BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25500_g2_i7 len=826 path=[6304:0-137 33479:138-195 6500:196-221
12345:222-243 6548:244-249 6554:250-296 34775:297-297 11997:298-322
6627:323-369 6674:370-439 33240:440-537 6842:538-596 6901:597-618
6923:619-659 6964:660-669 6974:670-693 27984:694-721 7029:722-724
7032:725-748 30187:749-767 7075:768-825]

Length=826
                                                                      Score     E

ref|XP_009628063.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    295   1e-93   
ref|XP_011092043.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    294   5e-93   
ref|XP_011077685.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    291   8e-92   
ref|XP_009787025.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    289   4e-91   
ref|XP_006359722.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    288   9e-91   
ref|XP_004243059.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    281   3e-88   
ref|XP_002521543.1|  Anthranilate N-benzoyltransferase protein, p...    280   7e-88   Ricinus communis
ref|XP_010050942.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    280   8e-88   
ref|XP_002269790.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    277   1e-86   Vitis vinifera
ref|XP_010467740.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    275   2e-85   
ref|XP_007211620.1|  hypothetical protein PRUPE_ppa005563mg             272   1e-84   
gb|KFK40283.1|  hypothetical protein AALP_AA3G354800                    271   4e-84   
ref|XP_008223800.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    270   1e-83   
ref|XP_010489453.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    269   2e-83   
ref|XP_004301782.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    268   4e-83   
ref|XP_006453312.1|  hypothetical protein CICLE_v10008265mg             266   3e-82   
ref|XP_002884178.1|  transferase family protein                         265   6e-82   
ref|XP_010034869.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    265   7e-82   
gb|ACC68164.1|  unknown                                                 265   7e-82   Arabidopsis halleri subsp. halleri
ref|XP_010414994.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    265   8e-82   
ref|XP_008223799.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    265   1e-81   
ref|XP_008372277.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    264   2e-81   
ref|XP_006381775.1|  hypothetical protein POPTR_0006s17880g             264   2e-81   
ref|XP_006296658.1|  hypothetical protein CARUB_v10015907mg             263   3e-81   
gb|KDO61846.1|  hypothetical protein CISIN_1g036315mg                   263   3e-81   
emb|CDY62143.1|  BnaCnng39330D                                          261   3e-81   
ref|XP_002325143.2|  transferase family protein                         263   3e-81   Populus trichocarpa [western balsam poplar]
ref|XP_010051711.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    263   4e-81   
emb|CDY56515.1|  BnaCnng30570D                                          261   5e-81   
gb|KCW80900.1|  hypothetical protein EUGRSUZ_C02269                     262   8e-81   
ref|NP_179497.1|  spermidine hydroxycinnamoyl transferase               262   1e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010050943.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    262   1e-80   
ref|XP_009150708.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    261   2e-80   
ref|XP_006409088.1|  hypothetical protein EUTSA_v10022690mg             261   3e-80   
gb|KCW82842.1|  hypothetical protein EUGRSUZ_C04213                     260   4e-80   
gb|AFF57840.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    260   4e-80   
ref|XP_011018001.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    259   2e-79   
ref|XP_009358743.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    258   4e-79   
ref|XP_010548604.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    255   3e-78   
emb|CDY03367.1|  BnaC09g09810D                                          254   2e-77   
ref|XP_003550655.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    253   2e-77   
gb|KHN17616.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    250   5e-77   
emb|CDY66506.1|  BnaAnng22360D                                          252   5e-77   
gb|KHN17617.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    250   4e-76   
ref|XP_009112574.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    250   5e-76   
ref|XP_002274695.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    249   7e-76   Vitis vinifera
ref|XP_007161968.1|  hypothetical protein PHAVU_001G112900g             249   9e-76   
ref|XP_007154735.1|  hypothetical protein PHAVU_003G143100g             249   2e-75   
ref|XP_007161967.1|  hypothetical protein PHAVU_001G112800g             248   2e-75   
ref|XP_003550654.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    248   5e-75   
ref|XP_008231463.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    247   7e-75   
ref|XP_010656623.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    243   2e-73   
emb|CBI36554.3|  unnamed protein product                                243   3e-73   
ref|XP_011076842.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    243   7e-73   
ref|XP_010265516.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    241   1e-72   
ref|XP_010673351.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    241   1e-72   
gb|EYU26551.1|  hypothetical protein MIMGU_mgv1a006988mg                239   4e-72   
ref|XP_004507883.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    239   6e-72   
ref|XP_003610074.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    237   4e-71   
gb|EPS69670.1|  hypothetical protein M569_05094                         237   4e-71   
ref|XP_002276550.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    236   6e-71   Vitis vinifera
gb|AFD64619.1|  putative hydroxycinnamoyl-CoA:shikimate/quinate h...    233   2e-69   
gb|EPS68189.1|  hypothetical protein M569_06582                         231   6e-69   
emb|CAN72449.1|  hypothetical protein VITISV_011069                     231   1e-68   Vitis vinifera
gb|AES90726.2|  spermidine hydroxycinnamoyl transferase                 227   3e-67   
ref|XP_010541075.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    229   3e-67   
emb|CDP18830.1|  unnamed protein product                                226   5e-67   
ref|XP_008231492.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    226   6e-67   
ref|XP_003608529.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    227   6e-67   
gb|EYU25632.1|  hypothetical protein MIMGU_mgv1a006215mg                222   2e-65   
emb|CDP21167.1|  unnamed protein product                                220   1e-64   
ref|XP_011083883.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    218   8e-64   
gb|ADD71921.1|  BAHD-type hydroxycinnamoyltransferase                   217   2e-63   Actaea racemosa
ref|XP_010669388.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    216   4e-63   
ref|XP_007219083.1|  hypothetical protein PRUPE_ppa014960mg             216   5e-63   
ref|XP_010273689.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    216   6e-63   
ref|XP_010669430.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    214   8e-62   
emb|CDP05692.1|  unnamed protein product                                213   8e-62   
ref|XP_010110725.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    212   2e-61   
ref|XP_011069658.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    211   3e-61   
ref|XP_010094198.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    210   1e-60   
ref|XP_010273688.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    209   2e-60   
emb|CDP21790.1|  unnamed protein product                                195   2e-56   
gb|AID69225.1|  hydroxycinnamoyl coenzyme A shikimate hydroxycinn...    196   3e-56   
ref|XP_004500023.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    198   5e-56   
ref|XP_003548918.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    197   7e-56   
ref|XP_011073311.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    195   3e-55   
gb|KHN18128.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    196   3e-55   
ref|XP_010265527.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    194   6e-55   
ref|XP_003599928.1|  Anthranilate N-benzoyltransferase protein          194   9e-55   
gb|KHN13395.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    194   1e-54   
gb|ACI16631.1|  malate O-hydroxycinnamoyl transferase                   192   6e-54   Trifolium pratense [peavine clover]
ref|XP_003599037.1|  Anthranilate N-benzoyltransferase protein          192   7e-54   
gb|ACF37072.1|  hydroxycinnamoyl CoA quinate transferase 1              191   2e-53   
ref|XP_003553115.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    190   4e-53   
gb|AEM63675.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...    189   7e-53   
gb|KHN35439.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    188   7e-53   
ref|XP_011082506.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    189   8e-53   
ref|XP_011020577.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    189   8e-53   
ref|XP_010113235.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    189   9e-53   
ref|XP_010094062.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    188   1e-52   
ref|XP_004135880.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    188   1e-52   
gb|AEJ88365.1|  hydroxycinnamoyltransferase                             188   1e-52   
ref|XP_003555244.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    189   2e-52   
gb|KHN22679.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    185   2e-52   
ref|XP_002529413.1|  Anthranilate N-benzoyltransferase protein, p...    187   3e-52   Ricinus communis
gb|AEM63676.1|  hydroxycinnamoyl CoA quinate hydroxycinnamoyl tra...    187   3e-52   
gb|ACC63882.1|  quinate O-hydroxycinnamoyltransferase/shikimate O...    187   4e-52   Populus trichocarpa [western balsam poplar]
ref|XP_004158793.1|  PREDICTED: LOW QUALITY PROTEIN: shikimate O-...    187   4e-52   
ref|XP_007214780.1|  hypothetical protein PRUPE_ppa023555mg             187   4e-52   
ref|XP_002277474.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    187   5e-52   Vitis vinifera
gb|ABO40491.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    186   6e-52   Coffea arabica [arabica coffee]
gb|ACU23734.1|  unknown                                                 187   8e-52   Glycine max [soybeans]
gb|AAZ80046.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    186   8e-52   Cynara cardunculus [cardoon]
ref|XP_006605610.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    187   8e-52   
gb|AFN85668.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    186   1e-51   
ref|XP_007146248.1|  hypothetical protein PHAVU_006G024700g             186   1e-51   
ref|XP_010094061.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    186   1e-51   
gb|ADL62855.1|  hydroxycinnamoyl-CoA transferase 2                      186   1e-51   
gb|KDP38697.1|  hypothetical protein JCGZ_04050                         185   2e-51   
dbj|BAJ14794.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    185   2e-51   
gb|ABO52899.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltr...    185   2e-51   Pinus radiata
gb|AGA20364.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...    185   2e-51   
ref|XP_002512739.1|  Anthranilate N-benzoyltransferase protein, p...    185   2e-51   Ricinus communis
gb|KHM99609.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    184   3e-51   
ref|XP_007150819.1|  hypothetical protein PHAVU_005G183200g             185   3e-51   
emb|CDO98242.1|  unnamed protein product                                184   4e-51   
gb|AAZ80047.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    181   4e-51   Cynara cardunculus var. altilis [cultivated cardoon]
gb|AIG20957.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    184   4e-51   
ref|XP_010063596.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    184   5e-51   
pdb|4G2M|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    184   5e-51   
emb|CAD88491.1|  hydroxycinnamoyl-CoA hydroxycinnamoyltransferase       181   5e-51   Nicotiana benthamiana
pdb|4G0B|A  Chain A, Structure Of Native Hct From Coffea Canephora      184   5e-51   
gb|AFL93686.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    184   6e-51   
gb|ABO47805.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    184   6e-51   Coffea canephora [robusta coffee]
ref|XP_003532110.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    184   6e-51   
gb|AFS68800.1|  hydroxycinnamoyl transferase                            184   7e-51   
emb|CAJ40778.1|  hydroxycinnamoyl transferase                           184   7e-51   Coffea arabica [arabica coffee]
ref|XP_007023475.1|  Hydroxycinnamoyl-CoA shikimate/quinate hydro...    183   8e-51   
ref|XP_003532115.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    184   9e-51   
emb|CCC55431.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxyci...    183   1e-50   
gb|AHG97388.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    184   1e-50   
gb|AAZ80048.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    180   1e-50   Cynara cardunculus var. sylvestris [wild cardoon]
ref|XP_004303231.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    183   1e-50   
gb|AEO00530.1|  hydroxycinnamoyl transferase                            181   1e-50   
emb|CDG56248.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...    183   1e-50   
ref|XP_010101376.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    183   1e-50   
ref|XP_009615699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    182   2e-50   
ref|XP_008441993.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    183   2e-50   
ref|XP_004500005.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    183   2e-50   
ref|XP_004293648.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    182   2e-50   
gb|ABR17170.1|  unknown                                                 182   3e-50   Picea sitchensis
gb|AEK80405.1|  HQT                                                     182   4e-50   
emb|CDG56249.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...    181   4e-50   
gb|ABO77955.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    182   4e-50   Coffea canephora [robusta coffee]
gb|AHA44839.1|  hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltr...    181   4e-50   
gb|ACF17657.1|  putative hydroxycinnamoyl transferase                   181   5e-50   Capsicum annuum
gb|KHN29832.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    182   5e-50   
ref|XP_003551937.2|  PREDICTED: spermidine hydroxycinnamoyl trans...    182   5e-50   
ref|XP_003530223.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    181   6e-50   
ref|XP_003543709.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    181   6e-50   
gb|KHN31873.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    181   7e-50   
gb|AFZ78609.1|  hydroxycinnamoyl-CoA:shikimate/quinate hydroxycin...    181   1e-49   
ref|XP_006471643.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    181   1e-49   
gb|ACI16630.1|  shikimate O-hydroxycinnamoyltransferase                 181   1e-49   Trifolium pratense [peavine clover]
ref|XP_006583083.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    181   1e-49   
ref|XP_006493385.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    180   1e-49   
dbj|BAA87043.1|  N-hydroxycinnamoyl/benzoyltransferase                  180   1e-49   Ipomoea batatas [batate]
ref|XP_006368492.1|  transferase family protein                         180   1e-49   
ref|XP_006583082.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    181   1e-49   
pdb|4G22|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    180   1e-49   
gb|ACZ52698.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    180   2e-49   Lonicera japonica [Japanese honeysuckle]
ref|XP_007216677.1|  hypothetical protein PRUPE_ppa1027182mg            180   2e-49   
emb|CDG56253.1|  hydroxycinnamoyltransferase 2                          180   2e-49   
ref|XP_009375480.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    180   2e-49   
gb|ADG46003.1|  hydroxycinnamoyl transferase                            179   2e-49   
emb|CBI83579.1|  hydroxycinnamoyl transferase                           179   3e-49   
gb|ACI28534.1|  shikimate O-hydroxycinnamoyl transferase                179   3e-49   Trifolium pratense [peavine clover]
ref|XP_011034568.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    179   4e-49   
gb|AFL93687.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-tra...    179   5e-49   
ref|XP_002268988.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    179   5e-49   Vitis vinifera
gb|KEH28560.1|  shikimate/quinate hydroxycinnamoyltransferase           179   5e-49   
emb|CAN82918.1|  hypothetical protein VITISV_023290                     178   6e-49   Vitis vinifera
ref|XP_004235891.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    179   6e-49   
dbj|BAF49306.1|  putative acyltransferase                               179   6e-49   Clitoria ternatea
gb|EYU25633.1|  hypothetical protein MIMGU_mgv1a006801mg                178   6e-49   
ref|XP_007146396.1|  hypothetical protein PHAVU_006G036800g             179   7e-49   
ref|XP_004291518.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    178   7e-49   
gb|ACA64049.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    178   8e-49   
ref|XP_004507047.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    178   9e-49   
ref|XP_007215406.1|  hypothetical protein PRUPE_ppa005955mg             178   1e-48   
ref|XP_010063590.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    178   1e-48   
ref|XP_008228828.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    177   1e-48   
gb|KHN04193.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    177   1e-48   
ref|XP_010063583.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    178   1e-48   
ref|XP_007146398.1|  hypothetical protein PHAVU_006G037000g             178   1e-48   
ref|XP_008342823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    177   2e-48   
ref|XP_004149125.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    178   2e-48   
ref|XP_004293649.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    177   2e-48   
gb|ABK79689.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    177   3e-48   Cynara cardunculus var. scolymus [artichoke]
ref|NP_001289240.1|  shikimate O-hydroxycinnamoyltransferase-like       177   3e-48   
ref|XP_010527105.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    176   3e-48   
ref|XP_004166134.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    177   3e-48   
gb|KHN18130.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    177   3e-48   
ref|XP_010034043.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    177   4e-48   
ref|XP_003553113.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    177   4e-48   
ref|XP_009354208.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    176   4e-48   
dbj|BAF49305.1|  putative acyltransferase                               176   4e-48   Clitoria ternatea
gb|KCW53914.1|  hypothetical protein EUGRSUZ_J03126                     177   5e-48   
ref|XP_009800587.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    176   5e-48   
ref|XP_003531748.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    176   5e-48   
ref|XP_006341413.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    176   5e-48   
gb|AHA14500.1|  hydroxycinnamoyl-coenzyme A quinate transperase         176   5e-48   
ref|XP_002324530.2|  hypothetical protein POPTR_0018s11370g             176   6e-48   Populus trichocarpa [western balsam poplar]
gb|ABK79690.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    176   6e-48   Cynara cardunculus var. altilis [cultivated cardoon]
ref|NP_001280198.1|  shikimate O-hydroxycinnamoyltransferase-like       176   9e-48   
ref|XP_010244683.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    175   1e-47   
gb|AFF57839.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    175   1e-47   
ref|XP_010063586.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    175   1e-47   
gb|ADB44897.1|  hydroxycinnamoyl transferase                            175   2e-47   Sinopodophyllum hexandrum [Himalayan mayapple]
ref|XP_004507046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    175   2e-47   
ref|XP_009760608.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    174   2e-47   
ref|XP_004507045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    175   2e-47   
gb|ACJ23164.1|  hydroxycinnamoyl CoA quinate transferase 2              174   2e-47   
gb|AFF19203.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    174   2e-47   
ref|XP_006465544.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    174   3e-47   
gb|KDP41953.1|  hypothetical protein JCGZ_26971                         174   3e-47   
ref|XP_011018045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    174   3e-47   
ref|XP_002324534.1|  hypothetical protein POPTR_0018s11450g             174   3e-47   Populus trichocarpa [western balsam poplar]
ref|XP_011018044.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    174   4e-47   
gb|AGV54440.1|  shikimate O-hydroxycinnamoyltransferase                 174   4e-47   
emb|CAR92145.1|  hydroxycinnamoyl CoA quinate transferase 2             174   4e-47   
ref|XP_007135841.1|  hypothetical protein PHAVU_010G162700g             173   5e-47   
ref|XP_007027321.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    174   5e-47   
ref|XP_006474019.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    173   6e-47   
ref|XP_006343633.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    173   6e-47   
ref|XP_008228811.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    173   6e-47   
ref|XP_003532111.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    174   6e-47   
ref|XP_006474020.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    173   6e-47   
ref|NP_001275483.1|  HQT                                                173   7e-47   
ref|XP_004163669.1|  PREDICTED: Bloom syndrome protein homolog          179   7e-47   
ref|XP_009614241.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    173   8e-47   
gb|ABA46756.1|  hydroxycinnamoyl-CoA quinate-like protein               172   1e-46   Solanum tuberosum [potatoes]
ref|XP_009626780.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    172   1e-46   
ref|XP_009626781.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    172   1e-46   
ref|XP_002529412.1|  Anthranilate N-benzoyltransferase protein, p...    171   1e-46   Ricinus communis
ref|XP_008228810.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    172   1e-46   
gb|ADL62854.1|  hydroxycinnamoyl-CoA transferase 1                      172   2e-46   
ref|XP_007011895.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    172   2e-46   
ref|XP_008353756.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    172   2e-46   
ref|XP_007215401.1|  hypothetical protein PRUPE_ppa005910mg             172   2e-46   
ref|XP_008381165.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    171   3e-46   
ref|XP_006464645.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    171   3e-46   
gb|EYU21745.1|  hypothetical protein MIMGU_mgv1a006579mg                171   4e-46   
ref|XP_010244666.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    171   5e-46   
gb|KHM99608.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    171   5e-46   
ref|XP_003532114.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    171   6e-46   
gb|KDP38698.1|  hypothetical protein JCGZ_04051                         170   6e-46   
ref|XP_007033668.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    170   6e-46   
ref|XP_007215395.1|  hypothetical protein PRUPE_ppa005872mg             171   7e-46   
emb|CAE46932.1|  hydroxycinnamoyl CoA quinate transferase               170   7e-46   Nicotiana tabacum [American tobacco]
ref|XP_011018051.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    171   7e-46   
ref|XP_008381122.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    170   7e-46   
ref|XP_008228829.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    170   8e-46   
gb|KHG20214.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    170   8e-46   
ref|XP_007033659.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    170   9e-46   
ref|XP_007216058.1|  hypothetical protein PRUPE_ppa017691mg             170   1e-45   
ref|XP_008237042.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    170   2e-45   
ref|XP_009624297.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    169   2e-45   
ref|XP_004493179.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    170   2e-45   
gb|KHN11007.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    169   2e-45   
ref|XP_003535207.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    169   2e-45   
ref|XP_011011266.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    169   3e-45   
ref|XP_002324532.1|  hypothetical protein POPTR_0018s11380g             169   3e-45   Populus trichocarpa [western balsam poplar]
ref|XP_007215396.1|  hypothetical protein PRUPE_ppa005873mg             169   3e-45   
ref|XP_007146394.1|  hypothetical protein PHAVU_006G036600g             169   3e-45   
emb|CDG56252.1|  hydroxycinnamoyltransferase 1                          169   3e-45   
gb|EYU21749.1|  hypothetical protein MIMGU_mgv1a006630mg                168   6e-45   
ref|XP_009798536.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    168   6e-45   
emb|CBI25231.3|  unnamed protein product                                167   7e-45   
gb|KDP38692.1|  hypothetical protein JCGZ_04045                         167   8e-45   
gb|KEH39662.1|  shikimate/quinate hydroxycinnamoyltransferase           167   8e-45   
ref|XP_003637275.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    167   9e-45   
ref|XP_006382509.1|  hypothetical protein POPTR_0005s02820g             167   9e-45   
ref|XP_011036967.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    167   1e-44   
ref|XP_007099551.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    166   1e-44   
ref|XP_003629304.1|  Hydroxycinnamoyl-CoA quinate hydroxycinnamoy...    166   2e-44   
ref|XP_011036823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    166   2e-44   
gb|KHN36434.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    166   2e-44   
ref|XP_003551903.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    166   3e-44   
ref|XP_009365251.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    166   3e-44   
ref|NP_001234850.1|  hydroxycinnamoyl CoA quinate transferase           166   4e-44   
gb|ABO77957.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    166   4e-44   
ref|XP_010500346.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    166   4e-44   
ref|XP_006598127.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    166   5e-44   
ref|XP_011084630.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    165   5e-44   
ref|XP_010479239.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    165   5e-44   
ref|XP_006382508.1|  hypothetical protein POPTR_0005s02810g             165   7e-44   
gb|KEH38242.1|  shikimate/quinate hydroxycinnamoyltransferase           165   7e-44   
ref|XP_003575337.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    165   8e-44   
ref|XP_009789449.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    165   8e-44   
gb|KHN30507.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    165   9e-44   
emb|CAT00081.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    164   1e-43   
emb|CDP02827.1|  unnamed protein product                                165   1e-43   
ref|XP_010093469.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    164   1e-43   
ref|XP_009380783.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    164   1e-43   
gb|AFP49814.1|  caffeoyl-CoA quinic acid caffeoyl transferase 4         164   2e-43   
emb|CDY44162.1|  BnaC01g22120D                                          164   2e-43   
dbj|BAJ87836.1|  predicted protein                                      164   2e-43   
dbj|BAK06288.1|  predicted protein                                      164   2e-43   
ref|XP_010479238.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    164   2e-43   
gb|AGW27211.1|  rosmarinic acid synthase 6                              163   3e-43   
gb|ABO77956.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    163   4e-43   
ref|XP_006471700.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    163   5e-43   
ref|XP_006303737.1|  hypothetical protein CARUB_v10011876mg             162   6e-43   
dbj|BAC78635.1|  hydroxyanthranilate hydroxycinnamoyltransferase 3      162   7e-43   
ref|XP_006826688.1|  hypothetical protein AMTR_s00137p00072760          162   7e-43   
dbj|BAC78634.1|  hydroxyanthranilate hydroxycinnamoyltransferase 2      162   8e-43   
ref|XP_010093468.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    162   8e-43   
gb|EPS67739.1|  hypothetical protein M569_07035                         162   1e-42   
ref|XP_004493180.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    162   1e-42   
ref|XP_006471699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    162   1e-42   
gb|KHN16248.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    162   1e-42   
ref|XP_003580078.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    162   1e-42   
gb|KHN39742.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    161   1e-42   
ref|XP_004976123.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    161   2e-42   
ref|XP_003539366.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    162   2e-42   
dbj|BAJ95750.1|  predicted protein                                      160   3e-42   
ref|XP_009146509.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    160   3e-42   
dbj|BAJ93247.1|  predicted protein                                      160   3e-42   
ref|XP_006652479.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    160   4e-42   
dbj|BAC78633.1|  hydroxyanthranilate hydroxycinnamoyltransferase 1      160   5e-42   
ref|XP_007011894.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    161   5e-42   
ref|XP_010500344.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    160   6e-42   
sp|G0LD36.1|RAS_MELOI  RecName: Full=Rosmarinate synthase; Short=...    159   7e-42   
dbj|BAO20883.1|  hydroxycinnamoyl CoA: shikimate hydroxycinnamoyl...    160   7e-42   
ref|XP_008790160.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    159   7e-42   
emb|CDY22880.1|  BnaA01g18180D                                          159   7e-42   
ref|NP_001145871.1|  uncharacterized protein LOC100279386               159   8e-42   
ref|XP_003551902.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    159   1e-41   
ref|XP_006303767.1|  hypothetical protein CARUB_v10011977mg             159   1e-41   
ref|XP_010479240.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    159   2e-41   
ref|XP_006465262.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    158   2e-41   
gb|EPS61293.1|  hypothetical protein M569_13504                         158   2e-41   
gb|ACG47161.1|  anthranilate N-benzoyltransferase protein 2             158   2e-41   
ref|XP_007161962.1|  hypothetical protein PHAVU_001G112400g             158   3e-41   
ref|XP_002446745.1|  hypothetical protein SORBIDRAFT_06g021640          158   3e-41   
ref|XP_010462493.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    157   4e-41   
ref|XP_010480194.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    157   4e-41   
ref|XP_009366046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    157   4e-41   
emb|CDY05770.1|  BnaC07g00330D                                          157   4e-41   
ref|XP_010501253.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    157   4e-41   
gb|KFK35521.1|  hypothetical protein AALP_AA4G001700                    157   4e-41   
ref|XP_007027324.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    157   5e-41   
ref|XP_006453163.1|  hypothetical protein CICLE_v10010833mg             157   6e-41   
ref|XP_009394928.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    157   7e-41   
gb|AJA31666.1|  rosmarinic acid synthase                                157   8e-41   
ref|NP_001047408.1|  Os02g0611800                                       157   9e-41   
gb|AGW27209.1|  rosmarinic acid synthase 4                              156   9e-41   
ref|XP_009102018.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    156   1e-40   
emb|CDY31956.1|  BnaA07g00390D                                          156   1e-40   
ref|XP_010672786.1|  PREDICTED: anthranilate N-benzoyltransferase...    155   1e-40   
gb|KHG19404.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    156   1e-40   
ref|XP_008228885.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    155   2e-40   
ref|XP_006307576.1|  hypothetical protein CARUB_v10009198mg             156   2e-40   
gb|EPS64937.1|  hypothetical protein M569_09840                         155   2e-40   
ref|XP_007214866.1|  hypothetical protein PRUPE_ppa019948mg             156   2e-40   
ref|XP_002991534.1|  probable hydroxycinnamoyl transferase              156   2e-40   
ref|XP_008777439.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    155   2e-40   
gb|ADA60182.1|  rosmarinic acid synthase                                155   2e-40   
gb|AFF19202.1|  BAHD acyltransferase                                    155   2e-40   
ref|XP_007161963.1|  hypothetical protein PHAVU_001G112500g             155   3e-40   
ref|XP_006474074.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    155   3e-40   
ref|XP_003624650.1|  Anthranilate N-benzoyltransferase protein          155   3e-40   
ref|XP_009409799.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    155   3e-40   
ref|NP_001053225.1|  Os04g0500700                                       155   3e-40   
ref|XP_006486096.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    155   3e-40   
ref|XP_002529384.1|  Taxadien-5-alpha-ol O-acetyltransferase, put...    154   4e-40   
ref|XP_004149124.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    155   5e-40   
gb|AFK10218.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    154   6e-40   
gb|AGH61997.1|  rosmarinic acid synthase                                154   7e-40   
ref|XP_002979061.1|  probable hydroxycinnamoyltransferase               154   8e-40   
ref|XP_003548720.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    154   9e-40   
ref|XP_009366045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    154   9e-40   
dbj|BAN10302.1|  hydroxycinnamoyl-Coenzyme A shikimate/quinate hy...    149   1e-39   
ref|NP_199704.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyc...    154   1e-39   
emb|CDG56250.1|  hydroxycinnamoyl-CoA:hydroxyphenyllactate hydrox...    154   1e-39   
ref|XP_003624644.1|  Anthranilate N-benzoyltransferase protein          154   1e-39   
gb|AES80862.2|  spermidine hydroxycinnamoyl transferase                 154   1e-39   
gb|EMS60258.1|  Anthranilate N-benzoyltransferase protein 1             154   1e-39   
gb|EPS67512.1|  hypothetical protein M569_07262                         153   2e-39   
ref|XP_007156887.1|  hypothetical protein PHAVU_002G025600g             153   2e-39   
sp|A0PDV5.1|RAS_PLESU  RecName: Full=Rosmarinate synthase; Short=...    153   2e-39   
gb|AAM61215.1|  anthranilate N-benzoyltransferase                       153   2e-39   
ref|XP_003624649.1|  Anthranilate N-benzoyltransferase protein          153   2e-39   
ref|XP_010672789.1|  PREDICTED: anthranilate N-benzoyltransferase...    153   3e-39   
ref|XP_007099550.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    150   3e-39   
gb|AGW27208.1|  rosmarinic acid synthase 3                              152   4e-39   
ref|XP_010533496.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    152   4e-39   
ref|XP_006474075.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    152   4e-39   
ref|XP_002894568.1|  transferase family protein                         151   6e-39   
ref|XP_006392548.1|  hypothetical protein EUTSA_v10011497mg             151   7e-39   
ref|XP_009409797.1|  PREDICTED: uncharacterized protein LOC103991972    155   7e-39   
ref|XP_008223321.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    151   1e-38   
ref|XP_009399564.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    151   1e-38   
gb|KHG08871.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    150   1e-38   
ref|XP_010672790.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    150   2e-38   
ref|XP_010942060.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    150   2e-38   
ref|XP_004294955.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    150   2e-38   
ref|XP_010672788.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    150   3e-38   
gb|ACG29714.1|  anthranilate N-benzoyltransferase protein 1             149   4e-38   
ref|XP_002303858.2|  hypothetical protein POPTR_0003s18210g             147   5e-38   
ref|XP_007011897.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    146   1e-37   
gb|EMT15624.1|  Anthranilate N-benzoyltransferase protein 1             148   1e-37   
ref|XP_002452435.1|  hypothetical protein SORBIDRAFT_04g025760          148   1e-37   
ref|XP_006401163.1|  hypothetical protein EUTSA_v10013552mg             148   1e-37   
ref|XP_010545859.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    148   1e-37   
ref|XP_009132104.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    148   2e-37   
ref|NP_001132890.1|  LOC100194386                                       148   2e-37   
sp|O24645.1|HCBT1_DIACA  RecName: Full=Anthranilate N-benzoyltran...    147   3e-37   
ref|XP_006474077.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    145   3e-37   
ref|XP_010942061.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    147   3e-37   
ref|XP_008231077.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    147   3e-37   
ref|XP_008790158.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    147   3e-37   
gb|KHN14246.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    142   3e-37   
gb|EYU24587.1|  hypothetical protein MIMGU_mgv1a006602mg                147   4e-37   
ref|XP_003548723.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    147   5e-37   
ref|XP_010045760.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    146   6e-37   
ref|XP_003580168.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    146   7e-37   
emb|CDX88644.1|  BnaA03g10050D                                          146   8e-37   
ref|XP_004953073.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    147   8e-37   
gb|KHN46762.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    146   9e-37   
emb|CDX88645.1|  BnaA03g10040D                                          145   1e-36   
gb|AEA36976.1|  rosmarinic acid synthase                                146   1e-36   
gb|AEN02914.1|  HCT1                                                    142   1e-36   
ref|XP_009132100.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    145   1e-36   
sp|O23917.1|HCBT2_DIACA  RecName: Full=Anthranilate N-benzoyltran...    145   2e-36   
gb|ABI48360.1|  putative alcohol acyltransferase 1                      145   2e-36   
ref|XP_010545447.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    144   2e-36   
ref|XP_011073101.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    144   3e-36   
gb|EAZ23787.1|  hypothetical protein OsJ_07497                          145   3e-36   
gb|AGM90558.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    144   3e-36   
ref|XP_007215405.1|  hypothetical protein PRUPE_ppa005943mg             144   3e-36   
ref|XP_010547371.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    144   3e-36   
ref|XP_010667050.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    144   4e-36   
ref|XP_003578558.1|  PREDICTED: agmatine coumaroyltransferase-2-like    144   4e-36   
gb|KCW60630.1|  hypothetical protein EUGRSUZ_H03354                     144   4e-36   
emb|CAE01635.3|  OSJNBa0029H02.19                                       144   4e-36   
ref|XP_011073100.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    144   4e-36   
ref|XP_010024179.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    144   5e-36   
ref|XP_010667049.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    144   5e-36   
ref|XP_003578556.1|  PREDICTED: agmatine coumaroyltransferase-2-like    144   5e-36   
sp|O23918.1|HCBT3_DIACA  RecName: Full=Anthranilate N-benzoyltran...    144   6e-36   
ref|XP_004304535.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    143   7e-36   
ref|XP_002969244.1|  BAHD family acyltransferase, clade IV              144   8e-36   
ref|XP_004304536.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    143   8e-36   
dbj|BAJ89730.1|  predicted protein                                      143   8e-36   
ref|XP_009375174.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    143   1e-35   
gb|AEV93472.1|  hydroxycinnamoyl transferase                            139   1e-35   
ref|XP_009378002.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    143   1e-35   
dbj|BAJ91746.1|  predicted protein                                      143   1e-35   
ref|XP_009383405.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    142   1e-35   
ref|XP_003569241.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    142   1e-35   
ref|XP_008341279.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    142   2e-35   
ref|XP_007011893.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    141   2e-35   
emb|CAB06428.1|  anthranilate N-hydroxycinnamoyl/benzoyltransferase     142   2e-35   
ref|XP_009379971.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    142   2e-35   
dbj|BAK03392.1|  predicted protein                                      142   2e-35   
ref|XP_007217854.1|  hypothetical protein PRUPE_ppa024073mg             141   3e-35   
gb|EMT08585.1|  Anthranilate N-benzoyltransferase protein 1             141   4e-35   
ref|XP_009344220.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    141   4e-35   
ref|XP_010031392.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    141   5e-35   
emb|CDO98678.1|  unnamed protein product                                140   5e-35   
ref|XP_010911178.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    141   6e-35   
ref|XP_010110923.1|  Omega-hydroxypalmitate O-feruloyl transferase      140   7e-35   
gb|ABR16192.1|  unknown                                                 140   9e-35   
ref|XP_006347627.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    140   1e-34   
ref|XP_004235315.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    140   1e-34   
ref|XP_010538049.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    140   1e-34   
ref|XP_008777438.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    139   2e-34   
ref|XP_002866234.1|  transferase family protein                         139   2e-34   
gb|AFU82547.1|  hydroxycinnamoyl CoA quinate transferase                134   2e-34   
ref|XP_002960602.1|  BAHD family acyltransferase, clade IV              140   2e-34   
emb|CDY11845.1|  BnaC03g12710D                                          142   2e-34   
ref|XP_008379094.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    139   2e-34   
gb|AGW27210.1|  rosmarinic acid synthase 5                              139   2e-34   
ref|XP_006478316.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    139   3e-34   
gb|EYU24607.1|  hypothetical protein MIMGU_mgv1a006502mg                139   3e-34   
ref|XP_010911018.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    136   3e-34   
ref|NP_001275190.1|  feruloyl transferase                               139   3e-34   
ref|XP_004295153.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    139   3e-34   
ref|XP_008778437.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    138   4e-34   
gb|EYU24606.1|  hypothetical protein MIMGU_mgv1a005249mg                139   5e-34   
ref|XP_002268922.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    138   6e-34   
ref|XP_008804093.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    138   6e-34   
ref|XP_008791113.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    138   7e-34   
emb|CAN61656.1|  hypothetical protein VITISV_017126                     138   7e-34   
gb|EAZ09943.1|  hypothetical protein OsI_32242                          138   7e-34   
ref|NP_001063828.1|  Os09g0543900                                       137   7e-34   
ref|XP_010023895.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    137   8e-34   



>ref|XP_009628063.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Nicotiana 
tomentosiformis]
Length=448

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/279 (53%), Positives = 193/279 (69%), Gaps = 15/279 (5%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            VL+EAE++A L DLGDFSP P+ N L P VDY+  PI ++PL   QLTKF+CGGI+L FA
Sbjct  95   VLMEAETEAKLDDLGDFSPSPDSNSLFPRVDYT-IPIDELPLLFVQLTKFQCGGIALSFA  153

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            ISH V DG    +FL+EWA+LA G+PL + PFHDR+ L  G    + P       F+H  
Sbjct  154  ISHAVVDGQSALYFLTEWASLARGEPLGNEPFHDRKFLRAGEPPIAYP------TFEHLQ  207

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
               PPL++GQSS E E+  ETK S L+L+K Q+  L+  AN G     + R YTR+EV+T
Sbjct  208  FNPPPLLLGQSSSEEEKKNETKGSMLKLTKHQVEMLRKKANQGN----QGRSYTRYEVVT  263

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
            AHIWRC CKAR HK +QPT LC  V+IR  M+PPLP SYFGNA+++V+  GVSG+I SRP
Sbjct  264  AHIWRCVCKARGHKFEQPTNLCICVNIRNIMQPPLPKSYFGNAIVDVIANGVSGDITSRP  323

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            L+ VA ++R AI  VTS+Y N  IDF +N+ D+ K Q++
Sbjct  324  LEYVARRVRAAIKMVTSDYANSTIDFLKNQEDLSKYQDI  362



>ref|XP_011092043.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Sesamum 
indicum]
Length=464

 Score =   294 bits (753),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 145/278 (52%), Positives = 190/278 (68%), Gaps = 11/278 (4%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
            L+EA  +A L DLGD +P P   +L+P ++Y   PI++IPL   QLTKFRCGGISL + I
Sbjct  98   LIEAHCEATLNDLGDLTPSPHFRYLIPQINYMV-PIEEIPLLCVQLTKFRCGGISLSYTI  156

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS--  469
            SH VADG    HF+SEWA LA GKPL +APF DR+ L  G   S+ P+      F H+  
Sbjct  157  SHAVADGQSAFHFISEWARLARGKPLRTAPFLDRKLLRAGEPPSAQPR------FKHAQF  210

Query  468  --PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PPL++GQSS E+E  KET ++  +LSK Q+  LK  AN  R+ + + R YTR+E + A
Sbjct  211  DPPPLLIGQSSSENEWKKETTITMFKLSKIQVEMLKNEANRTRACDRRVRAYTRYESMAA  270

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            HIWRC+CKAR H  +QPT +   VDIRRRM+PPLPD +FGNAV++V+    SGE+++RPL
Sbjct  271  HIWRCSCKARRHVHKQPTAMVICVDIRRRMKPPLPDKFFGNAVVDVIATSFSGELMTRPL  330

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
               A KIR+AID VTSEYV+ AIDF +N  D  + Q++
Sbjct  331  GYAAGKIREAIDSVTSEYVHSAIDFLKNLKDFSRLQDI  368



>ref|XP_011077685.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Sesamum 
indicum]
Length=464

 Score =   291 bits (745),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 142/278 (51%), Positives = 190/278 (68%), Gaps = 11/278 (4%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
            L+EA  +A L DLGD +P P  ++L+P ++Y   PI++IPL   QLTKF+CGGISL + I
Sbjct  98   LIEAHCEATLNDLGDLTPSPHFHYLIPQINYMV-PIEEIPLLCAQLTKFQCGGISLSYTI  156

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS--  469
            SH VADG    HF+SEWA LA G+PL +APF DR+ L  G   S+ P+      F H+  
Sbjct  157  SHAVADGQSALHFISEWARLARGEPLQTAPFLDRKLLRAGEPPSAQPR------FKHAQF  210

Query  468  --PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PPL++GQSS E+E  KET ++  +LSK Q+  LK  AN  R+ + + R YTR+E I A
Sbjct  211  DPPPLLIGQSSSENESKKETTITMFKLSKIQVEMLKNEANRTRACDRRVRAYTRYESIAA  270

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            HIWRC+CKAR H  +QPT +   VDIRRRM+PPLP+ +FGNA+++V+    SGE+++RPL
Sbjct  271  HIWRCSCKARRHVHEQPTAMGICVDIRRRMKPPLPEKFFGNAIVDVIATSFSGELMTRPL  330

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
               A KIR+AID VTSEYV+ AIDF +N  D    Q++
Sbjct  331  GYAAGKIREAIDSVTSEYVHSAIDFLKNLKDFSMLQDI  368



>ref|XP_009787025.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Nicotiana 
sylvestris]
Length=448

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 145/279 (52%), Positives = 191/279 (68%), Gaps = 15/279 (5%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            V  EAE++A L DLGDFSP P+ N L P VDY+  PI ++PL   QLTKF+C G++L FA
Sbjct  95   VFTEAETEAKLDDLGDFSPSPDSNSLFPRVDYT-IPIDELPLLFVQLTKFQCSGVALSFA  153

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            ISH V DG    +FL+EWA+LA G+PL + PFHDRR L  G    +SP       F+H  
Sbjct  154  ISHAVVDGQSALYFLTEWASLARGEPLGNEPFHDRRLLRAGEPPIASP------TFEHLQ  207

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
               PPL++G+SS E E+  ETK S L+L+K Q+  L+  AN G     + R YTR+EV+T
Sbjct  208  FNQPPLLLGKSSSEEEKKNETKGSMLKLTKNQVEMLRKKANQGN----QGRSYTRYEVVT  263

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
            AHIWRCACKAR HK +QPT LC  V+IR+ M+P LP S+FGNA+++V+  GVSG+I SRP
Sbjct  264  AHIWRCACKARGHKFEQPTNLCICVNIRKIMQPHLPKSFFGNAIVDVIANGVSGDITSRP  323

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            L+  A ++R AI  VTS+Y N  IDF +N+ D+ K Q++
Sbjct  324  LEYAARRVRAAIKIVTSDYANSTIDFLKNQEDLSKYQDI  362



>ref|XP_006359722.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Solanum 
tuberosum]
Length=451

 Score =   288 bits (737),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 143/280 (51%), Positives = 194/280 (69%), Gaps = 12/280 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            VL EAE+DA L +L DF   P+ N L P VDY+  PI ++PL   QLTKF+CGGI+L FA
Sbjct  93   VLTEAEADAKLDNLTDFLLSPDYNSLFPRVDYTV-PIDELPLLFVQLTKFQCGGIALSFA  151

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS-  469
            ISH V DG    +F SEWA LA G+PL  AP HDR+ L  G    +SP       F+H  
Sbjct  152  ISHAVVDGQSALYFFSEWARLARGEPLMFAPCHDRKLLRAGEPAVASP------TFEHLQ  205

Query  468  ---PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSY-NAKPRGYTRFEVI  301
               PPL++G+SS E+E+ KETK + L+L+K Q+  L+  AN GRS  ++K R YTR+EV+
Sbjct  206  FNIPPLLIGKSSTENEKKKETKGAMLKLTKLQVEMLREKANQGRSIEDSKERSYTRYEVV  265

Query  300  TAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISR  121
            TAHIWRCACKAR HK +QPT LC  V+IR++M+PPLP++YFGNA+++V+  G SG+I S 
Sbjct  266  TAHIWRCACKARGHKFEQPTNLCICVNIRKKMDPPLPNTYFGNAIVDVIATGASGDIASS  325

Query  120  PLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            PL+  A ++R+AI+ VTS+Y N  I+F + + D+   Q++
Sbjct  326  PLECAAKRVREAINMVTSDYANSTINFLKKQEDLSIYQDI  365



>ref|XP_004243059.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Solanum lycopersicum]
Length=451

 Score =   281 bits (720),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/280 (49%), Positives = 193/280 (69%), Gaps = 12/280 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            VL EAE+DA L +L DF   P+ N L P VDY+ + I ++PL   QLTKF+CGGI+L FA
Sbjct  93   VLTEAEADAKLDNLTDFLLSPDYNSLFPRVDYTVE-INELPLLFVQLTKFQCGGIALSFA  151

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            ISH V DG    +F SEWA +A G+PL  +P HDR+ L  G   ++SP       F+H  
Sbjct  152  ISHAVVDGQSALYFFSEWARIARGEPLMFSPCHDRKLLRAGEPANASP------TFEHLQ  205

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSY-NAKPRGYTRFEVI  301
              +PPL++G+SS E+E+ K TK + L+L+K Q+  L+  AN GR   ++K R YTR+EV+
Sbjct  206  FNTPPLLIGKSSTENEKKKTTKGAMLKLTKHQVEMLREKANQGRCLEDSKERSYTRYEVV  265

Query  300  TAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISR  121
            TAHIWRCACKAR HK +QPT LC  V+IR++M PPLP++YFGNA+++V+  G SG+I S 
Sbjct  266  TAHIWRCACKARGHKFEQPTNLCICVNIRQKMNPPLPNTYFGNAIVDVIATGASGDIASS  325

Query  120  PLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            PL+  A ++R+AI+ VTS+Y N  I+F + + D+   Q++
Sbjct  326  PLECAAKRVREAINMVTSDYANSTINFLKKQEDLSIYQDI  365



>ref|XP_002521543.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF40814.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=449

 Score =   280 bits (717),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 139/278 (50%), Positives = 186/278 (67%), Gaps = 12/278 (4%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
            L+EAES + L DLGDFSP P  N+L+P VDY+  PI + PL + QLTKF+CGG+SL  +I
Sbjct  96   LIEAESQSKLEDLGDFSPSPAFNYLIPPVDYT-LPIHEQPLMLVQLTKFQCGGVSLSLSI  154

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS--  469
            SH VADG    HF+SEWA +A G+ L   PF DR+ L  G      P      VFDH   
Sbjct  155  SHTVADGQSALHFISEWARMARGEHLGIVPFLDRKVLRAGNAPMEEP------VFDHKEF  208

Query  468  --PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PPL++G+S++  +R K+T V+ L+L+K Q+  LK  AN G S +   R YTR+E +T 
Sbjct  209  NHPPLLLGESNNLEQRKKKTTVAMLKLTKDQVDKLKRKANEGMSVDTG-RAYTRYETLTG  267

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            H+WR ACKAR H+P QPT L   VD+R+RM+P LPD YFGNA I+V+    SGE+I++PL
Sbjct  268  HVWRSACKARGHQPGQPTALGVCVDLRKRMQPHLPDGYFGNATIDVIAISTSGELITKPL  327

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
               + KIR+AI+ VT+EYVN AI F + + D+ + Q+L
Sbjct  328  GYASGKIREAIEKVTNEYVNSAIAFLKKQKDLTRFQDL  365



>ref|XP_010050942.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Eucalyptus 
grandis]
 gb|KCW80898.1| hypothetical protein EUGRSUZ_C02267 [Eucalyptus grandis]
Length=457

 Score =   280 bits (717),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 140/278 (50%), Positives = 188/278 (68%), Gaps = 8/278 (3%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
            L+EAES+  L DLGDF P  E   +VPSVDY+  PI ++PL + Q+TKF+CGG++L   I
Sbjct  98   LIEAESEGTLNDLGDFCPSQEFEQIVPSVDYT-TPIHELPLLLVQVTKFKCGGLALSTTI  156

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS--  469
            SH VADG    HF++EWA LA G+PLS  P++DR+ L   VGE  S    P    +HS  
Sbjct  157  SHAVADGPSATHFMNEWARLARGEPLSVEPYYDRKVLW--VGEDPSGVLLPPPNLEHSEF  214

Query  468  --PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PPL++G + +  +RMK+T ++ L+L+K Q+ +LK AAN  R+ N  PR YTR+E + A
Sbjct  215  NHPPLLIGHTKNLEQRMKKTTMALLKLTKTQVESLKKAANKDRACN-NPRPYTRYETMAA  273

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            HIWRCACKAR HKP+QPT LC  VD R R++PPL   YFGNA  +VV  G SGE++S PL
Sbjct  274  HIWRCACKARKHKPEQPTVLCICVDARSRLQPPLKPGYFGNATFDVVAAGTSGELVSSPL  333

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            +  +SKIR+AI+ VT E+V   I+  R + D+   Q+L
Sbjct  334  RCTSSKIREAIEAVTYEHVKSTIEHIRRQPDLTMFQDL  371



>ref|XP_002269790.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Vitis vinifera]
 emb|CBI40129.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 145/278 (52%), Positives = 184/278 (66%), Gaps = 12/278 (4%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
            L+EAES A L D GDF+P P+L  LVP V+Y+  PI ++PL + QLTKF CGGISLG +I
Sbjct  97   LIEAESQATLDDFGDFAPSPDLESLVPCVNYNS-PIHELPLMLVQLTKFSCGGISLGTSI  155

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS--  469
            SH VADG    HF+ EWA LA G+PL + PF DR+ L  G     SP   P   FDH+  
Sbjct  156  SHAVADGQSALHFIDEWARLARGEPLGTPPFLDRKVLRAG----DSPIAPP--CFDHAEF  209

Query  468  --PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PPL++G SS   ER K T VS L+L+K Q+  LK  AN+ R      R Y+R+E I A
Sbjct  210  SHPPLLMGASSTVEERKKGTTVSLLKLTKTQVERLKKMANDSRPTECG-RPYSRYETIAA  268

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            HIWRCAC AR HKP+QPT +   +D R RM PPLP  YFGNA ++V+  G SGE++S+PL
Sbjct  269  HIWRCACNARGHKPEQPTAIGICIDSRSRMRPPLPQGYFGNATLDVIATGRSGELVSKPL  328

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
               +S+IR AI+ VT EYV  AIDF +N+ D+ + Q+L
Sbjct  329  GYASSRIRAAIEKVTDEYVWSAIDFLKNQPDLSQFQDL  366



>ref|XP_010467740.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Camelina 
sativa]
Length=451

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/278 (49%), Positives = 181/278 (65%), Gaps = 9/278 (3%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAES+  L+D  +FSP PE  +L+P V+Y  +PI+ IPLF+ QLTKF+CGG+SL   I
Sbjct  95   FIEAESEGKLSDFENFSPTPEFENLMPQVNYK-NPIETIPLFLAQLTKFKCGGLSLSVNI  153

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH---  472
            SH + DG    HF+SEWA LA G+PL + PF DR+ L    GE   P   P + FDH   
Sbjct  154  SHAIVDGQSALHFISEWARLARGEPLETVPFLDRKILW--AGEPLPPFASPPK-FDHKEF  210

Query  471  -SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PP ++G+  +  ER K+T V+ L+LSKPQ+  L++ AN G  Y    RG+TR+E +T 
Sbjct  211  DQPPFLIGEKDNVEERKKKTIVAMLKLSKPQLEKLRSKAN-GSKYADPSRGFTRYETVTG  269

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            H+WRCACKAR H P+QPT L   +D R RM+PPLP  YFGNA ++VV    SGE+IS  L
Sbjct  270  HVWRCACKARGHSPEQPTALGICIDTRSRMQPPLPRGYFGNATLDVVAASTSGELISNEL  329

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
               AS I  AI  VT+EYV   I++ +N+ D+ K Q+L
Sbjct  330  GFAASLISKAIKNVTNEYVMIGIEYLKNQEDLKKFQDL  367



>ref|XP_007211620.1| hypothetical protein PRUPE_ppa005563mg [Prunus persica]
 gb|EMJ12819.1| hypothetical protein PRUPE_ppa005563mg [Prunus persica]
Length=454

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/276 (47%), Positives = 183/276 (66%), Gaps = 4/276 (1%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAESD+ L D GDFSP PE ++L+P+VDY+  PI ++P+ + QLT+F+CGG+SL   I
Sbjct  96   FIEAESDSKLDDFGDFSPSPEYDYLIPTVDYTL-PIHELPILLVQLTRFKCGGLSLSLTI  154

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSPP  463
            SH V DG    HF+SEWA LA G+P+   PF DR+        + +  G      DH PP
Sbjct  155  SHAVVDGQSALHFISEWARLAKGEPIGVMPFLDRKAFQDRTLPAGNTLGLDHSELDH-PP  213

Query  462  LIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSY--NAKPRGYTRFEVITAHI  289
            L++GQS +  ERMK T V+ L+L+K Q+  LK  AN G  Y  +   R YTR+E +  HI
Sbjct  214  LLLGQSDNIEERMKRTTVAMLKLTKQQVEKLKRMANEGNDYKNSGTKRAYTRYETVAGHI  273

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCA KAR H+ +QPT +   VD R RM+PPLP  YFGNA  +V+   ++G+++S+PL  
Sbjct  274  WRCASKARVHRNEQPTAMGVCVDSRSRMQPPLPQGYFGNATFDVIATSLAGDLVSKPLGY  333

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
             +S+I++AI+ VT++YV  AID +RN+ D+ + Q+L
Sbjct  334  ASSRIKEAIEKVTNDYVMSAIDHFRNQPDLTRFQDL  369



>gb|KFK40283.1| hypothetical protein AALP_AA3G354800 [Arabis alpina]
Length=451

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 135/279 (48%), Positives = 178/279 (64%), Gaps = 9/279 (3%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
              +EAES+AVL D  D+SP PE   L+P V+Y  +PI+ IPL + QLTKF+CGG+SLG  
Sbjct  94   TFIEAESEAVLTDFNDYSPTPEFEKLMPQVNYK-NPIETIPLVLAQLTKFKCGGLSLGVN  152

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            +SH V DG    HFLSEW  +A  + + + PF DR+ L    GE   P   P R FDH  
Sbjct  153  LSHAVVDGLSALHFLSEWGRIARSEAIETVPFLDRKILW--AGEPLPPFASPPR-FDHKE  209

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
               PPL++G+  +  ER K+T V+ L+LSK Q+  LK+  N  + Y    RG+TR+E +T
Sbjct  210  FEQPPLLLGEKDNVEERKKKTTVAMLKLSKSQLEKLKSIVNTSK-YADPARGFTRYETVT  268

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             H+WRCACKAR H P+QPT +   VDIR RM+PPLP  YFGNA ++VV    SGE+IS  
Sbjct  269  GHVWRCACKARGHSPEQPTAIGICVDIRNRMQPPLPRGYFGNATLDVVAASTSGELISNE  328

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            L   A KI  AI  VT+EYV   I++ +N+ D+ K Q+L
Sbjct  329  LGFAAEKISKAIKNVTNEYVMIGIEYLKNQDDLKKFQDL  367



>ref|XP_008223800.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Prunus 
mume]
Length=462

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/280 (47%), Positives = 185/280 (66%), Gaps = 12/280 (4%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAESD+ L DLGDFSP PE ++++P+VDY+  PI ++P+ + QLT+FRCGG+SLG  I
Sbjct  96   FIEAESDSKLDDLGDFSPSPEYDYIIPTVDYT-LPIHELPILLVQLTRFRCGGLSLGLTI  154

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP-  466
            SH V DG    HF+SEWA LA G+P+   PF DR+       ++ +   G     DHS  
Sbjct  155  SHAVVDGQSTFHFISEWARLAKGEPIGVMPFLDRKAF-----QARTLPAGNTLGLDHSEL  209

Query  465  ---PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYN--AKPRGYTRFEVI  301
               PL++GQS +  ER K+T V+ L+L+K Q+  LK  AN G  YN     RGYTR+E +
Sbjct  210  DRLPLLLGQSDNIEERKKKTTVAMLKLTKQQVEKLKRMANEGNDYNNSGTKRGYTRYETV  269

Query  300  TAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISR  121
              HIWRCA KAR H+ +QPT +   VD+R RM PPLP  YFGNA    V   ++G+++S+
Sbjct  270  AGHIWRCASKARVHRNEQPTAMGVCVDLRSRMLPPLPQGYFGNATFYGVARSLAGDLVSK  329

Query  120  PLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            PL   +S+IR+AI+ V+++YV  AID +RN+ D+ + Q+L
Sbjct  330  PLGYASSRIREAIEKVSNDYVLSAIDHFRNQPDLTRFQDL  369



>ref|XP_010489453.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Camelina 
sativa]
Length=451

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/276 (48%), Positives = 180/276 (65%), Gaps = 5/276 (2%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAES+  L+D  DFSP PE  +L+P V+Y  +PI+ IPLF+ QLT+F+CGG+SL   I
Sbjct  95   FIEAESEGKLSDFKDFSPTPEFENLMPQVNYK-NPIETIPLFLAQLTRFKCGGLSLSVNI  153

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRG--VGESSSPQGGPRRVFDHS  469
            SH + DG    HF+SEWA LA G+PL + PF DR+ L  G  +   +SP     + FD  
Sbjct  154  SHAIVDGQSALHFISEWARLARGEPLETVPFLDRKILWAGEPLPPFASPPKFGHKEFDQ-  212

Query  468  PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            PP ++G+  +  ER K+T V+ L+LSK Q+  L++ AN G  Y    RG+TR+E +T H+
Sbjct  213  PPFLIGEKDNVEERKKKTIVAMLKLSKSQLEKLRSKAN-GSKYADPSRGFTRYETVTGHV  271

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCACKAR H P+QPT L   +D R RM+PPLP  YFGNA ++VV    SGE+IS  L  
Sbjct  272  WRCACKARGHSPEQPTALGICIDTRSRMQPPLPRGYFGNATLDVVAASTSGELISNELGF  331

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
             AS I  AI  VT+EY+   I++ +N+ D+ K Q+L
Sbjct  332  AASLISKAIKNVTNEYMMIGIEYLKNQEDLKKFQDL  367



>ref|XP_004301782.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Fragaria 
vesca subsp. vesca]
Length=465

 Score =   268 bits (686),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 141/287 (49%), Positives = 188/287 (66%), Gaps = 16/287 (6%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             VEAES++ L D GD SP PE N+LVP+VDYS  PI ++PL + QLT+F+CGG+SL   I
Sbjct  96   FVEAESNSKLEDFGDLSPSPEYNYLVPTVDYSL-PIHELPLLLVQLTRFKCGGVSLSLTI  154

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS--  469
            SH V DG    HF+SEWA LA G+PL   PF DR+ +++G  + ++P        DHS  
Sbjct  155  SHAVVDGPSALHFISEWARLARGEPLEVTPFLDRK-VMQG-RDDNTPAAAKPLPLDHSEF  212

Query  468  --PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRS-YN--------AKPRG  322
              PPL++GQS +  ER K+T VS LRL K Q+  LK  AN+    YN         K  G
Sbjct  213  DQPPLLLGQSDNVEERKKKTIVSMLRLRKDQLEKLKCIANDSYDLYNNSSSAGSTTKRGG  272

Query  321  YTRFEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGV  142
            YTR+E ++ HIWRCACKAR HK +QPT L   VD R RM+PPLP  YFGNA  +V+    
Sbjct  273  YTRYETVSGHIWRCACKARKHKAEQPTALGVCVDSRSRMQPPLPQGYFGNATFDVIATSH  332

Query  141  SGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            SGE++S+PL   AS+IR+AI+ V+++YV  AI+  +N+ D+ + Q+L
Sbjct  333  SGELVSKPLGYAASRIREAIEKVSNDYVLSAIENMKNQPDLTRFQDL  379



>ref|XP_006453312.1| hypothetical protein CICLE_v10008265mg [Citrus clementina]
 ref|XP_006474222.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Citrus 
sinensis]
 gb|ESR66552.1| hypothetical protein CICLE_v10008265mg [Citrus clementina]
Length=452

 Score =   266 bits (679),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/274 (52%), Positives = 181/274 (66%), Gaps = 4/274 (1%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
            LVEAES A L DLGD SP PE N+LVP+VDY+  PIQ++PL + QLT+F+CGGISL F I
Sbjct  98   LVEAESRAKLQDLGDLSPRPEYNYLVPAVDYT-LPIQELPLVLVQLTRFQCGGISLSFTI  156

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSPP  463
            SH VADG    HF+ EWA +A  +PL   PF DR+ L  G    S P       FDH PP
Sbjct  157  SHAVADGPSALHFIFEWARIARREPLGLPPFLDRKVLQAGEPPVSYPLLD-HAEFDH-PP  214

Query  462  LIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIWR  283
            L++GQ+ +  ER K T VS L+LS+ Q+  LK  AN G   N   R ++R+E +T H+WR
Sbjct  215  LLIGQTDNIEERKKMTTVSMLKLSEIQVKKLKNMANEGHC-NDIGRPFSRYETVTGHLWR  273

Query  282  CACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDVA  103
            CACKAR HK +Q T L   VD R RM+PPLP  YFGNA ++V+    SGE++S+PL   +
Sbjct  274  CACKARGHKAEQTTALGVCVDSRSRMQPPLPLGYFGNATLDVIALSRSGELVSKPLGYAS  333

Query  102  SKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            SKIR AI  VT EYV   I++ +N+ D+ K Q+L
Sbjct  334  SKIRRAIVSVTEEYVRSGIEYLKNQPDLTKFQDL  367



>ref|XP_002884178.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60437.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=451

 Score =   265 bits (678),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 178/278 (64%), Gaps = 9/278 (3%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAES+  L+D  DFSP PE  +L+P V+Y  +PI+ IPLF+ QLTKF+CGG+SL   +
Sbjct  95   FIEAESEGKLSDFKDFSPTPEFENLMPQVNYK-NPIETIPLFLAQLTKFKCGGLSLSVNV  153

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH---  472
            SH + DG    H +SEW  LA G+PL + PF DR+ L    GE   P   P + FDH   
Sbjct  154  SHAIVDGQSALHLISEWGRLARGEPLETVPFLDRKILW--AGEPLPPFESPPK-FDHKEF  210

Query  471  -SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PP ++G++ +  ER K+T V  L+LSK Q+  L++ AN  + Y    +G+TR+E +T 
Sbjct  211  DQPPFLIGETDNVEERKKKTIVVMLKLSKSQLEKLRSKANASK-YADPAKGFTRYETVTG  269

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            H+WRCACKAR H P+QPT L   +D R RM+PPLP  YFGNA ++VV    SGE+IS  L
Sbjct  270  HVWRCACKARGHSPEQPTALGICIDTRSRMQPPLPRGYFGNATLDVVAASTSGELISNEL  329

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
               AS I  AI  VT+EYV   I++ +N+ D+ K Q+L
Sbjct  330  GFAASLISKAIKNVTNEYVMIGIEYLKNQEDLKKFQDL  367



>ref|XP_010034869.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Eucalyptus 
grandis]
 gb|KCW53925.1| hypothetical protein EUGRSUZ_J03136 [Eucalyptus grandis]
Length=458

 Score =   265 bits (678),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 132/278 (47%), Positives = 187/278 (67%), Gaps = 7/278 (3%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
            L+EAES+A L+DLGDF P PE   +VPS+DY+  P  ++PL + Q+TKF+CGG++LG +I
Sbjct  98   LIEAESEAELSDLGDFCPGPEYEQIVPSLDYTM-PFHELPLLLVQVTKFKCGGLALGVSI  156

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH---  472
            SHVV DG    +FL EWA LA G+PL+  P+ D++ L  G  + SS    P  + +H   
Sbjct  157  SHVVTDGLSATYFLDEWARLARGEPLNVEPYFDKKVLWAGEEDPSSTLRSPPNL-EHPEF  215

Query  471  -SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PPL++G +++  +R K+T ++ LR++K Q+  LK AAN  R  +  PR YTRFE++ A
Sbjct  216  NDPPLLIGHTNNLEQRKKKTTMAILRVTKTQVETLKKAANKDRP-SHHPRPYTRFEIMAA  274

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            HIWRCACKAR H+P+Q T+L F VD R R+ PPL   +FGNAV+ V   G SGE++S PL
Sbjct  275  HIWRCACKARKHRPEQATSLYFYVDARSRLRPPLKPGFFGNAVLQVAAAGTSGELVSSPL  334

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
               +SKIR+ I+ VT ++   AI+  R + D+ + QEL
Sbjct  335  GCTSSKIREVIEAVTHDHFKSAIEHIRRQPDLTRFQEL  372



>gb|ACC68164.1| unknown [Arabidopsis halleri subsp. halleri]
Length=451

 Score =   265 bits (677),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 178/278 (64%), Gaps = 9/278 (3%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAES+  L+D  DFSP PE  +L+P V+Y  +PI+ IPLF+ QLTKF+CGG+SL   +
Sbjct  95   FIEAESEGRLSDFKDFSPTPEFENLMPQVNYK-NPIETIPLFLAQLTKFKCGGLSLSVNV  153

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH---  472
            SH + DG    H +SEW  LA G+PL + PF DR+ L    GE   P   P + FDH   
Sbjct  154  SHAIVDGQSALHLISEWGRLARGEPLETVPFLDRKILW--AGEPLPPFESPPK-FDHKEF  210

Query  471  -SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PP ++G++ +  ER K+T V  L+LSK Q+  L++ AN  + Y    +G+TR+E +T 
Sbjct  211  DQPPFLIGETDNVEERKKKTIVVMLKLSKSQLEKLRSKANASK-YADPAKGFTRYETVTG  269

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            H+WRCACKAR H P+QPT L   +D R RM+PPLP  YFGNA ++VV    SGE+IS  L
Sbjct  270  HVWRCACKARGHSPEQPTALGICIDTRSRMQPPLPRGYFGNATLDVVAASTSGELISNDL  329

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
               AS I  AI  VT+EYV   I++ +N+ D+ K Q+L
Sbjct  330  GFAASLISKAIKNVTNEYVMIGIEYLKNQKDLKKFQDL  367



>ref|XP_010414994.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Camelina 
sativa]
Length=456

 Score =   265 bits (677),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 133/282 (47%), Positives = 178/282 (63%), Gaps = 12/282 (4%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAES+  L+D  DFSP PE  +L+P V+Y  +PI+ IPLF+ QLTKF+CGG+SL   I
Sbjct  95   FIEAESEGKLSDFEDFSPTPEFENLMPQVNYK-NPIETIPLFLAQLTKFKCGGLSLSVNI  153

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH---  472
            SH + DG    HF+SEWA LA G+PL + PF DR+ L    GE   P   P + FDH   
Sbjct  154  SHAIVDGQSALHFISEWARLARGEPLETIPFLDRKILW--AGEPLPPFASPPK-FDHKEF  210

Query  471  -SPPLIVGQSSDESERMKETKVSTLRLSKPQIH----ALKAAANNGRSYNAKPRGYTRFE  307
              PP ++G+  +  ER K+T V+ L+LS+ Q+       +    NG  Y+   RG+TR+E
Sbjct  211  DQPPFLIGEKDNVEERKKKTIVTMLKLSESQLENSNKKRRENKANGSKYSDSSRGFTRYE  270

Query  306  VITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEII  127
             +T H+WRCACKAR H P+QPT L   +D R RM+PPLP  YFGNA ++VV    SGE+I
Sbjct  271  TVTGHVWRCACKARGHSPEQPTALGICIDTRSRMQPPLPRGYFGNATLDVVAASTSGELI  330

Query  126  SRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            S  L   AS I  AI  VT+EYV   I++ +N+ D+ K Q+L
Sbjct  331  SNELGFAASLISKAIKNVTNEYVMIGIEYLKNQEDLKKFQDL  372



>ref|XP_008223799.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Prunus mume]
Length=454

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/276 (46%), Positives = 182/276 (66%), Gaps = 4/276 (1%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAESD+ L D GDFSP PE ++L+P+VDY+  PI ++P+ + QLT+F+CGG+SL   I
Sbjct  96   FIEAESDSKLDDFGDFSPSPEYDYLIPTVDYTL-PIHELPILLVQLTRFKCGGLSLSLTI  154

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSPP  463
            SH V DG    HF+SEWA LA G+P+   PF DR+        + +  G      DH PP
Sbjct  155  SHAVVDGQSALHFISEWARLAKGEPIGVMPFLDRKAFQDRTLPAGNTLGLDHSELDH-PP  213

Query  462  LIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSY--NAKPRGYTRFEVITAHI  289
            L++G+S +  ER K+T V+ L+L+K Q+  LK  AN G  Y  +   R YTR+E +  HI
Sbjct  214  LLLGESDNIEERKKKTTVAMLKLTKQQVEKLKRMANEGNDYKNSGTKRAYTRYETVAGHI  273

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCA KAR H+ +Q T +   VD R RM+PPLP  YFGNA  +V+   ++G+++S+PL  
Sbjct  274  WRCASKARVHRNEQSTAMGVCVDSRSRMQPPLPQGYFGNATFDVIATSLAGDLVSKPLGY  333

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
             +S+I++AI+ VT++YV  AID +RN+ D+ + Q+L
Sbjct  334  ASSRIKEAIEKVTNDYVLSAIDHFRNQPDLTRFQDL  369



>ref|XP_008372277.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Malus domestica]
Length=455

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/280 (47%), Positives = 182/280 (65%), Gaps = 11/280 (4%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAES + L D GDFSP PE ++L+P+VDY+  PI ++P+ + QLT F+CGG+SL  AI
Sbjct  96   FIEAESSSKLDDFGDFSPSPEYHYLIPTVDYTL-PIHELPILLVQLTTFKCGGVSLSLAI  154

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS--  469
            SH V DG    HF+SEWA LA G+P+   PF DR+         + P G      DHS  
Sbjct  155  SHAVVDGQSALHFISEWARLARGEPIEVVPFLDRKVF----QALNLPAGSATLGLDHSEF  210

Query  468  --PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAK--PRGYTRFEVI  301
              PPLI+GQ+ +  ER K+T V+ L L+K Q+  LK  AN G ++N     R YTR+E +
Sbjct  211  NHPPLILGQADNIEERKKKTTVAMLSLTKDQVEKLKRMANEGTNFNNSDTKRAYTRYESV  270

Query  300  TAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISR  121
              HIWRCA KAR HK +QPT +   VD R RM+PPLP  YFGNA  +V+   ++G+++++
Sbjct  271  AGHIWRCASKARDHKNEQPTAMGVCVDSRSRMQPPLPQGYFGNATFDVIATSLAGDLVTK  330

Query  120  PLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            PL   +S+IR+AI+ VT++YV  AID  RN+ D+ + Q+L
Sbjct  331  PLGYASSRIREAIEKVTNDYVLSAIDNLRNQPDLTRFQDL  370



>ref|XP_006381775.1| hypothetical protein POPTR_0006s17880g, partial [Populus trichocarpa]
 gb|ERP59572.1| hypothetical protein POPTR_0006s17880g, partial [Populus trichocarpa]
Length=451

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 180/279 (65%), Gaps = 12/279 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +  EAES++ L DLGDF P  E  +L+P+VDY+  PI D+PL + QLTKF+CGGISL   
Sbjct  97   MFTEAESESKLEDLGDFLPSSEYKYLIPNVDYT-VPIHDLPLLLVQLTKFQCGGISLSLT  155

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS-  469
            ISH V DG    HF+SEWA +A G+PL   PF DR+ +LR      + Q      F H+ 
Sbjct  156  ISHAVVDGQSALHFMSEWARIARGEPLGVVPFLDRK-VLRARDPPIASQ------FHHAE  208

Query  468  ---PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
               PPL++GQ ++  ER K+  V+ LRL+K Q+  LK  AN  R      RGYTR+E ++
Sbjct  209  FDLPPLLLGQLNNAEERKKKATVAMLRLTKVQVENLKNVANEERISTDSGRGYTRYETLS  268

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             H+WR  CKAR H P+QPT L   VD R+RM+ PLPD Y GNA +NV+    +GE++S+P
Sbjct  269  GHVWRSVCKARGHNPEQPTALGVCVDSRKRMQSPLPDGYLGNATLNVIAVSHAGELMSKP  328

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            L   A KIR+AI+ VT+ YV  AIDF +N+ ++ + Q++
Sbjct  329  LGYAARKIREAIETVTNAYVRSAIDFLKNQPNLTRFQDI  367



>ref|XP_006296658.1| hypothetical protein CARUB_v10015907mg [Capsella rubella]
 gb|EOA29556.1| hypothetical protein CARUB_v10015907mg [Capsella rubella]
Length=451

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 179/278 (64%), Gaps = 9/278 (3%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAES+ +L+D  DFSP  E  +L+P V+Y  +PI+ IPL + QLTKF+CGG+SL   I
Sbjct  95   FIEAESEGMLSDFEDFSPTQEFENLMPQVNYK-NPIETIPLVLAQLTKFKCGGLSLSVNI  153

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH---  472
            SH + DG    HF+SEWA LA G+PL + PF DR+ L    GE   P   P + FDH   
Sbjct  154  SHAIVDGQSALHFMSEWARLARGEPLETVPFLDRKILW--AGEPLPPFASPPK-FDHKEF  210

Query  471  -SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PP ++G+  +  ER K+T V+ L+LSK  +  L+  AN+ +  ++  RG+TR+E +T 
Sbjct  211  EQPPFLIGEKDNVEERKKKTIVAMLKLSKSHLEKLRNKANSSKHADST-RGFTRYETVTG  269

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            H+WRCACKAR H  +QPT L   +D RRRM+PPLP  YFGNA ++VV    SGE+IS  L
Sbjct  270  HVWRCACKARGHSREQPTALGICIDTRRRMQPPLPRGYFGNATLDVVAASTSGELISNEL  329

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
               AS I  AI  VT+EYV   I++ +N+ D+ K Q+L
Sbjct  330  GFAASLISKAIKNVTNEYVMIGIEYLKNQEDLKKFQDL  367



>gb|KDO61846.1| hypothetical protein CISIN_1g036315mg [Citrus sinensis]
Length=452

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 140/274 (51%), Positives = 180/274 (66%), Gaps = 4/274 (1%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
            LVEAES A L DLGD SP PE N+LVP+VDY+  PIQ++PL + QLT+F+CGGISL F I
Sbjct  98   LVEAESRAKLEDLGDLSPRPEYNYLVPAVDYT-LPIQELPLVLVQLTRFQCGGISLSFTI  156

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSPP  463
            SH VADG    HF+ EWA +A  +PL   PF DR+ L  G    S P       FDH PP
Sbjct  157  SHAVADGPSALHFIFEWARIARREPLGLPPFLDRKVLQAGEPPVSYPLLD-HAEFDH-PP  214

Query  462  LIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIWR  283
            L++GQ+ +  ER K+T V  L+LS+ Q+  LK  AN G   N     ++R+E +T H+WR
Sbjct  215  LLIGQTDNIEERKKKTTVCMLKLSETQVKKLKNMANEGHC-NDIGHPFSRYETVTGHLWR  273

Query  282  CACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDVA  103
            CACKAR HK +Q T L   VD R RM+PPLP  YFGNA ++V+    SGE++S+PL   +
Sbjct  274  CACKARGHKAEQTTALGVCVDSRSRMQPPLPLGYFGNATLDVIALSRSGELVSKPLGYAS  333

Query  102  SKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            SKIR AI  VT EYV   I++ +N+ D+ K Q+L
Sbjct  334  SKIRRAIVSVTEEYVRSGIEYLKNQPDLTKFQDL  367



>emb|CDY62143.1| BnaCnng39330D [Brassica napus]
Length=380

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/276 (48%), Positives = 176/276 (64%), Gaps = 5/276 (2%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAES+A L+D  DFSP PE   LVP V+Y   PI+ IPLF+ Q+T+F+CGGISLG +I
Sbjct  24   FMEAESEAKLSDFNDFSPTPEFEKLVPQVNYK-HPIETIPLFLAQVTRFKCGGISLGVSI  82

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRG--VGESSSPQGGPRRVFDHS  469
            SH V DG    HFLSEW  +A G+PL + PF DR+ L  G  +   +SP    R+ F+  
Sbjct  83   SHAVVDGQSAFHFLSEWGRIARGEPLETTPFLDRKILWTGKPLPPFASPPQCERKGFEQ-  141

Query  468  PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            PPL++G++ +  ER K+T V  L+LSK  I  L++  N    Y    RG+TR+E +  H+
Sbjct  142  PPLLIGETDNVEERKKKTTVEILKLSKTLIEKLRSRVNTSE-YADPARGFTRYETVAGHV  200

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCA KAR H P+QPT+L   VD R R++PPLP  YFGNA IN V    SGE+IS  L  
Sbjct  201  WRCASKARGHSPEQPTSLGICVDTRSRVQPPLPRGYFGNATINAVARSTSGELISNGLGF  260

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
             A KI +AI  VT+EYV   I++ +N  D+   Q++
Sbjct  261  AAEKISEAIKSVTNEYVMTGIEYLKNHEDLKTFQDI  296



>ref|XP_002325143.2| transferase family protein [Populus trichocarpa]
 gb|EEF03708.2| transferase family protein [Populus trichocarpa]
Length=455

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 139/279 (50%), Positives = 190/279 (68%), Gaps = 13/279 (5%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
             L EAES++ L DLGD +  PE  +L+P+VDY+  P+ ++PL + QLT F+CGGISLG  
Sbjct  95   TLTEAESESKLEDLGDLT-SPEYQYLIPNVDYT-VPLHELPLLLVQLTIFQCGGISLGLR  152

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            ISH V DG     F+SEWA ++ G+PL + PF DR+ L  G    + PQ      FDH+ 
Sbjct  153  ISHAVVDGKSALQFMSEWARISRGEPLGTLPFLDRKVLRAGDPPVARPQ------FDHAE  206

Query  465  ----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
                PL++G+ S+  ER K+T ++ LRL+K Q+  LK  AN GRS ++  RGYTR+E +T
Sbjct  207  FGLPPLLLGELSNAEERKKKTTIAMLRLTKIQVEKLKNMANEGRSIDSG-RGYTRYETLT  265

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             HIWR ACKAR HKP+QPT L   VD R RM+PPLPD YFGNA ++V+    +GE++S+P
Sbjct  266  GHIWRSACKARRHKPEQPTALGVCVDSRGRMQPPLPDGYFGNASLDVIAVSQAGELLSKP  325

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            L   ASKIR+AI+ VT+EYV  AIDF +N+ D+ + Q++
Sbjct  326  LGYAASKIREAIETVTNEYVISAIDFLKNQPDLTRFQDI  364



>ref|XP_010051711.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Eucalyptus 
grandis]
Length=457

 Score =   263 bits (673),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 133/277 (48%), Positives = 185/277 (67%), Gaps = 6/277 (2%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
            L+EAES+  L DLGDF P P+   L+PS+DY+  PI + PL + Q+TKFRCGG++L  +I
Sbjct  98   LIEAESEGELNDLGDFCPGPDFEQLMPSLDYTM-PIHEQPLLLVQVTKFRCGGLALSLSI  156

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSS---PQGGPRRVFDH  472
            SHVVADG    HF +EWA LA G+PL+  P++DR+ L  G   S +   P       F+H
Sbjct  157  SHVVADGLSAAHFYNEWAWLARGEPLNIEPYYDRKVLWVGEDPSGARLPPPNLELSEFNH  216

Query  471  SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAH  292
             PPL++G +++  +RMK+T ++ L+++K Q+  LK A N  R  +  PR YTRFE I AH
Sbjct  217  -PPLLIGHANNLEQRMKKTALAMLKVTKTQVETLKNAVNKDRP-SHHPRPYTRFETIAAH  274

Query  291  IWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQ  112
            IWRC CKAR HKP+Q T+L F +D R R+ PPL   +FGNAV N+V  G SGE++S PL+
Sbjct  275  IWRCVCKARKHKPEQATSLYFYIDARSRLRPPLKPGFFGNAVFNMVAGGTSGELVSSPLR  334

Query  111  DVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
              +S IR+AI+ VT ++V  AI+  R + D+   Q+L
Sbjct  335  CTSSVIREAIEAVTHDHVKSAIEHIRRQPDLTTFQDL  371



>emb|CDY56515.1| BnaCnng30570D [Brassica napus]
Length=380

 Score =   261 bits (666),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 132/276 (48%), Positives = 176/276 (64%), Gaps = 5/276 (2%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAES+A L+D  DFSP PE   LVP V+Y   PI+ IPLF+ Q+T+F+CGGISLG +I
Sbjct  24   FMEAESEAKLSDFDDFSPTPEFEKLVPQVNYK-HPIETIPLFLAQVTRFKCGGISLGVSI  82

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRG--VGESSSPQGGPRRVFDHS  469
            SH V DG    HFLSEW  +A G+PL + PF DR+ L  G  +   +SP    R+ F+  
Sbjct  83   SHAVVDGQSAFHFLSEWGRIARGEPLETTPFLDRKILWTGQPLPPFASPPQCERKGFEQ-  141

Query  468  PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            PPL++G++ +  ER K+T V  L+LSK  I  L++  N    Y    RG+TR+E +  H+
Sbjct  142  PPLLIGETDNVEERKKKTTVEILKLSKTLIEKLRSRVNTSE-YADPARGFTRYETVAGHV  200

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCA KAR H P+QPT+L   VD R R++PPLP  YFGNA IN V    SGE+IS  L  
Sbjct  201  WRCASKARGHSPEQPTSLGICVDTRSRVQPPLPRGYFGNATINAVARSTSGELISNGLGF  260

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
             A KI +AI  VT+EYV   I++ +N  D+   Q++
Sbjct  261  AAEKISEAIKSVTNEYVMTGIEYLKNHEDLKTFQDI  296



>gb|KCW80900.1| hypothetical protein EUGRSUZ_C02269 [Eucalyptus grandis]
Length=457

 Score =   262 bits (670),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 136/278 (49%), Positives = 188/278 (68%), Gaps = 8/278 (3%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAES+  L DLGDFSP PE   LVPSVDY+  PI ++PL + Q+TKF+CGG++L F++
Sbjct  98   FIEAESEGELNDLGDFSPRPEFEQLVPSVDYT-KPIHELPLLLVQVTKFKCGGLTLSFSM  156

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS--  469
            SH VADG    HF++EWA LA G+ LS  P++DR+ L  G  + SS      R  +HS  
Sbjct  157  SHAVADGPSALHFMTEWARLARGERLSVEPYYDRKVLWVG-DDPSSTPPPRPRHLEHSEF  215

Query  468  --PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PPL++G +++  ER K+T V+ L+L++ Q+  LK AAN  R+   +P  YTR+E + A
Sbjct  216  NPPPLLIGHTNNLEERKKKTTVAMLKLTRTQVETLKNAANKERAGPHRP--YTRYETVAA  273

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            HIWRCACKAR HKP+QPT +   VD R R+ PPL   YFGNA ++VV  G+SGE++S PL
Sbjct  274  HIWRCACKARKHKPEQPTAVGICVDSRHRLHPPLKLGYFGNATLDVVAAGMSGELVSSPL  333

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
               +SKIR+AI+ VT ++V  AID  R + D+   Q++
Sbjct  334  GCTSSKIREAIERVTHDHVRSAIDHIRRQPDLTLFQDV  371



>ref|NP_179497.1| spermidine hydroxycinnamoyl transferase [Arabidopsis thaliana]
 sp|O64470.1|SHT_ARATH RecName: Full=Spermidine hydroxycinnamoyl transferase; AltName: 
Full=BAHD-like hydroxycinnamoyl transferase [Arabidopsis 
thaliana]
 gb|AAD12025.1| putative anthranilate N-hydroxycinnamoyl/benzoyltransferase [Arabidopsis 
thaliana]
 gb|AAO22784.1| putative anthranilate N-hydroxycinnamoyl/benzoyltransferase [Arabidopsis 
thaliana]
 gb|AAO42450.1| putative anthranilate N-hydroxycinnamoyl/benzoyltransferase [Arabidopsis 
thaliana]
 gb|AEC06845.1| spermidine hydroxycinnamoyl transferase [Arabidopsis thaliana]
Length=451

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 177/278 (64%), Gaps = 9/278 (3%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAES+  L+D  DFSP PE  +L+P V+Y  +PI+ IPLF+ Q+TKF+CGGISL   +
Sbjct  95   FIEAESEGKLSDFKDFSPTPEFENLMPQVNYK-NPIETIPLFLAQVTKFKCGGISLSVNV  153

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH---  472
            SH + DG    H +SEW  LA G+PL + PF DR+ L    GE   P   P + FDH   
Sbjct  154  SHAIVDGQSALHLISEWGRLARGEPLETVPFLDRKILW--AGEPLPPFVSPPK-FDHKEF  210

Query  471  -SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PP ++G++ +  ER K+T V  L LS  Q+  L++ AN G  ++   +G+TR+E +T 
Sbjct  211  DQPPFLIGETDNVEERKKKTIVVMLPLSTSQLQKLRSKAN-GSKHSDPAKGFTRYETVTG  269

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            H+WRCACKAR H P+QPT L   +D R RMEPPLP  YFGNA ++VV    SGE+IS  L
Sbjct  270  HVWRCACKARGHSPEQPTALGICIDTRSRMEPPLPRGYFGNATLDVVAASTSGELISNEL  329

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
               AS I  AI  VT+EYV   I++ +N+ D+ K Q+L
Sbjct  330  GFAASLISKAIKNVTNEYVMIGIEYLKNQKDLKKFQDL  367



>ref|XP_010050943.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Eucalyptus 
grandis]
Length=455

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/278 (49%), Positives = 188/278 (68%), Gaps = 8/278 (3%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAES+  L DLGDFSP PE   LVPSVDY+  PI ++PL + Q+TKF+CGG++L F++
Sbjct  96   FIEAESEGELNDLGDFSPRPEFEQLVPSVDYT-KPIHELPLLLVQVTKFKCGGLTLSFSM  154

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS--  469
            SH VADG    HF++EWA LA G+ LS  P++DR+ L  G  + SS      R  +HS  
Sbjct  155  SHAVADGPSALHFMTEWARLARGERLSVEPYYDRKVLWVG-DDPSSTPPPRPRHLEHSEF  213

Query  468  --PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PPL++G +++  ER K+T V+ L+L++ Q+  LK AAN  R+   +P  YTR+E + A
Sbjct  214  NPPPLLIGHTNNLEERKKKTTVAMLKLTRTQVETLKNAANKERAGPHRP--YTRYETVAA  271

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            HIWRCACKAR HKP+QPT +   VD R R+ PPL   YFGNA ++VV  G+SGE++S PL
Sbjct  272  HIWRCACKARKHKPEQPTAVGICVDSRHRLHPPLKLGYFGNATLDVVAAGMSGELVSSPL  331

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
               +SKIR+AI+ VT ++V  AID  R + D+   Q++
Sbjct  332  GCTSSKIREAIERVTHDHVRSAIDHIRRQPDLTLFQDV  369



>ref|XP_009150708.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Brassica 
rapa]
Length=451

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/276 (48%), Positives = 176/276 (64%), Gaps = 5/276 (2%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAES+A L+D  DFSP PE   LVP V+Y   PI+ IPLF+ Q+T+F+CGGISLG +I
Sbjct  95   FMEAESEAKLSDFNDFSPTPEFEKLVPQVNYK-HPIETIPLFLAQVTRFKCGGISLGVSI  153

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRG--VGESSSPQGGPRRVFDHS  469
            SH V DG    HFLSEW  +A G+PL + PF DR+ L  G  +   +SP    R+ F+  
Sbjct  154  SHAVVDGQSAFHFLSEWGRIARGEPLETTPFLDRKILWTGKPLPPFASPPQCERKGFEQ-  212

Query  468  PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            PPL++G++ +  ER K+T V  L+LSK  I  L++  N    Y    RG+TR+E +  H+
Sbjct  213  PPLLIGETDNVEERKKKTTVEILKLSKTLIEKLRSRVNTSE-YADPARGFTRYETVAGHV  271

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCA KAR H P+QPT+L   VD R R++PPLP  YFGNA IN V    SGE+IS  L  
Sbjct  272  WRCASKARGHSPEQPTSLGICVDTRSRVQPPLPRGYFGNATINAVARSTSGELISNGLGF  331

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
             A KI +AI  VT+EYV   I++ +N  D+   Q++
Sbjct  332  AAEKISEAIKSVTNEYVMTGIEYLKNHEDLKTFQDI  367



>ref|XP_006409088.1| hypothetical protein EUTSA_v10022690mg [Eutrema salsugineum]
 gb|ESQ50541.1| hypothetical protein EUTSA_v10022690mg [Eutrema salsugineum]
Length=451

 Score =   261 bits (666),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/279 (46%), Positives = 177/279 (63%), Gaps = 9/279 (3%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
              +EAES+A L+D  DFSP PE   L+P V+Y  +PI+ IPLF+ Q+TKF+CGGISL   
Sbjct  94   TFIEAESEAELSDFKDFSPTPEFEKLMPQVNYK-NPIETIPLFLAQVTKFKCGGISLSVN  152

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGG----PRRVF  478
            ISH V DG    HF+SEW  ++ G+PL + PF DR+ L    GE   P        R+ F
Sbjct  153  ISHAVVDGQSALHFMSEWGRISRGEPLGTVPFLDRKILW--AGEPLPPFASLPRFKRKEF  210

Query  477  DHSPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
            +  PP ++G++ +  ER K+T V+ L+LSK Q+  L++  N    +    RG+TR+E +T
Sbjct  211  EQ-PPFLIGETDNVEERKKKTTVAMLKLSKSQLEKLRSRVNTSE-FADPARGFTRYETVT  268

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
            AH+WRCACKAR H P+QPT L   +D R R++PPLP  YFGNA ++VV    SGE+IS  
Sbjct  269  AHVWRCACKARGHSPEQPTALGICIDTRSRVQPPLPRGYFGNATLDVVAASTSGELISNE  328

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            L   A KI  AI  VT+EYV   I++ + + D+ K Q+L
Sbjct  329  LGFAAGKISKAIKNVTNEYVMTGIEYLKQQEDLKKFQDL  367



>gb|KCW82842.1| hypothetical protein EUGRSUZ_C04213 [Eucalyptus grandis]
Length=453

 Score =   260 bits (665),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/274 (48%), Positives = 183/274 (67%), Gaps = 4/274 (1%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
            L+EAES+  L DLGDF P P+   L+PS+DY+  PI + PL + Q+TKFRCGG++L  +I
Sbjct  98   LIEAESEGELNDLGDFCPGPDFEQLMPSLDYTM-PIHEQPLLLVQVTKFRCGGLALSLSI  156

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSPP  463
            SHVVADG    HF +EWA LA G+PL+  P++DR+ +    G    P       F+H PP
Sbjct  157  SHVVADGLSAAHFYNEWAWLARGEPLNIEPYYDRK-VRHPSGARLPPPNLELSEFNH-PP  214

Query  462  LIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIWR  283
            L++G +++  +RMK+T ++ L+++K Q+  LK A N  R  +  PR YTRFE I AHIWR
Sbjct  215  LLIGHANNLEQRMKKTALAMLKVTKTQVETLKNAVNKDRP-SHHPRPYTRFETIAAHIWR  273

Query  282  CACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDVA  103
            C CKAR HKP+Q T+L F +D R R+ PPL   +FGNAV N+V  G SGE++S PL+  +
Sbjct  274  CVCKARKHKPEQATSLYFYIDARSRLRPPLKPGFFGNAVFNMVAGGTSGELVSSPLRCTS  333

Query  102  SKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            S IR+AI+ VT ++V  AI+  R + D+   Q+L
Sbjct  334  SVIREAIEAVTHDHVKSAIEHIRRQPDLTTFQDL  367



>gb|AFF57840.1| hydroxycinnamoyl-coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
2 [Pyrus x bretschneideri]
Length=455

 Score =   260 bits (665),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 181/277 (65%), Gaps = 5/277 (2%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAES + L D GDFSP PE ++L+P++DY+  PI ++P+ + QLT F+CGG+SL   I
Sbjct  96   FIEAESSSKLDDFGDFSPSPEYHYLIPTLDYTL-PIHELPILLVQLTTFKCGGVSLSLTI  154

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRL-LRGVGESSSPQGGPRRVFDHSP  466
            SH V DG    HF+SEWA LA G+P+   PF DR+      +   S+  G     F+H P
Sbjct  155  SHAVVDGQSALHFISEWARLARGEPIEVMPFLDRKVFQALNIPAGSATLGLDHSEFNH-P  213

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAK--PRGYTRFEVITAH  292
            P ++GQ+ +  ER K+T V+ L L+K Q+  LK  AN G ++N     R YTR+E +  H
Sbjct  214  PFLLGQADNTEERKKKTTVAMLSLTKDQVEKLKRMANEGTNFNNSDTKRAYTRYESVAGH  273

Query  291  IWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQ  112
            IWRCA KAR HK +QPT +   VD R RM+PPLP  YFGNA  +V+   ++G+++++PL 
Sbjct  274  IWRCASKARDHKNEQPTAMGVCVDSRNRMQPPLPQGYFGNATFDVIATSLAGDLVTKPLG  333

Query  111  DVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
              +S+IR+AI+ VT++YV  AID  RN+ D+ + Q+L
Sbjct  334  YASSRIREAIEKVTNDYVLSAIDNLRNQPDLTRFQDL  370



>ref|XP_011018001.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Populus euphratica]
Length=455

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/279 (49%), Positives = 188/279 (67%), Gaps = 13/279 (5%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
             L EAES++ L DLGD  P PE  +L+P+VDY+  P+ ++PL + QLT F+CG ISLG  
Sbjct  95   TLTEAESESKLEDLGDLPP-PEYQYLIPNVDYT-VPLHELPLLLVQLTIFQCGSISLGLR  152

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            ISHVV DG     F+SEWA ++ G+ L + PF DR+ L  G    + PQ      FDH+ 
Sbjct  153  ISHVVVDGKSALQFMSEWARISRGESLGTLPFLDRKVLRAGDPPLARPQ------FDHAE  206

Query  465  ----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
                PL++G+ S+  ER K+T  + LRL+K Q+  LK  AN GRS ++  RGYTR+E +T
Sbjct  207  FGLPPLLLGELSNAEERKKKTTTAMLRLTKIQVEKLKNMANEGRSIDSG-RGYTRYETLT  265

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             H+WR ACKAR HKP+QPT L   VD R RM+PPLPD YFGNA ++V+    +GE++S+P
Sbjct  266  GHVWRSACKARRHKPEQPTALGVCVDSRGRMQPPLPDGYFGNASLDVIAVSQAGELLSKP  325

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            L   ASKIR+AI+ VT+EYV  AIDF +N+ D+ + Q++
Sbjct  326  LGYAASKIREAIETVTNEYVISAIDFLKNQPDLTRFQDI  364



>ref|XP_009358743.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Pyrus x bretschneideri]
Length=455

 Score =   258 bits (659),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/277 (46%), Positives = 180/277 (65%), Gaps = 5/277 (2%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAES + L D GDFSP PE ++L+P+VDY+  PI ++P+ + QLT F+CGG+SL   I
Sbjct  96   FIEAESSSKLDDFGDFSPSPEYHYLIPTVDYTL-PIHELPILLVQLTTFKCGGVSLSLTI  154

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRL-LRGVGESSSPQGGPRRVFDHSP  466
            SH V DG    HF+SEWA LA G+P+   PF DR+      +   S+  G     F+H P
Sbjct  155  SHAVVDGQSALHFISEWARLARGEPIEVMPFLDRKVFQALNIPAGSATLGLDHSEFNH-P  213

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAK--PRGYTRFEVITAH  292
            P ++GQ+ +  ER K+T V+ L L+K Q+  LK  AN G + N     R YTR+E +  H
Sbjct  214  PFLLGQADNIEERKKKTTVAMLSLTKDQVEKLKRMANEGTNCNNSDTKRAYTRYESVAGH  273

Query  291  IWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQ  112
            IWRCA KAR HK +QPT +   VD R RM+PPLP  YFGNA  +V+   ++G+++++PL 
Sbjct  274  IWRCASKARDHKNEQPTAMGVCVDSRNRMQPPLPQGYFGNATFDVIATSLAGDLVTKPLG  333

Query  111  DVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
              +S+IR+AI+ VT++YV  AID  RN+ D+ + Q+L
Sbjct  334  YASSRIREAIEKVTNDYVLSAIDNLRNQPDLTRFQDL  370



>ref|XP_010548604.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Tarenaya 
hassleriana]
Length=447

 Score =   255 bits (652),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/274 (46%), Positives = 173/274 (63%), Gaps = 3/274 (1%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             VEAES++ L+  GDFSP PE  +LVP V+Y  +PI+ IPL + QLT+FRCGG+ LG  I
Sbjct  93   FVEAESESELSGFGDFSPSPEYENLVPQVNYE-NPIEKIPLLLVQLTRFRCGGLCLGVNI  151

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSPP  463
            SH V DG    HF+SEWA ++ G+PL +AP+ DRR L  G   +  P     +  +  PP
Sbjct  152  SHAVVDGQSALHFISEWARISCGQPLGTAPYLDRRILRAGEPPAVKPPPLDLKELEQ-PP  210

Query  462  LIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIWR  283
            L++G   +  ER K+T V+ L+L +  +  L+  AN    ++   R +TR+E +T H+WR
Sbjct  211  LMIGAEDNVEERKKDTTVAMLKLDRADVEKLRERANKSE-FSDSTRSFTRYEAVTGHVWR  269

Query  282  CACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDVA  103
             ACKAR H PQQPT L   +D R RM+PPLP  YFGNA ++V+    SGE+IS PL    
Sbjct  270  SACKARGHFPQQPTALGVCIDSRSRMQPPLPQGYFGNATLDVIAVSTSGELISNPLGYAV  329

Query  102  SKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
             KIR+AI  V  EYV   I++ +N+ D+ K Q+L
Sbjct  330  RKIREAIKKVNDEYVRSEIEYLKNQEDLKKFQDL  363



>emb|CDY03367.1| BnaC09g09810D [Brassica napus]
Length=451

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/277 (47%), Positives = 173/277 (62%), Gaps = 7/277 (3%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
            L+EAES+A L D  +F    E   LVP V+Y   PI+ IPLF+ Q+TKF+CG ISL   +
Sbjct  95   LMEAESEAELIDFNNFLGAAEFEKLVPQVNYK-SPIETIPLFLAQVTKFKCGRISLSVKV  153

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGE---SSSPQGGPRRVFDH  472
            SH V DG    HFLSEW  +A G+PL + PF DR+ L  G      ++SPQ   +     
Sbjct  154  SHAVVDGQSALHFLSEWGRIARGEPLETVPFLDRKVLWAGEQLPPFATSPQYEGKEF--E  211

Query  471  SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAH  292
             PPL++G++    ER KET V+ LRLSK Q+  L++  N    Y    RG+TR+E +T H
Sbjct  212  EPPLLIGETDCVEERKKETVVAMLRLSKSQLQKLRSRVNTSE-YADPARGFTRYETVTGH  270

Query  291  IWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQ  112
            +WRCACKAR H P+QPT L  SVD R R++PPLP  YFGNA ++VV   +SGE+I+  L 
Sbjct  271  VWRCACKARGHSPEQPTGLVISVDARNRVQPPLPRGYFGNATLDVVAASISGELITNELG  330

Query  111  DVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
              A KI  AI  VT+EYV   I++ +N  D+ + Q++
Sbjct  331  FAAGKISKAIKNVTNEYVMTGIEYLKNHEDLKEFQDI  367



>ref|XP_003550655.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=455

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/273 (48%), Positives = 174/273 (64%), Gaps = 13/273 (5%)
 Frame = -2

Query  822  LVEAESDAVLADLGD-FSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
             +EAES +   DLGD FSP  E N+LVP+VDY+  PI  +PL + QLT F+CGG+S+G  
Sbjct  95   FIEAESSSSFEDLGDDFSPSSEYNYLVPTVDYTL-PIHGLPLVLIQLTNFKCGGVSIGIT  153

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS-  469
            +SH V DG    HF+SEWA LA G+PL + PFHDR+ L  G      P     R   H+ 
Sbjct  154  LSHAVVDGPSASHFISEWARLARGEPLQTVPFHDRKVLHAG----DPPSVPLARCHSHTE  209

Query  468  ---PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
               PPL++G++ +  ER K+T +  L+LSK Q+  LK  AN G   N     Y+R+E I 
Sbjct  210  FDEPPLLLGKTDNTEERKKKTAMVILKLSKTQVETLKKTANYGGYGN---DSYSRYEAIA  266

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             HIWR ACKAR HK  QPTTL   VD R RMEPPLP  YFGNA ++ V   ++G+++S+P
Sbjct  267  GHIWRSACKARGHKEDQPTTLTVIVDSRSRMEPPLPKGYFGNATLDTVATSLAGDLVSKP  326

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            L   +S+IR+AI+ V+ EYV   I+F +N+ D+
Sbjct  327  LGYASSRIREAIERVSDEYVRSGIEFLKNQEDL  359



>gb|KHN17616.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=364

 Score =   250 bits (638),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 129/273 (47%), Positives = 173/273 (63%), Gaps = 15/273 (5%)
 Frame = -2

Query  822  LVEAESDAVLADLGD-FSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
             +EAES +   DLGD FSP  E N+LVP+VDY+  PI  +PL + QLT F+CGG+S+G  
Sbjct  5    FIEAESSSSFEDLGDDFSPSSEYNYLVPTVDYTL-PIHGLPLVLIQLTNFKCGGVSIGIT  63

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS-  469
            +SH V DG    HF+SEWA LA G+PL + PFHDR+ L  G      P     R   H+ 
Sbjct  64   LSHAVVDGPRASHFISEWARLARGEPLQTVPFHDRKVLHAG----DPPSVSLARCHSHTE  119

Query  468  ---PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
               PPL++G++ +  ER K+T +  L+LSK Q+  LK  AN G   N     + R+E I 
Sbjct  120  FDEPPLLLGKTDNTEERKKKTAMVILKLSKTQVETLKKRANYGGYGN-----WCRYEAIA  174

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             HIWR ACKAR HK  QPTTL   VD R RMEPPLP  YFGNA ++ V   ++G+++S+P
Sbjct  175  GHIWRSACKARGHKEDQPTTLTVIVDSRSRMEPPLPKGYFGNATLDTVATSLAGDLVSKP  234

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            L   +S+IR+AI+ V+ EYV   I+F +N+ D+
Sbjct  235  LGYASSRIREAIERVSDEYVRSGIEFLKNQEDL  267



>emb|CDY66506.1| BnaAnng22360D [Brassica napus]
Length=442

 Score =   252 bits (644),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 128/272 (47%), Positives = 169/272 (62%), Gaps = 7/272 (3%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
             L+EAES+A L D  +F    E   LVP V+Y   PI+ IPLF+ Q+TKF+CG ISL   
Sbjct  94   TLIEAESEAELIDFNNFLGAAEFEKLVPQVNYK-SPIETIPLFLAQVTKFKCGRISLSVK  152

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGE---SSSPQGGPRRVFD  475
            +SH V DG    HFLSEW  +A G+PL + PF DR+ L  G      +SSPQ   +    
Sbjct  153  VSHAVVDGQSALHFLSEWGRIARGEPLETVPFLDRKVLWAGEQLPPFASSPQYEGKEF--  210

Query  474  HSPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PPL++G++    ER KET V+ L+LSK Q+  L++  N    Y    RG+TR+E +T 
Sbjct  211  EEPPLLIGETDCVEERKKETVVAMLKLSKSQLQKLRSKVNTSE-YADPARGFTRYETVTG  269

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            H+WRCACKAR H P+QPT L  SVD R R++PPLP  YFGNA ++VV   +SGE+I+  L
Sbjct  270  HVWRCACKARGHSPEQPTGLVISVDARSRVQPPLPRGYFGNATLDVVAASISGELITNEL  329

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
               A KI  AI  VT+EYV   I++ +N  D+
Sbjct  330  GFAAGKISKAIKNVTNEYVMTGIEYLKNHEDL  361



>gb|KHN17617.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=446

 Score =   250 bits (638),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/281 (46%), Positives = 177/281 (63%), Gaps = 16/281 (6%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAES   L +LGDFSP  E N+LVP+VDY+  PI ++P+ + QLT F+CGG S+    
Sbjct  83   FIEAESSLTLENLGDFSPSSEYNNLVPNVDYTL-PIHELPVVLIQLTNFKCGGFSISLNT  141

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGP-------RR  484
            SH VADG    HFL EWA L+ G+ L +AP  DR      V  +  P   P       + 
Sbjct  142  SHAVADGPSALHFLCEWARLSRGELLQTAPLFDRT-----VFRAGEPPLMPLTECRVHKD  196

Query  483  VFDHSPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEV  304
             F H PPL++GQ+++  ER K+T V  L+++K Q+  LK  AN   S +A  RGYTR+E 
Sbjct  197  QFIH-PPLLLGQTNNTEERKKKTTVVILKMTKTQVETLKKTANESNSGHA--RGYTRYES  253

Query  303  ITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIIS  124
            +T H+WR ACKAR HK  QPT L   VD R RMEPPLP  YFGNA ++ V   ++G+++S
Sbjct  254  VTGHVWRTACKARGHKEDQPTALGVCVDSRSRMEPPLPKGYFGNATLDTVATSLAGDLVS  313

Query  123  RPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            +PL    S+IR+AI+ VT EYV   I+F +N+ D+ + Q+L
Sbjct  314  KPLGYACSRIREAIERVTDEYVRTGIEFLKNQEDLSRFQDL  354



>ref|XP_009112574.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Brassica 
rapa]
Length=451

 Score =   250 bits (638),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 127/278 (46%), Positives = 172/278 (62%), Gaps = 7/278 (3%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
             L+E ES+A L D  +F    E   LVP V++   PI+ IPLF+ Q+TKF+CG ISL   
Sbjct  94   TLIEGESEAELIDFNNFLGAAEFEKLVPQVNHK-SPIETIPLFLAQVTKFKCGRISLSVK  152

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGE---SSSPQGGPRRVFD  475
            +SH V DG    HFLSEW  +A G+PL + PF DR+ L  G      +SSPQ   +    
Sbjct  153  VSHAVVDGRSALHFLSEWGRIARGEPLETVPFLDRKVLWAGEQLPPFASSPQYEGKEF--  210

Query  474  HSPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PPL++G++    ER KET V+ L+LSK Q+  L++  N    Y    RG+TR+E +T 
Sbjct  211  EEPPLLIGETDCVEERKKETVVAMLKLSKSQLQKLRSKVNTSE-YADPARGFTRYETVTG  269

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            H+WRCACKAR H P+QPT L  SVD R R++PPLP  YFGNA ++VV   +SGE+I+  L
Sbjct  270  HVWRCACKARGHSPEQPTGLVISVDARSRVQPPLPRGYFGNATLDVVAASISGELITNEL  329

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
               A KI  AI  VT+EYV   I++ +N  D+ + Q++
Sbjct  330  GFAAGKISKAIKNVTNEYVMTGIEYLKNHEDLKEFQDI  367



>ref|XP_002274695.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Vitis 
vinifera]
Length=445

 Score =   249 bits (636),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 126/275 (46%), Positives = 171/275 (62%), Gaps = 12/275 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +L+  ES+A + D GDF P  E+  L+PSVDY+  PI ++PL + Q+TKF CGG+SLG  
Sbjct  91   LLIAVESEAKIDDFGDFRPTQEIRALIPSVDYN-KPIHELPLILVQITKFSCGGMSLGLG  149

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            ISH +ADG    HF+SEWA +A G+  +S PF DR  LL       +P+     VFDH  
Sbjct  150  ISHTIADGLSALHFISEWAKIARGEQSNSPPFLDRSVLL-------APEHLSAPVFDHPE  202

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
              + PL++G+  +  ER +ET +  L+LSK Q+  LK  AN  RS +   R YTR+E + 
Sbjct  203  YSTQPLLIGKQDNMEERKRETAILKLKLSKDQVEKLKDKANKDRSASNNKRPYTRYEAVA  262

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             HIWR ACKAR H+ QQPTTL   VD R RMEPPLP  YFGNA   V    +SGE++S+P
Sbjct  263  GHIWRSACKARQHESQQPTTLSIIVDARNRMEPPLPPRYFGNATFRVTAESMSGELVSKP  322

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  13
            L   + K R AI+  T EY+  ++ + + + DV +
Sbjct  323  LGYASGKARQAIEKATHEYLQSSLVYVKCQEDVTQ  357



>ref|XP_007161968.1| hypothetical protein PHAVU_001G112900g [Phaseolus vulgaris]
 gb|ESW33962.1| hypothetical protein PHAVU_001G112900g [Phaseolus vulgaris]
Length=455

 Score =   249 bits (636),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 126/276 (46%), Positives = 178/276 (64%), Gaps = 5/276 (2%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             VEA+S + L DLGDFSP  E ++L P VDY+  PI ++PL + QLTKF+CGGIS+   I
Sbjct  97   FVEAQSSSSLEDLGDFSPSSEHHYLFPKVDYTL-PIHELPLVLAQLTKFKCGGISISMTI  155

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSP--QGGPRRVFDHS  469
            SH VADG    HF  EWA LA G+ L   PF D + + R     S P  +      F+H 
Sbjct  156  SHAVADGPSALHFTREWARLARGETLEKVPFLDWK-VFRAGEPPSVPLTKCHVHTEFNH-  213

Query  468  PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            PPL++GQ+++  ER K+T V+ L+LSK Q+  L+  AN   +     R Y+R+E +T H+
Sbjct  214  PPLLLGQTNNSEERKKKTTVAILKLSKFQVETLRKTANESWNRPRNGRAYSRYESVTGHV  273

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WR ACKAR HK +QPT +   VD R RMEPPLP  YFGNA ++V+   ++G+++S+PL  
Sbjct  274  WRSACKARGHKEEQPTAVGICVDSRSRMEPPLPKEYFGNATLDVIASSLAGDLMSKPLGY  333

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
             +S+IR+AI+ V  EYV   ++F +N+ D+ + Q+L
Sbjct  334  ASSRIREAIERVNDEYVRSGVEFLKNQEDLSRFQDL  369



>ref|XP_007154735.1| hypothetical protein PHAVU_003G143100g [Phaseolus vulgaris]
 gb|ESW26729.1| hypothetical protein PHAVU_003G143100g [Phaseolus vulgaris]
Length=469

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/276 (46%), Positives = 177/276 (64%), Gaps = 5/276 (2%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             VEA+S + L DLGDFSP  E ++L P VDY+  PI ++PL + QLTKF+CGGIS+   I
Sbjct  97   FVEAQSSSSLEDLGDFSPSSEHHYLFPKVDYTL-PIHELPLVLAQLTKFKCGGISISMTI  155

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSP--QGGPRRVFDHS  469
            SH VADG    HF  EWA LA G+ L   PF D + + R     S P  +      FDH 
Sbjct  156  SHAVADGPSALHFTREWARLARGETLEKVPFLDWK-VFRAGEPPSVPLTKCHVHTEFDH-  213

Query  468  PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            PPL++GQ+++  ER K+T V+ L+LSK Q+  L+  AN   +     R Y+R+E +T H+
Sbjct  214  PPLLLGQTNNSEERKKKTTVANLKLSKFQVETLRKTANESWNRPRNGRAYSRYESVTGHV  273

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WR  CKAR H+ +QPT +   VD R RMEPPLP  YFGNA + VV   ++G+++S+PL  
Sbjct  274  WRSVCKARGHREEQPTGVGICVDSRSRMEPPLPKEYFGNATLYVVASSLAGDLMSKPLGY  333

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
             +S+IR+AI+ V  EYV  A++F +N+ D+ + Q+L
Sbjct  334  ASSRIREAIERVNDEYVRSAVEFLKNQEDLSRFQDL  369



>ref|XP_007161967.1| hypothetical protein PHAVU_001G112800g [Phaseolus vulgaris]
 gb|ESW33961.1| hypothetical protein PHAVU_001G112800g [Phaseolus vulgaris]
Length=455

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/272 (46%), Positives = 173/272 (64%), Gaps = 8/272 (3%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAES + L DL DFS   + +HLVP+VDY   PI ++PL + QLTKF+CGGI +G  +
Sbjct  96   FIEAESSSTLEDLTDFSASSKYHHLVPTVDYYSLPIHELPLALVQLTKFKCGGICIGVTL  155

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS--  469
            SHVV DG    HF  EWA LA G+ L + PF DR+ L  G      P     +   H+  
Sbjct  156  SHVVIDGPSAMHFTCEWARLARGQTLHTVPFLDRKVLRAG----EPPLVPLTKCHVHTEF  211

Query  468  --PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PPL++G++ +  E+ KET++ T+++S+ Q+  LK  AN         RGY+R+E +T+
Sbjct  212  DDPPLLLGRTDNNEEKKKETRMVTIKISRSQVETLKKRANESSHRPRNGRGYSRYESVTS  271

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            HIWR ACKAR HK  QPT L  +VD R RMEPPLP  YFGNA ++ V   ++G+++S PL
Sbjct  272  HIWRSACKARDHKENQPTMLTIAVDSRGRMEPPLPKGYFGNANLDTVACSLAGDLVSEPL  331

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
               AS+IR+AI+ V+ EYV   I+F +N+ D+
Sbjct  332  GFTASRIREAIERVSDEYVRSGIEFLKNQEDL  363



>ref|XP_003550654.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=460

 Score =   248 bits (632),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 130/281 (46%), Positives = 176/281 (63%), Gaps = 16/281 (6%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAES   L +LGDFSP  E N+LVP+VDY+  PI ++P+ + QLT F+CGG S+    
Sbjct  97   FIEAESSLTLENLGDFSPSSEYNNLVPNVDYTL-PIHELPVVLIQLTNFKCGGFSISLNT  155

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGP-------RR  484
            SH VADG    HFL EWA L+ G+ L +AP  DR      V  +  P   P       + 
Sbjct  156  SHAVADGPSALHFLCEWARLSRGELLQTAPLFDRT-----VFRAGEPPLMPLTECRVHKD  210

Query  483  VFDHSPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEV  304
             F H PPL++GQ+++  ER K+T V  L+L+K Q+  LK  AN   S +A  R YTR+E 
Sbjct  211  QFIH-PPLLLGQTNNTEERKKKTTVVILKLTKTQVETLKKTANESNSGHA--RCYTRYES  267

Query  303  ITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIIS  124
            +T H+WR ACKAR HK  QPT L   VD R RMEPPLP  YFGNA ++ V   ++G+++S
Sbjct  268  VTGHVWRTACKARGHKEDQPTALGVCVDSRSRMEPPLPKGYFGNATLDTVATSLAGDLVS  327

Query  123  RPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            +PL    S+IR+AI+ VT EYV   I+F +N+ D+ + Q+L
Sbjct  328  KPLGYACSRIREAIERVTDEYVRTGIEFLKNQEDLSRFQDL  368



>ref|XP_008231463.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Prunus 
mume]
Length=454

 Score =   247 bits (630),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 126/280 (45%), Positives = 177/280 (63%), Gaps = 13/280 (5%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAESD  L DLGDFSP PE + L+P+VDY+  PI ++PL   QLT+F+CGG SL   I
Sbjct  96   FIEAESDLKLDDLGDFSPSPESHSLLPTVDYNL-PIHELPLLFVQLTRFKCGGFSLALEI  154

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH---  472
            SH V DG   CHF+ EWA LA G+P+   PF D +  L      +     P +VFDH   
Sbjct  155  SHAVTDGQSACHFIGEWAKLARGEPVGVMPFLDGQAFL------ARHLPAPTQVFDHIEF  208

Query  471  -SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAK--PRGYTRFEVI  301
              PP ++GQS D  E   +T ++ LRL+K Q+  LK  AN G ++N     R YTR+E +
Sbjct  209  NQPPNLLGQSDDLQESKMKTTLTMLRLTKEQVDKLKQMANEGTNFNNSDTKRPYTRYETL  268

Query  300  TAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISR  121
              HIWRCA ++R+HK +QPT L   VD R R++P LP+ YFGNAV  +    ++G+++S+
Sbjct  269  AGHIWRCASRSRNHKDEQPTALMVCVDFRCRIKPQLPEGYFGNAVFYMPATSLAGDLLSK  328

Query  120  PLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            PL   +S+IR+A++ VT +YV  A +  +NE D+ + Q+L
Sbjct  329  PLGYASSRIREAVEKVTMDYVLSAHERLKNEPDLTRFQDL  368



>ref|XP_010656623.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Vitis 
vinifera]
Length=457

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/273 (47%), Positives = 167/273 (61%), Gaps = 12/273 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +L+  ESDA + D GDF P  E+  L+PSVDY   PI ++PL + Q+TKF CGGISLG  
Sbjct  91   LLIAVESDAKIDDFGDFGPTQEIRALIPSVDYD-KPIHELPLLLVQVTKFSCGGISLGLG  149

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
              H++ DG    HF+SEWA +A G+  +S+PF DR  LL       +P+     VFDH  
Sbjct  150  ALHIMTDGLSASHFISEWAKIARGEQPNSSPFLDRSILL-------APEHLSAPVFDHPE  202

Query  471  -SP-PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
             SP PL++G+     ER +E+   TL+LSK Q+  LK  AN  RS +   R YTR+E + 
Sbjct  203  YSPQPLLIGKQDHMEERKRESATLTLKLSKDQVEKLKDKANKDRSASNNKRPYTRYEAVA  262

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             HIWR ACKAR H+ QQPTTL   VD R RMEPPLP  YFGNA   V     SGE++S+P
Sbjct  263  GHIWRSACKARQHESQQPTTLSIIVDARNRMEPPLPPRYFGNATFRVTAESTSGELVSKP  322

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            L   + K R AI+  T EY+  ++ + + + DV
Sbjct  323  LGYASGKARQAIEKATHEYLQSSLMYVKCQEDV  355



>emb|CBI36554.3| unnamed protein product [Vitis vinifera]
Length=480

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/273 (47%), Positives = 167/273 (61%), Gaps = 12/273 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +L+  ESDA + D GDF P  E+  L+PSVDY   PI ++PL + Q+TKF CGGISLG  
Sbjct  87   LLIAVESDAKIDDFGDFGPTQEIRALIPSVDYD-KPIHELPLLLVQVTKFSCGGISLGLG  145

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
              H++ DG    HF+SEWA +A G+  +S+PF DR  LL       +P+     VFDH  
Sbjct  146  ALHIMTDGLSASHFISEWAKIARGEQPNSSPFLDRSILL-------APEHLSAPVFDHPE  198

Query  471  -SP-PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
             SP PL++G+     ER +E+   TL+LSK Q+  LK  AN  RS +   R YTR+E + 
Sbjct  199  YSPQPLLIGKQDHMEERKRESATLTLKLSKDQVEKLKDKANKDRSASNNKRPYTRYEAVA  258

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             HIWR ACKAR H+ QQPTTL   VD R RMEPPLP  YFGNA   V     SGE++S+P
Sbjct  259  GHIWRSACKARQHESQQPTTLSIIVDARNRMEPPLPPRYFGNATFRVTAESTSGELVSKP  318

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            L   + K R AI+  T EY+  ++ + + + DV
Sbjct  319  LGYASGKARQAIEKATHEYLQSSLMYVKCQEDV  351



>ref|XP_011076842.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Sesamum 
indicum]
Length=493

 Score =   243 bits (620),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 133/276 (48%), Positives = 175/276 (63%), Gaps = 14/276 (5%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
            L EAESDA L +L +F    E + LVPS D     ++ +PL   QLT+F+CGG+ LG A+
Sbjct  96   LTEAESDATLDELKEF----EHHQLVPSFD-----LEQLPLVAVQLTRFKCGGVCLGVAM  146

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVG---ESSSPQGGPRRVFDH  472
            SH   DG    HF +EWA LA G+ L + PF DR+ LL  VG    S++P   P   FD 
Sbjct  147  SHAAVDGQSASHFYTEWARLARGEQLETQPFLDRK-LLGDVGRKPHSAAPPLQPPPEFD-  204

Query  471  SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAH  292
             PPL++G+S  ++ER K T  ++LRL+K QI  ++  AN  R   A    +T +EVITAH
Sbjct  205  VPPLLIGESGCKNEREKTTTRASLRLTKFQIEMMRRKANENRGPAAAGSSFTSYEVITAH  264

Query  291  IWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQ  112
            IWRC CKAR H  +Q + L  SVDIRRRM PPLP +Y GNAV++VV    +GE++S+PL 
Sbjct  265  IWRCTCKARRHVREQRSRLSISVDIRRRMRPPLPKTYLGNAVLDVVALDYAGELVSKPLS  324

Query  111  DVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQE  4
              ASKIR+AI+ VT+EYV   IDF R   D+   Q+
Sbjct  325  YAASKIREAINKVTNEYVTSTIDFLRAVDDLSSFQD  360



>ref|XP_010265516.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Nelumbo nucifera]
Length=447

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/275 (46%), Positives = 173/275 (63%), Gaps = 14/275 (5%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
            L+EAES+  + D GDF P PE+  L+P VDY G PI +IPL + QLT F CGGIS+G AI
Sbjct  93   LLEAESENRIDDFGDFRPTPEIRQLIPRVDY-GLPINEIPLLLVQLTSFPCGGISIGVAI  151

Query  642  SHVVADGHGLCHFLSEWANLASG-KPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            SH V DG    +F+  W  +A G KP  + PF DR  L     ++S P   PR  FDH  
Sbjct  152  SHSVVDGKSAINFIGAWTKIARGEKPDPTPPFLDRTVL-----QASGPVVAPR--FDHVE  204

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
              S P ++G+  D+ ER KET V   +L+K Q+  LK+ AN GR+ ++  R YTR+E I 
Sbjct  205  FDSLPHLIGRPDDKEERAKETTVEMFKLTKEQVEKLKSKANEGRTKDSG-RAYTRYEAIA  263

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             H+WRCACKAR+H+ +Q T +   VD R R+ PPLP  YFGNA+   +    SG+++ +P
Sbjct  264  GHVWRCACKARAHEREQLTKVRIIVDCRNRLNPPLPQGYFGNAIXPTIATARSGDLMDQP  323

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  13
            L   A KIR+A+  +T EYV  AIDF R++ D+++
Sbjct  324  LGYAAGKIREAVVKMTDEYVRSAIDFLRSQPDLMR  358



>ref|XP_010673351.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Beta vulgaris 
subsp. vulgaris]
Length=457

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/275 (46%), Positives = 171/275 (62%), Gaps = 3/275 (1%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPEL-NHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            L+EA S   L+D GDF+    L  +L+P VDY   PI ++PL +GQLT+F+CGGI LG  
Sbjct  96   LIEANSSGELSDFGDFASQTNLFENLLPYVDYD-KPIDELPLMLGQLTQFKCGGICLGVN  154

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            ISHVVADG    HF+SEWA LA G+PL  AP+ +   + R      +  G    +    P
Sbjct  155  ISHVVADGQSALHFMSEWARLARGEPLEMAPYFNPD-IFRSQDLPKTSIGFDTHIEFKPP  213

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            PL++G +++  ER K T V+ L LSK  +  LK     G   +     YTR+EVI AHIW
Sbjct  214  PLLIGANNNLEERKKATIVAILPLSKEHVDILKKDVKEGSIDDHNMYSYTRYEVIAAHIW  273

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            R ACKAR H  +QPT L FSVD+R R++PPLP  YFGNA+++VV    SG+I+++PL   
Sbjct  274  RSACKAREHHLEQPTCLGFSVDVRNRLQPPLPPKYFGNAILDVVASSKSGDIMTKPLHYT  333

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
             +KIR AI+ V +EY+   IDF++   D+   Q+L
Sbjct  334  CAKIRQAIEKVNNEYIWSNIDFWKKLPDLTPFQDL  368



>gb|EYU26551.1| hypothetical protein MIMGU_mgv1a006988mg [Erythranthe guttata]
Length=423

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/246 (48%), Positives = 163/246 (66%), Gaps = 14/246 (6%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
            L+EA +++ L +LGDFSP P  +HL+P ++YS  PI++IPL   QLT+FRCGG++L + I
Sbjct  97   LIEARTESDLDELGDFSPSPHFDHLIPQMNYS-SPIEEIPLLSVQLTEFRCGGVTLSYNI  155

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH---  472
            SH   DG    HF++EWA LA G+PL+  P  DR+    G   S+ P+      F+H   
Sbjct  156  SHAATDGQSALHFITEWARLARGEPLAEEPVLDRKLFRAGEPPSARPR------FEHVQF  209

Query  471  -SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PPL++GQSS E+ER KET  + L+LSK Q+  L+  AN   +     RGY+R+E +T 
Sbjct  210  DPPPLLMGQSSSENERRKETTTAMLKLSKAQLEILRNEANGSIT---AARGYSRYEAVTG  266

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            H+WR AC AR H  +QP +L   VD+RRRM+PPLPD YFGNA+I+VV   ++GE+++RPL
Sbjct  267  HLWRSACMARGHTREQPISLGLCVDVRRRMKPPLPDRYFGNAIIDVVARSLAGELMTRPL  326

Query  114  QDVASK  97
               A K
Sbjct  327  GYAAGK  332



>ref|XP_004507883.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cicer 
arietinum]
Length=460

 Score =   239 bits (611),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 120/279 (43%), Positives = 174/279 (62%), Gaps = 9/279 (3%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPEL-NHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
             +EA+S   L D+ DFSP  +   +L+P +DY+  PI DIPL + QLT F+CGG+S+   
Sbjct  101  FIEAQSSLTLTDISDFSPSSDYYRYLIPRIDYTL-PINDIPLVIVQLTSFKCGGVSISLL  159

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQ----GGPRRVF  478
            +SH VADG    HF SEWA LA G+P+ + PF DR  L   VGES SP         R F
Sbjct  160  VSHAVADGQSALHFTSEWARLARGEPIKTMPFVDRNAL--HVGESQSPLLPQCSNSEREF  217

Query  477  DHSPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
            +  PP ++G + +  ER K+T V+ +++SK Q+  L+  AN      +  RGYTR+E +T
Sbjct  218  NE-PPFLLGNTDNIEERKKKTTVAIIKVSKTQVEKLRKTANESWGKPSNGRGYTRYETVT  276

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             H+WR A KAR H   QPT L   VD R R++P LP  YFGNA ++VV   ++G+++S+P
Sbjct  277  GHVWRTASKARGHGNDQPTALGVCVDWRCRVDPNLPKGYFGNATLDVVATSLAGDLMSKP  336

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            L   +S+IR+AI+ V +EYV   +++++   D+ K Q+L
Sbjct  337  LGYASSRIREAIEKVNNEYVRLGMEYFKKHEDLTKFQDL  375



>ref|XP_003610074.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase-like 
protein [Medicago truncatula]
 gb|AES92271.1| spermidine hydroxycinnamoyl transferase [Medicago truncatula]
Length=457

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/275 (44%), Positives = 170/275 (62%), Gaps = 8/275 (3%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSP-CPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
             +EAES   L++LGDFSP C    +L+P +DY+  PI+DIPL + QLT F+CGG S+   
Sbjct  103  FIEAESSLTLSELGDFSPSCEYYPYLIPHIDYT-RPIEDIPLVIVQLTNFKCGGASISLL  161

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            ISH VADG    HF SEWA LA G+P+ + P+ D   L      SS           + P
Sbjct  162  ISHAVADGPSALHFTSEWARLARGEPVRTMPYFDINVL------SSRSNVNVNEWEFNEP  215

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            PL++G S++  ER K+T V+ L++SK Q+  L+  AN      +  RGYTR+E +T H+W
Sbjct  216  PLLLGNSNNVEERKKKTTVAMLKVSKTQVEKLRKTANESWEKPSNGRGYTRYETLTGHVW  275

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            R A KAR H   Q T+L   VD R R+EP LP  YFGN  ++VV   ++G++IS+PL   
Sbjct  276  RSASKARGHANDQQTSLGVCVDWRNRVEPNLPKGYFGNGTLDVVATSLAGDLISKPLGYA  335

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            +S+IR+AI+ V  EYV   I++++ + D+ K Q+L
Sbjct  336  SSRIREAIEKVNDEYVRMGIEYFKKQEDLTKFQDL  370



>gb|EPS69670.1| hypothetical protein M569_05094, partial [Genlisea aurea]
Length=445

 Score =   237 bits (604),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/275 (45%), Positives = 171/275 (62%), Gaps = 8/275 (3%)
 Frame = -2

Query  822  LVEAESDAVLADLGDF-SPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
             VEAE    + +LG+F +  PE   L+P VDY    + + PL + Q+TKFRCGG  L  A
Sbjct  91   FVEAECGNDMDELGEFGASSPEFESLIPKVDYCSGDVVEFPLLLVQVTKFRCGGACLSLA  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            ISH V DG    HF+SEWA LA G+ +   P  DR+ LLR   +SS+ Q   R      P
Sbjct  151  ISHAVVDGQSSLHFISEWARLARGELIQHLPILDRK-LLRAGEKSSATQSAFRHKQFDPP  209

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            PLIVG+   E+ER K T V+ LR+S+ Q+  LK AAN+GR      R +TR+E +TAH+W
Sbjct  210  PLIVGEIDAENERKKPTAVAMLRISRSQVRTLKLAANDGR------RDFTRYEALTAHVW  263

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            R AC+AR+ + +QPT L   V+IRRR+ P LP  +FGNA+++V+    SGE+   PL   
Sbjct  264  RSACRARALRDEQPTNLAICVEIRRRVSPNLPAKFFGNAIVDVIASSSSGELTGNPLGFA  323

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            A K+++AI+ VT EYV+  ID+ +N  D+   Q++
Sbjct  324  AGKVKEAIESVTGEYVDSVIDYLKNLEDLAAVQDV  358



>ref|XP_002276550.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Vitis 
vinifera]
Length=445

 Score =   236 bits (603),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 124/273 (45%), Positives = 161/273 (59%), Gaps = 12/273 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +L+  ES+  + D GDF P PE+  L+PSVDY   PI ++PL + QLTKF CG +SLG  
Sbjct  91   LLIAVESEGKIDDYGDFRPTPEIRALIPSVDYD-KPIDELPLLLVQLTKFSCGSMSLGLG  149

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            ISH +ADG    HF+SEWA +A G+  +S PF DR  LL       +P+     VFDH  
Sbjct  150  ISHTIADGLSALHFISEWAKIARGEQANSPPFLDRSVLL-------APEHLTAPVFDHPE  202

Query  465  ----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
                PL++G+  +  ER +ET    L+LSK Q+  LK  AN  RS +   R YTR+E I 
Sbjct  203  FGPQPLLIGKQDNMEERKRETTTLMLKLSKDQVEKLKDKANKDRSPSDNKRPYTRYEAIA  262

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             HIWR ACKAR H+ QQPT L   VD R RMEPPLP  YFGN    V     SGE++S  
Sbjct  263  GHIWRSACKARQHESQQPTLLSIIVDARNRMEPPLPPRYFGNGTFRVTAETTSGELVSNS  322

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            L   + K R AI+  T EY+  ++ + + + DV
Sbjct  323  LGFASGKARQAIEKATHEYLQSSLVYVKCQEDV  355



>gb|AFD64619.1| putative hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyltransferase 
[Camellia sinensis]
Length=447

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/275 (45%), Positives = 169/275 (61%), Gaps = 13/275 (5%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAES+A + D GDF P  +   L+PSVDY G PI ++PL + Q+TKF CGG SLG  I
Sbjct  93   FLEAESEAKIDDFGDFCPSSKTTALIPSVDY-GRPIHELPLLLVQVTKFSCGGFSLGLGI  151

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS--  469
            SH +ADG    HF+SEWA +A G+   + PF DR  L     +   P   P+  FDHS  
Sbjct  152  SHALADGECAAHFISEWARIARGEKPENFPFLDRTIL-----QLEDPL--PKTSFDHSEF  204

Query  468  --PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGR-SYNAKPRGYTRFEVIT  298
               PL++G S++  ER K+T V+ L+LSK QI+ LK  AN  R S  +  R +TR+  +T
Sbjct  205  KPTPLLIGHSNNTEERNKKTIVAILKLSKEQINKLKNKANEYRNSETSTNRAFTRYGSVT  264

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
            AH+WRCACKAR H+ +Q T +  +VD R R++  LP  YFG  V+ VV    SG+I+S+P
Sbjct  265  AHMWRCACKARQHESEQLTNIRIAVDFRSRLQSSLPKWYFGCTVLPVVTTPTSGDIVSKP  324

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  13
            L   A K+R+ I  VT EY+     F +NE D+ K
Sbjct  325  LGYTAKKLREGIGKVTDEYIRSCFVFLKNEPDLSK  359



>gb|EPS68189.1| hypothetical protein M569_06582, partial [Genlisea aurea]
Length=435

 Score =   231 bits (589),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 172/273 (63%), Gaps = 19/273 (7%)
 Frame = -2

Query  825  VLVEAESDAV--LADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLG  652
            VL+EA  D V  +  L DF+   +  +LVP VDYSG+ I DIPL + QLT FR GG+S+G
Sbjct  89   VLIEAACDDVEDIDVLYDFAKSGDCQNLVPQVDYSGE-IDDIPLLLVQLTAFRRGGVSVG  147

Query  651  FAISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGE--SSSPQGGPRRVF  478
             + SH V DG  + HFLSEW+ +A G+P+   PF  R   + G  +  SS P        
Sbjct  148  LSFSHAVVDGKSVGHFLSEWSRIARGEPIGELPFLGREITIAGDAKPLSSFPPA------  201

Query  477  DHSPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
                PLI+G++    ER KET ++ L+++K QI ALK  AN  R+   KP G  R++ I 
Sbjct  202  ----PLIIGETDGRKEREKETTLTQLKITKSQIEALKKEAN--RTAGDKPCG--RYKAIA  253

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
            AH+WR AC+ARSH+  QPT +C  VD+R+R+ P LPD+YFGNAV+  +    SGE++ +P
Sbjct  254  AHVWRSACRARSHEDNQPTWMCIYVDVRKRVSPNLPDNYFGNAVVPAIAESFSGELVKKP  313

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            L     KIR+AIDGVTSE+V+ A+ F RN  D+
Sbjct  314  LGFTVDKIREAIDGVTSEFVHSAVRFIRNLDDL  346



>emb|CAN72449.1| hypothetical protein VITISV_011069 [Vitis vinifera]
Length=445

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/275 (45%), Positives = 163/275 (59%), Gaps = 12/275 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +L+  ESDA + D GDF P  E+  L+PSVDY+  PI ++PL + Q+TKF CG ISLG  
Sbjct  91   LLIAVESDAKIDDFGDFRPTQEIQALIPSVDYN-KPIHELPLLLVQVTKFSCGSISLGLG  149

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
             S V+ADG     F+  WA +A G+  +S PF DR  LL       +P+     VFDH  
Sbjct  150  TSRVMADGLSALPFIQGWAKIARGEQPNSPPFLDRSILL-------APENLTAPVFDHPE  202

Query  471  -SP-PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
             SP PL++G+     ER +ET    L+LSK Q+  LK  AN  RS +   R YTR+E + 
Sbjct  203  YSPQPLLIGKQDQMEERKRETATLMLKLSKDQVEKLKDKANKDRSASNNKRPYTRYEAVA  262

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             HIWR ACKAR H+  QPTTL   +D R RMEPPLP  YFGNA   V     SGE++S+P
Sbjct  263  GHIWRSACKARQHESLQPTTLSIILDARNRMEPPLPPRYFGNATFRVTAESTSGELVSKP  322

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  13
            L   + K R AI+  T EY+  ++ + + + DV +
Sbjct  323  LGYASGKARQAIEKATHEYLQSSLVYVKCQEDVTQ  357



>gb|AES90726.2| spermidine hydroxycinnamoyl transferase [Medicago truncatula]
Length=457

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/275 (41%), Positives = 171/275 (62%), Gaps = 7/275 (3%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPEL-NHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
             +EA+S   L++LGDFSP  E   +L+P +DY+  P++DIPL + QLT F CG +S+   
Sbjct  102  FIEAQSSLTLSELGDFSPSSEYYRYLIPHIDYTL-PMEDIPLVIFQLTNFNCGVVSISLL  160

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            ISH VADG    HF+ EWA +A G+PL   P      +L     +S  +  P ++     
Sbjct  161  ISHAVADGPSALHFIFEWARIARGEPLKMVPRFLDTNMLSPKRCNSVNKWEPDQL-----  215

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            PL++G   +  ER K+T V+ + LSK Q+  L+  AN   +  +  RGY+R+E +T HIW
Sbjct  216  PLLLGNLDNVEERKKKTTVAIINLSKTQVEKLRKTANESWNKPSNGRGYSRYETVTGHIW  275

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            R ACKAR HK  QPT L   VD RRR+EP LP  YFGNA+++V+   ++G+++S+PL   
Sbjct  276  RSACKAREHKNDQPTALGVCVDWRRRVEPNLPKGYFGNAILDVLATSLAGDLMSKPLGYA  335

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            +S+IR+A++ V  EY+    ++++ + D+ K Q+L
Sbjct  336  SSRIREAVEKVNDEYIRLGNEYFKKQEDLTKFQDL  370



>ref|XP_010541075.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Tarenaya 
hassleriana]
Length=532

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 123/275 (45%), Positives = 168/275 (61%), Gaps = 6/275 (2%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             V AES+A L+D  DF   PE + LV  V+Y  +PI+ IPL + Q+TKF+CGG S+   +
Sbjct  179  FVVAESEAELSDSDDFYLLPEYDKLVAQVNYK-NPIEKIPLLLIQITKFKCGGFSISGNV  237

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSPP  463
            SHV+ DG    HF+SEWA +A G+PL   PF DR+ L  G   +   Q   R+V D  P 
Sbjct  238  SHVIVDGQSTFHFISEWARIARGEPLGVIPFLDRKILRAGEPPAMDSQPLDRKVLDQPPS  297

Query  462  LIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKP-RGYTRFEVITAHIW  286
            +I      E  + K+TKV+ LRLSK  +  L+  AN   S  A P RG+TR+E +T H+W
Sbjct  298  MI--NEEREKNKKKKTKVAMLRLSKTDVQKLRNRANMSES--ADPARGFTRYEAVTGHVW  353

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            R   +AR H PQQPT +   +D R RM+PPLP  YFGNA ++V+    SGE+IS+PL   
Sbjct  354  RSVSRARGHLPQQPTAVGLCIDSRSRMQPPLPQGYFGNATVDVIAVSTSGELISKPLGHA  413

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
              KIR+AI  VT +YV   I++ + + D+ K Q+L
Sbjct  414  VRKIREAIKKVTDDYVRSEIEYLKRQEDLRKFQDL  448



>emb|CDP18830.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 116/275 (42%), Positives = 169/275 (61%), Gaps = 9/275 (3%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +L+EA+S+  + D GDF P P+++ L+P +DY+  P+ ++PL + Q+T+F CGG+SLG A
Sbjct  89   LLLEAQSELKIEDFGDFCPTPQISALIPPIDYNNTPLHEVPLLLVQITRFACGGVSLGLA  148

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            +SHV+ DG   CHF +EWA +A G+     P+ D R +L+   E  S      +  D  P
Sbjct  149  VSHVIVDGQSGCHFAAEWAKIARGEKSDDQPYLD-RTILQQYEEYPSSIAPKLQYSDFYP  207

Query  465  -PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANN-----GRSYNAKPRGYTRFEV  304
             P+++GQSS   ER K T  +   LSK QI  LK  ANN      ++ N +P  ++RF  
Sbjct  208  LPVLIGQSSSLEERKKATTCAMFPLSKEQIEQLKNNANNHHDLVHKTNNHQP--FSRFVA  265

Query  303  ITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIIS  124
            ++AHIW+C  KAR H P Q T L  +VD R R++PPLP  YFGNAV+ V    ++G++ S
Sbjct  266  VSAHIWKCLSKARMHSPDQETVLYVTVDFRSRLKPPLPGRYFGNAVLPVPARAIAGDLQS  325

Query  123  RPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            RP    +SKI++AID VT EYV   +   +N  +V
Sbjct  326  RPPSYASSKIKEAIDKVTDEYVRSYLACMKNMPEV  360



>ref|XP_008231492.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Prunus 
mume]
Length=454

 Score =   226 bits (577),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 114/280 (41%), Positives = 173/280 (62%), Gaps = 13/280 (5%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAESD+ L D  DF P P  + L P+VDY+  PI ++P+ + QLT+F+CGG+ L   I
Sbjct  96   FIEAESDSKLDDFDDFYPSPVYHSLFPAVDYNL-PIHELPILLVQLTRFKCGGVCLSLKI  154

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS--  469
            SH V DGH    F  EWA +A G+P++  PFHDR        ++  P      VF+H+  
Sbjct  155  SHAVVDGHSASRFYLEWARVARGQPIAVMPFHDRNAF-----QARHPPA-QSLVFEHTEL  208

Query  468  --PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAK--PRGYTRFEVI  301
              PP+++GQS+D   + K+   + LRL++ Q+  LK  AN G ++N     R YTR+E +
Sbjct  209  NQPPILLGQSNDIEVKNKKNTNTMLRLTRDQVERLKQMANEGTNFNNSDTKRPYTRYETV  268

Query  300  TAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISR  121
              HIWRCA K+R+ + +Q   L   +D R R++PPLP  YFGNA   V    +SG+++S+
Sbjct  269  AGHIWRCASKSRNLRDEQAMQLAVWMDFRSRIKPPLPQGYFGNATFYVNATSLSGDLLSK  328

Query  120  PLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            PL   +S+IR+AI+ VT++YV  A++  +N+ D+ + Q+L
Sbjct  329  PLGYASSRIREAIEKVTNDYVLSALEKLKNQPDLTQFQDL  368



>ref|XP_003608529.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase-like 
protein [Medicago truncatula]
Length=495

 Score =   227 bits (579),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 113/275 (41%), Positives = 171/275 (62%), Gaps = 7/275 (3%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPEL-NHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
             +EA+S   L++LGDFSP  E   +L+P +DY+  P++DIPL + QLT F CG +S+   
Sbjct  102  FIEAQSSLTLSELGDFSPSSEYYRYLIPHIDYTL-PMEDIPLVIFQLTNFNCGVVSISLL  160

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            ISH VADG    HF+ EWA +A G+PL   P      +L     +S  +  P ++     
Sbjct  161  ISHAVADGPSALHFIFEWARIARGEPLKMVPRFLDTNMLSPKRCNSVNKWEPDQL-----  215

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            PL++G   +  ER K+T V+ + LSK Q+  L+  AN   +  +  RGY+R+E +T HIW
Sbjct  216  PLLLGNLDNVEERKKKTTVAIINLSKTQVEKLRKTANESWNKPSNGRGYSRYETVTGHIW  275

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            R ACKAR HK  QPT L   VD RRR+EP LP  YFGNA+++V+   ++G+++S+PL   
Sbjct  276  RSACKAREHKNDQPTALGVCVDWRRRVEPNLPKGYFGNAILDVLATSLAGDLMSKPLGYA  335

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            +S+IR+A++ V  EY+    ++++ + D+ K Q+L
Sbjct  336  SSRIREAVEKVNDEYIRLGNEYFKKQEDLTKFQDL  370



>gb|EYU25632.1| hypothetical protein MIMGU_mgv1a006215mg [Erythranthe guttata]
Length=452

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/280 (43%), Positives = 166/280 (59%), Gaps = 13/280 (5%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
            L EAESDA + D GDF+P   +  L+PSVDY+  PI +IPL + QLT+FRCGG+S+G  I
Sbjct  96   LFEAESDAAVEDFGDFTPTAAIQALIPSVDYT-TPIDEIPLVIVQLTRFRCGGVSVGLGI  154

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS--  469
            SHV+ADG    HF+ EW   A G   +  PF DR+ L       + P+  P   FD +  
Sbjct  155  SHVMADGPSALHFVDEWTKFARGVGPAVPPFLDRKVL------ETPPEKAPAVKFDPAVL  208

Query  468  --PPLIVGQS-SDESERMKETKVSTLRLSKPQIHALKAAANNGRSY-NAKPRGYTRFEVI  301
              PP +VG+  S   +R K   V+ L L+K QI  L+  AN    Y N+  RGY+RFE +
Sbjct  209  RRPPTLVGEDDSSLEQRKKPIGVAFLTLTKLQIEKLRNKANLDFDYENSGGRGYSRFEAV  268

Query  300  TAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISR  121
             AHIWRC  KAR H  +Q T+L F  D R +++PPLP +YFGNA+I V     SG ++  
Sbjct  269  AAHIWRCTSKARGHVAEQQTSLHFVADFRNKLQPPLPKNYFGNALIRVEATDTSGSLLLN  328

Query  120  PLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            P+   + KIR+A++ VT + V   +D+ +   DV + + L
Sbjct  329  PIGAASRKIREAVEKVTEDTVRAYLDYLKELPDVGRFRSL  368



>emb|CDP21167.1| unnamed protein product [Coffea canephora]
Length=453

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 162/262 (62%), Gaps = 9/262 (3%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +L+EA+S+  + D GDF P P++  L+P +DY+  P+ ++PL + Q+TKF CGG+SLG A
Sbjct  92   LLLEAQSELKIEDFGDFCPTPQIRALIPPIDYNNTPLHEVPLLLVQITKFACGGVSLGSA  151

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            +SHV+ DG   CHF++EWA +A G+     P+ D R +L+   E  S      +  D  P
Sbjct  152  VSHVIVDGQSGCHFVAEWAKIARGEKSDDQPYLD-RTILQQYEECPSSIAPKLQYPDFYP  210

Query  465  -PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANN-----GRSYNAKPRGYTRFEV  304
             P+++GQSS   ER K T  +  +LSK QI  LK   NN      ++ N  P  ++RF  
Sbjct  211  LPVLIGQSSSLEERKKATTCAMFQLSKEQIEQLKNNVNNHHDLVHKTSNHPP--FSRFVA  268

Query  303  ITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIIS  124
            ++AHIW+C  KAR H P Q T L  +VD R R++PPL   YFGNAV+ V    ++G++ S
Sbjct  269  VSAHIWKCLSKARMHSPDQETVLYVTVDFRNRLKPPLSGRYFGNAVLPVPARAIAGDLQS  328

Query  123  RPLQDVASKIRDAIDGVTSEYV  58
            RP    +SKI++AID VT EYV
Sbjct  329  RPPSYASSKIKEAIDKVTDEYV  350



>ref|XP_011083883.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Sesamum 
indicum]
Length=447

 Score =   218 bits (555),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 163/278 (59%), Gaps = 13/278 (5%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
            + EAES++ + D GDF+P P +  L+PSVDY+  PI +IPL + QLT+F CGG+S+G  +
Sbjct  95   IFEAESESKVEDFGDFTPTPAIQALIPSVDYT-TPIDEIPLVIVQLTRFSCGGVSIGLGV  153

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS--  469
            SHV+ADG    HF+ EWA ++ G      PF DR+ L     E+  P       FD S  
Sbjct  154  SHVMADGPSALHFVDEWAKISRGAEPIVPPFLDRKVL-----ETDKPLSS---TFDPSVL  205

Query  468  --PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PP ++GQ  +  +R K   V+ L L+K QI  L+  AN         RGY+RFE + A
Sbjct  206  RPPPTLIGQEDNLEQRKKPITVAFLNLTKLQIEKLRNKANLDVDKETNSRGYSRFEAVAA  265

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            HIWRC  KAR H  +Q T+L F  D R +++PPLP ++FGNA+I V     SG ++S  +
Sbjct  266  HIWRCTSKARGHIAEQQTSLHFVADFRNKLKPPLPKTFFGNALIRVEATDKSGSLLSNSI  325

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
               + KIR+A++ VT + V   +DF +   DV + + L
Sbjct  326  GTASKKIREAVEKVTDDTVRAYLDFLKGLPDVGRFRSL  363



>gb|ADD71921.1| BAHD-type hydroxycinnamoyltransferase [Actaea racemosa]
Length=448

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/273 (42%), Positives = 159/273 (58%), Gaps = 10/273 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            V++EAESDA L D GDF P  E   L P VDY+ D + ++PL + QLT+F+CGGI +G A
Sbjct  92   VIIEAESDARLEDFGDFRPTSETTKLAPYVDYAKD-VSELPLLLVQLTRFKCGGIGIGIA  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPR--RVFDH  472
            +SH+V+DG G   F++ WA +  G+     PFHDR    +G      P   PR   V   
Sbjct  151  MSHIVSDGKGAFGFITTWAKINRGEKGIIEPFHDRTAFYKG-----DPTAKPRCDHVELK  205

Query  471  SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAH  292
              P+++G  S + ER KET    L LSK Q+  LK  +N G+  +   R Y+RFE ++ H
Sbjct  206  GYPVLLGNKSAKEERAKETTTRMLNLSKNQVDKLKEKSNLGKPKDYVGREYSRFEAMSGH  265

Query  291  IWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP--  118
            IWRCA KAR H+ +Q T+L  ++D R R+ PPLP  Y GNA +       SGE++S P  
Sbjct  266  IWRCASKARRHENEQLTSLRITIDCRNRLRPPLPPRYSGNATMVTTSIAESGELLSNPLG  325

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            L  V S IR  ID V  +Y+  A DF  ++ D+
Sbjct  326  LGFVCSVIRKCIDKVDDDYIKSATDFLISQDDL  358



>ref|XP_010669388.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Beta 
vulgaris subsp. vulgaris]
Length=460

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 121/277 (44%), Positives = 155/277 (56%), Gaps = 5/277 (2%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPE-LNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            L+E +S   + D GDF    E   HL+P ++Y   PIQD+P+   Q+T+F CGG+S+G +
Sbjct  99   LIEVDSTMKITDFGDFYSSSENFQHLLPRIEYYEKPIQDLPVLAVQVTRFACGGLSVGIS  158

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRG--VGESSSPQGGPRRVFDH  472
            +SHVV DG    HF  EWA LA G+PL   PF DRR L     V  S   +       D 
Sbjct  159  MSHVVVDGKSAFHFTEEWARLARGEPLEFVPFLDRRVLQAEDHVSRSKMTENIAGESMDF  218

Query  471  SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSY--NAKPRGYTRFEVIT  298
               L      D  E  K+   + + L+K +I  LK  AN  +    +   R Y+RFEVIT
Sbjct  219  FSQLRYFGEEDNLEWGKQVTPTFVYLTKDKIERLKEVANISKELMNDNGVRPYSRFEVIT  278

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
            AHIWRC  KAR  K +  TTL   VD R RMEPPLP  YFGNA+I++ I    GE+IS P
Sbjct  279  AHIWRCVTKARELKNEDITTLIACVDARGRMEPPLPPRYFGNAIIDIEISSCVGELISNP  338

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQ  7
            L    SKIR+A   V +EYV   I+FY+N+  V K Q
Sbjct  339  LSYACSKIREATTKVNNEYVLETIEFYKNQKSVSKYQ  375



>ref|XP_007219083.1| hypothetical protein PRUPE_ppa014960mg, partial [Prunus persica]
 gb|EMJ20282.1| hypothetical protein PRUPE_ppa014960mg, partial [Prunus persica]
Length=446

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 122/317 (38%), Positives = 172/317 (54%), Gaps = 50/317 (16%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAESD  L DLGDFSP PE + L P+VDY+  P  ++PL   QLT+F+CGG SLG  I
Sbjct  58   FIEAESDLKLDDLGDFSPSPEYHSLFPTVDYNL-PFHELPLLFVQLTRFKCGGFSLGLEI  116

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH---  472
            SH V +G   CHF+ EWA L  G+P+   PF D +  L      +     P +VFDH   
Sbjct  117  SHAVTNGQSACHFIGEWAKLTRGEPIGVMPFLDGQAFL------ARHLPAPTQVFDHIEF  170

Query  471  -SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN---------------NGRSY  340
              PP+++GQS +  E   +T ++ L+L+K Q+  LK  AN                 RS 
Sbjct  171  NQPPILLGQSDNLQESKMQTTLTMLKLTKEQVDKLKQMANEVLLSGFTQTAEQFKTSRSL  230

Query  339  ----NAKPRGYTRFEV--------------------ITAHIWRCACKARSHKPQQPTTLC  232
                N     Y RF+                     +  HIWRCA ++R+HK +QPT L 
Sbjct  231  ISQVNPIVLHYGRFKAKSYLSRCHILLIGTLSKHLQLAGHIWRCALRSRNHKDEQPTALM  290

Query  231  FSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDVASKIRDAIDGVTSEYVNC  52
              VD+R RM+P LP  YFGNAV  +    ++ +++S+PL  V S+IR+A++ VT +YV  
Sbjct  291  VCVDLRSRMKPQLPQGYFGNAVFYMPATSLADDLLSKPLGYVLSRIREAVEKVTMDYVLS  350

Query  51   AIDFYRNEGDVIKRQEL  1
            A +  +NE D+ + Q+L
Sbjct  351  AHEKLKNEPDLTRFQDL  367



>ref|XP_010273689.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=443

 Score =   216 bits (549),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 120/271 (44%), Positives = 155/271 (57%), Gaps = 15/271 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD+ + DL +F P PEL+ LVP  +Y+G  I + P    Q+T FRCGGI LG  
Sbjct  92   LFVEAESDSCIDDLSNFMPTPELSKLVPYANYNGTQINEWPPLAVQITFFRCGGICLGMG  151

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSS--APFHDRRRLL-RGVGESSSPQGGPRRVFD  475
            ISHVVADG     F++ WA +A    +     PF DR  L  R   E  +P+      FD
Sbjct  152  ISHVVADGAASMLFITTWAQMARSNIVDPELTPFLDRAVLHPRVQNEEDTPK------FD  205

Query  474  H----SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAK--PRGYTR  313
            H     PP++VGQ  +  E+ KET V+ L+LS  Q+  LK  AN GR  N     R Y+R
Sbjct  206  HIEYKRPPMLVGQVDEMEEQKKETTVAVLKLSSDQVELLKRVANEGREKNGNVDNREYSR  265

Query  312  FEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGE  133
            +E +  HIWRCA KAR     Q T +  SVD RRR+ P  P +YFGNA         +G+
Sbjct  266  YESLAGHIWRCASKARGLVNDQETKVQVSVDCRRRLRPAFPANYFGNATFPTTPMAKAGD  325

Query  132  IISRPLQDVASKIRDAIDGVTSEYVNCAIDF  40
            +IS+PL   A KIR++I  +T EYV  AIDF
Sbjct  326  LISKPLSYAAGKIRESIKRMTDEYVRSAIDF  356



>ref|XP_010669430.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Beta 
vulgaris subsp. vulgaris]
Length=480

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 117/277 (42%), Positives = 162/277 (58%), Gaps = 11/277 (4%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPC-PELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            LVE ES   + D GDF  C  +L  L+  + Y   PIQD+P+   Q+T+FRCGG+SLG +
Sbjct  125  LVEVESTMKMVDFGDFYSCTKKLRELLVPMSYYTKPIQDLPVLAVQITRFRCGGLSLGMS  184

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            +SHVVADG    HF+ EW  LA GKPL  APF DRR +LR      +      R+ ++  
Sbjct  185  MSHVVADGRSAFHFIKEWGRLALGKPLEEAPFLDRR-ILRAEAHQKTVVDQSERM-NYFS  242

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKP----RGYTRFEVIT  298
             L +G    E +  K+   + + L+K  I  LK  AN+  +         R Y+RFEV+ 
Sbjct  243  QLRLG----EDKWGKQVSPTFVVLTKDMIMRLKEVANSISNREIVKDHLRRPYSRFEVVA  298

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
            AH+WRC CKAR  K +  +TL  +V    RMEPPLP S+FGNAV++  I    GE+ISRP
Sbjct  299  AHVWRCVCKARELKSEDMSTLMVAVAAHDRMEPPLPSSFFGNAVVDAEISSSVGELISRP  358

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQ  7
            L    S +R+AI  VT+EY+  +I+F + + ++ K Q
Sbjct  359  LSYACSIVREAIQKVTNEYILASIEFLKKQQNLTKYQ  395



>emb|CDP05692.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   213 bits (542),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 115/281 (41%), Positives = 177/281 (63%), Gaps = 14/281 (5%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
            L+EA     L  +GD SP P  ++LVPS++Y  + ++++PL V Q+TKF+   I+LG AI
Sbjct  100  LLEAVCRETLDQIGDLSPSPLFHNLVPSLNY--NDMKNLPLLVIQVTKFKDENIALGIAI  157

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRV------  481
            SH++ADG    HF+ EWA L SG  + + PF DRR +LRG  +S  P+ G  R+      
Sbjct  158  SHIIADGQSAFHFIIEWARLVSGNSIFTKPFLDRR-VLRG--DSRVPRSGGERIDVNSHA  214

Query  480  -FDHSP-PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFE  307
               H P P+++G++S + ++ K+T +  L LS  +I  LK+ A++G    A  R Y+ FE
Sbjct  215  ANPHLPLPIVIGETSAKIQQEKKTSIDLLILSTKEIEFLKSLASDG-IVPAMKRPYSTFE  273

Query  306  VITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEII  127
            VI+AH+WRCAC+AR    +QPT L F ++ R+ ++PPLP  YFGNA++++     SG ++
Sbjct  274  VISAHLWRCACRARLLIHEQPTVLSFPINFRKLIQPPLPVGYFGNAILDIRSMDFSGNLL  333

Query  126  SRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQE  4
            +  L + A+KIR  I  VTSE++   I+F + + D+ K QE
Sbjct  334  TGTLANTAAKIRKTILAVTSEFLYSEIEFLQMQTDLSKFQE  374



>ref|XP_010110725.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXC27890.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=451

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/276 (41%), Positives = 166/276 (60%), Gaps = 7/276 (3%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
            ++EAE+++ +++       PE +HL+P +DY+  PI ++P+ + QLT+F CGG+S+   I
Sbjct  96   VIEAETESKISEF--IGELPEYHHLIPKIDYT-LPIHELPIVLVQLTRFSCGGVSISLCI  152

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSPP  463
            SH V DG  L HF+ EWA    G+PL   PF DR+ L  G+  + +     +  F+   P
Sbjct  153  SHAVVDGQSLLHFIFEWAAQTRGEPLMFPPFLDRKALRAGIPAAIASHSLEKPSFNL--P  210

Query  462  LIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNA--KPRGYTRFEVITAHI  289
             ++ +  +  E+ KE  ++ LRLSK Q+  LK  AN G   N   K R YTRFE +  ++
Sbjct  211  SLITEQEEVKEKEKEASLAILRLSKDQVEKLKRIANQGLENNTDTKNRAYTRFETLAGYV  270

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCACKAR HKP+Q T L   VD RRRM PPLP  YFGNA+I+V+    +GE+ S PL  
Sbjct  271  WRCACKARGHKPEQQTALGVCVDTRRRMTPPLPWGYFGNAIIDVLATSAAGELTSNPLGY  330

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
             A +I++A++     YV  AI++ +   D+   Q+L
Sbjct  331  AAGRIQEAVEMANGVYVWGAIEYLKCHEDLRDFQDL  366



>ref|XP_011069658.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Sesamum 
indicum]
Length=453

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/284 (42%), Positives = 163/284 (57%), Gaps = 22/284 (8%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
            + EAES+  + D GDF+P P +  L+PSVDY+  PI +IPL + Q+T+FRCGG+S+G  I
Sbjct  96   IFEAESEGAVEDFGDFTPSPAIQALIPSVDYT-TPIDEIPLVIVQVTRFRCGGLSIGLGI  154

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS--  469
            SHV+ADG    HF+ EW   A G      PF DR+ L     E+  P       FD S  
Sbjct  155  SHVMADGPSALHFIDEWTKFARGVGPVIPPFLDRKAL-----ETEKPV---HCKFDPSVL  206

Query  468  --PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN------NGRSYNAKPRGYTR  313
              PP ++GQ     +R K   V+ L L+K QI  L+A AN      NG   N   RGY+R
Sbjct  207  RPPPTLIGQEDSLEQRKKPISVAFLSLTKLQIEKLRAKANLDFYKENG---NEGSRGYSR  263

Query  312  FEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGE  133
            FE + AHIWRC  KAR H  +Q T+L F  D R +M+P LP +YFGNA+I V     SG 
Sbjct  264  FEAVAAHIWRCTSKARGHIAEQQTSLHFVADFRNKMKPALPRNYFGNALIRVEATDKSGN  323

Query  132  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            +++  +   + KIR+A++ VT + V   +D+ +   DV + + L
Sbjct  324  LLTNSMGMASRKIREAVEKVTDDTVRAYLDYLKGLPDVGRFRSL  367



>ref|XP_010094198.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB55374.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=469

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/283 (42%), Positives = 175/283 (62%), Gaps = 27/283 (10%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSP-CPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
              E E D  L + GDF+P  P   +L PS+D S  PI ++P+   QLT+F+CGGISL  +
Sbjct  101  FFEVEFDVELVEFGDFAPSTPNYQNLFPSIDCSV-PIHELPVLFVQLTRFKCGGISLSLS  159

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRR--RLLRGVGESSSPQGGPRRVFDH  472
             SHVVADG  + HF++EWA ++  +P+   P H R   R+ R             RVFDH
Sbjct  160  FSHVVADGLSMAHFVTEWARVSREEPMQKMPCHVRNPSRITRTT-----------RVFDH  208

Query  471  S------PPLIVGQ-SSDESERMK---ETKVSTLRLSKPQIHAL-KAAANNGRSYNAKPR  325
            S      P L++ + +SD+ + +K   E  V +L+LSK Q+  L K A++N ++   K  
Sbjct  209  STDFLYLPRLLIEKPTSDDHQEVKNMIERTVISLKLSKYQVEKLRKFASDNIQNDEGKRV  268

Query  324  GYTRFEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEP-PLPDSYFGNAVINVVIF  148
             YTR+EV+ AHIWRC  K R +K +Q TT   ++D RRR+EP  LP+ YFGNA+ +V   
Sbjct  269  VYTRYEVLAAHIWRCMTKVRKNKDEQETTNIVTIDARRRLEPAALPEEYFGNAIFDVKAR  328

Query  147  GVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             ++G+++++PL   AS+IR+AI+ VT+EYV  AIDF +N+ D+
Sbjct  329  SLAGDLVAKPLGYGASRIREAIEKVTNEYVLSAIDFIKNQQDL  371



>ref|XP_010273688.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=454

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/276 (42%), Positives = 162/276 (59%), Gaps = 14/276 (5%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEA+SD+ + DLGDF+P  EL  LVP VDY+   I + PL + Q+T FRCGGI LG  
Sbjct  93   LFVEAKSDSDIDDLGDFAPTSELRGLVPYVDYNETHISEWPLVLVQITSFRCGGICLGLG  152

Query  645  ISHVVADGHGLCHFLSEWANLA-SGKPL---SSAPFHDRRRLLRGVGESSSPQGGPRRVF  478
            ISH+VADG     F++ WA +A +G  +      PF DR  L   V + ++ +      F
Sbjct  153  ISHIVADGAAAMLFVTSWAQIARTGSNVIGPKLMPFIDRTVLRARVRKDAAEKTTK---F  209

Query  477  DH----SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRF  310
            DH     PP++V Q  +  E  KET V+ L+LS+ Q+ +LK  AN G       R YTR+
Sbjct  210  DHIEYKRPPVLVSQVDETEELKKETTVAVLKLSQYQVESLKRRANEG---TMDEREYTRY  266

Query  309  EVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEI  130
            E +  H+W+CA +AR    +Q T +  SVD RRR+ P LP +YFGNA         +G++
Sbjct  267  ETLAGHMWKCASEARGLVDEQETKVHVSVDCRRRLRPALPANYFGNATFPTTPVAKAGDL  326

Query  129  ISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  22
            IS+PL   ASKIR+ +  +T EYV  A+DF  ++ D
Sbjct  327  ISKPLSYAASKIREGVRRMTDEYVRSAVDFLGSQRD  362



>emb|CDP21790.1| unnamed protein product, partial [Coffea canephora]
Length=322

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/229 (43%), Positives = 136/229 (59%), Gaps = 8/229 (3%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +LVEA+S+  + D GDF P P++  L+P +DYS  P+ ++PL + Q+TK  CGG+S+G A
Sbjct  92   LLVEAQSELKIEDFGDFCPTPQIRALIPPIDYSNTPLHEVPLLLVQITKLACGGVSIGVA  151

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
             SH++ DG    HF SEWA +A G+     PF DR    +   +  S      +  D  P
Sbjct  152  ASHIIVDGQSWFHFFSEWAKIARGEKSDDKPFLDRTIFQQYEDDHPSSTAPKSQYSDFFP  211

Query  465  -PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNG-----RSYNAKPRGYTRFEV  304
             P+++GQSS   ER K T  + L+LSK QI  +K  AN       ++ N  P  ++RF  
Sbjct  212  LPVLIGQSSSLEERKKSTVCAMLKLSKDQIEQIKNKANYQDLMIHKTNNESP--FSRFVA  269

Query  303  ITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINV  157
            ++AHIW+C  KAR H P Q T L  SVD R R++PPLP  YFGNAV+ V
Sbjct  270  VSAHIWKCLSKARMHNPDQETVLYVSVDFRNRLKPPLPGRYFGNAVLPV  318



>gb|AID69225.1| hydroxycinnamoyl coenzyme A shikimate hydroxycinnamoyl transferase, 
partial [Garcinia mangostana]
Length=367

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 104/269 (39%), Positives = 154/269 (57%), Gaps = 11/269 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ +V+ D GDF+P P+L  L+PS+DYSGD I   PL V Q+T F+CGG+SLG  
Sbjct  28   LFVEAETTSVIDDFGDFAPTPDLKQLIPSIDYSGD-IGSFPLLVLQVTYFKCGGVSLGVG  86

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H VADG+   HF++ W+++A G  ++  PF DR  LLR       PQ   + +    P
Sbjct  87   MQHHVADGYSGLHFVNTWSDMARGLDITIPPFIDRT-LLRA---RDPPQPAFQHIEYQPP  142

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P +  +S  ++ +   TKV+  + SK QI ALKA A            Y+ +E++  H+W
Sbjct  143  PPL--KSPSQTLKPDSTKVAIFKFSKGQISALKAKAKEA----GNTVSYSSYEMLAGHVW  196

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            RC CKAR     Q T L  + D R R+ PPLP  YFGN +       V+G++ S+P    
Sbjct  197  RCTCKARGLADDQETKLYIATDGRSRLRPPLPPGYFGNVIFTATPIAVAGDLQSKPTWYA  256

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            AS+I  A+  + +EY+  A+D+   + D+
Sbjct  257  ASRIHGALSRMDNEYLRSALDYLELQPDL  285



>ref|XP_004500023.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cicer 
arietinum]
Length=463

 Score =   198 bits (503),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 110/276 (40%), Positives = 159/276 (58%), Gaps = 19/276 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCG-GISLGF  649
            +L+EAE+   + D GDFS       L P+ +Y+   I+++PLFV QLTKF+   G ++G 
Sbjct  99   ILIEAETTKTIHDYGDFSFSDSTKELAPTFNYNTQQIEEMPLFVVQLTKFKNNEGCAIGV  158

Query  648  AISHVVADGHGLCHFLSEWANLASGKPL--SSAPFHDRRRLLRGVGESSSPQGGPRRVFD  475
            A+ H++ADG     F++ WA LA G+ L  +  PF DR  L     + S     PR  F+
Sbjct  159  AMHHILADGLEAVRFINLWAKLARGETLDPNELPFLDRTVL-----KFSHTPLEPR--FE  211

Query  474  HSP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRS-----YNAKPRG  322
            H      PLI+G++  E ER+K+T VS LRLS  Q+  LK  AN              R 
Sbjct  212  HIELKPLPLILGRTDTEEERLKKTTVSLLRLSPEQVEKLKKKANENNEIVLAMMKKGSRP  271

Query  321  YTRFEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGV  142
            ++RFE I+AH+WRCA KAR  +  Q + + F+ D+R R+ PPLP +Y+GNA+    + G 
Sbjct  272  FSRFESISAHVWRCALKARELEENQESVVRFNADVRSRIVPPLPKNYYGNALTQTAVKGY  331

Query  141  SGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYR  34
             GEI S+PL  V+ KIR++++ V  EY+   ID  R
Sbjct  332  VGEITSKPLGYVSQKIRESVEVVNDEYIRSQIDVIR  367



>ref|XP_003548918.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=447

 Score =   197 bits (501),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 113/274 (41%), Positives = 156/274 (57%), Gaps = 17/274 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +L+EAES   L D   F P   +  L+P VDY+ +PI++ PLF+ QLT+F  GG  +G A
Sbjct  95   ILLEAESTRALNDYAIFEPNDTIKELIPKVDYT-EPIENSPLFLVQLTRFSNGGFCVGIA  153

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            IS+++ DG    HF++ WA LA G  L     HD   L + V +SS      +  FDH  
Sbjct  154  ISNIITDGISGTHFINLWATLARGDTLEE---HDMPLLNKVVLQSSDK----KPCFDHKE  206

Query  465  ----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
                PL++G +    E  KET V+ L+LS+  +  LK  AN G     + R Y+R+E I+
Sbjct  207  FKPLPLVLGHADTTEESKKETTVAMLKLSREMVEKLKKKANEGN----QGRAYSRYESIS  262

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVI-FGVSGEIISR  121
            AHIWRC  KAR     QPT +      R R+ PPLP +YFGNA    V    +SG+I+S+
Sbjct  263  AHIWRCVVKARDGYHNQPTVVHIIAGARNRLNPPLPLNYFGNATYPTVTPTCLSGDIVSK  322

Query  120  PLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            PL  VA KIR+AI+ +T EY+     F R++ DV
Sbjct  323  PLSYVAHKIREAIEVLTDEYLRSGFGFIRSQSDV  356



>ref|XP_011073311.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=433

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/270 (39%), Positives = 153/270 (57%), Gaps = 9/270 (3%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESDAV+ D GDF+P  EL  L+P VDYS   I   PL V Q+T+F+CGG+SLG  
Sbjct  92   LFVEAESDAVVDDFGDFAPTLELRRLIPPVDYSQG-ISTFPLVVLQVTRFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            I H+VADG    HF++ W+++A G  ++  PF DR  LLR       PQ     +    P
Sbjct  151  IHHIVADGLSALHFINTWSDMARGLDITIPPFIDRT-LLRA---RDPPQPKFEHIEYQPP  206

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P +    S +      T V+ L+L++ Q++ LKA +      +     Y+ +E++ AHIW
Sbjct  207  PTMAIHDSQKINAAPRTVVAILKLTRGQLNTLKAKSKE----DGNTVTYSSYEILAAHIW  262

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
             CAC+AR    +Q T L  + + R R+ PPLP  YFGN +      GVSGE+ S+P+   
Sbjct  263  VCACRARGLVDEQKTKLFIATNGRSRLRPPLPPGYFGNVIFTTTPVGVSGELQSKPISYT  322

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  16
            A KI D +  +  EY+  A+D+   + D++
Sbjct  323  AGKIHDVLVRMDDEYLRSALDYLEVQPDLM  352



>gb|KHN18128.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=462

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 117/284 (41%), Positives = 159/284 (56%), Gaps = 17/284 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNH-LVPSVDYSGDPIQDIPLFVGQLTKFRCG---GIS  658
             L+EA +    AD GDFSP   +   LVP++DY   PIQ+IPL   QLT+F+     G++
Sbjct  90   TLIEAATAKTFADFGDFSPSDSIKEELVPAIDYHSQPIQEIPLLFVQLTRFQGDQQQGLA  149

Query  657  LGFAISHVVADGHGLCHFLSEWANLASGK--PLSSAPFHDRRRLLRGVGESSSPQGGPRR  484
            +G A SH VADG    HF++ WA +  G    L+  PF DR  L       SS Q  P  
Sbjct  150  IGVAFSHPVADGSAWIHFMNTWAMVNRGDMLDLNEMPFLDRTIL---KFPPSSLQSLPPP  206

Query  483  VFDHSP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYT  316
             FDH      PLI+G+S    E+ K+T  S L+L+  Q+  LK  AN+  +     R ++
Sbjct  207  HFDHPELKPLPLILGKSDSTEEQNKKTAASMLKLTSKQVEMLKKKANDQLTKQGS-RPFS  265

Query  315  RFEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVI-FGVS  139
            RFE + AHIWRCACKAR     QPT   F+VD R R+ PPLP +YFGNA++  V      
Sbjct  266  RFEAVAAHIWRCACKARELHHNQPTLARFNVDFRNRLIPPLPRNYFGNALVATVTPECYV  325

Query  138  GEIISRPLQDVASKIRDAIDGVTSEYVNCAID--FYRNEGDVIK  13
            GE+ +RPL   A K+R+A+  +T EY+   ++  F   + D IK
Sbjct  326  GEMTTRPLSYAAQKMREAVALLTDEYIRSHLEVVFGEEQLDCIK  369



>ref|XP_010265527.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=435

 Score =   194 bits (494),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 106/275 (39%), Positives = 157/275 (57%), Gaps = 19/275 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ +V+ D GDF+P  EL  L+P+VDYSGD I   PL V Q+T+F+CGG+SLG  
Sbjct  92   LFVEAETGSVIDDFGDFAPTMELKQLIPAVDYSGD-ISSYPLLVLQITRFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  L+  PF DR  LLR        +  P   F H  
Sbjct  151  MQHHVADGSSGLHFINTWSDMARGLDLTIPPFIDRT-LLRA-------RDPPTPSFHHIE  202

Query  471  ---SPPLIVGQSSDESERMKE-TKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEV  304
               +PP+     +  S+   E T V+  ++S+ Q++ LKA + +G    A    Y+ +E+
Sbjct  203  YQPAPPMKHPPETPNSQSGPESTTVTMFKISRDQLNILKAKSKDG----ANSVNYSSYEM  258

Query  303  ITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIIS  124
            +  H+WRC CKAR     Q T L  + D R R+ PPLP  YFGN +       VSG+++S
Sbjct  259  LAGHVWRCVCKARGLPDDQDTKLYIATDGRSRLRPPLPPGYFGNGIFTATPIAVSGDLLS  318

Query  123  RPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            +PL   A +I DA+  +  EY+  A+D+   + D+
Sbjct  319  KPLTYAAGRIHDALVRMDDEYLRSALDYLELQPDL  353



>ref|XP_003599928.1| Anthranilate N-benzoyltransferase protein [Medicago truncatula]
 ref|XP_003599933.1| Anthranilate N-benzoyltransferase protein [Medicago truncatula]
 gb|AES70179.1| spermidine hydroxycinnamoyl transferase [Medicago truncatula]
Length=456

 Score =   194 bits (494),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 111/273 (41%), Positives = 163/273 (60%), Gaps = 21/273 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +L+EAE+   + D GDFSP      L+P VDY+  PI++IPLFV Q+T F   G ++G A
Sbjct  91   ILIEAETTKSIHDYGDFSPSDSTKELIPKVDYN-QPIEEIPLFVAQVTWFSSFGFAIGIA  149

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSS--APFHDRRRLLRGVGESSSPQGGPRRVFDH  472
             SH ++DG G  +F++ WA +A G+ L +   P+ DR  L     + S+    PR  F+H
Sbjct  150  YSHPLSDGVGCSNFINSWAKIARGERLEANELPYLDRTIL-----KFSNTPIEPR--FEH  202

Query  471  SP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRG---YTR  313
                  PLI+G+S  + ER K+T    L+L+  ++  LK  AN        P+G   Y+R
Sbjct  203  VELKPLPLILGRSDTDIERKKKTTAELLKLTAEEVEKLKKKANECDI----PKGSRPYSR  258

Query  312  FEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGE  133
            FE I+AHIW+ A KAR  +  Q + + F+V+IR R+ P LP +Y+GNA+I   + G  GE
Sbjct  259  FEAISAHIWKSASKARKLEENQQSVVRFNVEIRNRIIPNLPKNYYGNALIQTAVEGYIGE  318

Query  132  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYR  34
            I+S+PL  VA KIR+A + +T+EY+   ID  R
Sbjct  319  ILSKPLSYVAMKIREAHELITNEYIRSQIDVIR  351



>gb|KHN13395.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=447

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 112/274 (41%), Positives = 155/274 (57%), Gaps = 17/274 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +L+EAES   L D   F P   +  L+P VDY+ +PI++ PLF+ QLT+F  GG  +G A
Sbjct  95   ILLEAESTRALNDYAIFEPNDTIKELIPKVDYT-EPIENSPLFLVQLTRFSNGGFCVGIA  153

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            IS+++ DG    HF++ WA LA    L     HD   L + V +SS      +  FDH  
Sbjct  154  ISNIITDGISGTHFINLWATLARRDTLEE---HDMPLLNKVVLQSSDK----KPCFDHKE  206

Query  465  ----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
                PL++G +    E  KET V+ L+LS+  +  LK  AN G     + R Y+R+E I+
Sbjct  207  FKPLPLVLGHADTTEESKKETTVAMLKLSREMVEKLKKKANEGN----QGRAYSRYESIS  262

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVI-FGVSGEIISR  121
            AHIWRC  KAR     QPT +      R R+ PPLP +YFGNA    V    +SG+I+S+
Sbjct  263  AHIWRCVVKARDGYHNQPTVVHIIAGARNRLNPPLPLNYFGNATYPTVTPTCLSGDIVSK  322

Query  120  PLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            PL  VA KIR+AI+ +T EY+     F R++ DV
Sbjct  323  PLSYVAHKIREAIEVLTDEYLRSGFGFIRSQSDV  356



>gb|ACI16631.1| malate O-hydroxycinnamoyl transferase [Trifolium pratense]
Length=454

 Score =   192 bits (488),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 109/273 (40%), Positives = 155/273 (57%), Gaps = 15/273 (5%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCG-GISLGF  649
            +L+EAE+   + D GDFSP      L+P +DY+  P Q++PL V QLT F+   G +LG 
Sbjct  94   ILLEAETTKTIHDYGDFSPSDLTKELIPIIDYN-QPFQEMPLLVVQLTSFKNNQGFALGV  152

Query  648  AISHVVADGHGLCHFLSEWANLASGKPL--SSAPFHDRRRLLRGVGESSSPQGGPRRVFD  475
            A SH ++DG G   F++ WA +A G+ L  +  PF DR      +  S +P   PR  F+
Sbjct  153  AFSHSLSDGTGAVKFINSWAKIARGETLEPNELPFLDRTL----IKFSHTPSKVPR--FE  206

Query  474  HSP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAK-PRGYTRF  310
            H      PLI+G+     ER K+T  + L+LS  Q+  LK  AN+  S   K  R +++F
Sbjct  207  HIELKPLPLIIGRKDTSEERKKKTTATLLKLSYDQVEKLKKKANDFLSMKKKGSRPFSKF  266

Query  309  EVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEI  130
            E I AH+WRCA KAR  +  Q + + F  DIRRR+ PPLP ++F NA+      G  GEI
Sbjct  267  EAIGAHLWRCASKARGLEDDQESVVRFHADIRRRINPPLPQNFFANALALTATKGCVGEI  326

Query  129  ISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRN  31
             S+PL  VA KIR+  + V  +++   ID  R+
Sbjct  327  TSKPLGYVAQKIREGTELVKDDFIKSQIDVIRS  359



>ref|XP_003599037.1| Anthranilate N-benzoyltransferase protein [Medicago truncatula]
 ref|XP_003638356.1| Anthranilate N-benzoyltransferase protein [Medicago truncatula]
 gb|AES69288.1| spermidine hydroxycinnamoyl transferase [Medicago truncatula]
Length=451

 Score =   192 bits (487),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 108/275 (39%), Positives = 155/275 (56%), Gaps = 20/275 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCG--GISLG  652
            +L+EAE+   + D GDFSP      LVP +DY+  P++DIPLFV QLT+F+    G+++G
Sbjct  90   ILLEAETTKTIHDYGDFSPSDSTMELVPIIDYN-QPVEDIPLFVVQLTRFQNKDEGLAIG  148

Query  651  FAISHVVADGHGLCHFLSEWANLASGKPL--SSAPFHDRRRLLRGVGESSSPQGGPRRVF  478
             A SH ++DG G    ++ WA +A G+ L  +  PF DR  L             P   F
Sbjct  149  IAYSHPLSDGLGAIRLINSWAKIARGETLEVNELPFLDRTIL--------KFSHTPLVRF  200

Query  477  DHSP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRG---Y  319
            +H      PLI+G+     E+ K+T  + LRLS  Q+  LK  AN       K +G   +
Sbjct  201  EHKELKPLPLILGRKDTSEEKKKKTSATLLRLSPEQVDKLKKKANENDILAIKNKGSRPF  260

Query  318  TRFEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVS  139
            +R+E I+AHIW+CA +AR  +  Q + + F+ DIR R+ PPLP +YFGNA+      G  
Sbjct  261  SRYEAISAHIWKCASRARELEENQESVVRFNADIRTRLVPPLPKNYFGNALTQTAAIGYV  320

Query  138  GEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYR  34
            GEI S+PL  VA  IR+A + V+ E++   ID  R
Sbjct  321  GEITSKPLGYVAQMIREATELVSDEFIRSQIDVIR  355



>gb|ACF37072.1| hydroxycinnamoyl CoA quinate transferase 1 [Cynara cardunculus 
var. scolymus]
 emb|CAM84302.2| hydroxycinnamoyl CoA quinate transferase [Cynara cardunculus 
var. scolymus]
Length=449

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/274 (39%), Positives = 154/274 (56%), Gaps = 20/274 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD+ L D G+F+P PEL  L P+VDYSGD I   PLF  Q+T F+CGG++LG  
Sbjct  109  LFVEAESDSTLDDFGEFTPSPELRRLTPTVDYSGD-ISSYPLFFAQVTHFKCGGVALGCG  167

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H +ADG    HF++ W+++A G  ++  PF DR  LLR        +  P   FDH  
Sbjct  168  VFHTLADGLSSIHFINTWSDMARGLSIAIPPFIDRT-LLRA-------REPPTPTFDHIE  219

Query  471  --SPPLIVGQSSD-ESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVI  301
              +PP +   S + ES R   T V  L+L+  Q++ LKA+A N  S       Y+ +E++
Sbjct  220  YHAPPSMKTISQNPESSRKPSTTV--LKLTLDQLNVLKASAKNDGSNTT----YSTYEIL  273

Query  300  TAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISR  121
             AH+WRCACKAR     Q T L  + D R R+ P LP  Y GN V        SG++ ++
Sbjct  274  AAHLWRCACKARGLPDDQLTKLYVATDGRSRLSPQLPPGYLGNVVFTTTPVAKSGDLTTQ  333

Query  120  PLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             L + AS IR  +  + + Y+  AID+   + D+
Sbjct  334  SLSNAASLIRTTLTKMDNNYLRSAIDYLEVQPDL  367



>ref|XP_003553115.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=462

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 115/284 (40%), Positives = 159/284 (56%), Gaps = 17/284 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNH-LVPSVDYSGDPIQDIPLFVGQLTKFRCG---GIS  658
             L+EA +    AD GDFSP   +   LVP++DY   PIQ+IPL   QLT+F+     G++
Sbjct  90   TLIEAATAKTFADFGDFSPSDSIKEELVPAIDYHSQPIQEIPLLFVQLTRFQGDQQQGLA  149

Query  657  LGFAISHVVADGHGLCHFLSEWANLASGK--PLSSAPFHDRRRLLRGVGESSSPQGGPRR  484
            +G A SH VADG    HF++ WA +  G    L+  PF DR  +L+    S      P  
Sbjct  150  IGVAFSHPVADGSAWIHFMNTWAMVNRGDMLDLNEMPFLDRT-ILKFPPSSLQSPPPPH-  207

Query  483  VFDHSP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYT  316
             FDH      PLI+G+S    E+ K+T  S L+L+  Q+  LK  AN+  +     R ++
Sbjct  208  -FDHPELKPLPLILGKSDSTEEQNKKTAASMLKLTSKQVEMLKKKANDQLTKQGS-RPFS  265

Query  315  RFEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVI-FGVS  139
            RFE + AHIWRCACKAR     QPT   F+VD R R+ PPLP +YFGNA++  V      
Sbjct  266  RFEAVAAHIWRCACKARELHHNQPTLARFNVDFRNRLIPPLPRNYFGNALVATVTPECYV  325

Query  138  GEIISRPLQDVASKIRDAIDGVTSEYVNCAID--FYRNEGDVIK  13
            GE+ +RPL   A K+R+A+  +T EY+   ++  F   + D IK
Sbjct  326  GEMTTRPLSYAAQKMREAVALLTDEYIRSHLEVVFGEEQLDCIK  369



>gb|AEM63675.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Platycodon grandiflorus]
Length=434

 Score =   189 bits (480),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/270 (37%), Positives = 156/270 (58%), Gaps = 10/270 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+D V+ D GDF+P  EL  L+PSVDYS + I  IPL V Q+T F+CGG+SLG  
Sbjct  92   LFVEAETDGVVDDFGDFAPTLELRKLIPSVDYSLE-ISAIPLLVLQVTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGG-PRRVFDHS  469
            + H VADG    HF++ W+++A G  ++  PF DR  LLR       PQ   P   +  +
Sbjct  151  MQHHVADGASGLHFINTWSDMARGLDVTLPPFIDRT-LLRA---RDPPQPAFPHIEYQPA  206

Query  468  PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            P +        ++ + ET++S  +L++ Q++ALKA +      +     Y+ +E+++ H+
Sbjct  207  PTMKAPLEPANAQSVPETEISIFKLTREQLNALKAKSKE----DGNTVSYSSYEMLSGHV  262

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRC CKAR     Q T L  + D R R++P LP  YFGN +       V+G++ S+P   
Sbjct  263  WRCVCKARGLPDDQDTKLYIATDGRSRLQPVLPPGYFGNVIFTTTPTAVAGDLTSKPTWY  322

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             AS+I DA+  + +EY+  A+D+   + D+
Sbjct  323  AASRIHDALGRMDNEYLRSALDYLELQPDL  352



>gb|KHN35439.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=409

 Score =   188 bits (478),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 113/284 (40%), Positives = 158/284 (56%), Gaps = 28/284 (10%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPEL-NHLVPSVDYSGDPIQDIPLFVGQLTKFRCG------  667
             L+EAES   + D GDF+P  +L N L+P VDYS  PI+++PL + QLT+F+ G      
Sbjct  37   TLIEAESQKTMDDYGDFAPSEKLKNELIPPVDYS-QPIEELPLLLVQLTRFKKGSSNNNN  95

Query  666  ----GISLGFAISHVVADGHGLCHFLSEWANLASGKPLSSA---PFHDRRRLLRGVGESS  508
                G+++G A  HV+ DG     F++ WA L  G+ L S    PF DR      +  S+
Sbjct  96   NNQLGLAIGVAFCHVLCDGLAAIRFINAWAKLTRGEVLDSIEMFPFLDR-----TIMNST  150

Query  507  SPQGGPRRVFDHSP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSY  340
             P   PR  FDH      PL +G +    E+ KE     LRL+  Q+  LK   N+ R  
Sbjct  151  YPPRAPR--FDHPELKPLPLKLGTTDTIEEQKKEKTAVILRLTSQQVEKLKKKTNDERPQ  208

Query  339  NAKP-RGYTRFEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAV-  166
              +  R Y+R+EVI +HIWRCA KAR  +  QPT +  S DIR R+ PPLP +YFGNA+ 
Sbjct  209  KEETLRPYSRYEVIASHIWRCASKARELEDLQPTVVRVSADIRNRLNPPLPRNYFGNALA  268

Query  165  INVVIFGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYR  34
            + +     + E+I+ PL   A KIR+AI+ +  EY+   +DF R
Sbjct  269  VALTPKCHTKELITNPLSHGAQKIREAIELLNDEYIRSQLDFIR  312



>ref|XP_011082506.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=432

 Score =   189 bits (479),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 104/269 (39%), Positives = 153/269 (57%), Gaps = 10/269 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD V+ D GDF+P  EL  L+P+VDYS   I   PL V Q+T F+CGG+SLG  
Sbjct  92   LFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQG-ISTYPLLVLQVTHFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H VADG    HF++ W+++A G  L+  PF DR  LLR       PQ   + +     
Sbjct  151  MQHHVADGFSGLHFINTWSDMARGLDLTIPPFIDRT-LLRA---RDPPQPQFKHIEYQPA  206

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P +   +S ++E   ET VS  +L++ Q++ALKA +  G         Y+ +E++  H+W
Sbjct  207  PAMKTLASKDAE-APETAVSIFKLTRDQLNALKAKSKEG----GNTVTYSSYEMLAGHVW  261

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            R  C AR     Q T L  + D R R++PPLP  YFGN +       VSG++ S+P+   
Sbjct  262  RSVCMARGLPEDQDTKLYIATDGRSRLQPPLPPGYFGNVIFTATPIAVSGDLTSKPVWYA  321

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            ASKI DA+  + ++Y+  A+D+   + D+
Sbjct  322  ASKIHDALARMDNDYLRSALDYLELQPDL  350



>ref|XP_011020577.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=431

 Score =   189 bits (479),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 104/269 (39%), Positives = 152/269 (57%), Gaps = 11/269 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ +V+AD GDF+P  EL  L+P+VDYSG  I   PL V Q+T F+CGG+SLG  
Sbjct  92   LFVEAETASVVADFGDFAPTLELKQLIPTVDYSGG-ISTYPLLVLQVTHFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG    HF++ W+++A G  L+  PF DR  LLR       PQ     V    P
Sbjct  151  MQHHAADGFSGLHFVNTWSDMARGLDLTIPPFIDRT-LLRA---RDPPQPAFHHVEYQPP  206

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P +  ++  E+ + + T VS  +L++ Q++ LKA A  G        GY+ +E++  H+W
Sbjct  207  PAM--KAVPETSKPESTAVSIFKLTRDQLNTLKAKAKEG----GNNIGYSSYEMLAGHVW  260

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            R AC+AR     Q T L  + D R R+ P LP  YFGN +       V+GEI S+P    
Sbjct  261  RSACQARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYA  320

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            A KI D++  + ++Y+  A+DF   + D+
Sbjct  321  AGKIHDSLVRMDNDYLRSALDFLELQPDL  349



>ref|XP_010113235.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXC76036.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=439

 Score =   189 bits (479),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 103/277 (37%), Positives = 157/277 (57%), Gaps = 21/277 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ +V+ D GDF+P P+L  L+P+VD SG  I   PL V Q+T F CGG+SLG  
Sbjct  94   LFVEAETSSVIDDFGDFAPTPQLKALIPAVDLSGG-ISSYPLAVFQVTYFECGGVSLGVG  152

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H   DG    HF++ W+++A G  +   PF DR  L+R    S  P   PR  FDH  
Sbjct  153  MEHHAVDGASGLHFVNSWSDVARGLDIKVPPFIDRT-LIR----SRDP---PRPAFDHIE  204

Query  471  --SPPLIVGQSS----DESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRF  310
              +PP++   +S      S+    T V+  +++K Q+ ALK    N    +     Y+ +
Sbjct  205  YDAPPIMKNTASANFQKNSKYQTTTSVANFKITKDQLIALK----NKSKEDGSSVSYSSY  260

Query  309  EVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEI  130
            E+++ H+WRCACKAR+    Q T L  +VD R R++PPLP SYFGN +       ++G++
Sbjct  261  EMLSGHVWRCACKARALPDDQETKLFVAVDGRARLQPPLPQSYFGNVIFTTTPIALAGDL  320

Query  129  ISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            +S+P+   AS+I   +    +EY+  AID+   + D+
Sbjct  321  VSKPIWYAASQIHKTLVKTNNEYLKSAIDYLEIQPDL  357



>ref|XP_010094062.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB55152.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=432

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/277 (37%), Positives = 157/277 (57%), Gaps = 21/277 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ +V+ D GDF+P P+L  L+P+VD SG  I   PL V Q+T F CGG+SLG  
Sbjct  87   LFVEAETSSVIDDFGDFAPTPQLKALIPAVDLSGG-ISSYPLAVFQVTYFECGGVSLGVG  145

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H   DG    HF++ W+++A G  +   PF DR  L+R    S  P   PR  FDH  
Sbjct  146  MEHHAVDGASGLHFVNSWSDVARGLDIKVPPFIDRT-LIR----SRDP---PRPAFDHIE  197

Query  471  --SPPLIVGQSS----DESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRF  310
              +PP++   +S      S+    T V+  +++K Q+ ALK    N    +     Y+ +
Sbjct  198  YDAPPIMKNTASANFQKNSKYQTTTSVANFKITKDQLIALK----NKSKEDGSSVSYSSY  253

Query  309  EVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEI  130
            E+++ H+WRCACKAR+    Q T L  +VD R R++PPLP SYFGN +       ++G++
Sbjct  254  EMLSGHVWRCACKARALPDDQETKLFVAVDGRARLQPPLPQSYFGNVIFTTTPIALAGDL  313

Query  129  ISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            +S+P+   AS+I   +    +EY+  AID+   + D+
Sbjct  314  VSKPIWYAASQIHKTLVKTNNEYLKSAIDYLEIQPDL  350



>ref|XP_004135880.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cucumis 
sativus]
 gb|KGN45212.1| hypothetical protein Csa_7G431440 [Cucumis sativus]
Length=430

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/264 (39%), Positives = 155/264 (59%), Gaps = 16/264 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +LVEAE+ AV+ D GDF+P  +L  L+P+VDYSG  I+  PL V Q+T F+CGG+SLG  
Sbjct  92   LLVEAETTAVIDDFGDFAPTLQLRQLIPAVDYSGG-IESYPLLVLQVTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRV-FDHS  469
            + H VADG+   HF++ W++++ G  L   P+ DR  LLR       PQ   R V +  +
Sbjct  151  MQHHVADGYSGLHFVNTWSDMSRGLDLMLQPYIDRT-LLRA---RDPPQPAFRHVEYQPA  206

Query  468  PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEVITAH  292
            PP+     +D     + T VS  + ++ Q++ LKA +  NG + N     Y+ +E+++ H
Sbjct  207  PPMKNPVQADP----EGTTVSIFKFTREQLNLLKAKSKENGNTIN-----YSSYEMLSGH  257

Query  291  IWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQ  112
            +WR  CKAR     Q T L  + D R R+ PPLP+ YFGN +       V+GE++S P  
Sbjct  258  VWRSTCKARELPEDQDTKLYIATDGRARLRPPLPNGYFGNVIFTTTPLAVAGELMSNPTW  317

Query  111  DVASKIRDAIDGVTSEYVNCAIDF  40
              ASKI DA+  + ++Y+  A+D+
Sbjct  318  FAASKIHDALTRMDNDYLRSALDY  341



>gb|AEJ88365.1| hydroxycinnamoyltransferase [Cucumis sativus]
Length=430

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/264 (39%), Positives = 155/264 (59%), Gaps = 16/264 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +LVEAE+ AV+ D GDF+P  +L  L+P+VDYSG  I+  PL V Q+T F+CGG+SLG  
Sbjct  92   LLVEAETTAVIDDFGDFAPTLQLRQLIPAVDYSGG-IESYPLLVLQVTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRV-FDHS  469
            + H VADG+   HF++ W++++ G  L   P+ DR  LLR       PQ   R V +  +
Sbjct  151  MQHHVADGYSGLHFVNTWSDMSRGLDLMLQPYIDRT-LLRA---RDPPQPAFRHVEYQPA  206

Query  468  PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEVITAH  292
            PP+     +D     + T VS  + ++ Q++ LKA +  NG + N     Y+ +E+++ H
Sbjct  207  PPMKNPVQADP----EGTTVSIFKFTREQLNLLKAKSKENGNTIN-----YSSYEMLSGH  257

Query  291  IWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQ  112
            +WR  CKAR     Q T L  + D R R+ PPLP+ YFGN +       V+GE++S P  
Sbjct  258  VWRSTCKARELPEDQDTKLYIATDGRARLRPPLPNGYFGNVIFTTTPLAVAGELMSNPTW  317

Query  111  DVASKIRDAIDGVTSEYVNCAIDF  40
              ASKI DA+  + ++Y+  A+D+
Sbjct  318  FAASKIHDALTRMDNDYLRSALDY  341



>ref|XP_003555244.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like isoform 
X1 [Glycine max]
Length=461

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 113/284 (40%), Positives = 158/284 (56%), Gaps = 28/284 (10%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPEL-NHLVPSVDYSGDPIQDIPLFVGQLTKFRCG------  667
             L+EAES   + D GDF+P  +L N L+P VDYS  PI+++PL + QLT+F+ G      
Sbjct  89   TLIEAESQKTMDDYGDFAPSEKLKNELIPPVDYS-QPIEELPLLLVQLTRFKKGSSNNNN  147

Query  666  ----GISLGFAISHVVADGHGLCHFLSEWANLASGKPLSSA---PFHDRRRLLRGVGESS  508
                G+++G A  HV+ DG     F++ WA L  G+ L S    PF DR      +  S+
Sbjct  148  NNQLGLAIGVAFCHVLCDGLAAIRFINAWAKLTRGEVLDSIEMFPFLDR-----TIMNST  202

Query  507  SPQGGPRRVFDHSP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSY  340
             P   PR  FDH      PL +G +    E+ KE     LRL+  Q+  LK   N+ R  
Sbjct  203  YPPRAPR--FDHPELKPLPLKLGTTDTIEEQKKEKTAVILRLTSQQVEKLKKKTNDERPQ  260

Query  339  NAKP-RGYTRFEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAV-  166
              +  R Y+R+EVI +HIWRCA KAR  +  QPT +  S DIR R+ PPLP +YFGNA+ 
Sbjct  261  KEETLRPYSRYEVIASHIWRCASKARELEDLQPTVVRVSADIRNRLNPPLPRNYFGNALA  320

Query  165  INVVIFGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYR  34
            + +     + E+I+ PL   A KIR+AI+ +  EY+   +DF R
Sbjct  321  VALTPKCHTKELITNPLSHGAQKIREAIELLNDEYIRSQLDFIR  364



>gb|KHN22679.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=328

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/259 (40%), Positives = 143/259 (55%), Gaps = 44/259 (17%)
 Frame = -2

Query  789  DLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAISHVVADGHGLC  610
            +LGDFSP  E N+LVP+ DY+  PI D+PL + QLT+F+CGG+S+    SH V DG    
Sbjct  108  NLGDFSPSSEYNYLVPTADYTL-PIHDLPLVLVQLTRFKCGGVSIAITFSHAVVDGPSAL  166

Query  609  HFLSEWANLASGKPLSSAPFHDRRRLLRGVGES-SSPQGGPRRVFDHSPPLIVGQSSDES  433
            HF+ EWA LASG+P+ + PFHDR+ L  G   S  + +      FD  PPL++GQ     
Sbjct  167  HFMCEWARLASGEPMQTVPFHDRKVLRAGEPPSVPTTECHAHTEFD-EPPLLLGQIESTE  225

Query  432  ERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIWRCAC-KARSHK  256
            ER K+T ++                                  IT HI+   C KAR HK
Sbjct  226  ERKKKTAMA----------------------------------ITGHIYMEKCIKARGHK  251

Query  255  PQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDVASKIRDAIDG  76
              QPT L   VD R RMEPPLP  YFGNA        ++G+++S+ L   +S+IR+A++ 
Sbjct  252  EDQPTALTVIVDSRGRMEPPLPKGYFGNAT------SLAGDLVSKSLGYASSRIREAVER  305

Query  75   VTSEYVNCAIDFYRNEGDV  19
            +T EYV   I+F +N+ D+
Sbjct  306  ITYEYVRWGIEFLKNQEDL  324



>ref|XP_002529413.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF33009.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=425

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/275 (39%), Positives = 151/275 (55%), Gaps = 9/275 (3%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +  EAE+D+ + +LGDF     L  LVP VDYS + I   PL V Q+T F CGG+SLG  
Sbjct  80   LFTEAEADSAMDELGDFLRDDVLRFLVPKVDYS-NAIDSYPLLVLQVTTFTCGGVSLGVG  138

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
              H +ADG+   HF   W++++ G P+S  PFHDR  +LR   +  +P   P   +D  P
Sbjct  139  WHHTLADGYSALHFTMSWSSISRGLPISIPPFHDRT-VLR-CRDPPAPVF-PHIEYDEPP  195

Query  465  PLIVG-QSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
             L +  Q   E++      + TL+++  Q+  LKA     +S + K + Y+ +E++TAHI
Sbjct  196  ALYISPQDQKENQLGSSNYLETLKITADQLETLKAKV---KSKDDKTK-YSTYEILTAHI  251

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCACKAR     Q T L  SVD R R  PPLP  +FGN V +     + GE+ S PL D
Sbjct  252  WRCACKARGLSDDQETKLYISVDGRTRFSPPLPSGFFGNVVFHATPIALCGEVASEPLVD  311

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQE  4
             A ++   I  +  EY+  AID+    GD  +  E
Sbjct  312  TAGRVNKTIKRMDDEYLRSAIDYLEEIGDPTRVSE  346



>gb|AEM63676.1| hydroxycinnamoyl CoA quinate hydroxycinnamoyl transferase [Platycodon 
grandiflorus]
Length=443

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/275 (38%), Positives = 153/275 (56%), Gaps = 17/275 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+D+ + D GDF+P  E   L P VDYSGD I   PLF  Q+T F+CGG+SLG  
Sbjct  98   LFVEAETDSTVDDFGDFTPSAEQRQLAPMVDYSGD-ISSYPLFFAQVTYFKCGGVSLGCG  156

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H ++DG    HF++ W+++A G  ++  PF DR  LLR   +       PR VFDH  
Sbjct  157  VHHTLSDGVSSLHFINTWSDIARGLSIAIPPFIDRT-LLRARLQP------PRPVFDHVE  209

Query  471  --SPPLIVGQSSDESERMKETKVST--LRLSKPQIHALKAAANNGRSYNAKPRGYTRFEV  304
               PP +     + + +     VST  L+L+  Q++ LKA   N  +   +   Y+ + +
Sbjct  210  YHPPPSMNASVQNTNPKSSPKPVSTAILKLTLDQLNELKAKTKNDGNTREQ---YSSYVI  266

Query  303  ITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIIS  124
            + AH+WRCACKAR     Q T L  + D R R+ P LP  Y GN V        SGEI+S
Sbjct  267  LAAHLWRCACKARGLPDDQLTKLYVATDGRFRLSPTLPPGYLGNVVFTATPVAESGEIVS  326

Query  123  RPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            +PL + A KI +A+  +  EY+  A+D+  ++ D+
Sbjct  327  QPLSNSAKKIHNALAKMDDEYLRSALDYLESQPDL  361



>gb|ACC63882.1| quinate O-hydroxycinnamoyltransferase/shikimate O-hydroxycinnamoyltransferase 
[Populus trichocarpa]
 gb|AFZ78608.1| hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyl transferase 
[Populus tomentosa]
Length=433

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/269 (39%), Positives = 151/269 (56%), Gaps = 11/269 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEA + +V+AD GDF+P  EL  L+P+VDYSG  I   PL V Q+T F+CGG+SLG  
Sbjct  92   LFVEAGTASVVADFGDFAPTLELKQLIPTVDYSGG-ISTYPLLVLQVTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG    HF++ W+++A G  L+  PF DR  LLR       PQ     V    P
Sbjct  151  MQHHAADGFSGLHFVNTWSDMARGLDLTIPPFIDRT-LLRA---RDPPQPAFHHVEYQPP  206

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P +  ++  E+ + + T VS  +L++ Q++ LKA A  G        GY+ +E++  H+W
Sbjct  207  PAM--KTVLETSKPESTAVSIFKLTRDQLNTLKAKAKEG----GNNIGYSSYEMLAGHVW  260

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            R ACKAR     Q T L  + D R R+ P LP  YFGN +       V+GEI S+P    
Sbjct  261  RSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYA  320

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            A KI D++  + ++Y+  A+DF   + D+
Sbjct  321  AGKIHDSLVRMDNDYLRSALDFLELQPDL  349



>ref|XP_004158793.1| PREDICTED: LOW QUALITY PROTEIN: shikimate O-hydroxycinnamoyltransferase-like 
[Cucumis sativus]
Length=430

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/264 (39%), Positives = 155/264 (59%), Gaps = 16/264 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +LVEAE+ AV+ D GDF+P  +L  L+P+VDYSG  I+  PL V Q+T F+CGG+SLG  
Sbjct  92   LLVEAETTAVIDDFGDFAPTLQLRQLIPAVDYSGG-IESYPLLVLQVTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRV-FDHS  469
            + H VADG+   HF++ W++++ G  L   P+ DR  LLR       PQ   R V +  +
Sbjct  151  MQHHVADGYSGLHFVNTWSDMSRGLDLMLQPYIDRT-LLRA---RDPPQPAFRHVEYQPA  206

Query  468  PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEVITAH  292
            PP+     +D     + T VS  + ++ Q++ LKA +  NG + N     Y+ +E+++ H
Sbjct  207  PPMKNPVQADP----EGTTVSIFKFTREQLNLLKAKSKENGNTIN-----YSSYEMLSGH  257

Query  291  IWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQ  112
            +WR  CKAR     Q T +  + D R R+ PPLP+ YFGN +       V+GE++S P  
Sbjct  258  VWRSTCKARELPEDQDTKVYIATDGRARLRPPLPNGYFGNVIFTTTPLAVAGELMSNPTW  317

Query  111  DVASKIRDAIDGVTSEYVNCAIDF  40
              ASKI DA+  + ++Y+  A+D+
Sbjct  318  FAASKIHDALTRMDNDYLRSALDY  341



>ref|XP_007214780.1| hypothetical protein PRUPE_ppa023555mg [Prunus persica]
 gb|EMJ15979.1| hypothetical protein PRUPE_ppa023555mg [Prunus persica]
Length=423

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/277 (38%), Positives = 153/277 (55%), Gaps = 45/277 (16%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
             +EAESD+ L DL       E ++L+P+VDY+  PI ++P+ +                I
Sbjct  96   FIEAESDSKLDDL-------EYDYLIPTVDYTL-PIHELPILL---------------TI  132

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSPP  463
            SH V DG    HF+SEWA LA G+P+   PF DR+       ++ +   G     DHS  
Sbjct  133  SHAVVDGQSTFHFISEWARLAKGEPIGVMPFLDRKAF-----QARTLPAGNTLGLDHS--  185

Query  462  LIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYN---AKPRGYTRFEVITAH  292
                         K+T V+ L+L+K QI  LK  AN G  Y     KP  YTR++ +  H
Sbjct  186  -----------EKKKTTVAMLKLTKQQIEKLKRMANEGNDYKNSGTKP-AYTRYKTVAGH  233

Query  291  IWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQ  112
            IWRCA KAR H+ +QPT +   VD+R RM+PPLP  YFGNA    V   ++G+++S+PL 
Sbjct  234  IWRCASKARVHRNEQPTAMGVCVDLRSRMQPPLPQGYFGNATFYGVARSLAGDLVSKPLG  293

Query  111  DVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
              +S+I +AI+ V++ YV  AID +RN+ ++ + Q L
Sbjct  294  YASSRITEAIEKVSNYYVLSAIDHFRNQPNLTRFQAL  330



>ref|XP_002277474.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
 emb|CBI36545.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   187 bits (474),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 150/270 (56%), Gaps = 18/270 (7%)
 Frame = -2

Query  816  EAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAISH  637
            EAE+DA++ DLGDF+P   L HL+P VD+S   I   PL + Q+T F+CGG+ LG AI H
Sbjct  96   EAEADAIIDDLGDFTPSHRLRHLIPVVDHSAH-ISSYPLLLLQVTYFKCGGVCLGVAIHH  154

Query  636  VVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH----S  469
            +VADG G  HF++ W+++  G P++ +PF DR  +LR        +  P   F H     
Sbjct  155  MVADGSGCIHFINSWSDITRGIPIAISPFFDRT-ILRA-------RDPPAPRFSHVEYLP  206

Query  468  PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            PP + G S+     +K T    L L+   ++ALKA +    S +     Y+ +E + AH+
Sbjct  207  PPPLHGPST-----LKPTSTLILHLTPEHLNALKAKSVRHGSPSPSSVKYSTYETLAAHL  261

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRC CKAR     QPT L    D R R+ P LP  YFGNA+    +   SG++ S    D
Sbjct  262  WRCICKARGLSHDQPTKLYIPTDGRLRLRPTLPPGYFGNALFTSTLTANSGDLQSEAFSD  321

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
               +IR+AI G+  EY+  A+D+   + ++
Sbjct  322  TVQRIRNAIAGMEDEYLRSAVDYLEMQPNL  351



>gb|ABO40491.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea arabica]
Length=434

 Score =   186 bits (473),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 102/270 (38%), Positives = 154/270 (57%), Gaps = 10/270 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD V+ D GDF+P  EL  L+P+VDYS   I    L V Q+T F+CGG+SLG  
Sbjct  92   LFVEAESDGVVDDFGDFAPTLELRRLIPAVDYS-QGISSYALLVLQVTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG    HF++ W+++A G  ++  PF DR  LLR       PQ   + +    P
Sbjct  151  MQHHAADGFSGLHFINSWSDMARGLDVTLPPFIDRT-LLRA---RDPPQPQFQHIEYQPP  206

Query  465  P-LIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            P L V   + +S+ + ET VS  +L++ QI ALKA +      +     Y+ +E++  H+
Sbjct  207  PTLKVSPQTAKSDSVPETAVSIFKLTREQISALKAKSKE----DGNTISYSSYEMLAGHV  262

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCACKAR  +  Q T L  + D R R+ P LP  YFGN +    +  ++G++  +P+  
Sbjct  263  WRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATLIAIAGDLEFKPVWY  322

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             ASKI DA+  + ++Y+  A+D+   + D+
Sbjct  323  AASKIHDALARMDNDYLRSALDYLELQPDL  352



>gb|ACU23734.1| unknown [Glycine max]
Length=464

 Score =   187 bits (474),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 113/287 (39%), Positives = 157/287 (55%), Gaps = 31/287 (11%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPEL-NHLVPSVDYSGDPIQDIPLFVGQLTKFRCG------  667
             L+EAES   + D GDF+P  +L N L+P VDYS  PI+++PL + QLT+F+ G      
Sbjct  89   TLIEAESQKTMDDYGDFAPSEKLKNELIPPVDYS-QPIEELPLLLVQLTRFKKGSSNNNN  147

Query  666  ----GISLGFAISHVVADGHGLCHFLSEWANLASGKPLSSA---PFHDRRRLLRGVGESS  508
                G+++G A  HV+ DG     F++ WA L  G+ L S    PF DR      +  S+
Sbjct  148  NNQLGLAIGVAFCHVLCDGLAAIRFINAWAKLTRGEVLDSIEMFPFLDR-----TIMNST  202

Query  507  SPQGGPRRVFDHSP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGR--  346
             P   PR  FDH      PL +G +    E+ KE     LRL+  Q+  LK   N+ R  
Sbjct  203  YPPRAPR--FDHPELKPLPLKLGTTDTIEEQKKEKTAVILRLTSQQVEKLKKKTNDERPQ  260

Query  345  --SYNAKPRGYTRFEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGN  172
                    R Y+R+EVI +HIWRCA KAR  +  QPT +  S DIR R+ PPLP +YFGN
Sbjct  261  KEGITKTLRPYSRYEVIASHIWRCASKARELEDLQPTVVRVSADIRNRLNPPLPRNYFGN  320

Query  171  AV-INVVIFGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYR  34
            A+ + +     + E+I+ PL   A KIR+AI+ +  EY+   +DF R
Sbjct  321  ALAVALTPKCHTKELITNPLSHGAQKIREAIELLNDEYIRSQLDFIR  367



>gb|AAZ80046.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus]
Length=436

 Score =   186 bits (473),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 106/277 (38%), Positives = 157/277 (57%), Gaps = 22/277 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD V+ D GDF+P  EL  L+P+VDY+   I+   L V Q+T F+CGG+SLG  
Sbjct  92   LFVEAESDGVIDDFGDFAPTLELRKLIPAVDYTLG-IESYSLLVLQVTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H  ADG    HF++ W++LA G  L+  PF DR  LLR    S  P   P+  FDH  
Sbjct  151  MQHHAADGASGLHFINTWSDLARGLDLAVPPFIDRT-LLR----SRDP---PQPAFDHIE  202

Query  471  ---SPPLIVGQSSD--ESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRF  310
               +PP+    +    + E + ET VS  +L++ Q++ALK  +  +G + N     Y+ +
Sbjct  203  YQPAPPMKTAPTPTPTDDESVPETTVSIFKLTRDQVNALKGKSKEDGNTVN-----YSSY  257

Query  309  EVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEI  130
            E+++ H+WRC CKAR     Q T L  + D R R+ P LP  YFGN +       V+G++
Sbjct  258  EMLSGHVWRCVCKARGLPDDQDTKLYIATDGRARLRPSLPRGYFGNVIFTTTPIAVAGDL  317

Query  129  ISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             S+P    ASKI DA+  +  +Y+  A+D+   + D+
Sbjct  318  QSKPTWYAASKIHDALARMDDDYLKSALDYLELQPDL  354



>ref|XP_006605610.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like isoform 
X2 [Glycine max]
Length=464

 Score =   187 bits (474),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 113/287 (39%), Positives = 157/287 (55%), Gaps = 31/287 (11%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPEL-NHLVPSVDYSGDPIQDIPLFVGQLTKFRCG------  667
             L+EAES   + D GDF+P  +L N L+P VDYS  PI+++PL + QLT+F+ G      
Sbjct  89   TLIEAESQKTMDDYGDFAPSEKLKNELIPPVDYS-QPIEELPLLLVQLTRFKKGSSNNNN  147

Query  666  ----GISLGFAISHVVADGHGLCHFLSEWANLASGKPLSSA---PFHDRRRLLRGVGESS  508
                G+++G A  HV+ DG     F++ WA L  G+ L S    PF DR      +  S+
Sbjct  148  NNQLGLAIGVAFCHVLCDGLAAIRFINAWAKLTRGEVLDSIEMFPFLDR-----TIMNST  202

Query  507  SPQGGPRRVFDHSP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGR--  346
             P   PR  FDH      PL +G +    E+ KE     LRL+  Q+  LK   N+ R  
Sbjct  203  YPPRAPR--FDHPELKPLPLKLGTTDTIEEQKKEKTAVILRLTSQQVEKLKKKTNDERPQ  260

Query  345  --SYNAKPRGYTRFEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGN  172
                    R Y+R+EVI +HIWRCA KAR  +  QPT +  S DIR R+ PPLP +YFGN
Sbjct  261  KEGITKTLRPYSRYEVIASHIWRCASKARELEDLQPTVVRVSADIRNRLNPPLPRNYFGN  320

Query  171  AV-INVVIFGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYR  34
            A+ + +     + E+I+ PL   A KIR+AI+ +  EY+   +DF R
Sbjct  321  ALAVALTPKCHTKELITNPLSHGAQKIREAIELLNDEYIRSQLDFIR  367



>gb|AFN85668.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Hibiscus cannabinus]
Length=431

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 153/270 (57%), Gaps = 13/270 (5%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ +V+ D GDF+P  EL  L+P+VDYSG  I   PL V Q+T F+CGG SLG  
Sbjct  92   LFVEAETTSVIDDFGDFAPTLELRQLIPTVDYSGG-ISTYPLLVLQVTYFKCGGASLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG+   HF++ W+++A G  L+  PF DR  LLR       PQ     +    P
Sbjct  151  MQHHAADGYSGLHFINTWSDMARGLDLTIPPFIDRT-LLRA---RDPPQPAFHHIEYQPP  206

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEVITAHI  289
            P +   +  +S   + T VS  +L++ Q++ALKA +  +G S N     Y+ +E+++ H+
Sbjct  207  PAL--NTPPQSTGPESTAVSIFKLTREQLNALKAKSKEDGNSVN-----YSSYEMLSGHV  259

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WR  CKAR     Q T L  + D R R+ PPLP  YFGN +       V+G+++ +P   
Sbjct  260  WRSVCKARGLTDDQGTKLYIATDGRSRLRPPLPPGYFGNVIFTATPIAVAGDLMLKPTWY  319

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             AS+I DA+  +  EY+  A+DF   + D+
Sbjct  320  AASRIHDALVRMDDEYLRSALDFLELQPDL  349



>ref|XP_007146248.1| hypothetical protein PHAVU_006G024700g [Phaseolus vulgaris]
 gb|ESW18242.1| hypothetical protein PHAVU_006G024700g [Phaseolus vulgaris]
Length=449

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 116/282 (41%), Positives = 157/282 (56%), Gaps = 16/282 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRC-GGISLGF  649
            VL+EAES   + D  DF     +  LVP+VDY+   IQ++PL + Q+T F      S+G 
Sbjct  91   VLIEAESTKTVQDYDDFF-GESIKDLVPTVDYTKILIQELPLLLVQVTSFLGHEAFSIGV  149

Query  648  AISHVVADGHGLCHFLSEWANLASGKPLS--SAPFHDRRRLLRGVGESSSPQGGPRRVFD  475
            AISH++ DG     F++ WA LA G  L     PF DR  +LR +   S     P+R FD
Sbjct  150  AISHILCDGVAGVQFINSWAKLARGDTLEPHEMPFLDRT-VLRFIAPPS-----PQR-FD  202

Query  474  HSP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFE  307
            H      PLI+G+  + +E+ K  K + L+L+  Q+  LK  AN   S     R Y+RFE
Sbjct  203  HLEFKPLPLILGRCDNTAEKNKRVKATLLKLTAEQVGKLKNKANADESTKGS-RPYSRFE  261

Query  306  VITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEII  127
             I AH+WR ACKAR     QPT + F+ DIR R+ PPLP +YFGNA+         GEI+
Sbjct  262  AIAAHVWRSACKARGLDENQPTVVRFNADIRNRLIPPLPANYFGNALALTAASSQVGEIL  321

Query  126  SRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            S  L   A KIR+AI+ +T EY++  ID  R +  V K + L
Sbjct  322  SNSLGRAAKKIREAIEVLTYEYISSQIDVIRGQDHVDKARAL  363



>ref|XP_010094061.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB55151.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=447

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/268 (36%), Positives = 152/268 (57%), Gaps = 20/268 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + V AE+ +++ D G+F+P PEL  L+PSVDYS   I    L + QLT F+CGG+SLG  
Sbjct  105  LFVVAETTSLIDDFGEFAPTPELRRLIPSVDYSAG-ISSYSLLILQLTYFKCGGVSLGVG  163

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H  ADG    HF++ W+++A G  L+  PF DR  LLR        +  PR  F+H  
Sbjct  164  VQHHSADGFSGLHFVNTWSDMARGLDLTIPPFIDRT-LLRA-------RDPPRPAFEHVE  215

Query  471  ---SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEV  304
               +P +   Q + +S+   ET V   ++++ Q++ LK  +  NG + N     Y+ + +
Sbjct  216  YKPAPAMKTAQPTKDSQSSPETAVGMFKMTREQLNTLKTKSKENGNTIN-----YSSYAM  270

Query  303  ITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIIS  124
            ++ H+WRCACKAR     Q T L  + D R R++PPLP  YFGN +       ++G+I S
Sbjct  271  LSGHVWRCACKARELPEDQETKLYIATDGRSRLQPPLPPGYFGNVIFTATPMAMAGDIQS  330

Query  123  RPLQDVASKIRDAIDGVTSEYVNCAIDF  40
            +P    AS+I D +  + ++Y+  A+D+
Sbjct  331  KPTWYAASRIHDTLARMDNDYLRSALDY  358



>gb|ADL62855.1| hydroxycinnamoyl-CoA transferase 2 [Cynara cardunculus var. scolymus]
Length=432

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/274 (39%), Positives = 152/274 (55%), Gaps = 20/274 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE D+ L D G+F+P PEL  L P+VDYSGD I   PLF  Q+T F+CGG++LG  
Sbjct  92   LFVEAELDSTLDDFGEFTPSPELRRLTPTVDYSGD-ISSYPLFFAQVTHFKCGGVALGCG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H +ADG    HF++ W+++A G  ++  PF DR  LLR        +  P   FDH  
Sbjct  151  VFHALADGLSSIHFINTWSDMARGLSIAIPPFIDRT-LLRA-------REPPTPTFDHIE  202

Query  471  --SPPLIVGQSSD-ESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVI  301
              +PP +   S + ES R   T V  L+L+  Q++ LKA+  N  S       Y+ +E++
Sbjct  203  YHAPPSMKTISQNPESSRKPSTTV--LKLTLDQLNVLKASTKNDGSNTT----YSTYEIL  256

Query  300  TAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISR  121
             AH+WRCACKAR     Q T L  + D R R+ P LP  Y GN V        SG++ ++
Sbjct  257  AAHLWRCACKARGLPDDQLTKLYVATDGRSRLSPQLPPGYLGNVVFTTTPVAKSGDLTTQ  316

Query  120  PLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             L + AS IR  +  + + Y+  AID+   + D+
Sbjct  317  SLSNAASLIRTTLTKMDNNYLRSAIDYPEVQPDL  350



>gb|KDP38697.1| hypothetical protein JCGZ_04050 [Jatropha curcas]
Length=424

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/274 (36%), Positives = 150/274 (55%), Gaps = 19/274 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + +EAE+++ + +LGD     E   L+P VD+S + I   PLF  Q+TKFRCGG+SLG  
Sbjct  83   LFIEAETESAIHELGDSMLYEENRQLIPRVDHSKNDISSFPLFALQVTKFRCGGLSLGMQ  142

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPR---RVFD  475
              + ++DG    HF   W  +A G P+S  PF DR  L   V       G P+     +D
Sbjct  143  WHYTLSDGRAYIHFAKTWCEIARGLPISHQPFIDRTILRNQVA------GKPKFRHSEYD  196

Query  474  HSPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN--NGRSYNAKPRGYTRFEVI  301
            + PP+   Q+++        K    +++  Q++ALK+     N    N K + Y+ +E++
Sbjct  197  NLPPINPTQNNN-------AKTEIFKITVEQLNALKSKVQEENNNHGNGKTK-YSSYEIL  248

Query  300  TAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISR  121
            TAHIWRC CKAR     Q T +  +VD R R++PPLP  YFGNAV    +  +SGEIIS 
Sbjct  249  TAHIWRCTCKARGLSNDQATKINMAVDGRSRLKPPLPSGYFGNAVFRASLTALSGEIISE  308

Query  120  PLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             L++   +IR AI+ +  E++   +D+     D+
Sbjct  309  TLKETVERIRKAINRMDDEFLRSTMDYIDGLDDI  342



>dbj|BAJ14794.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Ipomoea batatas]
Length=431

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/269 (38%), Positives = 150/269 (56%), Gaps = 11/269 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +LVEAESD  + D GDF+P  EL  L+P+VDYS   I+  PL V Q+T F+CGG+SLG  
Sbjct  92   LLVEAESDGFVDDFGDFAPTLELRQLIPTVDYS-QGIESYPLLVLQVTHFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG    HF++ W+++A G  L+  PF DR  LLR       PQ   + V    P
Sbjct  151  MQHHAADGASGLHFINTWSDMARGLDLTVPPFIDRT-LLRA---REPPQPQFQHVEYQPP  206

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P +  ++        +T VS  +LS+ QI ALKA +      +     Y+ +E++  H+W
Sbjct  207  PAL--KAPQPQNVTSDTAVSIFKLSRDQISALKAKSKE----DGNTVAYSSYEMLAGHVW  260

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            RCAC+AR     Q T L  + D R R+ P LP  YFGN +       V+G++ S+P+   
Sbjct  261  RCACRARGLTEDQETKLYIATDGRSRLRPSLPTGYFGNVIFTATPIAVAGDLQSKPVWFA  320

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            ASKI  A+  + ++Y+  A+D+   + D+
Sbjct  321  ASKIHGALGRMDNDYLRSALDYLELQPDL  349



>gb|ABO52899.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase [Pinus 
radiata]
Length=433

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/269 (37%), Positives = 150/269 (56%), Gaps = 9/269 (3%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +LVEA +D+V+ D GDF+P  EL  L+P V+YS D I   PL V Q+T F+CGG+SLG  
Sbjct  92   LLVEAITDSVIDDFGDFAPTMELKQLIPKVNYSED-ISSYPLLVLQVTFFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H VADG+   HF++ W+++A G  ++  PF DR  LLR     + P    + +    P
Sbjct  151  MQHHVADGYAGIHFINTWSDVARGLDITLPPFIDRT-LLRA---RNPPTPKFQHIEYQQP  206

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P +   S   +    +  V+  +L+K Q+  LK  A      N     Y+ +E+++ HIW
Sbjct  207  PPLKDTSGIMNGEKTDISVAIFKLTKEQLEILKGKARE----NGNNIAYSSYEMLSGHIW  262

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            RCACKAR+    Q T L  + D R R+ P +P  YFGN +       V+G+IIS+P    
Sbjct  263  RCACKARNLAEDQETKLYIATDGRNRLRPSIPPGYFGNVIFTTTPMAVTGDIISKPTYYA  322

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            AS I +A+  +  EY+  A+D+   + D+
Sbjct  323  ASVIHEALGRMDDEYLRSALDYLELQPDL  351



>gb|AGA20364.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Leucaena leucocephala]
Length=439

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/280 (37%), Positives = 157/280 (56%), Gaps = 25/280 (9%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +LVEAE+  V+ D GDF+P  EL  L+P+VDYSG  I+  PL V Q+T F+CGG+SLG  
Sbjct  92   LLVEAETIGVIDDFGDFAPTLELRQLIPAVDYSGG-IETYPLLVLQVTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H  ADG    HF++ W+++A G  L+  PF DR  LLR        +  P+ VF+H  
Sbjct  151  MQHHAADGFSGLHFINTWSDMARGFDLTLPPFIDRT-LLRA-------RDPPQPVFEHIE  202

Query  471  --SPPLI------VGQSSDESERMKETKVSTLRLSKPQIHALKAAANN-GRSYNAKPRGY  319
               PP +      V   +          VS  ++++ Q++ALKA +   G + N     Y
Sbjct  203  YKPPPTMKSPQNPVQSPTKPGSDPNTATVSIFKMTRAQLNALKAKSKEAGNTVN-----Y  257

Query  318  TRFEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVS  139
            + +E++  H+WR  CKAR+    Q T L  + D R R++PPLP  YFGN +       V+
Sbjct  258  SSYEMLAGHVWRSTCKARALPDDQETKLYIATDGRSRLQPPLPPGYFGNVIFTATPMAVA  317

Query  138  GEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            G+++S+P    AS+I +A+  + +EY+  A+DF   + D+
Sbjct  318  GDLMSKPTWFAASRIHNALSRMDNEYLRSALDFLELQPDL  357



>ref|XP_002512739.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF49242.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=431

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/270 (39%), Positives = 153/270 (57%), Gaps = 13/270 (5%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +LV AE++AV+ D GDF+P  EL  L+P+VDYSG  I   PL V Q+T F+CGG+SLG  
Sbjct  92   LLVVAETNAVVDDFGDFAPTLELKQLIPTVDYSGG-ISTFPLLVLQVTHFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG    HF++ W+++A G   +  PF DR  LLR       PQ     +    P
Sbjct  151  MQHHAADGFSGLHFVNTWSDMARGLDCTIPPFIDRT-LLRA---RDPPQPQFNHIEYQPP  206

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEVITAHI  289
            P +  ++S E+ +   T VS  +LS+ Q++ LKA A  +G + N     Y+ + ++  H+
Sbjct  207  PAL--KASAETLKPDSTTVSIFKLSRDQLNILKAKAKEDGNTIN-----YSSYAMLAGHV  259

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WR ACKAR     Q T L  + D R R+ PPLP  YFGN +       V+G++ S+P   
Sbjct  260  WRSACKARGLTDDQETKLYIATDGRSRLNPPLPPGYFGNVIFTATPIAVAGDLESKPTWY  319

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             A KI DA+  + ++Y+  A+DF   + D+
Sbjct  320  AAGKIHDALARMDNDYLRSALDFLELQPDL  349



>gb|KHM99609.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=412

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 115/277 (42%), Positives = 154/277 (56%), Gaps = 22/277 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNH-LVPSVDYSGDPIQDIPLFVGQLTKFRCG-----G  664
             L+EAE+   LAD GDFSP   +   LVP++DY   PIQ+IPL   QLT+F+       G
Sbjct  37   TLIEAETAKTLADFGDFSPSDSIKEELVPAIDYHSQPIQEIPLLFVQLTRFKGDQQQQHG  96

Query  663  ISLGFAISHVVADGHGLCHFLSEWANLASGKPL--SSAPFHDRRRLLRGVGESSSPQGGP  490
            +++G A SH VADG     F++ WA +  G  L  +  PF DR  +L+    SSS     
Sbjct  97   LAIGMAYSHPVADGLAWTRFVNTWAMVNRGDSLDVNEMPFLDRT-ILKFPTWSSSLSLLS  155

Query  489  RRVFDHSP-------PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAK  331
                 HS        PLI+G+S    E+ K+T  S L+L+  Q+  LK  AN+  S    
Sbjct  156  PPPLSHSDHPELKPLPLILGRSDSTEEQNKKTTASVLKLTSKQVEMLKKKANDQGSTPC-  214

Query  330  PRGYTRFEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVI  151
                TRFE + AHIWRCACKAR    +QPT + F+ DIR R+ PPLP +YFGNA++  V 
Sbjct  215  ----TRFEAVAAHIWRCACKARGQHHKQPTIVRFNGDIRNRLIPPLPRNYFGNALVATVT  270

Query  150  -FGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAID  43
                 GEI SRPL   A K+R+AI  +  EY+   ++
Sbjct  271  PECYVGEITSRPLSYAARKLREAIALLRDEYIRSQLE  307



>ref|XP_007150819.1| hypothetical protein PHAVU_005G183200g [Phaseolus vulgaris]
 gb|ESW22813.1| hypothetical protein PHAVU_005G183200g [Phaseolus vulgaris]
Length=456

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/276 (38%), Positives = 157/276 (57%), Gaps = 21/276 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEA++ A + D GDFSP  EL  L+P+VDYS   I+  PL V Q+T F+CGG+SLG  
Sbjct  113  LFVEADTTAAIDDFGDFSPSLELRQLIPAVDYSAG-IETYPLLVLQVTYFKCGGVSLGVG  171

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W++LA G  +S  PF DR  L      S  P   PR VFDH  
Sbjct  172  MQHHVADGASGLHFINAWSDLARGFDISLPPFIDRTLLC-----SRDP---PRPVFDHIE  223

Query  471  -SPPLIVGQSSDESERMKE---TKVSTLRLSKPQIHALKAAA-NNGRSYNAKPRGYTRFE  307
              PP  +  ++ +  +        VST +LS+ Q++ LK  +  +G S +     Y+ +E
Sbjct  224  YRPPPAMNTTTLQPPKPGSDGAVAVSTFKLSRDQLNTLKGKSREDGNSIS-----YSSYE  278

Query  306  VITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEII  127
            ++  H+WR  C+AR    +Q T L  + D R R++PPLP  YFGN +       V+G++I
Sbjct  279  MLAGHVWRSVCRARELPDEQETKLYIATDGRSRLQPPLPPGYFGNVIFTTTPVAVAGDLI  338

Query  126  SRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            S+P    AS+I DA+  + +EY+  A+D+   + D+
Sbjct  339  SKPTWYAASRIHDALMRMDNEYLRSALDYLEVQPDL  374



>emb|CDO98242.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 102/270 (38%), Positives = 153/270 (57%), Gaps = 10/270 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD V+ D GDF+P  EL  L+P+VDYS   I    L V Q+T F+CGG+SLG  
Sbjct  92   LFVEAESDGVVDDFGDFAPTLELRRLIPAVDYS-QGISSYALLVLQVTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG    HF++ W+++A G  ++  PF DR  LLR       PQ   + +    P
Sbjct  151  MQHHAADGFSGLHFINSWSDMARGLDVTLPPFIDRT-LLRA---RDPPQPQFQHIEYQPP  206

Query  465  P-LIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            P L V   + +S+ + ET VS  +L++ QI ALKA +      +     Y+ +E++  H+
Sbjct  207  PALKVSPQTAKSDSVPETAVSIFKLTREQISALKAKSKE----DGNTISYSSYEMLAGHV  262

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCACKAR  +  Q T L  + D R R+ P LP  YFGN +       ++G++  +P+  
Sbjct  263  WRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWY  322

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             ASKI DA+  + ++Y+  A+D+   + D+
Sbjct  323  AASKIHDALARMDNDYLRSALDYLELQPDL  352



>gb|AAZ80047.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. altilis]
Length=308

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 102/266 (38%), Positives = 151/266 (57%), Gaps = 24/266 (9%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD V+ D GDF+P  EL  L+P+VDYS   I+   L V Q+T F+CGG+SLG  
Sbjct  61   LFVEAESDGVIDDFGDFAPTLELRKLIPAVDYSLG-IESYSLLVLQVTYFKCGGVSLGVG  119

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H  ADG    HF++ W+++A G  L+  PF DR  L     ++  P   P  VF+H  
Sbjct  120  MQHHAADGASGLHFINAWSDMARGLDLTLPPFIDRTLL-----QARDP---PVPVFEHVE  171

Query  471  ---SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEV  304
               +PP+ +   S   E    T VS  +L++ Q++ LKA +  +G + N     Y+ +E+
Sbjct  172  YQPAPPMKLAPKSASDE----TVVSMFKLTRDQLNGLKAKSKEDGNTIN-----YSSYEM  222

Query  303  ITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIIS  124
            ++ H+WR  CKAR  K  Q T L  + D R R++P LP  YFGN +       V+GE+ S
Sbjct  223  LSGHVWRSVCKARGLKDDQDTKLYIATDGRARLQPALPAGYFGNVIFTTTPIAVAGELQS  282

Query  123  RPLQDVASKIRDAIDGVTSEYVNCAI  46
            +P    ASKI DA+  + ++Y+  A+
Sbjct  283  KPTWYAASKIHDALAKMNNDYLKSAL  308



>gb|AIG20957.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Lonicera japonica]
Length=424

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 100/272 (37%), Positives = 155/272 (57%), Gaps = 18/272 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD V+ D GDF+P  E+  L+P+VDYS   I    L V Q+T F+CGG+SLG  
Sbjct  92   LFVEAESDGVIGDFGDFAPTLEMRKLIPAVDYSQG-ISSYALLVLQITYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H  ADG    HF++ W+++A G  L+  PF DR  LLR        +  P+  F H  
Sbjct  151  MQHHAADGASGLHFINTWSDMARGLDLTIPPFIDRT-LLRA-------RDPPQPTFPHIE  202

Query  471  -SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PP  +   ++E+  + +T VS  +L++ QI++LKA + +    +    GY+ +E++  
Sbjct  203  YQPPPTMRTKNNET--VPDTDVSIFKLTRDQINSLKAKSKD----DGNAIGYSSYEIMAG  256

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            H+WRC CKAR     Q T L  + D R R++P LP  YFGN +       V+G++ S+P 
Sbjct  257  HLWRCVCKARGLPEDQETKLYIATDGRARLKPSLPPGYFGNVIFTTTPIAVAGDLQSKPA  316

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
               AS+I DA+  + ++Y+  A+D+   + D+
Sbjct  317  WYAASRIHDALTRMDNDYLRSALDYLELQPDL  348



>ref|XP_010063596.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063597.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70836.1| hypothetical protein EUGRSUZ_F03978 [Eucalyptus grandis]
Length=454

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/273 (37%), Positives = 152/273 (56%), Gaps = 16/273 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ +V+ D GDF+P  EL  L+P+VDYSG  I   P+ V Q+T F+CGG+SLG  
Sbjct  99   LFVEAETSSVINDFGDFAPTLELRKLIPAVDYSGG-ISSYPVLVLQVTYFKCGGVSLGVG  157

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W++LA G  +   PF DR  LLR    + SP   PR  F H  
Sbjct  158  MQHHVADGFSGLHFVNTWSDLARGLDVKLPPFIDRT-LLR----AHSP---PRPQFPHIE  209

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
              SPP +       +     T VS  ++++ Q+  LK  A      N     Y+ +E++ 
Sbjct  210  YQSPPALRVSPETTNSAPYSTTVSIFKVTREQLDTLKTQAE---LENGNITSYSSYEILA  266

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             H+WRCAC+AR     Q + L  + D R R+ PPLP  YFGN +       V+G++IS+P
Sbjct  267  GHVWRCACRARGLSDDQDSKLYIATDGRMRLSPPLPRGYFGNVIFTATPIAVAGDLISKP  326

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            +   A KIR+++  +  +Y+  A+D+   + D+
Sbjct  327  VSYAAQKIRESLARMDDDYLRSALDYLELQPDL  359



>pdb|4G2M|A Chain A, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 2)
Length=439

 Score =   184 bits (467),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/270 (38%), Positives = 152/270 (56%), Gaps = 10/270 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD V+ D GDF+P  EL  L+P+VDYS   I    L V Q+T F+CGG+SLG  
Sbjct  97   LFVEAESDGVVDDFGDFAPTLELRRLIPAVDYS-QGISSYALLVLQVTYFKCGGVSLGVG  155

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG    HF++ W+++A G  ++  PF DR  LLR       PQ   + +    P
Sbjct  156  MRHHAADGFSGLHFINSWSDMARGLDVTLPPFIDRT-LLRA---RDPPQPQFQHIEYQPP  211

Query  465  P-LIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            P L V   +  S+ + ET VS  +L++ QI ALKA +      +     Y+ +E++  H+
Sbjct  212  PALAVSPQTAASDSVPETAVSIFKLTREQISALKAKSKE----DGNTISYSSYEMLAGHV  267

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCACKAR  +  Q T L  + D R R+ P LP  YFGN +       ++G++  +P+  
Sbjct  268  WRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWY  327

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             ASKI DA+  + ++Y+  A+D+   + D+
Sbjct  328  AASKIHDALARMDNDYLRSALDYLELQPDL  357



>emb|CAD88491.1| hydroxycinnamoyl-CoA hydroxycinnamoyltransferase [Nicotiana benthamiana]
Length=319

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 103/272 (38%), Positives = 152/272 (56%), Gaps = 13/272 (5%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD V+ D GDF+P  EL  L+P+VDYS   IQ   L V Q+T F+CGG+SLG  
Sbjct  26   LFVEAESDGVVDDFGDFAPTLELRQLIPAVDYS-QGIQSYALLVLQITHFKCGGVSLGVG  84

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG    HF++ W+++A G  L+  PF DR  LLR       PQ     V    P
Sbjct  85   MQHHAADGASGLHFINTWSDMARGLDLTIPPFIDRT-LLRA---RDPPQPQFPHVEYQPP  140

Query  465  PL--IVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEVITA  295
            P   +  +++   E + ET VS  +L++ QI+ LKA +  +G + N     Y+ +E++  
Sbjct  141  PTLKVTPENTTNPEIVPETSVSIFKLTRDQINTLKAKSKEDGNTVN-----YSSYEMLAG  195

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            H+WR  C AR     Q T L  + D R R+ P LP  YFGN +       V+G+I S+P+
Sbjct  196  HVWRSTCMARGLAHDQETKLYIATDGRSRLRPSLPPGYFGNVIFTTTPIAVAGDIQSKPI  255

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
               ASK+ DA+  + ++Y+  A+D+   + D+
Sbjct  256  WYAASKLHDALARMDNDYLRSALDYLELQPDL  287



>pdb|4G0B|A Chain A, Structure Of Native Hct From Coffea Canephora
 pdb|4G0B|B Chain B, Structure Of Native Hct From Coffea Canephora
Length=436

 Score =   184 bits (467),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/270 (38%), Positives = 153/270 (57%), Gaps = 10/270 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD V+ D GDF+P  EL  L+P+VDYS   I    L V Q+T F+CGG+SLG  
Sbjct  94   LFVEAESDGVVDDFGDFAPTLELRRLIPAVDYS-QGISSYALLVLQVTYFKCGGVSLGVG  152

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG    HF++ W+++A G  ++  PF DR  LLR       PQ   + +    P
Sbjct  153  MRHHAADGFSGLHFINSWSDMARGLDVTLPPFIDRT-LLRA---RDPPQPQFQHIEYQPP  208

Query  465  P-LIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            P L V   + +S+ + ET VS  +L++ QI ALKA +      +     Y+ +E++  H+
Sbjct  209  PALKVSPQTAKSDSVPETAVSIFKLTREQISALKAKSKE----DGNTISYSSYEMLAGHV  264

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCACKAR  +  Q T L  + D R R+ P LP  YFGN +       ++G++  +P+  
Sbjct  265  WRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWY  324

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             ASKI DA+  + ++Y+  A+D+   + D+
Sbjct  325  AASKIHDALARMDNDYLRSALDYLELQPDL  354



>gb|AFL93686.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl-transferase 
[Cynara cardunculus var. scolymus]
Length=436

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 105/277 (38%), Positives = 155/277 (56%), Gaps = 22/277 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD V+ D GDF+P  EL  L+P+VDY+   I+   L V Q+T FRCGG+SLG  
Sbjct  92   LFVEAESDGVIDDFGDFAPTLELRKLIPAVDYTLG-IESYSLLVLQVTYFRCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H  ADG    HF++ W++LA G  L+  PF DR  LLR        +  P+  FDH  
Sbjct  151  MQHHAADGASGLHFINTWSDLARGLDLTVPPFIDRT-LLRA-------RDPPQPAFDHIE  202

Query  471  ---SPPLIVGQSSD--ESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRF  310
               +PP+    +    + E + ET VS  RL++ Q++ALK  +  +G + N     Y+ +
Sbjct  203  YQPAPPMKTAPTPTPTDDESVPETTVSIFRLTRDQVNALKGKSKEDGNTIN-----YSSY  257

Query  309  EVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEI  130
            E+++ H+WRC  KAR     Q T L  + D R R+ P LP  YFGN +       V+G++
Sbjct  258  EMLSGHVWRCVRKARGLPDDQDTKLYIATDGRARLRPSLPRGYFGNVIFTTTPIAVAGDL  317

Query  129  ISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             S+P    ASKI DA+  +  +Y+  A+D+   + D+
Sbjct  318  QSKPTWYAASKIHDALARMDDDYLKSALDYLELQPDL  354



>gb|ABO47805.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 102/270 (38%), Positives = 153/270 (57%), Gaps = 10/270 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD V+ D GDF+P  EL  L+P+VDYS   I    L V Q+T F+CGG+SLG  
Sbjct  92   LFVEAESDGVVDDFGDFAPTLELRRLIPAVDYS-QGISSYALLVLQVTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG    HF++ W+++A G  ++  PF DR  LLR       PQ   + +    P
Sbjct  151  MRHHAADGFSGLHFINSWSDMARGLDVTLPPFIDRT-LLRA---RDPPQPQFQHIEYQPP  206

Query  465  P-LIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            P L V   + +S+ + ET VS  +L++ QI ALKA +      +     Y+ +E++  H+
Sbjct  207  PALKVSPQTAKSDSVPETAVSIFKLTREQISALKAKSKE----DGNTISYSSYEMLAGHV  262

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCACKAR  +  Q T L  + D R R+ P LP  YFGN +       ++G++  +P+  
Sbjct  263  WRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWY  322

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             ASKI DA+  + ++Y+  A+D+   + D+
Sbjct  323  AASKIHDALARMDNDYLRSALDYLELQPDL  352



>ref|XP_003532110.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=465

 Score =   184 bits (468),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 115/277 (42%), Positives = 154/277 (56%), Gaps = 22/277 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNH-LVPSVDYSGDPIQDIPLFVGQLTKFRCG-----G  664
             L+EAE+   LAD GDFSP   +   LVP++DY   PIQ+IPL   QLT+F+       G
Sbjct  90   TLIEAETAKTLADFGDFSPSDSIKEELVPAIDYHSQPIQEIPLLFVQLTRFKGDQQQQHG  149

Query  663  ISLGFAISHVVADGHGLCHFLSEWANLASGKPL--SSAPFHDRRRLLRGVGESSSPQGGP  490
            +++G A SH VADG     F++ WA +  G  L  +  PF DR  +L+    SSS     
Sbjct  150  LAIGMAYSHPVADGLAWTRFVNTWAMVNRGDSLDVNEMPFLDRT-ILKFPTWSSSLSLLS  208

Query  489  RRVFDHSP-------PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAK  331
                 HS        PLI+G+S    E+ K+T  S L+L+  Q+  LK  AN+  S    
Sbjct  209  PPPLSHSDHPELKPLPLILGRSDSTEEQNKKTTASVLKLTSKQVEMLKKKANDQGSTPC-  267

Query  330  PRGYTRFEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVI  151
                TRFE + AHIWRCACKAR    +QPT + F+ DIR R+ PPLP +YFGNA++  V 
Sbjct  268  ----TRFEAVAAHIWRCACKARGQHHKQPTIVRFNGDIRNRLIPPLPRNYFGNALVATVT  323

Query  150  -FGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAID  43
                 GEI SRPL   A K+R+AI  +  EY+   ++
Sbjct  324  PECYVGEITSRPLSYAARKLREAIALLRDEYIRSQLE  360



>gb|AFS68800.1| hydroxycinnamoyl transferase [Lonicera japonica]
Length=430

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 100/272 (37%), Positives = 155/272 (57%), Gaps = 18/272 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD V+ D GDF+P  E+  L+P+VDYS   I    L V Q+T F+CGG+SLG  
Sbjct  92   LFVEAESDGVIGDFGDFAPTLEMRKLIPAVDYSQG-ISSYALLVLQITYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H  ADG    HF++ W+++A G  L+  PF DR  LLR        +  P+  F H  
Sbjct  151  MQHHAADGASGLHFINAWSDMARGLDLTIPPFIDRT-LLRA-------RDPPQPTFPHIE  202

Query  471  -SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PP  +   ++E+  + +T VS  +L++ QI++LKA + +    +    GY+ +E++  
Sbjct  203  YQPPPTMRTKNNET--VPDTDVSIFKLTRDQINSLKAKSKD----DGNAIGYSSYEMMAG  256

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            H+WRC CKAR     Q T L  + D R R++P LP  YFGN +       V+G++ S+P 
Sbjct  257  HLWRCVCKARGLPEDQETKLYIATDGRARLKPSLPPGYFGNVIFTTTPIAVAGDLQSKPA  316

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
               AS+I DA+  + ++Y+  A+D+   + D+
Sbjct  317  WYAASRIHDALTRMDNDYLRSALDYLELQPDL  348



>emb|CAJ40778.1| hydroxycinnamoyl transferase [Coffea arabica]
Length=434

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 102/270 (38%), Positives = 152/270 (56%), Gaps = 10/270 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD V+ D GDF+P  EL  L+P+VDYS   I    L V Q+T F+CGG+SLG  
Sbjct  92   LFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQG-ISSYALLVLQVTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG    HF++ W+++A G  ++  PF DR  LLR       PQ   + +    P
Sbjct  151  MQHHAADGFSGLHFINSWSDMARGLDVTLPPFIDRT-LLRA---RDPPQPQFQHIEYQPP  206

Query  465  P-LIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            P L V   + +S+ + ET VS  +L++ QI ALKA        +     Y+ +E++  H+
Sbjct  207  PTLKVSPQTAKSDSVPETAVSIFKLTREQISALKAKPKE----DGNTISYSSYEMLAGHV  262

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCACKAR  +  Q T L  + D R R+ P LP  YFGN +       ++G++  +P+  
Sbjct  263  WRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWY  322

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             ASKI DA+  + ++Y+  A+D+   + D+
Sbjct  323  AASKIHDALARMDNDYLRSALDYLELQPDL  352



>ref|XP_007023475.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 ref|XP_007023476.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26097.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26098.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
Length=431

 Score =   183 bits (465),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 103/274 (38%), Positives = 156/274 (57%), Gaps = 21/274 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +LVEAE+++V+ D GDF+P  EL  L+P+VDYSG  I   PL V Q+T F+CGG SLG  
Sbjct  92   LLVEAETNSVIDDFGDFAPTLELRQLIPTVDYSGG-IGTYPLLVLQVTYFKCGGASLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H  ADG    HF++ W+++A G  L+  PF DR  LLR        +  P+ VF H  
Sbjct  151  MQHHAADGFSGLHFINTWSDMARGLDLTIPPFIDRT-LLRA-------RDPPQPVFHHIE  202

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEVI  301
               PP +   +  +S   + T VS  +L++ Q++ALKA +  +G + N     Y+ +E++
Sbjct  203  YQPPPAM--NTPPQSTGPESTAVSIFKLTREQLNALKAKSKEDGNTVN-----YSSYEML  255

Query  300  TAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISR  121
            + H+WR  CKAR     Q T L  + D R R+ PPLP  YFGN +       V+G+++S+
Sbjct  256  SGHVWRSVCKARGLAGDQGTKLYIATDGRARLRPPLPPGYFGNVIFTATPIAVAGDLLSK  315

Query  120  PLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            P    A  I DA+  +  +Y+  A+D+   + D+
Sbjct  316  PTWYAAGTIHDALARMDDDYLRSALDYLELQPDL  349



>ref|XP_003532115.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
 gb|KHM99604.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=452

 Score =   184 bits (466),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 111/276 (40%), Positives = 157/276 (57%), Gaps = 18/276 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNH-LVPSVDYSGDPIQDIPLFVGQLTKFRCG-GISLG  652
             L+EAE+   L D GDFSP   +   LVP +DY+  P++++PL   QLT+F+ G   ++G
Sbjct  90   TLLEAETTKSLGDYGDFSPSESIKEELVPQIDYT-QPLEELPLLFVQLTRFKDGESFAIG  148

Query  651  FAISHVVADGHGLCHFLSEWANLASGKPLS--SAPFHDRRRLLRGVGESSSPQGGPRRVF  478
             A SH +ADG     F++ WA +A G+ L     PF DR  +L+     S+P       F
Sbjct  149  VACSHTLADGLSAIQFINSWAKVARGETLEPHEVPFLDRT-VLKLQHSPSAP------CF  201

Query  477  DHSP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNG-RSYNAKPRGYTR  313
            DH      PL +G S   +E  K+T    L+L+  Q+  LK  AN+      ++ R Y+R
Sbjct  202  DHPELKPLPLKLGSSDSIAEENKKTCAVLLKLTPEQVGKLKKKANDQPMKEGSRVRPYSR  261

Query  312  FEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVI-FGVSG  136
            FE I AHIWRCACKAR    +QPT + F+ DIR R+ PPLP +YFGNA+   V      G
Sbjct  262  FEAIAAHIWRCACKARELDEKQPTLVRFNGDIRSRLIPPLPRTYFGNALAATVTPRCYVG  321

Query  135  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  28
            E +S+PL   A K+R+AI+ +T+EY+   +D    E
Sbjct  322  ETLSKPLSYAAQKVREAIEMLTNEYIRSQLDIVLGE  357



>emb|CCC55431.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Pinus pinaster]
Length=433

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/269 (37%), Positives = 149/269 (55%), Gaps = 9/269 (3%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +LVEA +D+V+ D GDF+P  EL  L+P V+YS D I   PL V Q+T F+CGG+SLG  
Sbjct  92   LLVEAITDSVIDDFGDFAPTMELKQLIPKVNYSED-ISSYPLLVLQVTFFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H VADG+   HF++ W+++A G  ++  PF DR  LLR     + P    + +    P
Sbjct  151  MQHHVADGYAGIHFINTWSDVARGLDITLPPFIDRT-LLRA---RNPPTPKFQHIEYQQP  206

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P +   S   +       V+  +L+K Q+  LK  A      N     Y+ +E+++ HIW
Sbjct  207  PPLKDTSGIMNGEKNGFSVAIFKLTKEQLEILKGKARE----NGNNIAYSSYEMLSGHIW  262

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            RCACKAR+    Q T L  + D R R+ P +P  YFGN +       V+G+IIS+P    
Sbjct  263  RCACKARNLAEDQETKLYIATDGRNRLRPSIPPGYFGNVIFTTTPMAVAGDIISKPTYYA  322

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            AS I +A+  +  EY+  A+D+   + D+
Sbjct  323  ASVIHEALGRMDDEYLRSALDYLELQPDL  351



>gb|AHG97388.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Gossypium hirsutum]
Length=499

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/274 (38%), Positives = 157/274 (57%), Gaps = 21/274 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+++V+ D GDF+P  EL  L+P+VDYSG  I   PL V Q+T F+CGG SLG  
Sbjct  160  LFVEAETNSVIDDFGDFAPTLELRQLIPTVDYSGG-ISTYPLLVLQVTYFKCGGASLGVG  218

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H  ADG+   HF++ W+++A G  L+  PF DR  LLR        +  P+ VF H  
Sbjct  219  MQHHAADGYSGLHFINTWSDMARGLDLTIPPFIDRT-LLRA-------RDPPQPVFHHVE  270

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEVI  301
               PP +  +   +S   + T +S  +L++ Q++ALKA    +G   N     Y+ +E++
Sbjct  271  YQPPPAM--KIPPQSTGPESTAISIFKLTRDQLNALKAKCKEDGNDVN-----YSSYEML  323

Query  300  TAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISR  121
            + H+WR  CKAR  +  Q T L  + D R R+ PPLP  YFGN +       V+G+++S+
Sbjct  324  SGHVWRSVCKARGLEDDQGTKLYIATDGRARLRPPLPPGYFGNVIFTATPIAVAGDLLSK  383

Query  120  PLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            P    AS+I DA+  +  EY+  A+D+   + D+
Sbjct  384  PTWYAASRIHDALVRMDDEYLRSALDYLELQPDL  417



>gb|AAZ80048.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. sylvestris]
Length=308

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/266 (38%), Positives = 151/266 (57%), Gaps = 24/266 (9%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD V+ D GDF+P  EL  L+P+VDYS   I+   L V Q+T F+CGG+SLG  
Sbjct  61   LFVEAESDGVIDDFGDFAPTLELRKLIPAVDYSLG-IESYSLLVLQVTYFQCGGVSLGVG  119

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H  ADG    HF++ W+++A G  L+  PF DR  L     ++  P   P  +F+H  
Sbjct  120  MQHHAADGASGLHFINAWSDMARGLDLTLPPFIDRTLL-----QARDP---PVPIFEHVE  171

Query  471  ---SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEV  304
               +PP+ +   S   E    T VS  +L++ Q++ LKA +  +G + N     Y+ +E+
Sbjct  172  YQPAPPMKLAPKSASDE----TVVSMFKLTRDQLNGLKAKSKEDGNTIN-----YSSYEM  222

Query  303  ITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIIS  124
            ++ H+WR  CKAR  K  Q T L  + D R R++P LP  YFGN +       V+GE+ S
Sbjct  223  LSGHVWRSVCKARGLKDDQDTKLYIATDGRARLQPALPAGYFGNVIFTTTPIAVAGELQS  282

Query  123  RPLQDVASKIRDAIDGVTSEYVNCAI  46
            +P    ASKI DA+  + ++Y+  A+
Sbjct  283  KPTWYAASKIHDALAKMNNDYLKSAL  308



>ref|XP_004303231.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=437

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/275 (37%), Positives = 157/275 (57%), Gaps = 21/275 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + V AES +V+ D GDF+P  EL  L+P+VDYS   I   PL V Q+T F+CGG+SLG  
Sbjct  96   LFVVAESSSVIDDFGDFAPTLELRKLIPTVDYSAG-ISSYPLLVLQVTYFKCGGVSLGVG  154

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  L+  PF DR  LLR        +  P+  F H  
Sbjct  155  MQHHVADGFAGLHFVNTWSDMARGLDLTIPPFIDRT-LLRA-------RDPPQPEFHHIE  206

Query  471  ---SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEV  304
               +PP+   Q S +    +ET +S  +L++ Q++ LKA +  +G + N     Y+ +E+
Sbjct  207  YQPAPPMKNPQQSTKPG-AEETTISIFKLTREQLNTLKAKSKEDGNTVN-----YSSYEM  260

Query  303  ITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIIS  124
            +  H+WRC CKAR     Q T L  + D R R++PPLP  YFGN +       V+G++ S
Sbjct  261  LAGHVWRCVCKARDLPDDQDTKLYIATDGRSRLQPPLPPGYFGNVIFTATPIAVAGDLQS  320

Query  123  RPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            +P    ASKI +A+  + ++Y+  A+D+   + D+
Sbjct  321  KPTWYAASKIHNALVRMDNDYLRSALDYLELQPDL  355



>gb|AEO00530.1| hydroxycinnamoyl transferase [Nicotiana benthamiana]
Length=369

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/272 (38%), Positives = 152/272 (56%), Gaps = 13/272 (5%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD V+ D GDF+P  EL  L+P+VDYS   IQ   L V Q+T F+CGG+SLG  
Sbjct  26   LFVEAESDGVVDDFGDFAPTLELRQLIPAVDYS-QGIQSYALLVLQITHFKCGGVSLGVG  84

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG    HF++ W+++A G  L+  PF DR  LLR       PQ     V    P
Sbjct  85   MQHHAADGASGLHFINTWSDMARGLDLTIPPFIDRT-LLRA---RDPPQPQFPHVEYQPP  140

Query  465  PL--IVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEVITA  295
            P   +  +++   E + ET VS  +L++ QI+ LKA +  +G + N     Y+ +E++  
Sbjct  141  PTLKVTPENTTNPEIVPETSVSIFKLTRDQINTLKAKSKEDGNTVN-----YSSYEMLAG  195

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            H+WR  C AR     Q T L  + D R R+ P LP  YFGN +       V+G+I S+P+
Sbjct  196  HVWRSTCMARGLAHDQETKLYIATDGRSRLRPSLPPGYFGNVIFTTTPIAVAGDIQSKPI  255

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
               ASK+ DA+  + ++Y+  A+D+   + D+
Sbjct  256  WYAASKLHDALARMDNDYLRSALDYLELQPDL  287



>emb|CDG56248.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase 1 
[Glechoma hederacea]
Length=434

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/271 (38%), Positives = 150/271 (55%), Gaps = 15/271 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD  + D GDF+P  EL  L+P+VDYS   I    L V Q+TKF+CGG+SLG  
Sbjct  95   LFVEAESDGSVDDYGDFAPNLELRRLIPAVDYS-QGISTYALLVLQVTKFKCGGVSLGVG  153

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  ++  PF DR  LLR        +  P+  F H  
Sbjct  154  MQHHVADGFSGLHFINTWSDMARGLDITLPPFIDRT-LLRA-------RDPPQPQFKHIE  205

Query  471  SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAH  292
              P    ++        ET VS  +L++ Q+  LKA +      +     Y+ +E++  H
Sbjct  206  YQPAPAMKTYGAGHYATETVVSIFKLTREQLTTLKAKSKE----DGNTVTYSSYEMLAGH  261

Query  291  IWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQ  112
            +WRCAC ARS    Q T L  + D R R++PPLP  YFGN +       V+G++ S+P+ 
Sbjct  262  VWRCACLARSLPEDQDTKLYIATDGRARLQPPLPQGYFGNVIFTATPLAVAGDLESKPVW  321

Query  111  DVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
              ASKI DA+  + +EY+  A+D+   + D+
Sbjct  322  YAASKIHDALARMDNEYLRSALDYLELQPDL  352



>ref|XP_010101376.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB88323.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=446

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/281 (36%), Positives = 154/281 (55%), Gaps = 22/281 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+D+ L D GDF+P PE + L+P+VDYSG  I   P+ V Q+T F+ GG+SLG  
Sbjct  96   LFVEAETDSALDDFGDFAPSPEFHGLIPAVDYSGG-ISSYPVLVLQVTHFKYGGVSLGVG  154

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            ++H VADG    H ++ W+++A G  L+  PF DR  L          +  PR  FDH  
Sbjct  155  LNHNVADGFAALHLVNTWSDMARGLGLTIPPFIDRTLL--------CARDPPRPTFDHIE  206

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAA-----NNGRSYNAKPR--GY  319
               PP +  +++  S   +       +++K Q+  LKA +     N+G +  +       
Sbjct  207  YKPPPSM--KTTSTSAPQQSIAAGIFKMTKEQLQVLKAKSKEYLINDGDTSTSSTATINL  264

Query  318  TRFEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVS  139
            T FE++  HIWRC CKAR+    Q T +  + D R R++PPLP  YFGN V        +
Sbjct  265  TSFEILAGHIWRCVCKARALADDQETRVYIATDGRSRLQPPLPPGYFGNVVFTAAPLATA  324

Query  138  GEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  16
            G+I S+P +  AS+I DA+  + + Y+  A+D+   + D++
Sbjct  325  GDIQSKPTRYAASRIHDALARMDNNYLRSALDYLELQPDLM  365



>ref|XP_009615699.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
tomentosiformis]
 sp|Q8GSM7.1|HST_TOBAC RecName: Full=Shikimate O-hydroxycinnamoyltransferase; AltName: 
Full=Hydroxycinnamoyl transferase; AltName: Full=Hydroxycinnamoyl-Coenzyme 
A shikimate/quinate hydroxycinnamoyltransferase 
[Nicotiana tabacum]
 emb|CAD47830.1| hydroxycinnamoyl transferase [Nicotiana tabacum]
Length=435

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/272 (38%), Positives = 153/272 (56%), Gaps = 13/272 (5%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD V+ D GDF+P  EL  L+P+VDYS   IQ   L V Q+T F+CGG+SLG  
Sbjct  92   LFVEAESDGVVDDFGDFAPTLELRQLIPAVDYSQG-IQSYALLVLQITHFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG    HF++ W+++A G  L+  PF DR  LLR       PQ     V    P
Sbjct  151  MQHHAADGASGLHFINTWSDMARGLDLTIPPFIDRT-LLRA---RDPPQPQFPHVEYQPP  206

Query  465  PL--IVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEVITA  295
            P   +  +++  SE + ET VS  +L++ QI+ LKA +  +G + N     Y+ +E++  
Sbjct  207  PTLKVTPENTPISEAVPETSVSIFKLTRDQINTLKAKSKEDGNTVN-----YSSYEMLAG  261

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            H+WR  C AR     Q T L  + D R R+ P LP  YFGN +       V+G+I S+P+
Sbjct  262  HVWRSTCMARGLAHDQETKLYIATDGRSRLRPSLPPGYFGNVIFTTTPIAVAGDIQSKPI  321

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
               ASK+ DA+  + ++Y+  A+D+   + D+
Sbjct  322  WYAASKLHDALARMDNDYLRSALDYLELQPDL  353



>ref|XP_008441993.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cucumis 
melo]
Length=457

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/296 (36%), Positives = 163/296 (55%), Gaps = 33/296 (11%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            V +EA     L D  DF+P   +  L P VDY+  P++D+P+F+ Q+T+F CGG+ +G  
Sbjct  91   VFIEASYGGTLDDYSDFTPSDVVRKLTPEVDYNS-PMEDVPMFLVQVTRFNCGGLVIGLN  149

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSA---PFHDRRRLLRGVGESSSPQGGPRRVFD  475
            +SH + DG     F++ WA++A G+  + +   P HDR  L     ++  P   PR  F 
Sbjct  150  VSHTLVDGVSAIMFINSWASIARGEKTAESILQPSHDRNVL-----QAQKPFCTPR--FY  202

Query  474  HSP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYN----------  337
            H      P ++G S  E E+MKETK + L+L++ Q+  L+  AN+    N          
Sbjct  203  HCEYDVLPFLIGCSDSEEEKMKETKSTLLKLTREQVEKLRTRANSSNPTNRNIDKVVDVV  262

Query  336  ----AKPRGYTRFEVITAHIWRCACKARS---HKPQQPTTLCFSVDIRRRMEPPLPDSYF  178
                 +PR Y+R+E IT HIW CA KAR+    K +Q T +   V++R+R+  P+P ++ 
Sbjct  263  NEELLQPRPYSRYESITGHIWVCASKARNINDDKSKQSTLVQIVVNVRQRLRKPIPKNFC  322

Query  177  GN-AVINVVIFGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  13
            GN A+I++      GE+ S+PL   A +IR+A   +T EYV  AIDF   + D I+
Sbjct  323  GNAALISITPQCKFGELKSQPLSYAAKRIREASWKMTDEYVTSAIDFLATQEDTIR  378



>ref|XP_004500005.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cicer 
arietinum]
Length=465

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/278 (39%), Positives = 160/278 (58%), Gaps = 22/278 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGG---ISL  655
            +L+EAE+   + D GDFS    +  L+P +D++  PI++IPLFV QLT+F+      +++
Sbjct  91   ILLEAETTQTIHDFGDFSSFDSIKELIPKIDFN-QPIEEIPLFVVQLTRFQNKDENFVAI  149

Query  654  GFAISHVVADGHGLCHFLSEWANLASGKPLSS--APFHDRRRLLRGVGESSSPQGGPRRV  481
            G A SH ++DG G  +F++ WA +A G+ L +   PF DR  L      S +P    +  
Sbjct  150  GIAYSHSLSDGLGCWNFINSWAKIARGETLEANELPFLDRTIL----KFSHTPL---KPC  202

Query  480  FDHSP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANN-----GRSYNAKP  328
            F+H      P I+G+S D  ER K+T+V  L+L++ ++  LK  AN      G    +K 
Sbjct  203  FEHRELKPLPFILGRSDDNIERKKKTRVELLKLTRDEVEKLKKKANECEISKGSISISKS  262

Query  327  RGYTRFEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIF  148
            R Y+RFE I+AHIWR A KAR     Q + + F+V IR R+ P LP +Y+GNA+I     
Sbjct  263  RPYSRFEAISAHIWRSASKARELNANQLSVVRFNVQIRNRIVPNLPKNYYGNALIQTEAR  322

Query  147  GVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYR  34
            G  GEI S+PL   A KIR+  + + +EY+   ID  R
Sbjct  323  GYIGEITSKPLSYAAKKIREGNELIKNEYIRSQIDVIR  360



>ref|XP_004293648.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/267 (36%), Positives = 151/267 (57%), Gaps = 11/267 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNH-LVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGF  649
            + V A+S + + DLGDF+P PE    L+P+VDYSG  I   PL + Q+T F+CG ++LG 
Sbjct  100  LFVVADSSSCIDDLGDFAPTPEFGRGLLPTVDYSGG-ISSYPLLLVQITYFKCGAVALGV  158

Query  648  AISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS  469
             + H +ADG    HF++ W+++A G  ++  P  DR  LLR   +       PR + DH+
Sbjct  159  RLDHHLADGLSALHFINTWSDIARGADIAIPPTIDRT-LLRAREQ-------PRTLLDHN  210

Query  468  PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
              ++    +D      ET VS  + ++ Q++ LKA +   +  + + + YT FEV   H+
Sbjct  211  HHIVYQPPNDHGTTGAETVVSVFKFTREQLNILKAMSTMTKEEDNEMK-YTTFEVFAGHV  269

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCACKAR     Q T   F+V+ R R++PPLP  YFGN +       V+G++IS+PL  
Sbjct  270  WRCACKARELANDQETNFYFAVNGRTRLQPPLPPGYFGNVIFRAAATAVAGDLISKPLSY  329

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNE  28
             A  I +A+  +  +Y+  A+D+   E
Sbjct  330  AACCIHNAVVRMDDDYLRSALDYLELE  356



>gb|ABR17170.1| unknown [Picea sitchensis]
Length=433

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/269 (37%), Positives = 149/269 (55%), Gaps = 9/269 (3%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +LVEA +D+V+ D GDF+P  EL  L+P V+YS D I    L V Q+T F+CGG+SLG  
Sbjct  92   LLVEATTDSVIDDFGDFAPTMELKQLIPKVNYSED-ISSYALLVLQVTFFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H VADG+   HF++ W+++A G  ++  PF DR  LLR     + P    + +    P
Sbjct  151  MQHHVADGYAGLHFINTWSDVARGLDIALPPFIDRT-LLRA---RNPPTPKFQHIEYQQP  206

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P +   S   +    +  V+  +L+K Q+  LK  A      N     Y+ +E+++ HIW
Sbjct  207  PPLKDTSGIMNGEKNDFSVAIFKLTKEQLDILKGKARE----NGNKVSYSSYEMLSGHIW  262

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            RCACKAR+    Q T L  + D R R+ P LP  YFGN +       V+G+I+S+P    
Sbjct  263  RCACKARNLTEDQGTKLYIATDGRSRLRPSLPPGYFGNVIFTTTPMAVAGDIVSKPTYYA  322

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            AS I +A+  +  EY+  A+D+   + D+
Sbjct  323  ASVIHEALGRMDDEYLRSALDYLELQPDL  351



>gb|AEK80405.1| HQT [Lonicera japonica]
Length=439

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 99/273 (36%), Positives = 148/273 (54%), Gaps = 20/273 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD  + D GDF+P  E+  L P+VDYSGD I   PL + Q+T F+CGG+SLG  
Sbjct  101  LFVEAESDCCVDDFGDFTPSTEMRRLTPTVDYSGD-ISSYPLIILQVTYFKCGGVSLGVG  159

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H ++DG    HF++ W+++A G  ++  PF DR  LLR       P+  P   FDH  
Sbjct  160  VHHTLSDGVSSLHFINTWSDMARGLSIAIPPFIDRT-LLR-------PRTPPTPTFDHVE  211

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
               PP ++ +        K    + L+LS  Q+  LKA A N        + ++ +E++ 
Sbjct  212  YHPPPSMITKPLSGP---KGVSTAILKLSLDQLTTLKAKAKN----EGNGKDHSTYEILA  264

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
            AH+WRCACKAR     Q + L  + D R R+ PPLP  Y GN V        SG++ + P
Sbjct  265  AHLWRCACKARDLSANQTSKLYIATDGRSRLCPPLPPGYLGNVVFTATPMADSGDLQAEP  324

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            +   A +I +++  + +EY+  A+DF     D+
Sbjct  325  VTSTAKRIHNSLTRMDNEYLRSALDFLETTPDL  357



>emb|CDG56249.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase 2 
[Glechoma hederacea]
Length=430

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/269 (37%), Positives = 149/269 (55%), Gaps = 15/269 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD  + D GDF+P  EL  L+P+VDYS   I    L V Q+TKF+CGG+SLG  
Sbjct  95   LFVEAESDGSVDDYGDFAPNLELRRLIPAVDYS-QGISTYALLVLQVTKFKCGGVSLGVG  153

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H VADG    HF++ W+++A G  ++  PF DR  LL        PQ   + +     
Sbjct  154  MQHHVADGFSGLHFINTWSDMARGLDITLPPFIDRTLLL----ARDPPQPQFKHIEYQPA  209

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P +      ++    ET VS  +L++ Q+  LKA +      +     Y+ +E++  H+W
Sbjct  210  PAM------KTYDATETVVSIFKLTREQLTTLKAKSKE----DGNTVTYSSYEMLAGHVW  259

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            RCAC ARS    Q T L  + D R R++PPLP  YFGN +       V+G++ S+P+   
Sbjct  260  RCACLARSLPEDQDTKLYIATDGRARLQPPLPQGYFGNVIFTTTPQAVAGDLDSKPVWYA  319

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            ASKI DA+  + +EY+  A+D+   + D+
Sbjct  320  ASKIHDALAQMDNEYLRSALDYLELQPDL  348



>gb|ABO77955.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 101/270 (37%), Positives = 152/270 (56%), Gaps = 10/270 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD V+ D GDF+P  E   L+P+VDYS   I    L V Q+T F+CGG+SLG  
Sbjct  92   LFVEAESDGVVDDFGDFAPTLEHRRLIPAVDYS-QGISSYALLVLQVTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG    HF++ W+++A G  ++  PF DR  LLR       PQ   + +    P
Sbjct  151  MQHHAADGFSGLHFINSWSDMARGLDVTLPPFIDRT-LLRA---RDPPQPQFQHIEYQPP  206

Query  465  P-LIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            P L V   + +S+ + ET VS  +L++ QI ALKA +      +     Y+ +E++  H+
Sbjct  207  PALKVSPQTAKSDSVPETAVSIFKLTREQISALKAKSKE----DGNTISYSSYEMLAGHV  262

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCACKAR  +  Q T L  + D R R+ P LP  YFGN +       ++G++  +P+  
Sbjct  263  WRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWY  322

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             ASKI DA+  + ++Y+  A+D+   + D+
Sbjct  323  AASKIHDALARMDNDYLRSALDYLELQPDL  352



>gb|AHA44839.1| hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltransferase [Larix 
kaempferi]
Length=433

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/269 (37%), Positives = 148/269 (55%), Gaps = 9/269 (3%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +LVEA +D+V+ D GDF+P  EL  L+P V+YS D I    L V Q+T F+CGG+SLG  
Sbjct  92   LLVEAITDSVIDDFGDFAPTMELKQLIPKVNYSED-ISSYALLVLQVTFFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H VADG+   HF++ W+++A G  ++  PF DR  LLR     + P      V    P
Sbjct  151  MQHHVADGYAGLHFINTWSDVARGLDITLPPFIDRT-LLRA---RNPPIPKFHHVEYQQP  206

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P +   S   +    +  V+  RL+K Q+  LK  A      N     Y+ +E+++ HIW
Sbjct  207  PPLKDTSGIMNGEKNDFSVAIFRLTKEQLDILKGKARE----NGNKVSYSSYEMLSGHIW  262

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            RCACKAR+ +  Q T L  + D R R+ P LP  YFGN +       V+G+I+S+P    
Sbjct  263  RCACKARNLREDQETKLYIATDGRSRLRPSLPPGYFGNVIFTTTPMAVAGDIVSKPTYYA  322

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            AS I D +  +  +Y+  A+D+   + D+
Sbjct  323  ASVIHDTLGRMDDDYLRSALDYLELQPDL  351



>gb|ACF17657.1| putative hydroxycinnamoyl transferase [Capsicum annuum]
Length=435

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 102/272 (38%), Positives = 153/272 (56%), Gaps = 13/272 (5%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD V+ D GDF+P  EL  L+P+VDYS   I+   L V Q+T F+CGG+SLG  
Sbjct  92   LFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQG-IESYALLVLQITHFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG    HF++ W+++A G  L+  PF DR  LLR       PQ     +    P
Sbjct  151  MQHHAADGASGLHFINTWSDMARGLDLTIPPFIDRT-LLRA---RDPPQPKFPHIEYQPP  206

Query  465  PL--IVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEVITA  295
            P   +  +++  SE + ET VS  +L++ QI+ALKA +  +G + N     Y+ +E++  
Sbjct  207  PTLKVTAENAPNSEPVPETSVSIFKLTRDQINALKAKSKEDGNTVN-----YSSYEMLAG  261

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            H+WR  C AR     Q T L  + D R R+ P LP  YFGN +       V+G++ S+P+
Sbjct  262  HVWRSTCMARGLAQDQETKLYIATDGRARLRPSLPSGYFGNVIFTATPVAVAGDLQSKPI  321

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
               ASKI D +  + ++Y+  A+D+   + D+
Sbjct  322  WYAASKIHDQLAIMDNDYLRSALDYLELQPDL  353



>gb|KHN29832.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=448

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 113/273 (41%), Positives = 152/273 (56%), Gaps = 17/273 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCG-GISLGF  649
            VL+EAES   L D GDF     +  LVP+VDY+  PI+++P  + Q+T F  G   ++G 
Sbjct  91   VLLEAESTKTLDDYGDFLR-ESIKDLVPTVDYTS-PIEELPSLLVQVTTFHGGKSFAIGV  148

Query  648  AISHVVADGHGLCHFLSEWANLASGKPLS--SAPFHDRRRLLRGVGESSSPQGGPRRVFD  475
            A+ H++ DG G   F++ WA LA G  L     PF DR  L     +   P   PR  FD
Sbjct  149  ALCHILCDGVGAIQFINSWAKLARGDTLEPHEMPFLDRTVL-----KFPHPLSPPR--FD  201

Query  474  HSP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFE  307
            H      PLI+G+S +  E+ K+   + L+L+  Q+  LK  AN+  S     R Y+RFE
Sbjct  202  HLEFKPLPLILGRSDNTVEKNKKVDATLLKLTPEQVGKLKKKANDD-STKEGSRPYSRFE  260

Query  306  VITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEII  127
             I AHIWRCA KAR     QPT + F+ DIR R+ PPLP +YFGNA+         G++I
Sbjct  261  AIAAHIWRCASKARELDKNQPTLVRFNADIRNRLIPPLPKNYFGNALSLTTASCHVGDVI  320

Query  126  SRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  28
            S  L   A KIR+AI+ VT EY+   ID  R +
Sbjct  321  SNSLSYAAQKIREAIEVVTYEYIWSQIDVIRGQ  353



>ref|XP_003551937.2| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=464

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 113/273 (41%), Positives = 152/273 (56%), Gaps = 17/273 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCG-GISLGF  649
            VL+EAES   L D GDF     +  LVP+VDY+  PI+++P  + Q+T F  G   ++G 
Sbjct  107  VLLEAESTKTLDDYGDFLR-ESIKDLVPTVDYTS-PIEELPSLLVQVTTFHGGKSFAIGV  164

Query  648  AISHVVADGHGLCHFLSEWANLASGKPLS--SAPFHDRRRLLRGVGESSSPQGGPRRVFD  475
            A+ H++ DG G   F++ WA LA G  L     PF DR  L     +   P   PR  FD
Sbjct  165  ALCHILCDGVGAIQFINSWAKLARGDTLEPHEMPFLDRTVL-----KFPHPLSPPR--FD  217

Query  474  HSP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFE  307
            H      PLI+G+S +  E+ K+   + L+L+  Q+  LK  AN+  S     R Y+RFE
Sbjct  218  HLEFKPLPLILGRSDNTVEKNKKVDATLLKLTPEQVGKLKKKANDD-STKEGSRPYSRFE  276

Query  306  VITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEII  127
             I AHIWRCA KAR     QPT + F+ DIR R+ PPLP +YFGNA+         G++I
Sbjct  277  AIAAHIWRCASKARKLDKNQPTLVRFNADIRNRLIPPLPKNYFGNALSLTTASCHVGDVI  336

Query  126  SRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  28
            S  L   A KIR+AI+ VT EY+   ID  R +
Sbjct  337  SNSLSYAAQKIREAIEVVTYEYIWSQIDVIRGQ  369



>ref|XP_003530223.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Glycine max]
 ref|XP_006583084.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X4 [Glycine max]
Length=438

 Score =   181 bits (460),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 101/278 (36%), Positives = 154/278 (55%), Gaps = 22/278 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEA++ AV+ D GDF+P  EL  L+P+VDYS   I+  PL V Q+T F+CGG+SLG  
Sbjct  92   LFVEADTGAVIDDFGDFAPTLELRQLIPAVDYSQG-IETYPLLVLQVTHFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  +S  PF DR  +LR        +  PR VFDH  
Sbjct  151  MQHHVADGASGLHFINTWSDVARGLDVSIPPFIDRT-ILRA-------RDPPRPVFDHIE  202

Query  471  --SPPLIVGQS-----SDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTR  313
               PP +  Q      SD         VS  RL++ Q++ LKA +      +     Y+ 
Sbjct  203  YKPPPAMKTQQPTKPGSDSDNAAAAAAVSIFRLTREQLNTLKAKSKE----DGNTISYSS  258

Query  312  FEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGE  133
            +E++  H+WR  CKAR+    Q T L  + D R R++PP P  YFGN +       V+G+
Sbjct  259  YEMLAGHVWRSVCKARALPDDQETKLYIATDGRSRLQPPPPPGYFGNVIFTTTPIAVAGD  318

Query  132  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            ++S+P    AS+I +A+  + ++Y+  A+D+   + D+
Sbjct  319  LMSKPTWYAASRIHNALLRMDNDYLRSALDYLELQPDL  356



>ref|XP_003543709.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Glycine max]
Length=439

 Score =   181 bits (460),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/282 (37%), Positives = 155/282 (55%), Gaps = 30/282 (11%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ A + D GDFSP  EL  L+PSVDYS   I   PL V Q+T F+CGG+SLG  
Sbjct  92   LFVEAETTAAIEDFGDFSPTLELRQLIPSVDYSAG-IHSYPLLVLQVTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  +S  PF DR  LLR        +  P  VFDH  
Sbjct  151  MQHHVADGASGLHFINAWSDVARGLDISLPPFIDRT-LLRA-------RDPPLPVFDHIE  202

Query  471  -SPPLIVGQSSDESERMKETK----------VSTLRLSKPQIHALKAAANNGRSYNAKPR  325
              PP     ++ ++  ++ +K          VST +L++ Q+  LK  +      +    
Sbjct  203  YKPP----PATKKTTPLQPSKPLGSDSTAVAVSTFKLTRDQLSTLKGKSRE----DGNTI  254

Query  324  GYTRFEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFG  145
             Y+ +E++  H+WR  CKAR+    Q T L  + D R R++PPLP  YFGN +       
Sbjct  255  SYSSYEMLAGHVWRSVCKARALPDDQETKLYIATDGRARLQPPLPHGYFGNVIFTTTRIA  314

Query  144  VSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            V+G+++S+P    AS+I DA+  + +EY+  A+D+   + D+
Sbjct  315  VAGDLMSKPTWYAASRIHDALIRMDNEYLRSALDYLELQPDL  356



>gb|KHN31873.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=439

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 103/282 (37%), Positives = 155/282 (55%), Gaps = 30/282 (11%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ A + D GDFSP  EL  L+PSVDYS   I   PL V Q+T F+CGG+SLG  
Sbjct  92   LFVEAETTAAIEDFGDFSPTLELRQLIPSVDYSAG-IHSYPLLVLQVTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  +S  PF DR  LLR        +  P  VFDH  
Sbjct  151  MQHHVADGASGLHFINAWSDVARGLDISLPPFIDRT-LLRA-------RDPPLPVFDHIE  202

Query  471  -SPPLIVGQSSDESERMKETK----------VSTLRLSKPQIHALKAAANNGRSYNAKPR  325
              PP     ++ ++  ++ +K          VST +L++ Q+  LK  +      +    
Sbjct  203  YKPP----PATKKTTPLQPSKPLGSDSTAVAVSTFKLTRDQLSTLKGKSRE----DGNTI  254

Query  324  GYTRFEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFG  145
             Y+ +E++  H+WR  CKAR+    Q T L  + D R R++PPLP  YFGN +       
Sbjct  255  SYSSYEMLAGHVWRSVCKARALPDDQETKLYIATDGRARLQPPLPHGYFGNVIFTTTPIA  314

Query  144  VSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            V+G+++S+P    AS+I DA+  + +EY+  A+D+   + D+
Sbjct  315  VAGDLMSKPTWYAASRIHDALIRMDNEYLRSALDYLELQPDL  356



>gb|AFZ78609.1| hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyl transferase 
[Populus tomentosa]
Length=431

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/273 (37%), Positives = 151/273 (55%), Gaps = 19/273 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ +V+ D  DF+P  EL  L+P+VDYSG  I   PL V Q+T F+CGG+SLG  
Sbjct  92   LFVEAETTSVIDDFADFAPTLELKQLIPTVDYSGG-ISTYPLLVLQVTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H  ADG    HF++ W+++A G  L+  PF DR  LLR        +  P+ VF H  
Sbjct  151  MQHHAADGFSGLHFVNTWSDMARGLDLTIPPFIDRT-LLRA-------RDPPQPVFHHVE  202

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
               PP +  ++  E+ + + T VS  +LS+ Q+  LKA A      +     Y+ +E++ 
Sbjct  203  YQPPPSM--KTVLETSKPESTAVSIFKLSRDQLSTLKAKAKE----DGNNISYSSYEMLA  256

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
            AH+WR  CKAR     Q T L  + D R R+ P LP  YFGN +       V+GE+ S+P
Sbjct  257  AHVWRSTCKARELPDDQETKLYIATDGRSRLRPQLPPGYFGNVIFTATPIAVAGEMQSKP  316

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
                A KI DA+  + ++Y+  A+D+   + D+
Sbjct  317  TWYAAGKIHDALVRMDNDYLKSALDYLELQPDL  349



>ref|XP_006471643.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Citrus 
sinensis]
Length=449

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/270 (37%), Positives = 148/270 (55%), Gaps = 8/270 (3%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+  VL DLGDF    EL  LVPSV+Y+ D I   PL + Q+T F+CGG+ L  A
Sbjct  95   LFVEAETSYVLDDLGDFESSFELQKLVPSVEYTKD-ISSYPLLITQVTHFKCGGVCLTVA  153

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H +AD   + +F++ W  +  G P+S+ PF DR  L  G+G  +SP+      +D  P
Sbjct  154  MHHTLADATSMIYFINAWDEVTRGVPISNPPFIDRTLL--GIGLPTSPKFH-HIEYDPPP  210

Query  465  PLIV-GQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
             + V  Q+ +     K    + L +S  QI+ LKA +      +  P  +TRFE++ AH 
Sbjct  211  SMNVPTQNIELQANPKSISSAILNISVDQINTLKAKSKQD---HGTPIEFTRFEILAAHT  267

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRC CKAR     Q + L   ++ R R++P LP  YFGN        G+SG+IIS PL  
Sbjct  268  WRCLCKARRLSTDQVSKLYIPINGRSRLDPRLPSGYFGNVTFTGTTIGLSGDIISEPLSS  327

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             A +IR+A   +  EY+  A+ +   + D+
Sbjct  328  TAERIREATMRMDDEYLKSALAYLSQQPDL  357



>gb|ACI16630.1| shikimate O-hydroxycinnamoyltransferase [Trifolium pratense]
Length=434

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/273 (37%), Positives = 149/273 (55%), Gaps = 17/273 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEA++ AV+ D GDF+P  EL  L+P+VDYS   I+  PL V Q+T F+CGG+SLG  
Sbjct  93   LFVEADTGAVIDDFGDFAPTLELRQLIPAVDYSRG-IESYPLLVLQVTYFKCGGVSLGVG  151

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  +S  PF DR  LLR        +  PR VFDH  
Sbjct  152  MQHHVADGASGLHFINTWSDVARGLDVSIPPFIDRT-LLRA-------RDPPRPVFDHIE  203

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
               PP +               VS  +L++ Q+  LKA +            Y+ +E++ 
Sbjct  204  YKPPPSMKTTQQSTKPGSDGAAVSIFKLTREQLSTLKAKSKEA----GNTIHYSSYEMLA  259

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             H+WR  CKARS    Q T L  + D R R++PP P  YFGN +       ++G+++S+P
Sbjct  260  GHVWRSVCKARSLPDDQETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDLMSKP  319

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
                AS+I +A+  + +EY+  A+DF   + D+
Sbjct  320  TWYAASRIHNALSRMDNEYLRSALDFLELQPDL  352



>ref|XP_006583083.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X3 [Glycine max]
Length=462

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/278 (36%), Positives = 154/278 (55%), Gaps = 22/278 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEA++ AV+ D GDF+P  EL  L+P+VDYS   I+  PL V Q+T F+CGG+SLG  
Sbjct  116  LFVEADTGAVIDDFGDFAPTLELRQLIPAVDYSQG-IETYPLLVLQVTHFKCGGVSLGVG  174

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  +S  PF DR  +LR        +  PR VFDH  
Sbjct  175  MQHHVADGASGLHFINTWSDVARGLDVSIPPFIDRT-ILRA-------RDPPRPVFDHIE  226

Query  471  --SPPLIVGQS-----SDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTR  313
               PP +  Q      SD         VS  RL++ Q++ LKA +      +     Y+ 
Sbjct  227  YKPPPAMKTQQPTKPGSDSDNAAAAAAVSIFRLTREQLNTLKAKSKE----DGNTISYSS  282

Query  312  FEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGE  133
            +E++  H+WR  CKAR+    Q T L  + D R R++PP P  YFGN +       V+G+
Sbjct  283  YEMLAGHVWRSVCKARALPDDQETKLYIATDGRSRLQPPPPPGYFGNVIFTTTPIAVAGD  342

Query  132  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            ++S+P    AS+I +A+  + ++Y+  A+D+   + D+
Sbjct  343  LMSKPTWYAASRIHNALLRMDNDYLRSALDYLELQPDL  380



>ref|XP_006493385.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Citrus 
sinensis]
Length=430

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/271 (38%), Positives = 153/271 (56%), Gaps = 16/271 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +LVEAE+ +++ D GDF+P  EL  L+P++DYSG  I   PL V Q+T F+CGG+SLG  
Sbjct  92   LLVEAETTSLIDDFGDFAPTLELKQLIPTIDYSGG-ISTYPLLVLQITHFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H VADG    HF++ W++ A G  L+  PF DR  LLR    S  P   P+  F+H  
Sbjct  151  MQHHVADGFSGLHFVNTWSDFARGLDLTIPPFIDRT-LLR----SRDP---PQPAFEHIE  202

Query  465  PLIVGQSSDESERMKETK-VSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEVITAH  292
                       +   ET  VS  +L++ Q++ LKA A  +G + N     Y+ +E++  H
Sbjct  203  YQPPPPLKHPLKSSSETTAVSIFKLTRDQLNILKAKAKEDGNTIN-----YSSYEMLAGH  257

Query  291  IWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQ  112
            +WR AC AR     Q T L  + D R R+ PPLP  YFGN +       V+G++ S+P+ 
Sbjct  258  VWRSACIARGLTADQETKLYIATDGRARLRPPLPPGYFGNVIFTATPMAVTGDLQSKPIW  317

Query  111  DVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
              AS+I DA+  + ++Y+  A+D+   + D+
Sbjct  318  YAASRIHDALVRMDNDYLRSALDYLELQPDL  348



>dbj|BAA87043.1| N-hydroxycinnamoyl/benzoyltransferase [Ipomoea batatas]
 dbj|BAJ14795.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Ipomoea 
batatas]
Length=431

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/275 (38%), Positives = 150/275 (55%), Gaps = 24/275 (9%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESDA + D GDF+P  EL   +P+VD SGD I   PL + Q+T+F+CGG+ LG  
Sbjct  97   LFVEAESDACVDDFGDFTPSLELRKFIPTVDTSGD-ISSFPLIIFQVTRFKCGGVCLGTG  155

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS-  469
            + H ++DG    HF++ W+++A G  ++  PF DR  LLR        +  P   F+HS 
Sbjct  156  VFHTLSDGVSSLHFINTWSDMARGLSVAIPPFIDRT-LLRA-------RDPPTPAFEHSE  207

Query  468  ---PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
               PP +  +S  ES+R      + L+++  Q+  LK          +K  G T +E++ 
Sbjct  208  YDQPPKL--KSVPESKRGSSASTTMLKITPEQLALLKT--------KSKHEGST-YEILA  256

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
            AHIWRCACKAR     Q T L  + D R R+ PPLP  Y GN V        SGE+ S P
Sbjct  257  AHIWRCACKARGLTDDQATKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESGELQSEP  316

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  13
            L + A +I  A+  +  EY+  A+DF   + D+ K
Sbjct  317  LTNSAKRIHSALSRMDDEYLRSALDFLECQPDLSK  351



>ref|XP_006368492.1| transferase family protein [Populus trichocarpa]
 gb|ACC63883.1| quinate O-hydroxycinnamoyltransferase/shikimate O-hydroxycinnamoyltransferase 
[Populus trichocarpa]
 gb|ERP65061.1| transferase family protein [Populus trichocarpa]
Length=431

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/273 (37%), Positives = 151/273 (55%), Gaps = 19/273 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ +V+ D  DF+P  EL  L+P+VDYSG  I   PL V Q+T F+CGG+SLG  
Sbjct  92   LFVEAETTSVIDDFADFAPTLELKQLIPTVDYSGG-ISTYPLLVLQVTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H  ADG    HF++ W+++A G  L+  PF DR  LLR        +  P+ VF H  
Sbjct  151  MQHHAADGFSGLHFVNTWSDMARGLDLTIPPFIDRT-LLRA-------RDPPQPVFHHVE  202

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
               PP +  ++  E+ + + T VS  +LS+ Q+  LKA A      +     Y+ +E++ 
Sbjct  203  YQPPPSM--KTVLETSKPESTAVSIFKLSRDQLSTLKAKAKE----DGNNISYSSYEMLA  256

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
            AH+WR  CKAR     Q T L  + D R R +P LP  YFGN +       V+GE+ S+P
Sbjct  257  AHVWRSTCKARELPDDQETKLYIATDGRSRWQPQLPPGYFGNVIFTATPIAVAGEMQSKP  316

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
                A KI DA+  + ++Y+  A+D+   + D+
Sbjct  317  TWYAAGKIHDALVRMDNDYLKSALDYLELQPDL  349



>ref|XP_006583082.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Glycine max]
Length=465

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/278 (36%), Positives = 154/278 (55%), Gaps = 22/278 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEA++ AV+ D GDF+P  EL  L+P+VDYS   I+  PL V Q+T F+CGG+SLG  
Sbjct  119  LFVEADTGAVIDDFGDFAPTLELRQLIPAVDYSQG-IETYPLLVLQVTHFKCGGVSLGVG  177

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  +S  PF DR  +LR        +  PR VFDH  
Sbjct  178  MQHHVADGASGLHFINTWSDVARGLDVSIPPFIDRT-ILRA-------RDPPRPVFDHIE  229

Query  471  --SPPLIVGQS-----SDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTR  313
               PP +  Q      SD         VS  RL++ Q++ LKA +      +     Y+ 
Sbjct  230  YKPPPAMKTQQPTKPGSDSDNAAAAAAVSIFRLTREQLNTLKAKSKE----DGNTISYSS  285

Query  312  FEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGE  133
            +E++  H+WR  CKAR+    Q T L  + D R R++PP P  YFGN +       V+G+
Sbjct  286  YEMLAGHVWRSVCKARALPDDQETKLYIATDGRSRLQPPPPPGYFGNVIFTTTPIAVAGD  345

Query  132  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            ++S+P    AS+I +A+  + ++Y+  A+D+   + D+
Sbjct  346  LMSKPTWYAASRIHNALLRMDNDYLRSALDYLELQPDL  383



>pdb|4G22|A Chain A, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 1)
 pdb|4G22|B Chain B, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 1)
Length=439

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/270 (37%), Positives = 151/270 (56%), Gaps = 10/270 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD V+ D GDF+P  EL  L+P+VDYS   I    L V Q+T F+ GG+SLG  
Sbjct  97   LFVEAESDGVVDDFGDFAPTLELRRLIPAVDYS-QGISSYALLVLQVTYFKXGGVSLGVG  155

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG    HF++ W+++A G  ++  PF DR  LLR       PQ   + +    P
Sbjct  156  MRHHAADGFSGLHFINSWSDMARGLDVTLPPFIDRT-LLRA---RDPPQPQFQHIEYQPP  211

Query  465  P-LIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            P L V   +  S+ + ET VS  +L++ QI ALKA +      +     Y+ +E++  H+
Sbjct  212  PALAVSPQTAASDSVPETAVSIFKLTREQISALKAKSKE----DGNTISYSSYEMLAGHV  267

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCACKAR  +  Q T L  + D R R+ P LP  YFGN +       ++G++  +P+  
Sbjct  268  WRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWY  327

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             ASKI DA+  + ++Y+  A+D+   + D+
Sbjct  328  AASKIHDALARMDNDYLRSALDYLELQPDL  357



>gb|ACZ52698.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Lonicera 
japonica]
Length=439

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/273 (36%), Positives = 147/273 (54%), Gaps = 20/273 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD  + D GDF+P  E+  L P+VDYSG  I   PL + Q+T F+CGG+SLG  
Sbjct  101  LFVEAESDCCVDDFGDFTPSSEMRRLTPTVDYSG-AISSYPLIILQVTYFKCGGVSLGVG  159

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H ++DG    HF++ W+++A G  ++  PF DR  LLR       P+  P   FDH  
Sbjct  160  VHHTLSDGVSSLHFINTWSDMARGLSIAIPPFIDRT-LLR-------PRIPPTPTFDHVE  211

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
               PP ++ +        K    + L+LS  Q+  LKA A N        + ++ +E++ 
Sbjct  212  YHPPPSMITKPLSGP---KGVSTAILKLSLDQLTTLKAKAKN----EGNGKDHSTYEILA  264

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
            AH+WRCACKAR   P Q + L  + D R R+ PPLP  Y GN V        SG++   P
Sbjct  265  AHLWRCACKARDLSPNQTSKLYIATDGRSRLCPPLPPGYLGNVVFTATPMAESGDLQVEP  324

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            +   A +I +++  + +EY+  A+DF     D+
Sbjct  325  VTSTAKRIHNSLTRMDNEYLRSALDFLETTPDL  357



>ref|XP_007216677.1| hypothetical protein PRUPE_ppa1027182mg [Prunus persica]
 gb|EMJ17876.1| hypothetical protein PRUPE_ppa1027182mg [Prunus persica]
Length=442

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 108/278 (39%), Positives = 156/278 (56%), Gaps = 27/278 (10%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + V AE+D+VL + GDF+P  E   LVP+VDYS   I   PL V Q+T F+CGG+SLG  
Sbjct  103  LFVVAETDSVLDEFGDFAPTLEFRKLVPAVDYSAG-ISSYPLLVVQVTYFKCGGLSLGVG  161

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  L+  PF DR  LLR        +  P+  FDH  
Sbjct  162  LEHRVADGFSGLHFVNTWSDIARGLDLTIPPFIDRT-LLRA-------RDPPQPAFDHIE  213

Query  471  ---SPPLIVGQSS--DESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRF  310
                PP+  G  +  DES       VS  RL++ Q++ LKA +  +G + N     YT +
Sbjct  214  YQPDPPIKTGTKAVGDES-----ATVSIFRLTREQLNILKAKSKEDGNTIN-----YTTY  263

Query  309  EVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEI  130
            E++  HIWRCA  AR     Q T L  +VD R R++PPLP  +FGN V +      +G+I
Sbjct  264  EMLAGHIWRCASVARELPDDQETKLHIAVDGRSRLQPPLPPGFFGNVVFSGAPIAAAGDI  323

Query  129  ISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  16
             S+P    AS+I DA+  + + Y+  A+D+   + D++
Sbjct  324  KSKPTWYAASRIHDAVVRMDNNYLRSALDYLELQPDLL  361



>emb|CDG56253.1| hydroxycinnamoyltransferase 2 [Glechoma hederacea]
Length=431

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/278 (36%), Positives = 148/278 (53%), Gaps = 18/278 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE D  LADL DFSP P ++ L   VDYS   I   PL + QLT+F+CGG+SLG  
Sbjct  93   LFVEAECDGALADLADFSPSPHIS-LAAKVDYSQG-ISTYPLSLMQLTRFKCGGVSLGVT  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
              H VADG    H+++ W+++A G  +S+ PF DRR L        + +  P+  F H  
Sbjct  151  NEHHVADGTAALHYINTWSDIARGLTVSAPPFLDRRLL--------AARSPPQPNFSHVE  202

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
                           E    T  +S+  ++A+K   N+G     K   YT +E +  H+W
Sbjct  203  YQPYPSLKTPLNITNEAAFKTFTMSRDHLNAIKEKCNSGE----KKTSYTTYEAVAGHVW  258

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            RC C AR   P Q + +  SVD R+R+ PPLP+ YFGNA+       + GE+ S+PL+  
Sbjct  259  RCICMARRLPPDQESKVQISVDSRQRLRPPLPERYFGNAIFFATPVALCGELESKPLRFA  318

Query  105  ASKIRDAIDGVTSEYVNCAIDFY----RNEGDVIKRQE  4
             +KI DA+  +  EY+  A+D+     +N   +++ +E
Sbjct  319  VAKIHDALARMDDEYMKSALDYLEVEQQNIAAIVRNEE  356



>ref|XP_009375480.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
 ref|XP_009375481.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=438

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/274 (37%), Positives = 149/274 (54%), Gaps = 18/274 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ +VL D GDF+P  EL  L+P+VDYS   +    L V Q+T F+CGG+SLG  
Sbjct  96   LFVEAETGSVLDDFGDFAPTLELRRLIPAVDYSAG-VSTYALLVLQVTYFKCGGVSLGVG  154

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  L+  PF DR  LLR    S  P   P+  F H  
Sbjct  155  MQHHVADGFSGLHFINTWSDMARGLDLTIPPFIDRT-LLR----SRDP---PQPAFHHIE  206

Query  471  ---SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVI  301
               +PP+     S +      T VS  RL++ Q++ LK+ +            Y+ +E+ 
Sbjct  207  YQPAPPMKTPLQSAKPGAADTTTVSIFRLTRDQLNILKSKSKEA----GNTVSYSSYEMF  262

Query  300  TAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISR  121
            + H+WRC CKAR     Q T L  + D R R++PPLP  YFGN +       V+G++ S+
Sbjct  263  SGHVWRCVCKARELPDDQDTKLYIATDGRSRLQPPLPPGYFGNVIFTTTPIAVAGDLQSK  322

Query  120  PLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            P    AS+I DA+  +   Y+  A+D+   + D+
Sbjct  323  PTWYAASRIHDALVRMDDNYLRSALDYLELQPDL  356



>gb|ADG46003.1| hydroxycinnamoyl transferase [Salvia miltiorrhiza]
Length=427

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/269 (38%), Positives = 151/269 (56%), Gaps = 15/269 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD  + D GDF+P  EL  L+P+VDYS + I   PL V Q+T F+CGG+SLG  
Sbjct  92   LFVEAESDGSVDDYGDFAPTLELRRLIPAVDYSQE-ISAYPLLVLQVTFFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H VADG    HF++ W+++A G  ++  PF DR  LLR    +  P     +  ++ P
Sbjct  151  MQHHVADGFSGPHFINTWSDMARGLDITLEPFIDRT-LLR----ARDPPEPQFKHIEYQP  205

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P  +    +      ET VS  +L++ Q+  LKA + +    +     Y+ +E++  HIW
Sbjct  206  PPAMKTYGE-----AETLVSIFKLTREQLTTLKAKSKD----DGNTVTYSSYEMLAGHIW  256

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            RCAC AR     Q T L  + D R R++PPLP  YFGN +       V+G++ S+P    
Sbjct  257  RCACLARGLPEDQSTKLYIATDGRFRLQPPLPPGYFGNVIFTATPMAVAGDLESKPAWYG  316

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            ASKI DA+  + +EY+  A+D+   + D+
Sbjct  317  ASKIHDALARMDNEYLRSALDYLELQPDL  345



>emb|CBI83579.1| hydroxycinnamoyl transferase [Solenostemon scutellarioides]
Length=427

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/269 (36%), Positives = 147/269 (55%), Gaps = 15/269 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD  + D GDF+P  EL  L+P+VDYS   I   PL V Q+T F+CGG+SLG  
Sbjct  92   LFVEAESDGTVDDYGDFAPSLELRRLIPAVDYSQG-ISAYPLLVLQVTFFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG    HF++ W+++A G  ++  PF DR  L         PQ   + V    P
Sbjct  151  MQHHAADGFSGLHFINTWSDMARGLDITLPPFIDRTLL----SARDPPQPQFKHVEYQPP  206

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P +      ++    ET VS  +L+K Q+  LKA +      +     Y+ +E+++ H+W
Sbjct  207  PAM------KTYEPAETVVSIFKLTKDQLTTLKAKSKE----DGNTTTYSSYEMLSGHVW  256

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            RC C AR    +Q T L  + D R R++P LP  YFGN +       V+G++ S+P+   
Sbjct  257  RCTCLARGLPEEQETKLYIATDGRSRLQPQLPPGYFGNVIFTATPLAVAGDLGSKPVWYA  316

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            ASKI DA+  + ++Y+  A+DF   + D+
Sbjct  317  ASKIHDALARMDNDYLRSALDFLELQPDL  345



>gb|ACI28534.1| shikimate O-hydroxycinnamoyl transferase [Trifolium pratense]
Length=434

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/273 (36%), Positives = 149/273 (55%), Gaps = 17/273 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEA++ AV+ D GDF+P  EL  L+P+VDYS   I+  PL V Q+T F+CGG+SLG  
Sbjct  93   LFVEADTGAVIDDFGDFAPTLELRQLIPAVDYSRG-IESYPLLVLQVTYFKCGGVSLGVG  151

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  +S  PF DR  LLR        +  PR VFDH  
Sbjct  152  MQHHVADGASGLHFINTWSDVARGLDVSIPPFIDRT-LLRA-------RDPPRPVFDHIE  203

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
               PP +               VS  +L++ Q+  LKA +            Y+ +E++ 
Sbjct  204  YKPPPSMKTTQQSTKPGSDGAAVSIFKLTREQLSTLKAKSKEA----GNTIHYSSYEMLA  259

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             H+WR  CKARS    Q T L  + D R R++PP P  YFGN +       ++G+++S+P
Sbjct  260  GHVWRSVCKARSLPDDQETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDLMSKP  319

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
                AS+I +A+  + ++Y+  A+DF   + D+
Sbjct  320  TWYAASRIHNALSRMDNDYLRSALDFLELQPDL  352



>ref|XP_011034568.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=431

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/269 (38%), Positives = 148/269 (55%), Gaps = 11/269 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ +V+ D  DF+P  EL  L+P+VDYSG  I    L V Q+T F+CGG+SLG  
Sbjct  92   LFVEAETTSVIDDFADFAPTSELKQLIPTVDYSGG-ISTYALLVLQVTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG    HF++ W+++A G  L+  PF DR  LLR       PQ     V    P
Sbjct  151  MQHHAADGFSGLHFVNTWSDMARGLDLTIPPFIDRT-LLRA---RDPPQPAFYHVEYQPP  206

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P +  ++  E+ + + T VS  +LS+ Q+  LKA AN     +     Y+ +E++ AH+W
Sbjct  207  PSM--KTVLETSKPESTAVSIFKLSRDQLSTLKAKANE----DGNNISYSSYEMLAAHVW  260

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            R  CKAR     Q T L  + D R R +P LP  YFGN +       V+GE+ S+P    
Sbjct  261  RSTCKARELPDDQETKLYIATDGRSRWQPQLPPGYFGNVIFTATPIAVAGEMQSKPTCYA  320

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            A KI DA+  + ++Y+  A+D+   + D+
Sbjct  321  AGKIHDALVRMDNDYLKSALDYLELQPDL  349



>gb|AFL93687.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-transferase [Cynara 
cardunculus var. scolymus]
Length=434

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/276 (37%), Positives = 150/276 (54%), Gaps = 22/276 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+D  + D G+ +P PEL  L P+VDYS D I   PL + Q+T+F CGG+SLG  
Sbjct  92   LFVEAEADCSIDDFGEITPSPELRKLAPTVDYS-DQISSYPLCITQVTRFNCGGVSLGCG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H ++DG    HF++ W++ A G  ++  PF DR  LLR        +  P  +F+H  
Sbjct  151  LHHTLSDGLSSLHFINTWSDKARGLSVAIPPFIDRS-LLRA-------RDPPTAMFEHLE  202

Query  471  --SPPLIVG--QSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFE  307
              SPP ++   Q+ + +   K    + LRL+  QI+ LK+ A  +G  Y      ++ +E
Sbjct  203  YHSPPSLIAPSQNQNSTSHPKLASTTMLRLTLDQINGLKSKAKGDGSVY------HSTYE  256

Query  306  VITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEII  127
            ++ AH+WRCACKAR     QPT L  + D R R+ PPLP  Y GN V        SGE  
Sbjct  257  ILAAHLWRCACKARGLSDDQPTKLYVATDGRSRLSPPLPPGYLGNVVFTATPIAKSGEFK  316

Query  126  SRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            S  L D A +I   +  +  +Y+  AID+   + D+
Sbjct  317  SESLADTARRIHIELAKMDDQYLRSAIDYLELQPDL  352



>ref|XP_002268988.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
Length=429

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/269 (36%), Positives = 147/269 (55%), Gaps = 13/269 (5%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEA++ +V+ D GDF+P  EL  L+P+VDYSGD I    L + Q+T F+CGG+SLG  
Sbjct  92   LFVEADTGSVIDDFGDFAPTLELRQLIPTVDYSGD-IGSYSLLILQVTHFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H VADG    HF++ W+++A G  ++  PF DR  LLR       PQ     +    P
Sbjct  151  MQHHVADGASGLHFINTWSDMARGLDITIPPFIDRT-LLRA---RDPPQPAFHHIEYQPP  206

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P    Q        + T V   R+++ Q++ LK    N    +     Y+ + ++  H+W
Sbjct  207  P----QLKTPLPNTQNTNVCIFRITRDQLNTLK----NKSKEDGNTISYSSYVMLAGHVW  258

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            RCACKARS    Q + +  + D R R+ P LP  YFGN +       V+GE++S+PL   
Sbjct  259  RCACKARSLPADQDSKMYIATDGRSRLRPALPPGYFGNVIFTTTPVAVAGELMSKPLWYA  318

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            ASKI +A+  +  EY+  A+D+   + D+
Sbjct  319  ASKIHNALARMDDEYLRSALDYLELQPDL  347



>gb|KEH28560.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=433

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 98/273 (36%), Positives = 149/273 (55%), Gaps = 17/273 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEA++  V+ D GDF+P  EL  L+P+VDYS   I+  PL V Q+T F+CGG+SLG  
Sbjct  92   LFVEADTGGVVDDFGDFAPTLELRQLIPAVDYSRG-IETYPLLVLQVTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  +S  PF DR  LLR        +  PR VFDH  
Sbjct  151  MQHHVADGASGLHFINTWSDVARGLDVSMPPFIDRT-LLRA-------RDPPRPVFDHIE  202

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
               PP +               VS  +L++ Q++ LKA +            Y+ +E++ 
Sbjct  203  YKPPPSMKTHQQPTKPGSDGAAVSIFKLTREQLNTLKAKSKEA----GNTIHYSSYEMLA  258

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             H+WR  CKARS    Q T L  + D R R++PP P  YFGN +       ++G+++++P
Sbjct  259  GHVWRSVCKARSLPDDQETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDLMTKP  318

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
                AS+I +A+  + +EY+  A+DF   + D+
Sbjct  319  TWYAASRIHNALSRMDNEYLRSALDFLELQPDL  351



>emb|CAN82918.1| hypothetical protein VITISV_023290 [Vitis vinifera]
Length=429

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 97/269 (36%), Positives = 147/269 (55%), Gaps = 13/269 (5%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEA++ +V+ D GDF+P  EL  L+P+VDYSGD I    L + Q+T F+CGG+SLG  
Sbjct  92   LFVEADTGSVIDDFGDFAPTLELRQLIPTVDYSGD-IGSYSLLILQVTHFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H VADG    HF++ W+++A G  ++  PF DR  LLR       PQ     +    P
Sbjct  151  MQHHVADGASGLHFINTWSDMARGLDITIPPFIDRT-LLRA---RDPPQPAFHHIEYQPP  206

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P    Q        + T V   R+++ Q++ LK    N    +     Y+ + ++  H+W
Sbjct  207  P----QLKTPLPNTQNTNVCIFRITRDQLNTLK----NKSKEDGNTISYSSYVMLAGHVW  258

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            RCACKARS    Q + +  + D R R+ P LP  YFGN +       V+GE++S+PL   
Sbjct  259  RCACKARSLPADQDSKMYIATDGRSRLRPALPPGYFGNVIFTTTPVAVAGELMSKPLWYA  318

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            ASKI +A+  +  EY+  A+D+   + D+
Sbjct  319  ASKIHNALARMDDEYLRSALDYLEIQPDL  347



>ref|XP_004235891.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Solanum lycopersicum]
Length=435

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 101/272 (37%), Positives = 152/272 (56%), Gaps = 13/272 (5%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD V+ D GDF+P  EL  L+P+VDYS   I+   L V Q+T+F+CGG+SLG  
Sbjct  92   LFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQG-IESYALLVLQITQFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG    HF++ W+++A G  L+  PF DR  LLR       PQ     V    P
Sbjct  151  MQHHAADGASGLHFINTWSDMARGLDLTIPPFIDRT-LLRA---RDPPQPQFPHVEYQPP  206

Query  465  PLI--VGQSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEVITA  295
            P +    ++   +E + ET VS  +L++ QI+ LKA +  +G + N     Y+ +E++  
Sbjct  207  PTLKTTEENVPNAETVPETSVSIFKLTRDQINTLKAKSKEDGNTVN-----YSSYEMLAG  261

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            H+WR  C AR     Q T L  + D R R+ P LP  YFGN +       V+G++ S+P+
Sbjct  262  HVWRSTCMARGLTQDQETKLYIATDGRARLRPSLPPGYFGNVIFTATPVAVAGDLQSKPI  321

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
               ASKI D +  + ++Y+  A+D+   + D+
Sbjct  322  WYAASKIHDQLAIMDNDYLRSALDYLELQPDL  353



>dbj|BAF49306.1| putative acyltransferase [Clitoria ternatea]
Length=436

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 100/277 (36%), Positives = 156/277 (56%), Gaps = 22/277 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEA++ AV+ D GDF+P  +L  L+P++DYS   I+  PL V Q+T F+CGG+SLG  
Sbjct  92   LFVEADTGAVIDDFGDFAPTLQLRQLIPAIDYSQG-IETYPLLVLQVTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  +S  PF DR  +LR        +  PR VFDH  
Sbjct  151  MQHHVADGASGLHFINTWSDVARGLDVSIPPFIDRT-ILRA-------RDPPRPVFDHIE  202

Query  471  --SPPLIVGQSSDESERM---KETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRF  310
               PP +   +  +  +        VS  +L++ Q+  LKA +  +G + N     Y+ +
Sbjct  203  YKPPPAMNNNTPSQPTKPGSDPTAAVSIFKLTRDQLTTLKAKSKEDGNTVN-----YSSY  257

Query  309  EVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEI  130
            E++  H+WR  CKARS    Q T L  + D R R++PP P  YFGN +       V+G++
Sbjct  258  EMLAGHVWRSVCKARSLPEDQETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAVAGDL  317

Query  129  ISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            +S+P    AS+I +A+  + +EY+  A+DF   + D+
Sbjct  318  MSKPTWYAASRIHNALLRMDNEYLRSALDFLELQPDL  354



>gb|EYU25633.1| hypothetical protein MIMGU_mgv1a006801mg [Erythranthe guttata]
Length=431

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 104/280 (37%), Positives = 154/280 (55%), Gaps = 34/280 (12%)
 Frame = -2

Query  822  LVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFAI  643
            + EAES+A + D GDF+P P +  L+PSVDY+  PI +IP+ + QLT+F CGG+S+G  I
Sbjct  96   IFEAESEAAVEDFGDFTPTPAIQALIPSVDYT-TPIDEIPMVIVQLTRFSCGGVSIGLGI  154

Query  642  SHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS--  469
            SHV+ADG    HF+ EWA +A        PF DR  L     E+ SP   P + FD +  
Sbjct  155  SHVMADGPSALHFVDEWAKIARSMGPIVPPFLDRTVL-----ENGSP---PAKPFDPAVL  206

Query  468  --PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN--NGRSYNAKPRGYTRFEVI  301
              PP ++GQ  +  +R K   V+ L L+K QI  L+   N  + ++ +   RGY+RFE  
Sbjct  207  RPPPTLIGQEDNMEQRKKPITVAFLNLTKLQIEKLRNKVNLDSDKNNSGGGRGYSRFEA-  265

Query  300  TAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISR  121
                               T+L F  D R +++PPLP ++FGNA+I V     SG ++S 
Sbjct  266  ------------------QTSLHFVADFRNKLQPPLPKNFFGNALIRVEATDTSGSLLSN  307

Query  120  PLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
             +   A KIR+A++ VT E V   +++ +   DV + + L
Sbjct  308  TIGAAAKKIREAVEKVTDETVRAYLEYLKGLPDVGRFRSL  347



>ref|XP_007146396.1| hypothetical protein PHAVU_006G036800g [Phaseolus vulgaris]
 gb|ESW18390.1| hypothetical protein PHAVU_006G036800g [Phaseolus vulgaris]
Length=455

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 108/266 (41%), Positives = 149/266 (56%), Gaps = 16/266 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCG-GISLGF  649
             L++A +    AD GDFSP      LVP VDY+  PI+DIPL + Q+T F  G G+++G 
Sbjct  95   TLLDAHTTNSFADYGDFSPSLSTEQLVPKVDYT-QPIEDIPLMLMQITGFHGGEGLAIGI  153

Query  648  AISHVVADGHGLCHFLSEWANLASGKPL--SSAPFHDRRRLLRGVGESSSPQGGPRRVFD  475
              SH + D   +  F++ WA +A G+ L  +  PF DR  +L+   + SSP         
Sbjct  154  VTSHPLTDATSMMPFVNNWAKVARGEELDPNEIPFLDRV-VLKLPQQPSSPSVK----LP  208

Query  474  HSPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
               P+   Q  ++ +R      +  +LS  Q+  LK  ANN ++ N   R Y+RFEVI A
Sbjct  209  EWKPVSQAQGIEQGQR----SAALFKLSSRQVEILKKKANNDKASNEGVRPYSRFEVIAA  264

Query  294  HIWRCACKAR--SHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFG-VSGEIIS  124
            HIWRCA KAR  +    QPT + FSVDIR R+ PPLP +YFGNA+   V      G+IIS
Sbjct  265  HIWRCASKARASAENSNQPTLVRFSVDIRSRLNPPLPKNYFGNALAKTVTPKCYEGDIIS  324

Query  123  RPLQDVASKIRDAIDGVTSEYVNCAI  46
             PL+  A KIR+A+  VT EY+   +
Sbjct  325  NPLRYAAQKIREAVYVVTDEYIRAQL  350



>ref|XP_004291518.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score =   178 bits (452),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 96/267 (36%), Positives = 148/267 (55%), Gaps = 11/267 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNH-LVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGF  649
            + V A+S + + D+G F+P PE    L+P+VDYSG  I    L + Q+T F+CGG++LG 
Sbjct  100  LFVVADSSSCIDDMGGFAPTPEFGRGLLPTVDYSGG-ISSYLLLLVQITYFKCGGVALGV  158

Query  648  AISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS  469
             + H +ADG    HF++ W+++A G  ++  P  DR  LLR   +       PR + DH+
Sbjct  159  RLDHYLADGFSALHFINTWSDIARGADIAIPPTIDRT-LLRARDQ-------PRTLLDHN  210

Query  468  PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
              ++    +D      ET VS    ++ Q++ LKA +   +  + K + YT FEV   H+
Sbjct  211  HHIVYQPPNDHGTTGAETVVSVFTFTREQLNILKAMSTMTKEEDNKMK-YTLFEVFAGHV  269

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCACKAR     Q T   F V+ R R++PPLP  YFGN +       V+G++IS+PL  
Sbjct  270  WRCACKARELANDQETNFYFPVNGRTRLQPPLPPGYFGNVIFRAAATAVAGDLISKPLSY  329

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNE  28
             A  I +A+  +  +Y+  A+D+   E
Sbjct  330  AACCIHNAVVRMDDDYLRSALDYLELE  356



>gb|ACA64049.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Salvia miltiorrhiza]
Length=427

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 100/269 (37%), Positives = 151/269 (56%), Gaps = 15/269 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD  + D GDF+P  EL  L+P+VDYS + I   PL V Q+T F+CGG+SLG  
Sbjct  92   LFVEAESDGSVDDYGDFAPTLELRRLIPAVDYSQE-ISAYPLLVLQVTFFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H VADG    HF++ W+++A G  ++  PF DR  LLR    +  P     +  ++ P
Sbjct  151  MQHHVADGFSGLHFVNTWSDMARGLDITLEPFIDRT-LLR----ARDPPEPQFKHIEYQP  205

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P  +    +      ET VS  +L++ Q+  LKA + +    +     ++ +E++  HIW
Sbjct  206  PPAMKTYGE-----AETLVSIFKLTREQLTTLKAKSKD----DGNTVTHSSYEMLAGHIW  256

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            RCAC AR     Q T L  + D R R++PPLP  YFGN +       V+G++ S+P    
Sbjct  257  RCACLARGLPEDQSTKLYIATDGRFRLQPPLPPGYFGNVIFTATPMAVAGDLESKPAWYG  316

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            ASKI DA+  + +EY+  A+D+   + D+
Sbjct  317  ASKIHDALARMDNEYLRSALDYLELQPDL  345



>ref|XP_004507047.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cicer 
arietinum]
Length=435

 Score =   178 bits (451),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 97/273 (36%), Positives = 150/273 (55%), Gaps = 18/273 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEA +D ++ D GDF+   +   L+P VDYS   I+  PL V Q+T F+CGG+SLG  
Sbjct  96   LFVEANTDTIIDDFGDFASTLQHCQLIPVVDYSSG-IRTYPLLVLQVTYFKCGGVSLGVG  154

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  +S  PF DR  LLR        +  PR  F+H  
Sbjct  155  MHHHVADGISGLHFINTWSDVARGLDVSVPPFIDRT-LLRA-------RDPPRPAFEHIE  206

Query  471  -SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEVIT  298
              PP I+  +    +      VS  +L+  QI  LKA +  +G++ N     ++ FE++ 
Sbjct  207  YKPPPIMKTTPKNQDTEATAAVSIFKLTCKQIATLKAKSKEDGKTIN-----FSSFEILA  261

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             H+WR  CKARS    Q T     +D R R++PPLP  Y GN +  +    ++G+++S+P
Sbjct  262  GHVWRSVCKARSLPDDQETKFSIPIDGRSRLQPPLPQGYLGNVIFTISTIAITGDLMSKP  321

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
                ASKI +A+    +EY+  +ID+   + D+
Sbjct  322  TWYAASKIHNALLQANNEYLRSSIDYLELQSDL  354



>ref|XP_007215406.1| hypothetical protein PRUPE_ppa005955mg [Prunus persica]
 gb|EMJ16605.1| hypothetical protein PRUPE_ppa005955mg [Prunus persica]
Length=435

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/278 (38%), Positives = 156/278 (56%), Gaps = 27/278 (10%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + V AE+ +VL D GDF+P  E   LVP+VDYS   +   PL V Q+T F+CGG+SLG  
Sbjct  96   LFVVAETASVLDDFGDFAPTLEFRKLVPAVDYSAG-MSSYPLLVVQVTYFKCGGVSLGVG  154

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS-  469
            + H VADG    HF++ W+++A G  L+  PF DR  LLR        +  P+  FDH+ 
Sbjct  155  LEHRVADGFSGLHFVNTWSDIARGLDLTIPPFIDRT-LLRA-------RDPPQPAFDHTE  206

Query  468  ----PPLIVGQSS--DESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRF  310
                PP+  G  +  DES       VS  RL++ Q++ LKA +  +G + N     YT +
Sbjct  207  YQPDPPIKTGTKAVGDES-----ATVSIFRLTREQLNILKAKSKEDGNTIN-----YTTY  256

Query  309  EVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEI  130
            E++  HIW+CA  AR     Q T L  +VD R R++PPLP  +FGN V +      +G++
Sbjct  257  EMLAGHIWKCASVARELPDDQETKLHIAVDGRSRLQPPLPPGFFGNVVFSSAPIAATGDL  316

Query  129  ISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  16
             S P    AS+I DA+  + ++Y+  A+D+   + D++
Sbjct  317  KSEPTWYAASRIHDAVVRMDNDYLRSALDYLELQPDLL  354



>ref|XP_010063590.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70827.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
 gb|KCW70828.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
 gb|KCW70829.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
Length=445

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/275 (37%), Positives = 153/275 (56%), Gaps = 21/275 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ +V+ DLGDF+   EL  L+P+V+YS   I   PL V Q+T F+CGG+SLG  
Sbjct  99   LFVEAETSSVVDDLGDFATL-ELRKLIPAVNYSSG-ISSDPLLVLQVTYFKCGGVSLGVG  156

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H V DG    HF++ W++LA G  +   PF DR  LLR    S SP   PR  F H  
Sbjct  157  MQHHVTDGFSGLHFVNTWSDLARGLDVKLPPFIDRT-LLR----SHSP---PRPQFPHIE  208

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAA--NNGRSYNAKPRGYTRFEV  304
              SPP +       +     + VS L++++ Q+ ALK  A   NG +       YT +E+
Sbjct  209  YQSPPALRVSPETTNSASDSSTVSILKVTREQLDALKTQAVLENGNTTR-----YTSYEI  263

Query  303  ITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIIS  124
            +  H+WRCAC+AR     Q T L  ++D R R+ PPLP  YFGN +  +    V+G++IS
Sbjct  264  LAGHVWRCACRARGLSDDQDTKLSIAIDGRMRLSPPLPQGYFGNGIFTITPIAVAGDLIS  323

Query  123  RPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            +P+   A  I +++     +Y+  A+D+   + D+
Sbjct  324  KPVLYAARTIHESLARANDDYLRSALDYLELQPDL  358



>ref|XP_008228828.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=442

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/278 (37%), Positives = 156/278 (56%), Gaps = 27/278 (10%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + V AE+ +VL D GDF+P  E   L+P+VDYS   I   PL V Q+T F+CGG+SLG  
Sbjct  103  LFVVAETASVLDDFGDFAPTLEFRKLIPAVDYSAG-ISSYPLLVVQVTYFKCGGVSLGVG  161

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  L+  PF DR  LLR        +  P+  FDH  
Sbjct  162  LEHRVADGLSGLHFVNTWSDIARGLDLTIPPFIDRT-LLRA-------RDPPQPAFDHIE  213

Query  471  ---SPPLIVGQSS--DESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRF  310
                PP+  G  S  DES       VS  RL++ Q++ LKA +  +G + N     YT +
Sbjct  214  YQPDPPIKTGTKSVGDES-----ATVSIFRLTREQLNILKAKSKEDGNTIN-----YTTY  263

Query  309  EVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEI  130
            E++  H+WRCA  AR     Q + L  +VD R R++PPLP  +FGN + +      +G++
Sbjct  264  EMLAGHVWRCASVARELPDDQESKLHIAVDGRSRLQPPLPPGFFGNVIFSSAPIAAAGDL  323

Query  129  ISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  16
             S+P    AS+I DA+  + ++Y+  A+D+   + D++
Sbjct  324  KSKPTWYAASRIHDAVVRMDNDYLRSALDYLELQPDLL  361



>gb|KHN04193.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=436

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/276 (36%), Positives = 153/276 (55%), Gaps = 20/276 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEA++ AV+ D GDF+P  EL  L+P+VDYS   I+  PL V Q+T F+CGG+SLG  
Sbjct  92   LFVEADTGAVIDDFGDFAPTLELRQLIPAVDYSQG-IETYPLLVLQVTHFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  +S  PF DR  +LR        +  PR VFDH  
Sbjct  151  MQHHVADGASGLHFINTWSDVARGLDVSIPPFIDRT-ILRA-------RDPPRPVFDHIE  202

Query  471  --SPPLIVGQSSDE---SERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFE  307
               PP +  Q   +           VS  RL++ Q++ LKA +      +     Y+ +E
Sbjct  203  YKPPPAMKTQQPTKPGSDSDNAAAAVSIFRLTREQLNTLKAKSKE----DGNTISYSSYE  258

Query  306  VITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEII  127
            ++  H+WR  CKAR+    Q T L  + D R R++PP P  YFGN +       V+G+++
Sbjct  259  MLAGHVWRSVCKARALPDDQETKLYIATDGRSRLQPPPPPGYFGNVIFTTTPIAVAGDLM  318

Query  126  SRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            S+P    AS+I +A+  + ++Y+  A+D+   + D+
Sbjct  319  SKPTWYAASRIHNALLRMDNDYLRSALDYLELQPDL  354



>ref|XP_010063583.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063585.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70825.1| hypothetical protein EUGRSUZ_F03972 [Eucalyptus grandis]
 gb|KCW70826.1| hypothetical protein EUGRSUZ_F03972 [Eucalyptus grandis]
Length=445

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/275 (37%), Positives = 153/275 (56%), Gaps = 21/275 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ +V+ D GDF+   EL  L+P+VDYSG  I   P+ V Q+T F+CGG+SLG  
Sbjct  99   LFVEAETSSVVDDFGDFATL-ELRKLIPTVDYSGG-ISSDPILVLQVTYFKCGGVSLGVG  156

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W++LA G  +   PF DR  LLR    + SP   PR  F H  
Sbjct  157  MQHHVADGFSGLHFVNTWSDLARGLDVKLPPFIDRT-LLR----ARSP---PRPQFPHIE  208

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAA--NNGRSYNAKPRGYTRFEV  304
              SPP +       +     T VS LR+++  +  LK  A  +NG +       Y+ +E+
Sbjct  209  YQSPPALRVSPETTNSAPDSTTVSILRVTREWLDNLKTQAELDNGNTTR-----YSSYEI  263

Query  303  ITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIIS  124
            +  H+WRCAC+AR     Q T +  + D R R+ PPLP  YFGN ++      V+G++IS
Sbjct  264  LAGHVWRCACRARGLSDDQDTKVYIATDARMRLSPPLPQGYFGNGILTTTPIAVAGDLIS  323

Query  123  RPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            +P+   A KI +++  +   Y+  A+D+   + D+
Sbjct  324  KPVSYAAQKIHESLARMNDNYLRSALDYLELQPDL  358



>ref|XP_007146398.1| hypothetical protein PHAVU_006G037000g [Phaseolus vulgaris]
 gb|ESW18392.1| hypothetical protein PHAVU_006G037000g [Phaseolus vulgaris]
Length=449

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/266 (38%), Positives = 151/266 (57%), Gaps = 12/266 (5%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCG-GISLGF  649
              +EAE+   +AD GDFSP   +  LVP +DY+  P+++IPL + Q T+   G G  +G 
Sbjct  89   TFIEAETTKSMADYGDFSPGV-VAELVPKIDYT-QPVEEIPLMLVQSTRLPGGNGFVIGL  146

Query  648  AISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS  469
            A+ HV++DG G   F++ WA L  G+ L     H+   L R V +       P   FDH 
Sbjct  147  AVCHVLSDGLGSIQFINSWAKLGRGETLEP---HELPYLDRTVLKHQHSSTSPSPCFDHP  203

Query  468  P----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVI  301
                 PL +G S   +E+ K+T+   L+L++ Q+  LK  AN  +      R Y+RFE +
Sbjct  204  ELKPLPLKLGSSDINAEQKKKTRAVLLKLTRQQVEKLKKEANE-QPLQEGVRAYSRFEAL  262

Query  300  TAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFG-VSGEIIS  124
              HIWR A KAR  + +QPT + F+ DIR R+ PPLP +Y+GNA+   V      GEI+S
Sbjct  263  AGHIWRSASKARELEEKQPTVVRFNADIRSRVIPPLPKNYYGNALAATVTPKCYVGEIVS  322

Query  123  RPLQDVASKIRDAIDGVTSEYVNCAI  46
            +PL   A K+R+AI+ +T+EY+   +
Sbjct  323  KPLSYAAQKVREAIEKLTNEYIRSQL  348



>ref|XP_008342823.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=438

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/278 (36%), Positives = 150/278 (54%), Gaps = 26/278 (9%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ +V+ D GDF+P  EL  L+PSVDY+   I   PL + Q+T F+CGG+SLG  
Sbjct  96   LFVEAETGSVIDDFGDFAPTLELRRLIPSVDYAAG-ISTYPLLLLQVTXFKCGGVSLGVG  154

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H  ADG    HF++ W+++A G  L+  PF DR  LLR        +  P+  F H  
Sbjct  155  MQHHAADGFSGLHFINTWSDMARGLDLTLPPFIDRT-LLRA-------RDPPQPAFHHIE  206

Query  471  ---SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRG----YTR  313
               +P +     S +      T VS  RL++ Q++ LK        Y +K  G    Y+ 
Sbjct  207  YQPAPQMKXPLQSAKPGAADSTTVSIFRLTRDQLNILK--------YKSKEAGNTVSYSS  258

Query  312  FEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGE  133
            +E+++ H+WRCACKAR     Q T L  + D R R++PPLP  YFGN +        +G+
Sbjct  259  YEMLSGHVWRCACKARELPDDQDTKLFIATDGRSRLQPPLPPGYFGNVIFTATPIAXAGD  318

Query  132  IISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            I S+P    AS+I DA+  +   Y+  A+D+   + D+
Sbjct  319  IQSKPTWYAASRIHDALVRMDDSYLRSALDYLELQPDL  356



>ref|XP_004149125.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cucumis 
sativus]
 gb|KGN53930.1| hypothetical protein Csa_4G190020 [Cucumis sativus]
Length=469

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/293 (35%), Positives = 162/293 (55%), Gaps = 32/293 (11%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + +EA     L D GDF+P   +  L P VDY+   I+D+P+F+ Q+T+F CGG+ +G  
Sbjct  91   LFIEASYGGTLDDFGDFTPTDVVRKLAPEVDYNSS-IEDVPMFLVQVTRFSCGGLVIGLN  149

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSA---PFHDRRRLLRGVGESSSPQGGPRRVFD  475
            +SH + DG     F++ WA++A G   + +   P HDR  L     +   P   P+  F 
Sbjct  150  VSHTLVDGVSAIMFINSWASIARGDKTAKSILQPLHDRNVL-----QPQKPFCPPQ--FY  202

Query  474  HSP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNA---------  334
            H      P ++G S+ + ERMKETK + L+L++ Q+  L+  AN+    N          
Sbjct  203  HCEYDILPFVIGCSNSKEERMKETKSALLKLTREQVEKLRMRANSSTPTNQNIEKVVDVN  262

Query  333  ----KPRGYTRFEVITAHIWRCACKAR---SHKPQQPTTLCFSVDIRRRMEPPLPDSYFG  175
                +P  ++R+E+IT HIW CA KAR   + K +Q T +   V+IR+R+  P+P ++ G
Sbjct  263  EVLLQPCPHSRYELITGHIWVCASKARNIDNDKSKQSTVVQIVVNIRQRLRTPIPKNFCG  322

Query  174  N-AVINVVIFGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            N A+I++      GE++S+PL   A KIR+A   +T EYV  AIDF   + D+
Sbjct  323  NAALISITPQCEFGELMSQPLSYAAKKIREASWKMTDEYVKSAIDFLATQEDI  375



>ref|XP_004293649.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/267 (36%), Positives = 148/267 (55%), Gaps = 11/267 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNH-LVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGF  649
            + V A+S + + DLGDF+P PE    L+P+VDYSG  I   PL + Q T F+CGG++LG 
Sbjct  100  LFVVADSSSCIDDLGDFAPTPEFGRGLLPTVDYSGG-ISSYPLLLVQTTYFKCGGVALGV  158

Query  648  AISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS  469
             + H++ADG    HF++ W+++A G  ++  P  DR  LLR        +  PR + DH+
Sbjct  159  RLDHLLADGLSALHFINTWSDIARGVDIAIPPTIDRT-LLRA-------RDQPRTLLDHN  210

Query  468  PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
              +     +D      ET VS    ++ Q++ LKA +   +  + + + YT FEV   H+
Sbjct  211  HHIEYQPPNDHGTTGAETVVSVFTFTREQLNILKAMSTMTKEEDNEMK-YTTFEVFAGHV  269

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCACK R     Q T L  +V+ R R++PPLP  YFGN +       V+G++IS+PL  
Sbjct  270  WRCACKVRELANDQETNLFLAVNGRTRLQPPLPPGYFGNVIFRAAATAVAGDLISKPLSY  329

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNE  28
             A  I +A+  +  +Y+   +D+   E
Sbjct  330  AACCIHNALVRMDDDYLRSVLDYLELE  356



>gb|ABK79689.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. scolymus]
Length=434

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/276 (36%), Positives = 150/276 (54%), Gaps = 22/276 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+D  + D G+ +P PEL  L P+VDYS D +   PL + Q+T+F CGG+SLG  
Sbjct  92   LFVEAEADCSIDDFGEITPSPELRKLAPTVDYS-DQVSSYPLCITQVTRFNCGGVSLGCG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H ++DG    HF++ W++ A G  ++  PF DR  LLR        +  P  +F+H  
Sbjct  151  LHHTLSDGLSSLHFINTWSDKARGLSVAIPPFIDRS-LLRA-------RDPPTAMFEHLE  202

Query  471  --SPPLIVGQSSDE--SERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFE  307
              SPP ++  S ++  +   K    + LRL+  QI+ LK+ A  +G  Y      ++ +E
Sbjct  203  YHSPPSLIAPSQNQNFTSHPKLASTAMLRLTLDQINGLKSKAKGDGSVY------HSTYE  256

Query  306  VITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEII  127
            ++ AH+WRCAC+AR     QPT L  + D R R+ PPLP  Y GN V        SGE  
Sbjct  257  ILAAHLWRCACEARGLSDDQPTKLYVATDGRSRLNPPLPPGYLGNVVFTATPIAKSGEFK  316

Query  126  SRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            S  L D A +I   +  +  +Y+  AID+   + D+
Sbjct  317  SESLADTARRIHSELAKMDDQYLRSAIDYLELQPDL  352



>ref|NP_001289240.1| shikimate O-hydroxycinnamoyltransferase-like [Pyrus x bretschneideri]
 gb|AFF57841.1| hydroxycinnamoyl-coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
3 [Pyrus x bretschneideri]
Length=438

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/270 (36%), Positives = 147/270 (54%), Gaps = 10/270 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ +V+ D GDF+P  EL  L+PSVDY+   I   PL + Q+T F+CGG+SLG  
Sbjct  96   LFVEAETGSVIDDFGDFAPTLELRKLIPSVDYAAG-ISTYPLLLLQVTYFKCGGVSLGVG  154

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRV-FDHS  469
            + H  ADG    HF++ W+++A G  L+  PF DR  LLR       PQ     + +  +
Sbjct  155  MQHHAADGFSGLHFINTWSDMARGLDLTLPPFIDRT-LLRA---RDPPQPAFHPIEYQPA  210

Query  468  PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            P +     S +      T VS  RL++ Q++ LK+ +            Y+ +E+++ H+
Sbjct  211  PQMKTPLQSAKPGAADSTTVSIFRLTRDQLNILKSKSKEA----GNTVSYSSYEMLSGHV  266

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCACKAR     Q T L  + D R R++PPLP  YFGN +       V+G+I S+P   
Sbjct  267  WRCACKARELPDDQDTKLYIATDGRSRLQPPLPPGYFGNVIFTTTPIAVAGDIQSKPTWY  326

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             AS+I D +  +   Y+  A+D+   + D+
Sbjct  327  AASRIHDGLVRMDDSYLRSALDYLELQPDL  356



>ref|XP_010527105.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Tarenaya 
hassleriana]
Length=399

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/270 (37%), Positives = 148/270 (55%), Gaps = 11/270 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +LV A++ +V+ D GDF+P   L  L+P+VDYSG PI   PL V Q+T F+CGG SLG  
Sbjct  57   LLVLADTPSVIDDFGDFAPTLLLRQLIPTVDYSG-PIDSYPLLVLQVTFFKCGGASLGVG  115

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H VADG    HF++ W+++A G  L+  PF DR  LLR       PQ     V    P
Sbjct  116  MQHHVADGFSGLHFINAWSDMARGLDLTIPPFIDRT-LLRA---RDPPQPAFHHVEYQPP  171

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANN-GRSYNAKPRGYTRFEVITAHI  289
            P +             T VS  +LS+ Q++ALKA +   G + N     Y+ +E+++ H+
Sbjct  172  PSMKNPVDPSKAGPDNTTVSIFKLSRDQLNALKAKSKEEGNTIN-----YSSYEMLSGHV  226

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WR  CKAR     Q + L  + D R R+ PPLP  YFGN +       V+G++ S+P   
Sbjct  227  WRSVCKARGLADDQESKLYIATDGRSRLRPPLPPGYFGNVIFTATPVAVAGDLHSKPTWY  286

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             A +I +A+  + +EY+  A+D+   + D+
Sbjct  287  AAGQIHNALVRMDNEYLRSALDYLEMQPDL  316



>ref|XP_004166134.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cucumis 
sativus]
Length=469

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 108/299 (36%), Positives = 159/299 (53%), Gaps = 32/299 (11%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + +EA     L D  DF+    L  L P VDY+  PI+D+PLFV Q+T+F CGG+ +G  
Sbjct  91   LFIEASYGGTLDDCSDFTHADGLRKLTPKVDYNS-PIEDVPLFVVQVTRFSCGGLVIGLN  149

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSA---PFHDRRRLLRGVGESSSPQGGPRRVFD  475
            +SH + DG     F++ WA++A G+  + +   P HDR  L     ++  P   PR  F 
Sbjct  150  VSHTLVDGVSAIMFINSWASIARGEKTTKSILQPSHDRNVL-----QAQKPFSPPR--FF  202

Query  474  HSP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNA---------  334
            H      P + G S  + E+MKETK + L+L+K Q+  L+  AN+    N          
Sbjct  203  HYEYDVLPFVTGCSDYKEEKMKETKFALLKLTKEQVEKLRMRANSSNPTNQNIEKSVDVN  262

Query  333  ----KPRGYTRFEVITAHIWRCACKAR---SHKPQQPTTLCFSVDIRRRMEPPLPDSYFG  175
                +P  Y+R+E IT HIW CA KAR   + K    T +   V++R+R+  P+P ++ G
Sbjct  263  EVLLQPSPYSRYESITGHIWVCASKARNIDNDKSNLSTMVQIVVNVRQRLRKPIPKNFCG  322

Query  174  N-AVINVVIFGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQEL  1
            N A+I+V      GE++S+PL   A KIR+A   +T EYV  AIDF     D+   + L
Sbjct  323  NAALISVTPQSNFGELMSQPLSYAAKKIREASWKMTDEYVTSAIDFLTTHEDICWTRTL  381



>gb|KHN18130.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=466

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/275 (37%), Positives = 152/275 (55%), Gaps = 18/275 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNH-LVPSVDYSGDPIQDIPLFVGQLTKFRCG----GI  661
             L+EAE+     D GDF+P   +   LVP +DY   PI++IPL + Q+T+F+      G+
Sbjct  91   TLIEAETAKTFDDFGDFTPSDSIKEELVPVIDYHSQPIEEIPLVLVQVTRFKGDRKQQGL  150

Query  660  SLGFAISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRV  481
            ++  A+SH VADG+   HF++ WA +  G  L     +D   L R +  SSS        
Sbjct  151  AVAVAVSHPVADGYAWIHFINTWAKVNRGGMLD---LNDMPCLDRTIRRSSSLSSP-PPR  206

Query  480  FDHSP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAK----PR  325
            FDH      P  +G+S    E+ K+T  + L+L+  Q+  L+  AN   + + K     R
Sbjct  207  FDHPELKPLPFKLGKSDSTEEQNKKTTAAVLKLTSEQVEMLRKKANENENLSTKQGSRSR  266

Query  324  GYTRFEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVI-F  148
              +RFE + AHIWRCACKAR     QPT + F+ D R R+ PPLP +YFGNA+   V   
Sbjct  267  PCSRFEAVAAHIWRCACKARELDRNQPTLVRFNADFRNRLTPPLPRNYFGNALAATVTPE  326

Query  147  GVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAID  43
              +GEI S+PL   A K+R+A++ +  EY++  +D
Sbjct  327  CYAGEITSKPLSYAARKMREAVEMLKEEYISSQLD  361



>ref|XP_010034043.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
Length=492

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 153/271 (56%), Gaps = 12/271 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ + + D GDF+P  EL  L+P+VDYS   +   PL V Q+T F+CGG+SLG  
Sbjct  150  LFVEAETSSAVDDFGDFAPTLELRKLIPAVDYSAG-LSTYPLLVLQVTYFKCGGVSLGVG  208

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H VADG    HF++ W+++A G  L++ PF DR  LLR       PQ   + +    P
Sbjct  209  MQHHVADGFSGLHFVNTWSDMARGLDLTTPPFIDRT-LLRA---RDPPQPQFKHIEYQPP  264

Query  465  PLIVGQSSDESERMKE-TKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEVITAH  292
            P +    S  ++   E T VS  ++++ Q++ LK  +  +G + N     Y+ +E++  H
Sbjct  265  PALKAPLSQTTKSGAESTAVSIFKMTREQLNKLKGKSKEDGNTVN-----YSSYEMLAGH  319

Query  291  IWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQ  112
            +WR ACKAR     Q + +  + D R R+ PPLP  YFGN +       V+G++ S+P  
Sbjct  320  VWRSACKARDLAVDQESKMYIATDGRSRLSPPLPPGYFGNVIFTATPLAVAGDLQSKPTW  379

Query  111  DVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
              AS+I DA+  + ++Y+  A+D+   + D+
Sbjct  380  YAASRIHDALVRMDNDYLRSALDYLELQPDL  410



>ref|XP_003553113.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=466

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 103/275 (37%), Positives = 152/275 (55%), Gaps = 18/275 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNH-LVPSVDYSGDPIQDIPLFVGQLTKFRCG----GI  661
             L+EAE+     D GDF+P   +   LVP +DY   PI++IPL + Q+T+F+      G+
Sbjct  91   TLIEAETAKTFDDFGDFTPSDSIKEELVPVIDYHSQPIEEIPLVLVQVTRFKGDRKQQGL  150

Query  660  SLGFAISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRV  481
            ++  A+SH VADG+   HF++ WA +  G  L     +D   L R +  SSS        
Sbjct  151  AVAVAVSHPVADGYAWIHFINTWAKVNRGGMLD---LNDMPCLDRTIRRSSSLSSP-PPR  206

Query  480  FDHSP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAK----PR  325
            FDH      P  +G+S    E+ K+T  + L+L+  Q+  L+  AN   + + K     R
Sbjct  207  FDHPELKPLPFKLGKSDSTEEQNKKTTAAVLKLTSEQVEMLRKKANENENLSTKQGSRSR  266

Query  324  GYTRFEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVI-F  148
              +RFE + AHIWRCACKAR     QPT + F+ D R R+ PPLP +YFGNA+   V   
Sbjct  267  PCSRFEAVAAHIWRCACKARELDRNQPTLVRFNADFRNRLTPPLPRNYFGNALAATVTPE  326

Query  147  GVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAID  43
              +GEI S+PL   A K+R+A++ +  EY++  +D
Sbjct  327  CYAGEITSKPLSYAARKMREAVEMLKEEYISSQLD  361



>ref|XP_009354208.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=441

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 105/275 (38%), Positives = 152/275 (55%), Gaps = 20/275 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + V AE+ +VL D GDF+P PE   L+P VDYS   I   PL V Q+T F+CGG+SLG  
Sbjct  99   LFVVAETASVLEDFGDFAPTPEFRKLIPVVDYSAG-ISTYPLLVVQVTYFKCGGVSLGVG  157

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  L+  PF DR  LLR        +  P+  FDH  
Sbjct  158  LEHRVADGCSGLHFVNTWSDIARGLDLTIPPFIDRT-LLRA-------RDPPQTTFDHVE  209

Query  471  ---SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANN-GRSYNAKPRGYTRFEV  304
                PP      S +    + T+VS  RL++ Q+  LKA +   G S N     Y+ +E+
Sbjct  210  YQPDPPSKTPPPSTKDGDAESTRVSIFRLTREQLSVLKAKSKEEGNSIN-----YSTYEM  264

Query  303  ITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIIS  124
            +  H+WRCA KAR+    Q T L  +VD R R++PPLP  +FGN V     F  +G++ S
Sbjct  265  LAGHVWRCATKARNLPDDQVTKLHVAVDGRSRLQPPLPPGFFGNVVFAGAPFATAGDLKS  324

Query  123  RPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            +P    A +I D +  + ++Y+  A+DF   + D+
Sbjct  325  KPTWYAAGRIHDVVVRMNNDYLRSALDFLEVQPDL  359



>dbj|BAF49305.1| putative acyltransferase [Clitoria ternatea]
Length=433

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 99/274 (36%), Positives = 152/274 (55%), Gaps = 19/274 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEA + A + D GDF+P  EL  L+PSVDYS   I+  PL V Q+T F+CGG+SLG  
Sbjct  92   LFVEAHTTASVDDFGDFAPTLELRQLIPSVDYSAG-IETYPLLVLQVTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  +S +PF DR  LLR        +  P  VFDH  
Sbjct  151  MQHHVADGASGLHFINAWSDVARGLDISISPFIDRT-LLRA-------RDPPEPVFDHVE  202

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAA-NNGRSYNAKPRGYTRFEVI  301
                P +           ++  VS  +L++ Q++ LK  +  +G + N     Y+ +E++
Sbjct  203  YKPAPAMKTPLPPTKPGSEQVAVSIFKLTRDQLNTLKGKSREDGNTVN-----YSSYEML  257

Query  300  TAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISR  121
              H+WR  CKAR+    Q T L  + D R R++P LP  YFGN +       V+G+++S+
Sbjct  258  AGHVWRSVCKARALPHDQETKLYIATDGRSRLQPSLPPGYFGNVIFTTTPIAVAGDLMSK  317

Query  120  PLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            P    AS+I DA+  + +EY+  A+D+   + D+
Sbjct  318  PTWYAASRIHDALVRMDNEYLRSALDYLELQPDL  351



>gb|KCW53914.1| hypothetical protein EUGRSUZ_J03126 [Eucalyptus grandis]
Length=497

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 153/271 (56%), Gaps = 12/271 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ + + D GDF+P  EL  L+P+VDYS   +   PL V Q+T F+CGG+SLG  
Sbjct  155  LFVEAETSSAVDDFGDFAPTLELRKLIPAVDYSAG-LSTYPLLVLQVTYFKCGGVSLGVG  213

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H VADG    HF++ W+++A G  L++ PF DR  LLR       PQ   + +    P
Sbjct  214  MQHHVADGFSGLHFVNTWSDMARGLDLTTPPFIDRT-LLRA---RDPPQPQFKHIEYQPP  269

Query  465  PLIVGQSSDESERMKE-TKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEVITAH  292
            P +    S  ++   E T VS  ++++ Q++ LK  +  +G + N     Y+ +E++  H
Sbjct  270  PALKAPLSQTTKSGAESTAVSIFKMTREQLNKLKGKSKEDGNTVN-----YSSYEMLAGH  324

Query  291  IWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQ  112
            +WR ACKAR     Q + +  + D R R+ PPLP  YFGN +       V+G++ S+P  
Sbjct  325  VWRSACKARDLAVDQESKMYIATDGRSRLSPPLPPGYFGNVIFTATPLAVAGDLQSKPTW  384

Query  111  DVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
              AS+I DA+  + ++Y+  A+D+   + D+
Sbjct  385  YAASRIHDALVRMDNDYLRSALDYLELQPDL  415



>ref|XP_009800587.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=436

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 101/270 (37%), Positives = 146/270 (54%), Gaps = 15/270 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESDA + D GDF+P  EL  L+P+VD SGD I   PL + Q+T+F+CGG+SLG  
Sbjct  98   LFVEAESDAFVDDFGDFTPSLELRKLIPTVDTSGD-ISTFPLIIFQVTRFKCGGVSLGGG  156

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H ++DG    HF++ W+++A G  ++  PF DR  LLR       P      V  H P
Sbjct  157  VFHTLSDGLSSIHFINTWSDIARGLSVAIPPFIDRT-LLRA---RDPPTSSFEHVEYHPP  212

Query  465  P-LIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            P LI    + ES   K +  + L+ S  Q+  LK+         +K  G T +E++ AHI
Sbjct  213  PSLISSSKTLESTSPKPSMTTMLKFSSDQLGLLKS--------KSKHEGST-YEILAAHI  263

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRC CKAR+    Q T L  + D R R+ PPLP  Y GN V        S E++  PL +
Sbjct  264  WRCTCKARALADDQLTKLHVATDGRSRLCPPLPPGYLGNVVFTATPMAKSSELLQEPLTN  323

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             A +I  ++  +   Y+  A+D+   + D+
Sbjct  324  SAKRIHTSLSKMDDNYLRSALDYLELQPDL  353



>ref|XP_003531748.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
1 [Glycine max]
 ref|XP_003531749.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
2 [Glycine max]
Length=429

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 97/273 (36%), Positives = 152/273 (56%), Gaps = 21/273 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEA++ AV+ D GDF+P  EL  L+P+VDYS   I   PL V Q+T F+CGG+SLG  
Sbjct  92   LFVEADTGAVIDDFGDFAPTLELRQLIPAVDYSQG-IASYPLLVLQVTHFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  +S  PF DR  +LR        +  PR +FDH  
Sbjct  151  MQHHVADGASGLHFINTWSDVARGLDVSIPPFIDRT-ILRA-------RDPPRPIFDHIE  202

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
               PP +  Q +  +       VS  RL++ Q++ LKA +      +     Y+ +E++ 
Sbjct  203  YKPPPAMKTQQATNAS----AAVSIFRLTRDQLNTLKAKSKE----DGNTISYSSYEMLA  254

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             H+WR   KAR+    Q T L  + D R R++PP P  YFGN +       V+G+++S+P
Sbjct  255  GHVWRSVSKARALPDDQETKLYIATDGRSRLQPPTPPGYFGNVIFTTTPIAVAGDLMSKP  314

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
                AS+I +A+  + ++Y+  A+D+   + D+
Sbjct  315  TWYAASRIHNALLRMDNDYLRSALDYLELQPDL  347



>ref|XP_006341413.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Solanum 
tuberosum]
Length=435

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 99/272 (36%), Positives = 152/272 (56%), Gaps = 13/272 (5%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD V+ D GDF+P  EL  L+P+VDYS   I+   L V Q+T F+CGG+SLG  
Sbjct  92   LFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQG-IESYALLVLQITHFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG    HF++ W+++A G  ++  PF DR  LLR       PQ     V    P
Sbjct  151  MQHHAADGASGLHFINTWSDMARGLDITIPPFIDRT-LLRA---RDPPQPQFPHVEYQPP  206

Query  465  PLI--VGQSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEVITA  295
            P +    +++  ++ + ET VS  +L++ QI+ LKA +  +G + N     Y+ +E++  
Sbjct  207  PTLEATEENAPNADTVPETSVSIFKLTRNQINTLKAKSKEDGNTVN-----YSSYEMLAG  261

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            H+WR  C AR     Q T L  + D R R+ P LP  YFGN +       V+G++ S+P+
Sbjct  262  HVWRSTCMARGLTQDQETKLYIATDGRARLRPSLPPGYFGNVIFTATPVAVAGDLQSKPI  321

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
               ASKI D +  + ++Y+  A+D+   + D+
Sbjct  322  WYAASKIHDQLAIMDNDYLRSALDYLELQPDL  353



>gb|AHA14500.1| hydroxycinnamoyl-coenzyme A quinate transperase [Fagopyrum tataricum]
Length=435

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 100/269 (37%), Positives = 148/269 (55%), Gaps = 11/269 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ +V+ D GDF+P  EL  L+P+VDYS   I    L V QLT F+CGG+SLG  
Sbjct  96   LFVEAETTSVIDDFGDFAPTLELRKLIPTVDYSQG-ISSYSLLVLQLTYFKCGGVSLGVG  154

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H  ADG    HF++ WA++A G  L+  PF DR  LLR       PQ     V    P
Sbjct  155  MQHHAADGFSGLHFINTWADMARGLDLTIPPFIDRT-LLRA---RDPPQPKFHHVEYQPP  210

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P +  ++  E    +E  V+  ++S+ QI  LKA +      N  P  Y+ +E+++ H+W
Sbjct  211  PTL--KNPTEPSTPEEATVAIFKISREQISTLKAKSKEDG--NTIP--YSSYEMLSGHVW  264

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            RC C+AR  +  Q T L  + D R R+ P LP  YFGN +        +G++ S+P    
Sbjct  265  RCVCQARGLENDQGTKLYIATDGRSRLNPTLPPGYFGNVIFTTTPVAQAGDLASKPTWYA  324

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            AS+I DA+  + +EY+  A+D+   + D+
Sbjct  325  ASRIHDALARMDNEYLRSALDYLELQPDL  353



>ref|XP_002324530.2| hypothetical protein POPTR_0018s11370g [Populus trichocarpa]
 gb|EEF03095.2| hypothetical protein POPTR_0018s11370g [Populus trichocarpa]
Length=440

 Score =   176 bits (446),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 100/274 (36%), Positives = 142/274 (52%), Gaps = 19/274 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + +EAE+D+ + D  DF P  EL  L+P+VDYS   I   PL V Q+T+F CGG+ LG  
Sbjct  92   LFIEAETDSAMGDFVDFKPSDELRQLIPTVDYSD--ISSYPLLVLQVTRFTCGGVCLGVG  149

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
              H +ADG    HF++ W+++A G P+ + PF DR  +LRG       +  P   F H  
Sbjct  150  WHHTLADGTECLHFINTWSDIARGLPVKTPPFIDRT-ILRG-------RVPPNPTFHHIE  201

Query  465  ----PLIVG--QSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEV  304
                P I    Q+       K+  V+ L++    ++ LKA A N     A    Y+ + +
Sbjct  202  YDPFPTINTHFQNPIPESGSKDISVANLKIPSDLLNTLKAMAKNDI---ASKTEYSTYVI  258

Query  303  ITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIIS  124
            +TAHIWRCACKAR     Q T +  S D R R  PP+P  YFGN +       +SG ++S
Sbjct  259  LTAHIWRCACKARGLSNDQATKINISTDGRNRFRPPIPPGYFGNVIFQATPIALSGALLS  318

Query  123  RPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  22
             PL   A +I  AI  +  EY+  A+D+     D
Sbjct  319  EPLAHTAERIHKAIKRMDDEYLRSAVDYLERVDD  352



>gb|ABK79690.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. altilis]
Length=434

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 100/276 (36%), Positives = 150/276 (54%), Gaps = 22/276 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+D  + D G+ +P PEL  L P+VDYS D +   PL + Q+T+F CGG+SLG  
Sbjct  92   LFVEAEADCSIDDFGETTPSPELRKLAPTVDYS-DQVSSYPLCITQVTRFNCGGVSLGCG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H ++DG    HF++ W++ A G  ++  PF DR  LLR        +  P  +F+H  
Sbjct  151  LHHTLSDGLSSLHFINTWSDKARGLSVAIPPFIDRS-LLRA-------RDPPTAMFEHLE  202

Query  471  --SPPLIVGQSSDE--SERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFE  307
              SPP ++  S ++  +   K    + LRL+  QI+ LK+ A  +G  Y      ++ +E
Sbjct  203  YHSPPSLIAPSQNQNFTSHPKLASTAMLRLTLDQINGLKSKAKGDGSVY------HSTYE  256

Query  306  VITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEII  127
            ++ AH+WRCAC+AR     QPT L  + D R R+ PPLP  Y GN V        SGE  
Sbjct  257  ILAAHLWRCACEARGLSDDQPTKLYVATDGRSRLNPPLPPGYLGNVVFKATPIAKSGEFK  316

Query  126  SRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            S  L D A +I   +  +  +Y+  AID+   + D+
Sbjct  317  SESLADTARRIHSELAKMGDQYLRSAIDYLELQPDL  352



>ref|NP_001280198.1| shikimate O-hydroxycinnamoyltransferase-like [Prunus mume]
 dbj|BAE48668.1| Alcohol acyl-transferase [Prunus mume]
Length=438

 Score =   176 bits (445),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 100/274 (36%), Positives = 147/274 (54%), Gaps = 19/274 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ +V+ D GDF+P  EL  L+P+VDYS   I    L V Q+T F+CGG+SLG  
Sbjct  97   LFVEAETSSVIDDFGDFAPTLELRRLIPAVDYSAG-ISSYALLVLQVTYFKCGGVSLGVG  155

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H  ADG    HF++ W+++A G  L+  PF DR  LLR        +  P+  F H  
Sbjct  156  MQHHAADGFSGLHFVNTWSDMARGLDLTLPPFIDRT-LLRA-------RDPPQPAFHHIE  207

Query  471  ---SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVI  301
               +PPL     S +      T VS  RL++ Q++ LKA +            Y+ +E++
Sbjct  208  YQPAPPLKTPLQSTKPG-ADSTTVSIFRLTREQLNILKAKSKEA----GNTISYSSYEMM  262

Query  300  TAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISR  121
              HIWRC CKAR     Q T L  + D R R++PPLP  YFGN +       V+G++ S+
Sbjct  263  AGHIWRCVCKARELPNDQDTKLYIATDGRSRLQPPLPPGYFGNVIFTATPIAVAGDLQSK  322

Query  120  PLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            P    AS+I D++  +   Y+  A+D+   + D+
Sbjct  323  PTWFAASRIHDSLVRMDDNYLRSALDYLELQPDL  356



>ref|XP_010244683.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/269 (36%), Positives = 145/269 (54%), Gaps = 11/269 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +LVEAE+ + + D GDFS   EL  L+P VDYS   I   PL + Q+T+FRCGG+SLG A
Sbjct  93   LLVEAETGSTIDDFGDFSATQELRQLIPVVDYSQH-ISSYPLLLLQVTRFRCGGVSLGVA  151

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H + DG  + HF++ W+ L  G  L      DR +L      +  P        ++ P
Sbjct  152  MHHSLVDGASIIHFINSWSELTRGLQLKIPSSLDRSQL-----HARHPPTPAFHHIEYLP  206

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P  +   + +S       V+ L+++  QI+ALKA A      ++    Y+ +EV+  H+W
Sbjct  207  PPSMKTPTSQSGP-THVAVAKLKITVDQINALKAKAEE----DSNTLNYSSYEVLVGHVW  261

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            RC CKAR     Q T L  +VD+R R+ PPLP  YFGN  +     GV+G++ S+PL   
Sbjct  262  RCVCKARGLCDDQDTKLYMAVDLRSRLRPPLPQGYFGNGTLVTSPIGVAGDLRSKPLAYA  321

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
              +I D +  +  EY+  AID+   + D+
Sbjct  322  VGRIHDQLMRMNDEYLRSAIDYLELQPDL  350



>gb|AFF57839.1| hydroxycinnamoyl-coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
1 [Pyrus x bretschneideri]
Length=441

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 105/275 (38%), Positives = 151/275 (55%), Gaps = 20/275 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + V AE+  VL D GDF+P PE   L+P VDYS   I   PL V Q+T F+CGG+SLG  
Sbjct  99   LFVVAETAFVLEDFGDFAPTPEFRKLIPVVDYSAG-ISTYPLLVVQVTYFKCGGVSLGVG  157

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  L+  PF DR  LLR        +  P+  FDH  
Sbjct  158  LEHRVADGCSGLHFVNTWSDIARGLDLTIPPFIDRA-LLRA-------RDPPQTTFDHVE  209

Query  471  ---SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANN-GRSYNAKPRGYTRFEV  304
                PP      S +    + T+VS  RL++ Q+  LKA +   G S N     Y+ +E+
Sbjct  210  YQPDPPSKTPPPSTKDGDAESTRVSIFRLTRKQLSVLKAKSKEEGNSIN-----YSTYEM  264

Query  303  ITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIIS  124
            +  H+WRCA KAR+    Q T L  +VD R R++PPLP  +FGN V     F  +G++ S
Sbjct  265  LAGHVWRCATKARNLPDDQVTKLHVAVDGRSRLQPPLPPGFFGNVVFAGAPFATAGDLKS  324

Query  123  RPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            +P    A +I D +  + ++Y+  A+DF   + D+
Sbjct  325  KPTWYAAGRIHDVVVRMNNDYLRSALDFLEVQPDL  359



>ref|XP_010063586.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063587.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063588.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063589.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70830.1| hypothetical protein EUGRSUZ_F03974 [Eucalyptus grandis]
Length=445

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/275 (37%), Positives = 151/275 (55%), Gaps = 21/275 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+ +V+ DLGDF+   EL  L+P+V+YS   I   P+ V Q+T F+CG +SLG  
Sbjct  99   LFVEAETSSVVDDLGDFATL-ELRKLIPAVNYSSG-ISSDPVLVLQVTYFKCGAVSLGVG  156

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
              H V DG    HFL+ W++LA G  +   PF DR  LLR    + SP   PR  F H  
Sbjct  157  TQHHVTDGFSGLHFLNTWSDLARGLDVKLPPFIDRT-LLR----ARSP---PRPQFPHIE  208

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAA--NNGRSYNAKPRGYTRFEV  304
              SPP +       +     + VS L++++ Q+ ALK  A   NG +       YT +E+
Sbjct  209  YQSPPALRVSPETTNSAPDSSTVSILKVTREQLDALKTQAVLENGNTTR-----YTSYEI  263

Query  303  ITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIIS  124
            +  H+WRCAC+AR     Q T L  + D R R+ PPLP  YFGN +  +    V+G++IS
Sbjct  264  LAGHVWRCACRARGLSDDQDTKLFIATDGRMRLSPPLPQGYFGNGIFTITPIAVAGDLIS  323

Query  123  RPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            +P+   A KI +++     +Y+  A+D+   + D+
Sbjct  324  KPVSYAAQKIHESLARTNDDYLRSALDYLELQPDL  358



>gb|ADB44897.1| hydroxycinnamoyl transferase [Sinopodophyllum hexandrum]
Length=438

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/272 (38%), Positives = 149/272 (55%), Gaps = 23/272 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            +LVEAE++  L DLGDF P  EL  L+P VD   D I   PL + Q+T F+CGG+S+G  
Sbjct  91   LLVEAETETSLDDLGDFRPTTELRQLIPRVDNPMD-ISPYPLLLLQVTYFKCGGVSVGVG  149

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS-  469
            + H   DG    HF++ W+ +A G  ++  PF DR  LLR    S  P   P  +F HS 
Sbjct  150  MEHTATDGASGTHFINSWSEIARGLDITIPPFIDRT-LLR----SRDP---PTPLFPHSE  201

Query  468  ---PPLI---VGQSSDESE---RMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYT  316
               PP +   +G  + ES+   +   + V+  +LS+ QI  LKA   +G    +    ++
Sbjct  202  HDPPPTMKAALGNGTLESKVHPKPSPSVVTMFKLSRDQISVLKAKCKDGPDIVS----FS  257

Query  315  RFEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSG  136
             FEVI  HIWRC CKAR     Q + +  +VD R R+ P LP  YFGNA+ ++     SG
Sbjct  258  SFEVIAGHIWRCICKARQLPDDQESKVSIAVDGRSRLNPKLPPGYFGNAIFHITPMAASG  317

Query  135  EIISRPLQDVASKIRDAIDGVTSEYVNCAIDF  40
            +I+S+PL     K+ +++     EY+  AIDF
Sbjct  318  DILSKPLIYAVGKLHESLQRANDEYLRSAIDF  349



>ref|XP_004507046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Cicer arietinum]
Length=436

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 155/277 (56%), Gaps = 22/277 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + +EA++  V+ D GDF+P  +L  L+P+VDYS   I+  PL V Q+T F+CGG+SLG  
Sbjct  92   LFIEADTGVVIDDFGDFAPTLKLRQLIPAVDYSQG-IETYPLLVLQVTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  +S  PF DR  LLR        +  PR VF+H  
Sbjct  151  MQHHVADGASGLHFINTWSDVARGLDVSIPPFIDRT-LLRA-------RDPPRPVFEHIE  202

Query  471  -SPPLIVGQSSDESERMKETK----VSTLRLSKPQIHALKAAANN-GRSYNAKPRGYTRF  310
              PP  +  S        +++    VS  +L++ Q+  LKA +   G + N     Y+ +
Sbjct  203  YKPPPSMKTSPHNQPTKADSEATAAVSIFKLTREQLVTLKAKSKEAGNTIN-----YSSY  257

Query  309  EVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEI  130
            E++  H+WR  CKARS    Q T L  + D R R++PP P  YFGN +       ++G++
Sbjct  258  EMLAGHVWRSVCKARSLPDDQETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDL  317

Query  129  ISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            +S+P    AS+I +A+  + +EY+  A+D+   + D+
Sbjct  318  MSKPTWYAASRIHNALSRMDNEYLRSALDYLELQPDL  354



>ref|XP_009760608.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
 ref|XP_009760609.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=432

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/274 (36%), Positives = 155/274 (57%), Gaps = 21/274 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD ++ D GDF+P  +L  L+P+VDYS   I    L V Q+T F+CGG+SLG  
Sbjct  93   LFVEAESDGIVDDFGDFAPTLKLRRLIPAVDYSQG-IHSYALLVLQITHFKCGGVSLGVG  151

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H  ADG    HF++ W+++A G  L+  PF +R  LLR        +  P   F H  
Sbjct  152  MQHHAADGFSGLHFINTWSDMARGLDLTIPPFINRT-LLRA-------RDPPLPQFPHIE  203

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEVI  301
               PP +  ++  ++E + ET VS  +L++ QI+ALKA +  +G + N     Y+ +E++
Sbjct  204  YQPPPTL--KNIAKTEAVPETAVSIFKLTRDQINALKAKSKEDGNTVN-----YSSYEML  256

Query  300  TAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISR  121
              H+WR  C AR  +  Q + L  + D R R+ P LP  YFGN +       V+G++ S+
Sbjct  257  AGHVWRSTCMARGLEEDQGSKLYIATDGRSRLRPILPPGYFGNVIFTATPIAVAGDLKSK  316

Query  120  PLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            P+   ASKI DA+  + ++Y+  A+D+   + D+
Sbjct  317  PIWYAASKIHDALAQMDNDYLRSALDYLELQPDL  350



>ref|XP_004507045.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Cicer arietinum]
Length=449

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 155/277 (56%), Gaps = 22/277 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + +EA++  V+ D GDF+P  +L  L+P+VDYS   I+  PL V Q+T F+CGG+SLG  
Sbjct  105  LFIEADTGVVIDDFGDFAPTLKLRQLIPAVDYSQG-IETYPLLVLQVTYFKCGGVSLGVG  163

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  +S  PF DR  LLR        +  PR VF+H  
Sbjct  164  MQHHVADGASGLHFINTWSDVARGLDVSIPPFIDRT-LLRA-------RDPPRPVFEHIE  215

Query  471  -SPPLIVGQSSDESERMKETK----VSTLRLSKPQIHALKAAANN-GRSYNAKPRGYTRF  310
              PP  +  S        +++    VS  +L++ Q+  LKA +   G + N     Y+ +
Sbjct  216  YKPPPSMKTSPHNQPTKADSEATAAVSIFKLTREQLVTLKAKSKEAGNTIN-----YSSY  270

Query  309  EVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEI  130
            E++  H+WR  CKARS    Q T L  + D R R++PP P  YFGN +       ++G++
Sbjct  271  EMLAGHVWRSVCKARSLPDDQETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDL  330

Query  129  ISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            +S+P    AS+I +A+  + +EY+  A+D+   + D+
Sbjct  331  MSKPTWYAASRIHNALSRMDNEYLRSALDYLELQPDL  367



>gb|ACJ23164.1| hydroxycinnamoyl CoA quinate transferase 2 [Cynara cardunculus 
var. scolymus]
Length=443

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/270 (36%), Positives = 146/270 (54%), Gaps = 11/270 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD+ L D G+  P PE   L PSVDYSGD I   PLF  Q+T F+CGG++LG  
Sbjct  102  LFVEAESDSTLDDFGELKPSPEFRQLTPSVDYSGD-ISSYPLFFAQVTHFKCGGVALGCG  160

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H ++DG    HF++ W+++A G  ++  PF +R  LLR       P      V  HSP
Sbjct  161  VHHTLSDGLSSLHFINTWSDMARGLSVAIPPFIERT-LLRA---REPPTPTYDHVEYHSP  216

Query  465  PLIVGQSSDE-SERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            P +   +    S  + ++  + L+L+  Q+++LKA A +          ++ +E++ AHI
Sbjct  217  PSMNTTAQKPGSGSLSKSSTTMLKLTLDQLNSLKAKAKSESG-----STHSTYEILAAHI  271

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCACKAR     Q + L  + D R R+ P LP  Y GN V        SG++ S+ L +
Sbjct  272  WRCACKARGLPDDQLSKLYVATDGRSRLSPRLPPGYLGNVVFTATPVAKSGDLTSKSLSN  331

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             A  I   +  +  +Y+  AID+  ++ D+
Sbjct  332  TAKLIHTTLTKMDDDYLRSAIDYLESQPDL  361



>gb|AFF19203.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Erythroxylum 
coca]
Length=433

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/275 (36%), Positives = 140/275 (51%), Gaps = 19/275 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAES  V+ D GDF+P  E+  LVP VDYS D I   PL + QLT FRCGG+ LG  
Sbjct  90   LFVEAESSRVMDDFGDFTPSFEMLELVPEVDYS-DHISSFPLLILQLTSFRCGGVCLGVG  148

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS-  469
              H +ADG    HF++ W+++  G  +   PF DR  L  G          P   F H+ 
Sbjct  149  WHHTLADGCSAMHFINSWSDVTRGLSVHIPPFIDRTPLAAG--------NPPTPTFHHAE  200

Query  468  ---PPLI--VGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEV  304
               PP I  + Q+       K      L+L+  QI+ LKA +            Y+ +E 
Sbjct  201  YDPPPSINTLDQNGKYQSSEKPACTKILKLTLDQINTLKATSKQQDGATK----YSTYET  256

Query  303  ITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIIS  124
            + AHIWRC C AR     QPT L  + D R R+ PPLP  YFGN +    +  +SG+I +
Sbjct  257  LAAHIWRCMCMARELDADQPTRLYIATDGRSRLRPPLPSGYFGNVIFTTTVTSLSGDIKT  316

Query  123  RPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
              L     ++R+++  + +EY+  A+D  + + D+
Sbjct  317  ETLVQTIKRLRESLKRMDNEYLRSALDHLQVQPDL  351



>ref|XP_006465544.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Citrus sinensis]
Length=437

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/271 (37%), Positives = 143/271 (53%), Gaps = 10/271 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + +EAE+  V+ DLGDF     L  LVP+VD + D I   PL V Q+T F+CGG SLG  
Sbjct  94   LFMEAETTCVIDDLGDFESNTILLKLVPNVDSTKD-ISSCPLLVTQVTHFKCGGASLGIG  152

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H +AD   + HF++ WA +  G  +S+ PF DR  L  GV     P        +H P
Sbjct  153  VYHTLADATSVFHFINAWAEMTHGISISNFPFIDRTVLEIGV-----PTCAKFHHIEHDP  207

Query  465  PLIVGQSS-DESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            P  +  +  D++ R   T +  L +S  QI+ LKA +            +TRFE++ AHI
Sbjct  208  PPSINNAPIDQNPRPISTAI--LNMSVDQINTLKAKSKENYG-PTNTINFTRFEILAAHI  264

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRC CKAR     Q + L F ++ R R+ PPLP  YFGN +       +SG+IIS PL  
Sbjct  265  WRCLCKARGLSNDQVSKLYFPINGRSRLNPPLPSGYFGNVIFPGTSLALSGDIISEPLSS  324

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  16
               +I  A+  +  EY+  A+ + +   DV+
Sbjct  325  TCERIHKALMRMDDEYLKSALAYLKQLPDVM  355



>gb|KDP41953.1| hypothetical protein JCGZ_26971 [Jatropha curcas]
Length=431

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/268 (37%), Positives = 146/268 (54%), Gaps = 11/268 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + V AE+ +V+ D GDF+P  EL  L+P+VDYSG  I   PL V QLT F+CGG+SLG  
Sbjct  92   LFVVAETSSVIDDFGDFAPTLELKKLIPTVDYSGG-ISTYPLLVLQLTYFKCGGVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H VADG    HF++ W+++  G  L+  PF DR  LLR       PQ     + ++ P
Sbjct  151  MQHHVADGFSGLHFVNTWSDMTRGLDLTIPPFIDRT-LLRA---RDPPQPAFHHI-EYQP  205

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P  +    D S +   T VS  +L++ Q++ LK  A      +     Y+ +E++  H+W
Sbjct  206  PPAMKTPVDNS-KPDSTTVSIFKLTRDQLNILKTKAKE----DGNTVSYSSYEMLAGHVW  260

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            R A KAR     Q T L  + D R R++PPLP  YFGN +        +GE+ S+P    
Sbjct  261  RSASKARGLVGDQETKLYIATDGRSRLQPPLPPGYFGNVIFTATPIAQAGEMQSKPTWFA  320

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGD  22
            A KI DA+  + ++Y+  A+D+   + D
Sbjct  321  ARKIHDALVRMDNDYLRSALDYLELQPD  348



>ref|XP_011018045.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018047.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
Length=430

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/272 (37%), Positives = 149/272 (55%), Gaps = 18/272 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+     DLGDF+   +L  LVP VDY+G  I   PL V Q+T+F+CG +SLG  
Sbjct  92   LFVEAETSCFADDLGDFTDSSKLLPLVPEVDYAGG-ISSFPLVVLQVTRFKCGAVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS-  469
            + H++ADG    HF++ W+++A G P+S+ PF DR  LLR        +  P   F HS 
Sbjct  151  LHHILADGTSALHFINSWSDVARGLPVSTPPFIDRT-LLRA-------RDPPHPTFHHSE  202

Query  468  --PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PP  +        +   TK+  L+++  Q+ +LKA     R+ +   R ++ +E ITA
Sbjct  203  YDPPPTMNTPPRSQPKTTCTKI--LKITPEQLGSLKAKV---RTEDGAAR-HSTYETITA  256

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            HIWR  CKAR     Q + L  S D R R+ P LP  Y GN +    + G+SGEI S+PL
Sbjct  257  HIWRSMCKARGLSDDQASKLYISTDGRSRLNPQLPPGYLGNVLFTTTVMGLSGEIQSKPL  316

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
                 +I +A+  +  EY+  A+D+   + D+
Sbjct  317  VRTMERIHEALGRMDDEYLRSALDYIEAQPDL  348



>ref|XP_002324534.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
 gb|EEF03099.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
Length=430

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/272 (37%), Positives = 148/272 (54%), Gaps = 18/272 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+   + DLGDF+   +L  LVP VDYSG  I   PL V Q+T F+CG +SLG  
Sbjct  92   LFVEAETSCFIDDLGDFTDSSKLLPLVPEVDYSGG-ISSFPLVVLQVTHFKCGAVSLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H++ADG    HF++ W+++A G P+S+ PF DR  LLR        +  P   F H  
Sbjct  151  LHHILADGTSALHFINSWSDVARGLPVSTPPFIDRT-LLRA-------RDPPNPTFHHVE  202

Query  471  -SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PP  +        +   TK+  L+++  Q+ +LKA     R+ +   R ++ +E ITA
Sbjct  203  YDPPPTMNTPPQSQPKTTCTKI--LKITPEQLGSLKAKV---RTEDGAVR-HSTYETITA  256

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            HIWR  CKAR     Q + L  S D R R+ P LP  Y GN +    + G+SGEI S+PL
Sbjct  257  HIWRSMCKARGLSDDQASKLYISTDGRSRLNPQLPPGYLGNVLFTTTVMGLSGEIQSKPL  316

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
                 +I +A+  +  EY+  A+D+   + D+
Sbjct  317  ARTMERIHEALVRMDDEYLRSALDYIEAQPDL  348



>ref|XP_011018044.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Populus euphratica]
Length=438

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 101/272 (37%), Positives = 149/272 (55%), Gaps = 18/272 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+     DLGDF+   +L  LVP VDY+G  I   PL V Q+T+F+CG +SLG  
Sbjct  100  LFVEAETSCFADDLGDFTDSSKLLPLVPEVDYAGG-ISSFPLVVLQVTRFKCGAVSLGVG  158

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS-  469
            + H++ADG    HF++ W+++A G P+S+ PF DR  LLR        +  P   F HS 
Sbjct  159  LHHILADGTSALHFINSWSDVARGLPVSTPPFIDRT-LLRA-------RDPPHPTFHHSE  210

Query  468  --PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
              PP  +        +   TK+  L+++  Q+ +LKA     R+ +   R ++ +E ITA
Sbjct  211  YDPPPTMNTPPRSQPKTTCTKI--LKITPEQLGSLKAKV---RTEDGAAR-HSTYETITA  264

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            HIWR  CKAR     Q + L  S D R R+ P LP  Y GN +    + G+SGEI S+PL
Sbjct  265  HIWRSMCKARGLSDDQASKLYISTDGRSRLNPQLPPGYLGNVLFTTTVMGLSGEIQSKPL  324

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
                 +I +A+  +  EY+  A+D+   + D+
Sbjct  325  VRTMERIHEALGRMDDEYLRSALDYIEAQPDL  356



>gb|AGV54440.1| shikimate O-hydroxycinnamoyltransferase [Phaseolus vulgaris]
Length=433

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 97/273 (36%), Positives = 150/273 (55%), Gaps = 17/273 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEA++ AV+ D GDF+P  EL  L+P+VDYS   I+  PL V Q+T F+CGG SLG  
Sbjct  92   LFVEADTGAVIDDFGDFAPTLELRQLIPAVDYSQG-IETYPLLVLQVTHFKCGGASLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  +S  PF DR  +LR        +  PR +FDH  
Sbjct  151  MQHHVADGASGLHFINTWSDVARGLDVSIPPFIDRT-ILRA-------RDPPRPLFDHIE  202

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
               PP +  Q    +       VS  +L++ Q+  LKA +      +     Y+ +E++ 
Sbjct  203  YKPPPPMNTQQHPTNSHTVPADVSIFKLTRDQLCTLKAKSKE----DGNTISYSSYEMLA  258

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             H+WR  CKAR+    Q T L  + D R R++P  P  YFGN +       V+G+++S+P
Sbjct  259  GHVWRSVCKARALPHDQETKLYIATDGRSRLQPSPPPGYFGNVIFTTTPIAVAGDLMSKP  318

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
                AS+I +A+  + +EY+  A+D+   + D+
Sbjct  319  TWYAASRIHNALLRMDNEYLRSALDYLELQPDL  351



>emb|CAR92145.1| hydroxycinnamoyl CoA quinate transferase 2 [Cynara cardunculus 
var. scolymus]
Length=443

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/270 (36%), Positives = 146/270 (54%), Gaps = 11/270 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD+ L D G+  P PE   L PSVDYSGD I   PLF  Q+T F+CGG++LG  
Sbjct  102  LFVEAESDSTLDDFGELKPSPEFRQLTPSVDYSGD-ISSYPLFFAQVTHFKCGGVALGCG  160

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H ++DG    HF++ W+++A G  ++  PF +R  LLR       P      V  HSP
Sbjct  161  VHHTLSDGLSSLHFINTWSDMARGLSVAIPPFIERT-LLRA---REPPTPTYDHVEYHSP  216

Query  465  PLIVGQSSDE-SERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            P +   +    S  + ++  + L+L+  Q+++LKA A +          ++ +E++ AHI
Sbjct  217  PSMNTTAQKPGSGSLSKSSTTMLKLTLDQLNSLKAKAKSESG-----STHSTYEILAAHI  271

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCACKAR     Q + L  + D R R+ P LP  Y GN V        SG++ S+ L +
Sbjct  272  WRCACKARGLPDDQLSKLYVATDGRSRLSPRLPPGYVGNVVFTATPVAKSGDLTSKSLSN  331

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             A  I   +  +  +Y+  AID+  ++ D+
Sbjct  332  TAKLIHTTLTKMDDDYLRSAIDYLESQPDL  361



>ref|XP_007135841.1| hypothetical protein PHAVU_010G162700g [Phaseolus vulgaris]
 gb|ESW07835.1| hypothetical protein PHAVU_010G162700g [Phaseolus vulgaris]
Length=433

 Score =   173 bits (439),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 97/273 (36%), Positives = 150/273 (55%), Gaps = 17/273 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEA++ AV+ D GDF+P  EL  L+P+VDYS   I+  PL V Q+T F+CGG SLG  
Sbjct  92   LFVEADTGAVVDDFGDFAPTLELRQLIPAVDYSQG-IETYPLLVLQVTHFKCGGASLGVG  150

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  +S  PF DR  +LR        +  PR +FDH  
Sbjct  151  MQHHVADGASGLHFINTWSDVARGLDVSIPPFIDRT-ILRA-------RDPPRPLFDHIE  202

Query  471  --SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
               PP +  Q    +       VS  +L++ Q+  LKA +      +     Y+ +E++ 
Sbjct  203  YKPPPPMNTQQHPTNSHTVPADVSIFKLTRDQLCTLKAKSKE----DGNTISYSSYEMLA  258

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             H+WR  CKAR+    Q T L  + D R R++P  P  YFGN +       V+G+++S+P
Sbjct  259  GHVWRSVCKARALPHDQETKLYIATDGRSRLQPSPPPGYFGNVIFTTTPIAVAGDLMSKP  318

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
                AS+I +A+  + +EY+  A+D+   + D+
Sbjct  319  TWYAASRIHNALLRMDNEYLRSALDYLELQPDL  351



>ref|XP_007027321.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY07823.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=437

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 104/277 (38%), Positives = 150/277 (54%), Gaps = 13/277 (5%)
 Frame = -2

Query  825  VLVEAESDAVLADL-GDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGF  649
            +  EAES +++ DL  DF+   ++  LVP +DYSG  I   PL   Q+T F+CGGISLG 
Sbjct  92   LFTEAESSSIMDDLVQDFTDGSKVPQLVPKIDYSGG-ISSYPLLGLQVTTFKCGGISLGV  150

Query  648  AISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRV-FDH  472
            A+ H + DG    HF++ WAN   G   S +PF DR  LLR     + P      V F+ 
Sbjct  151  AVQHTLLDGSSGLHFINSWANTVGGLSPSISPFLDRT-LLRA---RNPPTPKFHHVEFEP  206

Query  471  SPPLIVGQSSDESERM-KETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITA  295
            SP L    S+ ES++  K + VS  +++  Q++ LKA  N   + N K   Y+ + ++TA
Sbjct  207  SPSLQTMFSTSESQQSPKPSIVSVFKITTDQLNTLKAKVNESSNSNTK---YSTYSILTA  263

Query  294  HIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPL  115
            HIWRCA KAR     Q   L   VD R R+ PPLP  YFGN ++   +  +SG+++S   
Sbjct  264  HIWRCATKARDLLEDQQLKLTMPVDGRNRLHPPLPPGYFGNVIVMAALVALSGDLLSESF  323

Query  114  QDVASKIRDAIDGVTSEYVNCAIDFYRNEGD--VIKR  10
             D   +I   +  +  EY+  +ID+     D  VI+R
Sbjct  324  IDTVKRIHKILKEMDDEYLRSSIDYIEKAPDINVIRR  360



>ref|XP_006474019.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Citrus 
sinensis]
Length=443

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 98/275 (36%), Positives = 146/275 (53%), Gaps = 16/275 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+  V+ D GDF+   +L  L+P+ D + D     PL + Q+T+F+CGG+ L   
Sbjct  94   LFVEAETSCVIDDFGDFAEGSKLLPLLPTFDDTKDN-SSYPLMMTQVTRFKCGGVCLATR  152

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPR-RVFDHS  469
              H++ADG    HF++ WA +  G P+S  PF DR  L  GV  S      PR    ++ 
Sbjct  153  FHHILADGASTYHFVNSWAEMTRGVPISIPPFFDRTVLDFGVPNS------PRFHHIEYD  206

Query  468  PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            PP  +   +  SE +  T +  L L + +I   K+  N G ++      YTR EV+ AHI
Sbjct  207  PPPSMNTPTQNSESIC-TAILNLSLEQIKILKEKSKENRGSTFE-----YTRLEVLAAHI  260

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRC CKAR     Q + L F  + R ++ PPLP  YFGN V    +  +SG I+S PL  
Sbjct  261  WRCVCKARELSDDQASKLHFPTNGRSKLNPPLPSGYFGNVVFTTALIALSGNILSEPLNY  320

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGD--VIKR  10
               +I  A++ +  EY+  A+ + R + D  V++R
Sbjct  321  TVERIHRALERMNDEYLKSALAYLRQQPDPTVLRR  355



>ref|XP_006343633.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Solanum tuberosum]
Length=435

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 141/269 (52%), Gaps = 14/269 (5%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD+ + D GDF+PC EL  L+PSV+ SGD I   PL + Q+T+F+CGGI+LG  
Sbjct  98   LFVEAESDSCIDDFGDFTPCLELKKLIPSVETSGD-ISTFPLAIFQVTRFKCGGIALGGG  156

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H ++DG    HF++ W+++A G  ++  PF DR  L         P      V  H P
Sbjct  157  VFHTLSDGLSSLHFINTWSDIARGLSVAVPPFIDRTLL----HARDPPTSSFEHVEYHPP  212

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P ++     ES   K +  + L+ S  Q+  LK+ + N  S          +E++ AHIW
Sbjct  213  PTLISSKKGESTGPKSSTTAMLKFSSEQVGLLKSKSENEGS---------TYEILAAHIW  263

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            RC  KAR     Q T L  + D R R+ PPLP  Y GN V        S E+ S PL++ 
Sbjct  264  RCTSKARGLADDQLTKLHVATDGRSRLCPPLPPGYLGNVVFTATPIAKSCELQSEPLRNS  323

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
              +I + +  +   Y+  A+D+   + D+
Sbjct  324  VKRIHNELIKMDDNYLRSALDYLELQPDL  352



>ref|XP_008228811.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=440

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 101/278 (36%), Positives = 153/278 (55%), Gaps = 27/278 (10%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + + AE+ + + D GDF+P  E   L+P+VDYS   I   PL V Q+T F+CGG+SLG  
Sbjct  101  LFIVAETSSTIEDFGDFAPTLEFRKLIPAVDYSAG-ISTYPLLVLQVTYFKCGGVSLGVG  159

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  L+  PF DR  LLR        +  P+  FDH  
Sbjct  160  LEHRVADGLSGLHFVNTWSDIARGLDLTIPPFIDRT-LLRA-------RDPPQPAFDHIE  211

Query  471  ---SPPLIVGQSS--DESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRF  310
                PP+  G  +  DES       VS  RL++ Q++ LKA +  +G + N     YT +
Sbjct  212  YQPDPPIKTGTKAVGDES-----ATVSIFRLTREQLNILKAKSKEDGNTIN-----YTTY  261

Query  309  EVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEI  130
            E++  H+WRCA  AR     Q T L  +VD R R++PPLP  +FGN V        +G++
Sbjct  262  EMLAGHVWRCASVARELPDDQETKLHIAVDGRSRLQPPLPPGFFGNVVFAGAPIAAAGDL  321

Query  129  ISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  16
             S+P    AS+I D +  + ++Y+  A+D+   + D++
Sbjct  322  KSKPTWYAASRIHDTVVRMDNDYLRSALDYLELQPDLL  359



>ref|XP_003532111.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=476

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 104/282 (37%), Positives = 152/282 (54%), Gaps = 22/282 (8%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNH-LVPSVDYSGDPIQDIPLFVGQLTKFRCG-----G  664
             L+EAE+   + D GDF+P   +   LVP +DY   PI++IPL   Q+T+F+       G
Sbjct  91   TLIEAETVKTIDDFGDFTPSESVKEELVPVIDYHSQPIEEIPLVFVQVTRFKGDKEQQQG  150

Query  663  ISLGFAISHVVADGHGLCHFLSEWANLASGKPL--SSAPFHDRRRLLRGVGESSSPQGGP  490
            +++  A+SH VADG    HF++ WA +  G  L  +  PF DR  +L+     SS    P
Sbjct  151  LAIAVAVSHPVADGSAWIHFINTWAKVNRGDMLGLNDMPFIDRT-ILKSSSSLSSLSPPP  209

Query  489  RRVFDHSP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKP--  328
               FDH      P I+G+S    E+ K+T  + L+L+  Q+  L+   N   + + K   
Sbjct  210  SPRFDHPELQPLPFILGRSDSTEEQKKKTTAAMLKLTSEQVEMLRKKVNENENLSTKQGS  269

Query  327  ------RGYTRFEVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAV  166
                  R  +RFE + AHIWRCACKAR     QPT + F+ D R R+  PLP +YFGNA+
Sbjct  270  RSRSRSRPCSRFEAVAAHIWRCACKARKLDRNQPTLVRFNADFRSRLTRPLPRNYFGNAL  329

Query  165  INVVI-FGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAID  43
               V     +GEI SRPL   A K+R+A++ +  EY+   ++
Sbjct  330  AATVTPESYAGEITSRPLSYAARKLREAVEMLKEEYITSQLE  371



>ref|XP_006474020.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Citrus 
sinensis]
Length=443

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 98/275 (36%), Positives = 146/275 (53%), Gaps = 16/275 (6%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAE+  V+ D GDF+   +L  L+P+ D + D     PL + Q+T+F+CGG+ L   
Sbjct  94   LFVEAETSCVIDDFGDFAEGSKLLPLLPTFDDTKDN-SSYPLMMTQVTRFKCGGVCLATR  152

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPR-RVFDHS  469
              H++ADG    HF++ WA +  G P+S  PF DR  L  GV  S      PR    ++ 
Sbjct  153  FHHILADGASTYHFVNSWAEMTRGVPISIPPFFDRTVLDFGVPNS------PRFHHIEYD  206

Query  468  PPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            PP  +   +  SE +  T +  L L + +I   K+  N G ++      YTR EV+ AHI
Sbjct  207  PPPSMNTPTQNSESIC-TAILNLSLEQIKILKEKSKENRGSTFE-----YTRLEVLAAHI  260

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRC CKAR     Q + L F  + R ++ PPLP  YFGN V    +  +SG I+S PL  
Sbjct  261  WRCVCKARELSDDQASKLHFPTNGRSKLNPPLPSGYFGNVVFTTALIALSGNILSEPLNY  320

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGD--VIKR  10
               +I  A++ +  EY+  A+ + R + D  V++R
Sbjct  321  TVERIHRALERMNDEYLKSALAYLRQQPDPTVLRR  355



>ref|NP_001275483.1| HQT [Solanum tuberosum]
 gb|ADF50082.1| HQT [Solanum tuberosum]
Length=433

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 141/269 (52%), Gaps = 14/269 (5%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD+ + D GDF+PC EL  L+PSV+ SGD I   PL + Q+T+F+CGGI+LG  
Sbjct  98   LFVEAESDSCIDDFGDFTPCLELKKLIPSVETSGD-ISTFPLAIFQVTRFKCGGIALGGG  156

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H ++DG    HF++ W+++A G  ++  PF DR  L         P      V  H P
Sbjct  157  VFHTLSDGLSSLHFINTWSDIARGLSVAVPPFIDRTLL----HARDPPTSSFEHVEYHPP  212

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P ++     ES   K +  + L+ S  Q+  LK+ + N  S          +E++ AHIW
Sbjct  213  PTLISSKKGESTGPKSSTTAMLKFSSEQVGLLKSKSENEGS---------TYEILAAHIW  263

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            RC  KAR     Q T L  + D R R+ PPLP  Y GN V        S E+ S PL++ 
Sbjct  264  RCTSKARGLADDQLTKLHVATDGRSRLCPPLPPGYLGNVVFTATPIAKSCELQSEPLRNS  323

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
              +I + +  +   Y+  A+D+   + D+
Sbjct  324  VKRIHNELIKMDDNYLRSALDYLELQPDL  352



>ref|XP_004163669.1| PREDICTED: Bloom syndrome protein homolog [Cucumis sativus]
Length=1050

 Score =   179 bits (453),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 104/293 (35%), Positives = 162/293 (55%), Gaps = 32/293 (11%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + +EA     L D GDF+P   +  L P VDY+   I+D+P+F+ Q+T+F CGG+ +G  
Sbjct  91   LFIEASYGGTLDDFGDFTPTDVVRKLAPEVDYNSS-IEDVPMFLVQVTRFSCGGLVIGLN  149

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSA---PFHDRRRLLRGVGESSSPQGGPRRVFD  475
            +SH + DG     F++ WA++A G   + +   P HDR  L     +   P   P+  F 
Sbjct  150  VSHTLVDGVSAIMFINSWASIARGDKTAKSILQPLHDRNVL-----QPQKPFCPPQ--FY  202

Query  474  HSP----PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNA---------  334
            H      P ++G S+ + ERMKETK + L+L++ Q+  L+  AN+    N          
Sbjct  203  HCEYDILPFVIGCSNSKEERMKETKSALLKLTREQVEKLRMRANSSTPTNQNIEKVVDVN  262

Query  333  ----KPRGYTRFEVITAHIWRCACKAR---SHKPQQPTTLCFSVDIRRRMEPPLPDSYFG  175
                +P  ++R+E+IT HIW CA KAR   + K +Q T +   V+IR+R+  P+P ++ G
Sbjct  263  EVLLQPCPHSRYELITGHIWVCASKARNIDNDKSKQSTVVQIVVNIRQRLRTPIPKNFCG  322

Query  174  N-AVINVVIFGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            N A+I++      GE++S+PL   A KIR+A   +T EYV  AIDF   + D+
Sbjct  323  NAALISITPQCEFGELMSQPLSYAAKKIREASWKMTDEYVKSAIDFLATQEDI  375



>ref|XP_009614241.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=434

 Score =   173 bits (438),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 100/275 (36%), Positives = 147/275 (53%), Gaps = 18/275 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNH-LVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGF  649
            + +EAE DA++ D GDF P  E+   L+P+VD SGD I   PL + Q+T+F+CGG+SLG 
Sbjct  94   LFIEAEIDAIIDDFGDFIPSLEIKKMLIPNVDTSGD-ISSFPLVIFQVTRFKCGGVSLGC  152

Query  648  AISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHS  469
             + H ++DG    HF++ W+ +  G  ++ +PF DR  L         P    + V  HS
Sbjct  153  GVFHTLSDGISSLHFINTWSEVVRGVSVAVSPFIDRSLL----HARDPPTPAYKHVEYHS  208

Query  468  PPLIVGQSSDESERMKETKVST---LRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVIT  298
            PP +   S +  +++   K ST    +++  Q+  LK          +K  G T +E++ 
Sbjct  209  PPALKSSSKNVHDQVNGPKSSTTTMFKITSDQLTLLKT--------KSKHEGST-YEILA  259

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
            AHIWRC CKAR     Q T L  + D R R+ PPLP  Y GN V        SGEI+S P
Sbjct  260  AHIWRCTCKARILDDDQLTKLHVATDGRSRLFPPLPPGYLGNVVFTATPIAKSGEILSEP  319

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  13
            L + A +I  A+  +  EY+  AID+   + D+ K
Sbjct  320  LMNTAQRIHSALARMDDEYLRSAIDYLELQTDLSK  354



>gb|ABA46756.1| hydroxycinnamoyl-CoA quinate-like protein [Solanum tuberosum]
Length=433

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 141/269 (52%), Gaps = 14/269 (5%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD+ + D GDF+PC EL  L+PSV+ SGD I   PL + Q+T+F+CGGI+LG  
Sbjct  98   LFVEAESDSCIDDFGDFTPCLELKKLIPSVETSGD-ISTFPLAIFQVTRFKCGGIALGGG  156

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H ++DG    HF++ W+++A G  ++  PF DR  L         P      V  H P
Sbjct  157  VFHTLSDGLSSLHFINTWSDIARGLSVAVPPFIDRTLL----HAREPPTSSFEHVEYHPP  212

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            P ++     ES   K +  + L+ S  Q+  LK+ + N  S          +E++ AHIW
Sbjct  213  PTLISSKKGESTGPKSSTTAMLKFSSEQVGLLKSKSENEGS---------TYEILAAHIW  263

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            RC  KAR     Q T L  + D R R+ PPLP  Y GN V        S E+ S PL++ 
Sbjct  264  RCTSKARGLADDQLTKLHVATDGRSRLCPPLPPGYLGNVVFTATPIAKSCELQSEPLRNS  323

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
              +I + +  +   Y+  A+D+   + D+
Sbjct  324  VKRIPNELIKMDDNYLRSALDYLELQPDL  352



>ref|XP_009626780.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=439

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/273 (36%), Positives = 152/273 (56%), Gaps = 19/273 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD  + D GDF+P  EL  L+P+VDY+   I    L V Q+T F+CGG+SLG  
Sbjct  100  LFVEAESDGTVDDFGDFAPTLELRRLIPAVDYT-QGIHSYALLVLQITHFKCGGVSLGVG  158

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H  ADG    HF++ W+++A G  L+   F DR  LLR        +  P   F H  
Sbjct  159  MQHHAADGFSGLHFINAWSDMARGIDLTIPTFIDRT-LLRA-------RDPPLPQFPHIE  210

Query  471  -SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEVIT  298
              PP  +   + ++E + ET VS  +L++ QI+ALKA +  +G + N     Y+ +E++ 
Sbjct  211  YQPPPTLNNIA-KTEAVPETDVSIFKLTRDQINALKAKSKEDGNTVN-----YSSYEMLA  264

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             H+WR  C AR  +  Q + L  + D R R+ P LP  YFGN +       V+G++ S+P
Sbjct  265  GHVWRSTCMARGLEEDQGSKLYIATDGRFRLRPTLPPGYFGNVIFTATPIAVAGDLKSKP  324

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            +   ASKI DA+  + ++Y+  A+D+   + D+
Sbjct  325  IWYAASKIHDALARMDNDYLRSALDYLELQPDL  357



>ref|XP_009626781.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=432

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/273 (36%), Positives = 152/273 (56%), Gaps = 19/273 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD  + D GDF+P  EL  L+P+VDY+   I    L V Q+T F+CGG+SLG  
Sbjct  93   LFVEAESDGTVDDFGDFAPTLELRRLIPAVDYT-QGIHSYALLVLQITHFKCGGVSLGVG  151

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H  ADG    HF++ W+++A G  L+   F DR  LLR        +  P   F H  
Sbjct  152  MQHHAADGFSGLHFINAWSDMARGIDLTIPTFIDRT-LLRA-------RDPPLPQFPHIE  203

Query  471  -SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEVIT  298
              PP  +   + ++E + ET VS  +L++ QI+ALKA +  +G + N     Y+ +E++ 
Sbjct  204  YQPPPTLNNIA-KTEAVPETDVSIFKLTRDQINALKAKSKEDGNTVN-----YSSYEMLA  257

Query  297  AHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRP  118
             H+WR  C AR  +  Q + L  + D R R+ P LP  YFGN +       V+G++ S+P
Sbjct  258  GHVWRSTCMARGLEEDQGSKLYIATDGRFRLRPTLPPGYFGNVIFTATPIAVAGDLKSKP  317

Query  117  LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            +   ASKI DA+  + ++Y+  A+D+   + D+
Sbjct  318  IWYAASKIHDALARMDNDYLRSALDYLELQPDL  350



>ref|XP_002529412.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF33008.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=404

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/269 (34%), Positives = 149/269 (55%), Gaps = 11/269 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + +EAE+D+ + DLGD     ++  L+P++D+S + I   PLFV Q T F CGG+SLG  
Sbjct  66   LFIEAETDSSMDDLGDVMVNLKIPQLIPTLDFS-NGISSFPLFVVQATTFTCGGVSLGIR  124

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
              HV+ADG    +F++ W ++A G  ++ +P  DR  L      S  P     +  +   
Sbjct  125  FHHVLADGSAALYFINTWCDVARGLSINVSPMIDRTIL-----RSQDPPNPKFQHLEFGK  179

Query  465  PLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHIW  286
            PL +  +S +++      +  L+ +  Q++ LK   N+  S + + + Y+ +E++TAHIW
Sbjct  180  PLTLNTNSTKNQ---TNSIEILKFTPDQLNTLKTKVNSN-SKDGRTK-YSSYEILTAHIW  234

Query  285  RCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQDV  106
            RC C+AR+    Q T L  SVD R R++P LP SYFGN         + G+++S PL   
Sbjct  235  RCTCRARNLADDQATKLYISVDGRSRLQPQLPHSYFGNVTFPTTSIALCGDLLSEPLMAT  294

Query  105  ASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            A +IR AI  +  EY+  A+D+ +   D+
Sbjct  295  AERIRKAIRRMDDEYLRSAVDYLQVLDDL  323



>ref|XP_008228810.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=440

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/278 (37%), Positives = 153/278 (55%), Gaps = 27/278 (10%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + V AE+ + + D GDF+P  E   L+P+VDYS   I   PL V Q+T F+CGG+SLG  
Sbjct  101  LFVVAETGSTIDDFGDFAPTLEFRKLIPAVDYSAG-ISTYPLLVLQVTYFKCGGVSLGVG  159

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  L+  PF DR  LLR        +  P+  FDH  
Sbjct  160  LEHRVADGLSGLHFVNTWSDIARGLDLTIPPFIDRT-LLRA-------RDPPQPAFDHIE  211

Query  471  ---SPPLIVGQSS--DESERMKETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRF  310
                PP+  G  S  DES       VS  RL++ Q++ LKA +  +G + N     YT +
Sbjct  212  YQPDPPIKTGTKSVGDES-----ATVSIFRLTREQLNILKAKSKEDGNTIN-----YTTY  261

Query  309  EVITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEI  130
            E++  H+WRCA  AR     Q T L  +VD R R++P LP  +FGN V        +G++
Sbjct  262  EMLAGHVWRCASVARELPDDQETKLHIAVDGRSRLQPQLPPGFFGNVVFAGAPIAAAGDL  321

Query  129  ISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  16
             S+P    AS+I DA+  + ++Y+  A+D+   + D++
Sbjct  322  KSKPTWYAASRIHDAVVRMDNDYLRSALDYLELQPDLL  359



>gb|ADL62854.1| hydroxycinnamoyl-CoA transferase 1 [Cynara cardunculus var. scolymus]
Length=443

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/270 (35%), Positives = 145/270 (54%), Gaps = 11/270 (4%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + VEAESD+ L D G+  P P    L PSVDYSGD I   PL   Q+T F+CGG++LG  
Sbjct  102  LFVEAESDSTLDDFGELKPSPVFRQLTPSVDYSGD-ISSYPLLFAQVTHFKCGGVALGCG  160

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
            + H ++DG  L HF++ W+++A G  ++  PF +R  LLR       P      V  HSP
Sbjct  161  VHHTLSDGLSLLHFINTWSDMARGLSVAIPPFIERT-LLRA---REPPTPTYDHVEYHSP  216

Query  465  PLIVGQSSDE-SERMKETKVSTLRLSKPQIHALKAAANNGRSYNAKPRGYTRFEVITAHI  289
            P +   +    S  + ++  + L+L+  Q+++LKA A +          ++ +E++ AHI
Sbjct  217  PSMNTTAQKPGSGSLSKSSTTMLKLTLDQLNSLKAKAKSESG-----STHSTYEILAAHI  271

Query  288  WRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQD  109
            WRCACKAR     Q + L  + D R R+ P LP  Y GN V        SG++ S+ L +
Sbjct  272  WRCACKARGLPDDQLSKLYVATDGRSRLSPRLPPGYLGNVVFTATPVAKSGDLTSKSLSN  331

Query  108  VASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
             A  I   +  +  +Y+  AID+  ++ D+
Sbjct  332  TAKLIHTTLTKMDDDYLRSAIDYLESQPDL  361



>ref|XP_007011895.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007011896.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29514.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29515.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
Length=449

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 144/271 (53%), Gaps = 9/271 (3%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + +E+E+ A L DLGDF+P  +L  LVP+VDYSGD I   PL + Q+T F+ GG+SLG A
Sbjct  93   LFIESETAATLDDLGDFAPSSKLRQLVPTVDYSGD-ISSFPLVLLQVTSFKHGGVSLGAA  151

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDHSP  466
              H + DG  +C+F++ W+N   G  ++  P  DR  LLR      S        +D SP
Sbjct  152  FQHTLVDGSSVCYFMNSWSNTTRGLSITVTPSIDRT-LLRA--RVPSAPAFHHVEYDQSP  208

Query  465  PLIVGQSSDESERM-KETKVSTLRLSKPQIHALKAAAN-NGRSYNAKPRGYTRFEVITAH  292
            PL    S+  S+   K +  S  +++  Q+  LK+ A  NG   N      T ++++TAH
Sbjct  209  PLNTSISALNSQVGPKPSSTSIFKITADQLKTLKSKATMNG---NTTKTNRTTYDILTAH  265

Query  291  IWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIISRPLQ  112
            +W C CKAR     Q T L   +D R ++ PPLP  Y GN +       +SG++ S P  
Sbjct  266  VWHCVCKARGLSDDQATKLYIPIDGRSKLHPPLPPGYLGNVIFIAATTALSGDLQSEPFA  325

Query  111  DVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            D   +I   +  +  +Y+  A+D+  +  D+
Sbjct  326  DTIQRINRMVKRMDDKYMRSALDYIESVPDM  356



>ref|XP_008353756.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=441

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/275 (37%), Positives = 151/275 (55%), Gaps = 20/275 (7%)
 Frame = -2

Query  825  VLVEAESDAVLADLGDFSPCPELNHLVPSVDYSGDPIQDIPLFVGQLTKFRCGGISLGFA  646
            + V AE+ +VL D GDF+P PE   L+P +DYS   I   PL V Q+T F+CGG+SLG  
Sbjct  99   LFVVAETTSVLDDFGDFAPTPEFRKLIPVIDYSAG-ISTYPLLVVQVTYFKCGGVSLGVG  157

Query  645  ISHVVADGHGLCHFLSEWANLASGKPLSSAPFHDRRRLLRGVGESSSPQGGPRRVFDH--  472
            + H VADG    HF++ W+++A G  L+  PF DR  LLR        +  P+  FDH  
Sbjct  158  LEHRVADGCSGLHFVNTWSDIARGLDLTIPPFIDRT-LLRA-------RDPPQTTFDHVE  209

Query  471  ---SPPLIVGQSSDESERMKETKVSTLRLSKPQIHALKAAANN-GRSYNAKPRGYTRFEV  304
                PPL     + +    + T VS  RL++ Q+  LKA +   G S N     Y+ +E+
Sbjct  210  YQPDPPLKTPPPTTKDGDAESTTVSIFRLTREQLSVLKAKSKEEGNSIN-----YSTYEM  264

Query  303  ITAHIWRCACKARSHKPQQPTTLCFSVDIRRRMEPPLPDSYFGNAVINVVIFGVSGEIIS  124
            +  H+WRCA KAR+    + T L  +VD R R++PPLP  +FGN V     F  +G++ S
Sbjct  265  LAGHVWRCASKARNLPDDRVTKLHVAVDGRSRLQPPLPPGFFGNVVFAGAPFATAGDLKS  324

Query  123  RPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  19
            +P    AS I D +    ++Y+  A+D+   + D+
Sbjct  325  KPTWYAASXIHDVVVRXNNDYLRSALDYLEVQPDL  359



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1603186862720