  439  HMEAFKKHFYEDI  451



>ref|XP_004507883.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cicer 
arietinum]
Length=460

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 134/193 (69%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WR A KAR H   QPT L  CVD R R++P LP  YFGNA +DVV   ++G
Sbjct  271  RYETVTGHVWRTASKARGHGNDQPTALGVCVDWRCRVDPNLPKGYFGNATLDVVATSLAG  330

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            +++S+PL   +S+IR+AI+ V +EYV   +++++   D+ K Q+L  +      F GNPN
Sbjct  331  DLMSKPLGYASSRIREAIEKVNNEYVRLGMEYFKKHEDLTKFQDLHAIGSDKGPFYGNPN  390

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L V+SW+ LPI GLDFGWG+E++M PG H+ DGD L+LPGP+    +DGSLLVA CLQ  
Sbjct  391  LGVVSWLTLPIYGLDFGWGKEVYMGPGTHELDGDSLLLPGPD----NDGSLLVAICLQEA  446

Query  227  HIQDFNKYFYQDI  189
            H+  F ++F+QDI
Sbjct  447  HMDAFKRHFHQDI  459



>ref|XP_003610074.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase-like 
protein [Medicago truncatula]
 gb|AES92271.1| spermidine hydroxycinnamoyl transferase [Medicago truncatula]
Length=457

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 131/195 (67%), Gaps = 11/195 (6%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WR A KAR H   Q T+L  CVD R R+EP LP  YFGN  +DVV   ++G
Sbjct  266  RYETLTGHVWRSASKARGHANDQQTSLGVCVDWRNRVEPNLPKGYFGNGTLDVVATSLAG  325

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVL-------FGGN  414
            ++IS+PL   +S+IR+AI+ V  EYV   I++++ + D+ K Q+L   +       F GN
Sbjct  326  DLISKPLGYASSRIREAIEKVNDEYVRMGIEYFKKQEDLTKFQDLHAKMGSDDKGPFYGN  385

Query  413  PNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQ  234
            PNL V+SW+ LPI GLDFGWG+E++M PG HD DGD L+LP  +    DDGSLLVA CLQ
Sbjct  386  PNLGVVSWLTLPIYGLDFGWGKEVYMGPGTHDSDGDSLLLPSYD----DDGSLLVAICLQ  441

Query  233  VDHIQDFNKYFYQDI  189
              H+  F ++FYQDI
Sbjct  442  EVHMDAFKRHFYQDI  456



>emb|CDY03367.1| BnaC09g09810D [Brassica napus]
Length=451

 Score =   206 bits (524),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 132/193 (68%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WRCACKAR H P+QPT L   VD R R++PPLP  YFGNA +DVV   +SG
Sbjct  263  RYETVTGHVWRCACKARGHSPEQPTGLVISVDARNRVQPPLPRGYFGNATLDVVAASISG  322

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL--LGVL---FGGNPN  408
            E+I+  L   A KI  AI  VT+EYV   I++ +N  D+ + Q++  LG     F GNPN
Sbjct  323  ELITNELGFAAGKISKAIKNVTNEYVMTGIEYLKNHEDLKEFQDIHTLGSTEGPFYGNPN  382

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L ++SW+ LP+ GLDFGWG+E++M PG +D DG+ L+L   N    +DGSL++A C QV 
Sbjct  383  LGLVSWLTLPMYGLDFGWGQEVYMGPGTNDLDGNSLLLSDKN----EDGSLILATCQQVV  438

Query  227  HIQDFNKYFYQDI  189
            H++ F K+FY+DI
Sbjct  439  HMEAFKKHFYEDI  451



>emb|CDY66506.1| BnaAnng22360D [Brassica napus]
Length=442

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 127/188 (68%), Gaps = 8/188 (4%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WRCACKAR H P+QPT L   VD R R++PPLP  YFGNA +DVV   +SG
Sbjct  263  RYETVTGHVWRCACKARGHSPEQPTGLVISVDARSRVQPPLPRGYFGNATLDVVAASISG  322

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVIS  393
            E+I+  L   A KI  AI  VT+EYV   I++ +N  D+   +      F GNPNL ++S
Sbjct  323  ELITNELGFAAGKISKAIKNVTNEYVMTGIEYLKNHEDLKDTEG----PFYGNPNLGLVS  378

Query  392  WVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDF  213
            W+ LP+ GLDFGWG+E++M PG +D DG+ L+LP       +DGSL++A C QV H++ F
Sbjct  379  WLTLPMYGLDFGWGQEVYMGPGTNDLDGNSLLLPDKT----EDGSLILATCQQVVHMEAF  434

Query  212  NKYFYQDI  189
             K+FY+DI
Sbjct  435  KKHFYEDI  442



>gb|AES90726.2| spermidine hydroxycinnamoyl transferase [Medicago truncatula]
Length=457

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 132/195 (68%), Gaps = 11/195 (6%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T HIWR ACKAR HK  QPT L  CVD RRR+EP LP  YFGNAI+DV+   ++G
Sbjct  266  RYETVTGHIWRSACKAREHKNDQPTALGVCVDWRRRVEPNLPKGYFGNAILDVLATSLAG  325

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV------LFGGNP  411
            +++S+PL   +S+IR+A++ V  EY+    ++++ + D+ K Q+L  V       F  NP
Sbjct  326  DLMSKPLGYASSRIREAVEKVNDEYIRLGNEYFKKQEDLTKFQDLQVVGNGEKGPFYWNP  385

Query  410  NLSVISWVGLPIQGLDFGWGEEIHMSPGNH-DCDGDVLILPGPNGIDGDDGSLLVAACLQ  234
            NL V SW+ LPI GLDFGWG+E++M  G H + DGD L+LP PN    DDGSLLV  CLQ
Sbjct  386  NLGVTSWLSLPIYGLDFGWGKEVYMGLGTHEELDGDSLLLPSPN----DDGSLLVIICLQ  441

Query  233  VDHIQDFNKYFYQDI  189
              H+  F K+FYQDI
Sbjct  442  EIHMDVFKKHFYQDI  456



>gb|KCW82842.1| hypothetical protein EUGRSUZ_C04213 [Eucalyptus grandis]
Length=453

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 128/193 (66%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            R+E I AHIWRC CKAR HKP+Q T+L F +D R R+ PPL   +FGNA+ ++V  G SG
Sbjct  263  RFETIAAHIWRCVCKARKHKPEQATSLYFYIDARSRLRPPLKPGFFGNAVFNMVAGGTSG  322

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            E++S PL+  +S IR+AI+ VT ++V  AI+  R + D+   Q+L        +F GNPN
Sbjct  323  ELVSSPLRCTSSVIREAIEAVTHDHVKSAIEHIRRQPDLTTFQDLHAQGSTQGVFYGNPN  382

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L +  W+ LP+ GLDFGWG EIHM  GNHD D D ++LPG      + G L+VA CLQ  
Sbjct  383  LRLSCWLTLPLNGLDFGWGREIHMGLGNHDLDADSVVLPGRE----EAGGLVVAVCLQTA  438

Query  227  HIQDFNKYFYQDI  189
            HI+DF K+FY DI
Sbjct  439  HIEDFKKFFYDDI  451



>ref|XP_010051711.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Eucalyptus 
grandis]
Length=457

 Score =   204 bits (519),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 128/193 (66%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            R+E I AHIWRC CKAR HKP+Q T+L F +D R R+ PPL   +FGNA+ ++V  G SG
Sbjct  267  RFETIAAHIWRCVCKARKHKPEQATSLYFYIDARSRLRPPLKPGFFGNAVFNMVAGGTSG  326

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            E++S PL+  +S IR+AI+ VT ++V  AI+  R + D+   Q+L        +F GNPN
Sbjct  327  ELVSSPLRCTSSVIREAIEAVTHDHVKSAIEHIRRQPDLTTFQDLHAQGSTQGVFYGNPN  386

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L +  W+ LP+ GLDFGWG EIHM  GNHD D D ++LPG      + G L+VA CLQ  
Sbjct  387  LRLSCWLTLPLNGLDFGWGREIHMGLGNHDLDADSVVLPGRE----EAGGLVVAVCLQTA  442

Query  227  HIQDFNKYFYQDI  189
            HI+DF K+FY DI
Sbjct  443  HIEDFKKFFYDDI  455



>ref|XP_010541075.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Tarenaya 
hassleriana]
Length=532

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 128/194 (66%), Gaps = 11/194 (6%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WR   +AR H PQQPT +  C+D R RM+PPLP  YFGNA +DV+    SG
Sbjct  344  RYEAVTGHVWRSVSRARGHLPQQPTAVGLCIDSRSRMQPPLPQGYFGNATVDVIAVSTSG  403

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            E+IS+PL     KIR+AI  VT +YV   I++ + + D+ K Q+L  +      F GNPN
Sbjct  404  ELISKPLGHAVRKIREAIKKVTDDYVRSEIEYLKRQEDLRKFQDLHALGGTERPFYGNPN  463

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDD-GSLLVAACLQV  231
            L+V+SW+ LPI G DFGWG E+   PG +D DGD L+LP     D DD GS+++A CL+ 
Sbjct  464  LAVVSWLNLPICGFDFGWGSEVFKGPGTYDFDGDSLLLP-----DHDDPGSVVLALCLEE  518

Query  230  DHIQDFNKYFYQDI  189
             H++ F KYFY+DI
Sbjct  519  SHMEAFKKYFYEDI  532



>ref|XP_010034869.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Eucalyptus 
grandis]
 gb|KCW53925.1| hypothetical protein EUGRSUZ_J03136 [Eucalyptus grandis]
Length=458

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 130/193 (67%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            R+E++ AHIWRCACKAR H+P+Q T+L F VD R R+ PPL   +FGNA++ V   G SG
Sbjct  268  RFEIMAAHIWRCACKARKHRPEQATSLYFYVDARSRLRPPLKPGFFGNAVLQVAAAGTSG  327

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL--LGVL---FGGNPN  408
            E++S PL   +SKIR+ I+ VT ++   AI+  R + D+ + QEL  LG     F GNPN
Sbjct  328  ELVSSPLGCTSSKIREVIEAVTHDHFKSAIEHIRRQPDLTRFQELDILGSTQGAFYGNPN  387

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L V SW+ L + GLDFGWG EIHM+P  H+ DG+ +++P       + G LLV   LQ++
Sbjct  388  LGVSSWLSLMVYGLDFGWGREIHMAPATHEYDGECVVIPSLE----EAGGLLVTVGLQIE  443

Query  227  HIQDFNKYFYQDI  189
            H++DF K+FY+DI
Sbjct  444  HMEDFKKFFYKDI  456



>ref|XP_008231463.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Prunus 
mume]
Length=454

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 134/194 (69%), Gaps = 10/194 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +  HIWRCA ++R+HK +QPT L  CVD R R++P LP+ YFGNA+  +    ++G
Sbjct  264  RYETLAGHIWRCASRSRNHKDEQPTALMVCVDFRCRIKPQLPEGYFGNAVFYMPATSLAG  323

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVL------FGGNP  411
            +++S+PL   +S+IR+A++ VT +YV  A +  +NE D+ + Q+L          F GNP
Sbjct  324  DLLSKPLGYASSRIREAVEKVTMDYVLSAHERLKNEPDLTRFQDLHYAKESERGPFNGNP  383

Query  410  NLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQV  231
            N+ V+SW+ LPI GLDFGWG+EI+M PG HD DGD +ILPG +G    DGS++VA  LQV
Sbjct  384  NIGVLSWLRLPIYGLDFGWGKEIYMGPGPHDFDGDSMILPGADG----DGSVVVALSLQV  439

Query  230  DHIQDFNKYFYQDI  189
             HI  F K+FY+DI
Sbjct  440  AHIDVFKKHFYEDI  453



>ref|XP_011076842.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Sesamum 
indicum]
Length=493

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 129/202 (64%), Gaps = 17/202 (8%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YEVITAHIWRC CKAR H  +Q + LS  VDIRRRM PPLP +Y GNA++DVV    +GE
Sbjct  258  YEVITAHIWRCTCKARRHVREQRSRLSISVDIRRRMRPPLPKTYLGNAVLDVVALDYAGE  317

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-------------  429
            ++S+PL   ASKIR+AI+ VT+EYV   IDF R   D+   Q+   +             
Sbjct  318  LVSKPLSYAASKIREAINKVTNEYVTSTIDFLRAVDDLSSFQDWNSISSDDDDDDDDDDK  377

Query  428  -LFGGNPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLL  252
              F GNPNL V SW  L   GLDFGWG+E +M P ++  DGD LI+  P+G D  DGS++
Sbjct  378  GFFCGNPNLCVTSWSTLQFHGLDFGWGKEAYMGPVDYGNDGDCLII--PSGHDS-DGSVV  434

Query  251  VAACLQVDHIQDFNKYFYQDIN  186
            V ACLQ  H++ F K+FY D+ 
Sbjct  435  VIACLQEPHMEAFRKFFYDDME  456



>ref|XP_007161967.1| hypothetical protein PHAVU_001G112800g [Phaseolus vulgaris]
 gb|ESW33961.1| hypothetical protein PHAVU_001G112800g [Phaseolus vulgaris]
Length=455

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 129/194 (66%), Gaps = 10/194 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T+HIWR ACKAR HK  QPT L+  VD R RMEPPLP  YFGNA +D V   ++G
Sbjct  265  RYESVTSHIWRSACKARDHKENQPTMLTIAVDSRGRMEPPLPKGYFGNANLDTVACSLAG  324

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELL------GVLFGGNP  411
            +++S PL   AS+IR+AI+ V+ EYV   I+F +N+ D+ +  + L         F GNP
Sbjct  325  DLVSEPLGFTASRIREAIERVSDEYVRSGIEFLKNQEDLRRFHQDLHPEGREKEPFYGNP  384

Query  410  NLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQV  231
            NLSV+SW+ LP+   DFGWG+ ++ SP  HD DGD ++LP P+    +DGS+LV   LQV
Sbjct  385  NLSVVSWLRLPLYDTDFGWGKGVYTSPATHDFDGDFVLLPDPD----EDGSVLVCLGLQV  440

Query  230  DHIQDFNKYFYQDI  189
             HI  F  +FYQDI
Sbjct  441  LHIDAFRNHFYQDI  454



>ref|XP_007214780.1| hypothetical protein PRUPE_ppa023555mg [Prunus persica]
 gb|EMJ15979.1| hypothetical protein PRUPE_ppa023555mg [Prunus persica]
Length=423

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 130/193 (67%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RY+ +  HIWRCA KAR H+ +QPT +  CVD+R RM+PPLP  YFGNA    V   ++G
Sbjct  226  RYKTVAGHIWRCASKARVHRNEQPTAMGVCVDLRSRMQPPLPQGYFGNATFYGVARSLAG  285

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL--LGVLFG---GNPN  408
            +++S+PL   +S+I +AI+ V++ YV  AID +RN+ ++ + Q L  LG+  G   GNPN
Sbjct  286  DLVSKPLGYASSRITEAIEKVSNYYVLSAIDHFRNQPNLTRFQALHALGIAEGDLYGNPN  345

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L V++W   P+ GLDFGW +E++M  G +D DG+  +LP P G    DGS+++  CLQV 
Sbjct  346  LEVVTWSTPPMYGLDFGWEKEMYMGSGTYDFDGESFLLPSPEG----DGSMVLTLCLQVA  401

Query  227  HIQDFNKYFYQDI  189
            H+  F K+FY+DI
Sbjct  402  HMDAFKKHFYEDI  414



>ref|XP_002274695.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Vitis 
vinifera]
Length=445

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 118/193 (61%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +  HIWR ACKAR H+ QQPT LS  VD R RMEPPLP  YFGNA   V    +SG
Sbjct  257  RYEAVAGHIWRSACKARQHESQQPTTLSIIVDARNRMEPPLPPRYFGNATFRVTAESMSG  316

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            E++S+PL   + K R AI+  T EY+  ++ + + + DV + +    V      F GNPN
Sbjct  317  ELVSKPLGYASGKARQAIEKATHEYLQSSLVYVKCQEDVTQFRNFHTVGCAKGAFYGNPN  376

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L + SW  LPI G DFGWG+EI+M PG    DG V + PG     G +GS LVA  LQV 
Sbjct  377  LEITSWARLPIYGADFGWGQEIYMGPGAIGYDGKVFVFPG----QGLEGSFLVALRLQVR  432

Query  227  HIQDFNKYFYQDI  189
            HI  F K+FY+DI
Sbjct  433  HIDAFQKFFYEDI  445



>gb|EYU26551.1| hypothetical protein MIMGU_mgv1a006988mg [Erythranthe guttata]
Length=423

 Score =   192 bits (489),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 124/190 (65%), Gaps = 26/190 (14%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T H+WR AC AR H  +QP +L  CVD+RRRM+PPLPD YFGNAIIDVV   ++G
Sbjct  260  RYEAVTGHLWRSACMARGHTREQPISLGLCVDVRRRMKPPLPDRYFGNAIIDVVARSLAG  319

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVIS  393
            E+++RPL   A K                 D +      ++ +E  G +F GNPNL VIS
Sbjct  320  ELMTRPLGYAAGK-----------------DIH-----ALRTKEGAGAVFYGNPNLWVIS  357

Query  392  WVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDF  213
            W+ LP+ G+DFGWG++I M+PG H  DGD +ILPG +G    DGSL+VA CLQ + ++ F
Sbjct  358  WISLPLTGVDFGWGKDIAMTPGAHAGDGDSVILPGCDG----DGSLVVAICLQSEFMEGF  413

Query  212  NKYFYQDINN  183
             K+FYQ+I N
Sbjct  414  KKFFYQNIPN  423



>emb|CBI36554.3| unnamed protein product [Vitis vinifera]
Length=480

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 116/195 (59%), Gaps = 9/195 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +  HIWR ACKAR H+ QQPT LS  VD R RMEPPLP  YFGNA   V     SG
Sbjct  253  RYEAVAGHIWRSACKARQHESQQPTTLSIIVDARNRMEPPLPPRYFGNATFRVTAESTSG  312

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            E++S+PL   + K R AI+  T EY+  ++ + + + DV   +    V      F GNPN
Sbjct  313  ELVSKPLGYASGKARQAIEKATHEYLQSSLMYVKCQEDVTPFRNFNTVGCAKGAFYGNPN  372

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L + SW  LPI G DFGWGEEI+M PG    DG V + PG     G DGS LVA  LQV 
Sbjct  373  LEITSWARLPIYGADFGWGEEIYMGPGEIGYDGKVFVFPG----QGLDGSFLVALRLQVR  428

Query  227  HIQDFNKYFYQDINN  183
            HI  F K+F +DI N
Sbjct  429  HIDAFQKFFNEDICN  443



>ref|XP_010094198.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB55374.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=469

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 132/195 (68%), Gaps = 9/195 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP-LPDSYFGNAIIDVVIHGVS  576
            RYEV+ AHIWRC  K R +K +Q T     +D RRR+EP  LP+ YFGNAI DV    ++
Sbjct  272  RYEVLAAHIWRCMTKVRKNKDEQETTNIVTIDARRRLEPAALPEEYFGNAIFDVKARSLA  331

Query  575  GEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFG------GN  414
            G+++++PL   AS+IR+AI+ VT+EYV  AIDF +N+ D+ + + L  +         GN
Sbjct  332  GDLVAKPLGYGASRIREAIEKVTNEYVLSAIDFIKNQQDLSRFRYLYSLFVENNINLLGN  391

Query  413  PNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQ  234
            PN++V +WV LP  G+DFGWG+EI+  PGN + DGD ++    + + GD GSL+V  CLQ
Sbjct  392  PNVAVTNWVNLPAYGIDFGWGKEIYFGPGNLEIDGDSVLF--RDNVSGDIGSLIVVLCLQ  449

Query  233  VDHIQDFNKYFYQDI  189
            VDH+ DF K+FY++I
Sbjct  450  VDHVDDFKKHFYKEI  464



>ref|XP_010656623.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Vitis 
vinifera]
Length=457

 Score =   191 bits (485),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 115/193 (60%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +  HIWR ACKAR H+ QQPT LS  VD R RMEPPLP  YFGNA   V     SG
Sbjct  257  RYEAVAGHIWRSACKARQHESQQPTTLSIIVDARNRMEPPLPPRYFGNATFRVTAESTSG  316

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            E++S+PL   + K R AI+  T EY+  ++ + + + DV   +    V      F GNPN
Sbjct  317  ELVSKPLGYASGKARQAIEKATHEYLQSSLMYVKCQEDVTPFRNFNTVGCAKGAFYGNPN  376

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L + SW  LPI G DFGWGEEI+M PG    DG V + PG     G DGS LVA  LQV 
Sbjct  377  LEITSWARLPIYGADFGWGEEIYMGPGEIGYDGKVFVFPG----QGLDGSFLVALRLQVR  432

Query  227  HIQDFNKYFYQDI  189
            HI  F K+F +DI
Sbjct  433  HIDAFQKFFNEDI  445



>ref|XP_008231492.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Prunus 
mume]
Length=454

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 129/194 (66%), Gaps = 10/194 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +  HIWRCA K+R+ + +Q   L+  +D R R++PPLP  YFGNA   V    +SG
Sbjct  264  RYETVAGHIWRCASKSRNLRDEQAMQLAVWMDFRSRIKPPLPQGYFGNATFYVNATSLSG  323

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVL------FGGNP  411
            +++S+PL   +S+IR+AI+ VT++YV  A++  +N+ D+ + Q+L   +      F GNP
Sbjct  324  DLLSKPLGYASSRIREAIEKVTNDYVLSALEKLKNQPDLTQFQDLHRAIESDQGSFHGNP  383

Query  410  NLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQV  231
            N+ V+SW+ +P  GLDFGWG+EI+M PG HD DGD +ILP  NG    DGS+ VA  LQV
Sbjct  384  NVGVVSWLTVPFWGLDFGWGKEIYMGPGTHDFDGDFVILPSANG----DGSVFVALSLQV  439

Query  230  DHIQDFNKYFYQDI  189
             H+  F K+FY+D 
Sbjct  440  VHVDAFKKHFYEDF  453



>ref|XP_010110725.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXC27890.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=451

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 127/195 (65%), Gaps = 13/195 (7%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            R+E +  ++WRCACKAR HKP+Q T L  CVD RRRM PPLP  YFGNAIIDV+    +G
Sbjct  262  RFETLAGYVWRCACKARGHKPEQQTALGVCVDTRRRMTPPLPWGYFGNAIIDVLATSAAG  321

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFG------GNP  411
            E+ S PL   A +I++A++     YV  AI++ +   D+   Q+L   L G       NP
Sbjct  322  ELTSNPLGYAAGRIQEAVEMANGVYVWGAIEYLKCHEDLRDFQDLGARLSGERFPFYKNP  381

Query  410  NLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDV-LILPGPNGIDGDDGSLLVAACLQ  234
            NL V+SW+ LP+ G+DFGWG+E ++ PG  D DG+   ++P P+G    DGS++VA CLQ
Sbjct  382  NLGVVSWLSLPMYGVDFGWGKEAYIGPG--DVDGETAFLVPCPSG----DGSVVVALCLQ  435

Query  233  VDHIQDFNKYFYQDI  189
             DH++ F K+FY D+
Sbjct  436  ADHMESFKKHFYNDV  450



>ref|XP_002276550.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Vitis 
vinifera]
Length=445

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 113/193 (59%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE I  HIWR ACKAR H+ QQPT LS  VD R RMEPPLP  YFGN    V     SG
Sbjct  257  RYEAIAGHIWRSACKARQHESQQPTLLSIIVDARNRMEPPLPPRYFGNGTFRVTAETTSG  316

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            E++S  L   + K R AI+  T EY+  ++ + + + DV   +    V      F GNPN
Sbjct  317  ELVSNSLGFASGKARQAIEKATHEYLQSSLVYVKCQEDVTNFRNFHTVGCAKGAFYGNPN  376

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L + SW  LPI G DFGWG+EI+M PG    DG V + PG     G DGS +VA  LQV 
Sbjct  377  LEITSWARLPIYGADFGWGQEIYMGPGGIGYDGKVFVFPG----QGQDGSFVVALRLQVR  432

Query  227  HIQDFNKYFYQDI  189
            H+  F K+FY+DI
Sbjct  433  HVDAFQKFFYEDI  445



>emb|CAN72449.1| hypothetical protein VITISV_011069 [Vitis vinifera]
Length=445

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 112/193 (58%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +  HIWR ACKAR H+  QPT LS  +D R RMEPPLP  YFGNA   V     SG
Sbjct  257  RYEAVAGHIWRSACKARQHESLQPTTLSIILDARNRMEPPLPPRYFGNATFRVTAESTSG  316

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            E++S+PL   + K R AI+  T EY+  ++ + + + DV + +    V      F GNPN
Sbjct  317  ELVSKPLGYASGKARQAIEKATHEYLQSSLVYVKCQEDVTQFRNFHTVGCTKGAFYGNPN  376

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L + SW  LPI G DFGWG+EI+M PG    DG V + P      G DGS  V   LQV 
Sbjct  377  LDITSWARLPIYGADFGWGQEIYMGPGAIGYDGKVFVFPS----RGQDGSFHVVLRLQVR  432

Query  227  HIQDFNKYFYQDI  189
            HI  F  +FY+DI
Sbjct  433  HIDAFQXFFYEDI  445



>gb|AFD64619.1| putative hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyltransferase 
[Camellia sinensis]
Length=447

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 119/193 (62%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RY  +TAH+WRCACKAR H+ +Q TN+   VD R R++  LP  YFG  ++ VV    SG
Sbjct  259  RYGSVTAHMWRCACKARQHESEQLTNIRIAVDFRSRLQSSLPKWYFGCTVLPVVTTPTSG  318

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            +I+S+PL   A K+R+ I  VT EY+     F +NE D+ K +    V      F GNPN
Sbjct  319  DIVSKPLGYTAKKLREGIGKVTDEYIRSCFVFLKNEPDLSKFRFFHTVGSSQGAFYGNPN  378

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            +SV +W  LP+ G+DFGWG+EI M PG    DG   ILPG N    +DGS L+   LQV 
Sbjct  379  MSVTNWTRLPLYGMDFGWGKEICMIPGAIGYDGKAFILPGRN----EDGSFLIPLRLQVT  434

Query  227  HIQDFNKYFYQDI  189
            H+ +F K+FY+DI
Sbjct  435  HMDNFKKFFYEDI  447



>emb|CAT00087.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=260

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 119/193 (62%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            R+  ++AHIW+C  KAR H P Q T L   VD R R++PPLP  YFGNA++ V    ++G
Sbjct  72   RFVAVSAHIWKCLSKARMHSPDQETVLYVTVDFRSRLKPPLPGRYFGNAVLPVPARAIAG  131

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            ++ SRP    +SKI++AID VT EYV   +   +N  +V   +    V     LF GNPN
Sbjct  132  DLQSRPPSYASSKIKEAIDKVTDEYVRSYLACMKNMPEVSSSRHFHTVGCAQGLFFGNPN  191

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L + SWVGL +  ++FG GE   M+P +   DG + ++PGPNG    DGSL++   LQV+
Sbjct  192  LLITSWVGLDVYKVNFGGGEATSMTPESLGYDGRLFLIPGPNG----DGSLIIPLRLQVE  247

Query  227  HIQDFNKYFYQDI  189
            HI  F KYFY+DI
Sbjct  248  HINAFKKYFYEDI  260



>emb|CDP21167.1| unnamed protein product [Coffea canephora]
Length=453

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 121/193 (63%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            R+  ++AHIW+C  KAR H P Q T L   VD R R++PPL   YFGNA++ V    ++G
Sbjct  265  RFVAVSAHIWKCLSKARMHSPDQETVLYVTVDFRNRLKPPLSGRYFGNAVLPVPARAIAG  324

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            ++ SRP    +SKI++AID VT EYV   +   ++  +V   +    V     LF GNPN
Sbjct  325  DLQSRPPSYASSKIKEAIDKVTDEYVRSYLVCMKDMPEVSSSRHFHTVGCAQGLFFGNPN  384

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L + SWVGL +  ++FGWGE I M+PG+   DG + ++PGPNG    DGSL++   LQV+
Sbjct  385  LLITSWVGLDVYKVNFGWGEAISMTPGSLGYDGRLFLIPGPNG----DGSLIIPLRLQVE  440

Query  227  HIQDFNKYFYQDI  189
            HI  F KYFY+DI
Sbjct  441  HINAFKKYFYEDI  453



>ref|XP_003608529.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase-like 
protein [Medicago truncatula]
Length=495

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 115/171 (67%), Gaps = 11/171 (6%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +T HIWR ACKAR HK  QPT L  CVD RRR+EP LP  YFGNAI+DV+   ++G
Sbjct  266  RYETVTGHIWRSACKAREHKNDQPTALGVCVDWRRRVEPNLPKGYFGNAILDVLATSLAG  325

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV------LFGGNP  411
            +++S+PL   +S+IR+A++ V  EY+    ++++ + D+ K Q+L  V       F  NP
Sbjct  326  DLMSKPLGYASSRIREAVEKVNDEYIRLGNEYFKKQEDLTKFQDLQVVGNGEKGPFYWNP  385

Query  410  NLSVISWVGLPIQGLDFGWGEEIHMSPGNH-DCDGDVLILPGPNGIDGDDG  261
            NL V SW+ LPI GLDFGWG+E++M  G H + DGD L+LP PN    DDG
Sbjct  386  NLGVTSWLSLPIYGLDFGWGKEVYMGLGTHEELDGDSLLLPSPN----DDG  432



>emb|CDP18830.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 120/193 (62%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            R+  ++AHIW+C  KAR H P Q T L   VD R R++PPLP  YFGNA++ V    ++G
Sbjct  262  RFVAVSAHIWKCLSKARMHSPDQETVLYVTVDFRSRLKPPLPGRYFGNAVLPVPARAIAG  321

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV-----LFGGNPN  408
            ++ SRP    +SKI++AID VT EYV   +   +N  +V   +    V     LF GNPN
Sbjct  322  DLQSRPPSYASSKIKEAIDKVTDEYVRSYLACMKNMPEVSSSRHFHTVGCAKGLFFGNPN  381

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L + SWVGL +  ++FG GE   M+PG+   DG + ++PGPNG    DGSL++   LQV+
Sbjct  382  LLITSWVGLDVHKVNFGGGEANSMTPGSLGYDGRLFLIPGPNG----DGSLIIPLRLQVE  437

Query  227  HIQDFNKYFYQDI  189
            HI  F KYFY+DI
Sbjct  438  HINAFKKYFYEDI  450



>ref|XP_010265516.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Nelumbo nucifera]
Length=447

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 118/194 (61%), Gaps = 11/194 (6%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE I  H+WRCACKAR+H+ +Q T +   VD R R+ PPLP  YFGNAI   +    SG
Sbjct  258  RYEAIAGHVWRCACKARAHEREQLTKVRIIVDCRNRLNPPLPQGYFGNAIXPTIATARSG  317

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVL------FGGNP  411
            +++ +PL   A KIR+A+  +T EYV  AIDF R++ D+++ +     +      F GNP
Sbjct  318  DLMDQPLGYAAGKIREAVVKMTDEYVRSAIDFLRSQPDLMRFRTSFHSVGCSEGGFFGNP  377

Query  410  NLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQV  231
            NL++ SW+GL I   DFGWG  I+M PG    DG   +L G     G+DGSL +   LQV
Sbjct  378  NLTITSWLGLAIYEGDFGWGRPIYMGPGLIASDGKCSVLSG-----GEDGSLAIPLGLQV  432

Query  230  DHIQDFNKYFYQDI  189
             H+  F + FY+DI
Sbjct  433  AHVDAFKELFYEDI  446



>gb|EPS68189.1| hypothetical protein M569_06582, partial [Genlisea aurea]
Length=435

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 124/195 (64%), Gaps = 14/195 (7%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RY+ I AH+WR AC+ARSH+  QPT +   VD+R+R+ P LPD+YFGNA++  +    SG
Sbjct  248  RYKAIAAHVWRSACRARSHEDNQPTWMCIYVDVRKRVSPNLPDNYFGNAVVPAIAESFSG  307

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV-----IKRQELLGVLFGGNPN  408
            E++ +PL     KIR+AIDGVTSE+V+ A+ F RN  D+     ++ ++   + F GNPN
Sbjct  308  ELVKKPLGFTVDKIREAIDGVTSEFVHSAVRFIRNLDDLSPFQFMQHRKSRDLEFYGNPN  367

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSP--GNHDCDGDVLILPGPNGIDGDDGSLLVAACLQ  234
            ++V S +G P  GLDFGWG+E+ M P   N  CDG+  +         D G + V  CLQ
Sbjct  368  VTVTSGLGSPKNGLDFGWGKEVLMIPFADNFYCDGESFVFE-------DGGDVAVFICLQ  420

Query  233  VDHIQDFNKYFYQDI  189
             + +++F + FY+D+
Sbjct  421  SEVVEEFRRIFYEDL  435



>ref|XP_011083883.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Sesamum 
indicum]
Length=447

 Score =   169 bits (427),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 116/193 (60%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            R+E + AHIWRC  KAR H  +Q T+L F  D R +++PPLP ++FGNA+I V     SG
Sbjct  259  RFEAVAAHIWRCTSKARGHIAEQQTSLHFVADFRNKLKPPLPKTFFGNALIRVEATDKSG  318

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL-----LGVLFGGNPN  408
             ++S  +   + KIR+A++ VT + V   +DF +   DV + + L         F GNPN
Sbjct  319  SLLSNSIGTASKKIREAVEKVTDDTVRAYLDFLKGLPDVGRFRSLDNNGRPKGDFYGNPN  378

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L++ISW  LP+ G DFGWG+EIHM PG+   DG   I+P  +G    DGS  +A  LQ +
Sbjct  379  LAIISWTALPLYGADFGWGKEIHMGPGSMGFDGKTFIIPSHDG----DGSFNIAIWLQEE  434

Query  227  HIQDFNKYFYQDI  189
            H+  F K FY DI
Sbjct  435  HMGAFKKCFYDDI  447



>gb|ADD71921.1| BAHD-type hydroxycinnamoyltransferase [Actaea racemosa]
Length=448

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 118/196 (60%), Gaps = 13/196 (7%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            R+E ++ HIWRCA KAR H+ +Q T+L   +D R R+ PPLP  Y GNA +       SG
Sbjct  258  RFEAMSGHIWRCASKARRHENEQLTSLRITIDCRNRLRPPLPPRYSGNATMVTTSIAESG  317

Query  572  EIISRP--LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK-RQELLGV-----LFGG  417
            E++S P  L  V S IR  ID V  +Y+  A DF  ++ D+   R     V     +F G
Sbjct  318  ELLSNPLGLGFVCSVIRKCIDKVDDDYIKSATDFLISQDDLTPYRSGFHNVGSTEGVFLG  377

Query  416  NPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACL  237
            NPNL++ SWVGLPI  +DFGWG+ I+M P     DG +LI+PG      DDGS++V   L
Sbjct  378  NPNLAITSWVGLPINDVDFGWGKPIYMGPTALGYDGKLLIIPG-----KDDGSVIVPIRL  432

Query  236  QVDHIQDFNKYFYQDI  189
            QV HI DF K+FY+DI
Sbjct  433  QVAHIDDFEKFFYEDI  448



>ref|XP_007219083.1| hypothetical protein PRUPE_ppa014960mg, partial [Prunus persica]
 gb|EMJ20282.1| hypothetical protein PRUPE_ppa014960mg, partial [Prunus persica]
Length=446

 Score =   164 bits (415),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 115/172 (67%), Gaps = 10/172 (6%)
 Frame = -3

Query  740  ITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIIS  561
            +  HIWRCA ++R+HK +QPT L  CVD+R RM+P LP  YFGNA+  +    ++ +++S
Sbjct  267  LAGHIWRCALRSRNHKDEQPTALMVCVDLRSRMKPQLPQGYFGNAVFYMPATSLADDLLS  326

Query  560  RPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVL------FGGNPNLSV  399
            +PL  V S+IR+A++ VT +YV  A +  +NE D+ + Q+L          F GNPN+ V
Sbjct  327  KPLGYVLSRIREAVEKVTMDYVLSAHEKLKNEPDLTRFQDLHYAKESERGPFNGNPNIGV  386

Query  398  ISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAA  243
            ++W+ L I GLDFGWG+EI+M PG HD DGD LILPG +     DGS++VA 
Sbjct  387  LNWLTLLIYGLDFGWGKEIYMGPGPHDFDGDSLILPGAD----RDGSVVVAT  434



>ref|XP_010669430.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Beta 
vulgaris subsp. vulgaris]
Length=480

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 119/194 (61%), Gaps = 13/194 (7%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            R+EV+ AH+WRC CKAR  K +  + L   V    RMEPPLP S+FGNA++D  I    G
Sbjct  293  RFEVVAAHVWRCVCKARELKSEDMSTLMVAVAAHDRMEPPLPSSFFGNAVVDAEISSSVG  352

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL--LGVLFG---GNPN  408
            E+ISRPL    S +R+AI  VT+EY+  +I+F + + ++ K Q +   G++ G   G+ N
Sbjct  353  ELISRPLSYACSIVREAIQKVTNEYILASIEFLKKQQNLTKYQYIDDRGIMEGPAYGDHN  412

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPG-NHDCDGDVLILPGPNGIDGDDGSLLVAACLQV  231
            ++V+SW+ L   G+DFGWG+EIHM P     CDGD+ + P  N     DGSL+V  CLQ 
Sbjct  413  ITVVSWLNLSSHGVDFGWGKEIHMGPPIVQTCDGDIHLSPYKN-----DGSLIVGVCLQP  467

Query  230  DHIQDFNKYFYQDI  189
            +  + F KY    I
Sbjct  468  N--EKFVKYITSPI  479



>emb|CDP05692.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 124/195 (64%), Gaps = 9/195 (5%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            +EVI+AH+WRCAC+AR    +QPT LSF ++ R+ ++PPLP  YFGNAI+D+     SG 
Sbjct  272  FEVISAHLWRCACRARLLIHEQPTVLSFPINFRKLIQPPLPVGYFGNAILDIRSMDFSGN  331

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVL-FGGNPNLSVIS  393
            +++  L + A+KIR  I  VTSE++   I+F + + D+ K QE    + + GNPNL++ S
Sbjct  332  LLTGTLANTAAKIRKTILAVTSEFLYSEIEFLQMQTDLSKFQERHDYMEYLGNPNLTISS  391

Query  392  WVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGD-DGSLLVAACLQVDHIQD  216
            W+  P  GLDFGWG+ + M   +H+ DGD +       + GD  G ++V+ C Q ++I+ 
Sbjct  392  WLTFPFNGLDFGWGKSLGMVEASHNGDGDFV-------LHGDLHGGVVVSMCFQEEYIKS  444

Query  215  FNKYFYQDINNL*RR  171
            F  YFY+   ++ ++
Sbjct  445  FKYYFYEIFGDMNKK  459



>ref|XP_011069658.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Sesamum 
indicum]
Length=453

 Score =   161 bits (408),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 123/221 (56%), Gaps = 19/221 (9%)
 Frame = -3

Query  815  SIYKHPIKKMEFRLVLNLFE----------FRYEVITAHIWRCACKARSHKPQQPTNLSF  666
            S+ K  I+K+  +  L+ ++           R+E + AHIWRC  KAR H  +Q T+L F
Sbjct  232  SLTKLQIEKLRAKANLDFYKENGNEGSRGYSRFEAVAAHIWRCTSKARGHIAEQQTSLHF  291

Query  665  CVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCA  486
              D R +M+P LP +YFGNA+I V     SG +++  +   + KIR+A++ VT + V   
Sbjct  292  VADFRNKMKPALPRNYFGNALIRVEATDKSGNLLTNSMGMASRKIREAVEKVTDDTVRAY  351

Query  485  IDFYRNEGDVIKRQELLGVL-----FGGNPNLSVISWVGLPIQGLDFGWGEEIHMSPGNH  321
            +D+ +   DV + + L         F GNPNL++ISW  LP+ G DFGWG EIH+ PG  
Sbjct  352  LDYLKGLPDVGRFRSLDNNGRPKGDFYGNPNLAIISWTALPLYGTDFGWGNEIHLGPGPM  411

Query  320  DCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFY  198
              DG   I+PG  G    DGS  VA  LQ +H+  F K FY
Sbjct  412  GFDGKTFIIPGREG----DGSFKVAIWLQEEHMDAFKKCFY  448



>ref|XP_004166134.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cucumis 
sativus]
Length=469

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 119/201 (59%), Gaps = 17/201 (8%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARS---HKPQQPTNLSFCVDIRRRMEPPLPDSYFGNA-IIDVVIH  585
            RYE IT HIW CA KAR+    K    T +   V++R+R+  P+P ++ GNA +I V   
Sbjct  273  RYESITGHIWVCASKARNIDNDKSNLSTMVQIVVNVRQRLRKPIPKNFCGNAALISVTPQ  332

Query  584  GVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL---------LG  432
               GE++S+PL   A KIR+A   +T EYV  AIDF     D+   + L         + 
Sbjct  333  SNFGELMSQPLSYAAKKIREASWKMTDEYVTSAIDFLTTHEDICWTRTLSSSSSSIVQVR  392

Query  431  VLFGGNPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLL  252
              F GNPNLSV+SW+ +PI   DFGWG   ++ P   DCDG+  I+PGPN    +DGS++
Sbjct  393  STFLGNPNLSVVSWLSMPIYDADFGWGHPDYVGPLMLDCDGETFIMPGPN----NDGSII  448

Query  251  VAACLQVDHIQDFNKYFYQDI  189
            VA  L + H++DF K+FY+D+
Sbjct  449  VAIQLHMKHMEDFKKFFYEDL  469



>gb|EYU25632.1| hypothetical protein MIMGU_mgv1a006215mg [Erythranthe guttata]
Length=452

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/193 (41%), Positives = 112/193 (58%), Gaps = 9/193 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            R+E + AHIWRC  KAR H  +Q T+L F  D R +++PPLP +YFGNA+I V     SG
Sbjct  264  RFEAVAAHIWRCTSKARGHVAEQQTSLHFVADFRNKLQPPLPKNYFGNALIRVEATDTSG  323

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVL-----FGGNPN  408
             ++  P+   + KIR+A++ VT + V   +D+ +   DV + + L         F GNPN
Sbjct  324  SLLLNPIGAASRKIREAVEKVTEDTVRAYLDYLKELPDVGRFRSLDNSGRPKGDFYGNPN  383

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L++ISW+ LP+ G DFGWG EIH+ PG    DG   I+P   G    +GS  VA  LQ +
Sbjct  384  LAIISWMSLPLYGADFGWGNEIHLGPGPMGFDGKTFIIPTREG----NGSFNVAIWLQEE  439

Query  227  HIQDFNKYFYQDI  189
            ++  F  + Y  I
Sbjct  440  YMGAFKNFLYDGI  452



>ref|XP_010669388.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Beta 
vulgaris subsp. vulgaris]
Length=460

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 116/194 (60%), Gaps = 13/194 (7%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            R+EVITAHIWRC  KAR  K +  T L  CVD R RMEPPLP  YFGNAIID+ I    G
Sbjct  273  RFEVITAHIWRCVTKARELKNEDITTLIACVDARGRMEPPLPPRYFGNAIIDIEISSCVG  332

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL--LGVLFG---GNPN  408
            E+IS PL    SKIR+A   V +EYV   I+FY+N+  V K Q +   G + G   G+ N
Sbjct  333  ELISNPLSYACSKIREATTKVNNEYVLETIEFYKNQKSVSKYQYIDDRGKIRGPSYGDQN  392

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPG-NHDCDGDVLILPGPNGIDGDDGSLLVAACLQV  231
            + V+SW+ L  + +DFGWG+EIHM P   +  DGD +I P       DDGS++V   LQ 
Sbjct  393  VLVMSWLNLMGRSIDFGWGKEIHMGPPIVYAGDGDFMITPY-----KDDGSVVVGVSLQP  447

Query  230  DHIQDFNKYFYQDI  189
               Q F +Y    I
Sbjct  448  K--QKFQEYMSNPI  459



>ref|XP_004149124.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cucumis 
sativus]
 gb|KGN53927.1| hypothetical protein Csa_4G189010 [Cucumis sativus]
Length=453

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 118/201 (59%), Gaps = 17/201 (8%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARS---HKPQQPTNLSFCVDIRRRMEPPLPDSYFGNA-IIDVVIH  585
            RYE IT HIW CA KAR+    K    T +   V++R+R+  P+P ++ GNA +I V + 
Sbjct  257  RYESITGHIWVCASKARNINNDKSNLSTMVQIVVNVRQRLRKPIPKNFCGNAALISVTLQ  316

Query  584  GVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGV--------  429
               GE++S+PL   A KIR+A   +T EYV  AIDF     D+   +             
Sbjct  317  SNFGELMSQPLSYSAKKIREASWKMTDEYVTSAIDFLTTHEDICWTRTSSSSSSSIVQVR  376

Query  428  -LFGGNPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLL  252
              + GNPNLSV+SW+ +PI   DFGWG   ++ P   DCDG+  I+PGPN    +DGS++
Sbjct  377  NTYLGNPNLSVVSWLSMPIYDADFGWGHPDYVGPLMLDCDGETFIMPGPN----NDGSII  432

Query  251  VAACLQVDHIQDFNKYFYQDI  189
            VA  L + H++DF K+FY+D+
Sbjct  433  VAIQLHMKHMEDFKKFFYEDL  453



>gb|KHN29832.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=448

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 113/195 (58%), Gaps = 11/195 (6%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            R+E I AHIWRCA KAR     QPT + F  DIR R+ PPLP +YFGNA+         G
Sbjct  258  RFEAIAAHIWRCASKARELDKNQPTLVRFNADIRNRLIPPLPKNYFGNALSLTTASCHVG  317

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELL-------GVLFGGN  414
            ++IS  L   A KIR+AI+ VT EY+   ID  R +  +   + L          LF GN
Sbjct  318  DVISNSLSYAAQKIREAIEVVTYEYIWSQIDVIRGQEQLDNARALFFGQNEGKDALFYGN  377

Query  413  PNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQ  234
            PNL + SW+ +P+   DFGWG+ +++  G+       LI+  P+G    DGS++++   Q
Sbjct  378  PNLLITSWMSMPMHEADFGWGKPVYLGLGSVSTQDRALIIQSPDG----DGSIILSIHFQ  433

Query  233  VDHIQDFNKYFYQDI  189
            ++H+Q F KYFY+D+
Sbjct  434  MEHMQLFKKYFYEDM  448



>ref|XP_003551937.2| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=464

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 113/195 (58%), Gaps = 11/195 (6%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            R+E I AHIWRCA KAR     QPT + F  DIR R+ PPLP +YFGNA+         G
Sbjct  274  RFEAIAAHIWRCASKARKLDKNQPTLVRFNADIRNRLIPPLPKNYFGNALSLTTASCHVG  333

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELL-------GVLFGGN  414
            ++IS  L   A KIR+AI+ VT EY+   ID  R +  +   + L          LF GN
Sbjct  334  DVISNSLSYAAQKIREAIEVVTYEYIWSQIDVIRGQEQLDNARALFFGQNEGKDALFYGN  393

Query  413  PNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQ  234
            PNL + SW+ +P+   DFGWG+ +++  G+       LI+  P+G    DGS++++   Q
Sbjct  394  PNLLITSWMSMPMHEADFGWGKPVYLGLGSVSTQDRALIIQSPDG----DGSIILSIHFQ  449

Query  233  VDHIQDFNKYFYQDI  189
            ++H+Q F KYFY+D+
Sbjct  450  MEHMQLFKKYFYEDM  464



>ref|XP_003532115.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
 gb|KHM99604.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=452

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 114/196 (58%), Gaps = 12/196 (6%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVI-HGVS  576
            R+E I AHIWRCACKAR    +QPT + F  DIR R+ PPLP +YFGNA+   V      
Sbjct  261  RFEAIAAHIWRCACKARELDEKQPTLVRFNGDIRSRLIPPLPRTYFGNALAATVTPRCYV  320

Query  575  GEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG--DVIK-----RQELLGVLFGG  417
            GE +S+PL   A K+R+AI+ +T+EY+   +D    E   D IK     + E     F G
Sbjct  321  GETLSKPLSYAAQKVREAIEMLTNEYIRSQLDIVLGEEQLDCIKALFSGQGERRNAPFAG  380

Query  416  NPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACL  237
            NPNL + SW+ +P+   DFGWG+ ++            +IL  P+G    DGS++V+   
Sbjct  381  NPNLQITSWMSMPVYEADFGWGKPMYFGLAYVSAQDRAVILLSPHG----DGSVIVSMHF  436

Query  236  QVDHIQDFNKYFYQDI  189
            Q+ H+Q F KYFY++I
Sbjct  437  QIAHMQLFKKYFYENI  452



>ref|XP_003599927.1| Anthranilate N-benzoyltransferase protein [Medicago truncatula]
 ref|XP_003599932.1| Anthranilate N-benzoyltransferase protein [Medicago truncatula]
 gb|AES70178.1| spermidine hydroxycinnamoyl transferase [Medicago truncatula]
Length=253

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 115/196 (59%), Gaps = 9/196 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            R+E I+AHIW+ A KAR  +  Q + + F V+IR R+ P LP +Y+GNA+I     G  G
Sbjct  56   RFEAISAHIWKSASKARKLEENQQSVVRFNVEIRNRIIPNLPRNYYGNALIQTSTRGFIG  115

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYR--NEGDVIKRQELLG---VLFGGNPN  408
            EI S+PL  VA KIR+A + +T+EY+   ID  R     D  ++  L+G   V F GNPN
Sbjct  116  EITSKPLSYVAQKIREANELITNEYIRSQIDVIRGFENLDDARKLFLVGGRDVTFSGNPN  175

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L + SW+ LP    DFGWG+ +H   G    +   LIL  P+    +DGS +V    QV+
Sbjct  176  LHITSWMTLPSYKADFGWGKPMHFGIGYVSPNDRGLILLSPD----EDGSAIVCMHFQVE  231

Query  227  HIQDFNKYFYQDINNL  180
             +Q F K+FY+DI  L
Sbjct  232  LMQLFKKFFYEDIYEL  247



>ref|XP_003548918.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=447

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 117/196 (60%), Gaps = 13/196 (7%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHG-VS  576
            RYE I+AHIWRC  KAR     QPT +      R R+ PPLP +YFGNA    V    +S
Sbjct  257  RYESISAHIWRCVVKARDGYHNQPTVVHIIAGARNRLNPPLPLNYFGNATYPTVTPTCLS  316

Query  575  GEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQE------LLGVLFGGN  414
            G+I+S+PL  VA KIR+AI+ +T EY+     F R++ DV   +E       +  LF GN
Sbjct  317  GDIVSKPLSYVAHKIREAIEVLTDEYLRSGFGFIRSQSDVGWLREKNDNEGKVESLFLGN  376

Query  413  PNLSVISWV-GLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACL  237
            PNL++ SW+  +P+ G +FGWG  ++M PG    DG   I+PG      +DGS+LVA  L
Sbjct  377  PNLNIWSWMRNMPMYGPNFGWGRPVYMGPGVVKGDGRAFIMPG-----QEDGSVLVAIRL  431

Query  236  QVDHIQDFNKYFYQDI  189
            Q  H++ F + F++D+
Sbjct  432  QSAHVEAFKEVFHKDM  447



>gb|KHN13395.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=447

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 116/196 (59%), Gaps = 13/196 (7%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHG-VS  576
            RYE I+AHIWRC  KAR     QPT +      R R+ PPLP +YFGNA    V    +S
Sbjct  257  RYESISAHIWRCVVKARDGYHNQPTVVHIIAGARNRLNPPLPLNYFGNATYPTVTPTCLS  316

Query  575  GEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV------IKRQELLGVLFGGN  414
            G+I+S+PL  VA KIR+AI+ +T EY+     F R++ DV         +  +  LF GN
Sbjct  317  GDIVSKPLSYVAHKIREAIEVLTDEYLRSGFGFIRSQSDVGWLRGKNDNEGKVESLFLGN  376

Query  413  PNLSVISWV-GLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACL  237
            PNL++ SW+  +P+ G +FGWG  ++M PG    DG   I+PG      +DGS+LVA  L
Sbjct  377  PNLNIWSWMRNMPMYGPNFGWGRPVYMGPGAVKGDGRAFIMPG-----QEDGSVLVAIRL  431

Query  236  QVDHIQDFNKYFYQDI  189
            Q  H++ F + F++D+
Sbjct  432  QSAHVEAFKEVFHKDM  447



>gb|KHN35439.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=409

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 117/196 (60%), Gaps = 12/196 (6%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAI-IDVVIHGVS  576
            RYEVI +HIWRCA KAR  +  QPT +    DIR R+ PPLP +YFGNA+ + +     +
Sbjct  218  RYEVIASHIWRCASKARELEDLQPTVVRVSADIRNRLNPPLPRNYFGNALAVALTPKCHT  277

Query  575  GEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYR--NEGDVIK-----RQELLGVLFGG  417
             E+I+ PL   A KIR+AI+ +  EY+   +DF R   + D I+     + E     F G
Sbjct  278  KELITNPLSHGAQKIREAIELLNDEYIRSQLDFIRCHEQLDRIRASYLDQGEPKNAPFYG  337

Query  416  NPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACL  237
            NPNL+++SW+ +P+   DFGWG+  +  PG    DG   I+   +    +DGSL+V+A L
Sbjct  338  NPNLTIVSWMSMPVYEADFGWGKPGYFGPGAVYPDGKAYIIRSSD----EDGSLVVSAHL  393

Query  236  QVDHIQDFNKYFYQDI  189
            Q  H + F K+FY+DI
Sbjct  394  QTAHKELFKKFFYEDI  409



>gb|ACU23734.1| unknown [Glycine max]
Length=464

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 117/196 (60%), Gaps = 12/196 (6%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAI-IDVVIHGVS  576
            RYEVI +HIWRCA KAR  +  QPT +    DIR R+ PPLP +YFGNA+ + +     +
Sbjct  273  RYEVIASHIWRCASKARELEDLQPTVVRVSADIRNRLNPPLPRNYFGNALAVALTPKCHT  332

Query  575  GEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYR--NEGDVIK-----RQELLGVLFGG  417
             E+I+ PL   A KIR+AI+ +  EY+   +DF R   + D I+     + E     F G
Sbjct  333  KELITNPLSHGAQKIREAIELLNDEYIRSQLDFIRCHEQLDRIRASYLDQGEPKNAPFYG  392

Query  416  NPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACL  237
            NPNL+++SW+ +P+   DFGWG+  +  PG    DG   I+   +    +DGSL+V+A L
Sbjct  393  NPNLTIVSWMSMPVYEADFGWGKPGYFGPGAVYPDGKAYIIRSSD----EDGSLVVSAHL  448

Query  236  QVDHIQDFNKYFYQDI  189
            Q  H + F K+FY+DI
Sbjct  449  QTTHKELFKKFFYEDI  464



>ref|XP_006605610.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like isoform 
X2 [Glycine max]
Length=464

 Score =   153 bits (386),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 117/196 (60%), Gaps = 12/196 (6%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAI-IDVVIHGVS  576
            RYEVI +HIWRCA KAR  +  QPT +    DIR R+ PPLP +YFGNA+ + +     +
Sbjct  273  RYEVIASHIWRCASKARELEDLQPTVVRVSADIRNRLNPPLPRNYFGNALAVALTPKCHT  332

Query  575  GEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYR--NEGDVIK-----RQELLGVLFGG  417
             E+I+ PL   A KIR+AI+ +  EY+   +DF R   + D I+     + E     F G
Sbjct  333  KELITNPLSHGAQKIREAIELLNDEYIRSQLDFIRCHEQLDRIRASYLDQGEPKNAPFYG  392

Query  416  NPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACL  237
            NPNL+++SW+ +P+   DFGWG+  +  PG    DG   I+   +    +DGSL+V+A L
Sbjct  393  NPNLTIVSWMSMPVYEADFGWGKPGYFGPGAVYPDGKAYIIRSSD----EDGSLVVSAHL  448

Query  236  QVDHIQDFNKYFYQDI  189
            Q  H + F K+FY+DI
Sbjct  449  QTAHKELFKKFFYEDI  464



>ref|XP_003555244.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like isoform 
X1 [Glycine max]
Length=461

 Score =   153 bits (386),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 117/196 (60%), Gaps = 12/196 (6%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAI-IDVVIHGVS  576
            RYEVI +HIWRCA KAR  +  QPT +    DIR R+ PPLP +YFGNA+ + +     +
Sbjct  270  RYEVIASHIWRCASKARELEDLQPTVVRVSADIRNRLNPPLPRNYFGNALAVALTPKCHT  329

Query  575  GEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYR--NEGDVIK-----RQELLGVLFGG  417
             E+I+ PL   A KIR+AI+ +  EY+   +DF R   + D I+     + E     F G
Sbjct  330  KELITNPLSHGAQKIREAIELLNDEYIRSQLDFIRCHEQLDRIRASYLDQGEPKNAPFYG  389

Query  416  NPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACL  237
            NPNL+++SW+ +P+   DFGWG+  +  PG    DG   I+   +    +DGSL+V+A L
Sbjct  390  NPNLTIVSWMSMPVYEADFGWGKPGYFGPGAVYPDGKAYIIRSSD----EDGSLVVSAHL  445

Query  236  QVDHIQDFNKYFYQDI  189
            Q  H + F K+FY+DI
Sbjct  446  QTAHKELFKKFFYEDI  461



>ref|XP_003553113.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=466

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 113/197 (57%), Gaps = 14/197 (7%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVI-HGVS  576
            R+E + AHIWRCACKAR     QPT + F  D R R+ PPLP +YFGNA+   V     +
Sbjct  270  RFEAVAAHIWRCACKARELDRNQPTLVRFNADFRNRLTPPLPRNYFGNALAATVTPECYA  329

Query  575  GEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD------VIKRQ-ELLGVLFGG  417
            GEI S+PL   A K+R+A++ +  EY++  +D    E        +  RQ E     F G
Sbjct  330  GEITSKPLSYAARKMREAVEMLKEEYISSQLDIALGEEQLESIKALFSRQGERRNAPFAG  389

Query  416  NPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDV-LILPGPNGIDGDDGSLLVAAC  240
            NPNL + SW+ +P+   DFGWG+  H   G + C  D  +I+ GP     +DGS++V   
Sbjct  390  NPNLQITSWINIPLYEADFGWGKPEHFVLG-YVCPFDRGIIIQGPE----NDGSVIVIMY  444

Query  239  LQVDHIQDFNKYFYQDI  189
             Q+ H+Q F K+FY+D+
Sbjct  445  FQISHMQLFKKFFYEDV  461



>gb|KHN18130.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=466

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 113/197 (57%), Gaps = 14/197 (7%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVI-HGVS  576
            R+E + AHIWRCACKAR     QPT + F  D R R+ PPLP +YFGNA+   V     +
Sbjct  270  RFEAVAAHIWRCACKARELDRNQPTLVRFNADFRNRLTPPLPRNYFGNALAATVTPECYA  329

Query  575  GEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD------VIKRQ-ELLGVLFGG  417
            GEI S+PL   A K+R+A++ +  EY++  +D    E        +  RQ E     F G
Sbjct  330  GEITSKPLSYAARKMREAVEMLKEEYISSQLDIALGEEQLESIKALFSRQGERRNAPFAG  389

Query  416  NPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDV-LILPGPNGIDGDDGSLLVAAC  240
            NPNL + SW+ +P+   DFGWG+  H   G + C  D  +I+ GP     +DGS++V   
Sbjct  390  NPNLQITSWINIPLYEADFGWGKPEHFVLG-YVCPFDRGIIIQGPE----NDGSVIVIMY  444

Query  239  LQVDHIQDFNKYFYQDI  189
             Q+ H+Q F K+FY+D+
Sbjct  445  FQISHMQLFKKFFYEDV  461



>ref|XP_008441993.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cucumis 
melo]
Length=457

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 117/192 (61%), Gaps = 12/192 (6%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARS---HKPQQPTNLSFCVDIRRRMEPPLPDSYFGNA-IIDVVIH  585
            RYE IT HIW CA KAR+    K +Q T +   V++R+R+  P+P ++ GNA +I +   
Sbjct  274  RYESITGHIWVCASKARNINDDKSKQSTLVQIVVNVRQRLRKPIPKNFCGNAALISITPQ  333

Query  584  GVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNL  405
               GE+ S+PL   A +IR+A   +T EYV  AIDF   + D I+    +   F GNPNL
Sbjct  334  CKFGELKSQPLSYAAKRIREASWKMTDEYVTSAIDFLATQEDTIR----VKGTFWGNPNL  389

Query  404  SVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDH  225
            S++SW+ +PI   DFGWG   ++ P   D DG   I+ GPN    +DGS+++   LQ+ +
Sbjct  390  SIVSWMSMPIYDADFGWGYPDYVGPSILDNDGKAFIMLGPN----NDGSIIIVIRLQMKY  445

Query  224  IQDFNKYFYQDI  189
            ++DF K+FY+D+
Sbjct  446  MEDFKKFFYEDL  457



>ref|XP_009798536.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=436

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 103/184 (56%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YEV+ AHIWRC CKAR+    Q T L    D R R+ PPLP  Y GN +        SGE
Sbjct  257  YEVLAAHIWRCTCKARALDNDQLTKLHVATDGRSRLFPPLPPGYLGNVVFTATPIAKSGE  316

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            I+S PL + A +I  A+  +  EY+  AID+   + D+ K   + G  +  +PNL++ SW
Sbjct  317  ILSEPLMNTAQRIHSALARMDDEYLRSAIDYLELQTDLSKL--IRGPTYFASPNLNINSW  374

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LP+   DFGWG+ IHM P     +G V ILP P+    +D +L +A CL  DH+  F 
Sbjct  375  TRLPVHDSDFGWGKPIHMGPACILYEGTVYILPSPS----NDKNLRLAVCLDADHMPLFE  430

Query  209  KYFY  198
            KY Y
Sbjct  431  KYLY  434



>ref|XP_010273688.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=454

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 109/197 (55%), Gaps = 16/197 (8%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +  H+W+CA +AR    +Q T +   VD RRR+ P LP +YFGNA         +G
Sbjct  265  RYETLAGHMWKCASEARGLVDEQETKVHVSVDCRRRLRPALPANYFGNATFPTTPVAKAG  324

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDF---------YRNEGDVIKRQELLGVLFG  420
            ++IS+PL   ASKIR+ +  +T EYV  A+DF         +R     I  +  LG  +G
Sbjct  325  DLISKPLSYAASKIREGVRRMTDEYVRSAVDFLGSQRDWSQFRTSFHSIDDKAKLGAYYG  384

Query  419  GNPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAAC  240
              PNL++ SW+GLP+   DFGWG+  HM P +   DG   +      I  +D  ++V   
Sbjct  385  C-PNLAITSWIGLPLYTADFGWGQPFHMGPTSLGADGKAYV------ISTEDDGIIVYLR  437

Query  239  LQVDHIQDFNKYFYQDI  189
            LQ +H++ F + FY+D+
Sbjct  438  LQTEHMEKFKELFYEDL  454



>gb|EPS67739.1| hypothetical protein M569_07035, partial [Genlisea aurea]
Length=428

 Score =   150 bits (378),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 109/188 (58%), Gaps = 13/188 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y ++ AHIWRCAC AR+    Q T L   V+ R R+ PPLP +YFGNAI       V+G+
Sbjct  248  YVILAAHIWRCACSARALPEDQETQLDIAVNGRSRLRPPLPPAYFGNAIFTATPLSVAGD  307

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            +  +PL+  A+KI++A+  +  EY+  A+D+       ++R EL G++ G      PNL 
Sbjct  308  VTGKPLRHSAAKIQEALWRMDDEYLRSALDYLE-----LRRLELKGLVRGRESFRCPNLG  362

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            ++SW+ LP+   DFGWG+ + M P     +G   ++P P     DDGSL VA CL  DH+
Sbjct  363  IVSWIRLPVHEADFGWGKPVFMGPAGIGYEGLCYVIPSP----ADDGSLSVAICLLEDHV  418

Query  221  QDFNKYFY  198
            + F K  Y
Sbjct  419  EAFRKSLY  426



>ref|XP_009614241.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=434

 Score =   149 bits (377),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 103/185 (56%), Gaps = 6/185 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++ AHIWRC CKAR     Q T L    D R R+ PPLP  Y GN +        SGE
Sbjct  255  YEILAAHIWRCTCKARILDDDQLTKLHVATDGRSRLFPPLPPGYLGNVVFTATPIAKSGE  314

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            I+S PL + A +I  A+  +  EY+  AID+   + D+ K   + G  +  +PNL++ SW
Sbjct  315  ILSEPLMNTAQRIHSALARMDDEYLRSAIDYLELQTDLSKL--IRGPTYFASPNLNINSW  372

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LP+   DFGWG+ IHM P     +G V ILP P+    +D +L +A CL  DH+  F 
Sbjct  373  TRLPVHDSDFGWGKPIHMGPACILYEGTVYILPSPS----NDKNLRLAVCLDADHMPLFE  428

Query  209  KYFYQ  195
            KY Y+
Sbjct  429  KYLYE  433



>ref|XP_007146248.1| hypothetical protein PHAVU_006G024700g [Phaseolus vulgaris]
 gb|ESW18242.1| hypothetical protein PHAVU_006G024700g [Phaseolus vulgaris]
Length=449

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 110/195 (56%), Gaps = 11/195 (6%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            R+E I AH+WR ACKAR     QPT + F  DIR R+ PPLP +YFGNA+         G
Sbjct  259  RFEAIAAHVWRSACKARGLDENQPTVVRFNADIRNRLIPPLPANYFGNALALTAASSQVG  318

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELL-------GVLFGGN  414
            EI+S  L   A KIR+AI+ +T EY++  ID  R +  V K + L          LF GN
Sbjct  319  EILSNSLGRAAKKIREAIEVLTYEYISSQIDVIRGQDHVDKARALYFGANEGKDALFFGN  378

Query  413  PNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQ  234
            PNL + SW+ +P+   DFGWG+ +++           LI      +DGDD S++V    Q
Sbjct  379  PNLLITSWMRMPMHEADFGWGKAVYLGHAGVATQDRALI---TQSLDGDD-SIIVFLPFQ  434

Query  233  VDHIQDFNKYFYQDI  189
            ++H+Q F  +FY++I
Sbjct  435  MEHMQLFKDFFYEEI  449



>gb|EPS73563.1| hypothetical protein M569_01193, partial [Genlisea aurea]
Length=305

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 103/189 (54%), Gaps = 13/189 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y  I AH+WRCA  ARS    Q T L   V+ R R+ PPLP  YFGN I       V+G+
Sbjct  114  YVTIAAHVWRCATLARSLSADQKTQLDIPVNGRSRLRPPLPPGYFGNGIFPAAASAVAGD  173

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            ++ +PL   A+ IR+A+  +  EY+  A+D+         R  L G++ G      PNL 
Sbjct  174  VVGKPLSQSAATIREALARMDDEYLRSALDYVETF-----RPNLKGLVRGSETFRCPNLG  228

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            ++SW+GLPI   DFGWG  + M P     +G   ++P P+    +DGSL VA CL  DH+
Sbjct  229  IVSWIGLPIHEADFGWGRPVFMGPIGIGYEGLSYVIPSPD----NDGSLSVAICLHKDHM  284

Query  221  QDFNKYFYQ  195
              F K FYQ
Sbjct  285  VRFQKLFYQ  293



>ref|XP_010063583.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063585.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70825.1| hypothetical protein EUGRSUZ_F03972 [Eucalyptus grandis]
 gb|KCW70826.1| hypothetical protein EUGRSUZ_F03972 [Eucalyptus grandis]
Length=445

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 102/184 (55%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WRCAC+AR     Q T +    D R R+ PPLP  YFGN I+      V+G+
Sbjct  261  YEILAGHVWRCACRARGLSDDQDTKVYIATDARMRLSPPLPQGYFGNGILTTTPIAVAGD  320

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            +IS+P+   A KI +++  +   Y+  A+D+   + D+       G      PNL ++SW
Sbjct  321  LISKPVSYAAQKIHESLARMNDNYLRSALDYLELQPDLSALAR--GAHTFRCPNLGIVSW  378

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I+M PG    +G   ILP P      DGSL VA  LQ +H++ F 
Sbjct  379  VRLPIHDADFGWGRPIYMGPGGIAYEGLSYILPSPTS----DGSLSVAISLQTEHVKPFE  434

Query  209  KYFY  198
            K+FY
Sbjct  435  KFFY  438



>gb|KDP38692.1| hypothetical protein JCGZ_04045 [Jatropha curcas]
Length=437

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 102/185 (55%), Gaps = 7/185 (4%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE + AHIWRC CKAR     Q T L    D R R+ PPLP  YFGN +    +   S E
Sbjct  259  YETLAAHIWRCMCKARGLSNDQATKLYIATDGRFRLRPPLPRGYFGNVLFTATVKTSSEE  318

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S PL+ +  KI  A+ G+  EY+  A+DF + + D+   +   G     +PNL+++SW
Sbjct  319  VQSNPLK-IVEKIHSALKGMDDEYLRSALDFLQMQPDLTALKR--GASTFRSPNLNIVSW  375

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            + LPI   DFGW   I M P +   +G   +LP P     +DGSL +  CL+ DHIQ F 
Sbjct  376  MKLPIHEADFGWSRPIFMGPASVVFEGMGYVLPSPR----NDGSLRLIICLETDHIQLFQ  431

Query  209  KYFYQ  195
             YFY+
Sbjct  432  AYFYE  436



>gb|KHM99609.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=412

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 112/197 (57%), Gaps = 14/197 (7%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVI-HGVS  576
            R+E + AHIWRCACKAR    +QPT + F  DIR R+ PPLP +YFGNA++  V      
Sbjct  216  RFEAVAAHIWRCACKARGQHHKQPTIVRFNGDIRNRLIPPLPRNYFGNALVATVTPECYV  275

Query  575  GEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV-------IKRQELLGVLFGG  417
            GEI SRPL   A K+R+AI  +  EY+   ++    E  +       + + E     FGG
Sbjct  276  GEITSRPLSYAARKLREAIALLRDEYIRSQLEAVFGEEQLKCIRAFFLGQGEGRSEPFGG  335

Query  416  NPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDV-LILPGPNGIDGDDGSLLVAAC  240
            NPNL + SW+  P+   DFGWG+ ++   G + C  D  +I+  P     DDGSL+V   
Sbjct  336  NPNLQITSWINFPVDSTDFGWGKPVYFGLG-YVCALDRGIIVRDPQ----DDGSLIVIMH  390

Query  239  LQVDHIQDFNKYFYQDI  189
             Q+ H+Q F K FY+DI
Sbjct  391  FQIAHMQLFKKLFYEDI  407



>ref|XP_010063590.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70827.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
 gb|KCW70828.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
 gb|KCW70829.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
Length=445

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 102/184 (55%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WRCAC+AR     Q T LS  +D R R+ PPLP  YFGN I  +    V+G+
Sbjct  261  YEILAGHVWRCACRARGLSDDQDTKLSIAIDGRMRLSPPLPQGYFGNGIFTITPIAVAGD  320

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            +IS+P+   A  I +++     +Y+  A+D+   + D+       G      PNL + SW
Sbjct  321  LISKPVLYAARTIHESLARANDDYLRSALDYLELQPDLSALAR--GAHTFRCPNLGITSW  378

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I+M PG    +G   ILP P      DGSL VA  LQ +H++ F 
Sbjct  379  VRLPIHDADFGWGRPIYMGPGRIAYEGLSYILPSPTS----DGSLSVAISLQTEHMKPFE  434

Query  209  KYFY  198
            K+FY
Sbjct  435  KFFY  438



>ref|XP_010063586.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063587.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063588.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063589.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70830.1| hypothetical protein EUGRSUZ_F03974 [Eucalyptus grandis]
Length=445

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 101/184 (55%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WRCAC+AR     Q T L    D R R+ PPLP  YFGN I  +    V+G+
Sbjct  261  YEILAGHVWRCACRARGLSDDQDTKLFIATDGRMRLSPPLPQGYFGNGIFTITPIAVAGD  320

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            +IS+P+   A KI +++     +Y+  A+D+   + D+       G      PNL + SW
Sbjct  321  LISKPVSYAAQKIHESLARTNDDYLRSALDYLELQPDLSALAR--GAHTFRCPNLGITSW  378

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I+M PG    +G   ILP P      DGSL VA  LQ +H++ F 
Sbjct  379  VRLPIHDTDFGWGRPIYMGPGGIAYEGLSYILPSPTS----DGSLSVAISLQTEHMKPFE  434

Query  209  KYFY  198
            K+FY
Sbjct  435  KFFY  438



>ref|XP_003532110.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=465

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 112/197 (57%), Gaps = 14/197 (7%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVI-HGVS  576
            R+E + AHIWRCACKAR    +QPT + F  DIR R+ PPLP +YFGNA++  V      
Sbjct  269  RFEAVAAHIWRCACKARGQHHKQPTIVRFNGDIRNRLIPPLPRNYFGNALVATVTPECYV  328

Query  575  GEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV-------IKRQELLGVLFGG  417
            GEI SRPL   A K+R+AI  +  EY+   ++    E  +       + + E     FGG
Sbjct  329  GEITSRPLSYAARKLREAIALLRDEYIRSQLEAVFGEEQLKCIRAFFLGQGEGRSEPFGG  388

Query  416  NPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDV-LILPGPNGIDGDDGSLLVAAC  240
            NPNL + SW+  P+   DFGWG+ ++   G + C  D  +I+  P     DDGSL+V   
Sbjct  389  NPNLQITSWINFPVDSTDFGWGKPVYFGLG-YVCALDRGIIVRDPQ----DDGSLIVIMH  443

Query  239  LQVDHIQDFNKYFYQDI  189
             Q+ H+Q F K FY+DI
Sbjct  444  FQIAHMQLFKKLFYEDI  460



>ref|XP_011073311.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=433

 Score =   147 bits (372),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 107/188 (57%), Gaps = 14/188 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++ AHIW CAC+AR    +Q T L    + R R+ PPLP  YFGN I      GVSGE
Sbjct  254  YEILAAHIWVCACRARGLVDEQKTKLFIATNGRSRLRPPLPPGYFGNVIFTTTPVGVSGE  313

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            + S+P+   A KI D +  +  EY+  A+D+   + D      L+ ++ G N    PNL+
Sbjct  314  LQSKPISYTAGKIHDVLVRMDDEYLRSALDYLEVQPD------LMALVRGANTFNCPNLA  367

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWVGLPI   DFGWG  + M PG+   +G  ++LP P     +DGSL VA  LQ + +
Sbjct  368  ITSWVGLPIHDADFGWGRPVFMGPGSILYEGLCVVLPSPT----NDGSLSVAVSLQEEPM  423

Query  221  QDFNKYFY  198
            + F K FY
Sbjct  424  KVFEKLFY  431



>emb|CDG56249.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase 2 
[Glechoma hederacea]
Length=430

 Score =   147 bits (371),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 103/184 (56%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WRCAC ARS    Q T L    D R R++PPLP  YFGN I       V+G+
Sbjct  251  YEMLAGHVWRCACLARSLPEDQDTKLYIATDGRARLQPPLPQGYFGNVIFTTTPQAVAGD  310

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S+P+   ASKI DA+  + +EY+  A+D+   + D+  +  + G      PNL + SW
Sbjct  311  LDSKPVWYAASKIHDALAQMDNEYLRSALDYLELQPDL--KALVRGAHTFRCPNLGITSW  368

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   +LP P     +DGSL VA  LQ +H++ F 
Sbjct  369  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSP----ANDGSLSVAISLQAEHMKLFE  424

Query  209  KYFY  198
            K  Y
Sbjct  425  KLLY  428



>gb|AFR67331.1| hydroxycinnamoyl CoA shikimate hydroxycinnamoyl transferase, 
partial [Leucaena leucocephala]
Length=274

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 103/185 (56%), Gaps = 6/185 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WR  CKAR+    Q T L    D R R++PPLP  YFGN I       V+G+
Sbjct  95   YEMLAGHVWRSTCKARALPDDQETKLYIATDGRSRLQPPLPPGYFGNVIFTATPMAVAGD  154

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            ++S+P    AS+I +A+  + +EY+  A+DF   + D+  +  + G      PNL + SW
Sbjct  155  LMSKPTWFAASRIHNALSRMDNEYLRSALDFLELQPDL--KALVRGAHTFKCPNLGITSW  212

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   ILP      G+DGSL VA  LQ +H++ F 
Sbjct  213  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPS----SGNDGSLSVAIALQPEHMKVFK  268

Query  209  KYFYQ  195
            +  Y+
Sbjct  269  EVLYE  273



>ref|XP_003532111.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=476

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 110/196 (56%), Gaps = 14/196 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVI-HGVSG  573
            +E + AHIWRCACKAR     QPT + F  D R R+  PLP +YFGNA+   V     +G
Sbjct  281  FEAVAAHIWRCACKARKLDRNQPTLVRFNADFRSRLTRPLPRNYFGNALAATVTPESYAG  340

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD------VIKRQ-ELLGVLFGGN  414
            EI SRPL   A K+R+A++ +  EY+   ++    E        +  RQ E     F GN
Sbjct  341  EITSRPLSYAARKLREAVEMLKEEYITSQLEVVLGEEQLESIKALFSRQGERRNSPFAGN  400

Query  413  PNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDV-LILPGPNGIDGDDGSLLVAACL  237
            PNL + SW+ +P+   DFGWG+  H   G + C  D  +I+ GP     +DGS++V    
Sbjct  401  PNLQITSWISIPLYEADFGWGKPEHFVLG-YVCPFDRGIIIRGPE----NDGSVIVIMYF  455

Query  236  QVDHIQDFNKYFYQDI  189
            Q+ H+Q F K+FY+D+
Sbjct  456  QIAHMQLFKKFFYEDV  471



>ref|XP_004500023.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cicer 
arietinum]
Length=463

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 108/194 (56%), Gaps = 10/194 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            R+E I+AH+WRCA KAR  +  Q + + F  D+R R+ PPLP +Y+GNA+    + G  G
Sbjct  274  RFESISAHVWRCALKARELEENQESVVRFNADVRSRIVPPLPKNYYGNALTQTAVKGYVG  333

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELL------GVLFGGNP  411
            EI S+PL  V+ KIR++++ V  EY+   ID  R   ++   + L         L+ GNP
Sbjct  334  EITSKPLGYVSQKIRESVEVVNDEYIRSQIDVIRGFENLDDARSLFLGDFDKKTLYFGNP  393

Query  410  NLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQV  231
            N  V SW+ +P    DFGWG+ ++    +       LIL    G    DGS++V    Q+
Sbjct  394  NFHVTSWLSMPTYEADFGWGKPVYFGLNSLSPHDRALILLSSEG----DGSVIVCLHFQI  449

Query  230  DHIQDFNKYFYQDI  189
             H++ F K+FY DI
Sbjct  450  AHLELFKKFFYGDI  463



>emb|CDG56248.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase 1 
[Glechoma hederacea]
Length=434

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 103/184 (56%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WRCAC ARS    Q T L    D R R++PPLP  YFGN I       V+G+
Sbjct  255  YEMLAGHVWRCACLARSLPEDQDTKLYIATDGRARLQPPLPQGYFGNVIFTATPLAVAGD  314

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S+P+   ASKI DA+  + +EY+  A+D+   + D+  +  + G      PNL + SW
Sbjct  315  LESKPVWYAASKIHDALARMDNEYLRSALDYLELQPDL--KALVRGAHTFRCPNLGITSW  372

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   +LP P     +DGSL VA  LQ +H++ F 
Sbjct  373  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSP----ANDGSLSVAISLQAEHMKLFE  428

Query  209  KYFY  198
            K  Y
Sbjct  429  KLLY  432



>dbj|BAA87043.1| N-hydroxycinnamoyl/benzoyltransferase [Ipomoea batatas]
 dbj|BAJ14795.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Ipomoea 
batatas]
Length=431

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 100/184 (54%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++ AHIWRCACKAR     Q T L    D R R+ PPLP  Y GN +        SGE
Sbjct  252  YEILAAHIWRCACKARGLTDDQATKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESGE  311

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S PL + A +I  A+  +  EY+  A+DF   + D+ K   + G  +  +PNL++ SW
Sbjct  312  LQSEPLTNSAKRIHSALSRMDDEYLRSALDFLECQPDLSKL--IRGSNYFASPNLNINSW  369

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LP+   DFGWG  IHM P     +G V ILP PN     D +L +A CL  +H+  F 
Sbjct  370  TRLPVHESDFGWGRPIHMGPACILYEGTVYILPSPN----KDRTLSLAVCLDAEHMPLFK  425

Query  209  KYFY  198
            ++ Y
Sbjct  426  EFLY  429



>ref|XP_003553115.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=462

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 113/197 (57%), Gaps = 14/197 (7%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVI-HGVS  576
            R+E + AHIWRCACKAR     QPT   F VD R R+ PPLP +YFGNA++  V      
Sbjct  266  RFEAVAAHIWRCACKARELHHNQPTLARFNVDFRNRLIPPLPRNYFGNALVATVTPECYV  325

Query  575  GEIISRPLQDVASKIRDAIDGVTSEYVNCAID--FYRNEGDVIK-----RQELLGVLFGG  417
            GE+ +RPL   A K+R+A+  +T EY+   ++  F   + D IK     + E     FGG
Sbjct  326  GEMTTRPLSYAAQKMREAVALLTDEYIRSHLEVVFGEEQLDCIKAFFLGQGEGRYAPFGG  385

Query  416  NPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDV-LILPGPNGIDGDDGSLLVAAC  240
            NPNL + SW+ +     DFGWG+ ++   G + C  D  +I+ GP     DDGS++V   
Sbjct  386  NPNLQITSWINMRAYETDFGWGKPVYFGLG-YVCALDRGIIMRGPQ----DDGSVIVIMH  440

Query  239  LQVDHIQDFNKYFYQDI  189
             Q+ H+Q   K+FY+DI
Sbjct  441  FQIAHMQLLKKFFYEDI  457



>ref|XP_004149125.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cucumis 
sativus]
 gb|KGN53930.1| hypothetical protein Csa_4G190020 [Cucumis sativus]
Length=469

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 116/201 (58%), Gaps = 17/201 (8%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARS---HKPQQPTNLSFCVDIRRRMEPPLPDSYFGNA-IIDVVIH  585
            RYE+IT HIW CA KAR+    K +Q T +   V+IR+R+  P+P ++ GNA +I +   
Sbjct  273  RYELITGHIWVCASKARNIDNDKSKQSTVVQIVVNIRQRLRTPIPKNFCGNAALISITPQ  332

Query  584  GVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFG-----  420
               GE++S+PL   A KIR+A   +T EYV  AIDF   + D+   +             
Sbjct  333  CEFGELMSQPLSYAAKKIREASWKMTDEYVKSAIDFLATQEDICWTRTSSSSSSSIVRVK  392

Query  419  ----GNPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLL  252
                 NPNLS++SW+ +PI   DFGWG   ++ P     DG + I+PGPN    +DG ++
Sbjct  393  GTSLSNPNLSIVSWLSMPIYDADFGWGYPDYVGPSMLAYDGKMFIMPGPN----NDGLII  448

Query  251  VAACLQVDHIQDFNKYFYQDI  189
            VA  LQ+ H++ F K+FY+D+
Sbjct  449  VAIQLQMKHMEYFKKFFYEDL  469



>gb|ADG46003.1| hydroxycinnamoyl transferase [Salvia miltiorrhiza]
Length=427

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 102/185 (55%), Gaps = 6/185 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  HIWRCAC AR     Q T L    D R R++PPLP  YFGN I       V+G+
Sbjct  248  YEMLAGHIWRCACLARGLPEDQSTKLYIATDGRFRLQPPLPPGYFGNVIFTATPMAVAGD  307

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S+P    ASKI DA+  + +EY+  A+D+   + D+  +  + G      PNL + SW
Sbjct  308  LESKPAWYGASKIHDALARMDNEYLRSALDYLELQPDL--KALVRGAHTFRCPNLGITSW  365

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   +LP P     +DGSL VA  LQ DH++ F 
Sbjct  366  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSP----ANDGSLSVAISLQADHMKVFE  421

Query  209  KYFYQ  195
            K  Y+
Sbjct  422  KLLYE  426



>gb|ACA64049.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Salvia miltiorrhiza]
Length=427

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 102/185 (55%), Gaps = 6/185 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  HIWRCAC AR     Q T L    D R R++PPLP  YFGN I       V+G+
Sbjct  248  YEMLAGHIWRCACLARGLPEDQSTKLYIATDGRFRLQPPLPPGYFGNVIFTATPMAVAGD  307

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S+P    ASKI DA+  + +EY+  A+D+   + D+  +  + G      PNL + SW
Sbjct  308  LESKPAWYGASKIHDALARMDNEYLRSALDYLELQPDL--KALVRGAHTFRCPNLGITSW  365

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   +LP P     +DGSL VA  LQ DH++ F 
Sbjct  366  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSP----ANDGSLSVAISLQADHMKVFE  421

Query  209  KYFYQ  195
            K  Y+
Sbjct  422  KLLYE  426



>gb|KHN18128.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=462

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 113/197 (57%), Gaps = 14/197 (7%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVI-HGVS  576
            R+E + AHIWRCACKAR     QPT   F VD R R+ PPLP +YFGNA++  V      
Sbjct  266  RFEAVAAHIWRCACKARELHHNQPTLARFNVDFRNRLIPPLPRNYFGNALVATVTPECYV  325

Query  575  GEIISRPLQDVASKIRDAIDGVTSEYVNCAID--FYRNEGDVIK-----RQELLGVLFGG  417
            GE+ +RPL   A K+R+A+  +T EY+   ++  F   + D IK     + E     FGG
Sbjct  326  GEMTTRPLSYAAQKMREAVALLTDEYIRSHLEVVFGEEQLDCIKAFFLGQGEGRYAPFGG  385

Query  416  NPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDV-LILPGPNGIDGDDGSLLVAAC  240
            NPNL + SW+ +     DFGWG+ ++   G + C  D  +I+ GP     DDGS++V   
Sbjct  386  NPNLQITSWINMRAYETDFGWGKPVYFGLG-YVCALDRGIIMRGPQ----DDGSVIVIMH  440

Query  239  LQVDHIQDFNKYFYQDI  189
             Q+ H+Q   K+FY+DI
Sbjct  441  FQIAHMQLLKKFFYEDI  457



>gb|KHM99608.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=475

 Score =   145 bits (366),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 110/196 (56%), Gaps = 14/196 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVI-HGVSG  573
            +E + AHIWRCACKAR     QPT + F  D R R+  PLP +YFGNA+   V     +G
Sbjct  280  FEAVAAHIWRCACKARKLDRNQPTLVRFNADFRSRLTRPLPRNYFGNALAATVTPECYAG  339

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD------VIKRQ-ELLGVLFGGN  414
            EI SRPL   A K+R+A++ +  EY+   ++    E        +  RQ E     F GN
Sbjct  340  EITSRPLSYAARKLREAVEMLKEEYITSQLEVVLGEEQLESIKALFSRQGERRNSPFAGN  399

Query  413  PNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDV-LILPGPNGIDGDDGSLLVAACL  237
            PNL + SW+ +P+   DFGWG+  H   G + C  D  +I+ GP     +DGS++V    
Sbjct  400  PNLQITSWISIPLYEADFGWGKPEHFVLG-YVCPFDRGIIIRGPE----NDGSVIVIMYF  454

Query  236  QVDHIQDFNKYFYQDI  189
            Q+ H+Q F K+FY+D+
Sbjct  455  QIAHMQLFKKFFYEDV  470



>ref|XP_006382509.1| hypothetical protein POPTR_0005s02820g [Populus trichocarpa]
 gb|ERP60306.1| hypothetical protein POPTR_0005s02820g [Populus trichocarpa]
Length=444

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 107/186 (58%), Gaps = 10/186 (5%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            +E + AHIW+C CKAR     Q T L    D R R+ PPLP  Y GN +    I G+SGE
Sbjct  265  FETLAAHIWQCTCKARGITNDQATKLHIPTDGRSRLNPPLPAGYCGNVLFTAAILGLSGE  324

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV--IKRQELLGVLFGGNPNLSVI  396
            I S+PL D  +KIR A+  + +EY+  AID+ + + D+  +KR    G     +PNL+++
Sbjct  325  IQSKPLVDTIAKIRGALKRMDNEYLRSAIDYLQVQADLEALKR----GPHTFKSPNLNIV  380

Query  395  SWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQD  216
            SW+ +PI   DFGWG    M P     +G   I   PN    +DGSL++  CL+ +H++ 
Sbjct  381  SWMTMPIYDADFGWGRPYFMGPAIVGFEGMAYIARCPN----NDGSLMIFTCLESNHMEL  436

Query  215  FNKYFY  198
            F K+FY
Sbjct  437  FKKFFY  442



>gb|EPS67512.1| hypothetical protein M569_07262 [Genlisea aurea]
Length=448

 Score =   144 bits (364),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 104/185 (56%), Gaps = 6/185 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y ++  H+WRCAC+ARS    Q T +   +D R R+ PPLP  YFGNA+        +G+
Sbjct  269  YVLVAGHVWRCACEARSLPDDQKTKVYIAIDGRSRLRPPLPPGYFGNALFTATPIAAAGD  328

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            +I + L+  A+KI +AI  +  EY+  A+D+   + D+  +  + G      PNL + SW
Sbjct  329  VIGKSLRHSATKIHEAIARMDDEYLRSALDYLELQPDL--KALVRGAHTYRCPNLGITSW  386

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LPI   DFGWG  I M PG    +G   +LP P+    +DGSL VA  LQ DH+  F+
Sbjct  387  ARLPIHEADFGWGRPIFMGPGGIAFEGLSFVLPSPD----NDGSLSVAISLQKDHLNVFH  442

Query  209  KYFYQ  195
            K FYQ
Sbjct  443  KLFYQ  447



>ref|XP_010545859.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Tarenaya 
hassleriana]
Length=440

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 100/184 (54%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE + AH+WRCAC+AR    ++ T L   VD R R+ PP+P   FGN +  +     SG+
Sbjct  261  YESLAAHVWRCACRARDLPDEEKTLLYIAVDARSRLRPPIPKELFGNVVQALAPMAYSGD  320

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            I+  PL   A +IR A+  V  EY+   + F R+    I  + L G     NPNLS++SW
Sbjct  321  IVKEPLSSTAGRIRKAVKEVDDEYIRSGLAFLRDNPQAI--EVLTGRPVSQNPNLSIVSW  378

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              +P+   DFGWG   H++P +  CDG   ++ G +  DG    L +  CL+  H++ F 
Sbjct  379  TQMPMYEADFGWGPPFHVAPASIRCDGKGYLMSGRSREDG----LSLYICLETQHMELFK  434

Query  209  KYFY  198
            K FY
Sbjct  435  KLFY  438



>emb|CBI83579.1| hydroxycinnamoyl transferase [Solenostemon scutellarioides]
Length=427

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 103/185 (56%), Gaps = 6/185 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE+++ H+WRC C AR    +Q T L    D R R++P LP  YFGN I       V+G+
Sbjct  248  YEMLSGHVWRCTCLARGLPEEQETKLYIATDGRSRLQPQLPPGYFGNVIFTATPLAVAGD  307

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S+P+   ASKI DA+  + ++Y+  A+DF   + D+  +  + G      PNL + SW
Sbjct  308  LGSKPVWYAASKIHDALARMDNDYLRSALDFLELQPDL--KALVRGAHTFRCPNLGITSW  365

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   +LP P     +DGSL VA  LQ +H++ F 
Sbjct  366  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSPT----NDGSLSVAISLQAEHMKLFE  421

Query  209  KYFYQ  195
            K  YQ
Sbjct  422  KLLYQ  426



>ref|XP_009800587.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=436

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 98/185 (53%), Gaps = 5/185 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++ AHIWRC CKAR+    Q T L    D R R+ PPLP  Y GN +        S E
Sbjct  256  YEILAAHIWRCTCKARALADDQLTKLHVATDGRSRLCPPLPPGYLGNVVFTATPMAKSSE  315

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            ++  PL + A +I  ++  +   Y+  A+D+   + D+     + G  +  +PNL++ SW
Sbjct  316  LLQEPLTNSAKRIHTSLSKMDDNYLRSALDYLELQPDL--SALIRGPTYFASPNLNINSW  373

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LP+   DFGWG  IHM P     +G V ILP PN     D +L +A CL  DH+  F 
Sbjct  374  TRLPVHDSDFGWGRPIHMGPACILYEGTVYILPSPN---SKDRNLRLAVCLDADHMPLFE  430

Query  209  KYFYQ  195
            KY Y+
Sbjct  431  KYLYE  435



>gb|AFK47698.1| unknown [Lotus japonicus]
Length=276

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 103/192 (54%), Gaps = 5/192 (3%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            R+E I AHIWRCA KA +    QP+ + F  + R RM PPLP +YFGNA+      G  G
Sbjct  80   RFEAIGAHIWRCASKAGAFDQNQPSVIRFNAENRGRMVPPLPRNYFGNALTQTAATGYVG  139

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGG-NPNLSVI  396
            EI S+PL  VA KIR+A++ V  EY+   ID  R +  +     L     G  NPNL   
Sbjct  140  EITSKPLSHVAQKIREAVEVVNDEYIRSQIDVIRCQKHLDDATALFSPFSGNQNPNLLFT  199

Query  395  SWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQD  216
            SW+ +P+   DFG G+ ++             I   P+G    DGS++V+   Q+ ++Q 
Sbjct  200  SWMSMPMYEADFGKGKPVYFGLAYVSSHDRAYIFLSPDG----DGSVIVSMFFQMSNMQL  255

Query  215  FNKYFYQDINNL  180
            F ++FY DI+  
Sbjct  256  FKEFFYADISTF  267



>emb|CBI25231.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 102/189 (54%), Gaps = 14/189 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y ++  H+WRCACKARS    Q + +    D R R+ P LP  YFGN I       V+GE
Sbjct  227  YVMLAGHVWRCACKARSLPADQDSKMYIATDGRSRLRPALPPGYFGNVIFTTTPVAVAGE  286

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            ++S+PL   ASKI +A+  +  EY+  A+D+   + D      L  ++ G +    PN+ 
Sbjct  287  LMSKPLWYAASKIHNALARMDDEYLRSALDYLELQPD------LTALVRGAHTFRCPNIG  340

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SW  LPI   DFGWG  I M PG    +G    LP P     +DGSL +A  LQ DH+
Sbjct  341  ITSWTRLPIYDADFGWGRPIFMGPGGIALEGLAFALPSPT----NDGSLSIAISLQEDHM  396

Query  221  QDFNKYFYQ  195
            + F KY Y+
Sbjct  397  KLFQKYLYE  405



>gb|AGA20364.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Leucaena leucocephala]
Length=439

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 103/185 (56%), Gaps = 6/185 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WR  CKAR+    Q T L    D R R++PPLP  YFGN I       V+G+
Sbjct  260  YEMLAGHVWRSTCKARALPDDQETKLYIATDGRSRLQPPLPPGYFGNVIFTATPMAVAGD  319

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            ++S+P    AS+I +A+  + +EY+  A+DF   + D+  +  + G      PNL + SW
Sbjct  320  LMSKPTWFAASRIHNALSRMDNEYLRSALDFLELQPDL--KALVRGAHTFKCPNLGITSW  377

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   ILP      G+DGSL VA  LQ +H++ F 
Sbjct  378  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPS----SGNDGSLSVAIALQPEHMKVFK  433

Query  209  KYFYQ  195
            +  Y+
Sbjct  434  EVLYE  438



>ref|XP_010273689.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=443

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 103/188 (55%), Gaps = 9/188 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE +  HIWRCA KAR     Q T +   VD RRR+ P  P +YFGNA         +G
Sbjct  265  RYESLAGHIWRCASKARGLVNDQETKVQVSVDCRRRLRPAFPANYFGNATFPTTPMAKAG  324

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVIS  393
            ++IS+PL   A KIR++I  +T EYV  AIDF  +  D+ + +  LG  +   PNL++ S
Sbjct  325  DLISKPLSYAAGKIRESIKRMTDEYVRSAIDFLGSYRDLSRFR--LGARYWC-PNLAITS  381

Query  392  WVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDF  213
            WVGL +   DFGWG+  HM P     DG   +      +  ++G +++   LQ +H+  F
Sbjct  382  WVGLSLYTADFGWGQPFHMGPATVRPDGKAFL------VSAENGGIIIYLRLQTEHVVKF  435

Query  212  NKYFYQDI  189
             +  YQ +
Sbjct  436  KELLYQGL  443



>ref|XP_007146398.1| hypothetical protein PHAVU_006G037000g [Phaseolus vulgaris]
 gb|ESW18392.1| hypothetical protein PHAVU_006G037000g [Phaseolus vulgaris]
Length=449

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/196 (38%), Positives = 112/196 (57%), Gaps = 12/196 (6%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHG-VS  576
            R+E +  HIWR A KAR  + +QPT + F  DIR R+ PPLP +Y+GNA+   V      
Sbjct  258  RFEALAGHIWRSASKARELEEKQPTVVRFNADIRSRVIPPLPKNYYGNALAATVTPKCYV  317

Query  575  GEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG--DVIKR-----QELLGVLFGG  417
            GEI+S+PL   A K+R+AI+ +T+EY+   +     E   D I+R      E   V F G
Sbjct  318  GEIVSKPLSYAAQKVREAIEKLTNEYIRSQLKNVLGEEQLDCIRRLFMGEGERRNVPFAG  377

Query  416  NPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACL  237
            NPNL + SW+ +P+   DFGWG+ ++            +I+  P+G    DGS++++   
Sbjct  378  NPNLHITSWMSMPLYEADFGWGKPVNFGLAYVFAQDRAVIILSPHG----DGSIVISMTF  433

Query  236  QVDHIQDFNKYFYQDI  189
            Q +H++ F K+FY+ I
Sbjct  434  QEEHLELFKKFFYETI  449



>ref|XP_003604491.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase-like 
protein [Medicago truncatula]
 gb|AES86688.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=411

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 113/196 (58%), Gaps = 13/196 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAI-IDVVIHGVSG  573
            YEV+T H+WRCACKAR     QPT +    DIR R+ PPLP +YFGNA+ + +       
Sbjct  219  YEVVTTHLWRCACKARGLDDVQPTVIRLPGDIRNRINPPLPQNYFGNALAVALTPICYVK  278

Query  572  EIISRPLQDVASKIRDAIDGVTS-EYVNCAIDFYRNE-------GDVIKRQELLGVLFGG  417
            +I++ PL   A KIR+AI  V++ EY+   +DF R +         +++  +     F G
Sbjct  279  DIVNEPLSYGAGKIREAIGLVSNPEYIRSHLDFIRCQESLDFIRTSIVENGKAKAATFYG  338

Query  416  NPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACL  237
            NPN+++ SW+ +P+   DFGWG+ +   P     DG + I+   +G    DGSLLV+  L
Sbjct  339  NPNMNITSWMSMPVYEADFGWGKPLFFGPALVLPDGRLYIMRSSSG----DGSLLVSVHL  394

Query  236  QVDHIQDFNKYFYQDI  189
            Q  H++ F  +FYQD+
Sbjct  395  QSRHMELFKNFFYQDL  410



>ref|XP_006840118.1| hypothetical protein AMTR_s00727p00010990 [Amborella trichopoda]
 gb|ERN01793.1| hypothetical protein AMTR_s00727p00010990 [Amborella trichopoda]
Length=281

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 100/189 (53%), Gaps = 16/189 (8%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WRC+CKAR+    Q T +    D R R+ P LP  YFGN I       V+G+
Sbjct  102  YEMLAGHVWRCSCKARNLPDDQLTKMYIATDGRSRLRPLLPAGYFGNVIFTATPIAVAGD  161

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN-----PNL  405
            ++SRP    A  IR A+  +  +Y+  A+D+   + D       LG L  G      PN+
Sbjct  162  LMSRPAYVAAGCIRQALARMDDDYLRSALDYLEIQPD-------LGALVRGAHTFRCPNI  214

Query  404  SVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDH  225
             + SW  LPI   DFGWG  + M PG    +G   +LP P+G    DGSL +A  LQ DH
Sbjct  215  GITSWARLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSPSG----DGSLSLAISLQADH  270

Query  224  IQDFNKYFY  198
            +  F KYFY
Sbjct  271  MVLFKKYFY  279



>ref|XP_002268988.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
Length=429

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 102/189 (54%), Gaps = 14/189 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y ++  H+WRCACKARS    Q + +    D R R+ P LP  YFGN I       V+GE
Sbjct  250  YVMLAGHVWRCACKARSLPADQDSKMYIATDGRSRLRPALPPGYFGNVIFTTTPVAVAGE  309

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            ++S+PL   ASKI +A+  +  EY+  A+D+   + D      L  ++ G +    PN+ 
Sbjct  310  LMSKPLWYAASKIHNALARMDDEYLRSALDYLELQPD------LTALVRGAHTFRCPNIG  363

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SW  LPI   DFGWG  I M PG    +G    LP P     +DGSL +A  LQ DH+
Sbjct  364  ITSWTRLPIYDADFGWGRPIFMGPGGIALEGLAFALPSPT----NDGSLSIAISLQEDHM  419

Query  221  QDFNKYFYQ  195
            + F KY Y+
Sbjct  420  KLFQKYLYE  428



>ref|XP_010113235.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXC76036.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=439

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 105/185 (57%), Gaps = 14/185 (8%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE+++ H+WRCACKAR+    Q T L   VD R R++PPLP SYFGN I       ++G+
Sbjct  260  YEMLSGHVWRCACKARALPDDQETKLFVAVDGRARLQPPLPQSYFGNVIFTTTPIALAGD  319

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            ++S+P+   AS+I   +    +EY+  AID+   + D      L  ++ G +    PNL 
Sbjct  320  LVSKPIWYAASQIHKTLVKTNNEYLKSAIDYLEIQPD------LSALVRGAHTFRCPNLG  373

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG  I M PG    +G   +LP P     +DGSL +A  LQ +H+
Sbjct  374  ITSWVRLPIYDADFGWGRPIFMGPGGIMFEGLAYVLPSPT----NDGSLSIAIGLQPEHM  429

Query  221  QDFNK  207
            + F K
Sbjct  430  EAFGK  434



>emb|CAN82918.1| hypothetical protein VITISV_023290 [Vitis vinifera]
Length=429

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 102/189 (54%), Gaps = 14/189 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y ++  H+WRCACKARS    Q + +    D R R+ P LP  YFGN I       V+GE
Sbjct  250  YVMLAGHVWRCACKARSLPADQDSKMYIATDGRSRLRPALPPGYFGNVIFTTTPVAVAGE  309

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            ++S+PL   ASKI +A+  +  EY+  A+D+   + D      L  ++ G +    PN+ 
Sbjct  310  LMSKPLWYAASKIHNALARMDDEYLRSALDYLEIQPD------LTALVRGAHTFRCPNIG  363

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SW  LPI   DFGWG  I M PG    +G    LP P     +DGSL +A  LQ DH+
Sbjct  364  ITSWTRLPIYDADFGWGRPIFMGPGGIALEGLAFALPSPT----NDGSLSIAISLQEDHM  419

Query  221  QDFNKYFYQ  195
            + F KY Y+
Sbjct  420  KLFQKYLYE  428



>ref|XP_003599928.1| Anthranilate N-benzoyltransferase protein [Medicago truncatula]
 ref|XP_003599933.1| Anthranilate N-benzoyltransferase protein [Medicago truncatula]
 gb|AES70179.1| spermidine hydroxycinnamoyl transferase [Medicago truncatula]
Length=456

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 110/197 (56%), Gaps = 10/197 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            R+E I+AHIW+ A KAR  +  Q + + F V+IR R+ P LP +Y+GNA+I   + G  G
Sbjct  258  RFEAISAHIWKSASKARKLEENQQSVVRFNVEIRNRIIPNLPKNYYGNALIQTAVEGYIG  317

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELL------GVLFGGNP  411
            EI+S+PL  VA KIR+A + +T+EY+   ID  R   ++   ++L          + GNP
Sbjct  318  EILSKPLSYVAMKIREAHELITNEYIRSQIDVIRGFENLDDARKLFIGGEGKNATYFGNP  377

Query  410  NLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQV  231
            NL + SW+ LP    DFGWG+  +   G        LI   P G    DGS++V    QV
Sbjct  378  NLHITSWMALPSHKADFGWGKPFYFGLGYVSPHDRGLIYLSPEG----DGSVIVCMHFQV  433

Query  230  DHIQDFNKYFYQDINNL  180
            + +Q F K FY D+  L
Sbjct  434  ELMQLFKKLFYGDLYEL  450



>ref|NP_001289240.1| shikimate O-hydroxycinnamoyltransferase-like [Pyrus x bretschneideri]
 gb|AFF57841.1| hydroxycinnamoyl-coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
3 [Pyrus x bretschneideri]
Length=438

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 102/188 (54%), Gaps = 14/188 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE+++ H+WRCACKAR     Q T L    D R R++PPLP  YFGN I       V+G+
Sbjct  259  YEMLSGHVWRCACKARELPDDQDTKLYIATDGRSRLQPPLPPGYFGNVIFTTTPIAVAGD  318

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            I S+P    AS+I D +  +   Y+  A+D+   + D      L  ++ G +    PNL 
Sbjct  319  IQSKPTWYAASRIHDGLVRMDDSYLRSALDYLELQPD------LSALVRGAHSFRCPNLG  372

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG  I M PG    +G   I+P       +DGSL VA CLQ +H+
Sbjct  373  ITSWVRLPIHDADFGWGRPIFMGPGGIAFEGLSFIIPSAT----NDGSLSVAICLQTEHM  428

Query  221  QDFNKYFY  198
            + F+K  Y
Sbjct  429  KSFSKLLY  436



>gb|AHG97388.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Gossypium hirsutum]
Length=499

 Score =   142 bits (358),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 103/188 (55%), Gaps = 14/188 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE+++ H+WR  CKAR  +  Q T L    D R R+ PPLP  YFGN I       V+G+
Sbjct  320  YEMLSGHVWRSVCKARGLEDDQGTKLYIATDGRARLRPPLPPGYFGNVIFTATPIAVAGD  379

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            ++S+P    AS+I DA+  +  EY+  A+D+   + D      L  ++ G +    PNL 
Sbjct  380  LLSKPTWYAASRIHDALVRMDDEYLRSALDYLELQPD------LSALVRGAHTFRCPNLG  433

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG  I M PG    +G   +LP PN    +DGSL VA  LQ +H+
Sbjct  434  ITSWVRLPIHDADFGWGRPIFMGPGGIPYEGLSFVLPSPN----NDGSLSVAISLQTEHM  489

Query  221  QDFNKYFY  198
              F K FY
Sbjct  490  NVFEKLFY  497



>ref|XP_010094062.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB55152.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=432

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 105/185 (57%), Gaps = 14/185 (8%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE+++ H+WRCACKAR+    Q T L   VD R R++PPLP SYFGN I       ++G+
Sbjct  253  YEMLSGHVWRCACKARALPDDQETKLFVAVDGRARLQPPLPQSYFGNVIFTTTPIALAGD  312

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            ++S+P+   AS+I   +    +EY+  AID+   + D      L  ++ G +    PNL 
Sbjct  313  LVSKPIWYAASQIHKTLVKTNNEYLKSAIDYLEIQPD------LSALVRGAHTFRCPNLG  366

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG  I M PG    +G   +LP P     +DGSL +A  LQ +H+
Sbjct  367  ITSWVRLPIYDADFGWGRPIFMGPGGIMFEGLAYVLPSPT----NDGSLSIAIGLQPEHM  422

Query  221  QDFNK  207
            + F K
Sbjct  423  EAFGK  427



>ref|XP_008466864.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Cucumis melo]
Length=280

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 100/184 (54%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE+++ H+WRC CKAR     Q T L    D R R+ PPLP+ YFGN I       V+GE
Sbjct  101  YEMLSGHVWRCTCKARELPDDQDTKLYIATDGRARLRPPLPNGYFGNVIFTATPLAVAGE  160

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            ++S P    A KI DA+  + ++Y+  A+D+   + ++     + G      PNL + SW
Sbjct  161  LMSNPTWFAAGKIHDALTRMDNDYLRSALDYLEIQPNI--SALVRGAHTFRCPNLGITSW  218

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   I+P  +    DDGSL VA  LQ  H++ F 
Sbjct  219  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSAS----DDGSLSVAISLQNRHMKVFE  274

Query  209  KYFY  198
            K F+
Sbjct  275  KLFF  278



>ref|XP_009624297.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=436

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 97/185 (52%), Gaps = 5/185 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++ AHIWRC CKAR+    Q T L    D R R+ PPLP  Y GN +        S E
Sbjct  256  YEILAAHIWRCTCKARALSDDQLTKLHVATDGRSRLCPPLPPGYLGNVVFTGTPMAKSSE  315

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            ++  PL + A +I  A+  +   Y+  A+D+     D+     + G  +  +PNL++ SW
Sbjct  316  LLQEPLTNSAKRIHSALSKMDDNYLRSALDYLELLPDL--SALIRGPTYFASPNLNINSW  373

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LP+   DFGWG  IHM P     +G V ILP PN     D +L +A CL  DH+  F 
Sbjct  374  TRLPVHDSDFGWGRPIHMGPACILYEGTVYILPSPN---SKDRNLRLAVCLDADHMPLFE  430

Query  209  KYFYQ  195
            KY Y+
Sbjct  431  KYLYE  435



>emb|CAE46932.1| hydroxycinnamoyl CoA quinate transferase [Nicotiana tabacum]
Length=436

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 97/185 (52%), Gaps = 5/185 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++ AHIWRC CKAR+    Q T L    D R R+ PPLP  Y GN +        S E
Sbjct  256  YEILAAHIWRCTCKARALSDDQLTKLHVATDGRSRLCPPLPPGYLGNVVFTGTPMAKSSE  315

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            ++  PL + A +I  A+  +   Y+  A+D+     D+     + G  +  +PNL++ SW
Sbjct  316  LLQEPLTNSAKRIHSALSKMDDNYLRSALDYLELLPDL--SALIRGPTYFASPNLNINSW  373

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LP+   DFGWG  IHM P     +G V ILP PN     D +L +A CL  DH+  F 
Sbjct  374  TRLPVHDSDFGWGRPIHMGPACILYEGTVYILPSPN---SKDRNLRLAVCLDADHMPLFE  430

Query  209  KYFYQ  195
            KY Y+
Sbjct  431  KYLYE  435



>ref|XP_010244683.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 100/188 (53%), Gaps = 14/188 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YEV+  H+WRC CKAR     Q T L   VD+R R+ PPLP  YFGN  +     GV+G+
Sbjct  253  YEVLVGHVWRCVCKARGLCDDQDTKLYMAVDLRSRLRPPLPQGYFGNGTLVTSPIGVAGD  312

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            + S+PL     +I D +  +  EY+  AID+   + D      L  ++ G +    PN+ 
Sbjct  313  LRSKPLAYAVGRIHDQLMRMNDEYLRSAIDYLELQPD------LTALVRGADTFRCPNMG  366

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            +++W  LPI   DFGWG  I+M P     +G   ILP P      DGS  +A  LQ DH+
Sbjct  367  IVNWTQLPIYDADFGWGRPIYMGPATVLHEGMAYILPSP----AQDGSATLAVSLQSDHM  422

Query  221  QDFNKYFY  198
            Q F K FY
Sbjct  423  QLFEKIFY  430



>ref|XP_010063596.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063597.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70836.1| hypothetical protein EUGRSUZ_F03978 [Eucalyptus grandis]
Length=454

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 105/198 (53%), Gaps = 14/198 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WRCAC+AR     Q + L    D R R+ PPLP  YFGN I       V+G+
Sbjct  262  YEILAGHVWRCACRARGLSDDQDSKLYIATDGRMRLSPPLPRGYFGNVIFTATPIAVAGD  321

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            +IS+P+   A KIR+++  +  +Y+  A+D+   + D      L  ++ G +    PNL 
Sbjct  322  LISKPVSYAAQKIRESLARMDDDYLRSALDYLELQPD------LSALVRGAHTFRCPNLG  375

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG  I M PG    +G   ILP        DGSL VA  LQ +H+
Sbjct  376  ITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSSTS----DGSLSVAISLQTEHM  431

Query  221  QDFNKYFYQDINNL*RRR  168
            + F K+ Y       R+R
Sbjct  432  KLFEKFLYDFPGESPRKR  449



>gb|AGE10615.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl transferase, partial 
[Lonicera macranthoides]
Length=276

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 102/185 (55%), Gaps = 6/185 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YEV+ AH+WRCACKAR     Q + L    D R R+ PPLP  Y GN +       VSG+
Sbjct  98   YEVLAAHLWRCACKARGLAKDQMSKLYIATDGRARLCPPLPFGYLGNVVFTATPMAVSGD  157

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            +++ P+ D + +I  A+  +   Y+  A+D+     D+  +  + G  +  +PNL++ SW
Sbjct  158  LVAEPIIDSSRRIHSALTQMDDGYLRSALDYLELLPDL--KALVRGPHYFASPNLNINSW  215

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LP+   DFGWG  I M P +   +G + I+P P     +D SLL+A CL V H+  F 
Sbjct  216  SRLPVYDADFGWGRPIFMGPASILYEGTIYIIPSPT----NDRSLLLAVCLDVGHMPLFK  271

Query  209  KYFYQ  195
            KY Y+
Sbjct  272  KYLYE  276



>gb|AFN85668.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Hibiscus cannabinus]
Length=431

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 99/184 (54%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE+++ H+WR  CKAR     Q T L    D R R+ PPLP  YFGN I       V+G+
Sbjct  252  YEMLSGHVWRSVCKARGLTDDQGTKLYIATDGRSRLRPPLPPGYFGNVIFTATPIAVAGD  311

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            ++ +P    AS+I DA+  +  EY+  A+DF   + D+     + G      PNL + SW
Sbjct  312  LMLKPTWYAASRIHDALVRMDDEYLRSALDFLELQPDL--SALVRGAHTFKCPNLGITSW  369

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LPI   DFGWG  I M PG    +G   +LP PN    +DGSL VA  LQ +H++ F 
Sbjct  370  ARLPIHDADFGWGRPIFMGPGGIPYEGLSFVLPSPN----NDGSLSVAISLQTEHMKVFE  425

Query  209  KYFY  198
            K FY
Sbjct  426  KLFY  429



>ref|XP_011036967.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=443

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 107/186 (58%), Gaps = 10/186 (5%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            +E++ AHIW+C CKAR     Q T L    D R R+ PPLP  Y GN +    I G+SGE
Sbjct  264  FEILAAHIWQCTCKARGITNDQATKLHIPTDGRSRLNPPLPAGYCGNVLFTTAILGLSGE  323

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV--IKRQELLGVLFGGNPNLSVI  396
            I S+PL    +KIR A+  + +EY+  AID+ + + D+  +KR    G     +PNL+++
Sbjct  324  IQSKPLVHTIAKIRGALKRMDNEYLRSAIDYLQVQADLEALKR----GPRTFKSPNLNIV  379

Query  395  SWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQD  216
            SW+ +PI   DFGWG    M P     +G   I   P+    +DGSL++  CL+ +H++ 
Sbjct  380  SWMAMPIYDADFGWGRPYFMGPAIVGFEGMAYIARCPS----NDGSLMIFTCLESNHMEL  435

Query  215  FNKYFY  198
            F ++FY
Sbjct  436  FKEFFY  441



>ref|XP_010265527.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=435

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 101/189 (53%), Gaps = 16/189 (8%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WRC CKAR     Q T L    D R R+ PPLP  YFGN I       VSG+
Sbjct  256  YEMLAGHVWRCVCKARGLPDDQDTKLYIATDGRSRLRPPLPPGYFGNGIFTATPIAVSGD  315

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN-----PNL  405
            ++S+PL   A +I DA+  +  EY+  A+D+       ++ Q  L VL  G      PN+
Sbjct  316  LLSKPLTYAAGRIHDALVRMDDEYLRSALDY-------LELQPDLTVLVRGAHTFRCPNI  368

Query  404  SVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDH  225
             + SWV LPI   DFGWG  I M PG    +G   +LP P     +DG+L +A  LQ DH
Sbjct  369  GITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLAFLLPSPV----NDGNLSLAISLQSDH  424

Query  224  IQDFNKYFY  198
            ++ F K  Y
Sbjct  425  MKVFQKILY  433



>ref|XP_003599037.1| Anthranilate N-benzoyltransferase protein [Medicago truncatula]
 ref|XP_003638356.1| Anthranilate N-benzoyltransferase protein [Medicago truncatula]
 gb|AES69288.1| spermidine hydroxycinnamoyl transferase [Medicago truncatula]
Length=451

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 107/194 (55%), Gaps = 10/194 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            RYE I+AHIW+CA +AR  +  Q + + F  DIR R+ PPLP +YFGNA+      G  G
Sbjct  262  RYEAISAHIWKCASRARELEENQESVVRFNADIRTRLVPPLPKNYFGNALTQTAAIGYVG  321

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELL------GVLFGGNP  411
            EI S+PL  VA  IR+A + V+ E++   ID  R    +   ++L        + + GNP
Sbjct  322  EITSKPLGYVAQMIREATELVSDEFIRSQIDVIRGFEHLDDARKLFMGGVGENIPYFGNP  381

Query  410  NLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQV  231
            N +  SW+ +PI   DFGWG+ ++            +IL  P+G    DGS+LV    Q+
Sbjct  382  NFNFTSWMSMPIYEADFGWGKPVYFGLAFVSPHDRAVILHSPDG----DGSVLVCLHFQI  437

Query  230  DHIQDFNKYFYQDI  189
              ++ F K+FY DI
Sbjct  438  ALLELFKKFFYGDI  451



>gb|AFS68800.1| hydroxycinnamoyl transferase [Lonicera japonica]
Length=430

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 101/185 (55%), Gaps = 6/185 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WRC CKAR     Q T L    D R R++P LP  YFGN I       V+G+
Sbjct  251  YEMMAGHLWRCVCKARGLPEDQETKLYIATDGRARLKPSLPPGYFGNVIFTTTPIAVAGD  310

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S+P    AS+I DA+  + ++Y+  A+D+   + D+  +  + G      PNL + SW
Sbjct  311  LQSKPAWYAASRIHDALTRMDNDYLRSALDYLELQPDL--KALVRGAHTFRCPNLGITSW  368

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LPI   DFGWG  I M PG    +G   +LP P     +DGSL VA  LQ +H++ F 
Sbjct  369  ARLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSPT----NDGSLSVAISLQAEHMKLFA  424

Query  209  KYFYQ  195
            KY Y+
Sbjct  425  KYLYE  429



>gb|AGE10614.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl transferase, partial 
[Lonicera macranthoides]
Length=214

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 98/185 (53%), Gaps = 6/185 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++ AH+WRCACKAR   P Q + L    D R R+ PPLP  Y GN +        SG+
Sbjct  36   YEILAAHLWRCACKARDLSPNQTSKLYIATDGRSRLCPPLPPGYLGNVVFTATPMAESGD  95

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            +   P+   A +I +++  + +EY+  A+DF     D+  +  + G  +  +PNL++ SW
Sbjct  96   LQVEPVTSTAKRIHNSLTRMDNEYLRSALDFLETTPDL--KTLVRGPNYFASPNLNINSW  153

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LP+   DFGWG  I M P +   +G + I+P       +D SL +A CL   H+  F 
Sbjct  154  TRLPVHDADFGWGRPIFMGPASILYEGTIYIIPSTT----NDRSLSLAVCLDAGHMARFE  209

Query  209  KYFYQ  195
            K  Y+
Sbjct  210  KCLYE  214



>gb|ACI16631.1| malate O-hydroxycinnamoyl transferase [Trifolium pratense]
Length=454

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 105/194 (54%), Gaps = 10/194 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            ++E I AH+WRCA KAR  +  Q + + F  DIRRR+ PPLP ++F NA+      G  G
Sbjct  265  KFEAIGAHLWRCASKARGLEDDQESVVRFHADIRRRINPPLPQNFFANALALTATKGCVG  324

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDF---YRNEGDVIKR---QELLGVLFGGNP  411
            EI S+PL  VA KIR+  + V  +++   ID    +R   D +K     E     + GNP
Sbjct  325  EITSKPLGYVAQKIREGTELVKDDFIKSQIDVIRSFRKMDDAMKLFLGDETEKAPYFGNP  384

Query  410  NLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQV  231
            N  V SW G+P    DFG+G+ I+             I   P+G    DGS++V+   Q+
Sbjct  385  NFQVASWTGMPFYEADFGYGKPIYFGYAGVSPHDRAYITLSPDG----DGSVIVSLHFQM  440

Query  230  DHIQDFNKYFYQDI  189
             H++ F KYFY+DI
Sbjct  441  AHLELFKKYFYEDI  454



>ref|XP_011082506.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=432

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 100/184 (54%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WR  C AR     Q T L    D R R++PPLP  YFGN I       VSG+
Sbjct  253  YEMLAGHVWRSVCMARGLPEDQDTKLYIATDGRSRLQPPLPPGYFGNVIFTATPIAVSGD  312

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S+P+   ASKI DA+  + ++Y+  A+D+   + D+  +  + G      PNL + SW
Sbjct  313  LTSKPVWYAASKIHDALARMDNDYLRSALDYLELQPDL--KALVRGAHTFRCPNLGITSW  370

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   +LP P     +DGSL VA  LQ +H++ F 
Sbjct  371  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSPT----NDGSLSVAISLQAEHMKLFE  426

Query  209  KYFY  198
            K  Y
Sbjct  427  KLLY  430



>ref|XP_011036823.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=443

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 106/186 (57%), Gaps = 10/186 (5%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            +E + AHIW+C CKAR     Q T L    D R R+ PPLP  Y GNA+    I G+SGE
Sbjct  264  FETLAAHIWQCTCKARGITNDQATKLHIPTDGRSRLNPPLPAGYCGNALFTTAILGLSGE  323

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV--IKRQELLGVLFGGNPNLSVI  396
            I S+PL    +KIR A+  + +EY+  AID+ + + D+  +KR    G     NPN++++
Sbjct  324  IQSKPLVHTIAKIRGALKRMDNEYLRSAIDYSQVQTDLEALKR----GPHTFNNPNINIV  379

Query  395  SWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQD  216
            SW+ +PI   DFGWG    M P     +G   I   P+    +DGS +V  CL+ +H++ 
Sbjct  380  SWMTMPIYDADFGWGRPSFMGPAVVLFEGMAYITRSPS----NDGSFMVFICLESNHMEL  435

Query  215  FNKYFY  198
            F ++FY
Sbjct  436  FKEFFY  441



>ref|XP_010094061.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB55151.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=447

 Score =   139 bits (350),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 100/189 (53%), Gaps = 16/189 (8%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y +++ H+WRCACKAR     Q T L    D R R++PPLP  YFGN I       ++G+
Sbjct  268  YAMLSGHVWRCACKARELPEDQETKLYIATDGRSRLQPPLPPGYFGNVIFTATPMAMAGD  327

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN-----PNL  405
            I S+P    AS+I D +  + ++Y+  A+D+       ++ Q  L  L  G      PNL
Sbjct  328  IQSKPTWYAASRIHDTLARMDNDYLRSALDY-------LELQPSLSALVRGAHTFRCPNL  380

Query  404  SVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDH  225
             + SWV LPI   DFGWG  I M PG    +G   +LP P     +DGSL VA  LQ  H
Sbjct  381  GITSWVRLPIHDADFGWGRPIFMGPGGIMFEGLAFMLPSP----ANDGSLSVAIGLQPQH  436

Query  224  IQDFNKYFY  198
            ++ F K  Y
Sbjct  437  MKAFEKLLY  445



>ref|XP_011018051.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
 ref|XP_011018052.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=440

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 103/188 (55%), Gaps = 13/188 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y ++TAHIWRCACKAR     Q T ++   + R R+ PP+P  YFGN I       +SG+
Sbjct  256  YVILTAHIWRCACKARGLSYDQATKINISTNGRNRLRPPIPPGYFGNVIFQATPIALSGD  315

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD---VIKRQELLGVLFGGNPNLSV  399
            + S  L  +A +I  AI  +  EY+  A+D+     D   V++  E        +PNL++
Sbjct  316  LSSERLAHIAERIHKAIKRMDDEYLRSAVDYLEKVDDLTTVMRSSETY-----RSPNLNI  370

Query  398  ISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQ  219
            +SWV  P    DFGWG+ ++M P     +G   ILP P     +DG+L +  CL+ DH++
Sbjct  371  VSWVRFPFYDADFGWGKPVYMRPA-FAFEGKGYILPSPT----NDGTLSLTICLETDHLE  425

Query  218  DFNKYFYQ  195
             F K FY+
Sbjct  426  SFQKLFYE  433



>ref|XP_007161962.1| hypothetical protein PHAVU_001G112400g [Phaseolus vulgaris]
 gb|ESW33956.1| hypothetical protein PHAVU_001G112400g [Phaseolus vulgaris]
Length=460

 Score =   139 bits (350),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 105/197 (53%), Gaps = 15/197 (8%)
 Frame = -3

Query  749  YEVITAHIWRCACKAR-SHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVS-  576
            +EVI+ H+WRC  KAR S K +QPT LS  V+ R RM PPLP++Y GN     V    S 
Sbjct  260  FEVISGHLWRCVSKARYSGKREQPTRLSTLVNCRGRMRPPLPENYTGNTAFPTVTPTCSF  319

Query  575  GEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV--------IKRQELLGVLFG  420
            GEI+ RPL      +R A++ +T E+V  A+D    E D+             +    + 
Sbjct  320  GEIMHRPLSYAVGNVRVALERMTGEFVESALDHIAREKDMNMVRYNFHYPAPTVHKGPYK  379

Query  419  GNPNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAAC  240
            GNPNL V+SW+    +  DFGWGE ++  PG  D +G   ++    G     G ++VA  
Sbjct  380  GNPNLFVVSWMNFSFKDADFGWGEPLYFGPGYMDSEGKAFLMNEAKG-----GGIIVAIS  434

Query  239  LQVDHIQDFNKYFYQDI  189
            L+  H+  F KYFY DI
Sbjct  435  LEASHMDAFKKYFYGDI  451



>gb|KDP38697.1| hypothetical protein JCGZ_04050 [Jatropha curcas]
Length=424

 Score =   138 bits (348),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 104/184 (57%), Gaps = 10/184 (5%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++TAHIWRC CKAR     Q T ++  VD R R++PPLP  YFGNA+    +  +SGE
Sbjct  245  YEILTAHIWRCTCKARGLSNDQATKINMAVDGRSRLKPPLPSGYFGNAVFRASLTALSGE  304

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            IIS  L++   +IR AI+ +  E++   +D+     D+   Q          PNL + SW
Sbjct  305  IISETLKETVERIRKAINRMDDEFLRSTMDYIDGLDDISAIQNRC-------PNLGITSW  357

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            + +P   LDFG G+ +   P N   +G   ILP P+  +  DGS  +   L+++H++ FN
Sbjct  358  MRIPFYSLDFGMGKPLCFRPVN-PVEGKGYILPTPS--NEIDGSWALIITLEINHMESFN  414

Query  209  KYFY  198
            K FY
Sbjct  415  KLFY  418



>ref|XP_002512739.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF49242.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=431

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 99/185 (54%), Gaps = 6/185 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y ++  H+WR ACKAR     Q T L    D R R+ PPLP  YFGN I       V+G+
Sbjct  252  YAMLAGHVWRSACKARGLTDDQETKLYIATDGRSRLNPPLPPGYFGNVIFTATPIAVAGD  311

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S+P    A KI DA+  + ++Y+  A+DF   + D+     + G      PNL + SW
Sbjct  312  LESKPTWYAAGKIHDALARMDNDYLRSALDFLELQPDL--SALVRGAHTFKCPNLGITSW  369

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   ILP P     +DGSL VA  LQ +H++ F 
Sbjct  370  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----NDGSLSVAIALQSEHMKLFE  425

Query  209  KYFYQ  195
            K+ Y+
Sbjct  426  KFIYE  430



>gb|AEM63675.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Platycodon grandiflorus]
Length=434

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 101/184 (55%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE+++ H+WRC CKAR     Q T L    D R R++P LP  YFGN I       V+G+
Sbjct  255  YEMLSGHVWRCVCKARGLPDDQDTKLYIATDGRSRLQPVLPPGYFGNVIFTTTPTAVAGD  314

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S+P    AS+I DA+  + +EY+  A+D+   + D+  +  + G      PNL + SW
Sbjct  315  LTSKPTWYAASRIHDALGRMDNEYLRSALDYLELQPDL--KALVRGAHTFKCPNLGITSW  372

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LPI   DFGWG  I M PG    +G   +LP       +DGSL +A  LQ +H++ F+
Sbjct  373  ARLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSTT----NDGSLSIAISLQAEHMKLFS  428

Query  209  KYFY  198
            K+ Y
Sbjct  429  KFLY  432



>gb|ABO40491.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea arabica]
Length=434

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 102/184 (55%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WRCACKAR  +  Q T L    D R R+ P LP  YFGN I    +  ++G+
Sbjct  255  YEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATLIAIAGD  314

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            +  +P+   ASKI DA+  + ++Y+  A+D+   + D+  +  + G      PNL + SW
Sbjct  315  LEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPDL--KALVRGAHTFKCPNLGITSW  372

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   ILP P     +DGS+ VA  LQ +H++ F 
Sbjct  373  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----NDGSMSVAISLQGEHMKLFQ  428

Query  209  KYFY  198
             + Y
Sbjct  429  SFLY  432



>gb|AFL93687.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-transferase [Cynara 
cardunculus var. scolymus]
Length=434

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 100/190 (53%), Gaps = 6/190 (3%)
 Frame = -3

Query  767  NLFEFRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVI  588
            +++   YE++ AH+WRCACKAR     QPT L    D R R+ PPLP  Y GN +     
Sbjct  249  SVYHSTYEILAAHLWRCACKARGLSDDQPTKLYVATDGRSRLSPPLPPGYLGNVVFTATP  308

Query  587  HGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPN  408
               SGE  S  L D A +I   +  +  +Y+  AID+   + D+     + G  +  +PN
Sbjct  309  IAKSGEFKSESLADTARRIHIELAKMDDQYLRSAIDYLELQPDLTAL--VRGPTYFASPN  366

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L++ SW  LPI   DFGWG  I M P +   +G + I+P P+G    D S+ +A CL  D
Sbjct  367  LNINSWTRLPIYESDFGWGRPIFMGPASILYEGTIYIIPSPSG----DRSVSLAVCLDPD  422

Query  227  HIQDFNKYFY  198
            H+  F K  Y
Sbjct  423  HMSLFRKCLY  432



>ref|XP_006382508.1| hypothetical protein POPTR_0005s02810g [Populus trichocarpa]
 gb|ERP60305.1| hypothetical protein POPTR_0005s02810g [Populus trichocarpa]
Length=443

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 105/186 (56%), Gaps = 10/186 (5%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            +E + AHIW+C CKAR     Q T L    D R R+ PPLP  Y GNA+    + G+SGE
Sbjct  264  FETLAAHIWQCTCKARGISNDQATKLHIPTDGRSRLNPPLPAGYCGNALFTTAVLGLSGE  323

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV--IKRQELLGVLFGGNPNLSVI  396
            I S+PL    +KIR A+  + +EY+  AID+   + ++  +KR    G     NPN++++
Sbjct  324  IQSKPLVHTITKIRGALKRMDNEYLRSAIDYLHVQPNLEALKR----GPHTFNNPNINIV  379

Query  395  SWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQD  216
            SW+ +PI   DFGWG    M P     +G   I   P+    +DGS ++  CL+ +H++ 
Sbjct  380  SWMTMPIYDADFGWGRPSFMGPAVVLFEGMAYITRSPS----NDGSFMIFICLESNHMEL  435

Query  215  FNKYFY  198
            F K+FY
Sbjct  436  FKKFFY  441



>ref|XP_002324530.2| hypothetical protein POPTR_0018s11370g [Populus trichocarpa]
 gb|EEF03095.2| hypothetical protein POPTR_0018s11370g [Populus trichocarpa]
Length=440

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 100/188 (53%), Gaps = 13/188 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y ++TAHIWRCACKAR     Q T ++   D R R  PP+P  YFGN I       +SG 
Sbjct  256  YVILTAHIWRCACKARGLSNDQATKINISTDGRNRFRPPIPPGYFGNVIFQATPIALSGA  315

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD---VIKRQELLGVLFGGNPNLSV  399
            ++S PL   A +I  AI  +  EY+  A+D+     D   V++  E        +PNL++
Sbjct  316  LLSEPLAHTAERIHKAIKRMDDEYLRSAVDYLERVDDFTTVMRSSETY-----RSPNLTI  370

Query  398  ISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQ  219
             SWV LP    DFGWG+ ++M P +    G   I P P     +DG+L +   L+ DH+Q
Sbjct  371  ASWVRLPFYDADFGWGKPVYMRPASAFV-GKGYIQPSPT----NDGTLSLTIFLETDHLQ  425

Query  218  DFNKYFYQ  195
             F K FY+
Sbjct  426  SFQKLFYE  433



>ref|XP_009760608.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
 ref|XP_009760609.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=432

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 100/184 (54%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WR  C AR  +  Q + L    D R R+ P LP  YFGN I       V+G+
Sbjct  253  YEMLAGHVWRSTCMARGLEEDQGSKLYIATDGRSRLRPILPPGYFGNVIFTATPIAVAGD  312

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S+P+   ASKI DA+  + ++Y+  A+D+   + D+  +  + G      PNL + SW
Sbjct  313  LKSKPIWYAASKIHDALAQMDNDYLRSALDYLELQPDL--KALVRGAHTFRCPNLGITSW  370

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   ILP P     +DGSL VA  LQ DH++ F 
Sbjct  371  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----NDGSLSVAISLQADHMKLFE  426

Query  209  KYFY  198
            KY Y
Sbjct  427  KYLY  430



>ref|XP_009626780.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=439

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 100/184 (54%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WR  C AR  +  Q + L    D R R+ P LP  YFGN I       V+G+
Sbjct  260  YEMLAGHVWRSTCMARGLEEDQGSKLYIATDGRFRLRPTLPPGYFGNVIFTATPIAVAGD  319

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S+P+   ASKI DA+  + ++Y+  A+D+   + D+  +  + G      PNL + SW
Sbjct  320  LKSKPIWYAASKIHDALARMDNDYLRSALDYLELQPDL--KALVRGAHTFRCPNLGITSW  377

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   ILP P     +DGSL VA  LQ DH++ F 
Sbjct  378  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----NDGSLSVAISLQADHMKLFE  433

Query  209  KYFY  198
            KY Y
Sbjct  434  KYLY  437



>gb|ABK79690.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. altilis]
Length=434

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 100/190 (53%), Gaps = 6/190 (3%)
 Frame = -3

Query  767  NLFEFRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVI  588
            +++   YE++ AH+WRCAC+AR     QPT L    D R R+ PPLP  Y GN +     
Sbjct  249  SVYHSTYEILAAHLWRCACEARGLSDDQPTKLYVATDGRSRLNPPLPPGYLGNVVFKATP  308

Query  587  HGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPN  408
               SGE  S  L D A +I   +  +  +Y+  AID+   + D+     + G  +  +PN
Sbjct  309  IAKSGEFKSESLADTARRIHSELAKMGDQYLRSAIDYLELQPDLTAL--VRGPTYFASPN  366

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L++ SW  LPI   DFGWG  I M P +   +G + I+P P+G    D S+ +A CL  D
Sbjct  367  LNINSWTRLPIYESDFGWGRPIFMGPASILYEGTIYIIPSPSG----DRSVSLAVCLDPD  422

Query  227  HIQDFNKYFY  198
            H+  F K  Y
Sbjct  423  HMSLFRKCLY  432



>gb|ABK79689.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. scolymus]
Length=434

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 100/190 (53%), Gaps = 6/190 (3%)
 Frame = -3

Query  767  NLFEFRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVI  588
            +++   YE++ AH+WRCAC+AR     QPT L    D R R+ PPLP  Y GN +     
Sbjct  249  SVYHSTYEILAAHLWRCACEARGLSDDQPTKLYVATDGRSRLNPPLPPGYLGNVVFTATP  308

Query  587  HGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPN  408
               SGE  S  L D A +I   +  +  +Y+  AID+   + D+     + G  +  +PN
Sbjct  309  IAKSGEFKSESLADTARRIHSELAKMDDQYLRSAIDYLELQPDLTAL--VRGPTYFASPN  366

Query  407  LSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  228
            L++ SW  LPI   DFGWG  I M P +   +G + I+P P+G    D S+ +A CL  D
Sbjct  367  LNINSWTRLPIYESDFGWGRPIFMGPASILYEGTIYIIPSPSG----DRSVSLAVCLDPD  422

Query  227  HIQDFNKYFY  198
            H+  F K  Y
Sbjct  423  HMSLFRKCLY  432



>ref|XP_009626781.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=432

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 100/184 (54%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WR  C AR  +  Q + L    D R R+ P LP  YFGN I       V+G+
Sbjct  253  YEMLAGHVWRSTCMARGLEEDQGSKLYIATDGRFRLRPTLPPGYFGNVIFTATPIAVAGD  312

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S+P+   ASKI DA+  + ++Y+  A+D+   + D+  +  + G      PNL + SW
Sbjct  313  LKSKPIWYAASKIHDALARMDNDYLRSALDYLELQPDL--KALVRGAHTFRCPNLGITSW  370

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   ILP P     +DGSL VA  LQ DH++ F 
Sbjct  371  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----NDGSLSVAISLQADHMKLFE  426

Query  209  KYFY  198
            KY Y
Sbjct  427  KYLY  430



>gb|AEM63676.1| hydroxycinnamoyl CoA quinate hydroxycinnamoyl transferase [Platycodon 
grandiflorus]
Length=443

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 103/190 (54%), Gaps = 16/190 (8%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y ++ AH+WRCACKAR     Q T L    D R R+ P LP  Y GN +        SGE
Sbjct  264  YVILAAHLWRCACKARGLPDDQLTKLYVATDGRFRLSPTLPPGYLGNVVFTATPVAESGE  323

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN-----PNL  405
            I+S+PL + A KI +A+  +  EY+  A+D+  ++ D       LG L  G      PNL
Sbjct  324  IVSQPLSNSAKKIHNALAKMDDEYLRSALDYLESQPD-------LGALIRGPNYFACPNL  376

Query  404  SVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDH  225
            ++ SW  LPI   DFGWG  I M P +   +G + ++P P+    ++ S+ +A CL+ DH
Sbjct  377  NINSWTRLPIYDADFGWGRPIFMGPASILYEGTIYVIPSPD----NNRSVSLALCLEADH  432

Query  224  IQDFNKYFYQ  195
            +  F KY Y+
Sbjct  433  MPLFEKYLYE  442



>ref|XP_002529413.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF33009.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=425

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 99/186 (53%), Gaps = 6/186 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++TAHIWRCACKAR     Q T L   VD R R  PPLP  +FGN +       + GE
Sbjct  244  YEILTAHIWRCACKARGLSDDQETKLYISVDGRTRFSPPLPSGFFGNVVFHATPIALCGE  303

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S PL D A ++   I  +  EY+  AID+    GD  +  E +    G  PNL ++SW
Sbjct  304  VASEPLVDTAGRVNKTIKRMDDEYLRSAIDYLEEIGDPTRVSERVMKTGGKCPNLKIVSW  363

Query  389  VGLP-IQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDF  213
              +P ++  DFGWG+ I M   N   +G   I+  P+G    D +L++A CL    +  F
Sbjct  364  ARMPFLEAHDFGWGKPISMRAAN-PSEGKGHIISCPSG----DENLVLAICLGTHQMPAF  418

Query  212  NKYFYQ  195
             K FY+
Sbjct  419  KKLFYE  424



>emb|CCC55431.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Pinus pinaster]
Length=433

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 102/195 (52%), Gaps = 14/195 (7%)
 Frame = -3

Query  767  NLFEFRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVI  588
            N+    YE+++ HIWRCACKAR+    Q T L    D R R+ P +P  YFGN I     
Sbjct  248  NIAYSSYEMLSGHIWRCACKARNLAEDQETKLYIATDGRNRLRPSIPPGYFGNVIFTTTP  307

Query  587  HGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN--  414
              V+G+IIS+P    AS I +A+  +  EY+  A+D+   + D      L  ++ G +  
Sbjct  308  MAVAGDIISKPTYYAASVIHEALGRMDDEYLRSALDYLELQPD------LTALVRGSHTF  361

Query  413  --PNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAAC  240
              PN+ + SW  LPI   DFGWG  I M PG    +G   +LP       +DGSL VA  
Sbjct  362  RCPNIGITSWSRLPIHDADFGWGRPIFMGPGGIAYEGLAFVLPS----SANDGSLSVALG  417

Query  239  LQVDHIQDFNKYFYQ  195
            LQ DH+  F K  Y+
Sbjct  418  LQPDHMARFAKMLYE  432



>gb|KDP38698.1| hypothetical protein JCGZ_04051 [Jatropha curcas]
Length=429

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 110/187 (59%), Gaps = 5/187 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++TAHIWRC CKAR     Q T L+  VD R R++PPLP  YFGNA+       ++G+
Sbjct  247  YEILTAHIWRCTCKARGLSNDQATKLNIAVDGRSRLKPPLPSGYFGNALFLASSIALAGD  306

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            I S  L++   +IR AI+ + +E++  A+D+     D++    + G  F   PNLS++SW
Sbjct  307  IGSETLKETVERIRKAINRMDNEFLRSAMDYIDGVDDIMAI--VRGPEFCRCPNLSIVSW  364

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            + LP   LDFG G+ + M P N   +G   I+  P+  +  DGS ++  CL+V H+Q F 
Sbjct  365  MRLPFYSLDFGMGKPLCMRPPN-PVEGKGYIVATPS--NEIDGSWVLILCLEVHHMQFFK  421

Query  209  KYFYQDI  189
              FY ++
Sbjct  422  NLFYDEL  428



>pdb|4G22|A Chain A, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 1)
 pdb|4G22|B Chain B, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 1)
Length=439

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 101/184 (55%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WRCACKAR  +  Q T L    D R R+ P LP  YFGN I       ++G+
Sbjct  260  YEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGD  319

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            +  +P+   ASKI DA+  + ++Y+  A+D+   + D+  +  + G      PNL + SW
Sbjct  320  LEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPDL--KALVRGAHTFKXPNLGITSW  377

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   ILP P     +DGS+ VA  LQ +H++ F 
Sbjct  378  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----NDGSMSVAISLQGEHMKLFQ  433

Query  209  KYFY  198
             + Y
Sbjct  434  SFLY  437



>ref|XP_008342823.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=438

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 101/188 (54%), Gaps = 14/188 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE+++ H+WRCACKAR     Q T L    D R R++PPLP  YFGN I        +G+
Sbjct  259  YEMLSGHVWRCACKARELPDDQDTKLFIATDGRSRLQPPLPPGYFGNVIFTATPIAXAGD  318

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            I S+P    AS+I DA+  +   Y+  A+D+   + D      L  ++ G +    PNL 
Sbjct  319  IQSKPTWYAASRIHDALVRMDDSYLRSALDYLELQPD------LSALVRGAHSFRCPNLG  372

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG  I M PG    +G   I+P       +DGSL +A  LQ +H+
Sbjct  373  ITSWVRLPIHDADFGWGRPIFMGPGGIAFEGLAFIIPSAT----NDGSLSLAISLQTEHM  428

Query  221  QDFNKYFY  198
            + F+K  Y
Sbjct  429  KSFSKLLY  436



>pdb|4G2M|A Chain A, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 2)
Length=439

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 101/184 (55%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WRCACKAR  +  Q T L    D R R+ P LP  YFGN I       ++G+
Sbjct  260  YEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGD  319

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            +  +P+   ASKI DA+  + ++Y+  A+D+   + D+  +  + G      PNL + SW
Sbjct  320  LEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPDL--KALVRGAHTFKXPNLGITSW  377

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   ILP P     +DGS+ VA  LQ +H++ F 
Sbjct  378  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----NDGSMSVAISLQGEHMKLFQ  433

Query  209  KYFY  198
             + Y
Sbjct  434  SFLY  437



>dbj|BAO20883.1| hydroxycinnamoyl CoA: shikimate hydroxycinnamoyl transferase 
[Panicum virgatum]
Length=438

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 105/189 (56%), Gaps = 15/189 (8%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y V+ AH+W+C   ARS  P+QPT L    D R+R++PPLPD YFGN I        +G+
Sbjct  260  YAVLAAHVWKCVSLARSLPPEQPTKLYCATDGRQRLQPPLPDGYFGNVIFTATPLAEAGK  319

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            + S  L + A+ I+ A+D + ++Y   A+D+   + D      L  ++ G +    PNL 
Sbjct  320  VTSG-LAEGAAVIQGALDRMDNDYCRSALDYLELQPD------LSALVRGAHTFRCPNLG  372

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG  + M PG    +G   +LP  NG    DGSL +A  LQ +H+
Sbjct  373  LTSWVRLPIHDADFGWGRPVSMGPGGIAYEGLAFVLPSANG----DGSLSIAISLQAEHM  428

Query  221  QDFNKYFYQ  195
            + F K  Y+
Sbjct  429  EKFRKLIYE  437



>gb|ABR17170.1| unknown [Picea sitchensis]
Length=433

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 99/189 (52%), Gaps = 14/189 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE+++ HIWRCACKAR+    Q T L    D R R+ P LP  YFGN I       V+G+
Sbjct  254  YEMLSGHIWRCACKARNLTEDQGTKLYIATDGRSRLRPSLPPGYFGNVIFTTTPMAVAGD  313

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            I+S+P    AS I +A+  +  EY+  A+D+   + D      L  ++ G +    PN+ 
Sbjct  314  IVSKPTYYAASVIHEALGRMDDEYLRSALDYLELQPD------LTALVRGAHTFRCPNIG  367

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SW  LPI   DFGWG  I M PG    +G   ILP        DGSL VA  LQ DH+
Sbjct  368  ITSWSRLPIHDADFGWGRPIFMGPGGIAYEGLAFILPS----SAKDGSLSVALGLQPDHM  423

Query  221  QDFNKYFYQ  195
              F K  Y+
Sbjct  424  VRFEKMLYE  432



>gb|EYU21749.1| hypothetical protein MIMGU_mgv1a006630mg [Erythranthe guttata]
Length=437

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 100/184 (54%), Gaps = 4/184 (2%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            ++++ AHIWRC  +AR     Q T L    D R R+ P LP  YFGN I       VSG+
Sbjct  256  FQMVVAHIWRCVTRARGLPRAQETKLYISTDGRSRLRPALPPGYFGNVIFTAAPVAVSGD  315

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            I+S P+   A KIR A+  +  EY+  A+D+   +GDV  +    G      P+L VISW
Sbjct  316  ILSEPVTYAAGKIRAALARMDDEYMRSALDYLELQGDV--KAVARGPQTFTCPDLGVISW  373

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LP+   DFGWG+ ++M PG    +G   ++P P     ++G LLVA  LQ  H++ F 
Sbjct  374  VRLPVYDADFGWGKPVYMGPGGLAYEGRCFLMPPPPA--NEEGGLLVAMSLQKQHVEIFK  431

Query  209  KYFY  198
            +  Y
Sbjct  432  ELLY  435



>ref|XP_004135880.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cucumis 
sativus]
 gb|KGN45212.1| hypothetical protein Csa_7G431440 [Cucumis sativus]
Length=430

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 100/184 (54%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE+++ H+WR  CKAR     Q T L    D R R+ PPLP+ YFGN I       V+GE
Sbjct  251  YEMLSGHVWRSTCKARELPEDQDTKLYIATDGRARLRPPLPNGYFGNVIFTTTPLAVAGE  310

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            ++S P    ASKI DA+  + ++Y+  A+D+   + ++     + G      PNL + SW
Sbjct  311  LMSNPTWFAASKIHDALTRMDNDYLRSALDYLEIQPNI--SALVRGAHTFRCPNLGITSW  368

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   I+P  +    DDGSL VA  LQ  H++ F 
Sbjct  369  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSAS----DDGSLSVAISLQNRHMKVFE  424

Query  209  KYFY  198
            K F+
Sbjct  425  KLFF  428



>gb|AEJ88365.1| hydroxycinnamoyltransferase [Cucumis sativus]
Length=430

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 100/184 (54%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE+++ H+WR  CKAR     Q T L    D R R+ PPLP+ YFGN I       V+GE
Sbjct  251  YEMLSGHVWRSTCKARELPEDQDTKLYIATDGRARLRPPLPNGYFGNVIFTTTPLAVAGE  310

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            ++S P    ASKI DA+  + ++Y+  A+D+   + ++     + G      PNL + SW
Sbjct  311  LMSNPTWFAASKIHDALTRMDNDYLRSALDYLEIQPNI--SALVRGAHTFRCPNLGITSW  368

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   I+P  +    DDGSL VA  LQ  H++ F 
Sbjct  369  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSAS----DDGSLSVAISLQNRHMKVFE  424

Query  209  KYFY  198
            K F+
Sbjct  425  KLFF  428



>ref|XP_002324534.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
 gb|EEF03099.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
Length=430

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 100/186 (54%), Gaps = 10/186 (5%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE ITAHIWR  CKAR     Q + L    D R R+ P LP  Y GN +    + G+SGE
Sbjct  251  YETITAHIWRSMCKARGLSDDQASKLYISTDGRSRLNPQLPPGYLGNVLFTTTVMGLSGE  310

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV--IKRQELLGVLFGGNPNLSVI  396
            I S+PL     +I +A+  +  EY+  A+D+   + D+  +KR    G     +PNL+++
Sbjct  311  IQSKPLARTMERIHEALVRMDDEYLRSALDYIEAQPDLNALKR----GPHTYASPNLNIV  366

Query  395  SWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQD  216
            SW+ LP+   DFGWG  + M P    C+G+  IL  P     +DGSL +  CL+  H+  
Sbjct  367  SWIRLPVHDADFGWGRPVFMGPARVFCEGNAYILRSPV----NDGSLSLFICLEAQHMPL  422

Query  215  FNKYFY  198
            F K  Y
Sbjct  423  FEKCLY  428



>ref|XP_011018044.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Populus euphratica]
Length=438

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 100/186 (54%), Gaps = 10/186 (5%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE ITAHIWR  CKAR     Q + L    D R R+ P LP  Y GN +    + G+SGE
Sbjct  259  YETITAHIWRSMCKARGLSDDQASKLYISTDGRSRLNPQLPPGYLGNVLFTTTVMGLSGE  318

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV--IKRQELLGVLFGGNPNLSVI  396
            I S+PL     +I +A+  +  EY+  A+D+   + D+  +KR    G     +PNL+++
Sbjct  319  IQSKPLVRTMERIHEALGRMDDEYLRSALDYIEAQPDLNALKR----GPHTYASPNLNIV  374

Query  395  SWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQD  216
            SW+ LP+   DFGWG  + M P    C+G+  IL  P     +DGSL +  CL+  H+  
Sbjct  375  SWIRLPVHDADFGWGRPVFMGPARVFCEGNAYILRSPV----NDGSLSLFICLEAQHMPL  430

Query  215  FNKYFY  198
            F K  Y
Sbjct  431  FEKCLY  436



>ref|XP_011018045.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018047.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
Length=430

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 100/186 (54%), Gaps = 10/186 (5%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE ITAHIWR  CKAR     Q + L    D R R+ P LP  Y GN +    + G+SGE
Sbjct  251  YETITAHIWRSMCKARGLSDDQASKLYISTDGRSRLNPQLPPGYLGNVLFTTTVMGLSGE  310

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV--IKRQELLGVLFGGNPNLSVI  396
            I S+PL     +I +A+  +  EY+  A+D+   + D+  +KR    G     +PNL+++
Sbjct  311  IQSKPLVRTMERIHEALGRMDDEYLRSALDYIEAQPDLNALKR----GPHTYASPNLNIV  366

Query  395  SWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQD  216
            SW+ LP+   DFGWG  + M P    C+G+  IL  P     +DGSL +  CL+  H+  
Sbjct  367  SWIRLPVHDADFGWGRPVFMGPARVFCEGNAYILRSPV----NDGSLSLFICLEAQHMPL  422

Query  215  FNKYFY  198
            F K  Y
Sbjct  423  FEKCLY  428



>ref|XP_010034043.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
Length=492

 Score =   137 bits (344),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 102/189 (54%), Gaps = 14/189 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WR ACKAR     Q + +    D R R+ PPLP  YFGN I       V+G+
Sbjct  313  YEMLAGHVWRSACKARDLAVDQESKMYIATDGRSRLSPPLPPGYFGNVIFTATPLAVAGD  372

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            + S+P    AS+I DA+  + ++Y+  A+D+   + D      L  ++ G +    PNL 
Sbjct  373  LQSKPTWYAASRIHDALVRMDNDYLRSALDYLELQPD------LSALVRGAHTFRCPNLG  426

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG  I M PG    +G   ILP P     +DGS+ VA  LQ +H+
Sbjct  427  ITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----NDGSMSVAISLQTEHM  482

Query  221  QDFNKYFYQ  195
            + F K  Y+
Sbjct  483  KVFEKLLYE  491



>gb|KCW53914.1| hypothetical protein EUGRSUZ_J03126 [Eucalyptus grandis]
Length=497

 Score =   137 bits (344),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 102/189 (54%), Gaps = 14/189 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WR ACKAR     Q + +    D R R+ PPLP  YFGN I       V+G+
Sbjct  318  YEMLAGHVWRSACKARDLAVDQESKMYIATDGRSRLSPPLPPGYFGNVIFTATPLAVAGD  377

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            + S+P    AS+I DA+  + ++Y+  A+D+   + D      L  ++ G +    PNL 
Sbjct  378  LQSKPTWYAASRIHDALVRMDNDYLRSALDYLELQPD------LSALVRGAHTFRCPNLG  431

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG  I M PG    +G   ILP P     +DGS+ VA  LQ +H+
Sbjct  432  ITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----NDGSMSVAISLQTEHM  487

Query  221  QDFNKYFYQ  195
            + F K  Y+
Sbjct  488  KVFEKLLYE  496



>gb|AHA44839.1| hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltransferase [Larix 
kaempferi]
Length=433

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 99/189 (52%), Gaps = 14/189 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE+++ HIWRCACKAR+ +  Q T L    D R R+ P LP  YFGN I       V+G+
Sbjct  254  YEMLSGHIWRCACKARNLREDQETKLYIATDGRSRLRPSLPPGYFGNVIFTTTPMAVAGD  313

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            I+S+P    AS I D +  +  +Y+  A+D+   + D      L  ++ G +    PN+ 
Sbjct  314  IVSKPTYYAASVIHDTLGRMDDDYLRSALDYLELQPD------LTALVRGAHTFRCPNIG  367

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SW  LPI   DFGWG  I M PG    +G   ILP        DGSL VA  LQ DH+
Sbjct  368  ITSWSRLPIHDADFGWGRPIFMGPGGIAYEGLAFILPSST----KDGSLSVALGLQPDHM  423

Query  221  QDFNKYFYQ  195
              F K  Y+
Sbjct  424  VRFEKMLYE  432



>ref|XP_002529412.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF33008.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=404

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 104/188 (55%), Gaps = 15/188 (8%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++TAHIWRC C+AR+    Q T L   VD R R++P LP SYFGN         + G+
Sbjct  226  YEILTAHIWRCTCRARNLADDQATKLYISVDGRSRLQPQLPHSYFGNVTFPTTSIALCGD  285

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            ++S PL   A +IR AI  +  EY+  A+D+ +   D      L  V+ G +    PNL 
Sbjct  286  LLSEPLMATAERIRKAIRRMDDEYLRSAVDYLQVLDD------LTPVMRGPDACRCPNLH  339

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            +ISW+ LP    DFG G+ I++ P N   +G   ++P P    GDD +  ++ CL+ DH+
Sbjct  340  IISWMWLPFYEADFGMGKPIYVRPAN-PLEGKGYVIPTP----GDDRNWALSICLETDHM  394

Query  221  QDFNKYFY  198
              F K FY
Sbjct  395  HSFQKLFY  402



>pdb|4G0B|A Chain A, Structure Of Native Hct From Coffea Canephora
 pdb|4G0B|B Chain B, Structure Of Native Hct From Coffea Canephora
Length=436

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 101/184 (55%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WRCACKAR  +  Q T L    D R R+ P LP  YFGN I       ++G+
Sbjct  257  YEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGD  316

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            +  +P+   ASKI DA+  + ++Y+  A+D+   + D+  +  + G      PNL + SW
Sbjct  317  LEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPDL--KALVRGAHTFKCPNLGITSW  374

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   ILP P     +DGS+ VA  LQ +H++ F 
Sbjct  375  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----NDGSMSVAISLQGEHMKLFQ  430

Query  209  KYFY  198
             + Y
Sbjct  431  SFLY  434



>ref|XP_007027321.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY07823.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=437

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 99/187 (53%), Gaps = 10/187 (5%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y ++TAHIWRCA KAR     Q   L+  VD R R+ PPLP  YFGN I+   +  +SG+
Sbjct  258  YSILTAHIWRCATKARDLLEDQQLKLTMPVDGRNRLHPPLPPGYFGNVIVMAALVALSGD  317

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD--VIKRQELLGVLFGGNPNLSVI  396
            ++S    D   +I   +  +  EY+  +ID+     D  VI+R    G      PNLSV 
Sbjct  318  LLSESFIDTVKRIHKILKEMDDEYLRSSIDYIEKAPDINVIRR----GPQTMRCPNLSVN  373

Query  395  SWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQD  216
            SW+ LPI   DFGWG  I M P N   +G V ILP P      DGS+ +   L+  H++ 
Sbjct  374  SWIWLPIHDADFGWGRPIFMRPANIVHEGKVYILPSPT----KDGSVTLVTRLETSHMKL  429

Query  215  FNKYFYQ  195
            F K  Y+
Sbjct  430  FGKLLYE  436



>ref|XP_006493385.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Citrus 
sinensis]
Length=430

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 101/188 (54%), Gaps = 14/188 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WR AC AR     Q T L    D R R+ PPLP  YFGN I       V+G+
Sbjct  251  YEMLAGHVWRSACIARGLTADQETKLYIATDGRARLRPPLPPGYFGNVIFTATPMAVTGD  310

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            + S+P+   AS+I DA+  + ++Y+  A+D+   + D      L  ++ G +    PNL 
Sbjct  311  LQSKPIWYAASRIHDALVRMDNDYLRSALDYLELQPD------LSALVRGAHTFRCPNLG  364

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG  I M PG    +G   I+P P     +DGSL VA  LQ +H+
Sbjct  365  ITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSPT----NDGSLSVAISLQTEHM  420

Query  221  QDFNKYFY  198
            + F K  Y
Sbjct  421  KLFEKLIY  428



>gb|ABO47805.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 101/184 (55%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WRCACKAR  +  Q T L    D R R+ P LP  YFGN I       ++G+
Sbjct  255  YEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGD  314

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            +  +P+   ASKI DA+  + ++Y+  A+D+   + D+  +  + G      PNL + SW
Sbjct  315  LEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPDL--KALVRGAHTFKCPNLGITSW  372

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   ILP P     +DGS+ VA  LQ +H++ F 
Sbjct  373  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----NDGSMSVAISLQGEHMKLFQ  428

Query  209  KYFY  198
             + Y
Sbjct  429  SFLY  432



>emb|CAJ40778.1| hydroxycinnamoyl transferase [Coffea arabica]
Length=434

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 101/184 (55%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WRCACKAR  +  Q T L    D R R+ P LP  YFGN I       ++G+
Sbjct  255  YEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGD  314

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            +  +P+   ASKI DA+  + ++Y+  A+D+   + D+  +  + G      PNL + SW
Sbjct  315  LEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPDL--KALVRGAHTFKCPNLGITSW  372

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   ILP P     +DGS+ VA  LQ +H++ F 
Sbjct  373  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----NDGSMSVAISLQGEHMKLFQ  428

Query  209  KYFY  198
             + Y
Sbjct  429  SFLY  432



>emb|CDO98242.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 101/184 (55%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WRCACKAR  +  Q T L    D R R+ P LP  YFGN I       ++G+
Sbjct  255  YEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGD  314

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            +  +P+   ASKI DA+  + ++Y+  A+D+   + D+  +  + G      PNL + SW
Sbjct  315  LEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPDL--KALVRGAHTFKCPNLGITSW  372

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   ILP P     +DGS+ VA  LQ +H++ F 
Sbjct  373  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----NDGSMSVAISLQGEHMKLFQ  428

Query  209  KYFY  198
             + Y
Sbjct  429  SFLY  432



>gb|ABO77955.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 101/184 (55%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WRCACKAR  +  Q T L    D R R+ P LP  YFGN I       ++G+
Sbjct  255  YEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGD  314

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            +  +P+   ASKI DA+  + ++Y+  A+D+   + D+  +  + G      PNL + SW
Sbjct  315  LEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPDL--KALVRGAHTFKCPNLGITSW  372

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   ILP P     +DGS+ VA  LQ +H++ F 
Sbjct  373  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----NDGSMSVAISLQGEHMKLFQ  428

Query  209  KYFY  198
             + Y
Sbjct  429  SFLY  432



>gb|EYU25633.1| hypothetical protein MIMGU_mgv1a006801mg [Erythranthe guttata]
Length=431

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 98/169 (58%), Gaps = 9/169 (5%)
 Frame = -3

Query  680  TNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSE  501
            T+L F  D R +++PPLP ++FGNA+I V     SG ++S  +   A KIR+A++ VT E
Sbjct  267  TSLHFVADFRNKLQPPLPKNFFGNALIRVEATDTSGSLLSNTIGAAAKKIREAVEKVTDE  326

Query  500  YVNCAIDFYRNEGDVIKRQELLGVL-----FGGNPNLSVISWVGLPIQGLDFGWGEEIHM  336
             V   +++ +   DV + + L         F GNPNL++ISW  LP+ G DFGWG+EIHM
Sbjct  327  TVRAYLEYLKGLPDVGRFRSLDNSGRPKGDFYGNPNLAIISWTALPLYGADFGWGKEIHM  386

Query  335  SPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYQDI  189
             PG+   DG   ++P   G    DGS  +A  LQ +HI  F K  Y DI
Sbjct  387  GPGSMGFDGKTFLIPSHEG----DGSFNIAIWLQEEHISAFKKCLYNDI  431



>gb|AFZ78609.1| hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyl transferase 
[Populus tomentosa]
Length=431

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 101/194 (52%), Gaps = 14/194 (7%)
 Frame = -3

Query  767  NLFEFRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVI  588
            N+    YE++ AH+WR  CKAR     Q T L    D R R+ P LP  YFGN I     
Sbjct  246  NISYSSYEMLAAHVWRSTCKARELPDDQETKLYIATDGRSRLRPQLPPGYFGNVIFTATP  305

Query  587  HGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN--  414
              V+GE+ S+P    A KI DA+  + ++Y+  A+D+   + D      L  ++ G +  
Sbjct  306  IAVAGEMQSKPTWYAAGKIHDALVRMDNDYLKSALDYLELQPD------LSALVRGAHSF  359

Query  413  --PNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAAC  240
              PNL + SWV LPI   DFGWG  I M PG    +G   ILP P     +DGS+ VA  
Sbjct  360  RCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----NDGSMSVAIS  415

Query  239  LQVDHIQDFNKYFY  198
            LQ  H++ F K+ Y
Sbjct  416  LQAQHMKLFEKFIY  429



>ref|XP_004303231.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=437

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 102/188 (54%), Gaps = 14/188 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WRC CKAR     Q T L    D R R++PPLP  YFGN I       V+G+
Sbjct  258  YEMLAGHVWRCVCKARDLPDDQDTKLYIATDGRSRLQPPLPPGYFGNVIFTATPIAVAGD  317

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            + S+P    ASKI +A+  + ++Y+  A+D+   + D      L  ++ G +    PNL 
Sbjct  318  LQSKPTWYAASKIHNALVRMDNDYLRSALDYLELQPD------LSALVRGAHTFRCPNLG  371

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG  I M PG    +G   ++P       +DGSL VA  LQ +H+
Sbjct  372  ITSWVRLPIHDADFGWGRPIFMGPGGIGYEGLAFVIPSAT----NDGSLSVAISLQSEHM  427

Query  221  QDFNKYFY  198
            + F+K  Y
Sbjct  428  KSFSKLLY  435



>ref|XP_010101376.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB88323.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=446

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/192 (37%), Positives = 104/192 (54%), Gaps = 8/192 (4%)
 Frame = -3

Query  773  VLNLFEFRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDV  594
             +NL  F  E++  HIWRC CKAR+    Q T +    D R R++PPLP  YFGN +   
Sbjct  261  TINLTSF--EILAGHIWRCVCKARALADDQETRVYIATDGRSRLQPPLPPGYFGNVVFTA  318

Query  593  VIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN  414
                 +G+I S+P +  AS+I DA+  + + Y+  A+D+   + D++      G      
Sbjct  319  APLATAGDIQSKPTRYAASRIHDALARMDNNYLRSALDYLELQPDLMALAR--GAHTFRC  376

Query  413  PNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQ  234
            PNL + SWV LPI   DFGWG  + M PG    +G V++L  P     +DGSL ++  LQ
Sbjct  377  PNLGITSWVRLPIHDADFGWGRPVFMGPGKVSFEGFVIVLRSPI----EDGSLSISINLQ  432

Query  233  VDHIQDFNKYFY  198
             +H++ F K  Y
Sbjct  433  QEHLKAFEKLIY  444



>dbj|BAJ14794.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Ipomoea batatas]
Length=431

 Score =   135 bits (341),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 101/184 (55%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WRCAC+AR     Q T L    D R R+ P LP  YFGN I       V+G+
Sbjct  252  YEMLAGHVWRCACRARGLTEDQETKLYIATDGRSRLRPSLPTGYFGNVIFTATPIAVAGD  311

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S+P+   ASKI  A+  + ++Y+  A+D+   + D+  +  + G      PNL + SW
Sbjct  312  LQSKPVWFAASKIHGALGRMDNDYLRSALDYLELQPDL--KALVRGAHTFRCPNLGITSW  369

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   +LP P     +DGSL +A  LQ +H++ F 
Sbjct  370  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFMLPSPE----NDGSLSIAISLQEEHMKLFK  425

Query  209  KYFY  198
            ++ Y
Sbjct  426  EFLY  429



>gb|ADB44897.1| hydroxycinnamoyl transferase [Sinopodophyllum hexandrum]
Length=438

 Score =   135 bits (341),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 99/187 (53%), Gaps = 12/187 (6%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            +EVI  HIWRC CKAR     Q + +S  VD R R+ P LP  YFGNAI  +     SG+
Sbjct  259  FEVIAGHIWRCICKARQLPDDQESKVSIAVDGRSRLNPKLPPGYFGNAIFHITPMAASGD  318

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDF---YRNEGDVIKRQELLGVLFGGNPNLSV  399
            I+S+PL     K+ +++     EY+  AIDF   + N+  +++     G     +PNL +
Sbjct  319  ILSKPLIYAVGKLHESLQRANDEYLRSAIDFLELHPNKSSLVR-----GPHTFRSPNLGI  373

Query  398  ISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQ  219
             SW  +PI   DFGWG  I M PG+   +G   +LP P      DGS  +A  L  DH+ 
Sbjct  374  TSWCQMPIHEADFGWGRPIFMGPGSIIYEGLAYVLPTPE----KDGSRFLAVSLLPDHMT  429

Query  218  DFNKYFY  198
             F K FY
Sbjct  430  LFKKSFY  436



>gb|AHA14500.1| hydroxycinnamoyl-coenzyme A quinate transperase [Fagopyrum tataricum]
Length=435

 Score =   135 bits (341),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/189 (38%), Positives = 103/189 (54%), Gaps = 14/189 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE+++ H+WRC C+AR  +  Q T L    D R R+ P LP  YFGN I        +G+
Sbjct  256  YEMLSGHVWRCVCQARGLENDQGTKLYIATDGRSRLNPTLPPGYFGNVIFTTTPVAQAGD  315

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            + S+P    AS+I DA+  + +EY+  A+D+   + D      L  ++ G +    PNL 
Sbjct  316  LASKPTWYAASRIHDALARMDNEYLRSALDYLELQPD------LTALVRGAHTFRCPNLG  369

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SW  LPI   DFGWG  I M PG    +G   +LP P     +DGSL +A  LQ +H+
Sbjct  370  ITSWTRLPIHDADFGWGRPIFMGPGGIPYEGLAYMLPSPV----NDGSLSLAIALQPEHM  425

Query  221  QDFNKYFYQ  195
            + F+KY Y+
Sbjct  426  KLFSKYLYE  434



>ref|XP_004158793.1| PREDICTED: LOW QUALITY PROTEIN: shikimate O-hydroxycinnamoyltransferase-like 
[Cucumis sativus]
Length=430

 Score =   135 bits (341),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 100/184 (54%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE+++ H+WR  CKAR     Q T +    D R R+ PPLP+ YFGN I       V+GE
Sbjct  251  YEMLSGHVWRSTCKARELPEDQDTKVYIATDGRARLRPPLPNGYFGNVIFTTTPLAVAGE  310

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            ++S P    ASKI DA+  + ++Y+  A+D+   + ++     + G      PNL + SW
Sbjct  311  LMSNPTWFAASKIHDALTRMDNDYLRSALDYLEIQPNI--SALVRGAHTFRCPNLGITSW  368

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   I+P  +    DDGSL VA  LQ  H++ F 
Sbjct  369  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSAS----DDGSLSVAISLQNRHMKVFE  424

Query  209  KYFY  198
            K F+
Sbjct  425  KLFF  428



>gb|ABO52899.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase [Pinus 
radiata]
Length=433

 Score =   135 bits (341),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 102/195 (52%), Gaps = 14/195 (7%)
 Frame = -3

Query  767  NLFEFRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVI  588
            N+    YE+++ HIWRCACKAR+    Q T L    D R R+ P +P  YFGN I     
Sbjct  248  NIAYSSYEMLSGHIWRCACKARNLAEDQETKLYIATDGRNRLRPSIPPGYFGNVIFTTTP  307

Query  587  HGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN--  414
              V+G+IIS+P    AS I +A+  +  EY+  A+D+   + D      L  ++ G +  
Sbjct  308  MAVTGDIISKPTYYAASVIHEALGRMDDEYLRSALDYLELQPD------LTALVRGAHTF  361

Query  413  --PNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAAC  240
              PN+ + SW  LPI   DFGWG  I M PG    +G   +LP       +DGSL VA  
Sbjct  362  RCPNIGITSWSRLPIHDADFGWGRPIFMGPGGIAYEGLAFVLPS----SVNDGSLSVALG  417

Query  239  LQVDHIQDFNKYFYQ  195
            LQ DH+  F K  Y+
Sbjct  418  LQPDHMVRFAKMLYE  432



>ref|XP_010244666.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010244671.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 99/184 (54%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y V+  H+WRC  KAR  +  Q TNL   VD R R+ PPLP  YFGN I+    + + GE
Sbjct  261  YAVLAGHVWRCVSKARGLRDDQDTNLFITVDGRSRLRPPLPPGYFGNGILLTTSNALCGE  320

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S+PL     ++ D +  +  EYV  AID+   + D+     + G     +PN  ++SW
Sbjct  321  LRSKPLGYAVGRVHDVVTRMNDEYVRSAIDYLELQPDLTP--FVRGPHMFRSPNFWMVSW  378

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LP+   DFGWG  IH+ P     +G   ILP P     +DGS+L+A  LQ DH++ F 
Sbjct  379  ARLPLYDADFGWGRPIHVGPAVVYSEGLSYILPSPT----NDGSVLLAISLQSDHMEVFR  434

Query  209  KYFY  198
            K  Y
Sbjct  435  KILY  438



>ref|XP_004500005.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cicer 
arietinum]
Length=465

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 105/197 (53%), Gaps = 10/197 (5%)
 Frame = -3

Query  752  RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  573
            R+E I+AHIWR A KAR     Q + + F V IR R+ P LP +Y+GNA+I     G  G
Sbjct  267  RFEAISAHIWRSASKARELNANQLSVVRFNVQIRNRIVPNLPKNYYGNALIQTEARGYIG  326

Query  572  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELL------GVLFGGNP  411
            EI S+PL   A KIR+  + + +EY+   ID  R   ++   + L          F G P
Sbjct  327  EITSKPLSYAAKKIREGNELIKNEYIRSQIDVIRGFENLDDARRLFIGGDGKTPTFVGYP  386

Query  410  NLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQV  231
            NL + SW+G      DFGWG+ I+ S G+       +I+  P+    DD S+ V    QV
Sbjct  387  NLHITSWMGFATNEADFGWGKPIYFSMGHVTSYDRAIIIKSPD----DDASVTVCMHFQV  442

Query  230  DHIQDFNKYFYQDINNL  180
            + +Q F K+FY+D+  L
Sbjct  443  ELMQLFKKFFYEDLYEL  459



>ref|XP_002303858.2| hypothetical protein POPTR_0003s18210g [Populus trichocarpa]
 gb|EEE78837.2| hypothetical protein POPTR_0003s18210g [Populus trichocarpa]
Length=315

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 99/188 (53%), Gaps = 14/188 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WR ACKAR     Q T L    D R R+ P LP  YFGN I       V+GE
Sbjct  134  YEMLAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGE  193

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            I S+P    A KI D++  + ++Y+  A+DF   + D      L  ++ G +    PNL 
Sbjct  194  IQSKPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPD------LSALVRGAHTFRCPNLG  247

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG  I M PG    +G   I+P       +DGSL VA  LQ +H+
Sbjct  248  ITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSST----NDGSLSVAISLQAEHM  303

Query  221  QDFNKYFY  198
            + F K+ Y
Sbjct  304  KLFEKFIY  311



>ref|XP_006368492.1| transferase family protein [Populus trichocarpa]
 gb|ACC63883.1| quinate O-hydroxycinnamoyltransferase/shikimate O-hydroxycinnamoyltransferase 
[Populus trichocarpa]
 gb|ERP65061.1| transferase family protein [Populus trichocarpa]
Length=431

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 101/194 (52%), Gaps = 14/194 (7%)
 Frame = -3

Query  767  NLFEFRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVI  588
            N+    YE++ AH+WR  CKAR     Q T L    D R R +P LP  YFGN I     
Sbjct  246  NISYSSYEMLAAHVWRSTCKARELPDDQETKLYIATDGRSRWQPQLPPGYFGNVIFTATP  305

Query  587  HGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN--  414
              V+GE+ S+P    A KI DA+  + ++Y+  A+D+   + D      L  ++ G +  
Sbjct  306  IAVAGEMQSKPTWYAAGKIHDALVRMDNDYLKSALDYLELQPD------LSALVRGAHSF  359

Query  413  --PNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAAC  240
              PNL + SWV LPI   DFGWG  I M PG    +G   ILP P     +DGS+ VA  
Sbjct  360  RCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----NDGSMSVAIS  415

Query  239  LQVDHIQDFNKYFY  198
            LQ  H++ F K+ Y
Sbjct  416  LQAQHMKLFEKFIY  429



>ref|XP_009375480.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
 ref|XP_009375481.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=438

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 101/188 (54%), Gaps = 14/188 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE+ + H+WRC CKAR     Q T L    D R R++PPLP  YFGN I       V+G+
Sbjct  259  YEMFSGHVWRCVCKARELPDDQDTKLYIATDGRSRLQPPLPPGYFGNVIFTTTPIAVAGD  318

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            + S+P    AS+I DA+  +   Y+  A+D+   + D      L  ++ G +    PNL 
Sbjct  319  LQSKPTWYAASRIHDALVRMDDNYLRSALDYLELQPD------LSALVRGAHTFRCPNLG  372

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG+ I M PG    +G   +LP       +DGSL +A  LQ +H+
Sbjct  373  ITSWVRLPIHDADFGWGQPIFMGPGGIAFEGLAFVLPSAT----NDGSLSLAISLQSEHM  428

Query  221  QDFNKYFY  198
            + F++  Y
Sbjct  429  KSFSRLLY  436



>ref|XP_006826688.1| hypothetical protein AMTR_s00137p00072760 [Amborella trichopoda]
 gb|ERM93925.1| hypothetical protein AMTR_s00137p00072760 [Amborella trichopoda]
Length=455

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 101/186 (54%), Gaps = 10/186 (5%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YEV+  H+WRC C+AR+ +  QPT +    + R R++PPLP  YFGNA+       +SG+
Sbjct  272  YEVLAGHVWRCVCQARNLQSDQPTKMYIAANCRSRLQPPLPPEYFGNAVFAAAPLVMSGD  331

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYR--NEGDVIKRQELLGVLFGGNPNLSVI  396
            ++S+PL+  A KI +AI  + +EY+  A+D+     + D +KR    G      PN+ VI
Sbjct  332  LMSKPLKFAAEKIHEAIVRMDNEYLRSALDYLELLPDPDAVKR----GAHTFECPNIGVI  387

Query  395  SWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQD  216
            SW   P    DFGWG  + M P     +G   +L  P G    D  L +A  L  D ++ 
Sbjct  388  SWAKQPSYEADFGWGRPVFMGPAGMAHEGQAFVLRSPKG----DSYLCLAISLHEDCMRR  443

Query  215  FNKYFY  198
            F +YFY
Sbjct  444  FRQYFY  449



>ref|XP_003580078.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium 
distachyon]
 ref|XP_010240077.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium 
distachyon]
Length=443

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/189 (38%), Positives = 104/189 (55%), Gaps = 15/189 (8%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y V+ AH+WRC   ARS  P+QPT L    D R+R++PPLPD YFGN I        +G+
Sbjct  265  YAVLAAHVWRCVSLARSLPPEQPTKLYCATDGRQRLQPPLPDGYFGNVIFTATPLAEAGK  324

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            + S  L+D A+ I+ A+D ++ +Y   A+D+   + D      L  ++ G +    PNL 
Sbjct  325  VTSG-LEDGATVIQGALDRMSDDYCRSALDYLELQPD------LSALVRGAHTFRCPNLG  377

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG  + M PG    +G   ++P        DGSL +A  LQ +H+
Sbjct  378  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVIPS----SSKDGSLSIAISLQAEHM  433

Query  221  QDFNKYFYQ  195
            + F K  ++
Sbjct  434  EKFRKLIFE  442



>ref|NP_001145871.1| uncharacterized protein LOC100279386 [Zea mays]
 ref|XP_008667774.1| PREDICTED: uncharacterized protein LOC100279386 isoform X1 [Zea 
mays]
 gb|ACF84552.1| unknown [Zea mays]
 gb|ACF86236.1| unknown [Zea mays]
 gb|ACL52770.1| unknown [Zea mays]
 gb|ACN28217.1| unknown [Zea mays]
 tpg|DAA37089.1| TPA: anthranilate N-benzoyltransferase protein 2 isoform 1 [Zea 
mays]
 tpg|DAA37090.1| TPA: anthranilate N-benzoyltransferase protein 2 isoform 2 [Zea 
mays]
Length=440

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 103/185 (56%), Gaps = 15/185 (8%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y V+ AH+W+C   ARS  P+QPT L    D R+R++PPLPD YFGN I        +G+
Sbjct  262  YAVLAAHVWKCVSLARSLPPEQPTKLYCATDGRQRLQPPLPDGYFGNVIFTATPLAEAGK  321

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            + S  L + A+ I+ A+D + ++Y   A+D+   + D      L  ++ G +    PNL 
Sbjct  322  VTSE-LAEGAAVIQGALDRMDNDYCRSALDYLELQPD------LSALVRGAHTFRCPNLG  374

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG  + M PG    +G   +LP  NG    DGSL +A  LQ +H+
Sbjct  375  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANG----DGSLSIAISLQAEHM  430

Query  221  QDFNK  207
            + F K
Sbjct  431  EKFRK  435



>ref|NP_001280198.1| shikimate O-hydroxycinnamoyltransferase-like [Prunus mume]
 dbj|BAE48668.1| Alcohol acyl-transferase [Prunus mume]
Length=438

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 100/188 (53%), Gaps = 14/188 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  HIWRC CKAR     Q T L    D R R++PPLP  YFGN I       V+G+
Sbjct  259  YEMMAGHIWRCVCKARELPNDQDTKLYIATDGRSRLQPPLPPGYFGNVIFTATPIAVAGD  318

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            + S+P    AS+I D++  +   Y+  A+D+   + D      L  ++ G +    PNL 
Sbjct  319  LQSKPTWFAASRIHDSLVRMDDNYLRSALDYLELQPD------LSALVRGAHSFRCPNLG  372

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG  I M PG    +G   ++P       +DGSL VA  LQ +H+
Sbjct  373  ITSWVRLPIHDADFGWGRPIFMGPGGIAFEGLAFVIPSAT----NDGSLSVAISLQSEHM  428

Query  221  QDFNKYFY  198
            + F+K  Y
Sbjct  429  KSFSKLLY  436



>gb|AID69225.1| hydroxycinnamoyl coenzyme A shikimate hydroxycinnamoyl transferase, 
partial [Garcinia mangostana]
Length=367

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 96/184 (52%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WRC CKAR     Q T L    D R R+ PPLP  YFGN I       V+G+
Sbjct  188  YEMLAGHVWRCTCKARGLADDQETKLYIATDGRSRLRPPLPPGYFGNVIFTATPIAVAGD  247

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S+P    AS+I  A+  + +EY+  A+D+   + D+     + G      PNL + SW
Sbjct  248  LQSKPTWYAASRIHGALSRMDNEYLRSALDYLELQPDL--SALVRGAHTFKCPNLGITSW  305

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   ILP        DGS+ VA  LQ +H++ F 
Sbjct  306  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSAT----IDGSMSVAIALQSEHMKLFE  361

Query  209  KYFY  198
            K  Y
Sbjct  362  KLLY  365



>gb|AAZ80046.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus]
Length=436

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 99/184 (54%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE+++ H+WRC CKAR     Q T L    D R R+ P LP  YFGN I       V+G+
Sbjct  257  YEMLSGHVWRCVCKARGLPDDQDTKLYIATDGRARLRPSLPRGYFGNVIFTTTPIAVAGD  316

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S+P    ASKI DA+  +  +Y+  A+D+   + D+  +  + G      PNL + SW
Sbjct  317  LQSKPTWYAASKIHDALARMDDDYLKSALDYLELQPDL--KALVRGAHTFKCPNLGITSW  374

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LPI   DFGWG  I M PG    +G   +LP P     +DGSL +   LQ +H++ F+
Sbjct  375  ARLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSPI----NDGSLSIVISLQAEHMKLFS  430

Query  209  KYFY  198
            K+ Y
Sbjct  431  KFLY  434



>gb|AGE10604.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl transferase, partial 
[Lonicera hypoglauca]
Length=296

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 101/185 (55%), Gaps = 6/185 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YEV+ AH+WRCACKAR     Q + L    D R R+  PLP  Y GN +       VSG+
Sbjct  117  YEVLAAHLWRCACKARGLAKDQMSKLYIATDGRARLCSPLPFGYLGNVVFTATPMAVSGD  176

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            +++ P+ D + +I  A+  + + Y+  A+D+     D+  +  + G  +  +PNL++ SW
Sbjct  177  LVAEPIIDSSRRIHSALTQMDNGYLRSALDYLELLPDL--KALVRGPHYFASPNLNINSW  234

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LP+   DFGWG  I M P +   +G + I+P P     +D SL +A CL V H+  F 
Sbjct  235  SRLPVYDADFGWGRPIFMGPASILYEGTIYIIPSPT----NDRSLSLAVCLDVGHMPLFK  290

Query  209  KYFYQ  195
            KY Y+
Sbjct  291  KYLYE  295



>dbj|BAF49306.1| putative acyltransferase [Clitoria ternatea]
Length=436

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 99/184 (54%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WR  CKARS    Q T L    D R R++PP P  YFGN I       V+G+
Sbjct  257  YEMLAGHVWRSVCKARSLPEDQETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAVAGD  316

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            ++S+P    AS+I +A+  + +EY+  A+DF   + D+  +  + G      PNL + SW
Sbjct  317  LMSKPTWYAASRIHNALLRMDNEYLRSALDFLELQPDL--KALVRGAHTFKCPNLGITSW  374

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LPI   DFGWG  I M PG    +G   I+P       +DGSL VA  LQ DH++ F 
Sbjct  375  TRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPS----STNDGSLSVAIALQPDHMKVFK  430

Query  209  KYFY  198
             + Y
Sbjct  431  DFLY  434



>ref|XP_008381122.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=438

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 98/184 (53%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE+ + H+WRC CKA      Q T L    D R R++PPLP  YFGN I       V+G+
Sbjct  259  YEMFSGHVWRCVCKASEFPDDQDTKLYIATDGRSRLQPPLPPGYFGNVIFTTTPIAVAGD  318

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S+P    AS+I DA+  +   Y+  A+D+   + D+     + G      PNL + SW
Sbjct  319  LQSKPTWYAASRIHDALVRMDDNYLRSALDYLELQPDL--SALVRGAHTFRCPNLGITSW  376

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG+ I M PG    +G   +LP       + GSL +A CLQ +H++ F+
Sbjct  377  VRLPIHDADFGWGQPIFMGPGGIAFEGLAFVLPSAT----NGGSLSLAICLQSEHMKSFS  432

Query  209  KYFY  198
            +  Y
Sbjct  433  RLLY  436



>ref|XP_011034568.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=431

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 101/194 (52%), Gaps = 14/194 (7%)
 Frame = -3

Query  767  NLFEFRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVI  588
            N+    YE++ AH+WR  CKAR     Q T L    D R R +P LP  YFGN I     
Sbjct  246  NISYSSYEMLAAHVWRSTCKARELPDDQETKLYIATDGRSRWQPQLPPGYFGNVIFTATP  305

Query  587  HGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN--  414
              V+GE+ S+P    A KI DA+  + ++Y+  A+D+   + D      L  ++ G +  
Sbjct  306  IAVAGEMQSKPTCYAAGKIHDALVRMDNDYLKSALDYLELQPD------LSALVRGAHSF  359

Query  413  --PNLSVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAAC  240
              PNL + SWV LPI   DFGWG  I M PG    +G   ILP P     +DGS+ VA  
Sbjct  360  RCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----NDGSMSVAIS  415

Query  239  LQVDHIQDFNKYFY  198
            LQ  H++ F K+ Y
Sbjct  416  LQAQHMKLFEKFIY  429



>gb|ACZ52698.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Lonicera 
japonica]
Length=439

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 98/185 (53%), Gaps = 6/185 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++ AH+WRCACKAR   P Q + L    D R R+ PPLP  Y GN +        SG+
Sbjct  260  YEILAAHLWRCACKARDLSPNQTSKLYIATDGRSRLCPPLPPGYLGNVVFTATPMAESGD  319

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            +   P+   A +I +++  + +EY+  A+DF     D+  +  + G  +  +PNL++ SW
Sbjct  320  LQVEPVTSTAKRIHNSLTRMDNEYLRSALDFLETTPDL--KTLVRGPNYFASPNLNINSW  377

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LP+   DFGWG  I M P +   +G + I+P       +D SL +A CL   H+  F 
Sbjct  378  TRLPVHDADFGWGRPIFMGPASILYEGTIYIIPSTT----NDRSLSLAVCLDAGHMARFE  433

Query  209  KYFYQ  195
            K  Y+
Sbjct  434  KCLYE  438



>emb|CAT00081.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=430

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 111/224 (50%), Gaps = 6/224 (3%)
 Frame = -3

Query  869  SDNAIN*LNTVIKSGNLTSIYKHPIKKMEFRLVLNLFEFRYEVITAHIWRCACKARSHKP  690
            SD+ I  L T  ++     +   P +  + +   N     YE++ AHIWR ACKAR    
Sbjct  211  SDSRIQELKTGPRASTTAVLKITPEQLSQLKAKANNEGSTYEILAAHIWRTACKARGLTN  270

Query  689  QQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGV  510
             Q T L    D R R+ PPLP  Y GN +        S ++ S PL + A +I +A+  +
Sbjct  271  DQSTKLYVATDGRSRLIPPLPPGYLGNVVFTATPIAESSDLQSEPLTNSAKRIHNALARM  330

Query  509  TSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISWVGLPIQGLDFGWGEEIHMSP  330
             ++Y+  A+D+   + D+     + G     +PNL++ SW  LP    DFGWG  IH+ P
Sbjct  331  DNDYLRSALDYLEIQPDL--SALVRGPRHFASPNLNINSWTRLPFHDADFGWGRPIHIGP  388

Query  329  GNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFY  198
                 +G V +LP P    G D +L +A CL  DH+  F K+ Y
Sbjct  389  AIILYEGTVYVLPSP----GKDRTLSLAVCLDADHMPLFQKFLY  428



>gb|AEN02914.1| HCT1 [Populus nigra]
Length=297

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 97/184 (53%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WR ACKAR     Q T L    D R R+ P LP  YFGN I       V+GE
Sbjct  116  YEMLAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGE  175

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            I S+P    A KI D++  + ++Y+  A+DF   + D+     + G      PNL + SW
Sbjct  176  IQSKPTWCAAGKIHDSLVRMDNDYLRSALDFLELQPDL--SALVRGAHTFRCPNLGITSW  233

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   I+P       +DGS+ VA  LQ +H++ F 
Sbjct  234  VRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSST----NDGSMSVAISLQAEHMKLFE  289

Query  209  KYFY  198
            K+ Y
Sbjct  290  KFIY  293



>gb|ACI16630.1| shikimate O-hydroxycinnamoyltransferase [Trifolium pratense]
Length=434

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 100/184 (54%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WR  CKARS    Q T L    D R R++PP P  YFGN I       ++G+
Sbjct  255  YEMLAGHVWRSVCKARSLPDDQETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGD  314

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            ++S+P    AS+I +A+  + +EY+  A+DF   + D+  +  + G      PNL + SW
Sbjct  315  LMSKPTWYAASRIHNALSRMDNEYLRSALDFLELQPDL--KALVRGAHTFKCPNLGITSW  372

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LPI   DFGWG  I M PG    +G   I+P       +DGSL VA  LQ +H++ F 
Sbjct  373  ARLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSST----NDGSLSVAIALQHEHMKVFK  428

Query  209  KYFY  198
            ++ Y
Sbjct  429  EFLY  432



>gb|EYU24587.1| hypothetical protein MIMGU_mgv1a006602mg [Erythranthe guttata]
Length=437

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 97/185 (52%), Gaps = 3/185 (2%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YEV+  H+WRC   AR+    Q T L    D R R+ PP P  YFGN I         GE
Sbjct  255  YEVLAGHVWRCVTTARNLPENQQTKLYVSTDGRSRLRPPPPPGYFGNVIFSAAAVATGGE  314

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            I S  +   A KIR AI  +  EY+  AID+   + DVI    L    +   PNL +ISW
Sbjct  315  IGSNGVGFAAGKIRGAIARMDEEYLRSAIDYLEMKSDVIGSIALNENTYKC-PNLGIISW  373

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            + LPI G DFGWGE ++M P     +G   +L  PN   GDDGSLLVA  L  +H+  F 
Sbjct  374  IRLPIYGADFGWGEPVYMGPARPSSEGKCHLL--PNNTAGDDGSLLVAISLLKEHMLLFE  431

Query  209  KYFYQ  195
            K  YQ
Sbjct  432  KLLYQ  436



>dbj|BAC78634.1| hydroxyanthranilate hydroxycinnamoyltransferase 2 [Avena sativa]
Length=440

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 100/184 (54%), Gaps = 7/184 (4%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y V+ AH+WRCA  AR   P+QPT L    D R+R+ P LPD YFGNAI        +G+
Sbjct  262  YAVLGAHVWRCASMARGLAPEQPTKLYCATDGRQRLTPTLPDGYFGNAIFTATPLAEAGK  321

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            +    L D A+ I++A++ +  EY + A+D+   + D+     + G      PNL + SW
Sbjct  322  VTGS-LADGATTIQEALEKMDDEYCHSALDYLELQPDL--SALVRGAHTFRCPNLGLTSW  378

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  + M PG    +G   +LP  N     DGSL VA  LQ +H++ F 
Sbjct  379  VRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSAN----RDGSLSVAISLQAEHMEKFR  434

Query  209  KYFY  198
            K  +
Sbjct  435  KMIF  438



>gb|ACG47161.1| anthranilate N-benzoyltransferase protein 2 [Zea mays]
Length=442

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 103/185 (56%), Gaps = 15/185 (8%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y V+ AH+W+C   ARS  P+QPT L    D R+R++PPLPD YFGN I        +G+
Sbjct  262  YAVLAAHVWKCVSLARSLPPEQPTKLYCATDGRQRLQPPLPDGYFGNVIFTATPLAEAGK  321

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            + S  L + A+ I+ A+D + ++Y   A+D+   + D      L  ++ G +    PNL 
Sbjct  322  VTSE-LAEGAAVIQGALDRMDNDYCRSALDYLDLQPD------LSALVRGAHTFRCPNLG  374

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG  + M PG    +G   +LP  NG    DGSL +A  LQ +H+
Sbjct  375  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANG----DGSLSIAISLQAEHM  430

Query  221  QDFNK  207
            + F K
Sbjct  431  EKFRK  435



>gb|ACC63882.1| quinate O-hydroxycinnamoyltransferase/shikimate O-hydroxycinnamoyltransferase 
[Populus trichocarpa]
 gb|AFZ78608.1| hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyl transferase 
[Populus tomentosa]
Length=433

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 99/188 (53%), Gaps = 14/188 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WR ACKAR     Q T L    D R R+ P LP  YFGN I       V+GE
Sbjct  252  YEMLAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGE  311

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            I S+P    A KI D++  + ++Y+  A+DF   + D      L  ++ G +    PNL 
Sbjct  312  IQSKPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPD------LSALVRGAHTFRCPNLG  365

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG  I M PG    +G   I+P       +DGSL VA  LQ +H+
Sbjct  366  ITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSST----NDGSLSVAISLQAEHM  421

Query  221  QDFNKYFY  198
            + F K+ Y
Sbjct  422  KLFEKFIY  429



>ref|XP_010538049.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Tarenaya 
hassleriana]
Length=445

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 98/184 (53%), Gaps = 7/184 (4%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE + AH+WRCACKAR H   Q T+L F V+ R R+ PP+P  ++GNAI        SGE
Sbjct  267  YESLAAHLWRCACKARGHPDDQKTSLVFPVNARPRLCPPVPIEFYGNAIQMSAPSAFSGE  326

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            ++  PL   A +I+  I    +EY+   I + R+   +       G     NPNL V+SW
Sbjct  327  LLKEPLSSTAGRIKKTITEKDNEYIRSGIGYLRDNKVI---DGFSGRSSFRNPNLGVVSW  383

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              +P+  +DFGWG  ++  P +   +G + +L  P   +G    L +  CL+  H++ F 
Sbjct  384  SQMPMYAMDFGWGPPVYTGPASIRSEGKIYVLSAPTKEEG----LALYVCLEASHMELFK  439

Query  209  KYFY  198
            K+ Y
Sbjct  440  KFVY  443



>gb|KHN31873.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=439

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 101/187 (54%), Gaps = 6/187 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WR  CKAR+    Q T L    D R R++PPLP  YFGN I       V+G+
Sbjct  259  YEMLAGHVWRSVCKARALPDDQETKLYIATDGRARLQPPLPHGYFGNVIFTTTPIAVAGD  318

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            ++S+P    AS+I DA+  + +EY+  A+D+   + D+  +  + G      PNL + SW
Sbjct  319  LMSKPTWYAASRIHDALIRMDNEYLRSALDYLELQPDL--KSLVRGAHTFRCPNLGITSW  376

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LPI   DFGWG  I M PG    +G   I+P       +DGSL +A  L  + ++ F 
Sbjct  377  ARLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPS----STNDGSLSLAIALPPEQMKVFQ  432

Query  209  KYFYQDI  189
            + FY DI
Sbjct  433  ELFYDDI  439



>ref|XP_003543709.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Glycine max]
Length=439

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 101/187 (54%), Gaps = 6/187 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WR  CKAR+    Q T L    D R R++PPLP  YFGN I       V+G+
Sbjct  259  YEMLAGHVWRSVCKARALPDDQETKLYIATDGRARLQPPLPHGYFGNVIFTTTRIAVAGD  318

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            ++S+P    AS+I DA+  + +EY+  A+D+   + D+  +  + G      PNL + SW
Sbjct  319  LMSKPTWYAASRIHDALIRMDNEYLRSALDYLELQPDL--KSLVRGAHTFRCPNLGITSW  376

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LPI   DFGWG  I M PG    +G   I+P       +DGSL +A  L  + ++ F 
Sbjct  377  ARLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPS----STNDGSLSLAIALPPEQMKVFQ  432

Query  209  KYFYQDI  189
            + FY DI
Sbjct  433  ELFYDDI  439



>gb|AFP49814.1| caffeoyl-CoA quinic acid caffeoyl transferase 4 [Coffea arabica]
Length=430

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 110/224 (49%), Gaps = 6/224 (3%)
 Frame = -3

Query  869  SDNAIN*LNTVIKSGNLTSIYKHPIKKMEFRLVLNLFEFRYEVITAHIWRCACKARSHKP  690
            SD+ I  L T  ++     +   P +  + +   N     YE++ AHIWR ACKAR    
Sbjct  211  SDSRIQELKTGPRASTTAVLKITPEQLSQLKAKANNEGSTYEILAAHIWRTACKARGLTN  270

Query  689  QQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGV  510
             Q T L    D R R+ PPLP  Y GN +        S  + S PL + A +I +A+  +
Sbjct  271  DQSTKLYVATDGRSRLIPPLPPGYLGNVVFTATPIAESSNLQSEPLTNSAKRIHNALARM  330

Query  509  TSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISWVGLPIQGLDFGWGEEIHMSP  330
             ++Y+  A+D+   + D+     + G     +PNL++ SW  LP    DFGWG  IH+ P
Sbjct  331  DNDYLRSALDYLEIQPDL--SALVRGPRHFASPNLNINSWTRLPFHDADFGWGRPIHIGP  388

Query  329  GNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFY  198
                 +G V +LP P    G D +L +A CL  DH+  F K+ Y
Sbjct  389  AIILYEGTVYVLPSP----GKDRTLSLAVCLDADHMPLFQKFLY  428



>gb|ABO77956.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Coffea 
canephora]
Length=430

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 110/224 (49%), Gaps = 6/224 (3%)
 Frame = -3

Query  869  SDNAIN*LNTVIKSGNLTSIYKHPIKKMEFRLVLNLFEFRYEVITAHIWRCACKARSHKP  690
            SD+ I  L T  ++     +   P +  + +   N     YE++ AHIWR ACKAR    
Sbjct  211  SDSRIQELKTGPRASTTAVLKITPEQLSQLKAKANNEGSTYEILAAHIWRTACKARGLTN  270

Query  689  QQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGV  510
             Q T L    D R R+ PPLP  Y GN +        S  + S PL + A +I +A+  +
Sbjct  271  DQSTKLYVATDGRSRLIPPLPPGYLGNVVFTATPIAESSNLQSEPLTNSAKRIHNALARM  330

Query  509  TSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISWVGLPIQGLDFGWGEEIHMSP  330
             ++Y+  A+D+   + D+     + G     +PNL++ SW  LP    DFGWG  IH+ P
Sbjct  331  DNDYLRSALDYLEIQPDL--SALVRGPRHFASPNLNINSWTRLPFHDADFGWGRPIHIGP  388

Query  329  GNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFY  198
                 +G V +LP P    G D +L +A CL  DH+  F K+ Y
Sbjct  389  AIILYEGTVYVLPSP----GKDRTLSLAVCLDADHMPLFQKFLY  428



>gb|KHG20214.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
-like protein [Gossypium arboreum]
Length=436

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 102/190 (54%), Gaps = 16/190 (8%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            + ++ AHIWRC  KAR     Q T L F VD R R++PPLP  YFGN I    +   +G+
Sbjct  257  FNILAAHIWRCVSKARGLSADQDTKLYFPVDGRYRLDPPLPPGYFGNVIFTTALIAEAGD  316

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN-----PNL  405
            + +    D   +I + ++ +  EY+  AID+       I++   L  L  G      PNL
Sbjct  317  LETESFTDTIKRIHERLNQINDEYLRSAIDY-------IEKVPDLNTLVRGPHTFRCPNL  369

Query  404  SVISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDH  225
             V+ W  LPI   DFGWG  I+M PGN   +G + +LP P     +DGSL +AA L++ H
Sbjct  370  VVVPWNWLPIYEADFGWGRPIYMGPGNVVQEGKIYMLPSP----ANDGSLTLAARLEIPH  425

Query  224  IQDFNKYFYQ  195
            ++ F K  Y+
Sbjct  426  MKVFEKLIYE  435



>ref|XP_002446745.1| hypothetical protein SORBIDRAFT_06g021640 [Sorghum bicolor]
 gb|EES11073.1| hypothetical protein SORBIDRAFT_06g021640 [Sorghum bicolor]
Length=441

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 103/185 (56%), Gaps = 15/185 (8%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y V+ AH+W+C   ARS  P+QPT L    D R+R++PPLPD YFGN I        +G+
Sbjct  263  YAVLAAHVWKCVSLARSLPPEQPTKLYCATDGRQRLQPPLPDGYFGNVIFTATPLAEAGK  322

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            + S  L + A+ I+ A+D + ++Y   A+D+   + D      L  ++ G +    PNL 
Sbjct  323  VTSG-LAEGAAVIQGALDRMDNDYCRSALDYLELQPD------LSALVRGAHTFRCPNLG  375

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG  + M PG    +G   +LP  NG    DGSL +A  LQ +H+
Sbjct  376  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANG----DGSLSIAISLQAEHM  431

Query  221  QDFNK  207
            + F K
Sbjct  432  EKFRK  436



>emb|CDP02827.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   134 bits (336),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 110/224 (49%), Gaps = 6/224 (3%)
 Frame = -3

Query  869  SDNAIN*LNTVIKSGNLTSIYKHPIKKMEFRLVLNLFEFRYEVITAHIWRCACKARSHKP  690
            SD+ I  L T  ++     +   P +  + +   N     YE++ AHIWR ACKAR    
Sbjct  265  SDSRIQELKTGPRASTTAVLKITPEQLSQLKAKANNEGSTYEILAAHIWRTACKARGLTN  324

Query  689  QQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGV  510
             Q T L    D R R+ PPLP  Y GN +        S  + S PL + A +I +A+  +
Sbjct  325  DQSTKLYVATDGRSRLIPPLPPGYLGNVVFTATPIAESSNLQSEPLTNSAKRIHNALARM  384

Query  509  TSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISWVGLPIQGLDFGWGEEIHMSP  330
             ++Y+  A+D+   + D+     + G     +PNL++ SW  LP    DFGWG  IH+ P
Sbjct  385  DNDYLRSALDYLEIQPDL--SALVRGPRHFASPNLNINSWTRLPFHDADFGWGRPIHIGP  442

Query  329  GNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFY  198
                 +G V +LP P    G D +L +A CL  DH+  F K+ Y
Sbjct  443  AIILYEGTVYVLPSP----GKDRTLSLAVCLDADHMPLFQKFLY  482



>ref|XP_007215401.1| hypothetical protein PRUPE_ppa005910mg [Prunus persica]
 gb|EMJ16600.1| hypothetical protein PRUPE_ppa005910mg [Prunus persica]
Length=438

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 99/188 (53%), Gaps = 14/188 (7%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  HIWRC CKAR     Q T L    D R R++PPLP  YFGN I        +G+
Sbjct  259  YEMMAGHIWRCVCKARELPNDQDTKLYIATDGRSRLQPPLPPGYFGNVIFTATPIAAAGD  318

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            + S+P    AS+I D++  +   Y+  A+D+   + D      L  ++ G +    PNL 
Sbjct  319  LQSKPTWFAASRIHDSLVRMDDNYLRSALDYLELQPD------LSALVRGAHTFRCPNLG  372

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG  I M PG    +G   ++P       +DGSL VA  LQ +H+
Sbjct  373  ITSWVRLPIHDADFGWGRPIFMGPGGIAFEGLAFVIPSAT----NDGSLSVAISLQSEHM  428

Query  221  QDFNKYFY  198
            + F+K  Y
Sbjct  429  KSFSKLLY  436



>dbj|BAJ95750.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   133 bits (335),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 103/185 (56%), Gaps = 15/185 (8%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y V+ AH+WRC   AR+  P+QPT L    D R+R++PPLP+ YFGN I        +G+
Sbjct  260  YAVLAAHVWRCVSLARNLAPEQPTKLYCATDGRQRLQPPLPEGYFGNVIFTATPLAEAGK  319

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            + S  L + A+ I+ A+D +TS+Y   A+D+   + D      L  ++ G +    PNL 
Sbjct  320  VTSG-LAEGAAVIQGALDRMTSDYCQSALDYLEMQPD------LSALVRGAHTFRCPNLG  372

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG  + M PG    +G   +LP  +     DGSL +A  LQ +H+
Sbjct  373  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSAS----KDGSLSIAISLQAEHM  428

Query  221  QDFNK  207
            + F K
Sbjct  429  EKFRK  433



>dbj|BAJ93247.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 103/185 (56%), Gaps = 15/185 (8%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y V+ AH+WRC   AR+  P+QPT L    D R+R++PPLP+ YFGN I        +G+
Sbjct  260  YAVLAAHVWRCVSLARNLAPEQPTKLYCATDGRQRLQPPLPEGYFGNVIFTATPLAEAGK  319

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGN----PNLS  402
            + S  L + A+ I+ A+D +TS+Y   A+D+   + D      L  ++ G +    PNL 
Sbjct  320  VTSG-LAEGAAVIQGALDRMTSDYCQSALDYLEMQPD------LSALVRGAHTFRCPNLG  372

Query  401  VISWVGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHI  222
            + SWV LPI   DFGWG  + M PG    +G   +LP  +     DGSL +A  LQ +H+
Sbjct  373  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSAS----KDGSLSIAISLQAEHM  428

Query  221  QDFNK  207
            + F K
Sbjct  429  EKFRK  433



>gb|KEH28560.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=433

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 99/184 (54%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WR  CKARS    Q T L    D R R++PP P  YFGN I       ++G+
Sbjct  254  YEMLAGHVWRSVCKARSLPDDQETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGD  313

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            ++++P    AS+I +A+  + +EY+  A+DF   + D+  +  + G      PNL + SW
Sbjct  314  LMTKPTWYAASRIHNALSRMDNEYLRSALDFLELQPDL--KALVRGAHTFKCPNLGITSW  371

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LPI   DFGWG  I M PG    +G   I+P       +DGSL VA  LQ +H++ F 
Sbjct  372  ARLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPS----SANDGSLSVAIALQHEHMKVFK  427

Query  209  KYFY  198
             + Y
Sbjct  428  DFLY  431



>ref|XP_007023475.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 ref|XP_007023476.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26097.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26098.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
Length=431

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 96/184 (52%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE+++ H+WR  CKAR     Q T L    D R R+ PPLP  YFGN I       V+G+
Sbjct  252  YEMLSGHVWRSVCKARGLAGDQGTKLYIATDGRARLRPPLPPGYFGNVIFTATPIAVAGD  311

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            ++S+P    A  I DA+  +  +Y+  A+D+   + D+     + G      PNL + SW
Sbjct  312  LLSKPTWYAAGTIHDALARMDDDYLRSALDYLELQPDL--SALVRGAHTFKCPNLGITSW  369

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LPI   DFGWG  I M PG    +G   +LP P     +DGSL VA  LQ +H++ F 
Sbjct  370  ARLPIHDADFGWGRPIFMGPGGIPYEGLSFVLPSPT----NDGSLSVAISLQAEHMKLFE  425

Query  209  KYFY  198
            K  Y
Sbjct  426  KLIY  429



>ref|NP_001234850.1| hydroxycinnamoyl CoA quinate transferase [Solanum lycopersicum]
 emb|CAE46933.1| hydroxycinnamoyl CoA quinate transferase [Solanum lycopersicum]
Length=430

 Score =   133 bits (334),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 95/185 (51%), Gaps = 5/185 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++ AHIWRC CKAR     Q T L    D R R+ PPLP  Y GN +        S E
Sbjct  250  YEILAAHIWRCTCKARGLPEDQLTKLHVATDGRSRLCPPLPPGYLGNVVFTATPIAKSCE  309

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S PL +   +I + +  +   Y+  A+D+   + D+     + G  +  +PNL++ SW
Sbjct  310  LQSEPLTNSVKRIHNELIKMDDNYLRSALDYLELQPDL--STLIRGPAYFASPNLNINSW  367

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LP+   DFGWG  IHM P     +G + I+P PN     D +L +A CL   H+  F 
Sbjct  368  TRLPVHECDFGWGRPIHMGPACILYEGTIYIIPSPN---SKDRNLRLAVCLDAGHMSLFE  424

Query  209  KYFYQ  195
            KY Y+
Sbjct  425  KYLYE  429



>dbj|BAC78635.1| hydroxyanthranilate hydroxycinnamoyltransferase 3 [Avena sativa]
Length=440

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 99/184 (54%), Gaps = 7/184 (4%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y V+ AH+WRCA  AR   P+QPT L    D R+R+ P LPD YFGN I        +G+
Sbjct  262  YAVLGAHVWRCASLARGLAPEQPTKLYCATDGRQRLTPTLPDGYFGNVIFTATPLAEAGK  321

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            +    L D A+ I+DA++ +  EY + A+D+   + D+     + G      PNL + SW
Sbjct  322  VTGS-LADGATTIQDALEKMDDEYCHSALDYLELQPDL--SALVRGAHTFRCPNLGLTSW  378

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  + M PG    +G   +LP  N     DGSL VA  LQ +H++ F 
Sbjct  379  VRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSAN----RDGSLSVAISLQAEHMEKFR  434

Query  209  KYFY  198
            K  +
Sbjct  435  KMIF  438



>gb|AIG20957.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Lonicera japonica]
Length=424

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 97/179 (54%), Gaps = 6/179 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WRC CKAR     Q T L    D R R++P LP  YFGN I       V+G+
Sbjct  251  YEIMAGHLWRCVCKARGLPEDQETKLYIATDGRARLKPSLPPGYFGNVIFTTTPIAVAGD  310

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S+P    AS+I DA+  + ++Y+  A+D+   + D+  +  + G      PNL + SW
Sbjct  311  LQSKPAWYAASRIHDALTRMDNDYLRSALDYLELQPDL--KALVRGAHTFRCPNLGITSW  368

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDF  213
              LPI   DFGWG  I M PG    +G   +LP P     +DGSL VA  LQ +H++ F
Sbjct  369  ARLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSPT----NDGSLSVAISLQAEHMKLF  423



>gb|ACI28534.1| shikimate O-hydroxycinnamoyl transferase [Trifolium pratense]
Length=434

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 100/184 (54%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WR  CKARS    Q T L    D R R++PP P  YFGN I       ++G+
Sbjct  255  YEMLAGHVWRSVCKARSLPDDQETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGD  314

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            ++S+P    AS+I +A+  + ++Y+  A+DF   + D+  +  + G      PNL + SW
Sbjct  315  LMSKPTWYAASRIHNALSRMDNDYLRSALDFLELQPDL--KALVRGAHTFKCPNLGITSW  372

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LPI   DFGWG  I M PG    +G   I+P       +DGSL VA  LQ +H++ F 
Sbjct  373  ARLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSST----NDGSLSVAIALQHEHMKVFK  428

Query  209  KYFY  198
            ++ Y
Sbjct  429  EFLY  432



>gb|ABO77957.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Coffea 
canephora]
Length=430

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 110/224 (49%), Gaps = 6/224 (3%)
 Frame = -3

Query  869  SDNAIN*LNTVIKSGNLTSIYKHPIKKMEFRLVLNLFEFRYEVITAHIWRCACKARSHKP  690
            SD+ I  L T  ++     +   P +  + +   N     YE++ AHIWR ACKAR    
Sbjct  211  SDSRIQELKTGPRASTTAVLKITPEQLSQLKAKANNEGSTYEILAAHIWRTACKARGLTN  270

Query  689  QQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGV  510
             Q T L    D R R+ PPLP  Y GN +        S  + S PL + A +I +A+  +
Sbjct  271  DQSTKLYVATDGRSRLIPPLPPGYLGNVVFTATPIAESSNLQSEPLTNSAKRIHNALARM  330

Query  509  TSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISWVGLPIQGLDFGWGEEIHMSP  330
             ++Y+  A+D+   + D+     + G     +PNL++ SW  LP    DFGWG  IH+ P
Sbjct  331  DNDYLRSALDYLEIQPDL--SALVRGPRHFASPNLNINSWTRLPFHDADFGWGRPIHIGP  388

Query  329  GNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFY  198
                 +G V +LP P    G D +L +A CL  DH+  F ++ Y
Sbjct  389  AIILYEGTVYVLPSP----GKDRTLSLAVCLDADHMPLFQRFLY  428



>gb|AEO00530.1| hydroxycinnamoyl transferase [Nicotiana benthamiana]
Length=369

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 97/184 (53%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE++  H+WR  C AR     Q T L    D R R+ P LP  YFGN I       V+G+
Sbjct  190  YEMLAGHVWRSTCMARGLAHDQETKLYIATDGRSRLRPSLPPGYFGNVIFTTTPIAVAGD  249

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            I S+P+   ASK+ DA+  + ++Y+  A+D+   + D+  +  + G      PNL + SW
Sbjct  250  IQSKPIWYAASKLHDALARMDNDYLRSALDYLELQPDL--KALVRGAHTFKCPNLGITSW  307

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
              LPI   DFGWG  I M PG    +G   ILP P     +DGS  VA  LQ +H++ F 
Sbjct  308  SRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----NDGSQSVAISLQAEHMKLFE  363

Query  209  KYFY  198
            K+ Y
Sbjct  364  KFLY  367



>ref|XP_010527105.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Tarenaya 
hassleriana]
Length=399

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 99/187 (53%), Gaps = 6/187 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            YE+++ H+WR  CKAR     Q + L    D R R+ PPLP  YFGN I       V+G+
Sbjct  219  YEMLSGHVWRSVCKARGLADDQESKLYIATDGRSRLRPPLPPGYFGNVIFTATPVAVAGD  278

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S+P    A +I +A+  + +EY+  A+D+   + D+     + G      PNL + SW
Sbjct  279  LHSKPTWYAAGQIHNALVRMDNEYLRSALDYLEMQPDL--SALVRGAHTFKCPNLGITSW  336

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            V LPI   DFGWG  I M PG    +G   +LP       +DGSL VA  LQ +H++ F 
Sbjct  337  VRLPIHDADFGWGRPIFMGPGGIPYEGLSFVLPS----SANDGSLSVAIALQTEHMKLFE  392

Query  209  KYFYQDI  189
            K  + DI
Sbjct  393  KILHDDI  399



>ref|XP_007011895.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007011896.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29514.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29515.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
Length=449

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 98/184 (53%), Gaps = 6/184 (3%)
 Frame = -3

Query  749  YEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGE  570
            Y+++TAH+W C CKAR     Q T L   +D R ++ PPLP  Y GN I       +SG+
Sbjct  259  YDILTAHVWHCVCKARGLSDDQATKLYIPIDGRSKLHPPLPPGYLGNVIFIAATTALSGD  318

Query  569  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELLGVLFGGNPNLSVISW  390
            + S P  D   +I   +  +  +Y+  A+D+  +  D+  +  + G     +PNLS+ SW
Sbjct  319  LQSEPFADTIQRINRMVKRMDDKYMRSALDYIESVPDM--KTLMRGAHTFQSPNLSINSW  376

Query  389  VGLPIQGLDFGWGEEIHMSPGNHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  210
            + LP+   DFGWG  +H+   N   +G + I+P P     DDGSL +  CL+  H++ F 
Sbjct  377  MRLPLYAADFGWGRPMHVGLANVIHEGKICIVPSP----VDDGSLSLVVCLETSHMKQFE  432

Query  209  KYFY  198
            K  Y
Sbjct  433  KCLY  436



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1997200541776