BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25500_g2_i10 len=1742 path=[1:0-151 153:152-238 34252:239-249
34263:250-253 34267:254-254 34268:255-255 26595:256-414 6067:415-541
31483:542-608 6264:609-634 6290:635-648 6304:649-786 34612:787-795
6451:796-838 6494:839-844 6500:845-870 6526:871-892 6548:893-898
6554:899-945 34750:946-946 34751:947-964 34769:965-970
19266:971-1018 6674:1019-1088 6744:1089-1186 6842:1187-1245
32474:1246-1267 6923:1268-1308 27951:1309-1318 6974:1319-1342
35006:1343-1359 7015:1360-1373 7029:1374-1376 7032:1377-1400
7056:1401-1419 7075:1420-1477 7133:1478-1555 7211:1556-1593
7249:1594-1605 7261:1606-1640 18489:1641-1687 10865:1688-1708
35327:1709-1725 7381:1726-1741]

Length=1742
                                                                      Score     E

ref|XP_011077685.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    471   2e-157   
ref|XP_011092043.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    470   4e-157   
ref|XP_009787025.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    457   4e-152   
ref|XP_009628063.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    456   1e-151   
ref|XP_006359722.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    451   1e-149   
ref|XP_004243059.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    442   3e-146   
ref|XP_006453312.1|  hypothetical protein CICLE_v10008265mg             441   1e-145   
gb|KDO61846.1|  hypothetical protein CISIN_1g036315mg                   440   2e-145   
ref|XP_010050942.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    437   4e-144   
ref|XP_002269790.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    433   7e-143   Vitis vinifera
ref|XP_002521543.1|  Anthranilate N-benzoyltransferase protein, p...    433   9e-143   Ricinus communis
ref|XP_006381775.1|  hypothetical protein POPTR_0006s17880g             432   3e-142   
ref|XP_010489453.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    430   2e-141   
ref|XP_006409088.1|  hypothetical protein EUTSA_v10022690mg             427   1e-140   
ref|XP_006296658.1|  hypothetical protein CARUB_v10015907mg             426   5e-140   
ref|XP_010467740.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    426   7e-140   
ref|XP_002884178.1|  transferase family protein                         423   6e-139   
gb|ACC68164.1|  unknown                                                 423   6e-139   Arabidopsis halleri subsp. halleri
ref|NP_179497.1|  spermidine hydroxycinnamoyl transferase               423   8e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007211620.1|  hypothetical protein PRUPE_ppa005563mg             422   2e-138   
gb|KFK40283.1|  hypothetical protein AALP_AA3G354800                    422   2e-138   
ref|XP_002325143.2|  transferase family protein                         420   2e-137   Populus trichocarpa [western balsam poplar]
ref|XP_004301782.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    419   3e-137   
ref|XP_009358743.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    418   5e-137   
ref|XP_010548604.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    418   6e-137   
gb|KCW80900.1|  hypothetical protein EUGRSUZ_C02269                     418   7e-137   
ref|XP_009150708.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    418   7e-137   
ref|XP_010050943.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    418   8e-137   
ref|XP_010414994.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    415   9e-136   
ref|XP_008372277.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    415   1e-135   
ref|XP_011018001.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    414   4e-135   
ref|XP_007161968.1|  hypothetical protein PHAVU_001G112900g             413   7e-135   
ref|XP_008223799.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    412   1e-134   
ref|XP_008223800.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    412   2e-134   
gb|AFF57840.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    412   2e-134   
ref|XP_003550655.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    411   5e-134   
ref|XP_007154735.1|  hypothetical protein PHAVU_003G143100g             406   7e-132   
emb|CDY03367.1|  BnaC09g09810D                                          400   3e-130   
ref|XP_010051711.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    401   4e-130   
ref|XP_003550654.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    399   3e-129   
emb|CDY66506.1|  BnaAnng22360D                                          398   4e-129   
gb|KHN17617.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    396   2e-128   
ref|XP_009112574.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    396   2e-128   
gb|KCW82842.1|  hypothetical protein EUGRSUZ_C04213                     395   3e-128   
gb|EYU26551.1|  hypothetical protein MIMGU_mgv1a006988mg                394   4e-128   
ref|XP_010034869.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    395   4e-128   
ref|XP_004507883.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    392   8e-127   
gb|EPS69670.1|  hypothetical protein M569_05094                         389   1e-125   
ref|XP_007161967.1|  hypothetical protein PHAVU_001G112800g             387   6e-125   
ref|XP_003610074.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    386   2e-124   
ref|XP_011076842.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    378   7e-121   
ref|XP_010673351.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    376   1e-120   
ref|XP_008231463.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    375   3e-120   
gb|AES90726.2|  spermidine hydroxycinnamoyl transferase                 373   2e-119   
ref|XP_010541075.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    367   4e-116   
ref|XP_008231492.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    362   3e-115   
emb|CDY56515.1|  BnaCnng30570D                                          360   3e-115   
emb|CDY62143.1|  BnaCnng39330D                                          359   4e-115   
ref|XP_010110725.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    360   1e-114   
gb|AFD64619.1|  putative hydroxycinnamoyl-CoA:shikimate/quinate h...    360   2e-114   
ref|XP_002274695.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    359   4e-114   Vitis vinifera
ref|XP_010656623.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    353   1e-111   
emb|CBI36554.3|  unnamed protein product                                353   2e-111   
ref|XP_010094198.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    352   5e-111   
gb|KHN17616.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    347   9e-111   
ref|XP_002276550.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    345   1e-108   Vitis vinifera
ref|XP_003608529.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    346   2e-108   
ref|XP_010265516.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    342   3e-107   
emb|CAN72449.1|  hypothetical protein VITISV_011069                     335   5e-105   Vitis vinifera
gb|EPS68189.1|  hypothetical protein M569_06582                         328   2e-102   
ref|XP_010669430.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    328   7e-102   
ref|XP_011083883.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    327   1e-101   
emb|CDP05692.1|  unnamed protein product                                320   7e-99    
gb|ADD71921.1|  BAHD-type hydroxycinnamoyltransferase                   319   1e-98    Actaea racemosa
emb|CDP21167.1|  unnamed protein product                                319   1e-98    
ref|XP_010669388.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    318   5e-98    
emb|CDP18830.1|  unnamed protein product                                316   2e-97    
ref|XP_007214780.1|  hypothetical protein PRUPE_ppa023555mg             312   3e-96    
ref|XP_011069658.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    312   7e-96    
gb|EYU25632.1|  hypothetical protein MIMGU_mgv1a006215mg                306   2e-93    
ref|XP_007219083.1|  hypothetical protein PRUPE_ppa014960mg             292   3e-88    
ref|XP_008441993.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    290   1e-87    
ref|XP_010273688.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    290   2e-87    
ref|XP_004166134.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    291   2e-87    
ref|XP_010273689.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    286   4e-86    
ref|XP_003599928.1|  Anthranilate N-benzoyltransferase protein          283   6e-85    
gb|EYU25633.1|  hypothetical protein MIMGU_mgv1a006801mg                283   7e-85    
gb|KHN29832.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    281   5e-84    
ref|XP_003551937.2|  PREDICTED: spermidine hydroxycinnamoyl trans...    281   6e-84    
ref|XP_003555244.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    280   1e-83    
gb|ACU23734.1|  unknown                                                 280   3e-83    Glycine max [soybeans]
ref|XP_006605610.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    279   3e-83    
ref|XP_004500023.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    276   3e-82    
gb|ACI16631.1|  malate O-hydroxycinnamoyl transferase                   276   4e-82    Trifolium pratense [peavine clover]
ref|XP_003548918.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    276   5e-82    
ref|XP_009614241.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    273   2e-81    
gb|ACF37072.1|  hydroxycinnamoyl CoA quinate transferase 1              273   4e-81    
ref|XP_007146248.1|  hypothetical protein PHAVU_006G024700g             273   5e-81    
gb|KHN18128.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    273   6e-81    
gb|KHN13395.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    273   7e-81    
ref|XP_009800587.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    272   1e-80    
ref|XP_003553115.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    271   2e-80    
gb|ADL62855.1|  hydroxycinnamoyl-CoA transferase 2                      270   5e-80    
ref|XP_004149125.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    270   9e-80    
ref|XP_010265527.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    268   4e-79    
ref|XP_003599037.1|  Anthranilate N-benzoyltransferase protein          268   5e-79    
ref|XP_011073311.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    267   5e-79    
ref|XP_004500005.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    268   7e-79    
ref|XP_009798536.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    266   2e-78    
ref|XP_003532110.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    266   4e-78    
ref|XP_004149124.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    265   5e-78    
emb|CAE46932.1|  hydroxycinnamoyl CoA quinate transferase               264   1e-77    Nicotiana tabacum [American tobacco]
gb|KHN35439.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    262   2e-77    
gb|AEM63675.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...    263   2e-77    
gb|AEM63676.1|  hydroxycinnamoyl CoA quinate hydroxycinnamoyl tra...    263   2e-77    
ref|XP_009624297.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    263   4e-77    
ref|XP_007027321.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    262   6e-77    
gb|AFL93687.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-tra...    261   8e-77    
ref|XP_003532115.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    262   1e-76    
gb|AFS68800.1|  hydroxycinnamoyl transferase                            260   2e-76    
gb|AHA44839.1|  hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltr...    260   2e-76    
dbj|BAA87043.1|  N-hydroxycinnamoyl/benzoyltransferase                  260   3e-76    Ipomoea batatas [batate]
ref|XP_011082506.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    260   3e-76    
gb|ABO40491.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    260   4e-76    Coffea arabica [arabica coffee]
gb|ABR17170.1|  unknown                                                 259   4e-76    Picea sitchensis
gb|EPS64937.1|  hypothetical protein M569_09840                         259   5e-76    
dbj|BAJ14794.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    259   5e-76    
pdb|4G2M|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    259   5e-76    
ref|XP_006343633.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    259   5e-76    
gb|ADG46003.1|  hydroxycinnamoyl transferase                            259   6e-76    
gb|ABK79689.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    259   7e-76    Cynara cardunculus var. scolymus [artichoke]
ref|XP_002512739.1|  Anthranilate N-benzoyltransferase protein, p...    259   7e-76    Ricinus communis
ref|XP_010244666.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    259   7e-76    
pdb|4G0B|A  Chain A, Structure Of Native Hct From Coffea Canephora      259   8e-76    
emb|CDO98242.1|  unnamed protein product                                259   8e-76    
emb|CCC55431.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxyci...    259   8e-76    
ref|XP_011018051.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    259   8e-76    
gb|ABO52899.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltr...    259   9e-76    Pinus radiata
gb|ABO47805.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    259   9e-76    Coffea canephora [robusta coffee]
ref|XP_011018045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    258   9e-76    
ref|XP_011018044.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    259   9e-76    
gb|AGA20364.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...    258   1e-75    
emb|CAJ40778.1|  hydroxycinnamoyl transferase                           258   1e-75    Coffea arabica [arabica coffee]
ref|XP_002324534.1|  hypothetical protein POPTR_0018s11450g             258   1e-75    Populus trichocarpa [western balsam poplar]
gb|ABK79690.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    258   1e-75    Cynara cardunculus var. altilis [cultivated cardoon]
gb|ABO77955.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    258   2e-75    Coffea canephora [robusta coffee]
ref|XP_009760608.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    258   2e-75    
gb|KDP38697.1|  hypothetical protein JCGZ_04050                         257   3e-75    
ref|XP_010063590.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    258   3e-75    
ref|XP_010101376.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    257   5e-75    
ref|XP_004303231.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    257   5e-75    
ref|XP_010244683.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    257   5e-75    
gb|ACA64049.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    256   6e-75    
ref|XP_002324530.2|  hypothetical protein POPTR_0018s11370g             257   6e-75    Populus trichocarpa [western balsam poplar]
ref|XP_010063596.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    257   6e-75    
gb|KHN18130.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    257   7e-75    
ref|XP_010063586.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    256   8e-75    
gb|AFN85668.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    256   1e-74    
ref|XP_011020577.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    256   1e-74    
ref|XP_007146398.1|  hypothetical protein PHAVU_006G037000g             256   1e-74    
gb|ABA46756.1|  hydroxycinnamoyl-CoA quinate-like protein               255   2e-74    Solanum tuberosum [potatoes]
ref|NP_001234850.1|  hydroxycinnamoyl CoA quinate transferase           255   2e-74    
ref|XP_003532111.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    256   2e-74    
gb|KDP38692.1|  hypothetical protein JCGZ_04045                         255   2e-74    
pdb|4G22|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    255   2e-74    
ref|XP_009626781.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    255   3e-74    
ref|XP_003553113.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    256   3e-74    
ref|XP_009626780.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    255   3e-74    
gb|AHG97388.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    256   3e-74    
emb|CAN82918.1|  hypothetical protein VITISV_023290                     254   3e-74    Vitis vinifera
ref|NP_001275483.1|  HQT                                                254   3e-74    
ref|XP_002268988.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    254   3e-74    Vitis vinifera
ref|XP_010113235.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    254   4e-74    
gb|KHM99608.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    256   4e-74    
ref|XP_007023475.1|  Hydroxycinnamoyl-CoA shikimate/quinate hydro...    254   4e-74    
ref|XP_010063583.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    254   5e-74    
gb|ADB44897.1|  hydroxycinnamoyl transferase                            254   5e-74    Sinopodophyllum hexandrum [Himalayan mayapple]
ref|XP_009615699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    254   5e-74    
ref|XP_010094061.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    254   6e-74    
gb|AFZ78609.1|  hydroxycinnamoyl-CoA:shikimate/quinate hydroxycin...    254   6e-74    
ref|XP_007216677.1|  hypothetical protein PRUPE_ppa1027182mg            254   7e-74    
ref|XP_009354208.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    254   7e-74    
gb|KHM99609.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    253   7e-74    
gb|ACC63882.1|  quinate O-hydroxycinnamoyltransferase/shikimate O...    253   8e-74    Populus trichocarpa [western balsam poplar]
ref|XP_006368492.1|  transferase family protein                         253   1e-73    
gb|AFF19203.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    253   1e-73    
ref|XP_002277474.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    253   2e-73    Vitis vinifera
gb|AIG20957.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    252   2e-73    
gb|ACZ52698.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    252   3e-73    Lonicera japonica [Japanese honeysuckle]
ref|NP_001289240.1|  shikimate O-hydroxycinnamoyltransferase-like       252   3e-73    
gb|AEJ88365.1|  hydroxycinnamoyltransferase                             252   3e-73    
emb|CDG56248.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...    252   3e-73    
ref|XP_004135880.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    251   4e-73    
ref|XP_007215406.1|  hypothetical protein PRUPE_ppa005955mg             251   7e-73    
emb|CDG56249.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...    251   9e-73    
gb|AHA14500.1|  hydroxycinnamoyl-coenzyme A quinate transperase         251   9e-73    
emb|CBI83579.1|  hydroxycinnamoyl transferase                           250   1e-72    
gb|AID69225.1|  hydroxycinnamoyl coenzyme A shikimate hydroxycinn...    248   1e-72    
ref|XP_004158793.1|  PREDICTED: LOW QUALITY PROTEIN: shikimate O-...    250   1e-72    
ref|XP_010034043.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    251   2e-72    
gb|KCW53914.1|  hypothetical protein EUGRSUZ_J03126                     251   2e-72    
ref|XP_011034568.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    249   2e-72    
ref|XP_008228828.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    250   3e-72    
gb|AEK80405.1|  HQT                                                     249   3e-72    
ref|XP_002324532.1|  hypothetical protein POPTR_0018s11380g             249   3e-72    Populus trichocarpa [western balsam poplar]
gb|ACF17657.1|  putative hydroxycinnamoyl transferase                   249   4e-72    Capsicum annuum
gb|AFF57839.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    249   5e-72    
ref|XP_004235891.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    248   7e-72    
ref|NP_001280198.1|  shikimate O-hydroxycinnamoyltransferase-like       248   9e-72    
ref|XP_007146396.1|  hypothetical protein PHAVU_006G036800g             249   1e-71    
gb|AAZ80046.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    248   1e-71    Cynara cardunculus [cardoon]
gb|ACI16630.1|  shikimate O-hydroxycinnamoyltransferase                 247   2e-71    Trifolium pratense [peavine clover]
ref|XP_008342823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    248   2e-71    
ref|XP_008353756.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    247   2e-71    
ref|XP_004293648.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    247   4e-71    
gb|KDP38698.1|  hypothetical protein JCGZ_04051                         246   5e-71    
gb|AFL93686.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    246   6e-71    
gb|ACI28534.1|  shikimate O-hydroxycinnamoyl transferase                246   7e-71    Trifolium pratense [peavine clover]
gb|KHG20214.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    246   7e-71    
ref|XP_006341413.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    245   1e-70    
ref|XP_011011266.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    245   2e-70    
gb|EPS67739.1|  hypothetical protein M569_07035                         244   2e-70    
gb|ACJ23164.1|  hydroxycinnamoyl CoA quinate transferase 2              245   2e-70    
ref|XP_007033659.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    244   2e-70    
ref|XP_006493385.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    244   2e-70    
gb|ABO77957.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    244   2e-70    Coffea canephora [robusta coffee]
ref|XP_008790160.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    244   2e-70    
dbj|BAF49306.1|  putative acyltransferase                               244   2e-70    Clitoria ternatea
ref|XP_003530223.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    244   3e-70    
gb|KDP41953.1|  hypothetical protein JCGZ_26971                         244   3e-70    
emb|CAR92145.1|  hydroxycinnamoyl CoA quinate transferase 2             244   3e-70    
emb|CAT00081.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    244   4e-70    Coffea arabica [arabica coffee]
emb|CBI25231.3|  unnamed protein product                                243   4e-70    
ref|XP_009375480.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    244   4e-70    
emb|CDP02827.1|  unnamed protein product                                245   5e-70    
ref|XP_006583083.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    244   6e-70    
gb|KHN04193.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    243   7e-70    
ref|XP_006583082.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    244   7e-70    
ref|XP_007011895.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    243   8e-70    
gb|AFP49814.1|  caffeoyl-CoA quinic acid caffeoyl transferase 4         243   9e-70    
ref|XP_006465544.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    243   9e-70    
gb|KEH28560.1|  shikimate/quinate hydroxycinnamoyltransferase           243   9e-70    
ref|XP_008228811.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    243   9e-70    
gb|ADL62854.1|  hydroxycinnamoyl-CoA transferase 1                      243   1e-69    
gb|ABO77956.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    243   1e-69    Coffea canephora [robusta coffee]
ref|XP_004507045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    243   2e-69    
ref|XP_004507046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    242   2e-69    
ref|XP_003543709.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    242   2e-69    
gb|AEO00530.1|  hydroxycinnamoyl transferase                            240   2e-69    
ref|XP_008228810.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    242   2e-69    
gb|KHN22679.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    238   3e-69    
ref|XP_004293649.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    242   3e-69    
ref|XP_007215401.1|  hypothetical protein PRUPE_ppa005910mg             241   3e-69    
ref|XP_007146394.1|  hypothetical protein PHAVU_006G036600g             241   4e-69    
ref|XP_002529413.1|  Anthranilate N-benzoyltransferase protein, p...    241   4e-69    Ricinus communis
ref|XP_010527105.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    240   5e-69    
gb|KHN31873.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    241   7e-69    
ref|XP_003531748.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    240   7e-69    
ref|XP_004507047.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    240   1e-68    
gb|AGV54440.1|  shikimate O-hydroxycinnamoyltransferase                 239   2e-68    
ref|XP_007033668.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    239   2e-68    
ref|XP_007135841.1|  hypothetical protein PHAVU_010G162700g             239   2e-68    
ref|XP_007215395.1|  hypothetical protein PRUPE_ppa005872mg             239   4e-68    
ref|XP_007150819.1|  hypothetical protein PHAVU_005G183200g             239   4e-68    
gb|KHN11007.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    239   4e-68    
ref|XP_003535207.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    238   9e-68    
ref|XP_009394928.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    238   1e-67    
ref|XP_007027324.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    238   1e-67    
gb|EYU24587.1|  hypothetical protein MIMGU_mgv1a006602mg                237   1e-67    
ref|XP_003532114.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    238   2e-67    
emb|CDG56253.1|  hydroxycinnamoyltransferase 2                          237   2e-67    
ref|XP_004291518.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    237   2e-67    
ref|XP_009789449.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    237   2e-67    
ref|XP_006826688.1|  hypothetical protein AMTR_s00137p00072760          237   2e-67    
ref|XP_007215396.1|  hypothetical protein PRUPE_ppa005873mg             237   2e-67    
ref|XP_006382509.1|  hypothetical protein POPTR_0005s02820g             236   3e-67    
gb|EYU21745.1|  hypothetical protein MIMGU_mgv1a006579mg                236   3e-67    
ref|XP_009365251.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    236   4e-67    
ref|XP_002529412.1|  Anthranilate N-benzoyltransferase protein, p...    235   5e-67    Ricinus communis
ref|XP_010500346.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    236   6e-67    
gb|AFF19202.1|  BAHD acyltransferase                                    235   6e-67    
ref|XP_006474019.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    235   7e-67    
ref|XP_003548720.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    236   9e-67    
ref|XP_007214866.1|  hypothetical protein PRUPE_ppa019948mg             235   1e-66    
ref|XP_011036967.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    235   1e-66    
ref|XP_004493179.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    235   1e-66    
ref|XP_010479239.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    234   1e-66    
ref|XP_006474020.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    234   2e-66    
ref|XP_003629304.1|  Hydroxycinnamoyl-CoA quinate hydroxycinnamoy...    234   2e-66    
ref|XP_004976123.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    234   2e-66    
ref|NP_001145871.1|  uncharacterized protein LOC100279386               234   3e-66    
ref|XP_008381165.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    234   3e-66    
ref|XP_006464645.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    234   3e-66    
dbj|BAO20883.1|  hydroxycinnamoyl CoA: shikimate hydroxycinnamoyl...    233   3e-66    
gb|EYU21749.1|  hypothetical protein MIMGU_mgv1a006630mg                233   4e-66    
ref|XP_010479238.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    233   5e-66    
ref|XP_009366046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    233   5e-66    
ref|XP_003624650.1|  Anthranilate N-benzoyltransferase protein          234   5e-66    
dbj|BAF49305.1|  putative acyltransferase                               233   7e-66    
ref|XP_006465262.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    232   1e-65    
ref|XP_006474075.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    233   1e-65    
ref|XP_009399564.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    232   2e-65    
gb|AFK10218.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    231   2e-65    
ref|XP_003575337.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    232   2e-65    
ref|XP_010094062.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    231   2e-65    
gb|KHG19404.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    231   2e-65    
ref|XP_006652479.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    231   2e-65    
ref|XP_008237042.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    231   2e-65    
ref|XP_009380783.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    231   3e-65    
ref|XP_006382508.1|  hypothetical protein POPTR_0005s02810g             231   3e-65    
ref|XP_010479240.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    231   3e-65    
gb|EPS67512.1|  hypothetical protein M569_07262                         231   3e-65    
gb|ACG47161.1|  anthranilate N-benzoyltransferase protein 2             231   4e-65    
ref|XP_010942061.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    231   4e-65    
dbj|BAJ95750.1|  predicted protein                                      231   4e-65    
ref|XP_002446745.1|  hypothetical protein SORBIDRAFT_06g021640          231   4e-65    
ref|XP_008381122.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    230   5e-65    
dbj|BAJ93247.1|  predicted protein                                      230   5e-65    
ref|XP_011036823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    230   7e-65    
gb|AJA31666.1|  rosmarinic acid synthase                                229   9e-65    
ref|XP_009146509.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    229   9e-65    
ref|NP_001047408.1|  Os02g0611800                                       229   1e-64    
emb|CDY22880.1|  BnaA01g18180D                                          229   1e-64    
ref|XP_006303737.1|  hypothetical protein CARUB_v10011876mg             229   2e-64    
ref|XP_003551903.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    229   2e-64    
emb|CDG56250.1|  hydroxycinnamoyl-CoA:hydroxyphenyllactate hydrox...    229   2e-64    
ref|XP_010462493.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    228   2e-64    
ref|XP_006474074.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    229   2e-64    
sp|G0LD36.1|RAS_MELOI  RecName: Full=Rosmarinate synthase; Short=...    228   2e-64    
gb|ADA60182.1|  rosmarinic acid synthase                                228   3e-64    
dbj|BAC78634.1|  hydroxyanthranilate hydroxycinnamoyltransferase 2      228   3e-64    
ref|XP_006471643.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    228   3e-64    
ref|XP_006303767.1|  hypothetical protein CARUB_v10011977mg             228   4e-64    
ref|XP_010533496.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    228   5e-64    
dbj|BAC78635.1|  hydroxyanthranilate hydroxycinnamoyltransferase 3      228   5e-64    
ref|XP_004163669.1|  PREDICTED: Bloom syndrome protein homolog          237   6e-64    
ref|XP_010501253.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    227   6e-64    
emb|CDG56252.1|  hydroxycinnamoyltransferase 1                          227   7e-64    
ref|XP_010480194.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    227   7e-64    
emb|CDY05770.1|  BnaC07g00330D                                          227   7e-64    
dbj|BAC78633.1|  hydroxyanthranilate hydroxycinnamoyltransferase 1      227   1e-63    
dbj|BAK06288.1|  predicted protein                                      226   2e-63    
dbj|BAJ87836.1|  predicted protein                                      226   2e-63    
ref|XP_003580078.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    226   2e-63    
ref|XP_008223321.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    226   3e-63    
ref|XP_009366045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    226   3e-63    
ref|XP_011084630.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    225   3e-63    
gb|KFK35521.1|  hypothetical protein AALP_AA4G001700                    225   4e-63    
ref|NP_001053225.1|  Os04g0500700                                       225   4e-63    
ref|XP_007216058.1|  hypothetical protein PRUPE_ppa017691mg             225   4e-63    
ref|XP_006392548.1|  hypothetical protein EUTSA_v10011497mg             225   4e-63    
ref|XP_002979061.1|  probable hydroxycinnamoyltransferase               225   5e-63    
emb|CDY44162.1|  BnaC01g22120D                                          224   5e-63    
ref|XP_004493180.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    225   6e-63    
ref|XP_008228829.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    225   6e-63    
sp|A0PDV5.1|RAS_PLESU  RecName: Full=Rosmarinate synthase; Short=...    224   7e-63    
ref|XP_006307576.1|  hypothetical protein CARUB_v10009198mg             224   7e-63    
gb|KHG08871.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    224   8e-63    
emb|CDY31956.1|  BnaA07g00390D                                          224   1e-62    
ref|XP_010545447.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    224   1e-62    
gb|AEA36976.1|  rosmarinic acid synthase                                224   1e-62    
ref|XP_006598127.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    224   1e-62    
ref|XP_002894568.1|  transferase family protein                         224   1e-62    
gb|EMT08585.1|  Anthranilate N-benzoyltransferase protein 1             224   1e-62    
gb|KHN30507.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    224   2e-62    
ref|XP_002991534.1|  probable hydroxycinnamoyl transferase              224   2e-62    
ref|XP_010545859.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    223   2e-62    
gb|KHN36434.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    223   2e-62    
ref|XP_009102018.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    223   3e-62    
ref|XP_010500344.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    223   3e-62    
ref|XP_003624644.1|  Anthranilate N-benzoyltransferase protein          224   3e-62    
gb|AES80862.2|  spermidine hydroxycinnamoyl transferase                 224   3e-62    
ref|XP_003637275.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    223   3e-62    
ref|NP_199704.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyc...    222   4e-62    
gb|AAM61215.1|  anthranilate N-benzoyltransferase                       222   6e-62    
gb|ABI48360.1|  putative alcohol acyltransferase 1                      223   7e-62    
gb|KEH39662.1|  shikimate/quinate hydroxycinnamoyltransferase           221   8e-62    
gb|AGW27209.1|  rosmarinic acid synthase 4                              221   1e-61    
gb|AGH61997.1|  rosmarinic acid synthase                                221   1e-61    
ref|XP_006486096.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    221   1e-61    
emb|CDP21790.1|  unnamed protein product                                218   1e-61    
gb|KEH38242.1|  shikimate/quinate hydroxycinnamoyltransferase           221   2e-61    
ref|XP_003624649.1|  Anthranilate N-benzoyltransferase protein          221   2e-61    
ref|XP_007161962.1|  hypothetical protein PHAVU_001G112400g             221   3e-61    
gb|KHN16248.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    220   6e-61    
ref|XP_006471700.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    218   1e-60    
gb|EAZ23787.1|  hypothetical protein OsJ_07497                          219   2e-60    
ref|XP_007161963.1|  hypothetical protein PHAVU_001G112500g             218   2e-60    
ref|XP_006453163.1|  hypothetical protein CICLE_v10010833mg             218   3e-60    
ref|XP_006471699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    218   3e-60    
ref|XP_008777439.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    217   4e-60    
ref|XP_003551902.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    217   6e-60    
ref|XP_007156887.1|  hypothetical protein PHAVU_002G025600g             216   7e-60    
ref|XP_007217854.1|  hypothetical protein PRUPE_ppa024073mg             216   7e-60    
ref|XP_006401163.1|  hypothetical protein EUTSA_v10013552mg             216   8e-60    
ref|XP_007011894.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    219   9e-60    
dbj|BAJ89730.1|  predicted protein                                      216   1e-59    
gb|KHN46762.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    216   1e-59    
ref|NP_001132890.1|  LOC100194386                                       216   1e-59    
ref|XP_010093469.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    215   2e-59    
dbj|BAJ91746.1|  predicted protein                                      216   2e-59    
ref|XP_010538049.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    215   3e-59    
gb|AGM90558.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    215   4e-59    
gb|ACG29714.1|  anthranilate N-benzoyltransferase protein 1             215   4e-59    
ref|XP_003539366.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    216   4e-59    
emb|CAE01635.3|  OSJNBa0029H02.19                                       215   6e-59    
ref|XP_003548723.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    214   8e-59    
ref|XP_010547371.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    213   2e-58    
ref|XP_003604491.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    212   2e-58    
emb|CAD88491.1|  hydroxycinnamoyl-CoA hydroxycinnamoyltransferase       209   2e-58    
ref|XP_004295153.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    213   3e-58    
ref|XP_009132104.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    212   4e-58    
gb|AGW27208.1|  rosmarinic acid synthase 3                              211   8e-58    
ref|XP_004294955.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    211   1e-57    
emb|CDX88644.1|  BnaA03g10050D                                          211   1e-57    
ref|XP_010093468.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    210   1e-57    
gb|EYU24607.1|  hypothetical protein MIMGU_mgv1a006502mg                210   1e-57    
ref|XP_010942060.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    210   1e-57    
ref|XP_004953073.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    211   4e-57    
ref|XP_002866234.1|  transferase family protein                         209   5e-57    
ref|XP_002452435.1|  hypothetical protein SORBIDRAFT_04g025760          209   7e-57    
gb|AGW27211.1|  rosmarinic acid synthase 6                              207   2e-56    
emb|CDG56251.1|  hydroxycinnamoyl-CoA:hydroxyphenyllactate hydrox...    206   3e-56    
ref|NP_200592.1|  anthranilate N-hydroxycinnamoyl/benzoyltransfer...    206   7e-56    
ref|XP_010672790.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    206   1e-55    
ref|XP_009132100.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    205   2e-55    
gb|EYU24606.1|  hypothetical protein MIMGU_mgv1a005249mg                206   2e-55    
gb|KFK27325.1|  hypothetical protein AALP_AA8G368300                    204   3e-55    
ref|XP_010672788.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    204   3e-55    
ref|XP_006280408.1|  hypothetical protein CARUB_v10026341mg             204   4e-55    
gb|EPS61293.1|  hypothetical protein M569_13504                         202   4e-55    
ref|XP_006478316.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    203   4e-55    
ref|XP_009409799.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    202   8e-55    
ref|XP_010911178.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    202   1e-54    
ref|XP_010672789.1|  PREDICTED: anthranilate N-benzoyltransferase...    202   2e-54    
gb|EPS73563.1|  hypothetical protein M569_01193                         197   4e-54    
ref|XP_010667049.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    201   5e-54    
ref|XP_010667050.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    201   5e-54    
emb|CDX88645.1|  BnaA03g10040D                                          200   9e-54    
ref|XP_007099551.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    197   1e-53    
ref|XP_008790158.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    199   2e-53    
ref|XP_009409797.1|  PREDICTED: uncharacterized protein LOC103991972    204   5e-53    
ref|XP_009403058.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    197   1e-52    
emb|CAT00087.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    191   1e-52    
sp|O23917.1|HCBT2_DIACA  RecName: Full=Anthranilate N-benzoyltran...    197   1e-52    
ref|XP_010533495.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    196   2e-52    
gb|EMS60258.1|  Anthranilate N-benzoyltransferase protein 1             197   2e-52    
gb|AAZ80047.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    192   3e-52    
gb|AAZ80048.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    192   4e-52    
emb|CDY11845.1|  BnaC03g12710D                                          202   5e-52    
ref|XP_008777438.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    194   1e-51    
ref|XP_002303858.2|  hypothetical protein POPTR_0003s18210g             191   1e-51    
ref|XP_003560989.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    194   2e-51    
gb|KHN39742.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    193   2e-51    
ref|XP_010483334.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    194   2e-51    
ref|XP_002454696.1|  hypothetical protein SORBIDRAFT_04g035780          193   3e-51    
gb|AEN02914.1|  HCT1                                                    189   3e-51    
ref|XP_011073101.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    192   4e-51    
ref|XP_007099550.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    190   4e-51    
ref|XP_008231077.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    192   5e-51    
ref|NP_001169127.1|  hypothetical protein                               192   6e-51    
ref|XP_009403962.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    192   9e-51    
ref|XP_011073100.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    193   1e-50    
gb|AGW27210.1|  rosmarinic acid synthase 5                              191   1e-50    
ref|XP_007215405.1|  hypothetical protein PRUPE_ppa005943mg             191   1e-50    
ref|XP_008228885.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    189   1e-50    
ref|NP_001146402.1|  uncharacterized protein LOC100279982               191   2e-50    
sp|O24645.1|HCBT1_DIACA  RecName: Full=Anthranilate N-benzoyltran...    191   2e-50    
gb|ACG32145.1|  anthranilate N-benzoyltransferase protein 1             190   2e-50    
sp|O23918.1|HCBT3_DIACA  RecName: Full=Anthranilate N-benzoyltran...    190   4e-50    
ref|XP_004304536.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    189   5e-50    
ref|XP_002436612.1|  hypothetical protein SORBIDRAFT_10g005770          189   5e-50    
ref|XP_002437976.1|  hypothetical protein SORBIDRAFT_10g005760          189   5e-50    
ref|XP_004304535.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    189   6e-50    
ref|XP_002457418.1|  hypothetical protein SORBIDRAFT_03g006970          189   6e-50    
gb|AGE10604.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl tra...    185   7e-50    
ref|XP_003578136.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    188   1e-49    
ref|XP_004956853.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    188   1e-49    
ref|XP_009379971.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    189   2e-49    
tpg|DAA53439.1|  TPA: hypothetical protein ZEAMMB73_693497              187   2e-49    
ref|XP_004968189.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    187   3e-49    
gb|ACG34906.1|  anthranilate N-benzoyltransferase protein 1             188   4e-49    
ref|XP_008341279.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    187   5e-49    
ref|XP_002529384.1|  Taxadien-5-alpha-ol O-acetyltransferase, put...    186   6e-49    
emb|CAB06428.1|  anthranilate N-hydroxycinnamoyl/benzoyltransferase     187   7e-49    
emb|CDO98678.1|  unnamed protein product                                186   7e-49    
ref|XP_009375174.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    186   1e-48    
ref|XP_008791113.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    185   2e-48    
ref|XP_008239515.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    185   2e-48    
ref|XP_010528158.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    185   2e-48    
ref|XP_007209159.1|  hypothetical protein PRUPE_ppa006018mg             185   2e-48    
ref|XP_010528157.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    185   2e-48    
emb|CAT00082.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    185   2e-48    
ref|XP_009378002.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    185   3e-48    
ref|XP_004977198.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    184   6e-48    
gb|KDO63871.1|  hypothetical protein CISIN_1g014029mg                   184   6e-48    
ref|XP_010452842.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    184   8e-48    
ref|XP_009383405.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    183   9e-48    
gb|KCW60630.1|  hypothetical protein EUGRSUZ_H03354                     183   9e-48    
ref|XP_010024179.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    183   1e-47    



>ref|XP_011077685.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Sesamum 
indicum]
Length=464

 Score =   471 bits (1213),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 243/458 (53%), Positives = 310/458 (68%), Gaps = 30/458 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST-LSP-DAIIHSLRLSLSQVLVH  1568
             +V+PSEPT +G + L+E DQ G + +V  +YFY  P   L+P D I  +LR SL +VLVH
Sbjct  12    LVQPSEPTCNGCMPLTESDQTGVLTHVPTIYFYRPPQNWLTPKDTIFTTLRTSLRRVLVH  71

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL W   A         +CNG GA L+EA  +A L DLGD +P P F++L+P +
Sbjct  72    FYPLAGRLRWLDGARLEL-----DCNGKGAQLIEAHCEATLNDLGDLTPSPHFHYLIPQI  126

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             +Y  + PI +IPL   QLTKF+CGGISL + ISH VADGQ   HF+ EWA LA G+PL +
Sbjct  127   NY--MVPIEEIPLLCAQLTKFQCGGISLSYTISHAVADGQSALHFISEWARLARGEPLQT  184

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHS----PPLIIGQSSNESERMKETKVSTLRLS  1040
             APF DR+LLRAGE      P   +  F H+    PPL+IGQSS+E+E  KET ++  +LS
Sbjct  185   APFLDRKLLRAGE------PPSAQPRFKHAQFDPPPLLIGQSSSENESKKETTITMFKLS  238

Query  1039  KPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
             K Q+  LK   N  R+C+ ++R YTRYE I AHIWRC+CKAR H  +QPT +  CVDIRR
Sbjct  239   KIQVEMLKNEANRTRACDRRVRAYTRYESIAAHIWRCSCKARRHVHEQPTAMGICVDIRR  298

Query  859   RMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRN  680
             RM+PPLP+ +FGNAI+DV+    SGE+++RPL   A KIR+AID VTSEYV+ AIDF +N
Sbjct  299   RMKPPLPEKFFGNAIVDVIATSFSGELMTRPLGYAAGKIREAIDSVTSEYVHSAIDFLKN  358

Query  679   EGDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDV  521
               D    Q++ T       F GNPN+ V++W+ LP  GLD GWG+EI M+PG HDCDGD 
Sbjct  359   LKDFSMLQDIHTLRTNQGPFYGNPNIGVVSWMALPLQGLDFGWGREIFMAPGTHDCDGDS  418

Query  520   LILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             L+LPG  G    DGSL+VA CLQ   + DF K+FYEDI
Sbjct  419   LVLPGYEG----DGSLVVALCLQAVCMGDFKKFFYEDI  452



>ref|XP_011092043.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Sesamum 
indicum]
Length=464

 Score =   470 bits (1210),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 244/458 (53%), Positives = 309/458 (67%), Gaps = 30/458 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST-LSP-DAIIHSLRLSLSQVLVH  1568
             +V+PSE T +G + L+ELDQ G + +V  +YFY  P   L+P D I  +LR SL +VLVH
Sbjct  12    LVQPSERTCNGCMPLTELDQAGVLTHVPTIYFYRPPQNWLTPKDTIFTTLRTSLRRVLVH  71

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL W   A         +CNG GA L+EA  +A L DLGD +P P F +L+P +
Sbjct  72    FYPLAGRLRWLDGARLEL-----DCNGKGAQLIEAHCEATLNDLGDLTPSPHFRYLIPQI  126

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             +Y  + PI +IPL   QLTKFRCGGISL + ISH VADGQ   HF+ EWA LA GKPL +
Sbjct  127   NY--MVPIEEIPLLCVQLTKFRCGGISLSYTISHAVADGQSAFHFISEWARLARGKPLRT  184

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHS----PPLIIGQSSNESERMKETKVSTLRLS  1040
             APF DR+LLRAGE      P   +  F H+    PPL+IGQSS+E+E  KET ++  +LS
Sbjct  185   APFLDRKLLRAGE------PPSAQPRFKHAQFDPPPLLIGQSSSENEWKKETTITMFKLS  238

Query  1039  KPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
             K Q+  LK   N  R+C+ ++R YTRYE + AHIWRC+CKAR H  +QPT +  CVDIRR
Sbjct  239   KIQVEMLKNEANRTRACDRRVRAYTRYESMAAHIWRCSCKARRHVHKQPTAMVICVDIRR  298

Query  859   RMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRN  680
             RM+PPLPD +FGNA++DV+    SGE+++RPL   A KIR+AID VTSEYV+ AIDF +N
Sbjct  299   RMKPPLPDKFFGNAVVDVIATSFSGELMTRPLGYAAGKIREAIDSVTSEYVHSAIDFLKN  358

Query  679   EGDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDV  521
               D  + Q++         F GNPN+ VI+W+ LP  GLD GWG+EI M+PG HDCDGD 
Sbjct  359   LKDFSRLQDIHAITTNQGPFYGNPNIGVISWMALPLQGLDFGWGREIFMAPGTHDCDGDS  418

Query  520   LILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             L+LPG  G    DGSL+VA CLQ   + DF K+FYEDI
Sbjct  419   LVLPGYEG----DGSLVVALCLQAVCMGDFKKFFYEDI  452



>ref|XP_009787025.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Nicotiana 
sylvestris]
Length=448

 Score =   457 bits (1175),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 246/461 (53%), Positives = 306/461 (66%), Gaps = 40/461 (9%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFY-----TTPSTLSPDAIIHSLRLSLSQV  1577
             VVKP+EPTW+G +SLSE DQ   + +V  +Y+Y       PST   D II +LR SLS+ 
Sbjct  10    VVKPAEPTWNGTVSLSECDQTFAVTHVPTIYYYRFCQDCLPST---DNIIKTLRTSLSKA  66

Query  1576  LVHFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLV  1397
             LVHFYP AGRL W   +         +CN +G V  EAE++A L DLGDFSP P+ N L 
Sbjct  67    LVHFYPLAGRLRWIAGSRLEL-----DCNASGVVFTEAETEAKLDDLGDFSPSPDSNSLF  121

Query  1396  PSVDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKP  1217
             P VDY+   PI ++PL   QLTKF+C G++L FAISH V DGQ   +FL EWA+LA G+P
Sbjct  122   PRVDYT--IPIDELPLLFVQLTKFQCSGVALSFAISHAVVDGQSALYFLTEWASLARGEP  179

Query  1216  LSSAPFHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQSSNESERMKETKVSTL  1049
             L + PFHDRRLLRAGE      P      F H     PPL++G+SS+E E+  ETK S L
Sbjct  180   LGNEPFHDRRLLRAGE------PPIASPTFEHLQFNQPPLLLGKSSSEEEKKNETKGSML  233

Query  1048  RLSKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVD  869
             +L+K Q+  L+   N G     + R YTRYEV+TAHIWRCACKAR HK +QPTNL  CV+
Sbjct  234   KLTKNQVEMLRKKANQGN----QGRSYTRYEVVTAHIWRCACKARGHKFEQPTNLCICVN  289

Query  868   IRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDF  689
             IR+ M+P LP S+FGNAI+DV+ +GVSG+I SRPL+  A ++R AI  VTS+Y N  IDF
Sbjct  290   IRKIMQPHLPKSFFGNAIVDVIANGVSGDITSRPLEYAARRVRAAIKIVTSDYANSTIDF  349

Query  688   YRNEGDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCD  530
              +N+ D+ K Q++  F      F GNPNL VI+W+ LP  GLD GWGKEIHMSPG H+ D
Sbjct  350   LKNQEDLSKYQDIHAFRSKEGPFYGNPNLGVISWISLPLLGLDFGWGKEIHMSPGTHEYD  409

Query  529   GDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             GD +ILPG  G    DGSL VA  LQ  H+  F K+FYEDI
Sbjct  410   GDCVILPGNEG----DGSLTVAIILQAVHVDAFKKFFYEDI  446



>ref|XP_009628063.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Nicotiana 
tomentosiformis]
Length=448

 Score =   456 bits (1173),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 246/461 (53%), Positives = 306/461 (66%), Gaps = 40/461 (9%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFY-----TTPSTLSPDAIIHSLRLSLSQV  1577
             VVKP+E TW+G +SLSE DQ   + +V  +Y+Y       PST   D II +LR SLS+ 
Sbjct  10    VVKPAEATWNGTVSLSECDQTFAVTHVPTIYYYRFCHDCLPST---DNIIKTLRTSLSKA  66

Query  1576  LVHFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLV  1397
             LVHFYP +GRL W   +         +CN +G VL+EAE++A L DLGDFSP P+ N L 
Sbjct  67    LVHFYPLSGRLRWIAGSRLEL-----DCNASGVVLMEAETEAKLDDLGDFSPSPDSNSLF  121

Query  1396  PSVDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKP  1217
             P VDY+   PI ++PL   QLTKF+CGGI+L FAISH V DGQ   +FL EWA+LA G+P
Sbjct  122   PRVDYT--IPIDELPLLFVQLTKFQCGGIALSFAISHAVVDGQSALYFLTEWASLARGEP  179

Query  1216  LSSAPFHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQSSNESERMKETKVSTL  1049
             L + PFHDR+ LRAGE      P      F H     PPL++GQSS+E E+  ETK S L
Sbjct  180   LGNEPFHDRKFLRAGE------PPIAYPTFEHLQFNPPPLLLGQSSSEEEKKNETKGSML  233

Query  1048  RLSKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVD  869
             +L+K Q+  L+   N G     + R YTRYEV+TAHIWRC CKAR HK +QPTNL  CV+
Sbjct  234   KLTKHQVEMLRKKANQGN----QGRSYTRYEVVTAHIWRCVCKARGHKFEQPTNLCICVN  289

Query  868   IRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDF  689
             IR  M+PPLP SYFGNAI+DV+ +GVSG+I SRPL+ VA ++R AI  VTS+Y N  IDF
Sbjct  290   IRNIMQPPLPKSYFGNAIVDVIANGVSGDITSRPLEYVARRVRAAIKMVTSDYANSTIDF  349

Query  688   YRNEGDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCD  530
              +N+ D+ K Q++  F      F GNPNL VI+W+ LP  GLD GWGKEIHMSPG H+ D
Sbjct  350   LKNQEDLSKYQDIHAFRSKEGPFYGNPNLGVISWISLPLLGLDFGWGKEIHMSPGTHEYD  409

Query  529   GDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             GD +ILPG  G    DGSL VA  LQ  H+  F  +FYE+I
Sbjct  410   GDCVILPGKEG----DGSLTVAIILQAVHVDAFKNFFYEEI  446



>ref|XP_006359722.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Solanum 
tuberosum]
Length=451

 Score =   451 bits (1159),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 236/457 (52%), Positives = 304/457 (67%), Gaps = 29/457 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             VVKP+E TW+G +SLSE DQ   + +V  +Y+Y        D II +L+ SLS+ LV+FY
Sbjct  10    VVKPAEATWNGTVSLSEFDQTFAVTHVPTIYYYKFFHDFVTDEIIETLKTSLSKTLVYFY  69

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL W   +         +C+ +G VL EAE+DA L +L DF   P++N L P VDY
Sbjct  70    PLAGRLRWINGSRLEL-----DCDASGVVLTEAEADAKLDNLTDFLLSPDYNSLFPRVDY  124

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             +   PI ++PL   QLTKF+CGGI+L FAISH V DGQ   +F  EWA LA G+PL  AP
Sbjct  125   TV--PIDELPLLFVQLTKFQCGGIALSFAISHAVVDGQSALYFFSEWARLARGEPLMFAP  182

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQSSNESERMKETKVSTLRLSKP  1034
              HDR+LLRAGE      P      F H     PPL+IG+SS E+E+ KETK + L+L+K 
Sbjct  183   CHDRKLLRAGE------PAVASPTFEHLQFNIPPLLIGKSSTENEKKKETKGAMLKLTKL  236

Query  1033  QIHALKAADNNGRSC-NAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRR  857
             Q+  L+   N GRS  ++K R YTRYEV+TAHIWRCACKAR HK +QPTNL  CV+IR++
Sbjct  237   QVEMLREKANQGRSIEDSKERSYTRYEVVTAHIWRCACKARGHKFEQPTNLCICVNIRKK  296

Query  856   MEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  677
             M+PPLP++YFGNAI+DV+  G SG+I S PL+  A ++R+AI+ VTS+Y N  I+F + +
Sbjct  297   MDPPLPNTYFGNAIVDVIATGASGDIASSPLECAAKRVREAINMVTSDYANSTINFLKKQ  356

Query  676   GDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVL  518
              D+   Q++  F      F GNPNL VI+W+ LP  GLD GWGKEIHMSPG H+ DGD +
Sbjct  357   EDLSIYQDIHAFRNKEGPFYGNPNLGVISWISLPVLGLDFGWGKEIHMSPGIHEYDGDCV  416

Query  517   ILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             ILP   G    DGSL VA  LQ+ H+  F K+FYEDI
Sbjct  417   ILPENEG----DGSLTVAIVLQLAHVNAFEKFFYEDI  449



>ref|XP_004243059.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Solanum lycopersicum]
Length=451

 Score =   442 bits (1136),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 230/457 (50%), Positives = 302/457 (66%), Gaps = 29/457 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             VVKP+E TW+G +SLSE DQ   + +V  +Y+Y   +    D I+ +L++SLS+ LV+FY
Sbjct  10    VVKPAEATWNGTVSLSEFDQTFALTHVPTIYYYKYFNDFVTDEIVDTLKISLSKALVYFY  69

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL W   +         +C+ +G VL EAE+DA L +L DF   P++N L P VDY
Sbjct  70    PLAGRLRWINGSRLEL-----DCDASGVVLTEAEADAKLDNLTDFLLSPDYNSLFPRVDY  124

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             +    I ++PL   QLTKF+CGGI+L FAISH V DGQ   +F  EWA +A G+PL  +P
Sbjct  125   TV--EINELPLLFVQLTKFQCGGIALSFAISHAVVDGQSALYFFSEWARIARGEPLMFSP  182

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQSSNESERMKETKVSTLRLSKP  1034
              HDR+LLRAGE      P      F H    +PPL+IG+SS E+E+ K TK + L+L+K 
Sbjct  183   CHDRKLLRAGE------PANASPTFEHLQFNTPPLLIGKSSTENEKKKTTKGAMLKLTKH  236

Query  1033  QIHALKAADNNGRSC-NAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRR  857
             Q+  L+   N GR   ++K R YTRYEV+TAHIWRCACKAR HK +QPTNL  CV+IR++
Sbjct  237   QVEMLREKANQGRCLEDSKERSYTRYEVVTAHIWRCACKARGHKFEQPTNLCICVNIRQK  296

Query  856   MEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  677
             M PPLP++YFGNAI+DV+  G SG+I S PL+  A ++R+AI+ VTS+Y N  I+F + +
Sbjct  297   MNPPLPNTYFGNAIVDVIATGASGDIASSPLECAAKRVREAINMVTSDYANSTINFLKKQ  356

Query  676   GDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVL  518
              D+   Q++  F      F GNPNL VI+W+ LP  GLD GWGKEIHMSPG H+ DGD +
Sbjct  357   EDLSIYQDIHAFRNKEGPFYGNPNLGVISWISLPVLGLDFGWGKEIHMSPGIHEYDGDCV  416

Query  517   ILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             ILP   G    DGSL VA  LQ  H+  F K+FYEDI
Sbjct  417   ILPENEG----DGSLTVAIVLQHAHVDAFEKFFYEDI  449



>ref|XP_006453312.1| hypothetical protein CICLE_v10008265mg [Citrus clementina]
 ref|XP_006474222.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Citrus 
sinensis]
 gb|ESR66552.1| hypothetical protein CICLE_v10008265mg [Citrus clementina]
Length=452

 Score =   441 bits (1133),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 241/455 (53%), Positives = 300/455 (66%), Gaps = 24/455 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST--LSP-DAIIHSLRLSLSQVLV  1571
              VKP+EPT++G+L LSELDQIGT+ ++  +YFY  PS   L+P D +  +L+ SLS  LV
Sbjct  11    TVKPAEPTYNGILPLSELDQIGTITHIPTIYFYQQPSENWLNPSDKVFKTLKDSLSFALV  70

Query  1570  HFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPS  1391
             HFYP AGRL W              CN  G  LVEAES A L DLGD SP PE+N+LVP+
Sbjct  71    HFYPLAGRLRWIGRGRLEL-----ECNAAGVELVEAESRAKLQDLGDLSPRPEYNYLVPA  125

Query  1390  VDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLS  1211
             VDY+   PI ++PL   QLT+F+CGGISL F ISH VADG    HF+FEWA +A  +PL 
Sbjct  126   VDYT--LPIQELPLVLVQLTRFQCGGISLSFTISHAVADGPSALHFIFEWARIARREPLG  183

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
               PF DR++L+AGE   S  P      F H PPL+IGQ+ N  ER K T VS L+LS+ Q
Sbjct  184   LPPFLDRKVLQAGEPPVSY-PLLDHAEFDH-PPLLIGQTDNIEERKKMTTVSMLKLSEIQ  241

Query  1030  IHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             +  LK   N G  CN   R ++RYE +T H+WRCACKAR HK +Q T L  CVD R RM+
Sbjct  242   VKKLKNMANEGH-CNDIGRPFSRYETVTGHLWRCACKARGHKAEQTTALGVCVDSRSRMQ  300

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             PPLP  YFGNA +DV+    SGE++S+PL   +SKIR AI  VT EYV   I++ +N+ D
Sbjct  301   PPLPLGYFGNATLDVIALSRSGELVSKPLGYASSKIRRAIVSVTEEYVRSGIEYLKNQPD  360

Query  670   VIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLIL  512
             + K Q+L         F GNPNL V++W+ LP +GLD GWGKEIHM PG HD DGD LIL
Sbjct  361   LTKFQDLHALGGDEGPFYGNPNLGVVSWLTLPIYGLDFGWGKEIHMGPGTHDFDGDSLIL  420

Query  511   PGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             P PN    ++G L+VA CLQV H++ F K+FYEDI
Sbjct  421   PNPN----EEGGLIVALCLQVCHMEAFKKHFYEDI  451



>gb|KDO61846.1| hypothetical protein CISIN_1g036315mg [Citrus sinensis]
Length=452

 Score =   440 bits (1131),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 240/455 (53%), Positives = 299/455 (66%), Gaps = 24/455 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST--LSP-DAIIHSLRLSLSQVLV  1571
              VKP+EPT++G+L LSELDQIGT+ ++  +YFY  PS   L+P D +  +L+ SLS  LV
Sbjct  11    TVKPAEPTYNGILPLSELDQIGTITHIPTIYFYQQPSENWLNPSDKVFKTLKDSLSFALV  70

Query  1570  HFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPS  1391
             HFYP AGRL W              CN  G  LVEAES A L DLGD SP PE+N+LVP+
Sbjct  71    HFYPLAGRLRWIGRGRLEL-----ECNAAGVELVEAESRAKLEDLGDLSPRPEYNYLVPA  125

Query  1390  VDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLS  1211
             VDY+   PI ++PL   QLT+F+CGGISL F ISH VADG    HF+FEWA +A  +PL 
Sbjct  126   VDYT--LPIQELPLVLVQLTRFQCGGISLSFTISHAVADGPSALHFIFEWARIARREPLG  183

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
               PF DR++L+AGE   S  P      F H PPL+IGQ+ N  ER K+T V  L+LS+ Q
Sbjct  184   LPPFLDRKVLQAGEPPVSY-PLLDHAEFDH-PPLLIGQTDNIEERKKKTTVCMLKLSETQ  241

Query  1030  IHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             +  LK   N G  CN     ++RYE +T H+WRCACKAR HK +Q T L  CVD R RM+
Sbjct  242   VKKLKNMANEGH-CNDIGHPFSRYETVTGHLWRCACKARGHKAEQTTALGVCVDSRSRMQ  300

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             PPLP  YFGNA +DV+    SGE++S+PL   +SKIR AI  VT EYV   I++ +N+ D
Sbjct  301   PPLPLGYFGNATLDVIALSRSGELVSKPLGYASSKIRRAIVSVTEEYVRSGIEYLKNQPD  360

Query  670   VIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLIL  512
             + K Q+L         F GNPNL V++W+ LP +GLD GWGKEIHM PG HD DGD LIL
Sbjct  361   LTKFQDLHALGGDEGPFYGNPNLGVVSWLTLPIYGLDFGWGKEIHMGPGTHDFDGDSLIL  420

Query  511   PGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             P PN    +DG L+VA CLQV H++ F K+FYEDI
Sbjct  421   PNPN----EDGGLIVALCLQVCHMEAFKKHFYEDI  451



>ref|XP_010050942.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Eucalyptus 
grandis]
 gb|KCW80898.1| hypothetical protein EUGRSUZ_C02267 [Eucalyptus grandis]
Length=457

 Score =   437 bits (1123),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 230/457 (50%), Positives = 296/457 (65%), Gaps = 25/457 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTL--SPDAIIHSLRLSLSQVLVH  1568
              +KP   TW G L LSELDQIGT+ +V I+YFY  P  L    DAI + LR SLS+VLV 
Sbjct  12    TIKPETATWGGHLPLSELDQIGTITHVPIIYFYKLPLELLHPADAIFNILRGSLSRVLVP  71

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL               +CN  G  L+EAES+  L DLGDF P  EF  +VPSV
Sbjct  72    FYPLAGRLKRLDRGRLRL-----DCNAMGVWLIEAESEGTLNDLGDFCPSQEFEQIVPSV  126

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   PI ++PL   Q+TKF+CGG++L   ISH VADG   +HF+ EWA LA G+PLS 
Sbjct  127   DYT--TPIHELPLLLVQVTKFKCGGLALSTTISHAVADGPSATHFMNEWARLARGEPLSV  184

Query  1207  APFHDRRLLRAGEsssssS---PQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSK  1037
              P++DR++L  GE  S      P      F+H PPL+IG + N  +RMK+T ++ L+L+K
Sbjct  185   EPYYDRKVLWVGEDPSGVLLPPPNLEHSEFNH-PPLLIGHTKNLEQRMKKTTMALLKLTK  243

Query  1036  PQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRR  857
              Q+ +LK A N  R+CN   R YTRYE + AHIWRCACKAR HKP+QPT L  CVD R R
Sbjct  244   TQVESLKKAANKDRACNNP-RPYTRYETMAAHIWRCACKARKHKPEQPTVLCICVDARSR  302

Query  856   MEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  677
             ++PPL   YFGNA  DVV  G SGE++S PL+  +SKIR+AI+ VT E+V   I+  R +
Sbjct  303   LQPPLKPGYFGNATFDVVAAGTSGELVSSPLRCTSSKIREAIEAVTYEHVKSTIEHIRRQ  362

Query  676   GDVIKRQELGT------FFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVL  518
              D+   Q+L         F GNPNL V++W+ +P +GLD GWG+EIHM PG HD DGD L
Sbjct  363   PDLTMFQDLHALGSTQGLFYGNPNLGVVSWLTMPVYGLDFGWGREIHMGPGNHDFDGDCL  422

Query  517   ILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             +LP  +    + G L+VA  LQ++H++DF K+FYEDI
Sbjct  423   VLPSSD----EAGGLVVAVGLQIEHMEDFKKFFYEDI  455



>ref|XP_002269790.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Vitis vinifera]
 emb|CBI40129.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   433 bits (1114),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 239/453 (53%), Positives = 296/453 (65%), Gaps = 25/453 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST---LSPDAIIHSLRLSLSQVLV  1571
              VKPSEPT+ G LSLSE DQIGT+ +V  +YFY  PS    +    I+ +LR SLS+VLV
Sbjct  11    TVKPSEPTFDGRLSLSEWDQIGTITHVPTIYFYR-PSQDWIMRDGDILATLRDSLSRVLV  69

Query  1570  HFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPS  1391
             HFYP AGRL W   +          CN  G  L+EAES A L D GDF+P P+   LVP 
Sbjct  70    HFYPLAGRLCWIQGSRLEL-----ECNAMGVQLIEAESQATLDDFGDFAPSPDLESLVPC  124

Query  1390  VDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLS  1211
             V+Y+   PI ++PL   QLTKF CGGISLG +ISH VADGQ   HF+ EWA LA G+PL 
Sbjct  125   VNYNS--PIHELPLMLVQLTKFSCGGISLGTSISHAVADGQSALHFIDEWARLARGEPLG  182

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
             + PF DR++LRAG+S  +  P      F H PPL++G SS   ER K T VS L+L+K Q
Sbjct  183   TPPFLDRKVLRAGDSPIAP-PCFDHAEFSH-PPLLMGASSTVEERKKGTTVSLLKLTKTQ  240

Query  1030  IHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             +  LK   N+ R      R Y+RYE I AHIWRCAC AR HKP+QPT +  C+D R RM 
Sbjct  241   VERLKKMANDSRPTECG-RPYSRYETIAAHIWRCACNARGHKPEQPTAIGICIDSRSRMR  299

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             PPLP  YFGNA +DV+  G SGE++S+PL   +S+IR AI+ VT EYV  AIDF +N+ D
Sbjct  300   PPLPQGYFGNATLDVIATGRSGELVSKPLGYASSRIRAAIEKVTDEYVWSAIDFLKNQPD  359

Query  670   VIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLIL  512
             + + Q+L         F GNPNL VI+W+ LP +G+D GWGKE++M PG HD DGD LIL
Sbjct  360   LSQFQDLHALGNDEGPFYGNPNLGVISWLTLPMYGIDFGWGKEVYMGPGPHDFDGDSLIL  419

Query  511   PGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
             PG +G    DGSL+VA CLQV H+  F  +FYE
Sbjct  420   PGHDG----DGSLVVALCLQVAHMDAFKNFFYE  448



>ref|XP_002521543.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF40814.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=449

 Score =   433 bits (1113),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 230/454 (51%), Positives = 302/454 (67%), Gaps = 23/454 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT-TPSTLSP-DAIIHSLRLSLSQVLVH  1568
              VKP  PT +G L LSE DQ+G + +V  +YFY  +P  L+P D II++L+ SLS+ LV 
Sbjct  10    TVKPKYPTKTGSLYLSEWDQVGILTHVPTIYFYRPSPDWLTPSDKIINTLKDSLSRALVP  69

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL  T+           +C+  G  L+EAES + L DLGDFSP P FN+L+P V
Sbjct  70    FYPLAGRLRSTSNGRLEL-----DCSAVGVQLIEAESQSKLEDLGDFSPSPAFNYLIPPV  124

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   PI + PL   QLTKF+CGG+SL  +ISH VADGQ   HF+ EWA +A G+ L  
Sbjct  125   DYT--LPIHEQPLMLVQLTKFQCGGVSLSLSISHTVADGQSALHFISEWARMARGEHLGI  182

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
              PF DR++LRAG +     P    + F+H PPL++G+S+N  +R K+T V+ L+L+K Q+
Sbjct  183   VPFLDRKVLRAGNAPMEE-PVFDHKEFNH-PPLLLGESNNLEQRKKKTTVAMLKLTKDQV  240

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               LK   N G S +   R YTRYE +T H+WR ACKAR H+P QPT L  CVD+R+RM+P
Sbjct  241   DKLKRKANEGMSVDTG-RAYTRYETLTGHVWRSACKARGHQPGQPTALGVCVDLRKRMQP  299

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
              LPD YFGNA IDV+    SGE+I++PL   + KIR+AI+ VT+EYVN AI F + + D+
Sbjct  300   HLPDGYFGNATIDVIAISTSGELITKPLGYASGKIREAIEKVTNEYVNSAIAFLKKQKDL  359

Query  667   IKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLILP  509
              + Q+L         F GNPNL V++W+ LP +GLD GWGKEI+M PG HD DGD L+L 
Sbjct  360   TRFQDLNAIGGVEGPFYGNPNLGVVSWLTLPMYGLDFGWGKEIYMGPGTHDFDGDSLLLR  419

Query  508   GPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             G      +DGSL++A CLQV H++ F KYFYEDI
Sbjct  420   GLE----EDGSLVLAVCLQVAHMEAFKKYFYEDI  449



>ref|XP_006381775.1| hypothetical protein POPTR_0006s17880g, partial [Populus trichocarpa]
 gb|ERP59572.1| hypothetical protein POPTR_0006s17880g, partial [Populus trichocarpa]
Length=451

 Score =   432 bits (1110),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 225/458 (49%), Positives = 300/458 (66%), Gaps = 31/458 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT-TPSTLSP-DAIIHSLRLSLSQVLVH  1568
             +VKP++PTW+G +SLSELDQIGT+ YV  +YFY  +P+ L+P + +++ L+ SL  VLV 
Sbjct  12    IVKPAKPTWTGRVSLSELDQIGTITYVPTIYFYKPSPNWLTPSNDVVNDLKDSLRDVLVP  71

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FY  AGRL W              CN  G +  EAES++ L DLGDF P  E+ +L+P+V
Sbjct  72    FYLLAGRLHWIGRGRLEL-----ECNAMGVMFTEAESESKLEDLGDFLPSSEYKYLIPNV  126

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   PI D+PL   QLTKF+CGGISL   ISH V DGQ   HF+ EWA +A G+PL  
Sbjct  127   DYT--VPIHDLPLLLVQLTKFQCGGISLSLTISHAVVDGQSALHFMSEWARIARGEPLGV  184

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHS----PPLIIGQSSNESERMKETKVSTLRLS  1040
              PF DR++LRA +   +S        FHH+    PPL++GQ +N  ER K+  V+ LRL+
Sbjct  185   VPFLDRKVLRARDPPIASQ-------FHHAEFDLPPLLLGQLNNAEERKKKATVAMLRLT  237

Query  1039  KPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
             K Q+  LK   N  R      RGYTRYE ++ H+WR  CKAR H P+QPT L  CVD R+
Sbjct  238   KVQVENLKNVANEERISTDSGRGYTRYETLSGHVWRSVCKARGHNPEQPTALGVCVDSRK  297

Query  859   RMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRN  680
             RM+ PLPD Y GNA ++V+    +GE++S+PL   A KIR+AI+ VT+ YV  AIDF +N
Sbjct  298   RMQSPLPDGYLGNATLNVIAVSHAGELMSKPLGYAARKIREAIETVTNAYVRSAIDFLKN  357

Query  679   EGDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDV  521
             + ++ + Q++         F GNPN+ V++W+ LP +GLD GWGKEI+M PG HD DGD 
Sbjct  358   QPNLTRFQDIHALGGTEGPFYGNPNIGVVSWLTLPIYGLDFGWGKEIYMGPGTHDFDGDS  417

Query  520   LILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             L+LP PNG    DGS+++A CLQV H++ F KYFYEDI
Sbjct  418   LLLPSPNG----DGSVILAICLQVAHMEAFKKYFYEDI  451



>ref|XP_010489453.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Camelina 
sativa]
Length=451

 Score =   430 bits (1105),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 220/454 (48%), Positives = 290/454 (64%), Gaps = 22/454 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              + P+EPTW G   L+E DQ+GT+ ++  LYFY  PS      ++ +L+ SLS+VLVHFY
Sbjct  11    TIVPTEPTWIGRFPLAEWDQVGTITHIPTLYFYDKPSESFQGNVVETLKNSLSRVLVHFY  70

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL W             NCN  G   +EAES+  L+D  DFSP PEF +L+P V+Y
Sbjct  71    PMAGRLRWLPRGRFEL-----NCNAEGVEFIEAESEGKLSDFKDFSPTPEFENLMPQVNY  125

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
                +PI  IPLF  QLT+F+CGG+SL   ISH + DGQ   HF+ EWA LA G+PL + P
Sbjct  126   K--NPIETIPLFLAQLTRFKCGGLSLSVNISHAIVDGQSALHFISEWARLARGEPLETVP  183

Query  1201  FHDRRLLRAGEss--sssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
             F DR++L AGE     +S P+ G + F   PP +IG+  N  ER K+T V+ L+LSK Q+
Sbjct  184   FLDRKILWAGEPLPPFASPPKFGHKEFDQ-PPFLIGEKDNVEERKKKTIVAMLKLSKSQL  242

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               L++  N  +  +   RG+TRYE +T H+WRCACKAR H P+QPT L  C+D R RM+P
Sbjct  243   EKLRSKANGSKYADPS-RGFTRYETVTGHVWRCACKARGHSPEQPTALGICIDTRSRMQP  301

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  YFGNA +DVV    SGE+IS  L   AS I  AI  VT+EY+   I++ +N+ D+
Sbjct  302   PLPRGYFGNATLDVVAASTSGELISNELGFAASLISKAIKNVTNEYMMIGIEYLKNQEDL  361

Query  667   IKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLILP  509
              K Q+L         F GNPNL +++W+ LP +GLD GWGKE +  PG HD DGD LILP
Sbjct  362   KKFQDLHALGSTEGPFYGNPNLGLVSWLTLPMYGLDFGWGKEFYTGPGTHDFDGDSLILP  421

Query  508   GPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
               N    +DGS+++A CLQV H++ F K+FYEDI
Sbjct  422   DQN----EDGSVILATCLQVAHMEAFKKHFYEDI  451



>ref|XP_006409088.1| hypothetical protein EUTSA_v10022690mg [Eutrema salsugineum]
 gb|ESQ50541.1| hypothetical protein EUTSA_v10022690mg [Eutrema salsugineum]
Length=451

 Score =   427 bits (1099),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 219/454 (48%), Positives = 288/454 (63%), Gaps = 22/454 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V P+EPTW+G   L+E DQ+GT+ +V  +YFY  P       +  +LR SLS+ L HFY
Sbjct  11    TVVPAEPTWTGRFPLAEWDQVGTITHVPTVYFYDKPPESFQGNVFETLRNSLSRTLFHFY  70

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGR+ W             +CN  G   +EAES+A L+D  DFSP PEF  L+P V+Y
Sbjct  71    PMAGRVRWLPRGRLEL-----DCNAVGVTFIEAESEAELSDFKDFSPTPEFEKLMPQVNY  125

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
                +PI  IPLF  Q+TKF+CGGISL   ISH V DGQ   HF+ EW  ++ G+PL + P
Sbjct  126   K--NPIETIPLFLAQVTKFKCGGISLSVNISHAVVDGQSALHFMSEWGRISRGEPLGTVP  183

Query  1201  FHDRRLLRAGEss--sssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
             F DR++L AGE     +S P+  R+ F   PP +IG++ N  ER K+T V+ L+LSK Q+
Sbjct  184   FLDRKILWAGEPLPPFASLPRFKRKEFEQ-PPFLIGETDNVEERKKKTTVAMLKLSKSQL  242

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               L++  N     +   RG+TRYE +TAH+WRCACKAR H P+QPT L  C+D R R++P
Sbjct  243   EKLRSRVNTSEFADPA-RGFTRYETVTAHVWRCACKARGHSPEQPTALGICIDTRSRVQP  301

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  YFGNA +DVV    SGE+IS  L   A KI  AI  VT+EYV   I++ + + D+
Sbjct  302   PLPRGYFGNATLDVVAASTSGELISNELGFAAGKISKAIKNVTNEYVMTGIEYLKQQEDL  361

Query  667   IKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLILP  509
              K Q+L         F GNPNL +++W+ LP +GLD GWGKEI+M PG HD DGD L+LP
Sbjct  362   KKFQDLHALGSTEGPFYGNPNLGLVSWLTLPLYGLDFGWGKEIYMGPGTHDFDGDSLLLP  421

Query  508   GPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
               N    +DGSL++A CLQV H++ F K+FYEDI
Sbjct  422   DQN----EDGSLILATCLQVAHMEAFKKHFYEDI  451



>ref|XP_006296658.1| hypothetical protein CARUB_v10015907mg [Capsella rubella]
 gb|EOA29556.1| hypothetical protein CARUB_v10015907mg [Capsella rubella]
Length=451

 Score =   426 bits (1095),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 218/454 (48%), Positives = 289/454 (64%), Gaps = 22/454 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              + P+EPTW+G   L+E DQ+GT+ ++  LYFY  PS      ++ +L+ SLS+VLVHFY
Sbjct  11    TIVPAEPTWTGRFPLAEWDQVGTITHIPTLYFYDKPSESFQGNVVETLKTSLSRVLVHFY  70

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL W             NCN  G   +EAES+ +L+D  DFSP  EF +L+P V+Y
Sbjct  71    PMAGRLQWLPRGRFEL-----NCNAEGVEFIEAESEGMLSDFEDFSPTQEFENLMPQVNY  125

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
                +PI  IPL   QLTKF+CGG+SL   ISH + DGQ   HF+ EWA LA G+PL + P
Sbjct  126   K--NPIETIPLVLAQLTKFKCGGLSLSVNISHAIVDGQSALHFMSEWARLARGEPLETVP  183

Query  1201  FHDRRLLRAGEss--sssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
             F DR++L AGE     +S P+   + F   PP +IG+  N  ER K+T V+ L+LSK  +
Sbjct  184   FLDRKILWAGEPLPPFASPPKFDHKEFEQ-PPFLIGEKDNVEERKKKTIVAMLKLSKSHL  242

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               L+   N+ +  ++  RG+TRYE +T H+WRCACKAR H  +QPT L  C+D RRRM+P
Sbjct  243   EKLRNKANSSKHADST-RGFTRYETVTGHVWRCACKARGHSREQPTALGICIDTRRRMQP  301

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  YFGNA +DVV    SGE+IS  L   AS I  AI  VT+EYV   I++ +N+ D+
Sbjct  302   PLPRGYFGNATLDVVAASTSGELISNELGFAASLISKAIKNVTNEYVMIGIEYLKNQEDL  361

Query  667   IKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLILP  509
              K Q+L         F GNPNL +++W+ LP +GLD GWGKE +  PG HD DGD LILP
Sbjct  362   KKFQDLHAMGSTEGPFYGNPNLGLVSWLTLPMYGLDFGWGKEFYTGPGTHDFDGDSLILP  421

Query  508   GPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
               N    +DGS+++A CLQV H++ F K+FYEDI
Sbjct  422   DQN----EDGSVILATCLQVAHMEAFKKHFYEDI  451



>ref|XP_010467740.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Camelina 
sativa]
Length=451

 Score =   426 bits (1094),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 219/454 (48%), Positives = 289/454 (64%), Gaps = 22/454 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              + P+ PTW G   L+E DQ+GT+ ++  LYFY  PS      ++ +L+ SLS+VLVHFY
Sbjct  11    TIVPAAPTWIGRFPLAEWDQVGTITHIPTLYFYDKPSESFKGNVVETLKNSLSRVLVHFY  70

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL W             NCN  G   +EAES+  L+D  +FSP PEF +L+P V+Y
Sbjct  71    PMAGRLRWLPRGRFEL-----NCNAEGVEFIEAESEGKLSDFENFSPTPEFENLMPQVNY  125

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
                +PI  IPLF  QLTKF+CGG+SL   ISH + DGQ   HF+ EWA LA G+PL + P
Sbjct  126   K--NPIETIPLFLAQLTKFKCGGLSLSVNISHAIVDGQSALHFISEWARLARGEPLETVP  183

Query  1201  FHDRRLLRAGEss--sssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
             F DR++L AGE     +S P+   + F   PP +IG+  N  ER K+T V+ L+LSKPQ+
Sbjct  184   FLDRKILWAGEPLPPFASPPKFDHKEFDQ-PPFLIGEKDNVEERKKKTIVAMLKLSKPQL  242

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               L++  N  +  +   RG+TRYE +T H+WRCACKAR H P+QPT L  C+D R RM+P
Sbjct  243   EKLRSKANGSKYADPS-RGFTRYETVTGHVWRCACKARGHSPEQPTALGICIDTRSRMQP  301

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  YFGNA +DVV    SGE+IS  L   AS I  AI  VT+EYV   I++ +N+ D+
Sbjct  302   PLPRGYFGNATLDVVAASTSGELISNELGFAASLISKAIKNVTNEYVMIGIEYLKNQEDL  361

Query  667   IKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLILP  509
              K Q+L         F GNPNL +++W+ LP +GLD GWGKE +  PG HD DGD LILP
Sbjct  362   KKFQDLHALGSTEGPFYGNPNLGLVSWLTLPMYGLDFGWGKEFYTGPGTHDFDGDSLILP  421

Query  508   GPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
               +    +DGS+++A CLQV H++ F K+FYEDI
Sbjct  422   DHD----EDGSVILATCLQVAHMEAFKKHFYEDI  451



>ref|XP_002884178.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60437.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=451

 Score =   423 bits (1088),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 216/454 (48%), Positives = 287/454 (63%), Gaps = 22/454 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              + P+EPTW+G   L+E DQ+GT+ ++  LYFY  PS      ++ +L+ SLS+VLVHFY
Sbjct  11    TIVPAEPTWTGRFPLAEWDQVGTITHIPTLYFYDKPSESFQGNVVETLKESLSRVLVHFY  70

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL W             NCN  G   +EAES+  L+D  DFSP PEF +L+P V+Y
Sbjct  71    PMAGRLRWLPRGRFEL-----NCNAEGVEFIEAESEGKLSDFKDFSPTPEFENLMPQVNY  125

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
                +PI  IPLF  QLTKF+CGG+SL   +SH + DGQ   H + EW  LA G+PL + P
Sbjct  126   K--NPIETIPLFLAQLTKFKCGGLSLSVNVSHAIVDGQSALHLISEWGRLARGEPLETVP  183

Query  1201  FHDRRLLRAGEss--sssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
             F DR++L AGE      S P+   + F   PP +IG++ N  ER K+T V  L+LSK Q+
Sbjct  184   FLDRKILWAGEPLPPFESPPKFDHKEFDQ-PPFLIGETDNVEERKKKTIVVMLKLSKSQL  242

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               L++  N  +  +   +G+TRYE +T H+WRCACKAR H P+QPT L  C+D R RM+P
Sbjct  243   EKLRSKANASKYADPA-KGFTRYETVTGHVWRCACKARGHSPEQPTALGICIDTRSRMQP  301

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  YFGNA +DVV    SGE+IS  L   AS I  AI  VT+EYV   I++ +N+ D+
Sbjct  302   PLPRGYFGNATLDVVAASTSGELISNELGFAASLISKAIKNVTNEYVMIGIEYLKNQEDL  361

Query  667   IKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLILP  509
              K Q+L         F GNPNL +++W+ LP +GLD GWGKE +  PG HD DGD LILP
Sbjct  362   KKFQDLHALGSAEGPFYGNPNLGLVSWLTLPMYGLDFGWGKEFYTGPGTHDFDGDSLILP  421

Query  508   GPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
               N    +DGS+++A CLQV H++ F K+FY+DI
Sbjct  422   DQN----EDGSVILATCLQVAHMEAFKKHFYDDI  451



>gb|ACC68164.1| unknown [Arabidopsis halleri subsp. halleri]
Length=451

 Score =   423 bits (1088),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 216/454 (48%), Positives = 287/454 (63%), Gaps = 22/454 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              + P+EPTW+G   L+E DQ+GT+ ++  LYFY  PS      ++ +L+ SLS+VLVHFY
Sbjct  11    TIVPAEPTWTGRFPLAEWDQVGTITHIPTLYFYNKPSESFQGNVVETLKESLSRVLVHFY  70

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL W             NCN  G   +EAES+  L+D  DFSP PEF +L+P V+Y
Sbjct  71    PMAGRLRWLPRGRFEL-----NCNAEGVEFIEAESEGRLSDFKDFSPTPEFENLMPQVNY  125

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
                +PI  IPLF  QLTKF+CGG+SL   +SH + DGQ   H + EW  LA G+PL + P
Sbjct  126   K--NPIETIPLFLAQLTKFKCGGLSLSVNVSHAIVDGQSALHLISEWGRLARGEPLETVP  183

Query  1201  FHDRRLLRAGEss--sssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
             F DR++L AGE      S P+   + F   PP +IG++ N  ER K+T V  L+LSK Q+
Sbjct  184   FLDRKILWAGEPLPPFESPPKFDHKEFDQ-PPFLIGETDNVEERKKKTIVVMLKLSKSQL  242

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               L++  N  +  +   +G+TRYE +T H+WRCACKAR H P+QPT L  C+D R RM+P
Sbjct  243   EKLRSKANASKYADPA-KGFTRYETVTGHVWRCACKARGHSPEQPTALGICIDTRSRMQP  301

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  YFGNA +DVV    SGE+IS  L   AS I  AI  VT+EYV   I++ +N+ D+
Sbjct  302   PLPRGYFGNATLDVVAASTSGELISNDLGFAASLISKAIKNVTNEYVMIGIEYLKNQKDL  361

Query  667   IKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLILP  509
              K Q+L         F GNPNL +++W+ LP +GLD GWGKE +  PG HD DGD LILP
Sbjct  362   KKFQDLHALGSAEGPFYGNPNLGLVSWLTLPMYGLDFGWGKEFYTGPGTHDFDGDSLILP  421

Query  508   GPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
               N    +DGS+++A CLQV H++ F K+FY+DI
Sbjct  422   DQN----EDGSVILATCLQVAHMEAFKKHFYDDI  451



>ref|NP_179497.1| spermidine hydroxycinnamoyl transferase [Arabidopsis thaliana]
 sp|O64470.1|SHT_ARATH RecName: Full=Spermidine hydroxycinnamoyl transferase; AltName: 
Full=BAHD-like hydroxycinnamoyl transferase [Arabidopsis 
thaliana]
 gb|AAD12025.1| putative anthranilate N-hydroxycinnamoyl/benzoyltransferase [Arabidopsis 
thaliana]
 gb|AAO22784.1| putative anthranilate N-hydroxycinnamoyl/benzoyltransferase [Arabidopsis 
thaliana]
 gb|AAO42450.1| putative anthranilate N-hydroxycinnamoyl/benzoyltransferase [Arabidopsis 
thaliana]
 gb|AEC06845.1| spermidine hydroxycinnamoyl transferase [Arabidopsis thaliana]
Length=451

 Score =   423 bits (1087),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 219/454 (48%), Positives = 284/454 (63%), Gaps = 22/454 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              + P+EPTWSG   L+E DQ+GT+ ++  LYFY  PS      ++  L+ SLS+VLVHFY
Sbjct  11    TIVPAEPTWSGRFPLAEWDQVGTITHIPTLYFYDKPSESFQGNVVEILKTSLSRVLVHFY  70

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL W             NCN  G   +EAES+  L+D  DFSP PEF +L+P V+Y
Sbjct  71    PMAGRLRWLPRGRFEL-----NCNAEGVEFIEAESEGKLSDFKDFSPTPEFENLMPQVNY  125

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
                +PI  IPLF  Q+TKF+CGGISL   +SH + DGQ   H + EW  LA G+PL + P
Sbjct  126   K--NPIETIPLFLAQVTKFKCGGISLSVNVSHAIVDGQSALHLISEWGRLARGEPLETVP  183

Query  1201  FHDRRLLRAGEss--sssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
             F DR++L AGE      S P+   + F   PP +IG++ N  ER K+T V  L LS  Q+
Sbjct  184   FLDRKILWAGEPLPPFVSPPKFDHKEFDQ-PPFLIGETDNVEERKKKTIVVMLPLSTSQL  242

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               L++  N  +  +   +G+TRYE +T H+WRCACKAR H P+QPT L  C+D R RMEP
Sbjct  243   QKLRSKANGSKHSDPA-KGFTRYETVTGHVWRCACKARGHSPEQPTALGICIDTRSRMEP  301

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  YFGNA +DVV    SGE+IS  L   AS I  AI  VT+EYV   I++ +N+ D+
Sbjct  302   PLPRGYFGNATLDVVAASTSGELISNELGFAASLISKAIKNVTNEYVMIGIEYLKNQKDL  361

Query  667   IKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLILP  509
              K Q+L         F GNPNL V++W+ LP +GLD GWGKE +  PG HD DGD LILP
Sbjct  362   KKFQDLHALGSTEGPFYGNPNLGVVSWLTLPMYGLDFGWGKEFYTGPGTHDFDGDSLILP  421

Query  508   GPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
               N    +DGS+++A CLQV H++ F K+FYEDI
Sbjct  422   DQN----EDGSVILATCLQVAHMEAFKKHFYEDI  451



>ref|XP_007211620.1| hypothetical protein PRUPE_ppa005563mg [Prunus persica]
 gb|EMJ12819.1| hypothetical protein PRUPE_ppa005563mg [Prunus persica]
Length=454

 Score =   422 bits (1085),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 221/460 (48%), Positives = 294/460 (64%), Gaps = 31/460 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLS--PDAIIHSLRLSLSQVLVH  1568
             V+KPS PT  G L+LSE DQ+GT+ +V  +YFY    T +  PD I + L+ SLS+ LV 
Sbjct  10    VLKPSTPTLQGTLALSEWDQVGTITHVPTIYFYKPDQTFAAQPDTIANILKDSLSRALVP  69

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL W             +CN  G   +EAESD+ L D GDFSP PE+++L+P+V
Sbjct  70    FYPLAGRLRWIGGGRLEL-----HCNDMGVPFIEAESDSKLDDFGDFSPSPEYDYLIPTV  124

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   PI ++P+   QLT+F+CGG+SL   ISH V DGQ   HF+ EWA LA G+P+  
Sbjct  125   DYTL--PIHELPILLVQLTRFKCGGLSLSLTISHAVVDGQSALHFISEWARLAKGEPIGV  182

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHS----PPLIIGQSSNESERMKETKVSTLRLS  1040
              PF DR+  +       + P G      HS    PPL++GQS N  ERMK T V+ L+L+
Sbjct  183   MPFLDRKAFQ-----DRTLPAGNTLGLDHSELDHPPLLLGQSDNIEERMKRTTVAMLKLT  237

Query  1039  KPQIHALKAADNNGRSC--NAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDI  866
             K Q+  LK   N G     +   R YTRYE +  HIWRCA KAR H+ +QPT +  CVD 
Sbjct  238   KQQVEKLKRMANEGNDYKNSGTKRAYTRYETVAGHIWRCASKARVHRNEQPTAMGVCVDS  297

Query  865   RRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFY  686
             R RM+PPLP  YFGNA  DV+   ++G+++S+PL   +S+I++AI+ VT++YV  AID +
Sbjct  298   RSRMQPPLPQGYFGNATFDVIATSLAGDLVSKPLGYASSRIKEAIEKVTNDYVMSAIDHF  357

Query  685   RNEGDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDG  527
             RN+ D+ + Q+L         F GNPNL V++W+ LP +GLD GWGKEI+M PG HD DG
Sbjct  358   RNQPDLTRFQDLHALGSDQGPFYGNPNLGVVSWLTLPIYGLDFGWGKEIYMGPGPHDFDG  417

Query  526   DVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             D L+LP PNG    DGS+++A CLQV H+  F K+FYEDI
Sbjct  418   DSLLLPSPNG----DGSIVLALCLQVAHMDAFKKHFYEDI  453



>gb|KFK40283.1| hypothetical protein AALP_AA3G354800 [Arabis alpina]
Length=451

 Score =   422 bits (1084),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 215/454 (47%), Positives = 289/454 (64%), Gaps = 22/454 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             ++ P+EPTW+G   L+E DQ+GT+ +V  +YFY  PS      ++ +L+ SLS+ L +FY
Sbjct  11    IIVPAEPTWTGRFPLAEWDQVGTITHVPTVYFYDKPSESFQGDVVETLKNSLSRALFYFY  70

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL W             +CN  GA  +EAES+AVL D  D+SP PEF  L+P V+Y
Sbjct  71    PMAGRLRWLPRGRFEL-----DCNAAGATFIEAESEAVLTDFNDYSPTPEFEKLMPQVNY  125

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
                +PI  IPL   QLTKF+CGG+SLG  +SH V DG    HFL EW  +A  + + + P
Sbjct  126   K--NPIETIPLVLAQLTKFKCGGLSLGVNLSHAVVDGLSALHFLSEWGRIARSEAIETVP  183

Query  1201  FHDRRLLRAGEss--sssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
             F DR++L AGE     +S P+   + F   PPL++G+  N  ER K+T V+ L+LSK Q+
Sbjct  184   FLDRKILWAGEPLPPFASPPRFDHKEFEQ-PPLLLGEKDNVEERKKKTTVAMLKLSKSQL  242

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               LK+  N  +  +   RG+TRYE +T H+WRCACKAR H P+QPT +  CVDIR RM+P
Sbjct  243   EKLKSIVNTSKYADPA-RGFTRYETVTGHVWRCACKARGHSPEQPTAIGICVDIRNRMQP  301

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  YFGNA +DVV    SGE+IS  L   A KI  AI  VT+EYV   I++ +N+ D+
Sbjct  302   PLPRGYFGNATLDVVAASTSGELISNELGFAAEKISKAIKNVTNEYVMIGIEYLKNQDDL  361

Query  667   IKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLILP  509
              K Q+L         F GNPNL +++W+ LP +GLD GWGKE++M PG HD DGD L+L 
Sbjct  362   KKFQDLHALGSTEGPFYGNPNLGLVSWLTLPMYGLDFGWGKEVYMGPGTHDFDGDSLLLT  421

Query  508   GPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
               N    +DGS+++A CLQV H++ F K+FYEDI
Sbjct  422   DQN----EDGSVILATCLQVAHMEAFKKHFYEDI  451



>ref|XP_002325143.2| transferase family protein [Populus trichocarpa]
 gb|EEF03708.2| transferase family protein [Populus trichocarpa]
Length=455

 Score =   420 bits (1079),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 228/458 (50%), Positives = 305/458 (67%), Gaps = 32/458 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST--LSPDAIIHSLRLSLSQVLVH  1568
             VVKP++PTW+G +SLSE DQIGT+ +V  +YFY +        +AII++L+ SLS  LV 
Sbjct  10    VVKPAKPTWTGRVSLSEWDQIGTVTHVPTIYFYKSSPKWPTQSNAIINNLKDSLSHALVP  69

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FY  AGRL W              CN  G  L EAES++ L DLGD +  PE+ +L+P+V
Sbjct  70    FYLLAGRLHWIGRGRLEL-----ECNAMGVTLTEAESESKLEDLGDLT-SPEYQYLIPNV  123

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   P+ ++PL   QLT F+CGGISLG  ISH V DG+    F+ EWA ++ G+PL +
Sbjct  124   DYT--VPLHELPLLLVQLTIFQCGGISLGLRISHAVVDGKSALQFMSEWARISRGEPLGT  181

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSP----PLIIGQSSNESERMKETKVSTLRLS  1040
              PF DR++LRAG+      P   R  F H+     PL++G+ SN  ER K+T ++ LRL+
Sbjct  182   LPFLDRKVLRAGD------PPVARPQFDHAEFGLPPLLLGELSNAEERKKKTTIAMLRLT  235

Query  1039  KPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
             K Q+  LK   N GRS ++  RGYTRYE +T HIWR ACKAR HKP+QPT L  CVD R 
Sbjct  236   KIQVEKLKNMANEGRSIDSG-RGYTRYETLTGHIWRSACKARRHKPEQPTALGVCVDSRG  294

Query  859   RMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRN  680
             RM+PPLPD YFGNA +DV+    +GE++S+PL   ASKIR+AI+ VT+EYV  AIDF +N
Sbjct  295   RMQPPLPDGYFGNASLDVIAVSQAGELLSKPLGYAASKIREAIETVTNEYVISAIDFLKN  354

Query  679   EGDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDV  521
             + D+ + Q++         F GNPN++V++W+ LP +GLD GWG+EI+M PG HD DGD 
Sbjct  355   QPDLTRFQDIHALGGAEGPFYGNPNIAVVSWLTLPIYGLDFGWGEEIYMGPGTHDFDGDS  414

Query  520   LILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             L+LP PN    +DGS+++A CLQV H++ F K FYEDI
Sbjct  415   LLLPSPN----EDGSVILAICLQVAHMEAFKKCFYEDI  448



>ref|XP_004301782.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Fragaria 
vesca subsp. vesca]
Length=465

 Score =   419 bits (1078),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 231/468 (49%), Positives = 304/468 (65%), Gaps = 37/468 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFY-TTPSTLSP-DAIIHSLRLSLSQVLVH  1568
             VVKPS+ TW G L+LSE DQ+GT+ +   +YFY + P+ ++P DAI +SL+ SL++ LV 
Sbjct  10    VVKPSKTTWKGSLTLSEWDQVGTITHCPTIYFYKSNPNWVTPQDAIPNSLKDSLARALVP  69

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL W             +CN  G   VEAES++ L D GD SP PE+N+LVP+V
Sbjct  70    FYPLAGRLRWIGGGRLEL-----DCNAMGVQFVEAESNSKLEDFGDLSPSPEYNYLVPTV  124

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DYS   PI ++PL   QLT+F+CGG+SL   ISH V DG    HF+ EWA LA G+PL  
Sbjct  125   DYSL--PIHELPLLLVQLTRFKCGGVSLSLTISHAVVDGPSALHFISEWARLARGEPLEV  182

Query  1207  APFHDRRLLRAGEsssssSPQGGRRI-FHHS----PPLIIGQSSNESERMKETKVSTLRL  1043
              PF DR++++  + ++   P   + +   HS    PPL++GQS N  ER K+T VS LRL
Sbjct  183   TPFLDRKVMQGRDDNT---PAAAKPLPLDHSEFDQPPLLLGQSDNVEERKKKTIVSMLRL  239

Query  1042  SKPQIHALK--AAD-----NNGRSCNAKLR--GYTRYEVITAHIWRCACKARSHKPQQPT  890
              K Q+  LK  A D     NN  S  +  +  GYTRYE ++ HIWRCACKAR HK +QPT
Sbjct  240   RKDQLEKLKCIANDSYDLYNNSSSAGSTTKRGGYTRYETVSGHIWRCACKARKHKAEQPT  299

Query  889   NLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEY  710
              L  CVD R RM+PPLP  YFGNA  DV+    SGE++S+PL   AS+IR+AI+ V+++Y
Sbjct  300   ALGVCVDSRSRMQPPLPQGYFGNATFDVIATSHSGELVSKPLGYAASRIREAIEKVSNDY  359

Query  709   VNCAIDFYRNEGDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMS  548
             V  AI+  +N+ D+ + Q+L         F GNPNL V++W+ LP +GLD GWGKEI+M 
Sbjct  360   VLSAIENMKNQPDLTRFQDLHALGSDEGPFYGNPNLGVVSWLTLPIYGLDFGWGKEIYMG  419

Query  547   PG-HDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             PG HD DGD LILP  +G    DGS++VA CLQV H+  F K+FYED+
Sbjct  420   PGTHDFDGDSLILPSSDG----DGSVVVALCLQVAHMDAFKKHFYEDL  463



>ref|XP_009358743.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Pyrus x bretschneideri]
Length=455

 Score =   418 bits (1075),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 217/456 (48%), Positives = 291/456 (64%), Gaps = 22/456 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTL--SPDAIIHSLRLSLSQVLVH  1568
              VKPS+PTW G L+LSE DQ+G + +V  +YFY        S D I ++L+ SLS+ LV 
Sbjct  10    AVKPSQPTWQGCLTLSEWDQVGVITHVPTIYFYKPDRNFVTSSDTIANTLKDSLSRALVT  69

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL W             +CN  G   +EAES + L D GDFSP PE+++L+P+V
Sbjct  70    FYPLAGRLHWIGGGRLEL-----DCNAAGVRFIEAESSSKLDDFGDFSPSPEYHYLIPTV  124

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   PI ++P+   QLT F+CGG+SL   ISH V DGQ   HF+ EWA LA G+P+  
Sbjct  125   DYTL--PIHELPILLVQLTTFKCGGVSLSLTISHAVVDGQSALHFISEWARLARGEPIEV  182

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
              PF DR++ +A    + S+  G      + PP ++GQ+ N  ER K+T V+ L L+K Q+
Sbjct  183   MPFLDRKVFQALNIPAGSATLGLDHSEFNHPPFLLGQADNIEERKKKTTVAMLSLTKDQV  242

Query  1027  HALKAADNNGRSCNAK--LRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
               LK   N G +CN     R YTRYE +  HIWRCA KAR HK +QPT +  CVD R RM
Sbjct  243   EKLKRMANEGTNCNNSDTKRAYTRYESVAGHIWRCASKARDHKNEQPTAMGVCVDSRNRM  302

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
             +PPLP  YFGNA  DV+   ++G+++++PL   +S+IR+AI+ VT++YV  AID  RN+ 
Sbjct  303   QPPLPQGYFGNATFDVIATSLAGDLVTKPLGYASSRIREAIEKVTNDYVLSAIDNLRNQP  362

Query  673   DVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLI  515
             D+ + Q+L         F GNPNL V++W+ LP +GLD GWGKEI+M PG HD DGD LI
Sbjct  363   DLTRFQDLHALGSDQGPFYGNPNLGVVSWLTLPLYGLDFGWGKEIYMGPGTHDFDGDSLI  422

Query  514   LPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             LP P+G    +GS +VA CLQV H+  F K+FY+DI
Sbjct  423   LPSPDG----NGSAIVALCLQVAHMDAFKKHFYDDI  454



>ref|XP_010548604.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Tarenaya 
hassleriana]
Length=447

 Score =   418 bits (1074),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 217/453 (48%), Positives = 287/453 (63%), Gaps = 26/453 (6%)
 Frame = -2

Query  1738  VKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDA--IIHSLRLSLSQVLVHF  1565
             V+P+EPTW+G LSL+E DQ+GT+ +V  +YFY  P    P+   ++ +L+ SLS+ L HF
Sbjct  12    VQPAEPTWTGRLSLTEWDQVGTITHVPTVYFYNKP----PENFNVVETLKSSLSRALFHF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL W   +          CNG G   VEAES++ L+  GDFSP PE+ +LVP V+
Sbjct  68    YPLAGRLRWLPKSRLEL-----ECNGAGIPFVEAESESELSGFGDFSPSPEYENLVPQVN  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             Y   +PI  IPL   QLT+FRCGG+ LG  ISH V DGQ   HF+ EWA ++ G+PL +A
Sbjct  123   YE--NPIEKIPLLLVQLTRFRCGGLCLGVNISHAVVDGQSALHFISEWARISCGQPLGTA  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             P+ DRR+LRAGE  +   P    +     PPL+IG   N  ER K+T V+ L+L +  + 
Sbjct  181   PYLDRRILRAGEPPAVKPPPLDLKELEQ-PPLMIGAEDNVEERKKDTTVAMLKLDRADVE  239

Query  1024  ALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP  845
              L+   N     ++  R +TRYE +T H+WR ACKAR H PQQPT L  C+D R RM+PP
Sbjct  240   KLRERANKSEFSDST-RSFTRYEAVTGHVWRSACKARGHFPQQPTALGVCIDSRSRMQPP  298

Query  844   LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  665
             LP  YFGNA +DV+    SGE+IS PL     KIR+AI  V  EYV   I++ +N+ D+ 
Sbjct  299   LPQGYFGNATLDVIAVSTSGELISNPLGYAVRKIREAIKKVNDEYVRSEIEYLKNQEDLK  358

Query  664   KRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLILPG  506
             K Q+L         F GNPNL V++W+ LP +GLD GWGKE++M PG HD DGD L+LP 
Sbjct  359   KFQDLHALGSTEGPFYGNPNLGVVSWLTLPIYGLDFGWGKEVYMGPGTHDFDGDSLLLPD  418

Query  505   PNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
                   D GS+++A CLQV H++ F K+FYEDI
Sbjct  419   ----HEDAGSVVLALCLQVAHMEAFKKHFYEDI  447



>gb|KCW80900.1| hypothetical protein EUGRSUZ_C02269 [Eucalyptus grandis]
Length=457

 Score =   418 bits (1075),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 226/457 (49%), Positives = 296/457 (65%), Gaps = 25/457 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST-LSP-DAIIHSLRLSLSQVLVH  1568
              +KP   TW+G L LSELDQ+G + +V  +YFY  P   L P DAI  +LR SLS+ LV 
Sbjct  12    TIKPETATWTGHLPLSELDQMGIITHVPTIYFYKPPREWLHPADAIFDTLRGSLSRTLVP  71

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL W              CN  G   +EAES+  L DLGDFSP PEF  LVPSV
Sbjct  72    FYPLAGRLRWLEGGRLRL-----ECNAMGVCFIEAESEGELNDLGDFSPRPEFEQLVPSV  126

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   PI ++PL   Q+TKF+CGG++L F++SH VADG    HF+ EWA LA G+ LS 
Sbjct  127   DYT--KPIHELPLLLVQVTKFKCGGLTLSFSMSHAVADGPSALHFMTEWARLARGERLSV  184

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFH---HSPPLIIGQSSNESERMKETKVSTLRLSK  1037
              P++DR++L  G+  SS+ P   R + H   + PPL+IG ++N  ER K+T V+ L+L++
Sbjct  185   EPYYDRKVLWVGDDPSSTPPPRPRHLEHSEFNPPPLLIGHTNNLEERKKKTTVAMLKLTR  244

Query  1036  PQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRR  857
              Q+  LK A N  R+     R YTRYE + AHIWRCACKAR HKP+QPT +  CVD R R
Sbjct  245   TQVETLKNAANKERA--GPHRPYTRYETVAAHIWRCACKARKHKPEQPTAVGICVDSRHR  302

Query  856   MEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  677
             + PPL   YFGNA +DVV  G+SGE++S PL   +SKIR+AI+ VT ++V  AID  R +
Sbjct  303   LHPPLKLGYFGNATLDVVAAGMSGELVSSPLGCTSSKIREAIERVTHDHVRSAIDHIRRQ  362

Query  676   GDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVL  518
              D+   Q++         F GNPNL V++W+ LP +G D GWG+E+HM PG HD DGD L
Sbjct  363   PDLTLFQDVHALGSTRGPFYGNPNLGVVSWLTLPIYGHDFGWGREVHMGPGNHDFDGDSL  422

Query  517   ILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             +LP       ++G L+VA CLQ+ H++DF K+FYEDI
Sbjct  423   VLPSLE----EEGGLVVALCLQIAHMEDFKKFFYEDI  455



>ref|XP_009150708.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Brassica 
rapa]
Length=451

 Score =   418 bits (1074),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 218/454 (48%), Positives = 283/454 (62%), Gaps = 22/454 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              + PSEPTW+G   L+E D +GT+ +V  +YFY  PS L    ++ +LR SLS+ L HFY
Sbjct  11    TIVPSEPTWAGCFPLAEWDLVGTITHVPTVYFYNKPSELFQGNVVETLRNSLSRALFHFY  70

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL W             +CN  G   +EAES+A L+D  DFSP PEF  LVP V+Y
Sbjct  71    PMAGRLKWLPRGRLEL-----DCNAEGVSFMEAESEAKLSDFNDFSPTPEFEKLVPQVNY  125

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
                 PI  IPLF  Q+T+F+CGGISLG +ISH V DGQ   HFL EW  +A G+PL + P
Sbjct  126   K--HPIETIPLFLAQVTRFKCGGISLGVSISHAVVDGQSAFHFLSEWGRIARGEPLETTP  183

Query  1201  FHDRRLLRAGEss--sssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
             F DR++L  G+     +S PQ  R+ F   PPL+IG++ N  ER K+T V  L+LSK  I
Sbjct  184   FLDRKILWTGKPLPPFASPPQCERKGFEQ-PPLLIGETDNVEERKKKTTVEILKLSKTLI  242

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               L++  N     +   RG+TRYE +  H+WRCA KAR H P+QPT+L  CVD R R++P
Sbjct  243   EKLRSRVNTSEYADPA-RGFTRYETVAGHVWRCASKARGHSPEQPTSLGICVDTRSRVQP  301

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  YFGNA I+ V    SGE+IS  L   A KI +AI  VT+EYV   I++ +N  D+
Sbjct  302   PLPRGYFGNATINAVARSTSGELISNGLGFAAEKISEAIKSVTNEYVMTGIEYLKNHEDL  361

Query  667   IKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSP-GHDCDGDVLILP  509
                Q++         F GNPNL +++W+ LP +GLD GWGKE+HM P  HD DG  L+LP
Sbjct  362   KTFQDIHALGSTDGPFYGNPNLGLVSWLTLPMYGLDFGWGKEVHMGPCTHDGDGGSLLLP  421

Query  508   GPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
               N    DDGSL++A CLQV H++ F K+ YEDI
Sbjct  422   DKN----DDGSLILATCLQVAHMEAFKKHLYEDI  451



>ref|XP_010050943.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Eucalyptus 
grandis]
Length=455

 Score =   418 bits (1074),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 226/457 (49%), Positives = 296/457 (65%), Gaps = 25/457 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST-LSP-DAIIHSLRLSLSQVLVH  1568
              +KP   TW+G L LSELDQ+G + +V  +YFY  P   L P DAI  +LR SLS+ LV 
Sbjct  10    TIKPETATWTGHLPLSELDQMGIITHVPTIYFYKPPREWLHPADAIFDTLRGSLSRTLVP  69

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL W              CN  G   +EAES+  L DLGDFSP PEF  LVPSV
Sbjct  70    FYPLAGRLRWLEGGRLRL-----ECNAMGVCFIEAESEGELNDLGDFSPRPEFEQLVPSV  124

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   PI ++PL   Q+TKF+CGG++L F++SH VADG    HF+ EWA LA G+ LS 
Sbjct  125   DYT--KPIHELPLLLVQVTKFKCGGLTLSFSMSHAVADGPSALHFMTEWARLARGERLSV  182

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFH---HSPPLIIGQSSNESERMKETKVSTLRLSK  1037
              P++DR++L  G+  SS+ P   R + H   + PPL+IG ++N  ER K+T V+ L+L++
Sbjct  183   EPYYDRKVLWVGDDPSSTPPPRPRHLEHSEFNPPPLLIGHTNNLEERKKKTTVAMLKLTR  242

Query  1036  PQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRR  857
              Q+  LK A N  R+     R YTRYE + AHIWRCACKAR HKP+QPT +  CVD R R
Sbjct  243   TQVETLKNAANKERA--GPHRPYTRYETVAAHIWRCACKARKHKPEQPTAVGICVDSRHR  300

Query  856   MEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  677
             + PPL   YFGNA +DVV  G+SGE++S PL   +SKIR+AI+ VT ++V  AID  R +
Sbjct  301   LHPPLKLGYFGNATLDVVAAGMSGELVSSPLGCTSSKIREAIERVTHDHVRSAIDHIRRQ  360

Query  676   GDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVL  518
              D+   Q++         F GNPNL V++W+ LP +G D GWG+E+HM PG HD DGD L
Sbjct  361   PDLTLFQDVHALGSTRGPFYGNPNLGVVSWLTLPIYGHDFGWGREVHMGPGNHDFDGDSL  420

Query  517   ILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             +LP       ++G L+VA CLQ+ H++DF K+FYEDI
Sbjct  421   VLPSLE----EEGGLVVALCLQIAHMEDFKKFFYEDI  453



>ref|XP_010414994.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Camelina 
sativa]
Length=456

 Score =   415 bits (1067),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 218/458 (48%), Positives = 285/458 (62%), Gaps = 25/458 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              + P+EPTW G   L+E DQ+GT+ ++  LYFY  P       ++ +L+ SLS+VLVHFY
Sbjct  11    TIVPAEPTWIGRFPLAEWDQVGTISHIPTLYFYDKPYESFQGNVVETLKNSLSRVLVHFY  70

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL W             NCN  G   +EAES+  L+D  DFSP PEF +L+P V+Y
Sbjct  71    PMAGRLRWLPRGRFEL-----NCNAEGVEFIEAESEGKLSDFEDFSPTPEFENLMPQVNY  125

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
                +PI  IPLF  QLTKF+CGG+SL   ISH + DGQ   HF+ EWA LA G+PL + P
Sbjct  126   K--NPIETIPLFLAQLTKFKCGGLSLSVNISHAIVDGQSALHFISEWARLARGEPLETIP  183

Query  1201  FHDRRLLRAGEss--sssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
             F DR++L AGE     +S P+   + F   PP +IG+  N  ER K+T V+ L+LS+ Q+
Sbjct  184   FLDRKILWAGEPLPPFASPPKFDHKEFDQ-PPFLIGEKDNVEERKKKTIVTMLKLSESQL  242

Query  1027  H----ALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
                    +    NG   +   RG+TRYE +T H+WRCACKAR H P+QPT L  C+D R 
Sbjct  243   ENSNKKRRENKANGSKYSDSSRGFTRYETVTGHVWRCACKARGHSPEQPTALGICIDTRS  302

Query  859   RMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRN  680
             RM+PPLP  YFGNA +DVV    SGE+IS  L   AS I  AI  VT+EYV   I++ +N
Sbjct  303   RMQPPLPRGYFGNATLDVVAASTSGELISNELGFAASLISKAIKNVTNEYVMIGIEYLKN  362

Query  679   EGDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDV  521
             + D+ K Q+L         F GNPNL +++W+ LP  GLD GWGKE +  PG HD DGD 
Sbjct  363   QEDLKKFQDLHALGSTEGPFYGNPNLGLVSWLTLPMCGLDFGWGKEFYTGPGTHDFDGDS  422

Query  520   LILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             LILP  +    +DGS+++A CLQV H++ F K+FYEDI
Sbjct  423   LILPDHD----EDGSVILATCLQVTHMEAFKKHFYEDI  456



>ref|XP_008372277.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Malus domestica]
Length=455

 Score =   415 bits (1066),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 218/456 (48%), Positives = 291/456 (64%), Gaps = 22/456 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTL--SPDAIIHSLRLSLSQVLVH  1568
              +KPS+PTW G L+LSE DQ+G + +V  +YFY        S D I ++L+ SLS+ LV 
Sbjct  10    ALKPSQPTWQGCLTLSEWDQVGVITHVPTIYFYKPDHNFVTSSDTIANTLKDSLSRALVP  69

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL W             +CN  G   +EAES + L D GDFSP PE+++L+P+V
Sbjct  70    FYPLAGRLHWIGGGRLEL-----DCNAVGVRFIEAESSSKLDDFGDFSPSPEYHYLIPTV  124

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   PI ++P+   QLT F+CGG+SL  AISH V DGQ   HF+ EWA LA G+P+  
Sbjct  125   DYTL--PIHELPILLVQLTTFKCGGVSLSLAISHAVVDGQSALHFISEWARLARGEPIEV  182

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
              PF DR++ +A    + S+  G      + PPLI+GQ+ N  ER K+T V+ L L+K Q+
Sbjct  183   VPFLDRKVFQALNLPAGSATLGLDHSEFNHPPLILGQADNIEERKKKTTVAMLSLTKDQV  242

Query  1027  HALKAADNNGRSCNAK--LRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
               LK   N G + N     R YTRYE +  HIWRCA KAR HK +QPT +  CVD R RM
Sbjct  243   EKLKRMANEGTNFNNSDTKRAYTRYESVAGHIWRCASKARDHKNEQPTAMGVCVDSRSRM  302

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
             +PPLP  YFGNA  DV+   ++G+++++PL   +S+IR+AI+ VT++YV  AID  RN+ 
Sbjct  303   QPPLPQGYFGNATFDVIATSLAGDLVTKPLGYASSRIREAIEKVTNDYVLSAIDNLRNQP  362

Query  673   DVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLI  515
             D+ + Q+L         F GNPNL V++W+ LP +GLD GWGKEI+M PG H  DGD LI
Sbjct  363   DLTRFQDLQALGSDQGPFYGNPNLGVVSWLTLPLYGLDFGWGKEIYMGPGTHGFDGDSLI  422

Query  514   LPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             LP P+G    +GS +VA CLQV H+  F K+FYEDI
Sbjct  423   LPSPDG----NGSAIVALCLQVAHMDAFKKHFYEDI  454



>ref|XP_011018001.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Populus euphratica]
Length=455

 Score =   414 bits (1063),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 227/458 (50%), Positives = 305/458 (67%), Gaps = 32/458 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT-TPSTLS-PDAIIHSLRLSLSQVLVH  1568
             VVKP++PTW+G +SLSE DQIGT+ +V  +YFY  +P  L+  +A+I++L+ SLS  LV 
Sbjct  10    VVKPAKPTWTGRVSLSEWDQIGTITHVPTVYFYKPSPKWLTQSNAVINNLKDSLSHALVP  69

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FY  AGRL W              CN  G  L EAES++ L DLGD  P PE+ +L+P+V
Sbjct  70    FYLLAGRLHWIGRGRLEL-----ECNAMGVTLTEAESESKLEDLGDLPP-PEYQYLIPNV  123

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   P+ ++PL   QLT F+CG ISLG  ISHVV DG+    F+ EWA ++ G+ L +
Sbjct  124   DYT--VPLHELPLLLVQLTIFQCGSISLGLRISHVVVDGKSALQFMSEWARISRGESLGT  181

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSP----PLIIGQSSNESERMKETKVSTLRLS  1040
              PF DR++LRAG+      P   R  F H+     PL++G+ SN  ER K+T  + LRL+
Sbjct  182   LPFLDRKVLRAGD------PPLARPQFDHAEFGLPPLLLGELSNAEERKKKTTTAMLRLT  235

Query  1039  KPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
             K Q+  LK   N GRS ++  RGYTRYE +T H+WR ACKAR HKP+QPT L  CVD R 
Sbjct  236   KIQVEKLKNMANEGRSIDSG-RGYTRYETLTGHVWRSACKARRHKPEQPTALGVCVDSRG  294

Query  859   RMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRN  680
             RM+PPLPD YFGNA +DV+    +GE++S+PL   ASKIR+AI+ VT+EYV  AIDF +N
Sbjct  295   RMQPPLPDGYFGNASLDVIAVSQAGELLSKPLGYAASKIREAIETVTNEYVISAIDFLKN  354

Query  679   EGDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDV  521
             + D+ + Q++         F GNPN++V++W+ LP +GLD GWG+EI+M PG H  DGD 
Sbjct  355   QPDLTRFQDIHALGGAEGPFCGNPNIAVVSWLTLPIYGLDFGWGEEIYMGPGTHAFDGDS  414

Query  520   LILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             L+LP PN    +DGS+++A CLQV H++ F K FYEDI
Sbjct  415   LLLPSPN----EDGSVILAICLQVAHMEAFKKCFYEDI  448



>ref|XP_007161968.1| hypothetical protein PHAVU_001G112900g [Phaseolus vulgaris]
 gb|ESW33962.1| hypothetical protein PHAVU_001G112900g [Phaseolus vulgaris]
Length=455

 Score =   413 bits (1061),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 221/455 (49%), Positives = 289/455 (64%), Gaps = 20/455 (4%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST--LSPDAIIHS-LRLSLSQVLV  1571
              VKP EPT  G + LSE DQIGT+ +V  +YFY       L P+  I S L+ SLS+VLV
Sbjct  10    TVKPMEPTKCGRVPLSEWDQIGTITHVPTIYFYRLSQNFHLFPNNTIASNLKDSLSRVLV  69

Query  1570  HFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPS  1391
              FYP AGRL W +           +CN  G   VEA+S + L DLGDFSP  E ++L P 
Sbjct  70    PFYPLAGRLRWISNGRLEL-----DCNAMGVQFVEAQSSSSLEDLGDFSPSSEHHYLFPK  124

Query  1390  VDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLS  1211
             VDY+   PI ++PL   QLTKF+CGGIS+   ISH VADG    HF  EWA LA G+ L 
Sbjct  125   VDYTL--PIHELPLVLAQLTKFKCGGISISMTISHAVADGPSALHFTREWARLARGETLE  182

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
               PF D ++ RAGE  S    +       + PPL++GQ++N  ER K+T V+ L+LSK Q
Sbjct  183   KVPFLDWKVFRAGEPPSVPLTKCHVHTEFNHPPLLLGQTNNSEERKKKTTVAILKLSKFQ  242

Query  1030  IHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             +  L+   N   +     R Y+RYE +T H+WR ACKAR HK +QPT +  CVD R RME
Sbjct  243   VETLRKTANESWNRPRNGRAYSRYESVTGHVWRSACKARGHKEEQPTAVGICVDSRSRME  302

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             PPLP  YFGNA +DV+   ++G+++S+PL   +S+IR+AI+ V  EYV   ++F +N+ D
Sbjct  303   PPLPKEYFGNATLDVIASSLAGDLMSKPLGYASSRIREAIERVNDEYVRSGVEFLKNQED  362

Query  670   VIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLIL  512
             + + Q+L         F GNPNL V++W+ LP +G+D GWGKE++M PG HD DGD L+L
Sbjct  363   LSRFQDLYAVGSEKGPFYGNPNLGVVSWLTLPIYGVDFGWGKEVYMGPGTHDFDGDSLLL  422

Query  511   PGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             PGP   DGDDGSLL+A CLQV H+  F K+FYEDI
Sbjct  423   PGP---DGDDGSLLLALCLQVVHMDAFKKHFYEDI  454



>ref|XP_008223799.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Prunus mume]
Length=454

 Score =   412 bits (1060),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 216/460 (47%), Positives = 293/460 (64%), Gaps = 31/460 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLS--PDAIIHSLRLSLSQVLVH  1568
             V+KPS PT  G L+LSE DQ+GT+ +V  +YFY    T +  PD I + L+ SLS+ LV 
Sbjct  10    VLKPSTPTLQGTLALSEWDQVGTITHVPTIYFYKPDQTFAAQPDTIANILKDSLSRALVP  69

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL W             +CN  G   +EAESD+ L D GDFSP PE+++L+P+V
Sbjct  70    FYPLAGRLRWIGGGRLEL-----HCNDIGVPFIEAESDSKLDDFGDFSPSPEYDYLIPTV  124

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   PI ++P+   QLT+F+CGG+SL   ISH V DGQ   HF+ EWA LA G+P+  
Sbjct  125   DYTL--PIHELPILLVQLTRFKCGGLSLSLTISHAVVDGQSALHFISEWARLAKGEPIGV  182

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHS----PPLIIGQSSNESERMKETKVSTLRLS  1040
              PF DR+  +       + P G      HS    PPL++G+S N  ER K+T V+ L+L+
Sbjct  183   MPFLDRKAFQ-----DRTLPAGNTLGLDHSELDHPPLLLGESDNIEERKKKTTVAMLKLT  237

Query  1039  KPQIHALKAADNNGRSC--NAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDI  866
             K Q+  LK   N G     +   R YTRYE +  HIWRCA KAR H+ +Q T +  CVD 
Sbjct  238   KQQVEKLKRMANEGNDYKNSGTKRAYTRYETVAGHIWRCASKARVHRNEQSTAMGVCVDS  297

Query  865   RRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFY  686
             R RM+PPLP  YFGNA  DV+   ++G+++S+PL   +S+I++AI+ VT++YV  AID +
Sbjct  298   RSRMQPPLPQGYFGNATFDVIATSLAGDLVSKPLGYASSRIKEAIEKVTNDYVLSAIDHF  357

Query  685   RNEGDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDG  527
             RN+ D+ + Q+L         F GNPNL V++W+ LP +GLD GWGKEI+M PG HD DG
Sbjct  358   RNQPDLTRFQDLHALGSDQGPFYGNPNLGVVSWLTLPIYGLDFGWGKEIYMGPGPHDFDG  417

Query  526   DVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             D L+LP P+G    DGS+++A CLQV H+  F K+FYED+
Sbjct  418   DSLLLPSPDG----DGSIVLALCLQVAHMDAFKKHFYEDL  453



>ref|XP_008223800.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Prunus 
mume]
Length=462

 Score =   412 bits (1059),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 217/460 (47%), Positives = 292/460 (63%), Gaps = 31/460 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTL--SPDAIIHSLRLSLSQVLVH  1568
             V+KPS PT  G L+LSE DQ+GT+ +V I+YFY         PDA +++L+ SL + LV 
Sbjct  10    VLKPSTPTLQGSLALSESDQVGTVSHVSIIYFYRPDQNFVSQPDATVNTLKDSLCRALVP  69

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL W             +CNG G   +EAESD+ L DLGDFSP PE+++++P+V
Sbjct  70    FYPLAGRLHWIGGGRLEL-----DCNGMGVQFIEAESDSKLDDLGDFSPSPEYDYIIPTV  124

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   PI ++P+   QLT+FRCGG+SLG  ISH V DGQ   HF+ EWA LA G+P+  
Sbjct  125   DYTL--PIHELPILLVQLTRFRCGGLSLGLTISHAVVDGQSTFHFISEWARLAKGEPIGV  182

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSP----PLIIGQSSNESERMKETKVSTLRLS  1040
              PF DR+  +A      + P G      HS     PL++GQS N  ER K+T V+ L+L+
Sbjct  183   MPFLDRKAFQA-----RTLPAGNTLGLDHSELDRLPLLLGQSDNIEERKKKTTVAMLKLT  237

Query  1039  KPQIHALKAADNNGRSCN--AKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDI  866
             K Q+  LK   N G   N     RGYTRYE +  HIWRCA KAR H+ +QPT +  CVD+
Sbjct  238   KQQVEKLKRMANEGNDYNNSGTKRGYTRYETVAGHIWRCASKARVHRNEQPTAMGVCVDL  297

Query  865   RRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFY  686
             R RM PPLP  YFGNA    V   ++G+++S+PL   +S+IR+AI+ V+++YV  AID +
Sbjct  298   RSRMLPPLPQGYFGNATFYGVARSLAGDLVSKPLGYASSRIREAIEKVSNDYVLSAIDHF  357

Query  685   RNEGDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDG  527
             RN+ D+ + Q+L         F GNPNL V++W  LP +GLD GWGKEI+M  G +D DG
Sbjct  358   RNQPDLTRFQDLHALGIAEGNFYGNPNLEVVSWSTLPIYGLDFGWGKEIYMGSGTYDFDG  417

Query  526   DVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             +  +LP P+G    DGS+++  CLQV H+  F K+FYEDI
Sbjct  418   ESFLLPSPDG----DGSMVLTLCLQVAHMDAFKKHFYEDI  453



>gb|AFF57840.1| hydroxycinnamoyl-coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
2 [Pyrus x bretschneideri]
Length=455

 Score =   412 bits (1058),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 215/456 (47%), Positives = 289/456 (63%), Gaps = 22/456 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTL--SPDAIIHSLRLSLSQVLVH  1568
              VKPS+PTW G L+LSE DQ+G + +V  +YFY        S D I ++L+ SLS+ LV 
Sbjct  10    AVKPSQPTWQGCLTLSEWDQVGLITHVPTIYFYKPDHNFVTSSDTIANTLKDSLSRALVT  69

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL W             +CN  G   +EAES + L D GDFSP PE+++L+P++
Sbjct  70    FYPLAGRLHWIGGGRLEL-----DCNAVGVRFIEAESSSKLDDFGDFSPSPEYHYLIPTL  124

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   PI ++P+   QLT F+CGG+SL   ISH V DGQ   HF+ EWA LA G+P+  
Sbjct  125   DYTL--PIHELPILLVQLTTFKCGGVSLSLTISHAVVDGQSALHFISEWARLARGEPIEV  182

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
              PF DR++ +A    + S+  G      + PP ++GQ+ N  ER K+T V+ L L+K Q+
Sbjct  183   MPFLDRKVFQALNIPAGSATLGLDHSEFNHPPFLLGQADNTEERKKKTTVAMLSLTKDQV  242

Query  1027  HALKAADNNGRSCNAK--LRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
               LK   N G + N     R YTRYE +  HIWRCA KAR HK +QPT +  CVD R RM
Sbjct  243   EKLKRMANEGTNFNNSDTKRAYTRYESVAGHIWRCASKARDHKNEQPTAMGVCVDSRNRM  302

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
             +PPLP  YFGNA  DV+   ++G+++++PL   +S+IR+AI+ VT++YV  AID  RN+ 
Sbjct  303   QPPLPQGYFGNATFDVIATSLAGDLVTKPLGYASSRIREAIEKVTNDYVLSAIDNLRNQP  362

Query  673   DVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLI  515
             D+ + Q+L         F GNPNL V++W+ LP +GLD GWGKEI+M PG HD DG  LI
Sbjct  363   DLTRFQDLHALGSDQGPFYGNPNLGVVSWLTLPLYGLDFGWGKEIYMGPGTHDFDGHSLI  422

Query  514   LPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             LP P+G    +GS +VA CLQV H+  F K+FYEDI
Sbjct  423   LPSPDG----NGSAIVALCLQVAHMDAFKKHFYEDI  454



>ref|XP_003550655.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=455

 Score =   411 bits (1056),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 221/456 (48%), Positives = 291/456 (64%), Gaps = 25/456 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPD-AIIHSLRLSLSQVLVHF  1565
              VKP E TW G +SLSE DQ G + +V I+YFY TPS  S + +I  +L+ SLS+VLV F
Sbjct  10    TVKPIETTWCGRVSLSEWDQTGNVTHVPIIYFYRTPSQESNNNSIASTLKDSLSRVLVPF  69

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGD-FSPGPEFNHLVPSV  1388
             YP AGRL W             +CN  G   +EAES +   DLGD FSP  E+N+LVP+V
Sbjct  70    YPLAGRLHWINNGRLEL-----DCNAMGVQFIEAESSSSFEDLGDDFSPSSEYNYLVPTV  124

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   PI  +PL   QLT F+CGG+S+G  +SH V DG   SHF+ EWA LA G+PL +
Sbjct  125   DYTL--PIHGLPLVLIQLTNFKCGGVSIGITLSHAVVDGPSASHFISEWARLARGEPLQT  182

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
              PFHDR++L AG+  S    +         PPL++G++ N  ER K+T +  L+LSK Q+
Sbjct  183   VPFHDRKVLHAGDPPSVPLARCHSHTEFDEPPLLLGKTDNTEERKKKTAMVILKLSKTQV  242

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               LK   N G   N     Y+RYE I  HIWR ACKAR HK  QPT L+  VD R RMEP
Sbjct  243   ETLKKTANYGGYGN---DSYSRYEAIAGHIWRSACKARGHKEDQPTTLTVIVDSRSRMEP  299

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  YFGNA +D V   ++G+++S+PL   +S+IR+AI+ V+ EYV   I+F +N+ D+
Sbjct  300   PLPKGYFGNATLDTVATSLAGDLVSKPLGYASSRIREAIERVSDEYVRSGIEFLKNQEDL  359

Query  667   IK-RQELGTF-------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLI  515
              +  Q+L          F GNPNL+V++W+ LP +G+D GWGKE++MSP  HD DGD ++
Sbjct  360   RRFHQDLHAIESEKKEPFYGNPNLAVVSWLTLPIYGVDFGWGKELYMSPATHDFDGDFVL  419

Query  514   LPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             LPGP+G    DGSLLV   LQV+H+  F K+FYEDI
Sbjct  420   LPGPDG----DGSLLVCLGLQVEHMDAFKKHFYEDI  451



>ref|XP_007154735.1| hypothetical protein PHAVU_003G143100g [Phaseolus vulgaris]
 gb|ESW26729.1| hypothetical protein PHAVU_003G143100g [Phaseolus vulgaris]
Length=469

 Score =   406 bits (1043),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 219/457 (48%), Positives = 285/457 (62%), Gaps = 22/457 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST--LSPDAIIHS-LRLSLSQVLV  1571
              VKP EPT  G + LSE DQIGT+ +V  +YFY       L P+  I S L+ SLS+VLV
Sbjct  10    TVKPMEPTKCGRVPLSEWDQIGTITHVPTIYFYRLSQNFHLFPNNTIASNLKDSLSRVLV  69

Query  1570  HFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPS  1391
              FYP AGRL W +           +CN  G   VEA+S + L DLGDFSP  E ++L P 
Sbjct  70    PFYPLAGRLRWISNGRLEL-----DCNAMGVQFVEAQSSSSLEDLGDFSPSSEHHYLFPK  124

Query  1390  VDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLS  1211
             VDY+   PI ++PL   QLTKF+CGGIS+   ISH VADG    HF  EWA LA G+ L 
Sbjct  125   VDYTL--PIHELPLVLAQLTKFKCGGISISMTISHAVADGPSALHFTREWARLARGETLE  182

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
               PF D ++ RAGE  S    +         PPL++GQ++N  ER K+T V+ L+LSK Q
Sbjct  183   KVPFLDWKVFRAGEPPSVPLTKCHVHTEFDHPPLLLGQTNNSEERKKKTTVANLKLSKFQ  242

Query  1030  IHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             +  L+   N   +     R Y+RYE +T H+WR  CKAR H+ +QPT +  CVD R RME
Sbjct  243   VETLRKTANESWNRPRNGRAYSRYESVTGHVWRSVCKARGHREEQPTGVGICVDSRSRME  302

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             PPLP  YFGNA + VV   ++G+++S+PL   +S+IR+AI+ V  EYV  A++F +N+ D
Sbjct  303   PPLPKEYFGNATLYVVASSLAGDLMSKPLGYASSRIREAIERVNDEYVRSAVEFLKNQED  362

Query  670   VIKRQELGT------FFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG---HDCDGDVL  518
             + + Q+L         F GNPNL V++W+ LP +GLD GWGKE++M PG   HD DGD L
Sbjct  363   LSRFQDLHAVESEKGLFYGNPNLGVVSWLTLPFYGLDFGWGKEVYMGPGTHVHDFDGDSL  422

Query  517   ILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             +LPGP   D DDGSLL+  CLQV H+  F K+FYEDI
Sbjct  423   LLPGP---DEDDGSLLLHLCLQVVHMDAFKKHFYEDI  456



>emb|CDY03367.1| BnaC09g09810D [Brassica napus]
Length=451

 Score =   400 bits (1029),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 211/454 (46%), Positives = 282/454 (62%), Gaps = 22/454 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V P+EPTW+G   L+E DQ+GT+ +V  +YFY  P       ++ +L+ SLS+ L HFY
Sbjct  11    TVVPAEPTWTGRFPLAEWDQVGTITHVPTIYFYDKPPDSFQGNVVETLKNSLSRALFHFY  70

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL W             +CN  G  L+EAES+A L D  +F    EF  LVP V+Y
Sbjct  71    PLAGRLRWLPQDRLEL-----DCNAAGVKLMEAESEAELIDFNNFLGAAEFEKLVPQVNY  125

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
                 PI  IPLF  Q+TKF+CG ISL   +SH V DGQ   HFL EW  +A G+PL + P
Sbjct  126   K--SPIETIPLFLAQVTKFKCGRISLSVKVSHAVVDGQSALHFLSEWGRIARGEPLETVP  183

Query  1201  FHDRRLLRAGEss--sssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
             F DR++L AGE     ++SPQ   + F   PPL+IG++    ER KET V+ LRLSK Q+
Sbjct  184   FLDRKVLWAGEQLPPFATSPQYEGKEFEE-PPLLIGETDCVEERKKETVVAMLRLSKSQL  242

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               L++  N     +   RG+TRYE +T H+WRCACKAR H P+QPT L   VD R R++P
Sbjct  243   QKLRSRVNTSEYADPA-RGFTRYETVTGHVWRCACKARGHSPEQPTGLVISVDARNRVQP  301

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  YFGNA +DVV   +SGE+I+  L   A KI  AI  VT+EYV   I++ +N  D+
Sbjct  302   PLPRGYFGNATLDVVAASISGELITNELGFAAGKISKAIKNVTNEYVMTGIEYLKNHEDL  361

Query  667   IKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLILP  509
              + Q++ T       F GNPNL +++W+ LP +GLD GWG+E++M PG +D DG+ L+L 
Sbjct  362   KEFQDIHTLGSTEGPFYGNPNLGLVSWLTLPMYGLDFGWGQEVYMGPGTNDLDGNSLLLS  421

Query  508   GPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
               N    +DGSL++A C QV H++ F K+FYEDI
Sbjct  422   DKN----EDGSLILATCQQVVHMEAFKKHFYEDI  451



>ref|XP_010051711.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Eucalyptus 
grandis]
Length=457

 Score =   401 bits (1030),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 218/462 (47%), Positives = 289/462 (63%), Gaps = 35/462 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTL--SPDAIIHSLRLSLSQVLVH  1568
              +KP   TWSG L LSELDQI  + +   +YFY  PS    S DAI ++LR SL +VLV 
Sbjct  12    TIKPETETWSGYLPLSELDQIDMISHWYTIYFYKPPSEWLHSADAIFNTLRASLRRVLVP  71

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL               +CN  G  L+EAES+  L DLGDF PGP+F  L+PS+
Sbjct  72    FYPLAGRLERLDGGRLRL-----DCNAMGVWLIEAESEGELNDLGDFCPGPDFEQLMPSL  126

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   PI + PL   Q+TKFRCGG++L  +ISHVVADG   +HF  EWA LA G+PL+ 
Sbjct  127   DYTM--PIHEQPLLLVQVTKFRCGGLALSLSISHVVADGLSAAHFYNEWAWLARGEPLNI  184

Query  1207  APFHDRRLLRAGEsssssSPQGGR--------RIFHHSPPLIIGQSSNESERMKETKVST  1052
              P++DR++L  GE      P G R          F+H PPL+IG ++N  +RMK+T ++ 
Sbjct  185   EPYYDRKVLWVGED-----PSGARLPPPNLELSEFNH-PPLLIGHANNLEQRMKKTALAM  238

Query  1051  LRLSKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCV  872
             L+++K Q+  LK A N  R  +   R YTR+E I AHIWRC CKAR HKP+Q T+L F +
Sbjct  239   LKVTKTQVETLKNAVNKDRPSHHP-RPYTRFETIAAHIWRCVCKARKHKPEQATSLYFYI  297

Query  871   DIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAID  692
             D R R+ PPL   +FGNA+ ++V  G SGE++S PL+  +S IR+AI+ VT ++V  AI+
Sbjct  298   DARSRLRPPLKPGFFGNAVFNMVAGGTSGELVSSPLRCTSSVIREAIEAVTHDHVKSAIE  357

Query  691   FYRNEGDVIKRQELGT------FFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDC  533
               R + D+   Q+L         F GNPNL +  W+ LP +GLD GWG+EIHM  G HD 
Sbjct  358   HIRRQPDLTTFQDLHAQGSTQGVFYGNPNLRLSCWLTLPLNGLDFGWGREIHMGLGNHDL  417

Query  532   DGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             D D ++LPG      + G L+VA CLQ  HI+DF K+FY+DI
Sbjct  418   DADSVVLPGRE----EAGGLVVAVCLQTAHIEDFKKFFYDDI  455



>ref|XP_003550654.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=460

 Score =   399 bits (1024),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 216/458 (47%), Positives = 288/458 (63%), Gaps = 29/458 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFY--TTPSTLSPDAIIHSLRLSLSQVLVH  1568
              V+P EPT    + LSE DQIGT+ +V  +YFY  T+    + + +  +L+ +LS+ LV 
Sbjct  11    TVRPMEPTKCERVPLSEWDQIGTITHVPTIYFYRPTSQDKDNVNTVASTLKDALSRALVP  70

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL W             +CN  G   +EAES   L +LGDFSP  E+N+LVP+V
Sbjct  71    FYPLAGRLHWINKGRLEL-----DCNAMGVHFIEAESSLTLENLGDFSPSSEYNNLVPNV  125

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   PI ++P+   QLT F+CGG S+    SH VADG    HFL EWA L+ G+ L +
Sbjct  126   DYTL--PIHELPVVLIQLTNFKCGGFSISLNTSHAVADGPSALHFLCEWARLSRGELLQT  183

Query  1207  APFHDRRLLRAGEsssssSPQGGRRI----FHHSPPLIIGQSSNESERMKETKVSTLRLS  1040
             AP  DR + RAGE      P    R+    F H PPL++GQ++N  ER K+T V  L+L+
Sbjct  184   APLFDRTVFRAGEPPLM--PLTECRVHKDQFIH-PPLLLGQTNNTEERKKKTTVVILKLT  240

Query  1039  KPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
             K Q+  LK   N   S +A  R YTRYE +T H+WR ACKAR HK  QPT L  CVD R 
Sbjct  241   KTQVETLKKTANESNSGHA--RCYTRYESVTGHVWRTACKARGHKEDQPTALGVCVDSRS  298

Query  859   RMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRN  680
             RMEPPLP  YFGNA +D V   ++G+++S+PL    S+IR+AI+ VT EYV   I+F +N
Sbjct  299   RMEPPLPKGYFGNATLDTVATSLAGDLVSKPLGYACSRIREAIERVTDEYVRTGIEFLKN  358

Query  679   EGDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDV  521
             + D+ + Q+L         F GNPNL V++W+ LP +G+D GWGKE++M PG HD DGD 
Sbjct  359   QEDLSRFQDLYAIGSEKGPFYGNPNLGVVSWLTLPIYGVDFGWGKEVYMGPGTHDFDGDS  418

Query  520   LILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             L+LPGP+G    +GS+L+A CLQV H+  F K+FY+DI
Sbjct  419   LLLPGPDG----EGSVLLALCLQVPHMDTFKKHFYQDI  452



>emb|CDY66506.1| BnaAnng22360D [Brassica napus]
Length=442

 Score =   398 bits (1022),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 210/448 (47%), Positives = 280/448 (63%), Gaps = 19/448 (4%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V P+EPTW+G   L+E DQ+GT+ +V  +YFY  P       ++ +L+ SLS+ L HFY
Sbjct  11    TVVPAEPTWTGRFPLAEWDQVGTITHVPTIYFYDKPPDSFQGNVVDTLKNSLSRALFHFY  70

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL W             +CN  G  L+EAES+A L D  +F    EF  LVP V+Y
Sbjct  71    PLAGRLRWLPQDRLEL-----DCNAAGVTLIEAESEAELIDFNNFLGAAEFEKLVPQVNY  125

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
                 PI  IPLF  Q+TKF+CG ISL   +SH V DGQ   HFL EW  +A G+PL + P
Sbjct  126   KS--PIETIPLFLAQVTKFKCGRISLSVKVSHAVVDGQSALHFLSEWGRIARGEPLETVP  183

Query  1201  FHDRRLLRAGEss--sssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
             F DR++L AGE     +SSPQ   + F   PPL+IG++    ER KET V+ L+LSK Q+
Sbjct  184   FLDRKVLWAGEQLPPFASSPQYEGKEFEE-PPLLIGETDCVEERKKETVVAMLKLSKSQL  242

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               L++  N     +   RG+TRYE +T H+WRCACKAR H P+QPT L   VD R R++P
Sbjct  243   QKLRSKVNTSEYADPA-RGFTRYETVTGHVWRCACKARGHSPEQPTGLVISVDARSRVQP  301

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  YFGNA +DVV   +SGE+I+  L   A KI  AI  VT+EYV   I++ +N  D+
Sbjct  302   PLPRGYFGNATLDVVAASISGELITNELGFAAGKISKAIKNVTNEYVMTGIEYLKNHEDL  361

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLILPGPNGID  491
               +   G F+ GNPNL +++W+ LP +GLD GWG+E++M PG +D DG+ L+LP      
Sbjct  362   --KDTEGPFY-GNPNLGLVSWLTLPMYGLDFGWGQEVYMGPGTNDLDGNSLLLPDKT---  415

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYEDI  407
              +DGSL++A C QV H++ F K+FYEDI
Sbjct  416   -EDGSLILATCQQVVHMEAFKKHFYEDI  442



>gb|KHN17617.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=446

 Score =   396 bits (1017),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 214/453 (47%), Positives = 286/453 (63%), Gaps = 29/453 (6%)
 Frame = -2

Query  1726  EPTWSGLLSLSELDQIGTMMYVKILYFY--TTPSTLSPDAIIHSLRLSLSQVLVHFYPFA  1553
             EPT    + LSE DQIGT+ +V  +YFY  T+    + + +  +L+ +LS+ LV FYP A
Sbjct  2     EPTKCERVPLSEWDQIGTITHVPTIYFYRPTSQDKDNVNTVASTLKDALSRALVPFYPLA  61

Query  1552  GRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDYSGV  1373
             GRL W             +CN  G   +EAES   L +LGDFSP  E+N+LVP+VDY+  
Sbjct  62    GRLHWINKGRLEL-----DCNAMGVHFIEAESSLTLENLGDFSPSSEYNNLVPNVDYTL-  115

Query  1372  DPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAPFHD  1193
              PI ++P+   QLT F+CGG S+    SH VADG    HFL EWA L+ G+ L +AP  D
Sbjct  116   -PIHELPVVLIQLTNFKCGGFSISLNTSHAVADGPSALHFLCEWARLSRGELLQTAPLFD  174

Query  1192  RRLLRAGEsssssSPQGGRRI----FHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             R + RAGE      P    R+    F H PPL++GQ++N  ER K+T V  L+++K Q+ 
Sbjct  175   RTVFRAGEPPLM--PLTECRVHKDQFIH-PPLLLGQTNNTEERKKKTTVVILKMTKTQVE  231

Query  1024  ALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP  845
              LK   N   S +A  RGYTRYE +T H+WR ACKAR HK  QPT L  CVD R RMEPP
Sbjct  232   TLKKTANESNSGHA--RGYTRYESVTGHVWRTACKARGHKEDQPTALGVCVDSRSRMEPP  289

Query  844   LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  665
             LP  YFGNA +D V   ++G+++S+PL    S+IR+AI+ VT EYV   I+F +N+ D+ 
Sbjct  290   LPKGYFGNATLDTVATSLAGDLVSKPLGYACSRIREAIERVTDEYVRTGIEFLKNQEDLS  349

Query  664   KRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLILPG  506
             + Q+L         F GNPNL V++W+ LP +G+D GWGKE++M PG HD DGD L+LPG
Sbjct  350   RFQDLYAIGSEKGPFYGNPNLGVVSWLTLPIYGVDFGWGKEVYMGPGTHDFDGDSLLLPG  409

Query  505   PNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             P+G    +GS+L+A CLQV H+  F K+FY+DI
Sbjct  410   PDG----EGSVLLALCLQVPHMDTFKKHFYQDI  438



>ref|XP_009112574.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Brassica 
rapa]
Length=451

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 208/454 (46%), Positives = 281/454 (62%), Gaps = 22/454 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V P+EPTW+G   L+E DQ+GT+ +V  +YFY  P       ++ +L+ SLS+ L HFY
Sbjct  11    TVVPAEPTWTGRFPLAEWDQVGTITHVPTIYFYDKPPDSFQGNVVETLKNSLSRALFHFY  70

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL W             +CN  G  L+E ES+A L D  +F    EF  LVP V++
Sbjct  71    PLAGRLRWLPQDRLEL-----DCNAAGVTLIEGESEAELIDFNNFLGAAEFEKLVPQVNH  125

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
                 PI  IPLF  Q+TKF+CG ISL   +SH V DG+   HFL EW  +A G+PL + P
Sbjct  126   K--SPIETIPLFLAQVTKFKCGRISLSVKVSHAVVDGRSALHFLSEWGRIARGEPLETVP  183

Query  1201  FHDRRLLRAGEss--sssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
             F DR++L AGE     +SSPQ   + F   PPL+IG++    ER KET V+ L+LSK Q+
Sbjct  184   FLDRKVLWAGEQLPPFASSPQYEGKEFEE-PPLLIGETDCVEERKKETVVAMLKLSKSQL  242

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               L++  N     +   RG+TRYE +T H+WRCACKAR H P+QPT L   VD R R++P
Sbjct  243   QKLRSKVNTSEYADPA-RGFTRYETVTGHVWRCACKARGHSPEQPTGLVISVDARSRVQP  301

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  YFGNA +DVV   +SGE+I+  L   A KI  AI  VT+EYV   I++ +N  D+
Sbjct  302   PLPRGYFGNATLDVVAASISGELITNELGFAAGKISKAIKNVTNEYVMTGIEYLKNHEDL  361

Query  667   IKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLILP  509
              + Q++ T       F GNPNL +++W+ LP +GLD GWG+E++M PG +D DG+ L+LP
Sbjct  362   KEFQDIHTLGSTEGPFYGNPNLGLVSWLTLPMYGLDFGWGQEVYMGPGTNDLDGNSLLLP  421

Query  508   GPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
                    +DGSL++A C QV H++ F K+FYEDI
Sbjct  422   DKT----EDGSLILATCQQVVHMEAFKKHFYEDI  451



>gb|KCW82842.1| hypothetical protein EUGRSUZ_C04213 [Eucalyptus grandis]
Length=453

 Score =   395 bits (1016),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 214/454 (47%), Positives = 286/454 (63%), Gaps = 23/454 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTL--SPDAIIHSLRLSLSQVLVH  1568
              +KP   TWSG L LSELDQI  + +   +YFY  PS    S DAI ++LR SL +VLV 
Sbjct  12    TIKPETETWSGYLPLSELDQIDMISHWYTIYFYKPPSEWLHSADAIFNTLRASLRRVLVP  71

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL               +CN  G  L+EAES+  L DLGDF PGP+F  L+PS+
Sbjct  72    FYPLAGRLERLDGGRLRL-----DCNAMGVWLIEAESEGELNDLGDFCPGPDFEQLMPSL  126

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   PI + PL   Q+TKFRCGG++L  +ISHVVADG   +HF  EWA LA G+PL+ 
Sbjct  127   DYTM--PIHEQPLLLVQVTKFRCGGLALSLSISHVVADGLSAAHFYNEWAWLARGEPLNI  184

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
              P++DR++ R    +    P      F+H PPL+IG ++N  +RMK+T ++ L+++K Q+
Sbjct  185   EPYYDRKV-RHPSGARLPPPNLELSEFNH-PPLLIGHANNLEQRMKKTALAMLKVTKTQV  242

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               LK A N  R  +   R YTR+E I AHIWRC CKAR HKP+Q T+L F +D R R+ P
Sbjct  243   ETLKNAVNKDRPSHHP-RPYTRFETIAAHIWRCVCKARKHKPEQATSLYFYIDARSRLRP  301

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PL   +FGNA+ ++V  G SGE++S PL+  +S IR+AI+ VT ++V  AI+  R + D+
Sbjct  302   PLKPGFFGNAVFNMVAGGTSGELVSSPLRCTSSVIREAIEAVTHDHVKSAIEHIRRQPDL  361

Query  667   IKRQELGT------FFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLILP  509
                Q+L         F GNPNL +  W+ LP +GLD GWG+EIHM  G HD D D ++LP
Sbjct  362   TTFQDLHAQGSTQGVFYGNPNLRLSCWLTLPLNGLDFGWGREIHMGLGNHDLDADSVVLP  421

Query  508   GPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             G      + G L+VA CLQ  HI+DF K+FY+DI
Sbjct  422   GRE----EAGGLVVAVCLQTAHIEDFKKFFYDDI  451



>gb|EYU26551.1| hypothetical protein MIMGU_mgv1a006988mg [Erythranthe guttata]
Length=423

 Score =   394 bits (1013),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 210/454 (46%), Positives = 282/454 (62%), Gaps = 51/454 (11%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPS----TLSPDAIIHSLRLSLSQVL  1574
             +V+P+E TW+G ++L+E DQ G + +V  +YFY  PS    T S   +  +LR+SL + L
Sbjct  10    LVEPAESTWNGCMALTESDQTGFLTHVPTIYFYR-PSLNWLTSSKQTMFETLRVSLGKAL  68

Query  1573  VHFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVP  1394
             VHFYP AGRL W   +         +CNG G  L+EA +++ L +LGDFSP P F+HL+P
Sbjct  69    VHFYPLAGRLRWLAGSRLEL-----DCNGKGVELIEARTESDLDELGDFSPSPHFDHLIP  123

Query  1393  SVDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPL  1214
              ++YS   PI +IPL + QLT+FRCGG++L + ISH   DGQ   HF+ EWA LA G+PL
Sbjct  124   QMNYS--SPIEEIPLLSVQLTEFRCGGVTLSYNISHAATDGQSALHFITEWARLARGEPL  181

Query  1213  SSAPFHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQSSNESERMKETKVSTLR  1046
             +  P  DR+L RAGE      P   R  F H     PPL++GQSS+E+ER KET  + L+
Sbjct  182   AEEPVLDRKLFRAGE------PPSARPRFEHVQFDPPPLLMGQSSSENERRKETTTAMLK  235

Query  1045  LSKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDI  866
             LSK Q+  L+   N         RGY+RYE +T H+WR AC AR H  +QP +L  CVD+
Sbjct  236   LSKAQLEILR---NEANGSITAARGYSRYEAVTGHLWRSACMARGHTREQPISLGLCVDV  292

Query  865   RRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFY  686
             RRRM+PPLPD YFGNAIIDVV   ++GE+++RPL   A K   A+               
Sbjct  293   RRRMKPPLPDRYFGNAIIDVVARSLAGELMTRPLGYAAGKDIHALR--------------  338

Query  685   RNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLILP  509
                     ++  G  F GNPNL VI+W+ LP  G+D GWGK+I M+PG H  DGD +ILP
Sbjct  339   -------TKEGAGAVFYGNPNLWVISWISLPLTGVDFGWGKDIAMTPGAHAGDGDSVILP  391

Query  508   GPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             G +G    DGSL+VA CLQ + ++ F K+FY++I
Sbjct  392   GCDG----DGSLVVAICLQSEFMEGFKKFFYQNI  421



>ref|XP_010034869.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Eucalyptus 
grandis]
 gb|KCW53925.1| hypothetical protein EUGRSUZ_J03136 [Eucalyptus grandis]
Length=458

 Score =   395 bits (1016),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 212/457 (46%), Positives = 293/457 (64%), Gaps = 24/457 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST-LSP-DAIIHSLRLSLSQVLVH  1568
              +KP   TWSG L LSELDQI  + +    YFY  P   L P DAI  +LR SLS+VLV 
Sbjct  12    TIKPETETWSGHLPLSELDQICIITHTPTTYFYKPPPEWLHPADAIFSTLRGSLSRVLVP  71

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL W             +CN  G  L+EAES+A L+DLGDF PGPE+  +VPS+
Sbjct  72    FYPLAGRLRWLDGGRLRL-----DCNAMGVPLIEAESEAELSDLGDFCPGPEYEQIVPSL  126

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   P  ++PL   Q+TKF+CGG++LG +ISHVV DG   ++FL EWA LA G+PL+ 
Sbjct  127   DYTM--PFHELPLLLVQVTKFKCGGLALGVSISHVVTDGLSATYFLDEWARLARGEPLNV  184

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFH---HSPPLIIGQSSNESERMKETKVSTLRLSK  1037
              P+ D+++L AGE   SS+ +    + H   + PPL+IG ++N  +R K+T ++ LR++K
Sbjct  185   EPYFDKKVLWAGEEDPSSTLRSPPNLEHPEFNDPPLLIGHTNNLEQRKKKTTMAILRVTK  244

Query  1036  PQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRR  857
              Q+  LK A N  R  +   R YTR+E++ AHIWRCACKAR H+P+Q T+L F VD R R
Sbjct  245   TQVETLKKAANKDRPSHHP-RPYTRFEIMAAHIWRCACKARKHRPEQATSLYFYVDARSR  303

Query  856   MEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  677
             + PPL   +FGNA++ V   G SGE++S PL   +SKIR+ I+ VT ++   AI+  R +
Sbjct  304   LRPPLKPGFFGNAVLQVAAAGTSGELVSSPLGCTSSKIREVIEAVTHDHFKSAIEHIRRQ  363

Query  676   GDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVL  518
              D+ + QEL         F GNPNL V +W+ L  +GLD GWG+EIHM+P  H+ DG+ +
Sbjct  364   PDLTRFQELDILGSTQGAFYGNPNLGVSSWLSLMVYGLDFGWGREIHMAPATHEYDGECV  423

Query  517   ILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             ++P       + G LLV   LQ++H++DF K+FY+DI
Sbjct  424   VIPSLE----EAGGLLVTVGLQIEHMEDFKKFFYKDI  456



>ref|XP_004507883.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cicer 
arietinum]
Length=460

 Score =   392 bits (1008),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 209/454 (46%), Positives = 283/454 (62%), Gaps = 20/454 (4%)
 Frame = -2

Query  1738  VKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFYP  1559
             V+P EPTW G L LSE DQIG + +V  +YFY    T     I  +L+ SLS+VLV FYP
Sbjct  16    VRPIEPTWCGRLPLSEWDQIGIITHVPTIYFYRPSQTWLSTTIATTLKDSLSKVLVPFYP  75

Query  1558  FAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEF-NHLVPSVDY  1382
              AGRL W    +G        CN  GA  +EA+S   L D+ DFSP  ++  +L+P +DY
Sbjct  76    LAGRLQWNDKNNGRFDL---ECNALGAQFIEAQSSLTLTDISDFSPSSDYYRYLIPRIDY  132

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             +   PI DIPL   QLT F+CGG+S+   +SH VADGQ   HF  EWA LA G+P+ + P
Sbjct  133   TL--PINDIPLVIVQLTSFKCGGVSISLLVSHAVADGQSALHFTSEWARLARGEPIKTMP  190

Query  1201  FHDRRLLRAGEsssssSPQ--GGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
             F DR  L  GES S   PQ     R F+  PP ++G + N  ER K+T V+ +++SK Q+
Sbjct  191   FVDRNALHVGESQSPLLPQCSNSEREFNE-PPFLLGNTDNIEERKKKTTVAIIKVSKTQV  249

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               L+   N      +  RGYTRYE +T H+WR A KAR H   QPT L  CVD R R++P
Sbjct  250   EKLRKTANESWGKPSNGRGYTRYETVTGHVWRTASKARGHGNDQPTALGVCVDWRCRVDP  309

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
              LP  YFGNA +DVV   ++G+++S+PL   +S+IR+AI+ V +EYV   +++++   D+
Sbjct  310   NLPKGYFGNATLDVVATSLAGDLMSKPLGYASSRIREAIEKVNNEYVRLGMEYFKKHEDL  369

Query  667   IKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLILP  509
              K Q+L         F GNPNL V++W+ LP +GLD GWGKE++M PG H+ DGD L+LP
Sbjct  370   TKFQDLHAIGSDKGPFYGNPNLGVVSWLTLPIYGLDFGWGKEVYMGPGTHELDGDSLLLP  429

Query  508   GPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             GP+    +DGSLLVA CLQ  H+  F ++F++DI
Sbjct  430   GPD----NDGSLLVAICLQEAHMDAFKRHFHQDI  459



>gb|EPS69670.1| hypothetical protein M569_05094, partial [Genlisea aurea]
Length=445

 Score =   389 bits (998),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 211/455 (46%), Positives = 284/455 (62%), Gaps = 31/455 (7%)
 Frame = -2

Query  1738  VKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFYP  1559
             ++P+EPTW+G++ LSE DQ G + +V  +YFY   S +    I+ +   SLS+ LV+FYP
Sbjct  11    IRPAEPTWNGIMPLSESDQTGVITHVPTIYFYRPGSDVDIPLILTA---SLSRALVYFYP  67

Query  1558  FAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDF-SPGPEFNHLVPSVDY  1382
              A               L L+CNG G   VEAE    + +LG+F +  PEF  L+P VDY
Sbjct  68    LA-----GRLRRLPRGRLELDCNGEGVSFVEAECGNDMDELGEFGASSPEFESLIPKVDY  122

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
                D + + PL   Q+TKFRCGG  L  AISH V DGQ   HF+ EWA LA G+ +   P
Sbjct  123   CSGDVV-EFPLLLVQVTKFRCGGACLSLAISHAVVDGQSSLHFISEWARLARGELIQHLP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
               DR+LLRAGE SS++      + F   PPLI+G+   E+ER K T V+ LR+S+ Q+  
Sbjct  182   ILDRKLLRAGEKSSATQSAFRHKQFD-PPPLIVGEIDAENERKKPTAVAMLRISRSQVRT  240

Query  1021  LKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPL  842
             LK A N+GR      R +TRYE +TAH+WR AC+AR+ + +QPTNL+ CV+IRRR+ P L
Sbjct  241   LKLAANDGR------RDFTRYEALTAHVWRSACRARALRDEQPTNLAICVEIRRRVSPNL  294

Query  841   PDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  662
             P  +FGNAI+DV+    SGE+   PL   A K+++AI+ VT EYV+  ID+ +N  D+  
Sbjct  295   PAKFFGNAIVDVIASSSSGELTGNPLGFAAGKVKEAIESVTGEYVDSVIDYLKNLEDLAA  354

Query  661   RQELGTF---------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLIL  512
              Q++G           F GNPN+ VI+W+GLP +GLD GWGKEI+M PG HD DGD LIL
Sbjct  355   VQDVGGRRREKKEEGPFYGNPNIGVISWMGLPLYGLDFGWGKEIYMGPGTHDSDGDSLIL  414

Query  511   PGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             P P+     DG L+VA CLQV+ +  F  +FY+DI
Sbjct  415   PAPDS----DGDLVVAICLQVECMDAFKNFFYQDI  445



>ref|XP_007161967.1| hypothetical protein PHAVU_001G112800g [Phaseolus vulgaris]
 gb|ESW33961.1| hypothetical protein PHAVU_001G112800g [Phaseolus vulgaris]
Length=455

 Score =   387 bits (995),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 212/455 (47%), Positives = 284/455 (62%), Gaps = 20/455 (4%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST-LSPDAIIHS-LRLSLSQVLVH  1568
              V+P E TW G ++LSE DQ G + +V ++YFY  P   LS D II S L+ SLS+VLV 
Sbjct  10    TVRPMEATWCGRVALSEWDQTGKVTHVPMIYFYRLPQNFLSQDNIIASTLKDSLSRVLVP  69

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL WT            +CN  G   +EAES + L DL DFS   +++HLVP+V
Sbjct  70    FYPLAGRLHWTNNGRLEL-----DCNATGVRFIEAESSSTLEDLTDFSASSKYHHLVPTV  124

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY  + PI ++PL   QLTKF+CGGI +G  +SHVV DG    HF  EWA LA G+ L +
Sbjct  125   DYYSL-PIHELPLALVQLTKFKCGGICIGVTLSHVVIDGPSAMHFTCEWARLARGQTLHT  183

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
              PF DR++LRAGE       +         PPL++G++ N  E+ KET++ T+++S+ Q+
Sbjct  184   VPFLDRKVLRAGEPPLVPLTKCHVHTEFDDPPLLLGRTDNNEEKKKETRMVTIKISRSQV  243

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               LK   N         RGY+RYE +T+HIWR ACKAR HK  QPT L+  VD R RMEP
Sbjct  244   ETLKKRANESSHRPRNGRGYSRYESVTSHIWRSACKARDHKENQPTMLTIAVDSRGRMEP  303

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  YFGNA +D V   ++G+++S PL   AS+IR+AI+ V+ EYV   I+F +N+ D+
Sbjct  304   PLPKGYFGNANLDTVACSLAGDLVSEPLGFTASRIREAIERVSDEYVRSGIEFLKNQEDL  363

Query  667   IK-RQEL------GTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLIL  512
              +  Q+L         F GNPNLSV++W+ LP +  D GWGK ++ SP  HD DGD ++L
Sbjct  364   RRFHQDLHPEGREKEPFYGNPNLSVVSWLRLPLYDTDFGWGKGVYTSPATHDFDGDFVLL  423

Query  511   PGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             P P+    +DGS+LV   LQV HI  F  +FY+DI
Sbjct  424   PDPD----EDGSVLVCLGLQVLHIDAFRNHFYQDI  454



>ref|XP_003610074.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase-like 
protein [Medicago truncatula]
 gb|AES92271.1| spermidine hydroxycinnamoyl transferase [Medicago truncatula]
Length=457

 Score =   386 bits (991),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 209/457 (46%), Positives = 283/457 (62%), Gaps = 31/457 (7%)
 Frame = -2

Query  1738  VKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTL--SPDAIIHSLRLSLSQVLVHF  1565
             V+P EPTW G L LSE DQIG + +V  +YFY  P     SP+ I  +L+ SLS+VLV F
Sbjct  18    VRPMEPTWYGRLPLSEWDQIGNITHVSTIYFYRPPQKWLTSPNKIATTLKDSLSKVLVPF  77

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFN-HLVPSV  1388
             YP AGRL W  +           CN  GA  +EAES   L++LGDFSP  E+  +L+P +
Sbjct  78    YPLAGRLQWKESGRFDV-----ECNSLGAQFIEAESSLTLSELGDFSPSCEYYPYLIPHI  132

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   PI DIPL   QLT F+CGG S+   ISH VADG    HF  EWA LA G+P+ +
Sbjct  133   DYT--RPIEDIPLVIVQLTNFKCGGASISLLISHAVADGPSALHFTSEWARLARGEPVRT  190

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
              P+ D  +L +  + + +  +       + PPL++G S+N  ER K+T V+ L++SK Q+
Sbjct  191   MPYFDINVLSSRSNVNVNEWE------FNEPPLLLGNSNNVEERKKKTTVAMLKVSKTQV  244

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               L+   N      +  RGYTRYE +T H+WR A KAR H   Q T+L  CVD R R+EP
Sbjct  245   EKLRKTANESWEKPSNGRGYTRYETLTGHVWRSASKARGHANDQQTSLGVCVDWRNRVEP  304

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
              LP  YFGN  +DVV   ++G++IS+PL   +S+IR+AI+ V  EYV   I++++ + D+
Sbjct  305   NLPKGYFGNGTLDVVATSLAGDLISKPLGYASSRIREAIEKVNDEYVRMGIEYFKKQEDL  364

Query  667   IKRQEL---------GTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVL  518
              K Q+L         G F+ GNPNL V++W+ LP +GLD GWGKE++M PG HD DGD L
Sbjct  365   TKFQDLHAKMGSDDKGPFY-GNPNLGVVSWLTLPIYGLDFGWGKEVYMGPGTHDSDGDSL  423

Query  517   ILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             +LP  +    DDGSLLVA CLQ  H+  F ++FY+DI
Sbjct  424   LLPSYD----DDGSLLVAICLQEVHMDAFKRHFYQDI  456



>ref|XP_011076842.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Sesamum 
indicum]
Length=493

 Score =   378 bits (971),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 216/464 (47%), Positives = 283/464 (61%), Gaps = 37/464 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTL--SPDAIIHSLRLSLSQVLVH  1568
             +VKP+EPTW+G L LSELDQIG++ YV +++ Y  P      P+AI  +L+ SLS+VLV 
Sbjct  10    LVKPAEPTWNGSLPLSELDQIGSLGYVSLIHLYRPPQDWLSPPEAISRTLKSSLSKVLVP  69

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             F+P AGR S  +           +C+G G  L EAESDA L +L +F    E + LVPS 
Sbjct  70    FHPLAGRWSRISRGRFQI-----DCSGIGVPLTEAESDATLDELKEF----EHHQLVPSF  120

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             D      +  +PL A QLT+F+CGG+ LG A+SH   DGQ  SHF  EWA LA G+ L +
Sbjct  121   D------LEQLPLVAVQLTRFKCGGVCLGVAMSHAAVDGQSASHFYTEWARLARGEQLET  174

Query  1207  APFHDRRLL-RAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
              PF DR+LL   G    S++P          PPL+IG+S  ++ER K T  ++LRL+K Q
Sbjct  175   QPFLDRKLLGDVGRKPHSAAPPLQPPPEFDVPPLLIGESGCKNEREKTTTRASLRLTKFQ  234

Query  1030  IHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             I  ++   N  R   A    +T YEVITAHIWRC CKAR H  +Q + LS  VDIRRRM 
Sbjct  235   IEMMRRKANENRGPAAAGSSFTSYEVITAHIWRCTCKARRHVREQRSRLSISVDIRRRMR  294

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             PPLP +Y GNA++DVV    +GE++S+PL   ASKIR+AI+ VT+EYV   IDF R   D
Sbjct  295   PPLPKTYLGNAVLDVVALDYAGELVSKPLSYAASKIREAINKVTNEYVTSTIDFLRAVDD  354

Query  670   VIKRQELGT---------------FFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSP-GH  539
             +   Q+  +               FF GNPNL V +W  L  HGLD GWGKE +M P  +
Sbjct  355   LSSFQDWNSISSDDDDDDDDDDKGFFCGNPNLCVTSWSTLQFHGLDFGWGKEAYMGPVDY  414

Query  538   DCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
               DGD LI+  P+G D  DGS++V ACLQ  H++ F K+FY+D+
Sbjct  415   GNDGDCLII--PSGHDS-DGSVVVIACLQEPHMEAFRKFFYDDM  455



>ref|XP_010673351.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Beta vulgaris 
subsp. vulgaris]
Length=457

 Score =   376 bits (966),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 212/455 (47%), Positives = 273/455 (60%), Gaps = 22/455 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTL--SPDAIIHSLRLSLSQVLVH  1568
             +VKP E   +    LSE DQ G + +V  +YFY        S  +I+ +L+ SLS+VLVH
Sbjct  10    IVKPQERICTSTFQLSEWDQTGVITHVPTVYFYRPSQEWLKSSKSIVDTLKESLSRVLVH  69

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPE-FNHLVPS  1391
             FYP AGR+ W              CN  G  L+EA S   L+D GDF+     F +L+P 
Sbjct  70    FYPLAGRVRWIGQGRLELL-----CNAKGVELIEANSSGELSDFGDFASQTNLFENLLPY  124

Query  1390  VDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLS  1211
             VDY    PI ++PL  GQLT+F+CGGI LG  ISHVVADGQ   HF+ EWA LA G+PL 
Sbjct  125   VDYD--KPIDELPLMLGQLTQFKCGGICLGVNISHVVADGQSALHFMSEWARLARGEPLE  182

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
              AP+ +  + R+ +   +S       I    PPL+IG ++N  ER K T V+ L LSK  
Sbjct  183   MAPYFNPDIFRSQDLPKTSI-GFDTHIEFKPPPLLIGANNNLEERKKATIVAILPLSKEH  241

Query  1030  IHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             +  LK     G   +  +  YTRYEVI AHIWR ACKAR H  +QPT L F VD+R R++
Sbjct  242   VDILKKDVKEGSIDDHNMYSYTRYEVIAAHIWRSACKAREHHLEQPTCLGFSVDVRNRLQ  301

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             PPLP  YFGNAI+DVV    SG+I+++PL    +KIR AI+ V +EY+   IDF++   D
Sbjct  302   PPLPPKYFGNAILDVVASSKSGDIMTKPLHYTCAKIRQAIEKVNNEYIWSNIDFWKKLPD  361

Query  670   VIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLIL  512
             +   Q+L         F GNPNL VI+W+ LP +GLD GWGKEI+M PG HD DGD L+L
Sbjct  362   LTPFQDLHARKSMDGPFYGNPNLGVISWLTLPMYGLDFGWGKEIYMGPGTHDSDGDCLML  421

Query  511   PGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
              GP     ++GS+ VA CLQ  H+  F KY YEDI
Sbjct  422   RGPI----NNGSVKVAICLQEAHVDAFKKYLYEDI  452



>ref|XP_008231463.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Prunus 
mume]
Length=454

 Score =   375 bits (964),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 211/465 (45%), Positives = 287/465 (62%), Gaps = 41/465 (9%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFY------TTPSTLSPDAIIHSLRLSLSQ  1580
             V+KP+E TW G  +LSE DQIG + +V I+YFY       TP+    DAI ++L+ SL +
Sbjct  10    VLKPAEATWQGCQTLSEWDQIGCITHVGIIYFYRPDQHCVTPT----DAIANTLKDSLRR  65

Query  1579  VLVHFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHL  1400
              LV FYP AGRL W             +CNG G   +EAESD  L DLGDFSP PE + L
Sbjct  66    ALVPFYPLAGRLRWIEGGRLEL-----DCNGMGVQFIEAESDLKLDDLGDFSPSPESHSL  120

Query  1399  VPSVDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGK  1220
             +P+VDY+   PI ++PL   QLT+F+CGG SL   ISH V DGQ   HF+ EWA LA G+
Sbjct  121   LPTVDYNL--PIHELPLLFVQLTRFKCGGFSLALEISHAVTDGQSACHFIGEWAKLARGE  178

Query  1219  PLSSAPFHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQSSNESERMKETKVST  1052
             P+   PF D      G++  +       ++F H     PP ++GQS +  E   +T ++ 
Sbjct  179   PVGVMPFLD------GQAFLARHLPAPTQVFDHIEFNQPPNLLGQSDDLQESKMKTTLTM  232

Query  1051  LRLSKPQIHALKAADNNGRSCNAK--LRGYTRYEVITAHIWRCACKARSHKPQQPTNLSF  878
             LRL+K Q+  LK   N G + N     R YTRYE +  HIWRCA ++R+HK +QPT L  
Sbjct  233   LRLTKEQVDKLKQMANEGTNFNNSDTKRPYTRYETLAGHIWRCASRSRNHKDEQPTALMV  292

Query  877   CVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCA  698
             CVD R R++P LP+ YFGNA+  +    ++G+++S+PL   +S+IR+A++ VT +YV  A
Sbjct  293   CVDFRCRIKPQLPEGYFGNAVFYMPATSLAGDLLSKPLGYASSRIREAVEKVTMDYVLSA  352

Query  697   IDFYRNEGDVIKRQELGTF-------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-  542
              +  +NE D+ + Q+L          F GNPN+ V++W+ LP +GLD GWGKEI+M PG 
Sbjct  353   HERLKNEPDLTRFQDLHYAKESERGPFNGNPNIGVLSWLRLPIYGLDFGWGKEIYMGPGP  412

Query  541   HDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             HD DGD +ILPG +G    DGS++VA  LQV HI  F K+FYEDI
Sbjct  413   HDFDGDSMILPGADG----DGSVVVALSLQVAHIDVFKKHFYEDI  453



>gb|AES90726.2| spermidine hydroxycinnamoyl transferase [Medicago truncatula]
Length=457

 Score =   373 bits (958),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 205/460 (45%), Positives = 273/460 (59%), Gaps = 36/460 (8%)
 Frame = -2

Query  1738  VKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTL--SPDAIIHSLRLSLSQVLVHF  1565
             V+P EPTW G L LSE DQIG + +V  +YFY  P     SP  I  +L+ SLS+VLV F
Sbjct  17    VRPMEPTWCGRLPLSEWDQIGIIAHVPTIYFYQPPKNWLTSPTKIATTLKESLSKVLVPF  76

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEF-NHLVPSV  1388
             YP AGRL                CN  G   +EA+S   L++LGDFSP  E+  +L+P +
Sbjct  77    YPLAGRLHSKGNGRFDL-----ECNSLGVQFIEAQSSLTLSELGDFSPSSEYYRYLIPHI  131

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   P+ DIPL   QLT F CG +S+   ISH VADG    HF+FEWA +A G+PL  
Sbjct  132   DYTL--PMEDIPLVIFQLTNFNCGVVSISLLISHAVADGPSALHFIFEWARIARGEPLKM  189

Query  1207  AP-FHDRRLLRAGEsssssSPQGGRRIFHHSP---PLIIGQSSNESERMKETKVSTLRLS  1040
              P F D  +L         SP+    +    P   PL++G   N  ER K+T V+ + LS
Sbjct  190   VPRFLDTNML---------SPKRCNSVNKWEPDQLPLLLGNLDNVEERKKKTTVAIINLS  240

Query  1039  KPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
             K Q+  L+   N   +  +  RGY+RYE +T HIWR ACKAR HK  QPT L  CVD RR
Sbjct  241   KTQVEKLRKTANESWNKPSNGRGYSRYETVTGHIWRSACKAREHKNDQPTALGVCVDWRR  300

Query  859   RMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRN  680
             R+EP LP  YFGNAI+DV+   ++G+++S+PL   +S+IR+A++ V  EY+    ++++ 
Sbjct  301   RVEPNLPKGYFGNAILDVLATSLAGDLMSKPLGYASSRIREAVEKVNDEYIRLGNEYFKK  360

Query  679   EGDVIKRQELGTF-------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG--HDCDG  527
             + D+ K Q+L          F  NPNL V +W+ LP +GLD GWGKE++M  G   + DG
Sbjct  361   QEDLTKFQDLQVVGNGEKGPFYWNPNLGVTSWLSLPIYGLDFGWGKEVYMGLGTHEELDG  420

Query  526   DVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             D L+LP PN    DDGSLLV  CLQ  H+  F K+FY+DI
Sbjct  421   DSLLLPSPN----DDGSLLVIICLQEIHMDVFKKHFYQDI  456



>ref|XP_010541075.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Tarenaya 
hassleriana]
Length=532

 Score =   367 bits (942),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 200/453 (44%), Positives = 274/453 (60%), Gaps = 23/453 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V+P+EPT  G   L+ELDQ+ T+ +V I+Y Y  P+      ++  L+ SLS+ L HFY
Sbjct  95    TVRPAEPTRIGRFPLTELDQVNTINHVSIVYLYKKPAESFKGNVVEILKSSLSRALFHFY  154

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL W++ +         +CN  G   V AES+A L+D  DF   PE++ LV  V+Y
Sbjct  155   PLAGRLRWSSGSRLEL-----DCNAAGVPFVVAESEAELSDSDDFYLLPEYDKLVAQVNY  209

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
                +PI  IPL   Q+TKF+CGG S+   +SHV+ DGQ   HF+ EWA +A G+PL   P
Sbjct  210   K--NPIEKIPLLLIQITKFKCGGFSISGNVSHVIVDGQSTFHFISEWARIARGEPLGVIP  267

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR++LRAGE  +  S    R++    P +I      E  + K+TKV+ LRLSK  +  
Sbjct  268   FLDRKILRAGEPPAMDSQPLDRKVLDQPPSMI--NEEREKNKKKKTKVAMLRLSKTDVQK  325

Query  1021  LKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPL  842
             L+   N   S +   RG+TRYE +T H+WR   +AR H PQQPT +  C+D R RM+PPL
Sbjct  326   LRNRANMSESADPA-RGFTRYEAVTGHVWRSVSRARGHLPQQPTAVGLCIDSRSRMQPPL  384

Query  841   PDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  662
             P  YFGNA +DV+    SGE+IS+PL     KIR+AI  VT +YV   I++ + + D+ K
Sbjct  385   PQGYFGNATVDVIAVSTSGELISKPLGHAVRKIREAIKKVTDDYVRSEIEYLKRQEDLRK  444

Query  661   RQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLILPGP  503
              Q+L         F GNPNL+V++W+ LP  G D GWG E+   PG +D DGD L+LP  
Sbjct  445   FQDLHALGGTERPFYGNPNLAVVSWLNLPICGFDFGWGSEVFKGPGTYDFDGDSLLLP--  502

Query  502   NGIDGDD-GSLLVAACLQVDHIQDFNKYFYEDI  407
                D DD GS+++A CL+  H++ F KYFYEDI
Sbjct  503   ---DHDDPGSVVLALCLEESHMEAFKKYFYEDI  532



>ref|XP_008231492.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Prunus 
mume]
Length=454

 Score =   362 bits (930),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 194/462 (42%), Positives = 278/462 (60%), Gaps = 35/462 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTL--SPDAIIHSLRLSLSQVLVH  1568
             ++KP+E TW G L+LSE DQ+G++ ++  +YFY         P+ I + L+ SL + LV 
Sbjct  10    LLKPAEETWQGCLTLSEFDQVGSITHISTIYFYRPDQNWVTQPETIANILKDSLRRTLVP  69

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL W             +CNG G   +EAESD+ L D  DF P P ++ L P+V
Sbjct  70    FYPLAGRLRWIEGRRLEL-----DCNGMGVQFIEAESDSKLDDFDDFYPSPVYHSLFPAV  124

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   PI ++P+   QLT+F+CGG+ L   ISH V DG   S F  EWA +A G+P++ 
Sbjct  125   DYNL--PIHELPILLVQLTRFKCGGVCLSLKISHAVVDGHSASRFYLEWARVARGQPIAV  182

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHS----PPLIIGQSSNESERMKETKVSTLRLS  1040
              PFHDR   +A        P     +F H+    PP+++GQS++   + K+   + LRL+
Sbjct  183   MPFHDRNAFQARH------PPAQSLVFEHTELNQPPILLGQSNDIEVKNKKNTNTMLRLT  236

Query  1039  KPQIHALKAADNNGRSCNAK--LRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDI  866
             + Q+  LK   N G + N     R YTRYE +  HIWRCA K+R+ + +Q   L+  +D 
Sbjct  237   RDQVERLKQMANEGTNFNNSDTKRPYTRYETVAGHIWRCASKSRNLRDEQAMQLAVWMDF  296

Query  865   RRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFY  686
             R R++PPLP  YFGNA   V    +SG+++S+PL   +S+IR+AI+ VT++YV  A++  
Sbjct  297   RSRIKPPLPQGYFGNATFYVNATSLSGDLLSKPLGYASSRIREAIEKVTNDYVLSALEKL  356

Query  685   RNEGDVIKRQEL--------GTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDC  533
             +N+ D+ + Q+L        G+F  GNPN+ V++W+ +P  GLD GWGKEI+M PG HD 
Sbjct  357   KNQPDLTQFQDLHRAIESDQGSFH-GNPNVGVVSWLTVPFWGLDFGWGKEIYMGPGTHDF  415

Query  532   DGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             DGD +ILP  NG    DGS+ VA  LQV H+  F K+FYED 
Sbjct  416   DGDFVILPSANG----DGSVFVALSLQVVHVDAFKKHFYEDF  453



>emb|CDY56515.1| BnaCnng30570D [Brassica napus]
Length=380

 Score =   360 bits (923),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 183/373 (49%), Positives = 238/373 (64%), Gaps = 17/373 (5%)
 Frame = -2

Query  1498  NCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDYSGVDPIPDIPLFAGQLTKFRC  1319
             +CN  G   +EAES+A L+D  DFSP PEF  LVP V+Y    PI  IPLF  Q+T+F+C
Sbjct  16    DCNAEGVSFMEAESEAKLSDFDDFSPTPEFEKLVPQVNYK--HPIETIPLFLAQVTRFKC  73

Query  1318  GGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAPFHDRRLLRAGEss--sssSPQ  1145
             GGISLG +ISH V DGQ   HFL EW  +A G+PL + PF DR++L  G+     +S PQ
Sbjct  74    GGISLGVSISHAVVDGQSAFHFLSEWGRIARGEPLETTPFLDRKILWTGQPLPPFASPPQ  133

Query  1144  GGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHALKAADNNGRSCNAKLRGYT  965
               R+ F   PPL+IG++ N  ER K+T V  L+LSK  I  L++  N     +   RG+T
Sbjct  134   CERKGFEQ-PPLLIGETDNVEERKKKTTVEILKLSKTLIEKLRSRVNTSEYADPA-RGFT  191

Query  964   RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  785
             RYE +  H+WRCA KAR H P+QPT+L  CVD R R++PPLP  YFGNA I+ V    SG
Sbjct  192   RYETVAGHVWRCASKARGHSPEQPTSLGICVDTRSRVQPPLPRGYFGNATINAVARSTSG  251

Query  784   EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELGTF------FVGNPN  623
             E+IS  L   A KI +AI  VT+EYV   I++ +N  D+   Q++         F GNPN
Sbjct  252   ELISNGLGFAAEKISEAIKSVTNEYVMTGIEYLKNHEDLKTFQDIHALGSTDGPFYGNPN  311

Query  622   LSVINWVGLPNHGLDLGWGKEIHMSP-GHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  446
             L +++W+ LP +GLD GWGKE+HM P  HD DG  L+LP  N    DDGSL++A CLQV 
Sbjct  312   LGLVSWLTLPMYGLDFGWGKEVHMGPCTHDGDGGSLLLPDKN----DDGSLILATCLQVA  367

Query  445   HIQDFNKYFYEDI  407
             H++ F ++ YEDI
Sbjct  368   HMEAFKQHLYEDI  380



>emb|CDY62143.1| BnaCnng39330D [Brassica napus]
Length=380

 Score =   359 bits (922),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 183/373 (49%), Positives = 238/373 (64%), Gaps = 17/373 (5%)
 Frame = -2

Query  1498  NCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDYSGVDPIPDIPLFAGQLTKFRC  1319
             +CN  G   +EAES+A L+D  DFSP PEF  LVP V+Y    PI  IPLF  Q+T+F+C
Sbjct  16    DCNAEGVSFMEAESEAKLSDFNDFSPTPEFEKLVPQVNYK--HPIETIPLFLAQVTRFKC  73

Query  1318  GGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAPFHDRRLLRAGEss--sssSPQ  1145
             GGISLG +ISH V DGQ   HFL EW  +A G+PL + PF DR++L  G+     +S PQ
Sbjct  74    GGISLGVSISHAVVDGQSAFHFLSEWGRIARGEPLETTPFLDRKILWTGKPLPPFASPPQ  133

Query  1144  GGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHALKAADNNGRSCNAKLRGYT  965
               R+ F   PPL+IG++ N  ER K+T V  L+LSK  I  L++  N     +   RG+T
Sbjct  134   CERKGFEQ-PPLLIGETDNVEERKKKTTVEILKLSKTLIEKLRSRVNTSEYADPA-RGFT  191

Query  964   RYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSG  785
             RYE +  H+WRCA KAR H P+QPT+L  CVD R R++PPLP  YFGNA I+ V    SG
Sbjct  192   RYETVAGHVWRCASKARGHSPEQPTSLGICVDTRSRVQPPLPRGYFGNATINAVARSTSG  251

Query  784   EIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELGTF------FVGNPN  623
             E+IS  L   A KI +AI  VT+EYV   I++ +N  D+   Q++         F GNPN
Sbjct  252   ELISNGLGFAAEKISEAIKSVTNEYVMTGIEYLKNHEDLKTFQDIHALGSTDGPFYGNPN  311

Query  622   LSVINWVGLPNHGLDLGWGKEIHMSP-GHDCDGDVLILPGPNGIDGDDGSLLVAACLQVD  446
             L +++W+ LP +GLD GWGKE+HM P  HD DG  L+LP  N    DDGSL++A CLQV 
Sbjct  312   LGLVSWLTLPMYGLDFGWGKEVHMGPCTHDGDGGSLLLPDKN----DDGSLILATCLQVA  367

Query  445   HIQDFNKYFYEDI  407
             H++ F ++ YEDI
Sbjct  368   HMEAFKQHLYEDI  380



>ref|XP_010110725.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXC27890.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=451

 Score =   360 bits (925),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 201/458 (44%), Positives = 284/458 (62%), Gaps = 30/458 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTP--STLSPDAIIHSLRLSLSQVLVH  1568
              VKP+EPTW G   LSELDQ+G + ++  + FY  P  S L P+ +I++ R SLS+VLV 
Sbjct  10    TVKPAEPTWEGRQPLSELDQVGCITHIPTISFYRRPQNSQLQPETLINTARESLSRVLVT  69

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLAD-LGDFSPGPEFNHLVPS  1391
             FYP AGRL W T           +CN  GA ++EAE+++ +++ +G+    PE++HL+P 
Sbjct  70    FYPLAGRLRWITKGRLEL-----DCNAMGARVIEAETESKISEFIGEL---PEYHHLIPK  121

Query  1390  VDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLS  1211
             +DY+   PI ++P+   QLT+F CGG+S+   ISH V DGQ + HF+FEWA    G+PL 
Sbjct  122   IDYT--LPIHELPIVLVQLTRFSCGGVSISLCISHAVVDGQSLLHFIFEWAAQTRGEPLM  179

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
               PF DR+ LRAG  ++ +S    +  F+   P +I +     E+ KE  ++ LRLSK Q
Sbjct  180   FPPFLDRKALRAGIPAAIASHSLEKPSFNL--PSLITEQEEVKEKEKEASLAILRLSKDQ  237

Query  1030  IHALKAADNNGRSCNA--KLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRR  857
             +  LK   N G   N   K R YTR+E +  ++WRCACKAR HKP+Q T L  CVD RRR
Sbjct  238   VEKLKRIANQGLENNTDTKNRAYTRFETLAGYVWRCACKARGHKPEQQTALGVCVDTRRR  297

Query  856   MEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  677
             M PPLP  YFGNAIIDV+    +GE+ S PL   A +I++A++     YV  AI++ +  
Sbjct  298   MTPPLPWGYFGNAIIDVLATSAAGELTSNPLGYAAGRIQEAVEMANGVYVWGAIEYLKCH  357

Query  676   GDVIKRQELGTFFVG-------NPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDCDGDV-  521
              D+   Q+LG    G       NPNL V++W+ LP +G+D GWGKE ++ PG D DG+  
Sbjct  358   EDLRDFQDLGARLSGERFPFYKNPNLGVVSWLSLPMYGVDFGWGKEAYIGPG-DVDGETA  416

Query  520   LILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
              ++P P+G    DGS++VA CLQ DH++ F K+FY D+
Sbjct  417   FLVPCPSG----DGSVVVALCLQADHMESFKKHFYNDV  450



>gb|AFD64619.1| putative hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyltransferase 
[Camellia sinensis]
Length=447

 Score =   360 bits (924),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 203/457 (44%), Positives = 269/457 (59%), Gaps = 30/457 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +VKP++ T + L+ LSE DQ  T+ +   +YFY     L  +AIIH+L+ SLS+VL  FY
Sbjct  9     MVKPAKETPTRLMYLSEFDQFDTITHSPTVYFYQHSGELVLNAIIHTLKDSLSKVLTIFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL W             +CN  GA  +EAES+A + D GDF P  +   L+PSVDY
Sbjct  69    PLAGRLQWIARGRLQI-----HCNSTGAEFLEAESEAKIDDFGDFCPSSKTTALIPSVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
                 PI ++PL   Q+TKF CGG SLG  ISH +ADG+  +HF+ EWA +A G+   + P
Sbjct  124   G--RPIHELPLLLVQVTKFSCGGFSLGLGISHALADGECAAHFISEWARIARGEKPENFP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHS----PPLIIGQSSNESERMKETKVSTLRLSKP  1034
             F DR +L+  +          +  F HS     PL+IG S+N  ER K+T V+ L+LSK 
Sbjct  182   FLDRTILQLEDPLP-------KTSFDHSEFKPTPLLIGHSNNTEERNKKTIVAILKLSKE  234

Query  1033  QIHALKAADNNGRSCNAKL-RGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRR  857
             QI+ LK   N  R+      R +TRY  +TAH+WRCACKAR H+ +Q TN+   VD R R
Sbjct  235   QINKLKNKANEYRNSETSTNRAFTRYGSVTAHMWRCACKARQHESEQLTNIRIAVDFRSR  294

Query  856   MEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  677
             ++  LP  YFG  ++ VV    SG+I+S+PL   A K+R+ I  VT EY+     F +NE
Sbjct  295   LQSSLPKWYFGCTVLPVVTTPTSGDIVSKPLGYTAKKLREGIGKVTDEYIRSCFVFLKNE  354

Query  676   GDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVL  518
              D+ K +   T       F GNPN+SV NW  LP +G+D GWGKEI M PG    DG   
Sbjct  355   PDLSKFRFFHTVGSSQGAFYGNPNMSVTNWTRLPLYGMDFGWGKEICMIPGAIGYDGKAF  414

Query  517   ILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             ILPG N    +DGS L+   LQV H+ +F K+FYEDI
Sbjct  415   ILPGRN----EDGSFLIPLRLQVTHMDNFKKFFYEDI  447



>ref|XP_002274695.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Vitis 
vinifera]
Length=445

 Score =   359 bits (921),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 201/456 (44%), Positives = 264/456 (58%), Gaps = 30/456 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V+P++ T  G   LS+ DQ+  + +   +YFY  P  +S ++    LR SLS+ LV FY
Sbjct  9     TVRPAKETPGGYRCLSDSDQVRALTHAPTIYFYP-PVNVSLESATEILRHSLSEALVIFY  67

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL W             +CN  GA+L+  ES+A + D GDF P  E   L+PSVDY
Sbjct  68    PLAGRLHWIGGGRLEL-----DCNALGALLIAVESEAKIDDFGDFRPTQEIRALIPSVDY  122

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             +   PI ++PL   Q+TKF CGG+SLG  ISH +ADG    HF+ EWA +A G+  +S P
Sbjct  123   N--KPIHELPLILVQITKFSCGGMSLGLGISHTIADGLSALHFISEWAKIARGEQSNSPP  180

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQSSNESERMKETKVSTLRLSKP  1034
             F DR +L A E  S+        +F H    + PL+IG+  N  ER +ET +  L+LSK 
Sbjct  181   FLDRSVLLAPEHLSAP-------VFDHPEYSTQPLLIGKQDNMEERKRETAILKLKLSKD  233

Query  1033  QIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
             Q+  LK   N  RS +   R YTRYE +  HIWR ACKAR H+ QQPT LS  VD R RM
Sbjct  234   QVEKLKDKANKDRSASNNKRPYTRYEAVAGHIWRSACKARQHESQQPTTLSIIVDARNRM  293

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
             EPPLP  YFGNA   V    +SGE++S+PL   + K R AI+  T EY+  ++ + + + 
Sbjct  294   EPPLPPRYFGNATFRVTAESMSGELVSKPLGYASGKARQAIEKATHEYLQSSLVYVKCQE  353

Query  673   DVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLI  515
             DV + +   T       F GNPNL + +W  LP +G D GWG+EI+M PG    DG V +
Sbjct  354   DVTQFRNFHTVGCAKGAFYGNPNLEITSWARLPIYGADFGWGQEIYMGPGAIGYDGKVFV  413

Query  514   LPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
              PG     G +GS LVA  LQV HI  F K+FYEDI
Sbjct  414   FPG----QGLEGSFLVALRLQVRHIDAFQKFFYEDI  445



>ref|XP_010656623.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Vitis 
vinifera]
Length=457

 Score =   353 bits (906),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 205/456 (45%), Positives = 263/456 (58%), Gaps = 30/456 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V+P++ T  G   LS+ DQ+  + +  I+YFY  P  +S ++ I  LR SLS+ LV FY
Sbjct  9     TVRPAKETPGGYRCLSDSDQVRALTHAPIIYFYP-PVNVSLESAIEILRHSLSEALVIFY  67

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AG          GG  L L CN  GA+L+  ESDA + D GDF P  E   L+PSVDY
Sbjct  68    PLAG-----WLHWIGGGRLVLECNALGALLIAVESDAKIDDFGDFGPTQEIRALIPSVDY  122

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
                 PI ++PL   Q+TKF CGGISLG    H++ DG   SHF+ EWA +A G+  +S+P
Sbjct  123   D--KPIHELPLLLVQVTKFSCGGISLGLGALHIMTDGLSASHFISEWAKIARGEQPNSSP  180

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHH---SP-PLIIGQSSNESERMKETKVSTLRLSKP  1034
             F DR +L A E  S+        +F H   SP PL+IG+  +  ER +E+   TL+LSK 
Sbjct  181   FLDRSILLAPEHLSAP-------VFDHPEYSPQPLLIGKQDHMEERKRESATLTLKLSKD  233

Query  1033  QIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
             Q+  LK   N  RS +   R YTRYE +  HIWR ACKAR H+ QQPT LS  VD R RM
Sbjct  234   QVEKLKDKANKDRSASNNKRPYTRYEAVAGHIWRSACKARQHESQQPTTLSIIVDARNRM  293

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
             EPPLP  YFGNA   V     SGE++S+PL   + K R AI+  T EY+  ++ + + + 
Sbjct  294   EPPLPPRYFGNATFRVTAESTSGELVSKPLGYASGKARQAIEKATHEYLQSSLMYVKCQE  353

Query  673   DVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLI  515
             DV   +   T       F GNPNL + +W  LP +G D GWG+EI+M PG    DG V +
Sbjct  354   DVTPFRNFNTVGCAKGAFYGNPNLEITSWARLPIYGADFGWGEEIYMGPGEIGYDGKVFV  413

Query  514   LPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
              PG     G DGS LVA  LQV HI  F K+F EDI
Sbjct  414   FPG----QGLDGSFLVALRLQVRHIDAFQKFFNEDI  445



>emb|CBI36554.3| unnamed protein product [Vitis vinifera]
Length=480

 Score =   353 bits (906),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 205/456 (45%), Positives = 263/456 (58%), Gaps = 30/456 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V+P++ T  G   LS+ DQ+  + +  I+YFY  P  +S ++ I  LR SLS+ LV FY
Sbjct  5     TVRPAKETPGGYRCLSDSDQVRALTHAPIIYFYP-PVNVSLESAIEILRHSLSEALVIFY  63

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AG          GG  L L CN  GA+L+  ESDA + D GDF P  E   L+PSVDY
Sbjct  64    PLAG-----WLHWIGGGRLVLECNALGALLIAVESDAKIDDFGDFGPTQEIRALIPSVDY  118

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
                 PI ++PL   Q+TKF CGGISLG    H++ DG   SHF+ EWA +A G+  +S+P
Sbjct  119   D--KPIHELPLLLVQVTKFSCGGISLGLGALHIMTDGLSASHFISEWAKIARGEQPNSSP  176

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHH---SP-PLIIGQSSNESERMKETKVSTLRLSKP  1034
             F DR +L A E  S+        +F H   SP PL+IG+  +  ER +E+   TL+LSK 
Sbjct  177   FLDRSILLAPEHLSAP-------VFDHPEYSPQPLLIGKQDHMEERKRESATLTLKLSKD  229

Query  1033  QIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
             Q+  LK   N  RS +   R YTRYE +  HIWR ACKAR H+ QQPT LS  VD R RM
Sbjct  230   QVEKLKDKANKDRSASNNKRPYTRYEAVAGHIWRSACKARQHESQQPTTLSIIVDARNRM  289

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
             EPPLP  YFGNA   V     SGE++S+PL   + K R AI+  T EY+  ++ + + + 
Sbjct  290   EPPLPPRYFGNATFRVTAESTSGELVSKPLGYASGKARQAIEKATHEYLQSSLMYVKCQE  349

Query  673   DVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLI  515
             DV   +   T       F GNPNL + +W  LP +G D GWG+EI+M PG    DG V +
Sbjct  350   DVTPFRNFNTVGCAKGAFYGNPNLEITSWARLPIYGADFGWGEEIYMGPGEIGYDGKVFV  409

Query  514   LPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
              PG     G DGS LVA  LQV HI  F K+F EDI
Sbjct  410   FPG----QGLDGSFLVALRLQVRHIDAFQKFFNEDI  441



>ref|XP_010094198.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB55374.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=469

 Score =   352 bits (903),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 204/469 (43%), Positives = 291/469 (62%), Gaps = 38/469 (8%)
 Frame = -2

Query  1741  VVKP-SEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST-LSP-DAIIHSLRLSLSQVLV  1571
             +V+P  EPT  G  SLSELDQI ++ + +++YFY +P   L+P +A+ +SLR SL +VLV
Sbjct  10    MVRPIHEPTCKGRQSLSELDQINSLTHTQVIYFYQSPKIWLTPSEAVFNSLRDSLRRVLV  69

Query  1570  HFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPG-PEFNHLVP  1394
              FYP AGRL WT      G     +C+G G    E E D  L + GDF+P  P + +L P
Sbjct  70    PFYPLAGRLRWTLNDHHKGRLEL-DCDGRGVAFFEVEFDVELVEFGDFAPSTPNYQNLFP  128

Query  1393  SVDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPL  1214
             S+D S   PI ++P+   QLT+F+CGGISL  + SHVVADG  ++HF+ EWA ++  +P+
Sbjct  129   SIDCSV--PIHELPVLFVQLTRFKCGGISLSLSFSHVVADGLSMAHFVTEWARVSREEPM  186

Query  1213  SSAPFHDRRLLRAGEsssssSPQGGRRIFHHS------PPLIIGQSSN----ESERMKET  1064
                P H R   R   ++         R+F HS      P L+I + ++    E + M E 
Sbjct  187   QKMPCHVRNPSRITRTT---------RVFDHSTDFLYLPRLLIEKPTSDDHQEVKNMIER  237

Query  1063  KVSTLRLSKPQIHAL-KAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTN  887
              V +L+LSK Q+  L K A +N ++   K   YTRYEV+ AHIWRC  K R +K +Q T 
Sbjct  238   TVISLKLSKYQVEKLRKFASDNIQNDEGKRVVYTRYEVLAAHIWRCMTKVRKNKDEQETT  297

Query  886   LSFCVDIRRRMEPP-LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEY  710
                 +D RRR+EP  LP+ YFGNAI DV    ++G+++++PL   AS+IR+AI+ VT+EY
Sbjct  298   NIVTIDARRRLEPAALPEEYFGNAIFDVKARSLAGDLVAKPLGYGASRIREAIEKVTNEY  357

Query  709   VNCAIDFYRNEGDVIKRQELGTFFV-------GNPNLSVINWVGLPNHGLDLGWGKEIHM  551
             V  AIDF +N+ D+ + + L + FV       GNPN++V NWV LP +G+D GWGKEI+ 
Sbjct  358   VLSAIDFIKNQQDLSRFRYLYSLFVENNINLLGNPNVAVTNWVNLPAYGIDFGWGKEIYF  417

Query  550   SPGH-DCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
              PG+ + DGD ++    + + GD GSL+V  CLQVDH+ DF K+FY++I
Sbjct  418   GPGNLEIDGDSVLF--RDNVSGDIGSLIVVLCLQVDHVDDFKKHFYKEI  464



>gb|KHN17616.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=364

 Score =   347 bits (891),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 179/370 (48%), Positives = 240/370 (65%), Gaps = 22/370 (6%)
 Frame = -2

Query  1483  GAVLVEAESDAVLADLGD-FSPGPEFNHLVPSVDYSGVDPIPDIPLFAGQLTKFRCGGIS  1307
             G   +EAES +   DLGD FSP  E+N+LVP+VDY+   PI  +PL   QLT F+CGG+S
Sbjct  2     GVQFIEAESSSSFEDLGDDFSPSSEYNYLVPTVDYTL--PIHGLPLVLIQLTNFKCGGVS  59

Query  1306  LGFAISHVVADGQGISHFLFEWANLASGKPLSSAPFHDRRLLRAGEsssssSPQGGRRIF  1127
             +G  +SH V DG   SHF+ EWA LA G+PL + PFHDR++L AG+  S S  +      
Sbjct  60    IGITLSHAVVDGPRASHFISEWARLARGEPLQTVPFHDRKVLHAGDPPSVSLARCHSHTE  119

Query  1126  HHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHALKAADNNGRSCNAKLRGYTRYEVIT  947
                PPL++G++ N  ER K+T +  L+LSK Q+  LK   N G   N     + RYE I 
Sbjct  120   FDEPPLLLGKTDNTEERKKKTAMVILKLSKTQVETLKKRANYGGYGN-----WCRYEAIA  174

Query  946   AHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRP  767
              HIWR ACKAR HK  QPT L+  VD R RMEPPLP  YFGNA +D V   ++G+++S+P
Sbjct  175   GHIWRSACKARGHKEDQPTTLTVIVDSRSRMEPPLPKGYFGNATLDTVATSLAGDLVSKP  234

Query  766   LQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV---------IKRQELGTFFVGNPNLSV  614
             L   +S+IR+AI+ V+ EYV   I+F +N+ D+         I+ ++    F GNPNL+V
Sbjct  235   LGYASSRIREAIERVSDEYVRSGIEFLKNQEDLRRFHQDLHAIESEKKEEPFYGNPNLAV  294

Query  613   INWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQ  437
             ++W+ LP +G+D GWGKE++MSP  HD DGD ++LPGP+G    DGSLLV   LQV+H+ 
Sbjct  295   VSWLTLPIYGVDFGWGKELYMSPATHDFDGDFVLLPGPDG----DGSLLVCLGLQVEHMD  350

Query  436   DFNKYFYEDI  407
              F K+FYEDI
Sbjct  351   AFKKHFYEDI  360



>ref|XP_002276550.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Vitis 
vinifera]
Length=445

 Score =   345 bits (884),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 197/456 (43%), Positives = 253/456 (55%), Gaps = 30/456 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V+P+  T  G   +S+ DQ+  + +    YFY  P  +S ++    LR SLS+ LV FY
Sbjct  9     TVRPARETPGGCRCVSDSDQVRALTHAPTFYFYP-PVNVSLESATEILRHSLSEALVIFY  67

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL W             +CN  GA+L+  ES+  + D GDF P PE   L+PSVDY
Sbjct  68    PLAGRLHWIGGGRLEL-----DCNALGALLIAVESEGKIDDYGDFRPTPEIRALIPSVDY  122

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
                 PI ++PL   QLTKF CG +SLG  ISH +ADG    HF+ EWA +A G+  +S P
Sbjct  123   D--KPIDELPLLLVQLTKFSCGSMSLGLGISHTIADGLSALHFISEWAKIARGEQANSPP  180

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSP----PLIIGQSSNESERMKETKVSTLRLSKP  1034
             F DR +L A E  ++        +F H      PL+IG+  N  ER +ET    L+LSK 
Sbjct  181   FLDRSVLLAPEHLTAP-------VFDHPEFGPQPLLIGKQDNMEERKRETTTLMLKLSKD  233

Query  1033  QIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
             Q+  LK   N  RS +   R YTRYE I  HIWR ACKAR H+ QQPT LS  VD R RM
Sbjct  234   QVEKLKDKANKDRSPSDNKRPYTRYEAIAGHIWRSACKARQHESQQPTLLSIIVDARNRM  293

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
             EPPLP  YFGN    V     SGE++S  L   + K R AI+  T EY+  ++ + + + 
Sbjct  294   EPPLPPRYFGNGTFRVTAETTSGELVSNSLGFASGKARQAIEKATHEYLQSSLVYVKCQE  353

Query  673   DVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLI  515
             DV   +   T       F GNPNL + +W  LP +G D GWG+EI+M PG    DG V +
Sbjct  354   DVTNFRNFHTVGCAKGAFYGNPNLEITSWARLPIYGADFGWGQEIYMGPGGIGYDGKVFV  413

Query  514   LPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
              PG     G DGS +VA  LQV H+  F K+FYEDI
Sbjct  414   FPG----QGQDGSFVVALRLQVRHVDAFQKFFYEDI  445



>ref|XP_003608529.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase-like 
protein [Medicago truncatula]
Length=495

 Score =   346 bits (888),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 191/436 (44%), Positives = 256/436 (59%), Gaps = 36/436 (8%)
 Frame = -2

Query  1738  VKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTL--SPDAIIHSLRLSLSQVLVHF  1565
             V+P EPTW G L LSE DQIG + +V  +YFY  P     SP  I  +L+ SLS+VLV F
Sbjct  17    VRPMEPTWCGRLPLSEWDQIGIIAHVPTIYFYQPPKNWLTSPTKIATTLKESLSKVLVPF  76

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEF-NHLVPSV  1388
             YP AGRL                CN  G   +EA+S   L++LGDFSP  E+  +L+P +
Sbjct  77    YPLAGRLHSKGNGRFDL-----ECNSLGVQFIEAQSSLTLSELGDFSPSSEYYRYLIPHI  131

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   P+ DIPL   QLT F CG +S+   ISH VADG    HF+FEWA +A G+PL  
Sbjct  132   DYTL--PMEDIPLVIFQLTNFNCGVVSISLLISHAVADGPSALHFIFEWARIARGEPLKM  189

Query  1207  AP-FHDRRLLRAGEsssssSPQGGRRIFHHSP---PLIIGQSSNESERMKETKVSTLRLS  1040
              P F D  +L         SP+    +    P   PL++G   N  ER K+T V+ + LS
Sbjct  190   VPRFLDTNML---------SPKRCNSVNKWEPDQLPLLLGNLDNVEERKKKTTVAIINLS  240

Query  1039  KPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
             K Q+  L+   N   +  +  RGY+RYE +T HIWR ACKAR HK  QPT L  CVD RR
Sbjct  241   KTQVEKLRKTANESWNKPSNGRGYSRYETVTGHIWRSACKAREHKNDQPTALGVCVDWRR  300

Query  859   RMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRN  680
             R+EP LP  YFGNAI+DV+   ++G+++S+PL   +S+IR+A++ V  EY+    ++++ 
Sbjct  301   RVEPNLPKGYFGNAILDVLATSLAGDLMSKPLGYASSRIREAVEKVNDEYIRLGNEYFKK  360

Query  679   EGDVIKRQELGTF-------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG--HDCDG  527
             + D+ K Q+L          F  NPNL V +W+ LP +GLD GWGKE++M  G   + DG
Sbjct  361   QEDLTKFQDLQVVGNGEKGPFYWNPNLGVTSWLSLPIYGLDFGWGKEVYMGLGTHEELDG  420

Query  526   DVLILPGPNGIDGDDG  479
             D L+LP PN    DDG
Sbjct  421   DSLLLPSPN----DDG  432



>ref|XP_010265516.1| PREDICTED: spermidine hydroxycinnamoyl transferase [Nelumbo nucifera]
Length=447

 Score =   342 bits (876),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 196/458 (43%), Positives = 265/458 (58%), Gaps = 33/458 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              VKP+ PT +  L LS+ DQ+    +   +YFY +P  +SP + + ++R SLSQ LV FY
Sbjct  9     TVKPASPTPNCRLWLSDSDQLEPYTHAPTIYFYRSPIGVSPSSAVETMRSSLSQALVQFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL W             +CN  G  L+EAES+  + D GDF P PE   L+P VDY
Sbjct  69    PLAGRLQWIDGTRLEL-----DCNAMGVELLEAESENRIDDFGDFRPTPEIRQLIPRVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASG-KPLSSA  1205
                 PI +IPL   QLT F CGGIS+G AISH V DG+   +F+  W  +A G KP  + 
Sbjct  124   GL--PINEIPLLLVQLTSFPCGGISIGVAISHSVVDGKSAINFIGAWTKIARGEKPDPTP  181

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFH---HSPPLIIGQSSNESERMKETKVSTLRLSKP  1034
             PF DR +L+A        P    R  H    S P +IG+  ++ ER KET V   +L+K 
Sbjct  182   PFLDRTVLQAS------GPVVAPRFDHVEFDSLPHLIGRPDDKEERAKETTVEMFKLTKE  235

Query  1033  QIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
             Q+  LK+  N GR+ ++  R YTRYE I  H+WRCACKAR+H+ +Q T +   VD R R+
Sbjct  236   QVEKLKSKANEGRTKDSG-RAYTRYEAIAGHVWRCACKARAHEREQLTKVRIIVDCRNRL  294

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
              PPLP  YFGNAI   +    SG+++ +PL   A KIR+A+  +T EYV  AIDF R++ 
Sbjct  295   NPPLPQGYFGNAIXPTIATARSGDLMDQPLGYAAGKIREAVVKMTDEYVRSAIDFLRSQP  354

Query  673   DVIKRQ--------ELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDV  521
             D+++ +          G FF GNPNL++ +W+GL  +  D GWG+ I+M PG    DG  
Sbjct  355   DLMRFRTSFHSVGCSEGGFF-GNPNLTITSWLGLAIYEGDFGWGRPIYMGPGLIASDGKC  413

Query  520   LILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
              +L G     G+DGSL +   LQV H+  F + FYEDI
Sbjct  414   SVLSG-----GEDGSLAIPLGLQVAHVDAFKELFYEDI  446



>emb|CAN72449.1| hypothetical protein VITISV_011069 [Vitis vinifera]
Length=445

 Score =   335 bits (860),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 195/456 (43%), Positives = 255/456 (56%), Gaps = 30/456 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V+P++ T  G   LS+ DQ+  + ++ I+YFY  P  +S ++    LR SLS+ LV FY
Sbjct  9     TVRPAKETPGGYRCLSDCDQVKPVNHIPIIYFYP-PVNMSLESATEILRHSLSEALVIFY  67

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL W              CN  GA+L+  ESDA + D GDF P  E   L+PSVDY
Sbjct  68    PLAGRLHWIGGGRLVL-----ECNALGALLIAVESDAKIDDFGDFRPTQEIQALIPSVDY  122

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             +   PI ++PL   Q+TKF CG ISLG   S V+ADG     F+  WA +A G+  +S P
Sbjct  123   N--KPIHELPLLLVQVTKFSCGSISLGLGTSRVMADGLSALPFIQGWAKIARGEQPNSPP  180

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHH---SP-PLIIGQSSNESERMKETKVSTLRLSKP  1034
             F DR +L A E+ ++        +F H   SP PL+IG+     ER +ET    L+LSK 
Sbjct  181   FLDRSILLAPENLTAP-------VFDHPEYSPQPLLIGKQDQMEERKRETATLMLKLSKD  233

Query  1033  QIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
             Q+  LK   N  RS +   R YTRYE +  HIWR ACKAR H+  QPT LS  +D R RM
Sbjct  234   QVEKLKDKANKDRSASNNKRPYTRYEAVAGHIWRSACKARQHESLQPTTLSIILDARNRM  293

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
             EPPLP  YFGNA   V     SGE++S+PL   + K R AI+  T EY+  ++ + + + 
Sbjct  294   EPPLPPRYFGNATFRVTAESTSGELVSKPLGYASGKARQAIEKATHEYLQSSLVYVKCQE  353

Query  673   DVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLI  515
             DV + +   T       F GNPNL + +W  LP +G D GWG+EI+M PG    DG V +
Sbjct  354   DVTQFRNFHTVGCTKGAFYGNPNLDITSWARLPIYGADFGWGQEIYMGPGAIGYDGKVFV  413

Query  514   LPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
              P      G DGS  V   LQV HI  F  +FYEDI
Sbjct  414   FPS----RGQDGSFHVVLRLQVRHIDAFQXFFYEDI  445



>gb|EPS68189.1| hypothetical protein M569_06582, partial [Genlisea aurea]
Length=435

 Score =   328 bits (842),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 187/456 (41%), Positives = 265/456 (58%), Gaps = 43/456 (9%)
 Frame = -2

Query  1738  VKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFYP  1559
             ++P+ PT+ G++ L+E+D IG + +V ++YFY +     P      +  SL +VLV+FYP
Sbjct  11    IRPAAPTFQGIMPLTEMDLIGVVDHVSLIYFYPS----HPQDAFAVIAESLQKVLVYFYP  66

Query  1558  FAGRlswttaasgggtalaLNCNGNGAVLVEAESDAV--LADLGDFSPGPEFNHLVPSVD  1385
              AGRL                CNG GAVL+EA  D V  +  L DF+   +  +LVP VD
Sbjct  67    LAGRLRRLFGGRMEIV-----CNGEGAVLIEAACDDVEDIDVLYDFAKSGDCQNLVPQVD  121

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YSG   I DIPL   QLT FR GG+S+G + SH V DG+ + HFL EW+ +A G+P+   
Sbjct  122   YSG--EIDDIPLLLVQLTAFRRGGVSVGLSFSHAVVDGKSVGHFLSEWSRIARGEPIGEL  179

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSP-PLIIGQSSNESERMKETKVSTLRLSKPQI  1028
             PF  R +  AG+          + +    P PLIIG++    ER KET ++ L+++K QI
Sbjct  180   PFLGREITIAGD---------AKPLSSFPPAPLIIGETDGRKEREKETTLTQLKITKSQI  230

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
              ALK   N  R+   K  G  RY+ I AH+WR AC+ARSH+  QPT +   VD+R+R+ P
Sbjct  231   EALKKEAN--RTAGDKPCG--RYKAIAAHVWRSACRARSHEDNQPTWMCIYVDVRKRVSP  286

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
              LPD+YFGNA++  +    SGE++ +PL     KIR+AIDGVTSE+V+ A+ F RN  D+
Sbjct  287   NLPDNYFGNAVVPAIAESFSGELVKKPLGFTVDKIREAIDGVTSEFVHSAVRFIRNLDDL  346

Query  667   I------KRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHD---CDGDVLI  515
                     R+     F GNPN++V + +G P +GLD GWGKE+ M P  D   CDG+  +
Sbjct  347   SPFQFMQHRKSRDLEFYGNPNVTVTSGLGSPKNGLDFGWGKEVLMIPFADNFYCDGESFV  406

Query  514   LPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
                      D G + V  CLQ + +++F + FYED+
Sbjct  407   FE-------DGGDVAVFICLQSEVVEEFRRIFYEDL  435



>ref|XP_010669430.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Beta 
vulgaris subsp. vulgaris]
Length=480

 Score =   328 bits (842),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 194/463 (42%), Positives = 266/463 (57%), Gaps = 37/463 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST---LSP--DAIIHSLRLSLSQV  1577
              VKP+EPTW+G+L LSELDQI  + +  +LYFY  P+    L+P  + I+++L+ SLS  
Sbjct  36    TVKPAEPTWNGILPLSELDQISVITHSSVLYFYDKPTKEEWLNPSNNKIMNTLKESLSHA  95

Query  1576  LVHFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDF-SPGPEFNHL  1400
             LV FYP AGRLS+              CN  GA LVE ES   + D GDF S   +   L
Sbjct  96    LVPFYPLAGRLSYKGEGRFEL-----ECNAMGAELVEVESTMKMVDFGDFYSCTKKLREL  150

Query  1399  VPSVDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGK  1220
             +  + Y    PI D+P+ A Q+T+FRCGG+SLG ++SHVVADG+   HF+ EW  LA GK
Sbjct  151   LVPMSYY-TKPIQDLPVLAVQITRFRCGGLSLGMSMSHVVADGRSAFHFIKEWGRLALGK  209

Query  1219  PLSSAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLS  1040
             PL  APF DRR+LRA     +   Q  R   ++   L +G    E +  K+   + + L+
Sbjct  210   PLEEAPFLDRRILRAEAHQKTVVDQSER--MNYFSQLRLG----EDKWGKQVSPTFVVLT  263

Query  1039  KPQIHALKAADN---NGRSCNAKLRG-YTRYEVITAHIWRCACKARSHKPQQPTNLSFCV  872
             K  I  LK   N   N       LR  Y+R+EV+ AH+WRC CKAR  K +  + L   V
Sbjct  264   KDMIMRLKEVANSISNREIVKDHLRRPYSRFEVVAAHVWRCVCKARELKSEDMSTLMVAV  323

Query  871   DIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAID  692
                 RMEPPLP S+FGNA++D  I    GE+ISRPL    S +R+AI  VT+EY+  +I+
Sbjct  324   AAHDRMEPPLPSSFFGNAVVDAEISSSVGELISRPLSYACSIVREAIQKVTNEYILASIE  383

Query  691   FYRNEGDVIKRQELGTFFV------GNPNLSVINWVGLPNHGLDLGWGKEIHMSPG--HD  536
             F + + ++ K Q +    +      G+ N++V++W+ L +HG+D GWGKEIHM P     
Sbjct  384   FLKKQQNLTKYQYIDDRGIMEGPAYGDHNITVVSWLNLSSHGVDFGWGKEIHMGPPIVQT  443

Query  535   CDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             CDGD+ + P  N     DGSL+V  CLQ +  + F KY    I
Sbjct  444   CDGDIHLSPYKN-----DGSLIVGVCLQPN--EKFVKYITSPI  479



>ref|XP_011083883.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Sesamum 
indicum]
Length=447

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 186/453 (41%), Positives = 257/453 (57%), Gaps = 22/453 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+EPT   +L L+  DQI  + +   +YFY     L     I  L+ SLS+ LV FY
Sbjct  9     IVRPAEPTPDEILFLNACDQIKDISHTPTIYFYKHSEALDAGDAILRLKDSLSKALVLFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL+W             +CNG G  + EAES++ + D GDF+P P    L+PSVDY
Sbjct  69    PLAGRLNWAAEGGSRVEL---HCNGKGVPIFEAESESKVEDFGDFTPTPAIQALIPSVDY  125

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             +   PI +IPL   QLT+F CGG+S+G  +SHV+ADG    HF+ EWA ++ G      P
Sbjct  126   T--TPIDEIPLVIVQLTRFSCGGVSIGLGVSHVMADGPSALHFVDEWAKISRGAEPIVPP  183

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR++L   +  SS+      R     PP +IGQ  N  +R K   V+ L L+K QI  
Sbjct  184   FLDRKVLETDKPLSSTFDPSVLR----PPPTLIGQEDNLEQRKKPITVAFLNLTKLQIEK  239

Query  1021  LKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPL  842
             L+   N         RGY+R+E + AHIWRC  KAR H  +Q T+L F  D R +++PPL
Sbjct  240   LRNKANLDVDKETNSRGYSRFEAVAAHIWRCTSKARGHIAEQQTSLHFVADFRNKLKPPL  299

Query  841   PDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  662
             P ++FGNA+I V     SG ++S  +   + KIR+A++ VT + V   +DF +   DV +
Sbjct  300   PKTFFGNALIRVEATDKSGSLLSNSIGTASKKIREAVEKVTDDTVRAYLDFLKGLPDVGR  359

Query  661   RQEL-------GTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLILPG  506
              + L       G F+ GNPNL++I+W  LP +G D GWGKEIHM PG    DG   I+P 
Sbjct  360   FRSLDNNGRPKGDFY-GNPNLAIISWTALPLYGADFGWGKEIHMGPGSMGFDGKTFIIPS  418

Query  505   PNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
              +G    DGS  +A  LQ +H+  F K FY+DI
Sbjct  419   HDG----DGSFNIAIWLQEEHMGAFKKCFYDDI  447



>emb|CDP05692.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   320 bits (820),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 181/457 (40%), Positives = 271/457 (59%), Gaps = 33/457 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPS-TLSPD-AIIHSLRLSLSQVLVH  1568
             +VKPS PT+ G + LS  DQ G ++++  ++FY  P    + D ++I+ L+ SL+  LVH
Sbjct  14    LVKPSAPTFQGHMPLSLFDQTGYLIHIPTVHFYKPPPPQFTQDGSLINKLKSSLAMALVH  73

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGR+               NCN  GA L+EA     L  +GD SP P F++LVPS+
Sbjct  74    FYPLAGRIVLLEGGRMEL-----NCNSAGAQLLEAVCRETLDQIGDLSPSPLFHNLVPSL  128

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             +Y+ +    ++PL   Q+TKF+   I+LG AISH++ADGQ   HF+ EWA L SG  + +
Sbjct  129   NYNDMK---NLPLLVIQVTKFKDENIALGIAISHIIADGQSAFHFIIEWARLVSGNSIFT  185

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIF--------HHSPPLIIGQSSNESERMKETKVST  1052
              PF DRR+LR           GG RI         H   P++IG++S + ++ K+T +  
Sbjct  186   KPFLDRRVLRGDSRVPR---SGGERIDVNSHAANPHLPLPIVIGETSAKIQQEKKTSIDL  242

Query  1051  LRLSKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCV  872
             L LS  +I  LK+  ++G     K R Y+ +EVI+AH+WRCAC+AR    +QPT LSF +
Sbjct  243   LILSTKEIEFLKSLASDGIVPAMK-RPYSTFEVISAHLWRCACRARLLIHEQPTVLSFPI  301

Query  871   DIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAID  692
             + R+ ++PPLP  YFGNAI+D+     SG +++  L + A+KIR  I  VTSE++   I+
Sbjct  302   NFRKLIQPPLPVGYFGNAILDIRSMDFSGNLLTGTLANTAAKIRKTILAVTSEFLYSEIE  361

Query  691   FYRNEGDVIKRQELGTF--FVGNPNLSVINWVGLPNHGLDLGWGKEIHM-SPGHDCDGDV  521
             F + + D+ K QE   +  ++GNPNL++ +W+  P +GLD GWGK + M    H+ DGD 
Sbjct  362   FLQMQTDLSKFQERHDYMEYLGNPNLTISSWLTFPFNGLDFGWGKSLGMVEASHNGDGDF  421

Query  520   LILPGPNGIDGD-DGSLLVAACLQVDHIQDFNKYFYE  413
             +       + GD  G ++V+ C Q ++I+ F  YFYE
Sbjct  422   V-------LHGDLHGGVVVSMCFQEEYIKSFKYYFYE  451



>gb|ADD71921.1| BAHD-type hydroxycinnamoyltransferase [Actaea racemosa]
Length=448

 Score =   319 bits (817),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 188/458 (41%), Positives = 256/458 (56%), Gaps = 31/458 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             VVKPSEPT +  L L E DQ+    +  + + Y      S    + +L+ SLS+ LV +Y
Sbjct  9     VVKPSEPTPNVKLFLPESDQVKPWTHAPVFFVYQPEVDNSVSTSLENLKFSLSRALVPYY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL+              +CN  GAV++EAESDA L D GDF P  E   L P VDY
Sbjct  69    PLAGRLNGIGGGRFEL-----HCNTMGAVIIEAESDARLEDFGDFRPTSETTKLAPYVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             +    + ++PL   QLT+F+CGGI +G A+SH+V+DG+G   F+  WA +  G+     P
Sbjct  124   A--KDVSELPLLLVQLTRFKCGGIGIGIAMSHIVSDGKGAFGFITTWAKINRGEKGIIEP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFH---HSPPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
             FHDR     G+      P    R  H      P+++G  S + ER KET    L LSK Q
Sbjct  182   FHDRTAFYKGD------PTAKPRCDHVELKGYPVLLGNKSAKEERAKETTTRMLNLSKNQ  235

Query  1030  IHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             +  LK   N G+  +   R Y+R+E ++ HIWRCA KAR H+ +Q T+L   +D R R+ 
Sbjct  236   VDKLKEKSNLGKPKDYVGREYSRFEAMSGHIWRCASKARRHENEQLTSLRITIDCRNRLR  295

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRP--LQDVASKIRDAIDGVTSEYVNCAIDFYRNE  677
             PPLP  Y GNA +       SGE++S P  L  V S IR  ID V  +Y+  A DF  ++
Sbjct  296   PPLPPRYSGNATMVTTSIAESGELLSNPLGLGFVCSVIRKCIDKVDDDYIKSATDFLISQ  355

Query  676   GDVIKRQE----LGT---FFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSP-GHDCDGDV  521
              D+   +     +G+    F+GNPNL++ +WVGLP + +D GWGK I+M P     DG +
Sbjct  356   DDLTPYRSGFHNVGSTEGVFLGNPNLAITSWVGLPINDVDFGWGKPIYMGPTALGYDGKL  415

Query  520   LILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             LI+PG      DDGS++V   LQV HI DF K+FYEDI
Sbjct  416   LIIPGK-----DDGSVIVPIRLQVAHIDDFEKFFYEDI  448



>emb|CDP21167.1| unnamed protein product [Coffea canephora]
Length=453

 Score =   319 bits (818),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 180/455 (40%), Positives = 255/455 (56%), Gaps = 20/455 (4%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +VKP+ P    ++ LSE DQ   + +   ++FY   +          L+ SLS+ L  FY
Sbjct  9     IVKPARPIPRKVMYLSECDQCKPLTHATTVHFYKPENPELLKDATRVLKDSLSEALAAFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL                CN  GA+L+EA+S+  + D GDF P P+   L+P +DY
Sbjct  69    PLAGRLYQKDGGRVEL-----RCNSMGALLLEAQSELKIEDFGDFCPTPQIRALIPPIDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             +   P+ ++PL   Q+TKF CGG+SLG A+SHV+ DGQ   HF+ EWA +A G+     P
Sbjct  124   NNT-PLHEVPLLLVQITKFACGGVSLGSAVSHVIVDGQSGCHFVAEWAKIARGEKSDDQP  182

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             + DR +L+  E   SS     +    +  P++IGQSS+  ER K T  +  +LSK QI  
Sbjct  183   YLDRTILQQYEECPSSIAPKLQYPDFYPLPVLIGQSSSLEERKKATTCAMFQLSKEQIEQ  242

Query  1021  LKAADNNGRSCNAKLRG---YTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             LK   NN      K      ++R+  ++AHIW+C  KAR H P Q T L   VD R R++
Sbjct  243   LKNNVNNHHDLVHKTSNHPPFSRFVAVSAHIWKCLSKARMHSPDQETVLYVTVDFRNRLK  302

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             PPL   YFGNA++ V    ++G++ SRP    +SKI++AID VT EYV   +   ++  +
Sbjct  303   PPLSGRYFGNAVLPVPARAIAGDLQSRPPSYASSKIKEAIDKVTDEYVRSYLVCMKDMPE  362

Query  670   VIKRQELGT------FFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLIL  512
             V   +   T       F GNPNL + +WVGL  + ++ GWG+ I M+PG    DG + ++
Sbjct  363   VSSSRHFHTVGCAQGLFFGNPNLLITSWVGLDVYKVNFGWGEAISMTPGSLGYDGRLFLI  422

Query  511   PGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             PGPNG    DGSL++   LQV+HI  F KYFYEDI
Sbjct  423   PGPNG----DGSLIIPLRLQVEHINAFKKYFYEDI  453



>ref|XP_010669388.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Beta 
vulgaris subsp. vulgaris]
Length=460

 Score =   318 bits (814),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 199/461 (43%), Positives = 262/461 (57%), Gaps = 35/461 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST---LSP--DAIIHSLRLSLSQV  1577
             +VKP+E TW+G L LSELDQI  +     LYFY  P+    L+P  + I+++L+ SLSQV
Sbjct  10    IVKPAEQTWNGTLPLSELDQIAIITLSSHLYFYDKPTQEDWLNPQNNKILNTLKHSLSQV  69

Query  1576  LVHFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPE-FNHL  1400
             LV FYP AGRLSW              CN  GA L+E +S   + D GDF    E F HL
Sbjct  70    LVPFYPLAGRLSWIPGGRLKL-----ECNAMGAELIEVDSTMKITDFGDFYSSSENFQHL  124

Query  1399  VPSVDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGK  1220
             +P ++Y    PI D+P+ A Q+T+F CGG+S+G ++SHVV DG+   HF  EWA LA G+
Sbjct  125   LPRIEYYE-KPIQDLPVLAVQVTRFACGGLSVGISMSHVVVDGKSAFHFTEEWARLARGE  183

Query  1219  PLSSAPFHDRRLLRAGEsssssSPQ---GGRRIFHHSPPLIIGQSSNESERMKETKVSTL  1049
             PL   PF DRR+L+A +  S S       G  +   S     G+  N  E  K+   + +
Sbjct  184   PLEFVPFLDRRVLQAEDHVSRSKMTENIAGESMDFFSQLRYFGEEDN-LEWGKQVTPTFV  242

Query  1048  RLSKPQIHALKAADNNGRSC--NAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFC  875
              L+K +I  LK   N  +    +  +R Y+R+EVITAHIWRC  KAR  K +  T L  C
Sbjct  243   YLTKDKIERLKEVANISKELMNDNGVRPYSRFEVITAHIWRCVTKARELKNEDITTLIAC  302

Query  874   VDIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAI  695
             VD R RMEPPLP  YFGNAIID+ I    GE+IS PL    SKIR+A   V +EYV   I
Sbjct  303   VDARGRMEPPLPPRYFGNAIIDIEISSCVGELISNPLSYACSKIREATTKVNNEYVLETI  362

Query  694   DFYRNEGDVIKRQEL-------GTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG--  542
             +FY+N+  V K Q +       G  + G+ N+ V++W+ L    +D GWGKEIHM P   
Sbjct  363   EFYKNQKSVSKYQYIDDRGKIRGPSY-GDQNVLVMSWLNLMGRSIDFGWGKEIHMGPPIV  421

Query  541   HDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYF  419
             +  DGD +I P       DDGS++V   LQ    Q F +Y 
Sbjct  422   YAGDGDFMITPY-----KDDGSVVVGVSLQPK--QKFQEYM  455



>emb|CDP18830.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   316 bits (810),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 181/455 (40%), Positives = 254/455 (56%), Gaps = 23/455 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +VKP++P    ++ LSE DQ   + Y   ++FY   +          L+ SLS+ L  FY
Sbjct  9     IVKPAKPE---VMYLSECDQCKPLTYATTVHFYKPENPELLKDATRVLKDSLSEALAAFY  65

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL                CN  GA+L+EA+S+  + D GDF P P+ + L+P +DY
Sbjct  66    PLAGRLFQKDGGRVEL-----RCNSMGALLLEAQSELKIEDFGDFCPTPQISALIPPIDY  120

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             +   P+ ++PL   Q+T+F CGG+SLG A+SHV+ DGQ   HF  EWA +A G+     P
Sbjct  121   NNT-PLHEVPLLLVQITRFACGGVSLGLAVSHVIVDGQSGCHFAAEWAKIARGEKSDDQP  179

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             + DR +L+  E   SS     +    +  P++IGQSS+  ER K T  +   LSK QI  
Sbjct  180   YLDRTILQQYEEYPSSIAPKLQYSDFYPLPVLIGQSSSLEERKKATTCAMFPLSKEQIEQ  239

Query  1021  LKAADNNGRSCNAKLRG---YTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             LK   NN      K      ++R+  ++AHIW+C  KAR H P Q T L   VD R R++
Sbjct  240   LKNNANNHHDLVHKTNNHQPFSRFVAVSAHIWKCLSKARMHSPDQETVLYVTVDFRSRLK  299

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             PPLP  YFGNA++ V    ++G++ SRP    +SKI++AID VT EYV   +   +N  +
Sbjct  300   PPLPGRYFGNAVLPVPARAIAGDLQSRPPSYASSKIKEAIDKVTDEYVRSYLACMKNMPE  359

Query  670   VIKRQELGT------FFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLIL  512
             V   +   T       F GNPNL + +WVGL  H ++ G G+   M+PG    DG + ++
Sbjct  360   VSSSRHFHTVGCAKGLFFGNPNLLITSWVGLDVHKVNFGGGEANSMTPGSLGYDGRLFLI  419

Query  511   PGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             PGPNG    DGSL++   LQV+HI  F KYFYEDI
Sbjct  420   PGPNG----DGSLIIPLRLQVEHINAFKKYFYEDI  450



>ref|XP_007214780.1| hypothetical protein PRUPE_ppa023555mg [Prunus persica]
 gb|EMJ15979.1| hypothetical protein PRUPE_ppa023555mg [Prunus persica]
Length=423

 Score =   312 bits (799),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 184/456 (40%), Positives = 255/456 (56%), Gaps = 62/456 (14%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTL--SPDAIIHSLRLSLSQVLVH  1568
             V+KPS PT  G L+LSE DQI T+ +V I+ FY         PDAI+++L+ SL + LV 
Sbjct  10    VLKPSTPTLQGSLALSESDQIDTISHVSIINFYRPDQNFVSQPDAIVNTLKDSLCRALVP  69

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             F+P AGRL W             +CNG G   +EAESD+ L DL       E+++L+P+V
Sbjct  70    FHPLAGRLRWIGGGHLEL-----DCNGMGVQFIEAESDSKLDDL-------EYDYLIPTV  117

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DY+   PI ++P+                  ISH V DGQ   HF+ EWA LA G+P+  
Sbjct  118   DYTL--PIHELPIL---------------LTISHAVVDGQSTFHFISEWARLAKGEPIGV  160

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
              PF DR+  +A      + P G      HS               K+T V+ L+L+K QI
Sbjct  161   MPFLDRKAFQA-----RTLPAGNTLGLDHS-------------EKKKTTVAMLKLTKQQI  202

Query  1027  HALKAADNNGRSC-NAKLR-GYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
               LK   N G    N+  +  YTRY+ +  HIWRCA KAR H+ +QPT +  CVD+R RM
Sbjct  203   EKLKRMANEGNDYKNSGTKPAYTRYKTVAGHIWRCASKARVHRNEQPTAMGVCVDLRSRM  262

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
             +PPLP  YFGNA    V   ++G+++S+PL   +S+I +AI+ V++ YV  AID +RN+ 
Sbjct  263   QPPLPQGYFGNATFYGVARSLAGDLVSKPLGYASSRITEAIEKVSNYYVLSAIDHFRNQP  322

Query  673   DVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLI  515
             ++ + Q L           GNPNL V+ W   P +GLD GW KE++M  G +D DG+  +
Sbjct  323   NLTRFQALHALGIAEGDLYGNPNLEVVTWSTPPMYGLDFGWEKEMYMGSGTYDFDGESFL  382

Query  514   LPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             LP P G    DGS+++  CLQV H+  F K+FYEDI
Sbjct  383   LPSPEG----DGSMVLTLCLQVAHMDAFKKHFYEDI  414



>ref|XP_011069658.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Sesamum 
indicum]
Length=453

 Score =   312 bits (799),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 179/454 (39%), Positives = 250/454 (55%), Gaps = 25/454 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+E T  G++ L+  DQI  + +   +YFY   + L    ++  L+ SL + L  FY
Sbjct  10    IVRPAELTPDGVMYLNSCDQIKDITHTPTIYFYRHSNKLEAVNVVSVLKDSLGKALSLFY  69

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL+W             +CNG G  + EAES+  + D GDF+P P    L+PSVDY
Sbjct  70    PLAGRLNWAAEGGSRVEL---HCNGKGVPIFEAESEGAVEDFGDFTPSPAIQALIPSVDY  126

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             +   PI +IPL   Q+T+FRCGG+S+G  ISHV+ADG    HF+ EW   A G      P
Sbjct  127   T--TPIDEIPLVIVQVTRFRCGGLSIGLGISHVMADGPSALHFIDEWTKFARGVGPVIPP  184

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR+ L   +           R     PP +IGQ  +  +R K   V+ L L+K QI  
Sbjct  185   FLDRKALETEKPVHCKFDPSVLR----PPPTLIGQEDSLEQRKKPISVAFLSLTKLQIEK  240

Query  1021  LKAADN---NGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             L+A  N      + N   RGY+R+E + AHIWRC  KAR H  +Q T+L F  D R +M+
Sbjct  241   LRAKANLDFYKENGNEGSRGYSRFEAVAAHIWRCTSKARGHIAEQQTSLHFVADFRNKMK  300

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             P LP +YFGNA+I V     SG +++  +   + KIR+A++ VT + V   +D+ +   D
Sbjct  301   PALPRNYFGNALIRVEATDKSGNLLTNSMGMASRKIREAVEKVTDDTVRAYLDYLKGLPD  360

Query  670   VIKRQEL-------GTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLI  515
             V + + L       G F+ GNPNL++I+W  LP +G D GWG EIH+ PG    DG   I
Sbjct  361   VGRFRSLDNNGRPKGDFY-GNPNLAIISWTALPLYGTDFGWGNEIHLGPGPMGFDGKTFI  419

Query  514   LPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
             +PG  G    DGS  VA  LQ +H+  F K FY+
Sbjct  420   IPGREG----DGSFKVAIWLQEEHMDAFKKCFYD  449



>gb|EYU25632.1| hypothetical protein MIMGU_mgv1a006215mg [Erythranthe guttata]
Length=452

 Score =   306 bits (783),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 180/458 (39%), Positives = 254/458 (55%), Gaps = 27/458 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTL-SPDAIIHSLRLSLSQVLVHF  1565
              V+P+EPT   ++ ++  DQI  + +   +YFY     L S +  +  LR SLS+ L  F
Sbjct  9     TVRPAEPTPEEIMYINSCDQIKDITHTPTIYFYKNSEALDSENDAVSILRDSLSKALFLF  68

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL+W             +CNG G  L EAESDA + D GDF+P      L+PSVD
Sbjct  69    YPLAGRLNWAAEGGSRVEL---HCNGKGVPLFEAESDAAVEDFGDFTPTAAIQALIPSVD  125

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             Y+   PI +IPL   QLT+FRCGG+S+G  ISHV+ADG    HF+ EW   A G   +  
Sbjct  126   YT--TPIDEIPLVIVQLTRFRCGGVSVGLGISHVMADGPSALHFVDEWTKFARGVGPAVP  183

Query  1204  PFHDRRLLRA---GEsssssSPQGGRRIFHHSPPLIIGQS-SNESERMKETKVSTLRLSK  1037
             PF DR++L        +    P   RR     PP ++G+  S+  +R K   V+ L L+K
Sbjct  184   PFLDRKVLETPPEKAPAVKFDPAVLRR-----PPTLVGEDDSSLEQRKKPIGVAFLTLTK  238

Query  1036  PQIHALKAADN-NGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
              QI  L+   N +    N+  RGY+R+E + AHIWRC  KAR H  +Q T+L F  D R 
Sbjct  239   LQIEKLRNKANLDFDYENSGGRGYSRFEAVAAHIWRCTSKARGHVAEQQTSLHFVADFRN  298

Query  859   RMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRN  680
             +++PPLP +YFGNA+I V     SG ++  P+   + KIR+A++ VT + V   +D+ + 
Sbjct  299   KLQPPLPKNYFGNALIRVEATDTSGSLLLNPIGAASRKIREAVEKVTEDTVRAYLDYLKE  358

Query  679   EGDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDV  521
               DV + + L         F GNPNL++I+W+ LP +G D GWG EIH+ PG    DG  
Sbjct  359   LPDVGRFRSLDNSGRPKGDFYGNPNLAIISWMSLPLYGADFGWGNEIHLGPGPMGFDGKT  418

Query  520   LILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
              I+P   G    +GS  VA  LQ +++  F  + Y+ I
Sbjct  419   FIIPTREG----NGSFNVAIWLQEEYMGAFKNFLYDGI  452



>ref|XP_007219083.1| hypothetical protein PRUPE_ppa014960mg, partial [Prunus persica]
 gb|EMJ20282.1| hypothetical protein PRUPE_ppa014960mg, partial [Prunus persica]
Length=446

 Score =   292 bits (747),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 179/455 (39%), Positives = 250/455 (55%), Gaps = 78/455 (17%)
 Frame = -2

Query  1654  LYFY------TTPSTLSPDAIIHSLRLSLSQVLVHFYPFAGRlswttaasgggtalaLNC  1493
             +YFY       TP+    DAI ++L+ SL + LV FYP AGRL W             +C
Sbjct  1     IYFYRPDQHCVTPT----DAIANTLKDSLRRALVPFYPLAGRLRWIEGGRLEL-----DC  51

Query  1492  NGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDYSGVDPIPDIPLFAGQLTKFRCGG  1313
             NG G   +EAESD  L DLGDFSP PE++ L P+VDY+   P  ++PL   QLT+F+CGG
Sbjct  52    NGMGVEFIEAESDLKLDDLGDFSPSPEYHSLFPTVDYNL--PFHELPLLFVQLTRFKCGG  109

Query  1312  ISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAPFHDRRLLRAGEsssssSPQGGRR  1133
              SLG  ISH V +GQ   HF+ EWA L  G+P+   PF D      G++  +       +
Sbjct  110   FSLGLEISHAVTNGQSACHFIGEWAKLTRGEPIGVMPFLD------GQAFLARHLPAPTQ  163

Query  1132  IFHH----SPPLIIGQSSNESERMKETKVSTLRLSKPQIHALKAADNN------------  1001
             +F H     PP+++GQS N  E   +T ++ L+L+K Q+  LK   N             
Sbjct  164   VFDHIEFNQPPILLGQSDNLQESKMQTTLTMLKLTKEQVDKLKQMANEVLLSGFTQTAEQ  223

Query  1000  ------------------GR--------SCNAKLRG-YTRYEVITAHIWRCACKARSHKP  902
                               GR         C+  L G  +++  +  HIWRCA ++R+HK 
Sbjct  224   FKTSRSLISQVNPIVLHYGRFKAKSYLSRCHILLIGTLSKHLQLAGHIWRCALRSRNHKD  283

Query  901   QQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGV  722
             +QPT L  CVD+R RM+P LP  YFGNA+  +    ++ +++S+PL  V S+IR+A++ V
Sbjct  284   EQPTALMVCVDLRSRMKPQLPQGYFGNAVFYMPATSLADDLLSKPLGYVLSRIREAVEKV  343

Query  721   TSEYVNCAIDFYRNEGDVIKRQELGTF-------FVGNPNLSVINWVGLPNHGLDLGWGK  563
             T +YV  A +  +NE D+ + Q+L          F GNPN+ V+NW+ L  +GLD GWGK
Sbjct  344   TMDYVLSAHEKLKNEPDLTRFQDLHYAKESERGPFNGNPNIGVLNWLTLLIYGLDFGWGK  403

Query  562   EIHMSPG-HDCDGDVLILPGPNGIDGDDGSLLVAA  461
             EI+M PG HD DGD LILPG +     DGS++VA 
Sbjct  404   EIYMGPGPHDFDGDSLILPGAD----RDGSVVVAT  434



>ref|XP_008441993.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cucumis 
melo]
Length=457

 Score =   290 bits (743),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 170/467 (36%), Positives = 258/467 (55%), Gaps = 48/467 (10%)
 Frame = -2

Query  1732  PSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFYPFA  1553
             P+ PT +  L LSE DQ     ++  +Y Y +P+T+    ++ SL+ SLSQ+LV +YPFA
Sbjct  14    PNLPTPNLTLPLSEADQFRAWTHISTVYVYKSPNTV---VVVDSLKSSLSQILVPYYPFA  70

Query  1552  GRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDYSGV  1373
             GRL               +C   G V +EA     L D  DF+P      L P VDY+  
Sbjct  71    GRLRLIVGGRLEL-----HCCAAGVVFIEASYGGTLDDYSDFTPSDVVRKLTPEVDYNS-  124

Query  1372  DPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA---P  1202
              P+ D+P+F  Q+T+F CGG+ +G  +SH + DG     F+  WA++A G+  + +   P
Sbjct  125   -PMEDVPMFLVQVTRFNCGGLVIGLNVSHTLVDGVSAIMFINSWASIARGEKTAESILQP  183

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHS---PPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
              HDR +L+A +      P    R +H      P +IG S +E E+MKETK + L+L++ Q
Sbjct  184   SHDRNVLQAQK------PFCTPRFYHCEYDVLPFLIGCSDSEEEKMKETKSTLLKLTREQ  237

Query  1030  IHALKAADNNGRSCNAKL--------------RGYTRYEVITAHIWRCACKARS---HKP  902
             +  L+   N+    N  +              R Y+RYE IT HIW CA KAR+    K 
Sbjct  238   VEKLRTRANSSNPTNRNIDKVVDVVNEELLQPRPYSRYESITGHIWVCASKARNINDDKS  297

Query  901   QQPTNLSFCVDIRRRMEPPLPDSYFGN-AIIDVVIHGVSGEIISRPLQDVASKIRDAIDG  725
             +Q T +   V++R+R+  P+P ++ GN A+I +      GE+ S+PL   A +IR+A   
Sbjct  298   KQSTLVQIVVNVRQRLRKPIPKNFCGNAALISITPQCKFGELKSQPLSYAAKRIREASWK  357

Query  724   VTSEYVNCAIDFYRNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSP  545
             +T EYV  AIDF   + D I+ +  GTF+ GNPNLS+++W+ +P +  D GWG   ++ P
Sbjct  358   MTDEYVTSAIDFLATQEDTIRVK--GTFW-GNPNLSIVSWMSMPIYDADFGWGYPDYVGP  414

Query  544   G-HDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
                D DG   I+ GPN    +DGS+++   LQ+ +++DF K+FYED+
Sbjct  415   SILDNDGKAFIMLGPN----NDGSIIIVIRLQMKYMEDFKKFFYEDL  457



>ref|XP_010273688.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=454

 Score =   290 bits (743),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 174/464 (38%), Positives = 246/464 (53%), Gaps = 39/464 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT---TPSTLSPDAIIHSLRLSLSQVLV  1571
              VKP E T    L LSE+DQ     +   +YFY     P+  S + +    + +LSQ LV
Sbjct  11    TVKPIESTPIHRLDLSEIDQAKAWTHSPTVYFYRPNGQPNFFSAETV----KTALSQALV  66

Query  1570  HFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPS  1391
              FYP AGR+               NCN  GA+ VEA+SD+ + DLGDF+P  E   LVP 
Sbjct  67    QFYPLAGRIEKDKEGRLEL-----NCNEKGALFVEAKSDSDIDDLGDFAPTSELRGLVPY  121

Query  1390  VDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLA-SGKPL  1214
             VDY+    I + PL   Q+T FRCGGI LG  ISH+VADG     F+  WA +A +G  +
Sbjct  122   VDYNETH-ISEWPLVLVQITSFRCGGICLGLGISHIVADGAAAMLFVTSWAQIARTGSNV  180

Query  1213  ---SSAPFHDRRLLRAG-EsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLR  1046
                   PF DR +LRA     ++        I +  PP+++ Q     E  KET V+ L+
Sbjct  181   IGPKLMPFIDRTVLRARVRKDAAEKTTKFDHIEYKRPPVLVSQVDETEELKKETTVAVLK  240

Query  1045  LSKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDI  866
             LS+ Q+ +LK   N G       R YTRYE +  H+W+CA +AR    +Q T +   VD 
Sbjct  241   LSQYQVESLKRRANEG---TMDEREYTRYETLAGHMWKCASEARGLVDEQETKVHVSVDC  297

Query  865   RRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFY  686
             RRR+ P LP +YFGNA         +G++IS+PL   ASKIR+ +  +T EYV  A+DF 
Sbjct  298   RRRLRPALPANYFGNATFPTTPVAKAGDLISKPLSYAASKIREGVRRMTDEYVRSAVDFL  357

Query  685   RNEGD----------VIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-  539
              ++ D          +  + +LG ++ G PNL++ +W+GLP +  D GWG+  HM P   
Sbjct  358   GSQRDWSQFRTSFHSIDDKAKLGAYY-GCPNLAITSWIGLPLYTADFGWGQPFHMGPTSL  416

Query  538   DCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
               DG   +      I  +D  ++V   LQ +H++ F + FYED+
Sbjct  417   GADGKAYV------ISTEDDGIIVYLRLQTEHMEKFKELFYEDL  454



>ref|XP_004166134.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cucumis 
sativus]
Length=469

 Score =   291 bits (744),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 173/479 (36%), Positives = 254/479 (53%), Gaps = 54/479 (11%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              + P+ PT +  LSLSE DQ     Y   +Y Y     L    ++ +L+ SLS++LV +Y
Sbjct  11    TIIPNLPTPNLTLSLSEADQFRAWAYSTTVYVY---KFLDAAVVVDTLKSSLSEILVPYY  67

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             PFAGRL     +         +C   GA+ +EA     L D  DF+       L P VDY
Sbjct  68    PFAGRLRLIVGSRFEL-----HCCAAGALFIEASYGGTLDDCSDFTHADGLRKLTPKVDY  122

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA-  1205
             +   PI D+PLF  Q+T+F CGG+ +G  +SH + DG     F+  WA++A G+  + + 
Sbjct  123   NS--PIEDVPLFVVQVTRFSCGGLVIGLNVSHTLVDGVSAIMFINSWASIARGEKTTKSI  180

Query  1204  --PFHDRRLLRAGEsssssSPQGGRRIFHHS---PPLIIGQSSNESERMKETKVSTLRLS  1040
               P HDR +L+A +      P    R FH+     P + G S  + E+MKETK + L+L+
Sbjct  181   LQPSHDRNVLQAQK------PFSPPRFFHYEYDVLPFVTGCSDYKEEKMKETKFALLKLT  234

Query  1039  KPQIHALKAADNNGRSCNAKLRG-------------YTRYEVITAHIWRCACKAR---SH  908
             K Q+  L+   N+    N  +               Y+RYE IT HIW CA KAR   + 
Sbjct  235   KEQVEKLRMRANSSNPTNQNIEKSVDVNEVLLQPSPYSRYESITGHIWVCASKARNIDND  294

Query  907   KPQQPTNLSFCVDIRRRMEPPLPDSYFGN-AIIDVVIHGVSGEIISRPLQDVASKIRDAI  731
             K    T +   V++R+R+  P+P ++ GN A+I V      GE++S+PL   A KIR+A 
Sbjct  295   KSNLSTMVQIVVNVRQRLRKPIPKNFCGNAALISVTPQSNFGELMSQPLSYAAKKIREAS  354

Query  730   DGVTSEYVNCAIDFYRNEGDVIKRQELG----------TFFVGNPNLSVINWVGLPNHGL  581
               +T EYV  AIDF     D+   + L           + F+GNPNLSV++W+ +P +  
Sbjct  355   WKMTDEYVTSAIDFLTTHEDICWTRTLSSSSSSIVQVRSTFLGNPNLSVVSWLSMPIYDA  414

Query  580   DLGWGKEIHMSPGH-DCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             D GWG   ++ P   DCDG+  I+PGPN    +DGS++VA  L + H++DF K+FYED+
Sbjct  415   DFGWGHPDYVGPLMLDCDGETFIMPGPN----NDGSIIVAIQLHMKHMEDFKKFFYEDL  469



>ref|XP_010273689.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=443

 Score =   286 bits (732),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 173/453 (38%), Positives = 242/453 (53%), Gaps = 28/453 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT---TPSTLSPDAIIHSLRLSLSQVLV  1571
             VVKP +PT    L LS +DQI +    + +YFY     P+  S +    +++ +LSQ LV
Sbjct  11    VVKPLKPTPIHRLGLSPIDQIKSWT-TETVYFYRPNGQPNFFSAE----TMKTALSQALV  65

Query  1570  HFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPS  1391
              FYP AGR+               NCN  GA+ VEAESD+ + DL +F P PE + LVP 
Sbjct  66    EFYPLAGRIEKDKDGGLEL-----NCNEKGALFVEAESDSCIDDLSNFMPTPELSKLVPY  120

Query  1390  VDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLS  1211
              +Y+G   I + P  A Q+T FRCGGI LG  ISHVVADG     F+  WA +A    + 
Sbjct  121   ANYNGTQ-INEWPPLAVQITFFRCGGICLGMGISHVVADGAASMLFITTWAQMARSNIVD  179

Query  1210  S--APFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSK  1037
                 PF DR +L     +   +P+    I +  PP+++GQ     E+ KET V+ L+LS 
Sbjct  180   PELTPFLDRAVLHPRVQNEEDTPKFDH-IEYKRPPMLVGQVDEMEEQKKETTVAVLKLSS  238

Query  1036  PQIHALKAADNNGRSCNAKL--RGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIR  863
              Q+  LK   N GR  N  +  R Y+RYE +  HIWRCA KAR     Q T +   VD R
Sbjct  239   DQVELLKRVANEGREKNGNVDNREYSRYESLAGHIWRCASKARGLVNDQETKVQVSVDCR  298

Query  862   RRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYR  683
             RR+ P  P +YFGNA         +G++IS+PL   A KIR++I  +T EYV  AIDF  
Sbjct  299   RRLRPAFPANYFGNATFPTTPMAKAGDLISKPLSYAAGKIRESIKRMTDEYVRSAIDFLG  358

Query  682   NEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLILPG  506
             +  D + R  LG  +   PNL++ +WVGL  +  D GWG+  HM P     DG   +   
Sbjct  359   SYRD-LSRFRLGARY-WCPNLAITSWVGLSLYTADFGWGQPFHMGPATVRPDGKAFL---  413

Query  505   PNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
                +  ++G +++   LQ +H+  F +  Y+ +
Sbjct  414   ---VSAENGGIIIYLRLQTEHVVKFKELLYQGL  443



>ref|XP_003599928.1| Anthranilate N-benzoyltransferase protein [Medicago truncatula]
 ref|XP_003599933.1| Anthranilate N-benzoyltransferase protein [Medicago truncatula]
 gb|AES70179.1| spermidine hydroxycinnamoyl transferase [Medicago truncatula]
Length=456

 Score =   283 bits (725),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 173/462 (37%), Positives = 254/462 (55%), Gaps = 40/462 (9%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              + P+E T  G L  S+LDQ+  + +  ++Y Y  P     + II +L+ SLS++LVH+Y
Sbjct  9     TITPNESTPKGSLWFSDLDQVVRLSHTPLIYIYK-PKQNQQNIIIETLKNSLSKILVHYY  67

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGR  +             N N  GA+L+EAE+   + D GDFSP      L+P VDY
Sbjct  68    PVAGRYCYRKGGRIEL-----NLNAKGAILIEAETTKSIHDYGDFSPSDSTKELIPKVDY  122

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS--  1208
             +   PI +IPLF  Q+T F   G ++G A SH ++DG G S+F+  WA +A G+ L +  
Sbjct  123   N--QPIEEIPLFVAQVTWFSSFGFAIGIAYSHPLSDGVGCSNFINSWAKIARGERLEANE  180

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSP----PLIIGQSSNESERMKETKVSTLRLS  1040
              P+ DR +L+   +     P   R  F H      PLI+G+S  + ER K+T    L+L+
Sbjct  181   LPYLDRTILKFSNT-----PIEPR--FEHVELKPLPLILGRSDTDIERKKKTTAELLKLT  233

Query  1039  KPQIHALKAADNNGRSCN--AKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDI  866
               ++  LK   N    C+     R Y+R+E I+AHIW+ A KAR  +  Q + + F V+I
Sbjct  234   AEEVEKLKKKAN---ECDIPKGSRPYSRFEAISAHIWKSASKARKLEENQQSVVRFNVEI  290

Query  865   RRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFY  686
             R R+ P LP +Y+GNA+I   + G  GEI+S+PL  VA KIR+A + +T+EY+   ID  
Sbjct  291   RNRIIPNLPKNYYGNALIQTAVEGYIGEILSKPLSYVAMKIREAHELITNEYIRSQIDVI  350

Query  685   RNEGDVIKRQEL--------GTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDCD  530
             R   ++   ++L         T+F GNPNL + +W+ LP+H  D GWGK  +   G+   
Sbjct  351   RGFENLDDARKLFIGGEGKNATYF-GNPNLHITSWMALPSHKADFGWGKPFYFGLGYVSP  409

Query  529   GDV-LILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
              D  LI   P G    DGS++V    QV+ +Q F K FY D+
Sbjct  410   HDRGLIYLSPEG----DGSVIVCMHFQVELMQLFKKLFYGDL  447



>gb|EYU25633.1| hypothetical protein MIMGU_mgv1a006801mg [Erythranthe guttata]
Length=431

 Score =   283 bits (723),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 174/455 (38%), Positives = 241/455 (53%), Gaps = 42/455 (9%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT-TPSTLSPDAIIHSLRLSLSQVLVHF  1565
              V+PSEPT   ++ L+  DQI  + +   +YFY  +PS  +    +  LR SLS+ LV F
Sbjct  9     TVRPSEPTPEEIMYLNASDQIKDITHTPTIYFYRHSPSLDAAGDAVSRLRDSLSKALVLF  68

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL+W             +CNG G  + EAES+A + D GDF+P P    L+PSVD
Sbjct  69    YPLAGRLNWAAEGGSRVEL---HCNGKGVPIFEAESEAAVEDFGDFTPTPAIQALIPSVD  125

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             Y+   PI +IP+   QLT+F CGG+S+G  ISHV+ADG    HF+ EWA +A        
Sbjct  126   YT--TPIDEIPMVIVQLTRFSCGGVSIGLGISHVMADGPSALHFVDEWAKIARSMGPIVP  183

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             PF DR +L  G   +        R     PP +IGQ  N  +R K   V+ L L+K QI 
Sbjct  184   PFLDRTVLENGSPPAKPFDPAVLR----PPPTLIGQEDNMEQRKKPITVAFLNLTKLQIE  239

Query  1024  ALKAADN--NGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
              L+   N  + ++ +   RGY+R+E                     T+L F  D R +++
Sbjct  240   KLRNKVNLDSDKNNSGGGRGYSRFEA-------------------QTSLHFVADFRNKLQ  280

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             PPLP ++FGNA+I V     SG ++S  +   A KIR+A++ VT E V   +++ +   D
Sbjct  281   PPLPKNFFGNALIRVEATDTSGSLLSNTIGAAAKKIREAVEKVTDETVRAYLEYLKGLPD  340

Query  670   VIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLIL  512
             V + + L         F GNPNL++I+W  LP +G D GWGKEIHM PG    DG   ++
Sbjct  341   VGRFRSLDNSGRPKGDFYGNPNLAIISWTALPLYGADFGWGKEIHMGPGSMGFDGKTFLI  400

Query  511   PGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             P   G    DGS  +A  LQ +HI  F K  Y DI
Sbjct  401   PSHEG----DGSFNIAIWLQEEHISAFKKCLYNDI  431



>gb|KHN29832.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=448

 Score =   281 bits (718),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 174/460 (38%), Positives = 244/460 (53%), Gaps = 35/460 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V P+EPT  GLL LS++DQ+  + +   +Y +      + D +I  +R SLS++LVH+Y
Sbjct  9     TVLPNEPTPEGLLWLSDIDQVARLRHTPTIYIFHAKH--NHDTLIERMRNSLSKILVHYY  66

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL     +         +CN  G VL+EAES   L D GDF        LVP+VDY
Sbjct  67    PIAGRLRRIEGSGRLEL----DCNAKGVVLLEAESTKTLDDYGDFL-RESIKDLVPTVDY  121

Query  1381  SGVDPIPDIPLFAGQLTKFRCG-GISLGFAISHVVADGQGISHFLFEWANLASGKPLS--  1211
             +   PI ++P    Q+T F  G   ++G A+ H++ DG G   F+  WA LA G  L   
Sbjct  122   TS--PIEELPSLLVQVTTFHGGKSFAIGVALCHILCDGVGAIQFINSWAKLARGDTLEPH  179

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFH---HSPPLIIGQSSNESERMKETKVSTLRLS  1040
               PF DR +L+         P    R  H      PLI+G+S N  E+ K+   + L+L+
Sbjct  180   EMPFLDRTVLKFPH------PLSPPRFDHLEFKPLPLILGRSDNTVEKNKKVDATLLKLT  233

Query  1039  KPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
               Q+  LK   N+  S     R Y+R+E I AHIWRCA KAR     QPT + F  DIR 
Sbjct  234   PEQVGKLKKKANDD-STKEGSRPYSRFEAIAAHIWRCASKARELDKNQPTLVRFNADIRN  292

Query  859   RMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRN  680
             R+ PPLP +YFGNA+         G++IS  L   A KIR+AI+ VT EY+   ID  R 
Sbjct  293   RLIPPLPKNYFGNALSLTTASCHVGDVISNSLSYAAQKIREAIEVVTYEYIWSQIDVIRG  352

Query  679   EGDVIKRQEL--------GTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDCDGD  524
             +  +   + L           F GNPNL + +W+ +P H  D GWGK +++  G     D
Sbjct  353   QEQLDNARALFFGQNEGKDALFYGNPNLLITSWMSMPMHEADFGWGKPVYLGLGSVSTQD  412

Query  523   -VLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
               LI+  P+G    DGS++++   Q++H+Q F KYFYED+
Sbjct  413   RALIIQSPDG----DGSIILSIHFQMEHMQLFKKYFYEDM  448



>ref|XP_003551937.2| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=464

 Score =   281 bits (719),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 174/460 (38%), Positives = 244/460 (53%), Gaps = 35/460 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V P+EPT  GLL LS++DQ+  + +   +Y +      + D +I  +R SLS++LVH+Y
Sbjct  25    TVLPNEPTPEGLLWLSDIDQVARLRHTPTIYIFHAKH--NHDTLIERMRNSLSKILVHYY  82

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL     +         +CN  G VL+EAES   L D GDF        LVP+VDY
Sbjct  83    PIAGRLRRIEGSGRLEL----DCNAKGVVLLEAESTKTLDDYGDFL-RESIKDLVPTVDY  137

Query  1381  SGVDPIPDIPLFAGQLTKFRCG-GISLGFAISHVVADGQGISHFLFEWANLASGKPLS--  1211
             +   PI ++P    Q+T F  G   ++G A+ H++ DG G   F+  WA LA G  L   
Sbjct  138   TS--PIEELPSLLVQVTTFHGGKSFAIGVALCHILCDGVGAIQFINSWAKLARGDTLEPH  195

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFH---HSPPLIIGQSSNESERMKETKVSTLRLS  1040
               PF DR +L+         P    R  H      PLI+G+S N  E+ K+   + L+L+
Sbjct  196   EMPFLDRTVLKFPH------PLSPPRFDHLEFKPLPLILGRSDNTVEKNKKVDATLLKLT  249

Query  1039  KPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
               Q+  LK   N+  S     R Y+R+E I AHIWRCA KAR     QPT + F  DIR 
Sbjct  250   PEQVGKLKKKANDD-STKEGSRPYSRFEAIAAHIWRCASKARKLDKNQPTLVRFNADIRN  308

Query  859   RMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRN  680
             R+ PPLP +YFGNA+         G++IS  L   A KIR+AI+ VT EY+   ID  R 
Sbjct  309   RLIPPLPKNYFGNALSLTTASCHVGDVISNSLSYAAQKIREAIEVVTYEYIWSQIDVIRG  368

Query  679   EGDVIKRQEL--------GTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDCDGD  524
             +  +   + L           F GNPNL + +W+ +P H  D GWGK +++  G     D
Sbjct  369   QEQLDNARALFFGQNEGKDALFYGNPNLLITSWMSMPMHEADFGWGKPVYLGLGSVSTQD  428

Query  523   -VLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
               LI+  P+G    DGS++++   Q++H+Q F KYFYED+
Sbjct  429   RALIIQSPDG----DGSIILSIHFQMEHMQLFKKYFYEDM  464



>ref|XP_003555244.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like isoform 
X1 [Glycine max]
Length=461

 Score =   280 bits (716),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 179/473 (38%), Positives = 253/473 (53%), Gaps = 50/473 (11%)
 Frame = -2

Query  1738  VKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFYP  1559
             V P+EPT +  L LSE DQ+    +   +Y Y    T +    +  +R SLS++LVH++P
Sbjct  10    VTPNEPTPNVSLWLSESDQVARWSHTSTIYIYKENQTQN---ALERMRDSLSKILVHYHP  66

Query  1558  FAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEF-NHLVPSVDY  1382
              AGRL+W             NCNG G  L+EAES   + D GDF+P  +  N L+P VDY
Sbjct  67    LAGRLTWLEGGKVAL-----NCNGKGVTLIEAESQKTMDDYGDFAPSEKLKNELIPPVDY  121

Query  1381  SGVDPIPDIPLFAGQLTKFRCG----------GISLGFAISHVVADGQGISHFLFEWANL  1232
             S   PI ++PL   QLT+F+ G          G+++G A  HV+ DG     F+  WA L
Sbjct  122   S--QPIEELPLLLVQLTRFKKGSSNNNNNNQLGLAIGVAFCHVLCDGLAAIRFINAWAKL  179

Query  1231  ASGKPLSSA---PFHDRRLLRAGEsssssSPQGGRRIFHHSP----PLIIGQSSNESERM  1073
               G+ L S    PF DR ++ +     +  P+  R  F H      PL +G +    E+ 
Sbjct  180   TRGEVLDSIEMFPFLDRTIMNS-----TYPPRAPR--FDHPELKPLPLKLGTTDTIEEQK  232

Query  1072  KETKVSTLRLSKPQIHALKAADNNGRSCNAK-LRGYTRYEVITAHIWRCACKARSHKPQQ  896
             KE     LRL+  Q+  LK   N+ R    + LR Y+RYEVI +HIWRCA KAR  +  Q
Sbjct  233   KEKTAVILRLTSQQVEKLKKKTNDERPQKEETLRPYSRYEVIASHIWRCASKARELEDLQ  292

Query  895   PTNLSFCVDIRRRMEPPLPDSYFGNAI-IDVVIHGVSGEIISRPLQDVASKIRDAIDGVT  719
             PT +    DIR R+ PPLP +YFGNA+ + +     + E+I+ PL   A KIR+AI+ + 
Sbjct  293   PTVVRVSADIRNRLNPPLPRNYFGNALAVALTPKCHTKELITNPLSHGAQKIREAIELLN  352

Query  718   SEYVNCAIDFYR--NEGDVIKRQEL------GTFFVGNPNLSVINWVGLPNHGLDLGWGK  563
              EY+   +DF R   + D I+   L         F GNPNL++++W+ +P +  D GWGK
Sbjct  353   DEYIRSQLDFIRCHEQLDRIRASYLDQGEPKNAPFYGNPNLTIVSWMSMPVYEADFGWGK  412

Query  562   EIHMSPGHDC-DGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
               +  PG    DG   I+   +    +DGSL+V+A LQ  H + F K+FYEDI
Sbjct  413   PGYFGPGAVYPDGKAYIIRSSD----EDGSLVVSAHLQTAHKELFKKFFYEDI  461



>gb|ACU23734.1| unknown [Glycine max]
Length=464

 Score =   280 bits (715),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 179/476 (38%), Positives = 252/476 (53%), Gaps = 53/476 (11%)
 Frame = -2

Query  1738  VKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFYP  1559
             V P+EPT +  L LSE DQ+    +   +Y Y    T +    +  +R SLS++LVH++P
Sbjct  10    VTPNEPTPNVSLWLSESDQVARWSHTSTIYIYKENQTQN---ALERMRDSLSKILVHYHP  66

Query  1558  FAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEF-NHLVPSVDY  1382
              AGRL+W             NCNG G  L+EAES   + D GDF+P  +  N L+P VDY
Sbjct  67    LAGRLTWLEGGKVAL-----NCNGKGVTLIEAESQKTMDDYGDFAPSEKLKNELIPPVDY  121

Query  1381  SGVDPIPDIPLFAGQLTKFRCG----------GISLGFAISHVVADGQGISHFLFEWANL  1232
             S   PI ++PL   QLT+F+ G          G+++G A  HV+ DG     F+  WA L
Sbjct  122   S--QPIEELPLLLVQLTRFKKGSSNNNNNNQLGLAIGVAFCHVLCDGLAAIRFINAWAKL  179

Query  1231  ASGKPLSSA---PFHDRRLLRAGEsssssSPQGGRRIFHHSP----PLIIGQSSNESERM  1073
               G+ L S    PF DR ++ +     +  P+  R  F H      PL +G +    E+ 
Sbjct  180   TRGEVLDSIEMFPFLDRTIMNS-----TYPPRAPR--FDHPELKPLPLKLGTTDTIEEQK  232

Query  1072  KETKVSTLRLSKPQIHALKAADNNGR----SCNAKLRGYTRYEVITAHIWRCACKARSHK  905
             KE     LRL+  Q+  LK   N+ R         LR Y+RYEVI +HIWRCA KAR  +
Sbjct  233   KEKTAVILRLTSQQVEKLKKKTNDERPQKEGITKTLRPYSRYEVIASHIWRCASKARELE  292

Query  904   PQQPTNLSFCVDIRRRMEPPLPDSYFGNAI-IDVVIHGVSGEIISRPLQDVASKIRDAID  728
               QPT +    DIR R+ PPLP +YFGNA+ + +     + E+I+ PL   A KIR+AI+
Sbjct  293   DLQPTVVRVSADIRNRLNPPLPRNYFGNALAVALTPKCHTKELITNPLSHGAQKIREAIE  352

Query  727   GVTSEYVNCAIDFYR--NEGDVIKRQEL------GTFFVGNPNLSVINWVGLPNHGLDLG  572
              +  EY+   +DF R   + D I+   L         F GNPNL++++W+ +P +  D G
Sbjct  353   LLNDEYIRSQLDFIRCHEQLDRIRASYLDQGEPKNAPFYGNPNLTIVSWMSMPVYEADFG  412

Query  571   WGKEIHMSPGHDC-DGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             WGK  +  PG    DG   I+   +    +DGSL+V+A LQ  H + F K+FYEDI
Sbjct  413   WGKPGYFGPGAVYPDGKAYIIRSSD----EDGSLVVSAHLQTTHKELFKKFFYEDI  464



>ref|XP_006605610.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like isoform 
X2 [Glycine max]
Length=464

 Score =   279 bits (714),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 179/476 (38%), Positives = 252/476 (53%), Gaps = 53/476 (11%)
 Frame = -2

Query  1738  VKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFYP  1559
             V P+EPT +  L LSE DQ+    +   +Y Y    T +    +  +R SLS++LVH++P
Sbjct  10    VTPNEPTPNVSLWLSESDQVARWSHTSTIYIYKENQTQN---ALERMRDSLSKILVHYHP  66

Query  1558  FAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEF-NHLVPSVDY  1382
              AGRL+W             NCNG G  L+EAES   + D GDF+P  +  N L+P VDY
Sbjct  67    LAGRLTWLEGGKVAL-----NCNGKGVTLIEAESQKTMDDYGDFAPSEKLKNELIPPVDY  121

Query  1381  SGVDPIPDIPLFAGQLTKFRCG----------GISLGFAISHVVADGQGISHFLFEWANL  1232
             S   PI ++PL   QLT+F+ G          G+++G A  HV+ DG     F+  WA L
Sbjct  122   S--QPIEELPLLLVQLTRFKKGSSNNNNNNQLGLAIGVAFCHVLCDGLAAIRFINAWAKL  179

Query  1231  ASGKPLSSA---PFHDRRLLRAGEsssssSPQGGRRIFHHSP----PLIIGQSSNESERM  1073
               G+ L S    PF DR ++ +     +  P+  R  F H      PL +G +    E+ 
Sbjct  180   TRGEVLDSIEMFPFLDRTIMNS-----TYPPRAPR--FDHPELKPLPLKLGTTDTIEEQK  232

Query  1072  KETKVSTLRLSKPQIHALKAADNNGR----SCNAKLRGYTRYEVITAHIWRCACKARSHK  905
             KE     LRL+  Q+  LK   N+ R         LR Y+RYEVI +HIWRCA KAR  +
Sbjct  233   KEKTAVILRLTSQQVEKLKKKTNDERPQKEGITKTLRPYSRYEVIASHIWRCASKARELE  292

Query  904   PQQPTNLSFCVDIRRRMEPPLPDSYFGNAI-IDVVIHGVSGEIISRPLQDVASKIRDAID  728
               QPT +    DIR R+ PPLP +YFGNA+ + +     + E+I+ PL   A KIR+AI+
Sbjct  293   DLQPTVVRVSADIRNRLNPPLPRNYFGNALAVALTPKCHTKELITNPLSHGAQKIREAIE  352

Query  727   GVTSEYVNCAIDFYR--NEGDVIKRQEL------GTFFVGNPNLSVINWVGLPNHGLDLG  572
              +  EY+   +DF R   + D I+   L         F GNPNL++++W+ +P +  D G
Sbjct  353   LLNDEYIRSQLDFIRCHEQLDRIRASYLDQGEPKNAPFYGNPNLTIVSWMSMPVYEADFG  412

Query  571   WGKEIHMSPGHDC-DGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             WGK  +  PG    DG   I+   +    +DGSL+V+A LQ  H + F K+FYEDI
Sbjct  413   WGKPGYFGPGAVYPDGKAYIIRSSD----EDGSLVVSAHLQTAHKELFKKFFYEDI  464



>ref|XP_004500023.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cicer 
arietinum]
Length=463

 Score =   276 bits (707),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 171/469 (36%), Positives = 249/469 (53%), Gaps = 45/469 (10%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V P EPT  G L LS++DQ+    +    Y Y        +  I +L+ SL+++LVH+Y
Sbjct  16    TVIPDEPTPQGRLWLSDIDQVVRFGHTPTFYIYKPQKQNQIENSIQTLKNSLTKILVHYY  75

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL +T  A         N N  G +L+EAE+   + D GDFS       L P+ +Y
Sbjct  76    PIAGRLCYTQGARLEL-----NLNAKGVILIEAETTKTIHDYGDFSFSDSTKELAPTFNY  130

Query  1381  SGVDPIPDIPLFAGQLTKFRCG-GISLGFAISHVVADGQGISHFLFEWANLASGKPL--S  1211
             +    I ++PLF  QLTKF+   G ++G A+ H++ADG     F+  WA LA G+ L  +
Sbjct  131   N-TQQIEEMPLFVVQLTKFKNNEGCAIGVAMHHILADGLEAVRFINLWAKLARGETLDPN  189

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFHHSP----PLIIGQSSNESERMKETKVSTLRL  1043
               PF DR +L+   +     P   R  F H      PLI+G++  E ER+K+T VS LRL
Sbjct  190   ELPFLDRTVLKFSHT-----PLEPR--FEHIELKPLPLILGRTDTEEERLKKTTVSLLRL  242

Query  1042  SKPQIHALKAADNNGRSCNAKL-----RGYTRYEVITAHIWRCACKARSHKPQQPTNLSF  878
             S  Q+  LK   N        +     R ++R+E I+AH+WRCA KAR  +  Q + + F
Sbjct  243   SPEQVEKLKKKANENNEIVLAMMKKGSRPFSRFESISAHVWRCALKARELEENQESVVRF  302

Query  877   CVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCA  698
               D+R R+ PPLP +Y+GNA+    + G  GEI S+PL  V+ KIR++++ V  EY+   
Sbjct  303   NADVRSRIVPPLPKNYYGNALTQTAVKGYVGEITSKPLGYVSQKIRESVEVVNDEYIRSQ  362

Query  697   IDFYRNEGDVIKRQEL-------GTFFVGNPNLSVINWVGLPNHGLDLGWGKEIH-----  554
             ID  R   ++   + L        T + GNPN  V +W+ +P +  D GWGK ++     
Sbjct  363   IDVIRGFENLDDARSLFLGDFDKKTLYFGNPNFHVTSWLSMPTYEADFGWGKPVYFGLNS  422

Query  553   MSPGHDCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             +SP HD     LIL    G    DGS++V    Q+ H++ F K+FY DI
Sbjct  423   LSP-HD---RALILLSSEG----DGSVIVCLHFQIAHLELFKKFFYGDI  463



>gb|ACI16631.1| malate O-hydroxycinnamoyl transferase [Trifolium pratense]
Length=454

 Score =   276 bits (706),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 171/461 (37%), Positives = 244/461 (53%), Gaps = 31/461 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V P EPT  G L LS+ DQ+ T  +   +Y Y      + + +I +L+ SLS++LVH+Y
Sbjct  9     TVIPEEPTPQGRLWLSDKDQVATQHHTPTIYIYK--PNQNQENVIETLKNSLSKILVHYY  66

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL ++            N N  GA+L+EAE+   + D GDFSP      L+P +DY
Sbjct  67    PIAGRLCYSDEEVDSCRVEL-NLNAKGAILLEAETTKTIHDYGDFSPSDLTKELIPIIDY  125

Query  1381  SGVDPIPDIPLFAGQLTKFRCG-GISLGFAISHVVADGQGISHFLFEWANLASGKPL--S  1211
             +   P  ++PL   QLT F+   G +LG A SH ++DG G   F+  WA +A G+ L  +
Sbjct  126   N--QPFQEMPLLVVQLTSFKNNQGFALGVAFSHSLSDGTGAVKFINSWAKIARGETLEPN  183

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFH---HSPPLIIGQSSNESERMKETKVSTLRLS  1040
               PF DR L++   +     P    R  H      PLIIG+     ER K+T  + L+LS
Sbjct  184   ELPFLDRTLIKFSHT-----PSKVPRFEHIELKPLPLIIGRKDTSEERKKKTTATLLKLS  238

Query  1039  KPQIHALKAADNNGRSCNAK-LRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIR  863
               Q+  LK   N+  S   K  R ++++E I AH+WRCA KAR  +  Q + + F  DIR
Sbjct  239   YDQVEKLKKKANDFLSMKKKGSRPFSKFEAIGAHLWRCASKARGLEDDQESVVRFHADIR  298

Query  862   RRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDF--  689
             RR+ PPLP ++F NA+      G  GEI S+PL  VA KIR+  + V  +++   ID   
Sbjct  299   RRINPPLPQNFFANALALTATKGCVGEITSKPLGYVAQKIREGTELVKDDFIKSQIDVIR  358

Query  688   -YRNEGDVIK-----RQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMS-PGHDCD  530
              +R   D +K       E   +F GNPN  V +W G+P +  D G+GK I+    G    
Sbjct  359   SFRKMDDAMKLFLGDETEKAPYF-GNPNFQVASWTGMPFYEADFGYGKPIYFGYAGVSPH  417

Query  529   GDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
                 I   P+G    DGS++V+   Q+ H++ F KYFYEDI
Sbjct  418   DRAYITLSPDG----DGSVIVSLHFQMAHLELFKKYFYEDI  454



>ref|XP_003548918.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=447

 Score =   276 bits (705),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 174/463 (38%), Positives = 248/463 (54%), Gaps = 42/463 (9%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLS---PDA-IIHSLRLSLSQVL  1574
              V PSE T +  L LSE +QI    +   +Y Y  P+ L+   P+  ++ ++R SL+++L
Sbjct  9     TVIPSEATPNCSLLLSESEQINAPTHSLTIYVYK-PNHLNKIIPNMNMVDTMRDSLAKIL  67

Query  1573  VHFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVP  1394
             VH+YP AGRL                CN  G +L+EAES   L D   F P      L+P
Sbjct  68    VHYYPLAGRLRMIQGRRWEV-----ECNAKGVILLEAESTRALNDYAIFEPNDTIKELIP  122

Query  1393  SVDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPL  1214
              VDY+  +PI + PLF  QLT+F  GG  +G AIS+++ DG   +HF+  WA LA G  L
Sbjct  123   KVDYT--EPIENSPLFLVQLTRFSNGGFCVGIAISNIITDGISGTHFINLWATLARGDTL  180

Query  1213  SSAPFHDRRLLRAGEsssssSPQGGRRIFHHSP----PLIIGQSSNESERMKETKVSTLR  1046
                  HD  LL              +  F H      PL++G +    E  KET V+ L+
Sbjct  181   EE---HDMPLLNK----VVLQSSDKKPCFDHKEFKPLPLVLGHADTTEESKKETTVAMLK  233

Query  1045  LSKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDI  866
             LS+  +  LK   N G       R Y+RYE I+AHIWRC  KAR     QPT +      
Sbjct  234   LSREMVEKLKKKANEGNQG----RAYSRYESISAHIWRCVVKARDGYHNQPTVVHIIAGA  289

Query  865   RRRMEPPLPDSYFGNAIIDVVI-HGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDF  689
             R R+ PPLP +YFGNA    V    +SG+I+S+PL  VA KIR+AI+ +T EY+     F
Sbjct  290   RNRLNPPLPLNYFGNATYPTVTPTCLSGDIVSKPLSYVAHKIREAIEVLTDEYLRSGFGF  349

Query  688   YRNEGDVIKRQE-------LGTFFVGNPNLSVINWV-GLPNHGLDLGWGKEIHMSPG-HD  536
              R++ DV   +E       + + F+GNPNL++ +W+  +P +G + GWG+ ++M PG   
Sbjct  350   IRSQSDVGWLREKNDNEGKVESLFLGNPNLNIWSWMRNMPMYGPNFGWGRPVYMGPGVVK  409

Query  535   CDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
              DG   I+PG      +DGS+LVA  LQ  H++ F + F++D+
Sbjct  410   GDGRAFIMPG-----QEDGSVLVAIRLQSAHVEAFKEVFHKDM  447



>ref|XP_009614241.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=434

 Score =   273 bits (699),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 172/451 (38%), Positives = 241/451 (53%), Gaps = 35/451 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAI-IHSLRLSLSQVLVHF  1565
             +VKPS+PT S  L  S LD I   +++  +YFY  P+  SP+      ++ +LS VLV F
Sbjct  10    MVKPSKPTPSKRLWNSNLDVIVGRIHLLTVYFYK-PNGTSPNFFDFRIMKEALSNVLVSF  68

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNH-LVPSV  1388
             YP AGRL+              NCNG G + +EAE DA++ D GDF P  E    L+P+V
Sbjct  69    YPMAGRLAKDNEKERIEI----NCNGEGVLFIEAEIDAIIDDFGDFIPSLEIKKMLIPNV  124

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             D SG   I   PL   Q+T+F+CGG+SLG  + H ++DG    HF+  W+ +  G  ++ 
Sbjct  125   DTSG--DISSFPLVIFQVTRFKCGGVSLGCGVFHTLSDGISSLHFINTWSEVVRGVSVAV  182

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVST---LRLSK  1037
             +PF DR LL A +  +       + + +HSPP +   S N  +++   K ST    +++ 
Sbjct  183   SPFIDRSLLHARDPPT----PAYKHVEYHSPPALKSSSKNVHDQVNGPKSSTTTMFKITS  238

Query  1036  PQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRR  857
              Q+  LK          +K  G T YE++ AHIWRC CKAR     Q T L    D R R
Sbjct  239   DQLTLLKT--------KSKHEGST-YEILAAHIWRCTCKARILDDDQLTKLHVATDGRSR  289

Query  856   MEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  677
             + PPLP  Y GN +        SGEI+S PL + A +I  A+  +  EY+  AID+   +
Sbjct  290   LFPPLPPGYLGNVVFTATPIAKSGEILSEPLMNTAQRIHSALARMDDEYLRSAIDYLELQ  349

Query  676   GDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC---DGDVLILPG  506
              D+ K     T+F  +PNL++ +W  LP H  D GWGK IHM P   C   +G V ILP 
Sbjct  350   TDLSKLIRGPTYF-ASPNLNINSWTRLPVHDSDFGWGKPIHMGPA--CILYEGTVYILPS  406

Query  505   PNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
             P+    +D +L +A CL  DH+  F KY YE
Sbjct  407   PS----NDKNLRLAVCLDADHMPLFEKYLYE  433



>gb|ACF37072.1| hydroxycinnamoyl CoA quinate transferase 1 [Cynara cardunculus 
var. scolymus]
 emb|CAM84302.2| hydroxycinnamoyl CoA quinate transferase [Cynara cardunculus 
var. scolymus]
Length=449

 Score =   273 bits (699),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 165/446 (37%), Positives = 239/446 (54%), Gaps = 29/446 (7%)
 Frame = -2

Query  1738  VKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFYP  1559
             V+PS+PT S  +  S LD +   +++  +YFY  P+  S       ++ +L+ VLV FYP
Sbjct  28    VQPSQPTPSSTIWTSNLDLVVGRIHILTVYFYR-PNGASNFFDADVMKKALADVLVSFYP  86

Query  1558  FAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDYS  1379
              AGR+S              NCNG G + VEAESD+ L D G+F+P PE   L P+VDYS
Sbjct  87    MAGRISRDQNGRLEI-----NCNGEGVLFVEAESDSTLDDFGEFTPSPELRRLTPTVDYS  141

Query  1378  GVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAPF  1199
             G   I   PLF  Q+T F+CGG++LG  + H +ADG    HF+  W+++A G  ++  PF
Sbjct  142   G--DISSYPLFFAQVTHFKCGGVALGCGVFHTLADGLSSIHFINTWSDMARGLSIAIPPF  199

Query  1198  HDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSN-ESERMKETKVSTLRLSKPQIHA  1022
              DR LLRA E  + +       I +H+PP +   S N ES R   T V  L+L+  Q++ 
Sbjct  200   IDRTLLRAREPPTPTFDH----IEYHAPPSMKTISQNPESSRKPSTTV--LKLTLDQLNV  253

Query  1021  LKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPL  842
             LKA+  N  S       Y+ YE++ AH+WRCACKAR     Q T L    D R R+ P L
Sbjct  254   LKASAKNDGSNTT----YSTYEILAAHLWRCACKARGLPDDQLTKLYVATDGRSRLSPQL  309

Query  841   PDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  662
             P  Y GN +        SG++ ++ L + AS IR  +  + + Y+  AID+   + D+  
Sbjct  310   PPGYLGNVVFTTTPVAKSGDLTTQSLSNAASLIRTTLTKMDNNYLRSAIDYLEVQPDLSA  369

Query  661   RQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC---DGDVLILPGPNGID  491
                  ++F  +PNL++  W  LP H  D GWG+ + M P   C   +G + +LP PN   
Sbjct  370   LIRGPSYF-ASPNLNINTWTRLPVHDADFGWGRPVFMGPA--CILYEGTIYVLPSPN---  423

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
              +D S+ +A CL  D    F K+ Y+
Sbjct  424   -NDRSMSLAVCLDADEQPLFEKFLYD  448



>ref|XP_007146248.1| hypothetical protein PHAVU_006G024700g [Phaseolus vulgaris]
 gb|ESW18242.1| hypothetical protein PHAVU_006G024700g [Phaseolus vulgaris]
Length=449

 Score =   273 bits (698),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 168/456 (37%), Positives = 239/456 (52%), Gaps = 26/456 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V P++PT  G+  LS++DQ+  + +   +Y Y      +   +I  +R SLS++L H+Y
Sbjct  9     TVVPNQPTPEGIQWLSDIDQVARLHHTPTIYIYHAKH--NHGTLIQQMRNSLSKILCHYY  66

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               +CN  G VL+EAES   + D  DF  G     LVP+VDY
Sbjct  67    PLAGRLRKLEEGGRLEL----DCNAKGVVLIEAESTKTVQDYDDFF-GESIKDLVPTVDY  121

Query  1381  SGVDPIPDIPLFAGQLTKFRC-GGISLGFAISHVVADGQGISHFLFEWANLASGKPLS--  1211
             + +  I ++PL   Q+T F      S+G AISH++ DG     F+  WA LA G  L   
Sbjct  122   TKI-LIQELPLLLVQVTSFLGHEAFSIGVAISHILCDGVAGVQFINSWAKLARGDTLEPH  180

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
               PF DR +LR     +  SPQ    +     PLI+G+  N +E+ K  K + L+L+  Q
Sbjct  181   EMPFLDRTVLR---FIAPPSPQRFDHLEFKPLPLILGRCDNTAEKNKRVKATLLKLTAEQ  237

Query  1030  IHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             +  LK   N   S     R Y+R+E I AH+WR ACKAR     QPT + F  DIR R+ 
Sbjct  238   VGKLKNKANADESTKGS-RPYSRFEAIAAHVWRSACKARGLDENQPTVVRFNADIRNRLI  296

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             PPLP +YFGNA+         GEI+S  L   A KIR+AI+ +T EY++  ID  R +  
Sbjct  297   PPLPANYFGNALALTAASSQVGEILSNSLGRAAKKIREAIEVLTYEYISSQIDVIRGQDH  356

Query  670   VIKRQEL--------GTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDCDGDVLI  515
             V K + L           F GNPNL + +W+ +P H  D GWGK +++        D  +
Sbjct  357   VDKARALYFGANEGKDALFFGNPNLLITSWMRMPMHEADFGWGKAVYLGHAGVATQDRAL  416

Query  514   LPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             +     +DGDD S++V    Q++H+Q F  +FYE+I
Sbjct  417   I--TQSLDGDD-SIIVFLPFQMEHMQLFKDFFYEEI  449



>gb|KHN18128.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=462

 Score =   273 bits (698),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 177/465 (38%), Positives = 247/465 (53%), Gaps = 36/465 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V P++PT  G L LS  D      +  ++Y Y     +  D  I  +R SLS+VLV++Y
Sbjct  9     TVVPNQPTPKGRLWLSNSDNSTRPAHTPVIYIYKAQLNIEYD--IERMRDSLSKVLVYYY  66

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNH-LVPSVD  1385
             P AGRLS   +          +CN  G  L+EA +    AD GDFSP       LVP++D
Sbjct  67    PVAGRLSLAESGRMEV-----DCNAKGVTLIEAATAKTFADFGDFSPSDSIKEELVPAID  121

Query  1384  YSGVDPIPDIPLFAGQLTKFR---CGGISLGFAISHVVADGQGISHFLFEWANLASGK--  1220
             Y    PI +IPL   QLT+F+     G+++G A SH VADG    HF+  WA +  G   
Sbjct  122   YHS-QPIQEIPLLFVQLTRFQGDQQQGLAIGVAFSHPVADGSAWIHFMNTWAMVNRGDML  180

Query  1219  PLSSAPFHDRRLLRAGEsssssSPQGGRRIFHHSP----PLIIGQSSNESERMKETKVST  1052
              L+  PF DR +L+   SS  S P      F H      PLI+G+S +  E+ K+T  S 
Sbjct  181   DLNEMPFLDRTILKFPPSSLQSLPPPH---FDHPELKPLPLILGKSDSTEEQNKKTAASM  237

Query  1051  LRLSKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCV  872
             L+L+  Q+  LK   N+  +     R ++R+E + AHIWRCACKAR     QPT   F V
Sbjct  238   LKLTSKQVEMLKKKANDQLTKQGS-RPFSRFEAVAAHIWRCACKARELHHNQPTLARFNV  296

Query  871   DIRRRMEPPLPDSYFGNAIIDVVI-HGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAI  695
             D R R+ PPLP +YFGNA++  V      GE+ +RPL   A K+R+A+  +T EY+   +
Sbjct  297   DFRNRLIPPLPRNYFGNALVATVTPECYVGEMTTRPLSYAAQKMREAVALLTDEYIRSHL  356

Query  694   D--FYRNEGDVIKRQELG------TFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH  539
             +  F   + D IK   LG        F GNPNL + +W+ +  +  D GWGK ++   G+
Sbjct  357   EVVFGEEQLDCIKAFFLGQGEGRYAPFGGNPNLQITSWINMRAYETDFGWGKPVYFGLGY  416

Query  538   DCDGDV-LILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
              C  D  +I+ GP     DDGS++V    Q+ H+Q   K+FYEDI
Sbjct  417   VCALDRGIIMRGPQ----DDGSVIVIMHFQIAHMQLLKKFFYEDI  457



>gb|KHN13395.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=447

 Score =   273 bits (697),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 172/463 (37%), Positives = 246/463 (53%), Gaps = 42/463 (9%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLS---PDA-IIHSLRLSLSQVL  1574
              V PSE T +  L LSE +QI    +   +Y Y  P+ L+   P+  ++ ++R SL+++L
Sbjct  9     TVIPSEATPNCSLLLSESEQINAPTHSLTIYVYK-PNHLNKIIPNMNMVDTMRDSLAKIL  67

Query  1573  VHFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVP  1394
             VH+YP AGRL                CN  G +L+EAES   L D   F P      L+P
Sbjct  68    VHYYPLAGRLRMIQGRRWEV-----ECNAKGVILLEAESTRALNDYAIFEPNDTIKELIP  122

Query  1393  SVDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPL  1214
              VDY+  +PI + PLF  QLT+F  GG  +G AIS+++ DG   +HF+  WA LA    L
Sbjct  123   KVDYT--EPIENSPLFLVQLTRFSNGGFCVGIAISNIITDGISGTHFINLWATLARRDTL  180

Query  1213  SSAPFHDRRLLRAGEsssssSPQGGRRIFHHSP----PLIIGQSSNESERMKETKVSTLR  1046
                  HD  LL              +  F H      PL++G +    E  KET V+ L+
Sbjct  181   EE---HDMPLLNK----VVLQSSDKKPCFDHKEFKPLPLVLGHADTTEESKKETTVAMLK  233

Query  1045  LSKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDI  866
             LS+  +  LK   N G       R Y+RYE I+AHIWRC  KAR     QPT +      
Sbjct  234   LSREMVEKLKKKANEGNQG----RAYSRYESISAHIWRCVVKARDGYHNQPTVVHIIAGA  289

Query  865   RRRMEPPLPDSYFGNAIIDVVI-HGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDF  689
             R R+ PPLP +YFGNA    V    +SG+I+S+PL  VA KIR+AI+ +T EY+     F
Sbjct  290   RNRLNPPLPLNYFGNATYPTVTPTCLSGDIVSKPLSYVAHKIREAIEVLTDEYLRSGFGF  349

Query  688   YRNEGDV-------IKRQELGTFFVGNPNLSVINWV-GLPNHGLDLGWGKEIHMSPGH-D  536
              R++ DV           ++ + F+GNPNL++ +W+  +P +G + GWG+ ++M PG   
Sbjct  350   IRSQSDVGWLRGKNDNEGKVESLFLGNPNLNIWSWMRNMPMYGPNFGWGRPVYMGPGAVK  409

Query  535   CDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
              DG   I+PG      +DGS+LVA  LQ  H++ F + F++D+
Sbjct  410   GDGRAFIMPG-----QEDGSVLVAIRLQSAHVEAFKEVFHKDM  447



>ref|XP_009800587.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=436

 Score =   272 bits (695),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 168/447 (38%), Positives = 236/447 (53%), Gaps = 31/447 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +VKPS+PT +  L  S LD I   +++  +YFY  P+  S       ++ +LS VLV FY
Sbjct  16    LVKPSKPTPTKRLWSSNLDLIVGRIHLLTVYFYK-PNGSSNFFDSKIMKEALSNVLVSFY  74

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL+              NCNG G + VEAESDA + D GDF+P  E   L+P+VD 
Sbjct  75    PMAGRLARDEQGRIEI-----NCNGEGVLFVEAESDAFVDDFGDFTPSLELRKLIPTVDT  129

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T+F+CGG+SLG  + H ++DG    HF+  W+++A G  ++  P
Sbjct  130   SG--DISTFPLIIFQVTRFKCGGVSLGGGVFHTLSDGLSSIHFINTWSDIARGLSVAIPP  187

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSN-ESERMKETKVSTLRLSKPQIH  1025
             F DR LLRA +  +         + +H PP +I  S   ES   K +  + L+ S  Q+ 
Sbjct  188   FIDRTLLRARDPPT----SSFEHVEYHPPPSLISSSKTLESTSPKPSMTTMLKFSSDQLG  243

Query  1024  ALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP  845
              LK+         +K  G T YE++ AHIWRC CKAR+    Q T L    D R R+ PP
Sbjct  244   LLKS--------KSKHEGST-YEILAAHIWRCTCKARALADDQLTKLHVATDGRSRLCPP  294

Query  844   LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  665
             LP  Y GN +        S E++  PL + A +I  ++  +   Y+  A+D+   + D+ 
Sbjct  295   LPPGYLGNVVFTATPMAKSSELLQEPLTNSAKRIHTSLSKMDDNYLRSALDYLELQPDLS  354

Query  664   KRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC---DGDVLILPGPNGI  494
                   T+F  +PNL++ +W  LP H  D GWG+ IHM P   C   +G V ILP PN  
Sbjct  355   ALIRGPTYF-ASPNLNINSWTRLPVHDSDFGWGRPIHMGPA--CILYEGTVYILPSPN--  409

Query  493   DGDDGSLLVAACLQVDHIQDFNKYFYE  413
                D +L +A CL  DH+  F KY YE
Sbjct  410   -SKDRNLRLAVCLDADHMPLFEKYLYE  435



>ref|XP_003553115.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=462

 Score =   271 bits (694),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 177/465 (38%), Positives = 247/465 (53%), Gaps = 36/465 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V P++PT  G L LS  D      +  ++Y Y     +  D  I  +R SLS+VLV++Y
Sbjct  9     TVVPNQPTPKGRLWLSNSDNSTRPAHTPVIYIYKAQLNIEYD--IERMRDSLSKVLVYYY  66

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNH-LVPSVD  1385
             P AGRLS   +          +CN  G  L+EA +    AD GDFSP       LVP++D
Sbjct  67    PVAGRLSLAESGRMEV-----DCNAKGVTLIEAATAKTFADFGDFSPSDSIKEELVPAID  121

Query  1384  YSGVDPIPDIPLFAGQLTKFR---CGGISLGFAISHVVADGQGISHFLFEWANLASGK--  1220
             Y    PI +IPL   QLT+F+     G+++G A SH VADG    HF+  WA +  G   
Sbjct  122   YHS-QPIQEIPLLFVQLTRFQGDQQQGLAIGVAFSHPVADGSAWIHFMNTWAMVNRGDML  180

Query  1219  PLSSAPFHDRRLLRAGEsssssSPQGGRRIFHHSP----PLIIGQSSNESERMKETKVST  1052
              L+  PF DR +L+   SS  S P      F H      PLI+G+S +  E+ K+T  S 
Sbjct  181   DLNEMPFLDRTILKFPPSSLQSPPPPH---FDHPELKPLPLILGKSDSTEEQNKKTAASM  237

Query  1051  LRLSKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCV  872
             L+L+  Q+  LK   N+  +     R ++R+E + AHIWRCACKAR     QPT   F V
Sbjct  238   LKLTSKQVEMLKKKANDQLTKQGS-RPFSRFEAVAAHIWRCACKARELHHNQPTLARFNV  296

Query  871   DIRRRMEPPLPDSYFGNAIIDVVI-HGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAI  695
             D R R+ PPLP +YFGNA++  V      GE+ +RPL   A K+R+A+  +T EY+   +
Sbjct  297   DFRNRLIPPLPRNYFGNALVATVTPECYVGEMTTRPLSYAAQKMREAVALLTDEYIRSHL  356

Query  694   D--FYRNEGDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH  539
             +  F   + D IK   LG        F GNPNL + +W+ +  +  D GWGK ++   G+
Sbjct  357   EVVFGEEQLDCIKAFFLGQGEGRYAPFGGNPNLQITSWINMRAYETDFGWGKPVYFGLGY  416

Query  538   DCDGDV-LILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
              C  D  +I+ GP     DDGS++V    Q+ H+Q   K+FYEDI
Sbjct  417   VCALDRGIIMRGPQ----DDGSVIVIMHFQIAHMQLLKKFFYEDI  457



>gb|ADL62855.1| hydroxycinnamoyl-CoA transferase 2 [Cynara cardunculus var. scolymus]
Length=432

 Score =   270 bits (690),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 164/446 (37%), Positives = 238/446 (53%), Gaps = 29/446 (7%)
 Frame = -2

Query  1738  VKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFYP  1559
             V+PS+PT S  +  S LD +   +++  +YFY  P+  S       ++ +L+ VLV FYP
Sbjct  11    VQPSQPTPSSTIWTSNLDLVVGRIHILTVYFYR-PNGASNFFDADVMKKALADVLVSFYP  69

Query  1558  FAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDYS  1379
              AGR+S              NCNG G + VEAE D+ L D G+F+P PE   L P+VDYS
Sbjct  70    MAGRISRDRNGRLEI-----NCNGEGVLFVEAELDSTLDDFGEFTPSPELRRLTPTVDYS  124

Query  1378  GVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAPF  1199
             G   I   PLF  Q+T F+CGG++LG  + H +ADG    HF+  W+++A G  ++  PF
Sbjct  125   G--DISSYPLFFAQVTHFKCGGVALGCGVFHALADGLSSIHFINTWSDMARGLSIAIPPF  182

Query  1198  HDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSN-ESERMKETKVSTLRLSKPQIHA  1022
              DR LLRA E  + +       I +H+PP +   S N ES R   T V  L+L+  Q++ 
Sbjct  183   IDRTLLRAREPPTPTFDH----IEYHAPPSMKTISQNPESSRKPSTTV--LKLTLDQLNV  236

Query  1021  LKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPL  842
             LKA+  N  S       Y+ YE++ AH+WRCACKAR     Q T L    D R R+ P L
Sbjct  237   LKASTKNDGSNTT----YSTYEILAAHLWRCACKARGLPDDQLTKLYVATDGRSRLSPQL  292

Query  841   PDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  662
             P  Y GN +        SG++ ++ L + AS IR  +  + + Y+  AID+   + D+  
Sbjct  293   PPGYLGNVVFTTTPVAKSGDLTTQSLSNAASLIRTTLTKMDNNYLRSAIDYPEVQPDLSA  352

Query  661   RQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC---DGDVLILPGPNGID  491
                  ++F  +PNL++  W  LP H  D GWG+ + M P   C   +G + +LP PN   
Sbjct  353   LIRGPSYF-ASPNLNINTWTRLPVHDADFGWGRPVFMGPA--CILYEGTIYVLPSPN---  406

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
              +D S+ +A CL  D    F K+ Y+
Sbjct  407   -NDRSMSLAVCLDADEQPLFEKFLYD  431



>ref|XP_004149125.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cucumis 
sativus]
 gb|KGN53930.1| hypothetical protein Csa_4G190020 [Cucumis sativus]
Length=469

 Score =   270 bits (691),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 165/477 (35%), Positives = 254/477 (53%), Gaps = 56/477 (12%)
 Frame = -2

Query  1732  PSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFYPFA  1553
             P+ PT +  L LS  DQ    +++  +Y Y +P+      I+ SL+ SLS++LV +YPFA
Sbjct  14    PNLPTPNLTLPLSVADQFRAWVHITTVYVYKSPNAA---VIVDSLKSSLSKILVPYYPFA  70

Query  1552  GRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDYSGV  1373
             GRL               +C   GA+ +EA     L D GDF+P      L P VDY+  
Sbjct  71    GRLHVIVGGRLEL-----HCCAAGALFIEASYGGTLDDFGDFTPTDVVRKLAPEVDYNS-  124

Query  1372  DPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA---P  1202
               I D+P+F  Q+T+F CGG+ +G  +SH + DG     F+  WA++A G   + +   P
Sbjct  125   -SIEDVPMFLVQVTRFSCGGLVIGLNVSHTLVDGVSAIMFINSWASIARGDKTAKSILQP  183

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSP----PLIIGQSSNESERMKETKVSTLRLSKP  1034
              HDR +L+  +      PQ     F+H      P +IG S+++ ERMKETK + L+L++ 
Sbjct  184   LHDRNVLQPQK--PFCPPQ-----FYHCEYDILPFVIGCSNSKEERMKETKSALLKLTRE  236

Query  1033  QIHALKAADNNGRSCNAKLRG-------------YTRYEVITAHIWRCACKAR---SHKP  902
             Q+  L+   N+    N  +               ++RYE+IT HIW CA KAR   + K 
Sbjct  237   QVEKLRMRANSSTPTNQNIEKVVDVNEVLLQPCPHSRYELITGHIWVCASKARNIDNDKS  296

Query  901   QQPTNLSFCVDIRRRMEPPLPDSYFGN-AIIDVVIHGVSGEIISRPLQDVASKIRDAIDG  725
             +Q T +   V+IR+R+  P+P ++ GN A+I +      GE++S+PL   A KIR+A   
Sbjct  297   KQSTVVQIVVNIRQRLRTPIPKNFCGNAALISITPQCEFGELMSQPLSYAAKKIREASWK  356

Query  724   VTSEYVNCAIDFYRNEGDVIKRQELGTFF----------VGNPNLSVINWVGLPNHGLDL  575
             +T EYV  AIDF   + D+   +   +            + NPNLS+++W+ +P +  D 
Sbjct  357   MTDEYVKSAIDFLATQEDICWTRTSSSSSSSIVRVKGTSLSNPNLSIVSWLSMPIYDADF  416

Query  574   GWGKEIHMSPGHDC-DGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             GWG   ++ P     DG + I+PGPN    +DG ++VA  LQ+ H++ F K+FYED+
Sbjct  417   GWGYPDYVGPSMLAYDGKMFIMPGPN----NDGLIIVAIQLQMKHMEYFKKFFYEDL  469



>ref|XP_010265527.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=435

 Score =   268 bits (684),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 168/451 (37%), Positives = 240/451 (53%), Gaps = 34/451 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT-TPSTLSPDAIIHSLRLSLSQVLVHF  1565
             +V+P++ T    L  S +D +   M+   +YFY  T ST   D  +  L+ +LS+ LV F
Sbjct  10    MVRPAQETPQRSLWNSNVDLVVPRMHTPSVYFYRPTGSTNFFDPKV--LKEALSKALVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               NCNG G + VEAE+ +V+ D GDF+P  E   L+P+VD
Sbjct  68    YPMAGRLKRDEDGRIEI-----NCNGEGVLFVEAETGSVIDDFGDFAPTMELKQLIPAVD  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YSG   I   PL   Q+T+F+CGG+SLG  + H VADG    HF+  W+++A G  L+  
Sbjct  123   YSG--DISSYPLLVLQITRFKCGGVSLGVGMQHHVADGSSGLHFINTWSDMARGLDLTIP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHH-----SPPLI-IGQSSNESERMKETKVSTLRL  1043
             PF DR LLRA +  + S        FHH     +PP+    ++ N     + T V+  ++
Sbjct  181   PFIDRTLLRARDPPTPS--------FHHIEYQPAPPMKHPPETPNSQSGPESTTVTMFKI  232

Query  1042  SKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIR  863
             S+ Q++ LKA   +G    A    Y+ YE++  H+WRC CKAR     Q T L    D R
Sbjct  233   SRDQLNILKAKSKDG----ANSVNYSSYEMLAGHVWRCVCKARGLPDDQDTKLYIATDGR  288

Query  862   RRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYR  683
              R+ PPLP  YFGN I       VSG+++S+PL   A +I DA+  +  EY+  A+D+  
Sbjct  289   SRLRPPLPPGYFGNGIFTATPIAVSGDLLSKPLTYAAGRIHDALVRMDDEYLRSALDYLE  348

Query  682   NEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPG  506
              + D+      G      PN+ + +WV LP H  D GWG+ I M PG    +G   +LP 
Sbjct  349   LQPDLTVLVR-GAHTFRCPNIGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLAFLLPS  407

Query  505   PNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
             P     +DG+L +A  LQ DH++ F K  Y+
Sbjct  408   PV----NDGNLSLAISLQSDHMKVFQKILYD  434



>ref|XP_003599037.1| Anthranilate N-benzoyltransferase protein [Medicago truncatula]
 ref|XP_003638356.1| Anthranilate N-benzoyltransferase protein [Medicago truncatula]
 gb|AES69288.1| spermidine hydroxycinnamoyl transferase [Medicago truncatula]
Length=451

 Score =   268 bits (685),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 166/472 (35%), Positives = 245/472 (52%), Gaps = 56/472 (12%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V P + T  G L LS++DQ+  + + + +Y Y   S  + D  I +L+ SLS++LV++Y
Sbjct  9     TVIPEDATPQGCLWLSDIDQVVKLRHTQTIYIYK--SKQNTDKAIETLKNSLSKILVYYY  66

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGR  +             N N  GA+L+EAE+   + D GDFSP      LVP +DY
Sbjct  67    PVAGRYCYKEGGRIEL-----NLNAKGAILLEAETTKTIHDYGDFSPSDSTMELVPIIDY  121

Query  1381  SGVDPIPDIPLFAGQLTKFRCG--GISLGFAISHVVADGQGISHFLFEWANLASGKPL--  1214
             +   P+ DIPLF  QLT+F+    G+++G A SH ++DG G    +  WA +A G+ L  
Sbjct  122   N--QPVEDIPLFVVQLTRFQNKDEGLAIGIAYSHPLSDGLGAIRLINSWAKIARGETLEV  179

Query  1213  SSAPFHDRRLLRAGEsssssSPQGGRRIFHHSP------------PLIIGQSSNESERMK  1070
             +  PF DR +L+                F H+P            PLI+G+     E+ K
Sbjct  180   NELPFLDRTILK----------------FSHTPLVRFEHKELKPLPLILGRKDTSEEKKK  223

Query  1069  ETKVSTLRLSKPQIHALKAADNNGRSCNAKLRG---YTRYEVITAHIWRCACKARSHKPQ  899
             +T  + LRLS  Q+  LK   N       K +G   ++RYE I+AHIW+CA +AR  +  
Sbjct  224   KTSATLLRLSPEQVDKLKKKANENDILAIKNKGSRPFSRYEAISAHIWKCASRARELEEN  283

Query  898   QPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVT  719
             Q + + F  DIR R+ PPLP +YFGNA+      G  GEI S+PL  VA  IR+A + V+
Sbjct  284   QESVVRFNADIRTRLVPPLPKNYFGNALTQTAAIGYVGEITSKPLGYVAQMIREATELVS  343

Query  718   SEYVNCAIDFYR--NEGDVIKRQELGTF-----FVGNPNLSVINWVGLPNHGLDLGWGKE  560
              E++   ID  R     D  ++  +G       + GNPN +  +W+ +P +  D GWGK 
Sbjct  344   DEFIRSQIDVIRGFEHLDDARKLFMGGVGENIPYFGNPNFNFTSWMSMPIYEADFGWGKP  403

Query  559   IHMSPGHDCDGD-VLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             ++         D  +IL  P+G    DGS+LV    Q+  ++ F K+FY DI
Sbjct  404   VYFGLAFVSPHDRAVILHSPDG----DGSVLVCLHFQIALLELFKKFFYGDI  451



>ref|XP_011073311.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=433

 Score =   267 bits (683),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 166/448 (37%), Positives = 238/448 (53%), Gaps = 30/448 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFY--TTPSTLSPDAIIHSLRLSLSQVLVH  1568
             +V P+  T    L  S +D +   +++  +YFY  T        A+   L+ +L + LV 
Sbjct  10    LVLPAAVTPCVTLWNSNVDLVVCNIHIPTVYFYGPTGAVNFFDPAV---LKAALGRALVP  66

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL               +CN  G + VEAESDAV+ D GDF+P  E   L+P V
Sbjct  67    FYPVAGRLKRDKDGRIEI-----DCNAEGVLFVEAESDAVVDDFGDFAPTLELRRLIPPV  121

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DYS    I   PL   Q+T+F+CGG+SLG  I H+VADG    HF+  W+++A G  ++ 
Sbjct  122   DYS--QGISTFPLVVLQVTRFKCGGVSLGVGIHHIVADGLSALHFINTWSDMARGLDITI  179

Query  1207  APFHDRRLLRAGEsssssSPQGG-RRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
              PF DR LLRA +      PQ     I +  PP +    S +      T V+ L+L++ Q
Sbjct  180   PPFIDRTLLRARDP-----PQPKFEHIEYQPPPTMAIHDSQKINAAPRTVVAILKLTRGQ  234

Query  1030  IHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
             ++ LKA +  +G +       Y+ YE++ AHIW CAC+AR    +Q T L    + R R+
Sbjct  235   LNTLKAKSKEDGNTVT-----YSSYEILAAHIWVCACRARGLVDEQKTKLFIATNGRSRL  289

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
              PPLP  YFGN I      GVSGE+ S+P+   A KI D +  +  EY+  A+D+   + 
Sbjct  290   RPPLPPGYFGNVIFTTTPVGVSGELQSKPISYTAGKIHDVLVRMDDEYLRSALDYLEVQP  349

Query  673   DVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNG  497
             D++        F   PNL++ +WVGLP H  D GWG+ + M PG    +G  ++LP P  
Sbjct  350   DLMALVRGANTF-NCPNLAITSWVGLPIHDADFGWGRPVFMGPGSILYEGLCVVLPSPT-  407

Query  496   IDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                +DGSL VA  LQ + ++ F K FY+
Sbjct  408   ---NDGSLSVAVSLQEEPMKVFEKLFYD  432



>ref|XP_004500005.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cicer 
arietinum]
Length=465

 Score =   268 bits (685),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 169/467 (36%), Positives = 250/467 (54%), Gaps = 41/467 (9%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              + P+E T +G L LS+LDQI    +  ++Y Y  P   +   +  +L+ SLS++LV +Y
Sbjct  9     TITPNESTPNGSLWLSDLDQIFRPFHTTLIYIYK-PKKENQKNLTQTLKNSLSKILVPYY  67

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGR S+T            N N  GA+L+EAE+   + D GDFS       L+P +D+
Sbjct  68    PIAGRYSYTKLGRLEL-----NLNAKGAILLEAETTQTIHDFGDFSSFDSIKELIPKIDF  122

Query  1381  SGVDPIPDIPLFAGQLTKFRCGG---ISLGFAISHVVADGQGISHFLFEWANLASGKPLS  1211
             +   PI +IPLF  QLT+F+      +++G A SH ++DG G  +F+  WA +A G+ L 
Sbjct  123   N--QPIEEIPLFVVQLTRFQNKDENFVAIGIAYSHSLSDGLGCWNFINSWAKIARGETLE  180

Query  1210  S--APFHDRRLLRAGEsssssSPQGGRRIFHHSP----PLIIGQSSNESERMKETKVSTL  1049
             +   PF DR +L+   +         +  F H      P I+G+S +  ER K+T+V  L
Sbjct  181   ANELPFLDRTILKFSHTPL-------KPCFEHRELKPLPFILGRSDDNIERKKKTRVELL  233

Query  1048  RLSKPQIHALKAADNN-----GRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNL  884
             +L++ ++  LK   N      G    +K R Y+R+E I+AHIWR A KAR     Q + +
Sbjct  234   KLTRDEVEKLKKKANECEISKGSISISKSRPYSRFEAISAHIWRSASKARELNANQLSVV  293

Query  883   SFCVDIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVN  704
              F V IR R+ P LP +Y+GNA+I     G  GEI S+PL   A KIR+  + + +EY+ 
Sbjct  294   RFNVQIRNRIVPNLPKNYYGNALIQTEARGYIGEITSKPLSYAAKKIREGNELIKNEYIR  353

Query  703   CAIDFYR--NEGDVIKRQELG-----TFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSP  545
               ID  R     D  +R  +G       FVG PNL + +W+G   +  D GWGK I+ S 
Sbjct  354   SQIDVIRGFENLDDARRLFIGGDGKTPTFVGYPNLHITSWMGFATNEADFGWGKPIYFSM  413

Query  544   GHDCDGD-VLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             GH    D  +I+  P+    DD S+ V    QV+ +Q F K+FYED+
Sbjct  414   GHVTSYDRAIIIKSPD----DDASVTVCMHFQVELMQLFKKFFYEDL  456



>ref|XP_009798536.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=436

 Score =   266 bits (679),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 169/452 (37%), Positives = 243/452 (54%), Gaps = 35/452 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAI-IHSLRLSLSQVLVHF  1565
             +VKPS+PT S  L  S LD I   +++  +YFY  P+ +SP+      ++ +LS +LV F
Sbjct  10    MVKPSKPTPSKRLWNSNLDLIVGRIHLLTVYFYK-PNGISPNFFDFRIMKEALSNILVSF  68

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGD-FSPGPEFNH-LVPS  1391
             YP AGRL+      G       NCNG G + +EAE D  + D GD F+P  E    L+P+
Sbjct  69    YPMAGRLAKDNNEKGRIEI---NCNGEGVLFIEAEIDEFIDDFGDDFTPSLEIKKMLIPN  125

Query  1390  VDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLS  1211
             VD SG   I   PL   Q+T+F+CGG+SLG  + H ++DG    HF+  W+ +A G  ++
Sbjct  126   VDTSG--DISSFPLVIFQVTRFKCGGVSLGCGVFHTLSDGISSLHFINTWSEVARGLSVA  183

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERM---KETKVSTLRLS  1040
              +PF DR LLRA +  +       + + +H PP +   S    +++   K +  +  +++
Sbjct  184   VSPFIDRSLLRARDPPT----PAYKHVEYHPPPTLKSSSEYVHDQVNGPKSSITAMFKIT  239

Query  1039  KPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
               Q+  LK          +K  G T YEV+ AHIWRC CKAR+    Q T L    D R 
Sbjct  240   SDQLTLLKT--------KSKKEGST-YEVLAAHIWRCTCKARALDNDQLTKLHVATDGRS  290

Query  859   RMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRN  680
             R+ PPLP  Y GN +        SGEI+S PL + A +I  A+  +  EY+  AID+   
Sbjct  291   RLFPPLPPGYLGNVVFTATPIAKSGEILSEPLMNTAQRIHSALARMDDEYLRSAIDYLEL  350

Query  679   EGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC---DGDVLILP  509
             + D+ K     T+F  +PNL++ +W  LP H  D GWGK IHM P   C   +G V ILP
Sbjct  351   QTDLSKLIRGPTYF-ASPNLNINSWTRLPVHDSDFGWGKPIHMGPA--CILYEGTVYILP  407

Query  508   GPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
              P+    +D +L +A CL  DH+  F KY Y+
Sbjct  408   SPS----NDKNLRLAVCLDADHMPLFEKYLYD  435



>ref|XP_003532110.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=465

 Score =   266 bits (679),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 178/469 (38%), Positives = 245/469 (52%), Gaps = 41/469 (9%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V P++PT  G L LS  D      +  ++Y Y     +  +  I  ++ SLS+ LV+FY
Sbjct  9     TVVPNQPTPKGRLWLSNSDNSTRKAHSPVIYIYKAKHNIEYN--IERMKESLSKTLVYFY  66

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNH-LVPSVD  1385
             P AGRLS + +          +CN  G  L+EAE+   LAD GDFSP       LVP++D
Sbjct  67    PVAGRLSLSESGRMEV-----DCNAKGVTLIEAETAKTLADFGDFSPSDSIKEELVPAID  121

Query  1384  YSGVDPIPDIPLFAGQLTKFRCG-----GISLGFAISHVVADGQGISHFLFEWANLASGK  1220
             Y    PI +IPL   QLT+F+       G+++G A SH VADG   + F+  WA +  G 
Sbjct  122   YHS-QPIQEIPLLFVQLTRFKGDQQQQHGLAIGMAYSHPVADGLAWTRFVNTWAMVNRGD  180

Query  1219  PL--SSAPFHDRRLLRAGEsssssSPQGGRRIFHHSPP------LIIGQSSNESERMKET  1064
              L  +  PF DR +L+    SSS S      + H   P      LI+G+S +  E+ K+T
Sbjct  181   SLDVNEMPFLDRTILKFPTWSSSLSLLSPPPLSHSDHPELKPLPLILGRSDSTEEQNKKT  240

Query  1063  KVSTLRLSKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNL  884
               S L+L+  Q+  LK   N+  S        TR+E + AHIWRCACKAR    +QPT +
Sbjct  241   TASVLKLTSKQVEMLKKKANDQGSTPC-----TRFEAVAAHIWRCACKARGQHHKQPTIV  295

Query  883   SFCVDIRRRMEPPLPDSYFGNAIIDVVI-HGVSGEIISRPLQDVASKIRDAIDGVTSEYV  707
              F  DIR R+ PPLP +YFGNA++  V      GEI SRPL   A K+R+AI  +  EY+
Sbjct  296   RFNGDIRNRLIPPLPRNYFGNALVATVTPECYVGEITSRPLSYAARKLREAIALLRDEYI  355

Query  706   NCAID--FYRNEGDVIKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHM  551
                ++  F   +   I+   LG        F GNPNL + +W+  P    D GWGK ++ 
Sbjct  356   RSQLEAVFGEEQLKCIRAFFLGQGEGRSEPFGGNPNLQITSWINFPVDSTDFGWGKPVYF  415

Query  550   SPGHDCDGDV-LILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
               G+ C  D  +I+  P     DDGSL+V    Q+ H+Q F K FYEDI
Sbjct  416   GLGYVCALDRGIIVRDPQ----DDGSLIVIMHFQIAHMQLFKKLFYEDI  460



>ref|XP_004149124.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cucumis 
sativus]
 gb|KGN53927.1| hypothetical protein Csa_4G189010 [Cucumis sativus]
Length=453

 Score =   265 bits (678),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 164/466 (35%), Positives = 249/466 (53%), Gaps = 44/466 (9%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              + P+ PT +  LSLSE DQ     Y   +Y Y     L    ++ +L+ SLS++LV +Y
Sbjct  11    TIIPNLPTPNLTLSLSEADQFRAWAYSTTVYVY---KFLDAAVVVDTLKSSLSEILVPYY  67

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             PFAGRL     +         +C   GA+ +EA     L D  DF+       L P VDY
Sbjct  68    PFAGRLRLIVGSRFEL-----HCCAAGALFIEASYGGTLDDCSDFTHADGLRKLTPKVDY  122

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA-  1205
             +   PI D+PLF  Q+T+F CGG+ +G  +SH + DG     F+  WA++A G+  + + 
Sbjct  123   NS--PIEDVPLFVVQVTRFSCGGLVIGLNVSHTLVDGVSAIMFINSWASIARGEKTAKSI  180

Query  1204  --PFHDRRLLRAGEsssssSPQGGRRIFH---HSPPLIIGQSSNESERMKETKVSTLRLS  1040
               P HDR +L+A +      P    R FH   H  P +IG  S+  E++++ ++     +
Sbjct  181   LQPSHDRNVLQAQK------PFSPPRFFHYEYHVLPFVIG-CSDYKEQVEKLRMRANSSN  233

Query  1039  KPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKAR---SHKPQQPTNLSFCVD  869
                 +  K+ D N      +   Y+RYE IT HIW CA KAR   + K    T +   V+
Sbjct  234   PTNQNIEKSVDVN--EVLLQPSPYSRYESITGHIWVCASKARNINNDKSNLSTMVQIVVN  291

Query  868   IRRRMEPPLPDSYFGN-AIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAID  692
             +R+R+  P+P ++ GN A+I V +    GE++S+PL   A KIR+A   +T EYV  AID
Sbjct  292   VRQRLRKPIPKNFCGNAALISVTLQSNFGELMSQPLSYSAKKIREASWKMTDEYVTSAID  351

Query  691   FYRNEGDVIKRQ----------ELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG  542
             F     D+   +          ++   ++GNPNLSV++W+ +P +  D GWG   ++ P 
Sbjct  352   FLTTHEDICWTRTSSSSSSSIVQVRNTYLGNPNLSVVSWLSMPIYDADFGWGHPDYVGPL  411

Query  541   H-DCDGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
               DCDG+  I+PGPN    +DGS++VA  L + H++DF K+FYED+
Sbjct  412   MLDCDGETFIMPGPN----NDGSIIVAIQLHMKHMEDFKKFFYEDL  453



>emb|CAE46932.1| hydroxycinnamoyl CoA quinate transferase [Nicotiana tabacum]
Length=436

 Score =   264 bits (674),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 168/447 (38%), Positives = 233/447 (52%), Gaps = 31/447 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +VKPS+PT +  L  S LD I   +++  +YFY  P+  S       ++ +LS VLV FY
Sbjct  16    LVKPSKPTPTKRLWSSNLDLIVGRIHLLTVYFYK-PNGSSNFFDSKIMKEALSNVLVSFY  74

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL+              NCNG G + VEAESDA + D GDF+P  E   L+P+VD 
Sbjct  75    PMAGRLARDEQGRIEI-----NCNGEGVLFVEAESDAFVDDFGDFTPSLELRKLIPTVDT  129

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T+F+CGG+SLG  + H ++DG    HF+  W+++A G  ++  P
Sbjct  130   SG--DISTFPLIIFQVTRFKCGGVSLGGGVFHTLSDGLSSIHFINTWSDIARGLSVAIPP  187

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPP-LIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             F DR LLRA +  +         + +H PP LI    S ES   K +  + L+ S  Q+ 
Sbjct  188   FIDRTLLRARDPPT----SSFEHVEYHPPPSLISSSKSLESTSPKPSTTTMLKFSSDQLG  243

Query  1024  ALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP  845
              LK+   +  S          YE++ AHIWRC CKAR+    Q T L    D R R+ PP
Sbjct  244   LLKSKSKHDGST---------YEILAAHIWRCTCKARALSDDQLTKLHVATDGRSRLCPP  294

Query  844   LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  665
             LP  Y GN +        S E++  PL + A +I  A+  +   Y+  A+D+     D+ 
Sbjct  295   LPPGYLGNVVFTGTPMAKSSELLQEPLTNSAKRIHSALSKMDDNYLRSALDYLELLPDLS  354

Query  664   KRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC---DGDVLILPGPNGI  494
                   T+F  +PNL++ +W  LP H  D GWG+ IHM P   C   +G V ILP PN  
Sbjct  355   ALIRGPTYF-ASPNLNINSWTRLPVHDSDFGWGRPIHMGPA--CILYEGTVYILPSPN--  409

Query  493   DGDDGSLLVAACLQVDHIQDFNKYFYE  413
                D +L +A CL  DH+  F KY YE
Sbjct  410   -SKDRNLRLAVCLDADHMPLFEKYLYE  435



>gb|KHN35439.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=409

 Score =   262 bits (670),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 165/427 (39%), Positives = 232/427 (54%), Gaps = 47/427 (11%)
 Frame = -2

Query  1600  LRLSLSQVLVHFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSP  1421
             +R SLS++LVH++P AGRL+W             NCNG G  L+EAES   + D GDF+P
Sbjct  1     MRDSLSKILVHYHPLAGRLTWLEGGKVEL-----NCNGKGVTLIEAESQKTMDDYGDFAP  55

Query  1420  GPEF-NHLVPSVDYSGVDPIPDIPLFAGQLTKFRCG----------GISLGFAISHVVAD  1274
               +  N L+P VDYS   PI ++PL   QLT+F+ G          G+++G A  HV+ D
Sbjct  56    SEKLKNELIPPVDYS--QPIEELPLLLVQLTRFKKGSSNNNNNNQLGLAIGVAFCHVLCD  113

Query  1273  GQGISHFLFEWANLASGKPLSSA---PFHDRRLLRAGEsssssSPQGGRRIFHHSP----  1115
             G     F+  WA L  G+ L S    PF DR ++ +     +  P+  R  F H      
Sbjct  114   GLAAIRFINAWAKLTRGEVLDSIEMFPFLDRTIMNS-----TYPPRAPR--FDHPELKPL  166

Query  1114  PLIIGQSSNESERMKETKVSTLRLSKPQIHALKAADNNGRSCNAK-LRGYTRYEVITAHI  938
             PL +G +    E+ KE     LRL+  Q+  LK   N+ R    + LR Y+RYEVI +HI
Sbjct  167   PLKLGTTDTIEEQKKEKTAVILRLTSQQVEKLKKKTNDERPQKEETLRPYSRYEVIASHI  226

Query  937   WRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAI-IDVVIHGVSGEIISRPLQ  761
             WRCA KAR  +  QPT +    DIR R+ PPLP +YFGNA+ + +     + E+I+ PL 
Sbjct  227   WRCASKARELEDLQPTVVRVSADIRNRLNPPLPRNYFGNALAVALTPKCHTKELITNPLS  286

Query  760   DVASKIRDAIDGVTSEYVNCAIDFYR--NEGDVIKRQEL------GTFFVGNPNLSVINW  605
               A KIR+AI+ +  EY+   +DF R   + D I+   L         F GNPNL++++W
Sbjct  287   HGAQKIREAIELLNDEYIRSQLDFIRCHEQLDRIRASYLDQGEPKNAPFYGNPNLTIVSW  346

Query  604   VGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDGDDGSLLVAACLQVDHIQDFN  428
             + +P +  D GWGK  +  PG    DG   I+   +    +DGSL+V+A LQ  H + F 
Sbjct  347   MSMPVYEADFGWGKPGYFGPGAVYPDGKAYIIRSSD----EDGSLVVSAHLQTAHKELFK  402

Query  427   KYFYEDI  407
             K+FYEDI
Sbjct  403   KFFYEDI  409



>gb|AEM63675.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Platycodon grandiflorus]
Length=434

 Score =   263 bits (672),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 159/444 (36%), Positives = 235/444 (53%), Gaps = 21/444 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +VKP+E T    L  S +D +    +   +YFY  P+  +       L+ +LSQ+LV FY
Sbjct  10    MVKPAEETPIKTLWNSNVDLVVPNFHTPSVYFYR-PNGSANFFDAKVLKDALSQILVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P  GRL               +CNG G + VEAE+D V+ D GDF+P  E   L+PSVDY
Sbjct  69    PMGGRLKRDEDGRIEI-----DCNGEGVLFVEAETDGVVDDFGDFAPTLELRKLIPSVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S    I  IPL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  ++  P
Sbjct  124   SL--EISAIPLLVLQVTYFKCGGVSLGVGMQHHVADGASGLHFINTWSDMARGLDVTLPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LLRA +    + P      +  +P +        ++ + ET++S  +L++ Q++A
Sbjct  182   FIDRTLLRARDPPQPAFPHIE---YQPAPTMKAPLEPANAQSVPETEISIFKLTREQLNA  238

Query  1021  LKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPL  842
             LKA        +     Y+ YE+++ H+WRC CKAR     Q T L    D R R++P L
Sbjct  239   LKAKSKE----DGNTVSYSSYEMLSGHVWRCVCKARGLPDDQDTKLYIATDGRSRLQPVL  294

Query  841   PDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  662
             P  YFGN I       V+G++ S+P    AS+I DA+  + +EY+  A+D+   + D +K
Sbjct  295   PPGYFGNVIFTTTPTAVAGDLTSKPTWYAASRIHDALGRMDNEYLRSALDYLELQPD-LK  353

Query  661   RQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDGD  485
                 G      PNL + +W  LP H  D GWG+ I M PG    +G   +LP       +
Sbjct  354   ALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSTT----N  409

Query  484   DGSLLVAACLQVDHIQDFNKYFYE  413
             DGSL +A  LQ +H++ F+K+ Y+
Sbjct  410   DGSLSIAISLQAEHMKLFSKFLYD  433



>gb|AEM63676.1| hydroxycinnamoyl CoA quinate hydroxycinnamoyl transferase [Platycodon 
grandiflorus]
Length=443

 Score =   263 bits (673),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 162/447 (36%), Positives = 235/447 (53%), Gaps = 35/447 (8%)
 Frame = -2

Query  1732  PSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFYPFA  1553
             PSE  W+     S LD +   +++  +YFY  P+  S       L+ +LS VLV FYP A
Sbjct  24    PSEKLWN-----SNLDLVVGRIHILTVYFYR-PNGSSNFFDARVLKEALSNVLVSFYPMA  77

Query  1552  GRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDYSGV  1373
             GRL+              NCNG G + VEAE+D+ + D GDF+P  E   L P VDYSG 
Sbjct  78    GRLARDQEGRLEI-----NCNGEGVLFVEAETDSTVDDFGDFTPSAEQRQLAPMVDYSG-  131

Query  1372  DPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAPFHD  1193
               I   PLF  Q+T F+CGG+SLG  + H ++DG    HF+  W+++A G  ++  PF D
Sbjct  132   -DISSYPLFFAQVTYFKCGGVSLGCGVHHTLSDGVSSLHFINTWSDIARGLSIAIPPFID  190

Query  1192  RRLLRAGEsssssSPQGGRRIF----HHSPPLIIGQSSNESERMKETKVST--LRLSKPQ  1031
             R LLRA         Q  R +F    +H PP +     N + +     VST  L+L+  Q
Sbjct  191   RTLLRARL-------QPPRPVFDHVEYHPPPSMNASVQNTNPKSSPKPVSTAILKLTLDQ  243

Query  1030  IHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             ++ LKA   N  +   +   Y+ Y ++ AH+WRCACKAR     Q T L    D R R+ 
Sbjct  244   LNELKAKTKNDGNTREQ---YSSYVILAAHLWRCACKARGLPDDQLTKLYVATDGRFRLS  300

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             P LP  Y GN +        SGEI+S+PL + A KI +A+  +  EY+  A+D+  ++ D
Sbjct  301   PTLPPGYLGNVVFTATPVAESGEIVSQPLSNSAKKIHNALAKMDDEYLRSALDYLESQPD  360

Query  670   VIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGI  494
             +      G  +   PNL++ +W  LP +  D GWG+ I M P     +G + ++P P+  
Sbjct  361   LGALIR-GPNYFACPNLNINSWTRLPIYDADFGWGRPIFMGPASILYEGTIYVIPSPD--  417

Query  493   DGDDGSLLVAACLQVDHIQDFNKYFYE  413
               ++ S+ +A CL+ DH+  F KY YE
Sbjct  418   --NNRSVSLALCLEADHMPLFEKYLYE  442



>ref|XP_009624297.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=436

 Score =   263 bits (671),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 167/447 (37%), Positives = 232/447 (52%), Gaps = 31/447 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +VKPS+PT +  L  S LD I   +++  +YFY  P+  S       ++ +LS VLV FY
Sbjct  16    LVKPSKPTPTKRLWNSNLDLIVGRIHLLTVYFYK-PNGSSNFFDSKVMKEALSNVLVSFY  74

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL+              NCNG G + VEAESDA + D GDF+P  E   L+P+VD 
Sbjct  75    PMAGRLARDEQGRIEI-----NCNGEGVLFVEAESDAFVDDFGDFTPSLELRKLIPTVDT  129

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T+F+CGG+SLG  + H ++DG    HF+  W+++A G  +   P
Sbjct  130   SG--DISTFPLIIFQVTRFKCGGVSLGGGVFHTLSDGLSSIHFINTWSDIARGLSVVIPP  187

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPP-LIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             F DR LLRA +  +         + +H PP LI    + ES   K +  + L+ S  Q+ 
Sbjct  188   FIDRTLLRARDPPT----SSFEHVEYHPPPSLISSSKTKESTSPKPSTTTMLKFSSDQLG  243

Query  1024  ALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP  845
              LK+   +  S          YE++ AHIWRC CKAR+    Q T L    D R R+ PP
Sbjct  244   LLKSKSKHDGST---------YEILAAHIWRCTCKARALSDDQLTKLHVATDGRSRLCPP  294

Query  844   LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  665
             LP  Y GN +        S E++  PL + A +I  A+  +   Y+  A+D+     D+ 
Sbjct  295   LPPGYLGNVVFTGTPMAKSSELLQEPLTNSAKRIHSALSKMDDNYLRSALDYLELLPDLS  354

Query  664   KRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC---DGDVLILPGPNGI  494
                   T+F  +PNL++ +W  LP H  D GWG+ IHM P   C   +G V ILP PN  
Sbjct  355   ALIRGPTYF-ASPNLNINSWTRLPVHDSDFGWGRPIHMGPA--CILYEGTVYILPSPN--  409

Query  493   DGDDGSLLVAACLQVDHIQDFNKYFYE  413
                D +L +A CL  DH+  F KY YE
Sbjct  410   -SKDRNLRLAVCLDADHMPLFEKYLYE  435



>ref|XP_007027321.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY07823.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=437

 Score =   262 bits (669),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 167/448 (37%), Positives = 236/448 (53%), Gaps = 26/448 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V P+E T +  L +S  D +  M ++  +YFY  P+  +       L+ SLS++LV FY
Sbjct  10    IVCPAEETPNRRLWVSNFDLVMIMYHISTVYFYK-PNGSTNIFDTKVLKESLSKILVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADL-GDFSPGPEFNHLVPSVD  1385
             P AGRL +              CN  G +  EAES +++ DL  DF+ G +   LVP +D
Sbjct  69    PIAGRLGYDENGRLEII-----CNAKGVLFTEAESSSIMDDLVQDFTDGSKVPQLVPKID  123

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YSG   I   PL   Q+T F+CGGISLG A+ H + DG    HF+  WAN   G   S +
Sbjct  124   YSG--GISSYPLLGLQVTTFKCGGISLGVAVQHTLLDGSSGLHFINSWANTVGGLSPSIS  181

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERM-KETKVSTLRLSKPQI  1028
             PF DR LLRA    +   P+     F  SP L    S++ES++  K + VS  +++  Q+
Sbjct  182   PFLDRTLLRARNPPT---PKFHHVEFEPSPSLQTMFSTSESQQSPKPSIVSVFKITTDQL  238

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
             + LKA  N   + N K   Y+ Y ++TAHIWRCA KAR     Q   L+  VD R R+ P
Sbjct  239   NTLKAKVNESSNSNTK---YSTYSILTAHIWRCATKARDLLEDQQLKLTMPVDGRNRLHP  295

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD-  671
             PLP  YFGN I+   +  +SG+++S    D   +I   +  +  EY+  +ID+     D 
Sbjct  296   PLPPGYFGNVIVMAALVALSGDLLSESFIDTVKRIHKILKEMDDEYLRSSIDYIEKAPDI  355

Query  670   -VIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNG  497
              VI+R   G   +  PNLSV +W+ LP H  D GWG+ I M P +   +G V ILP P  
Sbjct  356   NVIRR---GPQTMRCPNLSVNSWIWLPIHDADFGWGRPIFMRPANIVHEGKVYILPSPT-  411

Query  496   IDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                 DGS+ +   L+  H++ F K  YE
Sbjct  412   ---KDGSVTLVTRLETSHMKLFGKLLYE  436



>gb|AFL93687.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-transferase [Cynara 
cardunculus var. scolymus]
Length=434

 Score =   261 bits (668),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 161/446 (36%), Positives = 233/446 (52%), Gaps = 25/446 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +VKPS+PT +  L  S LD +   +++  +YFY  P+  S       L+ +L+ VLV F+
Sbjct  10    MVKPSKPTPNQRLWNSNLDLVVGRIHILTVYFYR-PNGSSNFFDSGVLKXALADVLVSFF  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               NCNG G + VEAE+D  + D G+ +P PE   L P+VDY
Sbjct  69    PMAGRLGNDGDGRVEI-----NCNGEGVLFVEAEADCSIDDFGEITPSPELRKLAPTVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S  D I   PL   Q+T+F CGG+SLG  + H ++DG    HF+  W++ A G  ++  P
Sbjct  124   S--DQISSYPLCITQVTRFNCGGVSLGCGLHHTLSDGLSSLHFINTWSDKARGLSVAIPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIG--QSSNESERMKETKVSTLRLSKPQI  1028
             F DR LLRA +  ++        + +HSPP +I   Q+ N +   K    + LRL+  QI
Sbjct  182   FIDRSLLRARDPPTAMF----EHLEYHSPPSLIAPSQNQNSTSHPKLASTTMLRLTLDQI  237

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
             + LK+      S       ++ YE++ AH+WRCACKAR     QPT L    D R R+ P
Sbjct  238   NGLKSKAKGDGSVY-----HSTYEILAAHLWRCACKARGLSDDQPTKLYVATDGRSRLSP  292

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  Y GN +        SGE  S  L D A +I   +  +  +Y+  AID+   + D+
Sbjct  293   PLPPGYLGNVVFTATPIAKSGEFKSESLADTARRIHIELAKMDDQYLRSAIDYLELQPDL  352

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGID  491
                    T+F  +PNL++ +W  LP +  D GWG+ I M P     +G + I+P P+G  
Sbjct  353   TALVRGPTYF-ASPNLNINSWTRLPIYESDFGWGRPIFMGPASILYEGTIYIIPSPSG--  409

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
               D S+ +A CL  DH+  F K  Y+
Sbjct  410   --DRSVSLAVCLDPDHMSLFRKCLYD  433



>ref|XP_003532115.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
 gb|KHM99604.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=452

 Score =   262 bits (669),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 166/472 (35%), Positives = 245/472 (52%), Gaps = 58/472 (12%)
 Frame = -2

Query  1738  VKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFYP  1559
             V P++ T    L LS+ DQ+  + +   +Y Y           I  ++ SL ++LV++YP
Sbjct  11    VVPNQETPKVRLWLSDSDQVVRLGHTPTIYVYKAKHNTK---TIERMKTSLGKILVYYYP  67

Query  1558  FAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNH-LVPSVDY  1382
              AGRL+ + +          +CN  G  L+EAE+   L D GDFSP       LVP +DY
Sbjct  68    VAGRLNLSDSGRMEL-----DCNAKGVTLLEAETTKSLGDYGDFSPSESIKEELVPQIDY  122

Query  1381  SGVDPIPDIPLFAGQLTKFRCG-GISLGFAISHVVADGQGISHFLFEWANLASGKPLS--  1211
             +   P+ ++PL   QLT+F+ G   ++G A SH +ADG     F+  WA +A G+ L   
Sbjct  123   T--QPLEELPLLFVQLTRFKDGESFAIGVACSHTLADGLSAIQFINSWAKVARGETLEPH  180

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFHHSP-------------PLIIGQSSNESERMK  1070
               PF DR +L+                  HSP             PL +G S + +E  K
Sbjct  181   EVPFLDRTVLK----------------LQHSPSAPCFDHPELKPLPLKLGSSDSIAEENK  224

Query  1069  ETKVSTLRLSKPQIHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQP  893
             +T    L+L+  Q+  LK  A++      +++R Y+R+E I AHIWRCACKAR    +QP
Sbjct  225   KTCAVLLKLTPEQVGKLKKKANDQPMKEGSRVRPYSRFEAIAAHIWRCACKARELDEKQP  284

Query  892   TNLSFCVDIRRRMEPPLPDSYFGNAIIDVVI-HGVSGEIISRPLQDVASKIRDAIDGVTS  716
             T + F  DIR R+ PPLP +YFGNA+   V      GE +S+PL   A K+R+AI+ +T+
Sbjct  285   TLVRFNGDIRSRLIPPLPRTYFGNALAATVTPRCYVGETLSKPLSYAAQKVREAIEMLTN  344

Query  715   EYVNCAIDFYRNEG--DVIKR------QELGTFFVGNPNLSVINWVGLPNHGLDLGWGKE  560
             EY+   +D    E   D IK       +     F GNPNL + +W+ +P +  D GWGK 
Sbjct  345   EYIRSQLDIVLGEEQLDCIKALFSGQGERRNAPFAGNPNLQITSWMSMPVYEADFGWGKP  404

Query  559   IHMSPGHDCDGD-VLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             ++    +    D  +IL  P+G    DGS++V+   Q+ H+Q F KYFYE+I
Sbjct  405   MYFGLAYVSAQDRAVILLSPHG----DGSVIVSMHFQIAHMQLFKKYFYENI  452



>gb|AFS68800.1| hydroxycinnamoyl transferase [Lonicera japonica]
Length=430

 Score =   260 bits (665),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 162/444 (36%), Positives = 231/444 (52%), Gaps = 25/444 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V+P++      L  S +D +    +   +YFY  P+  S       L+ +LS+ LV FY
Sbjct  10    TVRPAQDLPPRSLWNSNVDLVVPNFHTPSVYFYN-PTGSSNFFDPKVLKDALSRALVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL                CNG G + VEAESD V+ D GDF+P  E   L+P+VDY
Sbjct  69    PMAGRLRRDEDGRIEI-----ECNGAGVLFVEAESDGVIGDFGDFAPTLEMRKLIPAVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S    I    L   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  L+  P
Sbjct  124   S--QGISSYALLVLQITYFKCGGVSLGVGMQHHAADGASGLHFINAWSDMARGLDLTIPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LLRA +    + P        + PP  +   +NE+  + +T VS  +L++ QI++
Sbjct  182   FIDRTLLRARDPPQPTFPH-----IEYQPPPTMRTKNNET--VPDTDVSIFKLTRDQINS  234

Query  1021  LKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPL  842
             LKA   +    +    GY+ YE++  H+WRC CKAR     Q T L    D R R++P L
Sbjct  235   LKAKSKD----DGNAIGYSSYEMMAGHLWRCVCKARGLPEDQETKLYIATDGRARLKPSL  290

Query  841   PDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  662
             P  YFGN I       V+G++ S+P    AS+I DA+  + ++Y+  A+D+   + D +K
Sbjct  291   PPGYFGNVIFTTTPIAVAGDLQSKPAWYAASRIHDALTRMDNDYLRSALDYLELQPD-LK  349

Query  661   RQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDGD  485
                 G      PNL + +W  LP H  D GWG+ I M PG    +G   +LP P     +
Sbjct  350   ALVRGAHTFRCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSPT----N  405

Query  484   DGSLLVAACLQVDHIQDFNKYFYE  413
             DGSL VA  LQ +H++ F KY YE
Sbjct  406   DGSLSVAISLQAEHMKLFAKYLYE  429



>gb|AHA44839.1| hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltransferase [Larix 
kaempferi]
Length=433

 Score =   260 bits (665),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 169/450 (38%), Positives = 230/450 (51%), Gaps = 34/450 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAI-IHSLRLSLSQVLVHF  1565
             +V+P+ PT    L  S +D +   ++   +YFY    T SPD   +H LR +LS+VLV F
Sbjct  10    MVRPAAPTPQRDLWNSNVDLVVPRIHTASVYFYR--PTGSPDFFSMHILRDALSKVLVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               NCNG G +LVEA +D+V+ D GDF+P  E   L+P V+
Sbjct  68    YPMAGRLKRDPDGRIEI-----NCNGEGVLLVEAITDSVIDDFGDFAPTMELKQLIPKVN  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS  + I    L   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  ++  
Sbjct  123   YS--EDISSYALLVLQVTFFKCGGVSLGVGMQHHVADGYAGLHFINTWSDVARGLDITLP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQSSNESERMKETKVSTLRLSK  1037
             PF DR LLRA               FHH     PP +   S   +    +  V+  RL+K
Sbjct  181   PFIDRTLLRARNPPIPK--------FHHVEYQQPPPLKDTSGIMNGEKNDFSVAIFRLTK  232

Query  1036  PQIHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
              Q+  LK  A  NG   +     Y+ YE+++ HIWRCACKAR+ +  Q T L    D R 
Sbjct  233   EQLDILKGKARENGNKVS-----YSSYEMLSGHIWRCACKARNLREDQETKLYIATDGRS  287

Query  859   RMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRN  680
             R+ P LP  YFGN I       V+G+I+S+P    AS I D +  +  +Y+  A+D+   
Sbjct  288   RLRPSLPPGYFGNVIFTTTPMAVAGDIVSKPTYYAASVIHDTLGRMDDDYLRSALDYLEL  347

Query  679   EGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGP  503
             + D+      G      PN+ + +W  LP H  D GWG+ I M PG    +G   ILP  
Sbjct  348   QPDLTALVR-GAHTFRCPNIGITSWSRLPIHDADFGWGRPIFMGPGGIAYEGLAFILPSS  406

Query  502   NGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                   DGSL VA  LQ DH+  F K  YE
Sbjct  407   T----KDGSLSVALGLQPDHMVRFEKMLYE  432



>dbj|BAA87043.1| N-hydroxycinnamoyl/benzoyltransferase [Ipomoea batatas]
 dbj|BAJ14795.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Ipomoea 
batatas]
Length=431

 Score =   260 bits (664),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 165/451 (37%), Positives = 237/451 (53%), Gaps = 43/451 (10%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHS-LRLSLSQVLVHF  1565
             +VKP++PT +  L  S LD I   +++  +YFY      SP+      ++ +LS VLV F
Sbjct  15    MVKPAKPTPAKRLWNSNLDLIVGRIHLLTVYFYRPNG--SPNFFDSKVMKEALSNVLVSF  72

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL+              +CN  G + VEAESDA + D GDF+P  E    +P+VD
Sbjct  73    YPMAGRLARDGEGRIEI-----DCNEEGVLFVEAESDACVDDFGDFTPSLELRKFIPTVD  127

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
              SG   I   PL   Q+T+F+CGG+ LG  + H ++DG    HF+  W+++A G  ++  
Sbjct  128   TSG--DISSFPLIIFQVTRFKCGGVCLGTGVFHTLSDGVSSLHFINTWSDMARGLSVAIP  185

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHS----PPLIIGQSSNESERMKETKVSTLRLSK  1037
             PF DR LLRA +  + +        F HS    PP +  +S  ES+R      + L+++ 
Sbjct  186   PFIDRTLLRARDPPTPA--------FEHSEYDQPPKL--KSVPESKRGSSASTTMLKITP  235

Query  1036  PQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRR  857
              Q+  LK          +K  G T YE++ AHIWRCACKAR     Q T L    D R R
Sbjct  236   EQLALLKT--------KSKHEGST-YEILAAHIWRCACKARGLTDDQATKLYVATDGRSR  286

Query  856   MEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  677
             + PPLP  Y GN +        SGE+ S PL + A +I  A+  +  EY+  A+DF   +
Sbjct  287   LCPPLPPGYLGNVVFTATPMAESGELQSEPLTNSAKRIHSALSRMDDEYLRSALDFLECQ  346

Query  676   GDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC---DGDVLILPG  506
              D+ K    G+ +  +PNL++ +W  LP H  D GWG+ IHM P   C   +G V ILP 
Sbjct  347   PDLSKLIR-GSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPA--CILYEGTVYILPS  403

Query  505   PNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
             PN     D +L +A CL  +H+  F ++ Y+
Sbjct  404   PN----KDRTLSLAVCLDAEHMPLFKEFLYD  430



>ref|XP_011082506.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=432

 Score =   260 bits (664),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 161/444 (36%), Positives = 229/444 (52%), Gaps = 23/444 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+  T    L  S +D +    +   +YFY  P+          L+ +L + LV FY
Sbjct  10    LVRPAAATPMVSLWNSNIDLVVPNFHTPSVYFYR-PTAADNFFDAGVLKAALGRALVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               +CN  G + VEAESD V+ D GDF+P  E   L+P+VDY
Sbjct  69    PMAGRLKRDEDGRVEI-----DCNAEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  L+  P
Sbjct  124   S--QGISTYPLLVLQVTHFKCGGVSLGVGMQHHVADGFSGLHFINTWSDMARGLDLTIPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LLRA +      PQ   +   + P   +   +++     ET VS  +L++ Q++A
Sbjct  182   FIDRTLLRARDP-----PQPQFKHIEYQPAPAMKTLASKDAEAPETAVSIFKLTRDQLNA  236

Query  1021  LKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPL  842
             LKA    G +       Y+ YE++  H+WR  C AR     Q T L    D R R++PPL
Sbjct  237   LKAKSKEGGNTVT----YSSYEMLAGHVWRSVCMARGLPEDQDTKLYIATDGRSRLQPPL  292

Query  841   PDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  662
             P  YFGN I       VSG++ S+P+   ASKI DA+  + ++Y+  A+D+   + D +K
Sbjct  293   PPGYFGNVIFTATPIAVSGDLTSKPVWYAASKIHDALARMDNDYLRSALDYLELQPD-LK  351

Query  661   RQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDGD  485
                 G      PNL + +WV LP H  D GWG+ I M PG    +G   +LP P     +
Sbjct  352   ALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSPT----N  407

Query  484   DGSLLVAACLQVDHIQDFNKYFYE  413
             DGSL VA  LQ +H++ F K  Y+
Sbjct  408   DGSLSVAISLQAEHMKLFEKLLYD  431



>gb|ABO40491.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea arabica]
Length=434

 Score =   260 bits (664),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 163/445 (37%), Positives = 234/445 (53%), Gaps = 23/445 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT-TPSTLSPDAIIHSLRLSLSQVLVHF  1565
             +V+P+  T    L  S +D +    +   +YFY  T S+   DA +  L+ +LS+ LV F
Sbjct  10    MVRPAHETPRRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKV--LKDALSRALVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL                CNG G + VEAESD V+ D GDF+P  E   L+P+VD
Sbjct  68    YPMAGRLKRDEDGRIEI-----ECNGEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVD  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS    I    L   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  ++  
Sbjct  123   YS--QGISSYALLVLQVTYFKCGGVSLGVGMQHHAADGFSGLHFINSWSDMARGLDVTLP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             PF DR LLRA +      PQ     +   P L +   + +S+ + ET VS  +L++ QI 
Sbjct  181   PFIDRTLLRARDPPQ---PQFQHIEYQPPPTLKVSPQTAKSDSVPETAVSIFKLTREQIS  237

Query  1024  ALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP  845
             ALKA        +     Y+ YE++  H+WRCACKAR  +  Q T L    D R R+ P 
Sbjct  238   ALKAKSKE----DGNTISYSSYEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPS  293

Query  844   LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  665
             LP  YFGN I    +  ++G++  +P+   ASKI DA+  + ++Y+  A+D+   + D +
Sbjct  294   LPPGYFGNVIFTATLIAIAGDLEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPD-L  352

Query  664   KRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDG  488
             K    G      PNL + +WV LP H  D GWG+ I M PG    +G   ILP P     
Sbjct  353   KALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----  408

Query  487   DDGSLLVAACLQVDHIQDFNKYFYE  413
             +DGS+ VA  LQ +H++ F  + Y+
Sbjct  409   NDGSMSVAISLQGEHMKLFQSFLYD  433



>gb|ABR17170.1| unknown [Picea sitchensis]
Length=433

 Score =   259 bits (663),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 168/446 (38%), Positives = 232/446 (52%), Gaps = 26/446 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAI-IHSLRLSLSQVLVHF  1565
             +V+P+ PT    L  S +D +   ++   +YFY  PS  SPD   +H LR +LS+VLV F
Sbjct  10    MVRPAAPTPQRDLWNSNVDLVVPRIHTASVYFYR-PSG-SPDFFSMHILRDALSKVLVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               NCNG G +LVEA +D+V+ D GDF+P  E   L+P V+
Sbjct  68    YPMAGRLKRDPDGRIEI-----NCNGEGVLLVEATTDSVIDDFGDFAPTMELKQLIPKVN  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS  + I    L   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  ++  
Sbjct  123   YS--EDISSYALLVLQVTFFKCGGVSLGVGMQHHVADGYAGLHFINTWSDVARGLDIALP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             PF DR LLRA    +       + I +  PP +   S   +    +  V+  +L+K Q+ 
Sbjct  181   PFIDRTLLRARNPPTPKF----QHIEYQQPPPLKDTSGIMNGEKNDFSVAIFKLTKEQLD  236

Query  1024  ALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
              LK  A  NG   +     Y+ YE+++ HIWRCACKAR+    Q T L    D R R+ P
Sbjct  237   ILKGKARENGNKVS-----YSSYEMLSGHIWRCACKARNLTEDQGTKLYIATDGRSRLRP  291

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
              LP  YFGN I       V+G+I+S+P    AS I +A+  +  EY+  A+D+   + D+
Sbjct  292   SLPPGYFGNVIFTTTPMAVAGDIVSKPTYYAASVIHEALGRMDDEYLRSALDYLELQPDL  351

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGID  491
                   G      PN+ + +W  LP H  D GWG+ I M PG    +G   ILP      
Sbjct  352   TALVR-GAHTFRCPNIGITSWSRLPIHDADFGWGRPIFMGPGGIAYEGLAFILPS----S  406

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
               DGSL VA  LQ DH+  F K  YE
Sbjct  407   AKDGSLSVALGLQPDHMVRFEKMLYE  432



>gb|EPS64937.1| hypothetical protein M569_09840, partial [Genlisea aurea]
Length=423

 Score =   259 bits (662),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 167/454 (37%), Positives = 238/454 (52%), Gaps = 47/454 (10%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V+P+EPT SG++ L+  DQI  + +   +YFY        DAI   LR SL++ LV FY
Sbjct  8     TVRPAEPTPSGVMYLNASDQIKDISHTPTIYFYRKGDG---DAI-SRLRESLAKALVLFY  63

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL+W          L   CN  G  ++EAE++  +  + DF+P       +P++DY
Sbjct  64    PLAGRLAWAPQGGSRVELL---CNAEGVAVLEAETEDTIDGMEDFTPTTAIEAFIPAMDY  120

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             +   PI  IPL A QLT+F CGG+SLG  I HV+ADG    HF+  WA +A G      P
Sbjct  121   TA--PIETIPLVAAQLTRFGCGGVSLGLGICHVMADGPSALHFVDVWAKVARGDGTIEPP  178

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR++L    +++   P   R      PP +IG   N+ ++ K   V+ L L+K QI  
Sbjct  179   FLDRKVLDL-PATTKFDPSVLR-----PPPTLIGLEDNQEQKKKPITVALLNLTKLQIQK  232

Query  1021  LKAADNNGRSC--NAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
             L+   N       ++  RGYTR+E +T                    L F  D R +++P
Sbjct  233   LREKANLDLPLPRDSGGRGYTRFEALTC-------------------LHFVADFRNKLQP  273

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP +YFGNA+I V     SG+++S  +   A KIR++++ V  E V   ++F +   DV
Sbjct  274   PLPHNYFGNALIRVESQDKSGQLLSSSVGTAAKKIRESVEKVRDETVRAYLEFLKGLPDV  333

Query  667   IKRQELGTF------FVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLILP  509
              + + L T       F GNPNL +I+W  L  +G D GWGKEIHM PG    DG   ++P
Sbjct  334   GRFRSLDTRGIPKGDFYGNPNLVIISWTALALYGADFGWGKEIHMGPGSMGFDGKTFLIP  393

Query  508   GPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
               +G    DGSL V   LQ +H+  F K  Y++I
Sbjct  394   SQSG----DGSLNVVIWLQEEHMPAFKKLLYDEI  423



>dbj|BAJ14794.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Ipomoea batatas]
Length=431

 Score =   259 bits (662),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 165/444 (37%), Positives = 231/444 (52%), Gaps = 24/444 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+E T    L  S +D +    +   +YFY  P+         +L+  LS+ LV FY
Sbjct  10    MVRPAEETPRIRLWNSNVDLVVPNFHTPSVYFYR-PNGADDFFESKALKDGLSRALVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL+              +CNG G +LVEAESD  + D GDF+P  E   L+P+VDY
Sbjct  69    PMAGRLTRDEDGRIEI-----DCNGAGVLLVEAESDGFVDDFGDFAPTLELRQLIPTVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S    I   PL   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  L+  P
Sbjct  124   S--QGIESYPLLVLQVTHFKCGGVSLGVGMQHHAADGASGLHFINTWSDMARGLDLTVPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LLRA E      PQ     +   P L   Q  N +    +T VS  +LS+ QI A
Sbjct  182   FIDRTLLRAREPPQ---PQFQHVEYQPPPALKAPQPQNVT---SDTAVSIFKLSRDQISA  235

Query  1021  LKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPL  842
             LKA      +  A    Y+ YE++  H+WRCAC+AR     Q T L    D R R+ P L
Sbjct  236   LKAKSKEDGNTVA----YSSYEMLAGHVWRCACRARGLTEDQETKLYIATDGRSRLRPSL  291

Query  841   PDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  662
             P  YFGN I       V+G++ S+P+   ASKI  A+  + ++Y+  A+D+   + D +K
Sbjct  292   PTGYFGNVIFTATPIAVAGDLQSKPVWFAASKIHGALGRMDNDYLRSALDYLELQPD-LK  350

Query  661   RQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDGD  485
                 G      PNL + +WV LP H  D GWG+ I M PG    +G   +LP P     +
Sbjct  351   ALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFMLPSPE----N  406

Query  484   DGSLLVAACLQVDHIQDFNKYFYE  413
             DGSL +A  LQ +H++ F ++ Y+
Sbjct  407   DGSLSIAISLQEEHMKLFKEFLYD  430



>pdb|4G2M|A Chain A, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 2)
Length=439

 Score =   259 bits (663),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 163/445 (37%), Positives = 233/445 (52%), Gaps = 23/445 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT-TPSTLSPDAIIHSLRLSLSQVLVHF  1565
             +V+P++ T    L  S +D +    +   +YFY  T S+   DA +  L+ +LS+ LV F
Sbjct  15    MVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKV--LKDALSRALVPF  72

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL                CNG G + VEAESD V+ D GDF+P  E   L+P+VD
Sbjct  73    YPMAGRLKRDEDGRIEI-----ECNGEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVD  127

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS    I    L   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  ++  
Sbjct  128   YS--QGISSYALLVLQVTYFKCGGVSLGVGMRHHAADGFSGLHFINSWSDMARGLDVTLP  185

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             PF DR LLRA +      PQ     +   P L +   +  S+ + ET VS  +L++ QI 
Sbjct  186   PFIDRTLLRARDPPQ---PQFQHIEYQPPPALAVSPQTAASDSVPETAVSIFKLTREQIS  242

Query  1024  ALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP  845
             ALKA        +     Y+ YE++  H+WRCACKAR  +  Q T L    D R R+ P 
Sbjct  243   ALKAKSKE----DGNTISYSSYEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPS  298

Query  844   LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  665
             LP  YFGN I       ++G++  +P+   ASKI DA+  + ++Y+  A+D+   + D +
Sbjct  299   LPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPD-L  357

Query  664   KRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDG  488
             K    G      PNL + +WV LP H  D GWG+ I M PG    +G   ILP P     
Sbjct  358   KALVRGAHTFKXPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----  413

Query  487   DDGSLLVAACLQVDHIQDFNKYFYE  413
             +DGS+ VA  LQ +H++ F  + Y+
Sbjct  414   NDGSMSVAISLQGEHMKLFQSFLYD  438



>ref|XP_006343633.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Solanum tuberosum]
Length=435

 Score =   259 bits (662),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 162/446 (36%), Positives = 232/446 (52%), Gaps = 30/446 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +VKPS+PT +  +  S LD I   +++  +YFY  P+  S       ++ +LS VLV FY
Sbjct  16    LVKPSKPTPTKRIWSSNLDLIVGRIHLLTVYFYK-PNGSSSFFDNKVMKEALSNVLVSFY  74

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL+              NCNG G + VEAESD+ + D GDF+P  E   L+PSV+ 
Sbjct  75    PMAGRLARDEQGRIEV-----NCNGEGVLFVEAESDSCIDDFGDFTPCLELKKLIPSVET  129

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T+F+CGGI+LG  + H ++DG    HF+  W+++A G  ++  P
Sbjct  130   SG--DISTFPLAIFQVTRFKCGGIALGGGVFHTLSDGLSSLHFINTWSDIARGLSVAVPP  187

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LL A +  +SS       + +H PP +I     ES   K +  + L+ S  Q+  
Sbjct  188   FIDRTLLHARDPPTSSF----EHVEYHPPPTLISSKKGESTGPKSSTTAMLKFSSEQVGL  243

Query  1021  LKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPL  842
             LK+   N  S          YE++ AHIWRC  KAR     Q T L    D R R+ PPL
Sbjct  244   LKSKSENEGST---------YEILAAHIWRCTSKARGLADDQLTKLHVATDGRSRLCPPL  294

Query  841   PDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  662
             P  Y GN +        S E+ S PL++   +I + +  +   Y+  A+D+   + D+  
Sbjct  295   PPGYLGNVVFTATPIAKSCELQSEPLRNSVKRIHNELIKMDDNYLRSALDYLELQPDLST  354

Query  661   RQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC---DGDVLILPGPNGID  491
                  T+F  +PNL++ +W  LP H  D GWG+ IHM P   C   +G + I+P PN   
Sbjct  355   LIRGPTYFT-SPNLNINSWTRLPVHECDFGWGRPIHMGPA--CILYEGTIYIIPSPN---  408

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
               D +L +A CL  DH+  F KY YE
Sbjct  409   TKDRNLRLAVCLDPDHMPLFEKYLYE  434



>gb|ADG46003.1| hydroxycinnamoyl transferase [Salvia miltiorrhiza]
Length=427

 Score =   259 bits (662),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 168/445 (38%), Positives = 236/445 (53%), Gaps = 30/445 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+PS  T +  L  S +D +    +   +YFY  PS  +      +++ +L + LV FY
Sbjct  10    LVRPSAATPAVNLWNSNVDLVVPNFHTPSVYFYR-PSGAAGFFDTAAMKAALGRALVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               NCN  G + VEAESD  + D GDF+P  E   L+P+VDY
Sbjct  69    PMAGRLKRDEDGRIEI-----NCNAEGVLFVEAESDGSVDDYGDFAPTLELRRLIPAVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  ++  P
Sbjct  124   S--QEISAYPLLVLQVTFFKCGGVSLGVGMQHHVADGFSGPHFINTWSDMARGLDITLEP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LLRA +      PQ  + I +  PP +  ++  E+E    T VS  +L++ Q+  
Sbjct  182   FIDRTLLRARDPPE---PQF-KHIEYQPPPAM--KTYGEAE----TLVSIFKLTREQLTT  231

Query  1021  LKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP  845
             LKA + ++G +       Y+ YE++  HIWRCAC AR     Q T L    D R R++PP
Sbjct  232   LKAKSKDDGNTVT-----YSSYEMLAGHIWRCACLARGLPEDQSTKLYIATDGRFRLQPP  286

Query  844   LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  665
             LP  YFGN I       V+G++ S+P    ASKI DA+  + +EY+  A+D+   + D +
Sbjct  287   LPPGYFGNVIFTATPMAVAGDLESKPAWYGASKIHDALARMDNEYLRSALDYLELQPD-L  345

Query  664   KRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDG  488
             K    G      PNL + +WV LP H  D GWG+ I M PG    +G   +LP P     
Sbjct  346   KALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSP----A  401

Query  487   DDGSLLVAACLQVDHIQDFNKYFYE  413
             +DGSL VA  LQ DH++ F K  YE
Sbjct  402   NDGSLSVAISLQADHMKVFEKLLYE  426



>gb|ABK79689.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. scolymus]
Length=434

 Score =   259 bits (662),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 159/446 (36%), Positives = 233/446 (52%), Gaps = 25/446 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +VKPS+PT +  L  S LD +   +++  +YFY  P+  S       L+ +L+ VLV F+
Sbjct  10    MVKPSKPTPNQRLWNSNLDLVVGRIHILTVYFYR-PNGSSNFFDSGVLKKALADVLVSFF  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               NCNG G + VEAE+D  + D G+ +P PE   L P+VDY
Sbjct  69    PMAGRLGNDGDGRVEI-----NCNGEGVLFVEAEADCSIDDFGEITPSPELRKLAPTVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S  D +   PL   Q+T+F CGG+SLG  + H ++DG    HF+  W++ A G  ++  P
Sbjct  124   S--DQVSSYPLCITQVTRFNCGGVSLGCGLHHTLSDGLSSLHFINTWSDKARGLSVAIPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNE--SERMKETKVSTLRLSKPQI  1028
             F DR LLRA +  ++        + +HSPP +I  S N+  +   K    + LRL+  QI
Sbjct  182   FIDRSLLRARDPPTAMF----EHLEYHSPPSLIAPSQNQNFTSHPKLASTAMLRLTLDQI  237

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
             + LK+      S       ++ YE++ AH+WRCAC+AR     QPT L    D R R+ P
Sbjct  238   NGLKSKAKGDGSVY-----HSTYEILAAHLWRCACEARGLSDDQPTKLYVATDGRSRLNP  292

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  Y GN +        SGE  S  L D A +I   +  +  +Y+  AID+   + D+
Sbjct  293   PLPPGYLGNVVFTATPIAKSGEFKSESLADTARRIHSELAKMDDQYLRSAIDYLELQPDL  352

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGID  491
                    T+F  +PNL++ +W  LP +  D GWG+ I M P     +G + I+P P+G  
Sbjct  353   TALVRGPTYF-ASPNLNINSWTRLPIYESDFGWGRPIFMGPASILYEGTIYIIPSPSG--  409

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
               D S+ +A CL  DH+  F K  Y+
Sbjct  410   --DRSVSLAVCLDPDHMSLFRKCLYD  433



>ref|XP_002512739.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF49242.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=431

 Score =   259 bits (661),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 167/448 (37%), Positives = 232/448 (52%), Gaps = 32/448 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT---TPSTLSPDAIIHSLRLSLSQVLV  1571
             +V PSE T    L  S +D +    +   +YFY      +   PD     L+ +L + LV
Sbjct  10    LVPPSEETPRVGLWNSNVDLVVPRFHTPSVYFYRPTGASNFFDPDV----LKAALGKALV  65

Query  1570  HFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPS  1391
              FYP AGRL               +CN  G +LV AE++AV+ D GDF+P  E   L+P+
Sbjct  66    PFYPMAGRLRRDEDGRIEI-----DCNAEGVLLVVAETNAVVDDFGDFAPTLELKQLIPT  120

Query  1390  VDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLS  1211
             VDYSG   I   PL   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G   +
Sbjct  121   VDYSG--GISTFPLLVLQVTHFKCGGVSLGVGMQHHAADGFSGLHFVNTWSDMARGLDCT  178

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
               PF DR LLRA +      PQ       + PP  + ++S E+ +   T VS  +LS+ Q
Sbjct  179   IPPFIDRTLLRARDP-----PQPQFNHIEYQPPPAL-KASAETLKPDSTTVSIFKLSRDQ  232

Query  1030  IHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
             ++ LKA A  +G + N     Y+ Y ++  H+WR ACKAR     Q T L    D R R+
Sbjct  233   LNILKAKAKEDGNTIN-----YSSYAMLAGHVWRSACKARGLTDDQETKLYIATDGRSRL  287

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
              PPLP  YFGN I       V+G++ S+P    A KI DA+  + ++Y+  A+DF   + 
Sbjct  288   NPPLPPGYFGNVIFTATPIAVAGDLESKPTWYAAGKIHDALARMDNDYLRSALDFLELQP  347

Query  673   DVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNG  497
             D+      G      PNL + +WV LP H  D GWG+ I M PG    +G   ILP P  
Sbjct  348   DLSALVR-GAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT-  405

Query  496   IDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                +DGSL VA  LQ +H++ F K+ YE
Sbjct  406   ---NDGSLSVAIALQSEHMKLFEKFIYE  430



>ref|XP_010244666.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010244671.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score =   259 bits (662),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 161/449 (36%), Positives = 231/449 (51%), Gaps = 33/449 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V P+EPT    L +S  DQ+    ++  +YF+T+  +      +H L+ +LS+VLV FY
Sbjct  18    TVGPAEPTPERTLWISNADQLVRRAHIPTVYFFTSDGSTG-FFNLHLLKQALSKVLVPFY  76

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL+              NCNG G + VEAE+++V+ D GDF+P P    L+P+VDY
Sbjct  77    PTAGRLNRNDQDGRLEI----NCNGEGVLFVEAETNSVIDDFGDFTPSPVLRQLIPAVDY  132

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S    I   PL   Q+T+FRCGG+ LG  + H + DG    HF+  W+++A G      P
Sbjct  133   S--KDISSYPLLLLQVTRFRCGGVCLGVGMHHSLVDGTSDIHFINSWSDMARGLQPKIPP  190

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQSSNESERMKETKVSTLRLSKP  1034
             F DR  LRA         Q    +FHH     PP I    S       +  V+  +++  
Sbjct  191   FLDRSSLRAR--------QPPTPMFHHIEFLPPPSIKTPKSQSGP--TDVAVAKFKITVD  240

Query  1033  QIHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRR  857
             QI+ LK  A  N  + N     Y+ Y V+  H+WRC  KAR  +  Q TNL   VD R R
Sbjct  241   QINTLKTNAKENDNTLN-----YSTYAVLAGHVWRCVSKARGLRDDQDTNLFITVDGRSR  295

Query  856   MEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  677
             + PPLP  YFGN I+    + + GE+ S+PL     ++ D +  +  EYV  AID+   +
Sbjct  296   LRPPLPPGYFGNGILLTTSNALCGELRSKPLGYAVGRVHDVVTRMNDEYVRSAIDYLELQ  355

Query  676   GDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPG-HDCDGDVLILPGPN  500
              D+      G     +PN  +++W  LP +  D GWG+ IH+ P     +G   ILP P 
Sbjct  356   PDLTPFVR-GPHMFRSPNFWMVSWARLPLYDADFGWGRPIHVGPAVVYSEGLSYILPSPT  414

Query  499   GIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                 +DGS+L+A  LQ DH++ F K  Y+
Sbjct  415   ----NDGSVLLAISLQSDHMEVFRKILYD  439



>pdb|4G0B|A Chain A, Structure Of Native Hct From Coffea Canephora
 pdb|4G0B|B Chain B, Structure Of Native Hct From Coffea Canephora
Length=436

 Score =   259 bits (661),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 163/445 (37%), Positives = 234/445 (53%), Gaps = 23/445 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT-TPSTLSPDAIIHSLRLSLSQVLVHF  1565
             +V+P++ T    L  S +D +    +   +YFY  T S+   DA +  L+ +LS+ LV F
Sbjct  12    MVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKV--LKDALSRALVPF  69

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL                CNG G + VEAESD V+ D GDF+P  E   L+P+VD
Sbjct  70    YPMAGRLKRDEDGRIEI-----ECNGEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVD  124

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS    I    L   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  ++  
Sbjct  125   YS--QGISSYALLVLQVTYFKCGGVSLGVGMRHHAADGFSGLHFINSWSDMARGLDVTLP  182

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             PF DR LLRA +      PQ     +   P L +   + +S+ + ET VS  +L++ QI 
Sbjct  183   PFIDRTLLRARDPPQ---PQFQHIEYQPPPALKVSPQTAKSDSVPETAVSIFKLTREQIS  239

Query  1024  ALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP  845
             ALKA        +     Y+ YE++  H+WRCACKAR  +  Q T L    D R R+ P 
Sbjct  240   ALKAKSKE----DGNTISYSSYEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPS  295

Query  844   LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  665
             LP  YFGN I       ++G++  +P+   ASKI DA+  + ++Y+  A+D+   + D +
Sbjct  296   LPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPD-L  354

Query  664   KRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDG  488
             K    G      PNL + +WV LP H  D GWG+ I M PG    +G   ILP P     
Sbjct  355   KALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----  410

Query  487   DDGSLLVAACLQVDHIQDFNKYFYE  413
             +DGS+ VA  LQ +H++ F  + Y+
Sbjct  411   NDGSMSVAISLQGEHMKLFQSFLYD  435



>emb|CDO98242.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   259 bits (661),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 163/445 (37%), Positives = 234/445 (53%), Gaps = 23/445 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT-TPSTLSPDAIIHSLRLSLSQVLVHF  1565
             +V+P++ T    L  S +D +    +   +YFY  T S+   DA +  L+ +LS+ LV F
Sbjct  10    MVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKV--LKDALSRALVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL                CNG G + VEAESD V+ D GDF+P  E   L+P+VD
Sbjct  68    YPMAGRLKRDEDGRIEI-----ECNGEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVD  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS    I    L   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  ++  
Sbjct  123   YS--QGISSYALLVLQVTYFKCGGVSLGVGMQHHAADGFSGLHFINSWSDMARGLDVTLP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             PF DR LLRA +      PQ     +   P L +   + +S+ + ET VS  +L++ QI 
Sbjct  181   PFIDRTLLRARDPPQ---PQFQHIEYQPPPALKVSPQTAKSDSVPETAVSIFKLTREQIS  237

Query  1024  ALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP  845
             ALKA        +     Y+ YE++  H+WRCACKAR  +  Q T L    D R R+ P 
Sbjct  238   ALKAKSKE----DGNTISYSSYEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPS  293

Query  844   LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  665
             LP  YFGN I       ++G++  +P+   ASKI DA+  + ++Y+  A+D+   + D +
Sbjct  294   LPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPD-L  352

Query  664   KRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDG  488
             K    G      PNL + +WV LP H  D GWG+ I M PG    +G   ILP P     
Sbjct  353   KALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----  408

Query  487   DDGSLLVAACLQVDHIQDFNKYFYE  413
             +DGS+ VA  LQ +H++ F  + Y+
Sbjct  409   NDGSMSVAISLQGEHMKLFQSFLYD  433



>emb|CCC55431.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Pinus pinaster]
Length=433

 Score =   259 bits (661),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 165/446 (37%), Positives = 233/446 (52%), Gaps = 26/446 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAI-IHSLRLSLSQVLVHF  1565
             +V+P+ PT    L  S +D +   ++   +YFY    T SPD   ++ LR +LS++LV F
Sbjct  10    MVRPAAPTPQRDLWNSNVDLVVPRIHTASVYFYR--PTGSPDFFSMNILRDALSKLLVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               NCNG G +LVEA +D+V+ D GDF+P  E   L+P V+
Sbjct  68    YPMAGRLKRDPDGRIEI-----NCNGEGVLLVEAITDSVIDDFGDFAPTMELKQLIPKVN  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS  + I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  ++  
Sbjct  123   YS--EDISSYPLLVLQVTFFKCGGVSLGVGMQHHVADGYAGIHFINTWSDVARGLDITLP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             PF DR LLRA    +       + I +  PP +   S   +       V+  +L+K Q+ 
Sbjct  181   PFIDRTLLRARNPPTPKF----QHIEYQQPPPLKDTSGIMNGEKNGFSVAIFKLTKEQLE  236

Query  1024  ALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
              LK  A  NG +       Y+ YE+++ HIWRCACKAR+    Q T L    D R R+ P
Sbjct  237   ILKGKARENGNNI-----AYSSYEMLSGHIWRCACKARNLAEDQETKLYIATDGRNRLRP  291

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
              +P  YFGN I       V+G+IIS+P    AS I +A+  +  EY+  A+D+   + D+
Sbjct  292   SIPPGYFGNVIFTTTPMAVAGDIISKPTYYAASVIHEALGRMDDEYLRSALDYLELQPDL  351

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGID  491
                   G+     PN+ + +W  LP H  D GWG+ I M PG    +G   +LP      
Sbjct  352   TALVR-GSHTFRCPNIGITSWSRLPIHDADFGWGRPIFMGPGGIAYEGLAFVLPS----S  406

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
              +DGSL VA  LQ DH+  F K  YE
Sbjct  407   ANDGSLSVALGLQPDHMARFAKMLYE  432



>ref|XP_011018051.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
 ref|XP_011018052.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=440

 Score =   259 bits (662),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 152/449 (34%), Positives = 230/449 (51%), Gaps = 31/449 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V P++ T +  L ++ LD      +V +L+ Y  P+  S    +  L+ +LS+VLV FY
Sbjct  10    MVLPNQDTPNHRLEVTNLDLFHAKYHVPLLFLYK-PNGSSNFFEVKGLKEALSKVLVSFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL+              NCNG G + +EAE+D+ + D  DF P  E   L+P+VD 
Sbjct  69    PVAGRLARDANGRIEI-----NCNGEGVLFIEAETDSAMGDFADFKPSDELRQLIPTVDS  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S    I   PL   Q+T+F CGG+ LG    H +ADG G  HF+  W+++A G  + + P
Sbjct  124   SD---IFSYPLLVLQVTRFTCGGVCLGVGWHHTLADGTGCLHFITTWSDIARGLTVKTPP  180

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSP----PLIIGQSSNESERM--KETKVSTLRLS  1040
             F DR +LR         P      FHH      P I     N   +   ++  V+ L++ 
Sbjct  181   FIDRTILRG------RVPPNP--TFHHVEYDPFPTINTPFQNPIRQSGSRDISVANLKIP  232

Query  1039  KPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
             +  ++ LKA   N  +   +   Y+ Y ++TAHIWRCACKAR     Q T ++   + R 
Sbjct  233   RDLLNTLKAMAKNDTASKTE---YSTYVILTAHIWRCACKARGLSYDQATKINISTNGRN  289

Query  859   RMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRN  680
             R+ PP+P  YFGN I       +SG++ S  L  +A +I  AI  +  EY+  A+D+   
Sbjct  290   RLRPPIPPGYFGNVIFQATPIALSGDLSSERLAHIAERIHKAIKRMDDEYLRSAVDYLEK  349

Query  679   EGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDCDGDVLILPGPN  500
               D+         +  +PNL++++WV  P +  D GWGK ++M P    +G   ILP P 
Sbjct  350   VDDLTTVMRSSETY-RSPNLNIVSWVRFPFYDADFGWGKPVYMRPAFAFEGKGYILPSPT  408

Query  499   GIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                 +DG+L +  CL+ DH++ F K FYE
Sbjct  409   ----NDGTLSLTICLETDHLESFQKLFYE  433



>gb|ABO52899.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase [Pinus 
radiata]
Length=433

 Score =   259 bits (661),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 165/446 (37%), Positives = 233/446 (52%), Gaps = 26/446 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAI-IHSLRLSLSQVLVHF  1565
             +V+P+ PT    L  S +D +   ++   +YFY    T SPD   ++ LR +LS++LV F
Sbjct  10    MVRPAAPTPQRDLWNSNVDLVVPRIHTASVYFYR--PTGSPDFFSMNILRDALSKLLVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               NCNG G +LVEA +D+V+ D GDF+P  E   L+P V+
Sbjct  68    YPMAGRLKRDPDGRIEI-----NCNGEGVLLVEAITDSVIDDFGDFAPTMELKQLIPKVN  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS  + I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  ++  
Sbjct  123   YS--EDISSYPLLVLQVTFFKCGGVSLGVGMQHHVADGYAGIHFINTWSDVARGLDITLP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             PF DR LLRA    +       + I +  PP +   S   +    +  V+  +L+K Q+ 
Sbjct  181   PFIDRTLLRARNPPTPKF----QHIEYQQPPPLKDTSGIMNGEKTDISVAIFKLTKEQLE  236

Query  1024  ALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
              LK  A  NG +       Y+ YE+++ HIWRCACKAR+    Q T L    D R R+ P
Sbjct  237   ILKGKARENGNNI-----AYSSYEMLSGHIWRCACKARNLAEDQETKLYIATDGRNRLRP  291

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
              +P  YFGN I       V+G+IIS+P    AS I +A+  +  EY+  A+D+   + D+
Sbjct  292   SIPPGYFGNVIFTTTPMAVTGDIISKPTYYAASVIHEALGRMDDEYLRSALDYLELQPDL  351

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGID  491
                   G      PN+ + +W  LP H  D GWG+ I M PG    +G   +LP      
Sbjct  352   TALVR-GAHTFRCPNIGITSWSRLPIHDADFGWGRPIFMGPGGIAYEGLAFVLPS----S  406

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
              +DGSL VA  LQ DH+  F K  YE
Sbjct  407   VNDGSLSVALGLQPDHMVRFAKMLYE  432



>gb|ABO47805.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score =   259 bits (661),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 163/445 (37%), Positives = 234/445 (53%), Gaps = 23/445 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT-TPSTLSPDAIIHSLRLSLSQVLVHF  1565
             +V+P++ T    L  S +D +    +   +YFY  T S+   DA +  L+ +LS+ LV F
Sbjct  10    MVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKV--LKDALSRALVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL                CNG G + VEAESD V+ D GDF+P  E   L+P+VD
Sbjct  68    YPMAGRLKRDEDGRIEI-----ECNGEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVD  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS    I    L   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  ++  
Sbjct  123   YS--QGISSYALLVLQVTYFKCGGVSLGVGMRHHAADGFSGLHFINSWSDMARGLDVTLP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             PF DR LLRA +      PQ     +   P L +   + +S+ + ET VS  +L++ QI 
Sbjct  181   PFIDRTLLRARDPPQ---PQFQHIEYQPPPALKVSPQTAKSDSVPETAVSIFKLTREQIS  237

Query  1024  ALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP  845
             ALKA        +     Y+ YE++  H+WRCACKAR  +  Q T L    D R R+ P 
Sbjct  238   ALKAKSKE----DGNTISYSSYEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPS  293

Query  844   LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  665
             LP  YFGN I       ++G++  +P+   ASKI DA+  + ++Y+  A+D+   + D +
Sbjct  294   LPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPD-L  352

Query  664   KRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDG  488
             K    G      PNL + +WV LP H  D GWG+ I M PG    +G   ILP P     
Sbjct  353   KALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----  408

Query  487   DDGSLLVAACLQVDHIQDFNKYFYE  413
             +DGS+ VA  LQ +H++ F  + Y+
Sbjct  409   NDGSMSVAISLQGEHMKLFQSFLYD  433



>ref|XP_011018045.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018047.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
Length=430

 Score =   258 bits (660),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 163/449 (36%), Positives = 235/449 (52%), Gaps = 35/449 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+PS  T    L  S LD +  M +V+ +YFY  P+  S       L  +LS VLV FY
Sbjct  10    MVRPSRDTPKRSLWSSNLDLLVPMFHVQTVYFYK-PNGSSRFFETQVLTDALSDVLVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGR+    +          NCNG G + VEAE+     DLGDF+   +   LVP VDY
Sbjct  69    PAAGRMRKHESGRIEI-----NCNGEGVLFVEAETSCFADDLGDFTDSSKLLPLVPEVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             +G   I   PL   Q+T+F+CG +SLG  + H++ADG    HF+  W+++A G P+S+ P
Sbjct  124   AG--GISSFPLVVLQVTRFKCGAVSLGVGLHHILADGTSALHFINSWSDVARGLPVSTPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHS---PPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
             F DR LLRA +             FHHS   PP  +        +   TK+  L+++  Q
Sbjct  182   FIDRTLLRARDPPHP--------TFHHSEYDPPPTMNTPPRSQPKTTCTKI--LKITPEQ  231

Query  1030  IHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             + +LKA     R+ +   R ++ YE ITAHIWR  CKAR     Q + L    D R R+ 
Sbjct  232   LGSLKA---KVRTEDGAAR-HSTYETITAHIWRSMCKARGLSDDQASKLYISTDGRSRLN  287

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             P LP  Y GN +    + G+SGEI S+PL     +I +A+  +  EY+  A+D+   + D
Sbjct  288   PQLPPGYLGNVLFTTTVMGLSGEIQSKPLVRTMERIHEALGRMDDEYLRSALDYIEAQPD  347

Query  670   V--IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHD-CDGDVLILPGPN  500
             +  +KR   G     +PNL++++W+ LP H  D GWG+ + M P    C+G+  IL  P 
Sbjct  348   LNALKR---GPHTYASPNLNIVSWIRLPVHDADFGWGRPVFMGPARVFCEGNAYILRSPV  404

Query  499   GIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                 +DGSL +  CL+  H+  F K  Y+
Sbjct  405   ----NDGSLSLFICLEAQHMPLFEKCLYD  429



>ref|XP_011018044.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Populus euphratica]
Length=438

 Score =   259 bits (661),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 163/449 (36%), Positives = 235/449 (52%), Gaps = 35/449 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+PS  T    L  S LD +  M +V+ +YFY  P+  S       L  +LS VLV FY
Sbjct  18    MVRPSRDTPKRSLWSSNLDLLVPMFHVQTVYFYK-PNGSSRFFETQVLTDALSDVLVPFY  76

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGR+    +          NCNG G + VEAE+     DLGDF+   +   LVP VDY
Sbjct  77    PAAGRMRKHESGRIEI-----NCNGEGVLFVEAETSCFADDLGDFTDSSKLLPLVPEVDY  131

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             +G   I   PL   Q+T+F+CG +SLG  + H++ADG    HF+  W+++A G P+S+ P
Sbjct  132   AG--GISSFPLVVLQVTRFKCGAVSLGVGLHHILADGTSALHFINSWSDVARGLPVSTPP  189

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHS---PPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
             F DR LLRA +             FHHS   PP  +        +   TK+  L+++  Q
Sbjct  190   FIDRTLLRARDPPHP--------TFHHSEYDPPPTMNTPPRSQPKTTCTKI--LKITPEQ  239

Query  1030  IHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             + +LKA     R+ +   R ++ YE ITAHIWR  CKAR     Q + L    D R R+ 
Sbjct  240   LGSLKA---KVRTEDGAAR-HSTYETITAHIWRSMCKARGLSDDQASKLYISTDGRSRLN  295

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             P LP  Y GN +    + G+SGEI S+PL     +I +A+  +  EY+  A+D+   + D
Sbjct  296   PQLPPGYLGNVLFTTTVMGLSGEIQSKPLVRTMERIHEALGRMDDEYLRSALDYIEAQPD  355

Query  670   V--IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHD-CDGDVLILPGPN  500
             +  +KR   G     +PNL++++W+ LP H  D GWG+ + M P    C+G+  IL  P 
Sbjct  356   LNALKR---GPHTYASPNLNIVSWIRLPVHDADFGWGRPVFMGPARVFCEGNAYILRSPV  412

Query  499   GIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                 +DGSL +  CL+  H+  F K  Y+
Sbjct  413   ----NDGSLSLFICLEAQHMPLFEKCLYD  437



>gb|AGA20364.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Leucaena leucocephala]
Length=439

 Score =   258 bits (660),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 162/452 (36%), Positives = 234/452 (52%), Gaps = 32/452 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+E T    L  S +D +    +   +YFY  P+  +       ++ +L++ LV FY
Sbjct  10    MVRPAEETPRRALWNSNVDLVVPNFHTPSVYFYR-PTGAANFFDAEVMKQALAKALVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               +CNG G +LVEAE+  V+ D GDF+P  E   L+P+VDY
Sbjct  69    PMAGRLRRDEDGRVEI-----DCNGEGVLLVEAETIGVIDDFGDFAPTLELRQLIPAVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  L+  P
Sbjct  124   SGG--IETYPLLVLQVTYFKCGGVSLGVGMQHHAADGFSGLHFINTWSDMARGFDLTLPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKE-------TKVSTLRL  1043
             F DR LLRA +      PQ       + PP  +    N  +   +         VS  ++
Sbjct  182   FIDRTLLRARDP-----PQPVFEHIEYKPPPTMKSPQNPVQSPTKPGSDPNTATVSIFKM  236

Query  1042  SKPQIHALKAADNN-GRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDI  866
             ++ Q++ALKA     G + N     Y+ YE++  H+WR  CKAR+    Q T L    D 
Sbjct  237   TRAQLNALKAKSKEAGNTVN-----YSSYEMLAGHVWRSTCKARALPDDQETKLYIATDG  291

Query  865   RRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFY  686
             R R++PPLP  YFGN I       V+G+++S+P    AS+I +A+  + +EY+  A+DF 
Sbjct  292   RSRLQPPLPPGYFGNVIFTATPMAVAGDLMSKPTWFAASRIHNALSRMDNEYLRSALDFL  351

Query  685   RNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILP  509
               + D +K    G      PNL + +WV LP H  D GWG+ I M PG    +G   ILP
Sbjct  352   ELQPD-LKALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILP  410

Query  508   GPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                   G+DGSL VA  LQ +H++ F +  YE
Sbjct  411   S----SGNDGSLSVAIALQPEHMKVFKEVLYE  438



>emb|CAJ40778.1| hydroxycinnamoyl transferase [Coffea arabica]
Length=434

 Score =   258 bits (660),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 163/445 (37%), Positives = 234/445 (53%), Gaps = 23/445 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT-TPSTLSPDAIIHSLRLSLSQVLVHF  1565
             +V+P++ T    L  S +D +    +   +YFY  T S+   DA +  L+ +LS+ LV F
Sbjct  10    MVRPAQETPRRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKV--LKDALSRALVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL                CNG G + VEAESD V+ D GDF+P  E   L+P+VD
Sbjct  68    YPMAGRLKRDEDGRIEI-----ECNGEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVD  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS    I    L   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  ++  
Sbjct  123   YS--QGISSYALLVLQVTYFKCGGVSLGVGMQHHAADGFSGLHFINSWSDMARGLDVTLP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             PF DR LLRA +      PQ     +   P L +   + +S+ + ET VS  +L++ QI 
Sbjct  181   PFIDRTLLRARDPPQ---PQFQHIEYQPPPTLKVSPQTAKSDSVPETAVSIFKLTREQIS  237

Query  1024  ALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP  845
             ALKA        +     Y+ YE++  H+WRCACKAR  +  Q T L    D R R+ P 
Sbjct  238   ALKAKPKE----DGNTISYSSYEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPS  293

Query  844   LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  665
             LP  YFGN I       ++G++  +P+   ASKI DA+  + ++Y+  A+D+   + D +
Sbjct  294   LPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPD-L  352

Query  664   KRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDG  488
             K    G      PNL + +WV LP H  D GWG+ I M PG    +G   ILP P     
Sbjct  353   KALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----  408

Query  487   DDGSLLVAACLQVDHIQDFNKYFYE  413
             +DGS+ VA  LQ +H++ F  + Y+
Sbjct  409   NDGSMSVAISLQGEHMKLFQSFLYD  433



>ref|XP_002324534.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
 gb|EEF03099.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
Length=430

 Score =   258 bits (659),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 162/449 (36%), Positives = 238/449 (53%), Gaps = 35/449 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+PS  T +  L  S LD +  M +V+ +YFY  P+  S       L+ +LS VLV FY
Sbjct  10    MVRPSRETPNRSLWSSNLDLLVPMFHVQTVYFYK-PNGSSRFFETQVLKDALSDVLVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGR+    +          +CNG G + VEAE+   + DLGDF+   +   LVP VDY
Sbjct  69    PAAGRMGKHESGRTEI-----HCNGEGILFVEAETSCFIDDLGDFTDSSKLLPLVPEVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T F+CG +SLG  + H++ADG    HF+  W+++A G P+S+ P
Sbjct  124   SG--GISSFPLVVLQVTHFKCGAVSLGVGLHHILADGTSALHFINSWSDVARGLPVSTPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHH---SPPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
             F DR LLRA +  +          FHH    PP  +        +   TK+  L+++  Q
Sbjct  182   FIDRTLLRARDPPNP--------TFHHVEYDPPPTMNTPPQSQPKTTCTKI--LKITPEQ  231

Query  1030  IHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             + +LKA     R+ +  +R ++ YE ITAHIWR  CKAR     Q + L    D R R+ 
Sbjct  232   LGSLKA---KVRTEDGAVR-HSTYETITAHIWRSMCKARGLSDDQASKLYISTDGRSRLN  287

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             P LP  Y GN +    + G+SGEI S+PL     +I +A+  +  EY+  A+D+   + D
Sbjct  288   PQLPPGYLGNVLFTTTVMGLSGEIQSKPLARTMERIHEALVRMDDEYLRSALDYIEAQPD  347

Query  670   V--IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHD-CDGDVLILPGPN  500
             +  +KR   G     +PNL++++W+ LP H  D GWG+ + M P    C+G+  IL  P 
Sbjct  348   LNALKR---GPHTYASPNLNIVSWIRLPVHDADFGWGRPVFMGPARVFCEGNAYILRSPV  404

Query  499   GIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                 +DGSL +  CL+  H+  F K  Y+
Sbjct  405   ----NDGSLSLFICLEAQHMPLFEKCLYD  429



>gb|ABK79690.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. altilis]
Length=434

 Score =   258 bits (659),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 159/446 (36%), Positives = 233/446 (52%), Gaps = 25/446 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +VKPS+PT +  L  S LD +   +++  +YFY  P+  S       L+ +L+ VLV F+
Sbjct  10    MVKPSKPTPNQRLWNSNLDLVVGRIHILTVYFYR-PNGSSNFFDSGVLKKALADVLVSFF  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               NCNG G + VEAE+D  + D G+ +P PE   L P+VDY
Sbjct  69    PMAGRLGNDGDGRVEI-----NCNGEGVLFVEAEADCSIDDFGETTPSPELRKLAPTVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S  D +   PL   Q+T+F CGG+SLG  + H ++DG    HF+  W++ A G  ++  P
Sbjct  124   S--DQVSSYPLCITQVTRFNCGGVSLGCGLHHTLSDGLSSLHFINTWSDKARGLSVAIPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNE--SERMKETKVSTLRLSKPQI  1028
             F DR LLRA +  ++        + +HSPP +I  S N+  +   K    + LRL+  QI
Sbjct  182   FIDRSLLRARDPPTAMF----EHLEYHSPPSLIAPSQNQNFTSHPKLASTAMLRLTLDQI  237

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
             + LK+      S       ++ YE++ AH+WRCAC+AR     QPT L    D R R+ P
Sbjct  238   NGLKSKAKGDGSVY-----HSTYEILAAHLWRCACEARGLSDDQPTKLYVATDGRSRLNP  292

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  Y GN +        SGE  S  L D A +I   +  +  +Y+  AID+   + D+
Sbjct  293   PLPPGYLGNVVFKATPIAKSGEFKSESLADTARRIHSELAKMGDQYLRSAIDYLELQPDL  352

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGID  491
                    T+F  +PNL++ +W  LP +  D GWG+ I M P     +G + I+P P+G  
Sbjct  353   TALVRGPTYF-ASPNLNINSWTRLPIYESDFGWGRPIFMGPASILYEGTIYIIPSPSG--  409

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
               D S+ +A CL  DH+  F K  Y+
Sbjct  410   --DRSVSLAVCLDPDHMSLFRKCLYD  433



>gb|ABO77955.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score =   258 bits (659),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 163/445 (37%), Positives = 234/445 (53%), Gaps = 23/445 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT-TPSTLSPDAIIHSLRLSLSQVLVHF  1565
             +V+P++ T    L  S +D +    +   +YFY  T S+   DA +  L+ +LS+ LV F
Sbjct  10    MVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKV--LKDALSRALVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL                CNG G + VEAESD V+ D GDF+P  E   L+P+VD
Sbjct  68    YPMAGRLKRDEDGQIEI-----ECNGEGVLFVEAESDGVVDDFGDFAPTLEHRRLIPAVD  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS    I    L   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  ++  
Sbjct  123   YS--QGISSYALLVLQVTYFKCGGVSLGVGMQHHAADGFSGLHFINSWSDMARGLDVTLP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             PF DR LLRA +      PQ     +   P L +   + +S+ + ET VS  +L++ QI 
Sbjct  181   PFIDRTLLRARDPPQ---PQFQHIEYQPPPALKVSPQTAKSDSVPETAVSIFKLTREQIS  237

Query  1024  ALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP  845
             ALKA        +     Y+ YE++  H+WRCACKAR  +  Q T L    D R R+ P 
Sbjct  238   ALKAKSKE----DGNTISYSSYEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPS  293

Query  844   LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  665
             LP  YFGN I       ++G++  +P+   ASKI DA+  + ++Y+  A+D+   + D +
Sbjct  294   LPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPD-L  352

Query  664   KRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDG  488
             K    G      PNL + +WV LP H  D GWG+ I M PG    +G   ILP P     
Sbjct  353   KALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----  408

Query  487   DDGSLLVAACLQVDHIQDFNKYFYE  413
             +DGS+ VA  LQ +H++ F  + Y+
Sbjct  409   NDGSMSVAISLQGEHMKLFQSFLYD  433



>ref|XP_009760608.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
 ref|XP_009760609.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=432

 Score =   258 bits (658),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 163/445 (37%), Positives = 235/445 (53%), Gaps = 25/445 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +VKP+  T    L  S +D +    +   +YFY   S+ S     + L+ +LS+ LV FY
Sbjct  10    MVKPATDTPQTNLWNSNVDLVVPNFHTPSVYFYRPLSSASNFFDSNMLKEALSKALVPFY  69

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL                C G G + VEAESD ++ D GDF+P  +   L+P+VDY
Sbjct  70    PMAGRLKRDEDGRIEI-----ECIGQGVLFVEAESDGIVDDFGDFAPTLKLRRLIPAVDY  124

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S    I    L   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  L+  P
Sbjct  125   S--QGIHSYALLVLQITHFKCGGVSLGVGMQHHAADGFSGLHFINTWSDMARGLDLTIPP  182

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F +R LLRA +      P     I +  PP +  ++  ++E + ET VS  +L++ QI+A
Sbjct  183   FINRTLLRARDPPLPQFPH----IEYQPPPTL--KNIAKTEAVPETAVSIFKLTRDQINA  236

Query  1021  LKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP  845
             LKA +  +G + N     Y+ YE++  H+WR  C AR  +  Q + L    D R R+ P 
Sbjct  237   LKAKSKEDGNTVN-----YSSYEMLAGHVWRSTCMARGLEEDQGSKLYIATDGRSRLRPI  291

Query  844   LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  665
             LP  YFGN I       V+G++ S+P+   ASKI DA+  + ++Y+  A+D+   + D +
Sbjct  292   LPPGYFGNVIFTATPIAVAGDLKSKPIWYAASKIHDALAQMDNDYLRSALDYLELQPD-L  350

Query  664   KRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDG  488
             K    G      PNL + +WV LP H  D GWG+ I M PG    +G   ILP P     
Sbjct  351   KALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----  406

Query  487   DDGSLLVAACLQVDHIQDFNKYFYE  413
             +DGSL VA  LQ DH++ F KY Y+
Sbjct  407   NDGSLSVAISLQADHMKLFEKYLYD  431



>gb|KDP38697.1| hypothetical protein JCGZ_04050 [Jatropha curcas]
Length=424

 Score =   257 bits (657),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 158/450 (35%), Positives = 239/450 (53%), Gaps = 40/450 (9%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELD-QIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHF  1565
             ++ P++   +  L LS+LD  +       +LYFY + +       +  L+ +LS VLV F
Sbjct  1     MICPAQELPNQHLYLSKLDINLPQTSIHYMLYFYESNNNFFDGTKV--LKEALSNVLVQF  58

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               NCNG+G + +EAE+++ + +LGD     E   L+P VD
Sbjct  59    YPAAGRLGRDEKGRLQI-----NCNGDGVLFIEAETESAIHELGDSMLYEENRQLIPRVD  113

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             +S  D I   PLFA Q+TKFRCGG+SLG    + ++DG+   HF   W  +A G P+S  
Sbjct  114   HSKND-ISSFPLFALQVTKFRCGGLSLGMQWHYTLSDGRAYIHFAKTWCEIARGLPISHQ  172

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHS-----PPLIIGQSSNESERMKETKVSTLRLS  1040
             PF DR +LR        +   G+  F HS     PP+   Q++N        K    +++
Sbjct  173   PFIDRTILR--------NQVAGKPKFRHSEYDNLPPINPTQNNN-------AKTEIFKIT  217

Query  1039  KPQIHALKAA--DNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDI  866
               Q++ALK+   + N    N K + Y+ YE++TAHIWRC CKAR     Q T ++  VD 
Sbjct  218   VEQLNALKSKVQEENNNHGNGKTK-YSSYEILTAHIWRCTCKARGLSNDQATKINMAVDG  276

Query  865   RRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFY  686
             R R++PPLP  YFGNA+    +  +SGEIIS  L++   +IR AI+ +  E++   +D+ 
Sbjct  277   RSRLKPPLPSGYFGNAVFRASLTALSGEIISETLKETVERIRKAINRMDDEFLRSTMDYI  336

Query  685   RNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDCDGDVLILPG  506
                 D+   Q         PNL + +W+ +P + LD G GK +   P +  +G   ILP 
Sbjct  337   DGLDDISAIQNRC------PNLGITSWMRIPFYSLDFGMGKPLCFRPVNPVEGKGYILPT  390

Query  505   PNGIDGDDGSLLVAACLQVDHIQDFNKYFY  416
             P+  +  DGS  +   L+++H++ FNK FY
Sbjct  391   PS--NEIDGSWALIITLEINHMESFNKLFY  418



>ref|XP_010063590.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70827.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
 gb|KCW70828.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
 gb|KCW70829.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
Length=445

 Score =   258 bits (658),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 162/448 (36%), Positives = 232/448 (52%), Gaps = 30/448 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHS--LRLSLSQVLVH  1568
             +V+P+E T    L  + LD +   M+   +YFY    +   D    S  L+ +LS+ LV 
Sbjct  17    MVRPAEDTPRCTLWNANLDLVVPSMHTPSVYFYRPTGS---DDFFDSEVLKEALSRALVL  73

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL               +CN  G + VEAE+ +V+ DLGDF+   E   L+P+V
Sbjct  74    FYPVAGRLKRDKNGRIEI-----DCNAEGVLFVEAETSSVVDDLGDFA-TLELRKLIPAV  127

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             +YS    I   PL   Q+T F+CGG+SLG  + H V DG    HF+  W++LA G  +  
Sbjct  128   NYSS--GISSDPLLVLQVTYFKCGGVSLGVGMQHHVTDGFSGLHFVNTWSDLARGLDVKL  185

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
              PF DR LLR+        P     I + SPP +       +     + VS L++++ Q+
Sbjct  186   PPFIDRTLLRSHSPPRPQFPH----IEYQSPPALRVSPETTNSASDSSTVSILKVTREQL  241

Query  1027  HALK--AADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
              ALK  A   NG +       YT YE++  H+WRCAC+AR     Q T LS  +D R R+
Sbjct  242   DALKTQAVLENGNTTR-----YTSYEILAGHVWRCACRARGLSDDQDTKLSIAIDGRMRL  296

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
              PPLP  YFGN I  +    V+G++IS+P+   A  I +++     +Y+  A+D+   + 
Sbjct  297   SPPLPQGYFGNGIFTITPIAVAGDLISKPVLYAARTIHESLARANDDYLRSALDYLELQP  356

Query  673   DVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNG  497
             D +     G      PNL + +WV LP H  D GWG+ I+M PG    +G   ILP P  
Sbjct  357   D-LSALARGAHTFRCPNLGITSWVRLPIHDADFGWGRPIYMGPGRIAYEGLSYILPSPTS  415

Query  496   IDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                 DGSL VA  LQ +H++ F K+FY+
Sbjct  416   ----DGSLSVAISLQTEHMKPFEKFFYD  439



>ref|XP_010101376.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB88323.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=446

 Score =   257 bits (657),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 154/452 (34%), Positives = 238/452 (53%), Gaps = 26/452 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAI-IHSLRLSLSQVLVHF  1565
             VV+P+E T   +L  S LD +    +V  +YFY  P+  + D   +  L+ +L + LV F
Sbjct  11    VVRPAEETPRRVLWSSSLDLLVGSNHVPTVYFYRRPTDGAADFFDVAVLKATLGKALVPF  70

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL      +        +CN  G + VEAE+D+ L D GDF+P PEF+ L+P+VD
Sbjct  71    YPLAGRLRQNNDDNRIEI----DCNAEGVLFVEAETDSALDDFGDFAPSPEFHGLIPAVD  126

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YSG   I   P+   Q+T F+ GG+SLG  ++H VADG    H +  W+++A G  L+  
Sbjct  127   YSG--GISSYPVLVLQVTHFKYGGVSLGVGLNHNVADGFAALHLVNTWSDMARGLGLTIP  184

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             PF DR LL A +      P+       + PP  + ++++ S   +       +++K Q+ 
Sbjct  185   PFIDRTLLCARDP-----PRPTFDHIEYKPPPSM-KTTSTSAPQQSIAAGIFKMTKEQLQ  238

Query  1024  ALKAA-------DNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDI  866
              LKA        D +  + +      T +E++  HIWRC CKAR+    Q T +    D 
Sbjct  239   VLKAKSKEYLINDGDTSTSSTATINLTSFEILAGHIWRCVCKARALADDQETRVYIATDG  298

Query  865   RRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFY  686
             R R++PPLP  YFGN +        +G+I S+P +  AS+I DA+  + + Y+  A+D+ 
Sbjct  299   RSRLQPPLPPGYFGNVVFTAAPLATAGDIQSKPTRYAASRIHDALARMDNNYLRSALDYL  358

Query  685   RNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLILP  509
               + D++     G      PNL + +WV LP H  D GWG+ + M PG    +G V++L 
Sbjct  359   ELQPDLMALAR-GAHTFRCPNLGITSWVRLPIHDADFGWGRPVFMGPGKVSFEGFVIVLR  417

Query  508   GPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
              P     +DGSL ++  LQ +H++ F K  Y+
Sbjct  418   SPI----EDGSLSISINLQQEHLKAFEKLIYD  445



>ref|XP_004303231.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=437

 Score =   257 bits (656),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 167/451 (37%), Positives = 240/451 (53%), Gaps = 35/451 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGL-LSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHF  1565
             +VKP+E T     L  + +D +   ++   +YFY  P+  S       L+ +LS+VLV F
Sbjct  13    IVKPAEETTEPRSLWNANVDLVIPSIHTPSIYFYR-PNGASNFFDPRVLKHALSKVLVPF  71

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               NCNG G + V AES +V+ D GDF+P  E   L+P+VD
Sbjct  72    YPMAGRLKRDDDGRIEI-----NCNGEGVLFVVAESSSVIDDFGDFAPTLELRKLIPTVD  126

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  L+  
Sbjct  127   YSA--GISSYPLLVLQVTYFKCGGVSLGVGMQHHVADGFAGLHFVNTWSDMARGLDLTIP  184

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHH-----SPPLIIGQSSNESERMKETKVSTLRLS  1040
             PF DR LLRA +      PQ     FHH     +PP+   Q S +    +ET +S  +L+
Sbjct  185   PFIDRTLLRARDP-----PQPE---FHHIEYQPAPPMKNPQQSTKPG-AEETTISIFKLT  235

Query  1039  KPQIHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIR  863
             + Q++ LKA +  +G + N     Y+ YE++  H+WRC CKAR     Q T L    D R
Sbjct  236   REQLNTLKAKSKEDGNTVN-----YSSYEMLAGHVWRCVCKARDLPDDQDTKLYIATDGR  290

Query  862   RRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYR  683
              R++PPLP  YFGN I       V+G++ S+P    ASKI +A+  + ++Y+  A+D+  
Sbjct  291   SRLQPPLPPGYFGNVIFTATPIAVAGDLQSKPTWYAASKIHNALVRMDNDYLRSALDYLE  350

Query  682   NEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLILPG  506
              + D+      G      PNL + +WV LP H  D GWG+ I M PG    +G   ++P 
Sbjct  351   LQPDLSALVR-GAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIGYEGLAFVIPS  409

Query  505   PNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                   +DGSL VA  LQ +H++ F+K  Y+
Sbjct  410   AT----NDGSLSVAISLQSEHMKSFSKLLYD  436



>ref|XP_010244683.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score =   257 bits (656),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 166/449 (37%), Positives = 232/449 (52%), Gaps = 33/449 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAI-IHSLRLSLSQVLVHF  1565
             +V+P+E T    L +S  D +    +  I+YF+   S  S D   +H L+ +LS+VLV F
Sbjct  10    MVRPAESTPEQTLWISNADLVVRRSHTPIVYFFR--SNGSADFFNLHLLKEALSKVLVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL+              NCNG G +LVEAE+ + + D GDFS   E   L+P VD
Sbjct  68    YPVAGRLNGNNEGGRLEI----NCNGKGVLLVEAETGSTIDDFGDFSATQELRQLIPVVD  123

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS    I   PL   Q+T+FRCGG+SLG A+ H + DG  I HF+  W+ L  G  L   
Sbjct  124   YS--QHISSYPLLLLQVTRFRCGGVSLGVAMHHSLVDGASIIHFINSWSELTRGLQLKIP  181

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHS---PPLIIGQSSNESERMKETKVSTLRLSKP  1034
                DR  L A    + +        FHH    PP  +   +++S       V+ L+++  
Sbjct  182   SSLDRSQLHARHPPTPA--------FHHIEYLPPPSMKTPTSQSGP-THVAVAKLKITVD  232

Query  1033  QIHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRR  857
             QI+ALKA A+ +  + N     Y+ YEV+  H+WRC CKAR     Q T L   VD+R R
Sbjct  233   QINALKAKAEEDSNTLN-----YSSYEVLVGHVWRCVCKARGLCDDQDTKLYMAVDLRSR  287

Query  856   MEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  677
             + PPLP  YFGN  +     GV+G++ S+PL     +I D +  +  EY+  AID+   +
Sbjct  288   LRPPLPQGYFGNGTLVTSPIGVAGDLRSKPLAYAVGRIHDQLMRMNDEYLRSAIDYLELQ  347

Query  676   GDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPN  500
              D+         F   PN+ ++NW  LP +  D GWG+ I+M P     +G   ILP P 
Sbjct  348   PDLTALVRGADTF-RCPNMGIVNWTQLPIYDADFGWGRPIYMGPATVLHEGMAYILPSP-  405

Query  499   GIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                  DGS  +A  LQ DH+Q F K FY+
Sbjct  406   ---AQDGSATLAVSLQSDHMQLFEKIFYD  431



>gb|ACA64049.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Salvia miltiorrhiza]
Length=427

 Score =   256 bits (655),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 167/445 (38%), Positives = 236/445 (53%), Gaps = 30/445 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+PS  T +  L  S +D +    +   +YFY  PS  +      +++ +L + LV FY
Sbjct  10    LVRPSAATPAVNLWNSNVDLVVPNFHTPSVYFYR-PSGAAGFFDTAAMKAALGRALVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               NCN  G + VEAESD  + D GDF+P  E   L+P+VDY
Sbjct  69    PMAGRLKRDEDGRIEI-----NCNAEGVLFVEAESDGSVDDYGDFAPTLELRRLIPAVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  ++  P
Sbjct  124   S--QEISAYPLLVLQVTFFKCGGVSLGVGMQHHVADGFSGLHFVNTWSDMARGLDITLEP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LLRA +      PQ  + I +  PP +  ++  E+E    T VS  +L++ Q+  
Sbjct  182   FIDRTLLRARDPPE---PQF-KHIEYQPPPAM--KTYGEAE----TLVSIFKLTREQLTT  231

Query  1021  LKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP  845
             LKA + ++G +       ++ YE++  HIWRCAC AR     Q T L    D R R++PP
Sbjct  232   LKAKSKDDGNTVT-----HSSYEMLAGHIWRCACLARGLPEDQSTKLYIATDGRFRLQPP  286

Query  844   LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  665
             LP  YFGN I       V+G++ S+P    ASKI DA+  + +EY+  A+D+   + D +
Sbjct  287   LPPGYFGNVIFTATPMAVAGDLESKPAWYGASKIHDALARMDNEYLRSALDYLELQPD-L  345

Query  664   KRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDG  488
             K    G      PNL + +WV LP H  D GWG+ I M PG    +G   +LP P     
Sbjct  346   KALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSP----A  401

Query  487   DDGSLLVAACLQVDHIQDFNKYFYE  413
             +DGSL VA  LQ DH++ F K  YE
Sbjct  402   NDGSLSVAISLQADHMKVFEKLLYE  426



>ref|XP_002324530.2| hypothetical protein POPTR_0018s11370g [Populus trichocarpa]
 gb|EEF03095.2| hypothetical protein POPTR_0018s11370g [Populus trichocarpa]
Length=440

 Score =   257 bits (656),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 154/446 (35%), Positives = 221/446 (50%), Gaps = 25/446 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V P++ T    L ++ LD      +V +LY Y  P+  S    +  L+ +LS+VL  FY
Sbjct  10    MVLPTQDTPDHRLEVTNLDLFHAKYHVPLLYLYK-PNGSSNFFEVKVLKEALSKVLESFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL+              NCNG G + +EAE+D+ + D  DF P  E   L+P+VDY
Sbjct  69    PVAGRLARDANGRIEI-----NCNGEGVLFIEAETDSAMGDFVDFKPSDELRQLIPTVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S    I   PL   Q+T+F CGG+ LG    H +ADG    HF+  W+++A G P+ + P
Sbjct  124   SD---ISSYPLLVLQVTRFTCGGVCLGVGWHHTLADGTECLHFINTWSDIARGLPVKTPP  180

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSP-PLIIGQSSNE--SERMKETKVSTLRLSKPQ  1031
             F DR +LR         P        + P P I     N       K+  V+ L++    
Sbjct  181   FIDRTILRG-----RVPPNPTFHHIEYDPFPTINTHFQNPIPESGSKDISVANLKIPSDL  235

Query  1030  IHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             ++ LKA   N  +   +   Y+ Y ++TAHIWRCACKAR     Q T ++   D R R  
Sbjct  236   LNTLKAMAKNDIASKTE---YSTYVILTAHIWRCACKARGLSNDQATKINISTDGRNRFR  292

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             PP+P  YFGN I       +SG ++S PL   A +I  AI  +  EY+  A+D+     D
Sbjct  293   PPIPPGYFGNVIFQATPIALSGALLSEPLAHTAERIHKAIKRMDDEYLRSAVDYLERVDD  352

Query  670   VIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDCDGDVLILPGPNGID  491
                       +  +PNL++ +WV LP +  D GWGK ++M P     G   I P P    
Sbjct  353   FTTVMRSSETY-RSPNLTIASWVRLPFYDADFGWGKPVYMRPASAFVGKGYIQPSPT---  408

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
              +DG+L +   L+ DH+Q F K FYE
Sbjct  409   -NDGTLSLTIFLETDHLQSFQKLFYE  433



>ref|XP_010063596.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063597.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70836.1| hypothetical protein EUGRSUZ_F03978 [Eucalyptus grandis]
Length=454

 Score =   257 bits (657),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 159/446 (36%), Positives = 226/446 (51%), Gaps = 25/446 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHS--LRLSLSQVLVH  1568
             VV P+E T    L  + +D +   M+   +YFY    +   D    S  L+ +LS+ LV 
Sbjct  17    VVCPAEDTPRCTLWNANVDLVVPSMHTPSVYFYRPTGS---DDFFDSRVLKEALSRALVL  73

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL               +CN  G + VEAE+ +V+ D GDF+P  E   L+P+V
Sbjct  74    FYPMAGRLKRDEDGRIEI-----DCNAEGVLFVEAETSSVINDFGDFAPTLELRKLIPAV  128

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DYSG   I   P+   Q+T F+CGG+SLG  + H VADG    HF+  W++LA G  +  
Sbjct  129   DYSG--GISSYPVLVLQVTYFKCGGVSLGVGMQHHVADGFSGLHFVNTWSDLARGLDVKL  186

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
              PF DR LLRA        P     I + SPP +       +     T VS  ++++ Q+
Sbjct  187   PPFIDRTLLRAHSPPRPQFPH----IEYQSPPALRVSPETTNSAPYSTTVSIFKVTREQL  242

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               LK         N  +  Y+ YE++  H+WRCAC+AR     Q + L    D R R+ P
Sbjct  243   DTLK---TQAELENGNITSYSSYEILAGHVWRCACRARGLSDDQDSKLYIATDGRMRLSP  299

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  YFGN I       V+G++IS+P+   A KIR+++  +  +Y+  A+D+   + D+
Sbjct  300   PLPRGYFGNVIFTATPIAVAGDLISKPVSYAAQKIRESLARMDDDYLRSALDYLELQPDL  359

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGID  491
                   G      PNL + +WV LP H  D GWG+ I M PG    +G   ILP      
Sbjct  360   SALVR-GAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSSTS--  416

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
               DGSL VA  LQ +H++ F K+ Y+
Sbjct  417   --DGSLSVAISLQTEHMKLFEKFLYD  440



>gb|KHN18130.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=466

 Score =   257 bits (657),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 166/470 (35%), Positives = 241/470 (51%), Gaps = 42/470 (9%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V P++PT  G L LS  DQ     +   LY Y     +  +  I  +  SLS++LVH+Y
Sbjct  9     TVAPNQPTPQGRLWLSNSDQTARPAHTPNLYIYKAKHNII-EYDIEKMIDSLSKILVHYY  67

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNH-LVPSVD  1385
             P AGRLS T +          +CN  G  L+EAE+     D GDF+P       LVP +D
Sbjct  68    PVAGRLSVTESGRMEV-----DCNAKGVTLIEAETAKTFDDFGDFTPSDSIKEELVPVID  122

Query  1384  YSGVDPIPDIPLFAGQLTKFR----CGGISLGFAISHVVADGQGISHFLFEWANLASGK-  1220
             Y    PI +IPL   Q+T+F+      G+++  A+SH VADG    HF+  WA +  G  
Sbjct  123   YHS-QPIEEIPLVLVQVTRFKGDRKQQGLAVAVAVSHPVADGYAWIHFINTWAKVNRGGM  181

Query  1219  -PLSSAPFHDRRLLRAGEsssssSPQGGRRIFHHSP----PLIIGQSSNESERMKETKVS  1055
               L+  P  DR + R+   SS          F H      P  +G+S +  E+ K+T  +
Sbjct  182   LDLNDMPCLDRTIRRSSSLSSPPP------RFDHPELKPLPFKLGKSDSTEEQNKKTTAA  235

Query  1054  TLRLSKPQIHALKAADNNGRSCNAKL----RGYTRYEVITAHIWRCACKARSHKPQQPTN  887
              L+L+  Q+  L+   N   + + K     R  +R+E + AHIWRCACKAR     QPT 
Sbjct  236   VLKLTSEQVEMLRKKANENENLSTKQGSRSRPCSRFEAVAAHIWRCACKARELDRNQPTL  295

Query  886   LSFCVDIRRRMEPPLPDSYFGNAIIDVVI-HGVSGEIISRPLQDVASKIRDAIDGVTSEY  710
             + F  D R R+ PPLP +YFGNA+   V     +GEI S+PL   A K+R+A++ +  EY
Sbjct  296   VRFNADFRNRLTPPLPRNYFGNALAATVTPECYAGEITSKPLSYAARKMREAVEMLKEEY  355

Query  709   VNCAIDFYRNEGDVIKRQELGTF--------FVGNPNLSVINWVGLPNHGLDLGWGKEIH  554
             ++  +D    E  +   + L +         F GNPNL + +W+ +P +  D GWGK  H
Sbjct  356   ISSQLDIALGEEQLESIKALFSRQGERRNAPFAGNPNLQITSWINIPLYEADFGWGKPEH  415

Query  553   MSPGHDCDGDV-LILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
                G+ C  D  +I+ GP     +DGS++V    Q+ H+Q F K+FYED+
Sbjct  416   FVLGYVCPFDRGIIIQGPE----NDGSVIVIMYFQISHMQLFKKFFYEDV  461



>ref|XP_010063586.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063587.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063588.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063589.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70830.1| hypothetical protein EUGRSUZ_F03974 [Eucalyptus grandis]
Length=445

 Score =   256 bits (655),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 161/446 (36%), Positives = 229/446 (51%), Gaps = 26/446 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+E T    L  + +D +   M+   +YFY  P+ L        L+ +LS+ LV FY
Sbjct  17    MVRPAEDTPRCTLWNANVDLVVPSMHTPSVYFYR-PTGLDDFFDSRVLKEALSRALVLFY  75

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               +CN  G + VEAE+ +V+ DLGDF+   E   L+P+V+Y
Sbjct  76    PLAGRLKRDKNGRIEI-----DCNAEGVLFVEAETSSVVDDLGDFA-TLELRKLIPAVNY  129

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S    I   P+   Q+T F+CG +SLG    H V DG    HFL  W++LA G  +   P
Sbjct  130   SS--GISSDPVLVLQVTYFKCGAVSLGVGTQHHVTDGFSGLHFLNTWSDLARGLDVKLPP  187

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LLRA        P     I + SPP +       +     + VS L++++ Q+ A
Sbjct  188   FIDRTLLRARSPPRPQFPH----IEYQSPPALRVSPETTNSAPDSSTVSILKVTREQLDA  243

Query  1021  LK--AADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
             LK  A   NG +       YT YE++  H+WRCAC+AR     Q T L    D R R+ P
Sbjct  244   LKTQAVLENGNTTR-----YTSYEILAGHVWRCACRARGLSDDQDTKLFIATDGRMRLSP  298

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  YFGN I  +    V+G++IS+P+   A KI +++     +Y+  A+D+   + D+
Sbjct  299   PLPQGYFGNGIFTITPIAVAGDLISKPVSYAAQKIHESLARTNDDYLRSALDYLELQPDL  358

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGID  491
                   G      PNL + +WV LP H  D GWG+ I+M PG    +G   ILP P    
Sbjct  359   SALAR-GAHTFRCPNLGITSWVRLPIHDTDFGWGRPIYMGPGGIAYEGLSYILPSPTS--  415

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
               DGSL VA  LQ +H++ F K+FY+
Sbjct  416   --DGSLSVAISLQTEHMKPFEKFFYD  439



>gb|AFN85668.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Hibiscus cannabinus]
Length=431

 Score =   256 bits (653),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 161/445 (36%), Positives = 232/445 (52%), Gaps = 26/445 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+  T    L  + +D +    +   +YFY  P+  +       ++ +LS+ LV FY
Sbjct  10    MVQPAGETPRRSLWNANVDLVVPRFHTPSVYFYR-PTGAANFFDPQVMKEALSKALVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               +CN  G + VEAE+ +V+ D GDF+P  E   L+P+VDY
Sbjct  69    PMAGRLKRDEDGRIEI-----DCNAEGVLFVEAETTSVIDDFGDFAPTLELRQLIPTVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T F+CGG SLG  + H  ADG    HF+  W+++A G  L+  P
Sbjct  124   SGG--ISTYPLLVLQVTYFKCGGASLGVGMQHHAADGYSGLHFINTWSDMARGLDLTIPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LLRA +      PQ       + PP  +  +  +S   + T VS  +L++ Q++A
Sbjct  182   FIDRTLLRARDP-----PQPAFHHIEYQPPPAL-NTPPQSTGPESTAVSIFKLTREQLNA  235

Query  1021  LKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP  845
             LKA +  +G S N     Y+ YE+++ H+WR  CKAR     Q T L    D R R+ PP
Sbjct  236   LKAKSKEDGNSVN-----YSSYEMLSGHVWRSVCKARGLTDDQGTKLYIATDGRSRLRPP  290

Query  844   LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  665
             LP  YFGN I       V+G+++ +P    AS+I DA+  +  EY+  A+DF   + D+ 
Sbjct  291   LPPGYFGNVIFTATPIAVAGDLMLKPTWYAASRIHDALVRMDDEYLRSALDFLELQPDLS  350

Query  664   KRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLILPGPNGIDG  488
                  G      PNL + +W  LP H  D GWG+ I M PG    +G   +LP PN    
Sbjct  351   ALVR-GAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIPYEGLSFVLPSPN----  405

Query  487   DDGSLLVAACLQVDHIQDFNKYFYE  413
             +DGSL VA  LQ +H++ F K FY+
Sbjct  406   NDGSLSVAISLQTEHMKVFEKLFYD  430



>ref|XP_011020577.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=431

 Score =   256 bits (653),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 161/444 (36%), Positives = 231/444 (52%), Gaps = 24/444 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+E T    L  S +D +    +   +YFY  P+  S       L+ +LS+ LV FY
Sbjct  10    MVQPAEETPRRRLWNSNVDLVVPRFHTPSVYFYR-PTGASNFFDAKVLKEALSKALVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               +CN  G + VEAE+ +V+AD GDF+P  E   L+P+VDY
Sbjct  69    PMAGRLRRDDDGRIEI-----DCNAEGVLFVEAETASVVADFGDFAPTLELKQLIPTVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  L+  P
Sbjct  124   SG--GISTYPLLVLQVTHFKCGGVSLGVGMQHHAADGFSGLHFVNTWSDMARGLDLTIPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LLRA +      PQ       + PP  + ++  E+ + + T VS  +L++ Q++ 
Sbjct  182   FIDRTLLRARDP-----PQPAFHHVEYQPPPAM-KAVPETSKPESTAVSIFKLTRDQLNT  235

Query  1021  LKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPL  842
             LKA    G        GY+ YE++  H+WR AC+AR     Q T L    D R R+ P L
Sbjct  236   LKAKAKEG----GNNIGYSSYEMLAGHVWRSACQARGLPDDQETKLYIATDGRSRLRPTL  291

Query  841   PDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  662
             P  YFGN I       V+GEI S+P    A KI D++  + ++Y+  A+DF   + D+  
Sbjct  292   PPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLSA  351

Query  661   RQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDGD  485
                 G      PNL + +WV LP H  D GWG+ I M PG    +G   I+P       +
Sbjct  352   LVR-GAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSST----N  406

Query  484   DGSLLVAACLQVDHIQDFNKYFYE  413
             DGS+ VA  LQ +H++ F K+ Y+
Sbjct  407   DGSMSVAISLQAEHMKLFEKFMYD  430



>ref|XP_007146398.1| hypothetical protein PHAVU_006G037000g [Phaseolus vulgaris]
 gb|ESW18392.1| hypothetical protein PHAVU_006G037000g [Phaseolus vulgaris]
Length=449

 Score =   256 bits (654),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 166/461 (36%), Positives = 245/461 (53%), Gaps = 38/461 (8%)
 Frame = -2

Query  1738  VKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFYP  1559
             V P E T  G L L++ DQ+    +    Y Y        +     LR SL ++LVH+YP
Sbjct  10    VLPCEETPKGHLWLADSDQVVRSGHTPTFYVYQAKHNHDTN---ERLRKSLGEILVHYYP  66

Query  1558  FAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDYS  1379
              AGRLS    A         +CN  G   +EAE+   +AD GDFSPG     LVP +DY+
Sbjct  67    VAGRLSLAEDARIQL-----DCNAKGVTFIEAETTKSMADYGDFSPGV-VAELVPKIDYT  120

Query  1378  GVDPIPDIPLFAGQLTKFRCG-GISLGFAISHVVADGQGISHFLFEWANLASGKPLS--S  1208
                P+ +IPL   Q T+   G G  +G A+ HV++DG G   F+  WA L  G+ L    
Sbjct  121   --QPVEEIPLMLVQSTRLPGGNGFVIGLAVCHVLSDGLGSIQFINSWAKLGRGETLEPHE  178

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSP----PLIIGQSSNESERMKETKVSTLRLS  1040
              P+ DR +L+   SS+S SP      F H      PL +G S   +E+ K+T+   L+L+
Sbjct  179   LPYLDRTVLKHQHSSTSPSP-----CFDHPELKPLPLKLGSSDINAEQKKKTRAVLLKLT  233

Query  1039  KPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
             + Q+  LK  + N +     +R Y+R+E +  HIWR A KAR  + +QPT + F  DIR 
Sbjct  234   RQQVEKLKK-EANEQPLQEGVRAYSRFEALAGHIWRSASKARELEEKQPTVVRFNADIRS  292

Query  859   RMEPPLPDSYFGNAIIDVVI-HGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYR  683
             R+ PPLP +Y+GNA+   V      GEI+S+PL   A K+R+AI+ +T+EY+   +    
Sbjct  293   RVIPPLPKNYYGNALAATVTPKCYVGEIVSKPLSYAAQKVREAIEKLTNEYIRSQLKNVL  352

Query  682   NEG--DVIKRQELG------TFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDCDG  527
              E   D I+R  +G        F GNPNL + +W+ +P +  D GWGK ++    +    
Sbjct  353   GEEQLDCIRRLFMGEGERRNVPFAGNPNLHITSWMSMPLYEADFGWGKPVNFGLAYVFAQ  412

Query  526   D-VLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             D  +I+  P+G    DGS++++   Q +H++ F K+FYE I
Sbjct  413   DRAVIILSPHG----DGSIVISMTFQEEHLELFKKFFYETI  449



>gb|ABA46756.1| hydroxycinnamoyl-CoA quinate-like protein [Solanum tuberosum]
Length=433

 Score =   255 bits (652),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 161/444 (36%), Positives = 230/444 (52%), Gaps = 30/444 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +VKPS+PT +  +  S LD I   +++  +YFY  P+  S       ++ +LS VLV FY
Sbjct  16    LVKPSKPTPTKRIWSSNLDLIVGRIHLLTVYFYK-PNGSSSFFDNKVMKEALSNVLVSFY  74

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL+              NCNG G + VEAESD+ + D GDF+P  E   L+PSV+ 
Sbjct  75    PMAGRLARDEQGRIEV-----NCNGEGVLFVEAESDSCIDDFGDFTPCLELKKLIPSVET  129

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T+F+CGGI+LG  + H ++DG    HF+  W+++A G  ++  P
Sbjct  130   SG--DISTFPLAIFQVTRFKCGGIALGGGVFHTLSDGLSSLHFINTWSDIARGLSVAVPP  187

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LL A E  +SS       + +H PP +I     ES   K +  + L+ S  Q+  
Sbjct  188   FIDRTLLHAREPPTSSF----EHVEYHPPPTLISSKKGESTGPKSSTTAMLKFSSEQVGL  243

Query  1021  LKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPL  842
             LK+   N  S          YE++ AHIWRC  KAR     Q T L    D R R+ PPL
Sbjct  244   LKSKSENEGST---------YEILAAHIWRCTSKARGLADDQLTKLHVATDGRSRLCPPL  294

Query  841   PDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  662
             P  Y GN +        S E+ S PL++   +I + +  +   Y+  A+D+   + D+  
Sbjct  295   PPGYLGNVVFTATPIAKSCELQSEPLRNSVKRIPNELIKMDDNYLRSALDYLELQPDLST  354

Query  661   RQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC---DGDVLILPGPNGID  491
                  T+F  +PNL++ +W  LP H  D GWG+ IHM P   C   +G + I+P PN   
Sbjct  355   LIRGPTYFT-SPNLNINSWTRLPVHECDFGWGRPIHMGPA--CILYEGTIYIIPSPN---  408

Query  490   GDDGSLLVAACLQVDHIQDFNKYF  419
               D +L +A CL  DH+  F KY 
Sbjct  409   TKDRNLRLAVCLDPDHMPLFEKYL  432



>ref|NP_001234850.1| hydroxycinnamoyl CoA quinate transferase [Solanum lycopersicum]
 emb|CAE46933.1| hydroxycinnamoyl CoA quinate transferase [Solanum lycopersicum]
Length=430

 Score =   255 bits (652),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 158/446 (35%), Positives = 229/446 (51%), Gaps = 35/446 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +VKPS+PT +  +  S LD I   +++  +YFY  P+  S       ++ +LS VLV FY
Sbjct  16    LVKPSKPTPTKRIWSSNLDLIVGRIHLLTVYFYK-PNGSSNFFDNKVIKEALSNVLVSFY  74

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               NCNG G + VEAESD+ + D GDF+P  E   L+PSV+ 
Sbjct  75    PMAGRLGRDEQGRIEV-----NCNGEGVLFVEAESDSCVDDFGDFTPSLELRKLIPSVET  129

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T+F+CGG++LG  + H ++DG    HF+  W+++A G  ++  P
Sbjct  130   SG--DISTFPLVIFQITRFKCGGVALGGGVFHTLSDGLSSIHFINTWSDIARGLSVAVPP  187

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LLRA +  + S       + +H PP +     N S+  + +  + L+ S  Q+  
Sbjct  188   FIDRTLLRARDPPTYSF----EHVEYHPPPTL-----NSSKNRESSTTTMLKFSSEQLGL  238

Query  1021  LKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPL  842
             LK+   N  S          YE++ AHIWRC CKAR     Q T L    D R R+ PPL
Sbjct  239   LKSKSKNEGST---------YEILAAHIWRCTCKARGLPEDQLTKLHVATDGRSRLCPPL  289

Query  841   PDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  662
             P  Y GN +        S E+ S PL +   +I + +  +   Y+  A+D+   + D+  
Sbjct  290   PPGYLGNVVFTATPIAKSCELQSEPLTNSVKRIHNELIKMDDNYLRSALDYLELQPDLST  349

Query  661   RQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC---DGDVLILPGPNGID  491
                 G  +  +PNL++ +W  LP H  D GWG+ IHM P   C   +G + I+P PN   
Sbjct  350   LIR-GPAYFASPNLNINSWTRLPVHECDFGWGRPIHMGPA--CILYEGTIYIIPSPN---  403

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
               D +L +A CL   H+  F KY YE
Sbjct  404   SKDRNLRLAVCLDAGHMSLFEKYLYE  429



>ref|XP_003532111.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=476

 Score =   256 bits (655),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 170/474 (36%), Positives = 245/474 (52%), Gaps = 40/474 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V P++PT  G L LS  DQ     +   LY Y     +  +  I  +  SLS +LV++Y
Sbjct  9     TVVPNQPTPKGRLWLSNSDQTARPAHTPNLYIYKAKHNII-EYDIEKMIDSLSIILVYYY  67

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNH-LVPSVD  1385
             P AGRLS T +          +CN  G  L+EAE+   + D GDF+P       LVP +D
Sbjct  68    PVAGRLSVTESGRMEV-----DCNAKGVTLIEAETVKTIDDFGDFTPSESVKEELVPVID  122

Query  1384  YSGVDPIPDIPLFAGQLTKFR-----CGGISLGFAISHVVADGQGISHFLFEWANLASGK  1220
             Y    PI +IPL   Q+T+F+       G+++  A+SH VADG    HF+  WA +  G 
Sbjct  123   YHS-QPIEEIPLVFVQVTRFKGDKEQQQGLAIAVAVSHPVADGSAWIHFINTWAKVNRGD  181

Query  1219  PL--SSAPFHDRRLLRAGEsssssSPQGGRRIFH---HSPPLIIGQSSNESERMKETKVS  1055
              L  +  PF DR +L++  S SS SP    R  H      P I+G+S +  E+ K+T  +
Sbjct  182   MLGLNDMPFIDRTILKSSSSLSSLSPPPSPRFDHPELQPLPFILGRSDSTEEQKKKTTAA  241

Query  1054  TLRLSKPQIHALKAADNNGRSCNAK--------LRGYTRYEVITAHIWRCACKARSHKPQ  899
              L+L+  Q+  L+   N   + + K         R  +R+E + AHIWRCACKAR     
Sbjct  242   MLKLTSEQVEMLRKKVNENENLSTKQGSRSRSRSRPCSRFEAVAAHIWRCACKARKLDRN  301

Query  898   QPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVI-HGVSGEIISRPLQDVASKIRDAIDGV  722
             QPT + F  D R R+  PLP +YFGNA+   V     +GEI SRPL   A K+R+A++ +
Sbjct  302   QPTLVRFNADFRSRLTRPLPRNYFGNALAATVTPESYAGEITSRPLSYAARKLREAVEML  361

Query  721   TSEYVNCAIDFYRNEGD------VIKRQ--ELGTFFVGNPNLSVINWVGLPNHGLDLGWG  566
               EY+   ++    E        +  RQ     + F GNPNL + +W+ +P +  D GWG
Sbjct  362   KEEYITSQLEVVLGEEQLESIKALFSRQGERRNSPFAGNPNLQITSWISIPLYEADFGWG  421

Query  565   KEIHMSPGHDCDGDV-LILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             K  H   G+ C  D  +I+ GP     +DGS++V    Q+ H+Q F K+FYED+
Sbjct  422   KPEHFVLGYVCPFDRGIIIRGPE----NDGSVIVIMYFQIAHMQLFKKFFYEDV  471



>gb|KDP38692.1| hypothetical protein JCGZ_04045 [Jatropha curcas]
Length=437

 Score =   255 bits (652),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 159/448 (35%), Positives = 228/448 (51%), Gaps = 31/448 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V P++ T    +  S LD +   +++  +YFY  P+  S       L+ +LS VLV FY
Sbjct  15    IVLPAKDTPRTSIWTSNLDLLVPTIHIPTVYFYK-PNGASNFFDSEVLKKALSHVLVPFY  73

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL                CN  G + VEAE+ +V+ D GDF+P  +   LVP++D 
Sbjct  74    PLAGRLRTDKNGRIDI-----ECNAKGVLFVEAETGSVIDDFGDFTPSLKMMQLVPTMDG  128

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
                + I   PL A Q+T FRCGG+ LG  + H VADG    HF+  W+ +  G  ++ +P
Sbjct  129   YSSEDISSYPLLAVQVTYFRCGGVCLGVCLHHTVADGTSAIHFINSWSEITRGNSITLSP  188

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQSSNESERMKETKVSTLRLSKP  1034
             F +R LL A       +P      FHH     PP +I      +   K T    LR++  
Sbjct  189   FIERTLLSA---RIPPTPT-----FHHVEYDPPPSMITPIKLNA---KPTSTKILRITPD  237

Query  1033  QIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
             Q+  LK+        N  +R ++ YE + AHIWRC CKAR     Q T L    D R R+
Sbjct  238   QLTTLKSKFKKNE--NGMVR-HSTYETLAAHIWRCMCKARGLSNDQATKLYIATDGRFRL  294

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
              PPLP  YFGN +    +   S E+ S PL+ +  KI  A+ G+  EY+  A+DF + + 
Sbjct  295   RPPLPRGYFGNVLFTATVKTSSEEVQSNPLK-IVEKIHSALKGMDDEYLRSALDFLQMQP  353

Query  673   DVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNG  497
             D+   +   + F  +PNL++++W+ LP H  D GW + I M P     +G   +LP P  
Sbjct  354   DLTALKRGASTF-RSPNLNIVSWMKLPIHEADFGWSRPIFMGPASVVFEGMGYVLPSPR-  411

Query  496   IDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                +DGSL +  CL+ DHIQ F  YFYE
Sbjct  412   ---NDGSLRLIICLETDHIQLFQAYFYE  436



>pdb|4G22|A Chain A, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 1)
 pdb|4G22|B Chain B, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 1)
Length=439

 Score =   255 bits (652),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 163/446 (37%), Positives = 236/446 (53%), Gaps = 25/446 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT-TPSTLSPDAIIHSLRLSLSQVLVHF  1565
             +V+P++ T    L  S +D +    +   +YFY  T S+   DA +  L+ +LS+ LV F
Sbjct  15    MVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKV--LKDALSRALVPF  72

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL                CNG G + VEAESD V+ D GDF+P  E   L+P+VD
Sbjct  73    YPMAGRLKRDEDGRIEI-----ECNGEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVD  127

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS    I    L   Q+T F+ GG+SLG  + H  ADG    HF+  W+++A G  ++  
Sbjct  128   YS--QGISSYALLVLQVTYFKXGGVSLGVGMRHHAADGFSGLHFINSWSDMARGLDVTLP  185

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             PF DR LLRA +      PQ     +   P L +   +  S+ + ET VS  +L++ QI 
Sbjct  186   PFIDRTLLRARDPPQ---PQFQHIEYQPPPALAVSPQTAASDSVPETAVSIFKLTREQIS  242

Query  1024  ALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
             ALKA +  +G + +     Y+ YE++  H+WRCACKAR  +  Q T L    D R R+ P
Sbjct  243   ALKAKSKEDGNTIS-----YSSYEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRP  297

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
              LP  YFGN I       ++G++  +P+   ASKI DA+  + ++Y+  A+D+   + D 
Sbjct  298   SLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPD-  356

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGID  491
             +K    G      PNL + +WV LP H  D GWG+ I M PG    +G   ILP P    
Sbjct  357   LKALVRGAHTFKXPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT---  413

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
              +DGS+ VA  LQ +H++ F  + Y+
Sbjct  414   -NDGSMSVAISLQGEHMKLFQSFLYD  438



>ref|XP_009626781.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=432

 Score =   255 bits (651),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 163/445 (37%), Positives = 231/445 (52%), Gaps = 25/445 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +VKP+  T    L  S +D +    +   +YFY   S  S     + L+ +LS+ LV FY
Sbjct  10    MVKPATDTPQTNLWNSNVDLVVPNFHTPSVYFYRPLSGASNFFDSNVLKEALSKALVPFY  69

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL                C G G + VEAESD  + D GDF+P  E   L+P+VDY
Sbjct  70    PMAGRLKKDEDGRIEI-----ECRGQGVLFVEAESDGTVDDFGDFAPTLELRRLIPAVDY  124

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             +    I    L   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  L+   
Sbjct  125   T--QGIHSYALLVLQITHFKCGGVSLGVGMQHHAADGFSGLHFINAWSDMARGIDLTIPT  182

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LLRA +      P     I +  PP +   +  ++E + ET VS  +L++ QI+A
Sbjct  183   FIDRTLLRARDPPLPQFPH----IEYQPPPTL--NNIAKTEAVPETDVSIFKLTRDQINA  236

Query  1021  LKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP  845
             LKA +  +G + N     Y+ YE++  H+WR  C AR  +  Q + L    D R R+ P 
Sbjct  237   LKAKSKEDGNTVN-----YSSYEMLAGHVWRSTCMARGLEEDQGSKLYIATDGRFRLRPT  291

Query  844   LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  665
             LP  YFGN I       V+G++ S+P+   ASKI DA+  + ++Y+  A+D+   + D +
Sbjct  292   LPPGYFGNVIFTATPIAVAGDLKSKPIWYAASKIHDALARMDNDYLRSALDYLELQPD-L  350

Query  664   KRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDG  488
             K    G      PNL + +WV LP H  D GWG+ I M PG    +G   ILP P     
Sbjct  351   KALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----  406

Query  487   DDGSLLVAACLQVDHIQDFNKYFYE  413
             +DGSL VA  LQ DH++ F KY Y+
Sbjct  407   NDGSLSVAISLQADHMKLFEKYLYD  431



>ref|XP_003553113.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
Length=466

 Score =   256 bits (653),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 166/470 (35%), Positives = 241/470 (51%), Gaps = 42/470 (9%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V P++PT  G L LS  DQ     +   LY Y     +  +  I  +  SLS+VLV++Y
Sbjct  9     TVAPNQPTPQGRLWLSNSDQTARPAHTPNLYIYKAKHNII-EYDIEKMIDSLSKVLVYYY  67

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNH-LVPSVD  1385
             P AGRLS T +          +CN  G  L+EAE+     D GDF+P       LVP +D
Sbjct  68    PVAGRLSVTESGRMEV-----DCNAKGVTLIEAETAKTFDDFGDFTPSDSIKEELVPVID  122

Query  1384  YSGVDPIPDIPLFAGQLTKFR----CGGISLGFAISHVVADGQGISHFLFEWANLASGK-  1220
             Y    PI +IPL   Q+T+F+      G+++  A+SH VADG    HF+  WA +  G  
Sbjct  123   YHS-QPIEEIPLVLVQVTRFKGDRKQQGLAVAVAVSHPVADGYAWIHFINTWAKVNRGGM  181

Query  1219  -PLSSAPFHDRRLLRAGEsssssSPQGGRRIFHHSP----PLIIGQSSNESERMKETKVS  1055
               L+  P  DR + R+   SS          F H      P  +G+S +  E+ K+T  +
Sbjct  182   LDLNDMPCLDRTIRRSSSLSSPPP------RFDHPELKPLPFKLGKSDSTEEQNKKTTAA  235

Query  1054  TLRLSKPQIHALKAADNNGRSCNAKL----RGYTRYEVITAHIWRCACKARSHKPQQPTN  887
              L+L+  Q+  L+   N   + + K     R  +R+E + AHIWRCACKAR     QPT 
Sbjct  236   VLKLTSEQVEMLRKKANENENLSTKQGSRSRPCSRFEAVAAHIWRCACKARELDRNQPTL  295

Query  886   LSFCVDIRRRMEPPLPDSYFGNAIIDVVI-HGVSGEIISRPLQDVASKIRDAIDGVTSEY  710
             + F  D R R+ PPLP +YFGNA+   V     +GEI S+PL   A K+R+A++ +  EY
Sbjct  296   VRFNADFRNRLTPPLPRNYFGNALAATVTPECYAGEITSKPLSYAARKMREAVEMLKEEY  355

Query  709   VNCAIDFYRNEGDVIKRQELGTF--------FVGNPNLSVINWVGLPNHGLDLGWGKEIH  554
             ++  +D    E  +   + L +         F GNPNL + +W+ +P +  D GWGK  H
Sbjct  356   ISSQLDIALGEEQLESIKALFSRQGERRNAPFAGNPNLQITSWINIPLYEADFGWGKPEH  415

Query  553   MSPGHDCDGDV-LILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
                G+ C  D  +I+ GP     +DGS++V    Q+ H+Q F K+FYED+
Sbjct  416   FVLGYVCPFDRGIIIQGPE----NDGSVIVIMYFQISHMQLFKKFFYEDV  461



>ref|XP_009626780.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=439

 Score =   255 bits (651),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 163/445 (37%), Positives = 231/445 (52%), Gaps = 25/445 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +VKP+  T    L  S +D +    +   +YFY   S  S     + L+ +LS+ LV FY
Sbjct  17    MVKPATDTPQTNLWNSNVDLVVPNFHTPSVYFYRPLSGASNFFDSNVLKEALSKALVPFY  76

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL                C G G + VEAESD  + D GDF+P  E   L+P+VDY
Sbjct  77    PMAGRLKKDEDGRIEI-----ECRGQGVLFVEAESDGTVDDFGDFAPTLELRRLIPAVDY  131

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             +    I    L   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  L+   
Sbjct  132   T--QGIHSYALLVLQITHFKCGGVSLGVGMQHHAADGFSGLHFINAWSDMARGIDLTIPT  189

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LLRA +      P     I +  PP +   +  ++E + ET VS  +L++ QI+A
Sbjct  190   FIDRTLLRARDPPLPQFPH----IEYQPPPTL--NNIAKTEAVPETDVSIFKLTRDQINA  243

Query  1021  LKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP  845
             LKA +  +G + N     Y+ YE++  H+WR  C AR  +  Q + L    D R R+ P 
Sbjct  244   LKAKSKEDGNTVN-----YSSYEMLAGHVWRSTCMARGLEEDQGSKLYIATDGRFRLRPT  298

Query  844   LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  665
             LP  YFGN I       V+G++ S+P+   ASKI DA+  + ++Y+  A+D+   + D +
Sbjct  299   LPPGYFGNVIFTATPIAVAGDLKSKPIWYAASKIHDALARMDNDYLRSALDYLELQPD-L  357

Query  664   KRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDG  488
             K    G      PNL + +WV LP H  D GWG+ I M PG    +G   ILP P     
Sbjct  358   KALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT----  413

Query  487   DDGSLLVAACLQVDHIQDFNKYFYE  413
             +DGSL VA  LQ DH++ F KY Y+
Sbjct  414   NDGSLSVAISLQADHMKLFEKYLYD  438



>gb|AHG97388.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Gossypium hirsutum]
Length=499

 Score =   256 bits (655),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 164/448 (37%), Positives = 237/448 (53%), Gaps = 32/448 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+  T    L  + +D +    +   +YFY  P+  +       ++ +LS+ LV FY
Sbjct  78    MVRPAGETPRRSLWNANVDLVVPRFHTPSVYFYR-PNGAANFFDPQVMKEALSKALVPFY  136

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               +CNG G + VEAE+++V+ D GDF+P  E   L+P+VDY
Sbjct  137   PMAGRLKRDEDGRIEI-----DCNGEGVLFVEAETNSVIDDFGDFAPTLELRQLIPTVDY  191

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T F+CGG SLG  + H  ADG    HF+  W+++A G  L+  P
Sbjct  192   SGG--ISTYPLLVLQVTYFKCGGASLGVGMQHHAADGYSGLHFINTWSDMARGLDLTIPP  249

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHH---SPPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
             F DR LLRA +      PQ    +FHH    PP  + +   +S   + T +S  +L++ Q
Sbjct  250   FIDRTLLRARDP-----PQP---VFHHVEYQPPPAM-KIPPQSTGPESTAISIFKLTRDQ  300

Query  1030  IHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
             ++ALKA    +G   N     Y+ YE+++ H+WR  CKAR  +  Q T L    D R R+
Sbjct  301   LNALKAKCKEDGNDVN-----YSSYEMLSGHVWRSVCKARGLEDDQGTKLYIATDGRARL  355

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
              PPLP  YFGN I       V+G+++S+P    AS+I DA+  +  EY+  A+D+   + 
Sbjct  356   RPPLPPGYFGNVIFTATPIAVAGDLLSKPTWYAASRIHDALVRMDDEYLRSALDYLELQP  415

Query  673   DVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLILPGPNG  497
             D+      G      PNL + +WV LP H  D GWG+ I M PG    +G   +LP PN 
Sbjct  416   DLSALVR-GAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIPYEGLSFVLPSPN-  473

Query  496   IDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                +DGSL VA  LQ +H+  F K FY+
Sbjct  474   ---NDGSLSVAISLQTEHMNVFEKLFYD  498



>emb|CAN82918.1| hypothetical protein VITISV_023290 [Vitis vinifera]
Length=429

 Score =   254 bits (650),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 158/444 (36%), Positives = 227/444 (51%), Gaps = 26/444 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+E T    L  S +D +   M+   +YFY  PS  +       ++ +LS+VLV FY
Sbjct  10    MVRPAEETPRRSLWNSNVDLVVPRMHTPSVYFYR-PSGAANFFDPQVMKEALSKVLVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               +CN  G + VEA++ +V+ D GDF+P  E   L+P+VDY
Sbjct  69    PMAGRLRRDEDGRIEI-----DCNAEGVLFVEADTGSVIDDFGDFAPTLELRQLIPTVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I    L   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  ++  P
Sbjct  124   SG--DIGSYSLLILQVTHFKCGGVSLGVGMQHHVADGASGLHFINTWSDMARGLDITIPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LLRA +      PQ       + PP    Q        + T V   R+++ Q++ 
Sbjct  182   FIDRTLLRARDP-----PQPAFHHIEYQPP---PQLKTPLPNTQNTNVCIFRITRDQLNT  233

Query  1021  LKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPL  842
             LK    N    +     Y+ Y ++  H+WRCACKARS    Q + +    D R R+ P L
Sbjct  234   LK----NKSKEDGNTISYSSYVMLAGHVWRCACKARSLPADQDSKMYIATDGRSRLRPAL  289

Query  841   PDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  662
             P  YFGN I       V+GE++S+PL   ASKI +A+  +  EY+  A+D+   + D+  
Sbjct  290   PPGYFGNVIFTTTPVAVAGELMSKPLWYAASKIHNALARMDDEYLRSALDYLEIQPDLTA  349

Query  661   RQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLILPGPNGIDGD  485
                 G      PN+ + +W  LP +  D GWG+ I M PG    +G    LP P     +
Sbjct  350   LVR-GAHTFRCPNIGITSWTRLPIYDADFGWGRPIFMGPGGIALEGLAFALPSPT----N  404

Query  484   DGSLLVAACLQVDHIQDFNKYFYE  413
             DGSL +A  LQ DH++ F KY YE
Sbjct  405   DGSLSIAISLQEDHMKLFQKYLYE  428



>ref|NP_001275483.1| HQT [Solanum tuberosum]
 gb|ADF50082.1| HQT [Solanum tuberosum]
Length=433

 Score =   254 bits (650),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 160/444 (36%), Positives = 230/444 (52%), Gaps = 30/444 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +VKPS+PT +  +  S LD I   +++  +YFY  P+  S       ++ +LS VLV FY
Sbjct  16    LVKPSKPTPTKRIWSSNLDLIVGRIHLLTVYFYK-PNGSSSFFDNKVMKEALSNVLVSFY  74

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL+              NCNG G + VEAESD+ + D GDF+P  E   L+PSV+ 
Sbjct  75    PMAGRLARDEQGRIEV-----NCNGEGVLFVEAESDSCIDDFGDFTPCLELKKLIPSVET  129

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T+F+CGGI+LG  + H ++DG    HF+  W+++A G  ++  P
Sbjct  130   SG--DISTFPLAIFQVTRFKCGGIALGGGVFHTLSDGLSSLHFINTWSDIARGLSVAVPP  187

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LL A +  +SS       + +H PP +I     ES   K +  + L+ S  Q+  
Sbjct  188   FIDRTLLHARDPPTSSF----EHVEYHPPPTLISSKKGESTGPKSSTTAMLKFSSEQVGL  243

Query  1021  LKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPL  842
             LK+   N  S          YE++ AHIWRC  KAR     Q T L    D R R+ PPL
Sbjct  244   LKSKSENEGST---------YEILAAHIWRCTSKARGLADDQLTKLHVATDGRSRLCPPL  294

Query  841   PDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  662
             P  Y GN +        S E+ S PL++   +I + +  +   Y+  A+D+   + D+  
Sbjct  295   PPGYLGNVVFTATPIAKSCELQSEPLRNSVKRIHNELIKMDDNYLRSALDYLELQPDLST  354

Query  661   RQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC---DGDVLILPGPNGID  491
                  T+F  +PNL++ +W  LP H  D GWG+ IHM P   C   +G + I+P PN   
Sbjct  355   LIRGPTYFT-SPNLNINSWTRLPVHECDFGWGRPIHMGPA--CILYEGTIYIIPSPN---  408

Query  490   GDDGSLLVAACLQVDHIQDFNKYF  419
               D +L +A CL  DH+  F KY 
Sbjct  409   TKDRNLRLAVCLDPDHMPLFEKYL  432



>ref|XP_002268988.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
Length=429

 Score =   254 bits (650),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 158/444 (36%), Positives = 227/444 (51%), Gaps = 26/444 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+E T    L  S +D +   M+   +YFY  PS  +       ++ +LS+VLV FY
Sbjct  10    MVRPAEETPRRSLWNSNVDLVVPRMHTPSVYFYR-PSGAANFFDPQVMKEALSKVLVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               +CN  G + VEA++ +V+ D GDF+P  E   L+P+VDY
Sbjct  69    PMAGRLRRDEDGRIEI-----DCNAEGVLFVEADTGSVIDDFGDFAPTLELRQLIPTVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I    L   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  ++  P
Sbjct  124   SG--DIGSYSLLILQVTHFKCGGVSLGVGMQHHVADGASGLHFINTWSDMARGLDITIPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LLRA +      PQ       + PP    Q        + T V   R+++ Q++ 
Sbjct  182   FIDRTLLRARDP-----PQPAFHHIEYQPP---PQLKTPLPNTQNTNVCIFRITRDQLNT  233

Query  1021  LKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPL  842
             LK    N    +     Y+ Y ++  H+WRCACKARS    Q + +    D R R+ P L
Sbjct  234   LK----NKSKEDGNTISYSSYVMLAGHVWRCACKARSLPADQDSKMYIATDGRSRLRPAL  289

Query  841   PDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  662
             P  YFGN I       V+GE++S+PL   ASKI +A+  +  EY+  A+D+   + D+  
Sbjct  290   PPGYFGNVIFTTTPVAVAGELMSKPLWYAASKIHNALARMDDEYLRSALDYLELQPDLTA  349

Query  661   RQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLILPGPNGIDGD  485
                 G      PN+ + +W  LP +  D GWG+ I M PG    +G    LP P     +
Sbjct  350   LVR-GAHTFRCPNIGITSWTRLPIYDADFGWGRPIFMGPGGIALEGLAFALPSPT----N  404

Query  484   DGSLLVAACLQVDHIQDFNKYFYE  413
             DGSL +A  LQ DH++ F KY YE
Sbjct  405   DGSLSIAISLQEDHMKLFQKYLYE  428



>ref|XP_010113235.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXC76036.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=439

 Score =   254 bits (650),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 160/451 (35%), Positives = 242/451 (54%), Gaps = 38/451 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHS--LRLSLSQVLVH  1568
             +VKP+E T    +  S LD + + M+   +YFY  P+  + D   ++  L+ +L++VLV 
Sbjct  10    IVKPAEETPRRSIWNSNLDLVVSNMHTPSVYFYR-PAGSNSDHFFNAEVLKEALARVLVT  68

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRLS   +          +CN  G + VEAE+ +V+ D GDF+P P+   L+P+V
Sbjct  69    FYPVAGRLSRDASGRIEI-----DCNAEGVLFVEAETSSVIDDFGDFAPTPQLKALIPAV  123

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             D SG   I   PL   Q+T F CGG+SLG  + H   DG    HF+  W+++A G  +  
Sbjct  124   DLSG--GISSYPLAVFQVTYFECGGVSLGVGMEHHAVDGASGLHFVNSWSDVARGLDIKV  181

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQSS----NESERMKETKVST  1052
              PF DR L+R+ +          R  F H    +PP++   +S      S+    T V+ 
Sbjct  182   PPFIDRTLIRSRDPP--------RPAFDHIEYDAPPIMKNTASANFQKNSKYQTTTSVAN  233

Query  1051  LRLSKPQIHALK-AADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFC  875
              +++K Q+ ALK  +  +G S +     Y+ YE+++ H+WRCACKAR+    Q T L   
Sbjct  234   FKITKDQLIALKNKSKEDGSSVS-----YSSYEMLSGHVWRCACKARALPDDQETKLFVA  288

Query  874   VDIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAI  695
             VD R R++PPLP SYFGN I       ++G+++S+P+   AS+I   +    +EY+  AI
Sbjct  289   VDGRARLQPPLPQSYFGNVIFTTTPIALAGDLVSKPIWYAASQIHKTLVKTNNEYLKSAI  348

Query  694   DFYRNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVL  518
             D+   + D +     G      PNL + +WV LP +  D GWG+ I M PG    +G   
Sbjct  349   DYLEIQPD-LSALVRGAHTFRCPNLGITSWVRLPIYDADFGWGRPIFMGPGGIMFEGLAY  407

Query  517   ILPGPNGIDGDDGSLLVAACLQVDHIQDFNK  425
             +LP P     +DGSL +A  LQ +H++ F K
Sbjct  408   VLPSPT----NDGSLSIAIGLQPEHMEAFGK  434



>gb|KHM99608.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=475

 Score =   256 bits (653),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 170/475 (36%), Positives = 246/475 (52%), Gaps = 43/475 (9%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
              V P++PT  G L LS  DQ     +   LY Y     +  +  I  +  SLS +LV++Y
Sbjct  9     TVVPNQPTPKGRLWLSNSDQTARPAHTPNLYIYKAKHNII-EYDIEKMIDSLSIILVYYY  67

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNH-LVPSVD  1385
             P AGRLS T +          +CN  G  L+EAE+   + D GDF+P       LVP +D
Sbjct  68    PVAGRLSVTESGRMEV-----DCNAKGVTLIEAETVKTIDDFGDFTPSESVKEELVPVID  122

Query  1384  YSGVDPIPDIPLFAGQLTKFR-----CGGISLGFAISHVVADGQGISHFLFEWANLASGK  1220
             Y    PI +IPL   Q+T+F+       G+++  A+SH VADG    HF+  WA +  G 
Sbjct  123   YHS-QPIEEIPLVLVQVTRFKGDKEQQQGLAIAVAVSHPVADGSAWIHFINTWAKVNRGD  181

Query  1219  PL--SSAPFHDRRLLRAGEsssssSPQGGRRIFHHSP----PLIIGQSSNESERMKETKV  1058
              L  +  PF DR +L++  S S S P   R  F+H      P I+G+S +  E+ K+T  
Sbjct  182   MLGLNDMPFIDRTILKSSSSLSLSPPPSPR--FNHPELQPLPFILGRSDSTEEQKKKTTA  239

Query  1057  STLRLSKPQIHALKAADNNGRSCNAK--------LRGYTRYEVITAHIWRCACKARSHKP  902
             + L+L+  Q+  L+   N   + + K         R  +R+E + AHIWRCACKAR    
Sbjct  240   AMLKLTSEQVEMLRKKVNENENLSTKQGSRSRSRSRPCSRFEAVAAHIWRCACKARKLDR  299

Query  901   QQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVI-HGVSGEIISRPLQDVASKIRDAIDG  725
              QPT + F  D R R+  PLP +YFGNA+   V     +GEI SRPL   A K+R+A++ 
Sbjct  300   NQPTLVRFNADFRSRLTRPLPRNYFGNALAATVTPECYAGEITSRPLSYAARKLREAVEM  359

Query  724   VTSEYVNCAIDFYRNEGD------VIKRQ--ELGTFFVGNPNLSVINWVGLPNHGLDLGW  569
             +  EY+   ++    E        +  RQ     + F GNPNL + +W+ +P +  D GW
Sbjct  360   LKEEYITSQLEVVLGEEQLESIKALFSRQGERRNSPFAGNPNLQITSWISIPLYEADFGW  419

Query  568   GKEIHMSPGHDCDGDV-LILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
             GK  H   G+ C  D  +I+ GP     +DGS++V    Q+ H+Q F K+FYED+
Sbjct  420   GKPEHFVLGYVCPFDRGIIIRGPE----NDGSVIVIMYFQIAHMQLFKKFFYEDV  470



>ref|XP_007023475.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 ref|XP_007023476.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26097.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26098.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
Length=431

 Score =   254 bits (649),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 163/448 (36%), Positives = 235/448 (52%), Gaps = 32/448 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+E T    L  S +D +    +   +YFY  P+  S       ++ +LS+ LV FY
Sbjct  10    MVRPAEETPRQSLWNSNVDLVVPRFHTPSVYFYR-PTGASNFFDPQVMKEALSKALVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P  GRL               +CNG G +LVEAE+++V+ D GDF+P  E   L+P+VDY
Sbjct  69    PMGGRLKRDEDGRIEI-----DCNGEGVLLVEAETNSVIDDFGDFAPTLELRQLIPTVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T F+CGG SLG  + H  ADG    HF+  W+++A G  L+  P
Sbjct  124   SGG--IGTYPLLVLQVTYFKCGGASLGVGMQHHAADGFSGLHFINTWSDMARGLDLTIPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHH---SPPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
             F DR LLRA +      PQ    +FHH    PP  +  +  +S   + T VS  +L++ Q
Sbjct  182   FIDRTLLRARDP-----PQ---PVFHHIEYQPPPAM-NTPPQSTGPESTAVSIFKLTREQ  232

Query  1030  IHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
             ++ALKA +  +G + N     Y+ YE+++ H+WR  CKAR     Q T L    D R R+
Sbjct  233   LNALKAKSKEDGNTVN-----YSSYEMLSGHVWRSVCKARGLAGDQGTKLYIATDGRARL  287

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
              PPLP  YFGN I       V+G+++S+P    A  I DA+  +  +Y+  A+D+   + 
Sbjct  288   RPPLPPGYFGNVIFTATPIAVAGDLLSKPTWYAAGTIHDALARMDDDYLRSALDYLELQP  347

Query  673   DVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLILPGPNG  497
             D+      G      PNL + +W  LP H  D GWG+ I M PG    +G   +LP P  
Sbjct  348   DLSALVR-GAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIPYEGLSFVLPSPT-  405

Query  496   IDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                +DGSL VA  LQ +H++ F K  Y+
Sbjct  406   ---NDGSLSVAISLQAEHMKLFEKLIYD  430



>ref|XP_010063583.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063585.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70825.1| hypothetical protein EUGRSUZ_F03972 [Eucalyptus grandis]
 gb|KCW70826.1| hypothetical protein EUGRSUZ_F03972 [Eucalyptus grandis]
Length=445

 Score =   254 bits (650),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 160/447 (36%), Positives = 231/447 (52%), Gaps = 28/447 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAI-IHSLRLSLSQVLVHF  1565
             +V P++ T      L+ +D +   ++   +YFY    T S D      L+ +LS+ LV F
Sbjct  17    MVSPAKDTPRCTQWLANVDLMVPTLHTPSVYFYR--PTRSDDFFDSRVLKEALSKALVLF  74

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               +CN  G + VEAE+ +V+ D GDF+   E   L+P+VD
Sbjct  75    YPVAGRLKRDENGRIEI-----DCNAEGVLFVEAETSSVVDDFGDFA-TLELRKLIPTVD  128

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YSG   I   P+   Q+T F+CGG+SLG  + H VADG    HF+  W++LA G  +   
Sbjct  129   YSG--GISSDPILVLQVTYFKCGGVSLGVGMQHHVADGFSGLHFVNTWSDLARGLDVKLP  186

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             PF DR LLRA        P     I + SPP +       +     T VS LR+++  + 
Sbjct  187   PFIDRTLLRARSPPRPQFPH----IEYQSPPALRVSPETTNSAPDSTTVSILRVTREWLD  242

Query  1024  ALK--AADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
              LK  A  +NG +       Y+ YE++  H+WRCAC+AR     Q T +    D R R+ 
Sbjct  243   NLKTQAELDNGNTTR-----YSSYEILAGHVWRCACRARGLSDDQDTKVYIATDARMRLS  297

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             PPLP  YFGN I+      V+G++IS+P+   A KI +++  +   Y+  A+D+   + D
Sbjct  298   PPLPQGYFGNGILTTTPIAVAGDLISKPVSYAAQKIHESLARMNDNYLRSALDYLELQPD  357

Query  670   VIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGI  494
              +     G      PNL +++WV LP H  D GWG+ I+M PG    +G   ILP P   
Sbjct  358   -LSALARGAHTFRCPNLGIVSWVRLPIHDADFGWGRPIYMGPGGIAYEGLSYILPSPTS-  415

Query  493   DGDDGSLLVAACLQVDHIQDFNKYFYE  413
                DGSL VA  LQ +H++ F K+FY+
Sbjct  416   ---DGSLSVAISLQTEHVKPFEKFFYD  439



>gb|ADB44897.1| hydroxycinnamoyl transferase [Sinopodophyllum hexandrum]
Length=438

 Score =   254 bits (649),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 158/453 (35%), Positives = 236/453 (52%), Gaps = 35/453 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+E T   +L  S +DQ+  ++   + ++    ST   D  + +++ SLS+ LV FY
Sbjct  10    IVEPAEETPKKILWTSNIDQLFKLLIPSVYFYRPDGSTNFFD--VKAMKESLSKALVSFY  67

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               +CNG G +LVEAE++  L DLGDF P  E   L+P VD 
Sbjct  68    PMAGRLKRNEDGRVET-----DCNGKGVLLVEAETETSLDDLGDFRPTTELRQLIPRVD-  121

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             + +D I   PL   Q+T F+CGG+S+G  + H   DG   +HF+  W+ +A G  ++  P
Sbjct  122   NPMD-ISPYPLLLLQVTYFKCGGVSVGVGMEHTATDGASGTHFINSWSEIARGLDITIPP  180

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLI---IGQSSNESE---RMKETKVSTLRLS  1040
             F DR LLR+ +  +   P       H  PP +   +G  + ES+   +   + V+  +LS
Sbjct  181   FIDRTLLRSRDPPTPLFPHSE----HDPPPTMKAALGNGTLESKVHPKPSPSVVTMFKLS  236

Query  1039  KPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
             + QI  LKA   +G      +  ++ +EVI  HIWRC CKAR     Q + +S  VD R 
Sbjct  237   RDQISVLKAKCKDG----PDIVSFSSFEVIAGHIWRCICKARQLPDDQESKVSIAVDGRS  292

Query  859   RMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDF---  689
             R+ P LP  YFGNAI  +     SG+I+S+PL     K+ +++     EY+  AIDF   
Sbjct  293   RLNPKLPPGYFGNAIFHITPMAASGDILSKPLIYAVGKLHESLQRANDEYLRSAIDFLEL  352

Query  688   YRNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLIL  512
             + N+  +++    G     +PNL + +W  +P H  D GWG+ I M PG    +G   +L
Sbjct  353   HPNKSSLVR----GPHTFRSPNLGITSWCQMPIHEADFGWGRPIFMGPGSIIYEGLAYVL  408

Query  511   PGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
             P P      DGS  +A  L  DH+  F K FY+
Sbjct  409   PTPE----KDGSRFLAVSLLPDHMTLFKKSFYD  437



>ref|XP_009615699.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
tomentosiformis]
 sp|Q8GSM7.1|HST_TOBAC RecName: Full=Shikimate O-hydroxycinnamoyltransferase; AltName: 
Full=Hydroxycinnamoyl transferase; AltName: Full=Hydroxycinnamoyl-Coenzyme 
A shikimate/quinate hydroxycinnamoyltransferase 
[Nicotiana tabacum]
 emb|CAD47830.1| hydroxycinnamoyl transferase [Nicotiana tabacum]
Length=435

 Score =   254 bits (649),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 164/448 (37%), Positives = 230/448 (51%), Gaps = 28/448 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAII-HSLRLSLSQVLVHF  1565
             +VKP+  T    L  S +D +    +   +YFY    T SP+      L+ +LS+ LV F
Sbjct  10    MVKPAAETPQQRLWNSNVDLVVPNFHTPSVYFYR--PTGSPNFFDGKVLKEALSKALVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               +C G G + VEAESD V+ D GDF+P  E   L+P+VD
Sbjct  68    YPMAGRLCRDEDGRIEI-----DCKGQGVLFVEAESDGVVDDFGDFAPTLELRQLIPAVD  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS    I    L   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  L+  
Sbjct  123   YS--QGIQSYALLVLQITHFKCGGVSLGVGMQHHAADGASGLHFINTWSDMARGLDLTIP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNE--SERMKETKVSTLRLSKPQ  1031
             PF DR LLRA +      P     + +  PP +     N   SE + ET VS  +L++ Q
Sbjct  181   PFIDRTLLRARDPPQPQFPH----VEYQPPPTLKVTPENTPISEAVPETSVSIFKLTRDQ  236

Query  1030  IHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
             I+ LKA +  +G + N     Y+ YE++  H+WR  C AR     Q T L    D R R+
Sbjct  237   INTLKAKSKEDGNTVN-----YSSYEMLAGHVWRSTCMARGLAHDQETKLYIATDGRSRL  291

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
              P LP  YFGN I       V+G+I S+P+   ASK+ DA+  + ++Y+  A+D+   + 
Sbjct  292   RPSLPPGYFGNVIFTTTPIAVAGDIQSKPIWYAASKLHDALARMDNDYLRSALDYLELQP  351

Query  673   DVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNG  497
             D +K    G      PNL + +W  LP H  D GWG+ I M PG    +G   ILP P  
Sbjct  352   D-LKALVRGAHTFKCPNLGITSWSRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT-  409

Query  496   IDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                +DGS  VA  LQ +H++ F K+ Y+
Sbjct  410   ---NDGSQSVAISLQAEHMKLFEKFLYD  434



>ref|XP_010094061.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB55151.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=447

 Score =   254 bits (650),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 157/450 (35%), Positives = 232/450 (52%), Gaps = 33/450 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+E T    L  S LD +   ++   +YFY  P+  +    +  ++ +LS+ LV FY
Sbjct  23    LVRPAEETPRRRLWNSSLDLVVPSVHTPSVYFYR-PTGAANFFDVAVVKAALSRALVPFY  81

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               +CN  G + V AE+ +++ D G+F+P PE   L+PSVDY
Sbjct  82    PMAGRLRRDDDGRIEI-----DCNAKGVLFVVAETTSLIDDFGEFAPTPELRRLIPSVDY  136

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S    I    L   QLT F+CGG+SLG  + H  ADG    HF+  W+++A G  L+  P
Sbjct  137   SA--GISSYSLLILQLTYFKCGGVSLGVGVQHHSADGFSGLHFVNTWSDMARGLDLTIPP  194

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHH-----SPPLIIGQSSNESERMKETKVSTLRLSK  1037
             F DR LLRA +          R  F H     +P +   Q + +S+   ET V   ++++
Sbjct  195   FIDRTLLRARDPP--------RPAFEHVEYKPAPAMKTAQPTKDSQSSPETAVGMFKMTR  246

Query  1036  PQIHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
              Q++ LK  +  NG + N     Y+ Y +++ H+WRCACKAR     Q T L    D R 
Sbjct  247   EQLNTLKTKSKENGNTIN-----YSSYAMLSGHVWRCACKARELPEDQETKLYIATDGRS  301

Query  859   RMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRN  680
             R++PPLP  YFGN I       ++G+I S+P    AS+I D +  + ++Y+  A+D+   
Sbjct  302   RLQPPLPPGYFGNVIFTATPMAMAGDIQSKPTWYAASRIHDTLARMDNDYLRSALDYLEL  361

Query  679   EGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGP  503
             +  +      G      PNL + +WV LP H  D GWG+ I M PG    +G   +LP P
Sbjct  362   QPSLSALVR-GAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIMFEGLAFMLPSP  420

Query  502   NGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                  +DGSL VA  LQ  H++ F K  Y+
Sbjct  421   ----ANDGSLSVAIGLQPQHMKAFEKLLYD  446



>gb|AFZ78609.1| hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyl transferase 
[Populus tomentosa]
Length=431

 Score =   254 bits (648),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 166/449 (37%), Positives = 235/449 (52%), Gaps = 34/449 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAI-IHSLRLSLSQVLVHF  1565
             +V+P+E T    L  S +D +    +   +YFY    T +P+      L+ +LS+ LV F
Sbjct  10    MVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYR--PTGAPNFFDAKVLKGALSKALVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               NCN  G + VEAE+ +V+ D  DF+P  E   L+P+VD
Sbjct  68    YPMAGRLRRDEDGRIEI-----NCNAEGVLFVEAETTSVIDDFADFAPTLELKQLIPTVD  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YSG   I   PL   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  L+  
Sbjct  123   YSG--GISTYPLLVLQVTYFKCGGVSLGVGMQHHAADGFSGLHFVNTWSDMARGLDLTIP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHH---SPPLIIGQSSNESERMKETKVSTLRLSKP  1034
             PF DR LLRA +      PQ    +FHH    PP  + ++  E+ + + T VS  +LS+ 
Sbjct  181   PFIDRTLLRARDP-----PQP---VFHHVEYQPPPSM-KTVLETSKPESTAVSIFKLSRD  231

Query  1033  QIHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRR  857
             Q+  LKA A  +G + +     Y+ YE++ AH+WR  CKAR     Q T L    D R R
Sbjct  232   QLSTLKAKAKEDGNNIS-----YSSYEMLAAHVWRSTCKARELPDDQETKLYIATDGRSR  286

Query  856   MEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  677
             + P LP  YFGN I       V+GE+ S+P    A KI DA+  + ++Y+  A+D+   +
Sbjct  287   LRPQLPPGYFGNVIFTATPIAVAGEMQSKPTWYAAGKIHDALVRMDNDYLKSALDYLELQ  346

Query  676   GDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPN  500
              D+      G      PNL + +WV LP H  D GWG+ I M PG    +G   ILP P 
Sbjct  347   PDLSALVR-GAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT  405

Query  499   GIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                 +DGS+ VA  LQ  H++ F K+ Y+
Sbjct  406   ----NDGSMSVAISLQAQHMKLFEKFIYD  430



>ref|XP_007216677.1| hypothetical protein PRUPE_ppa1027182mg [Prunus persica]
 gb|EMJ17876.1| hypothetical protein PRUPE_ppa1027182mg [Prunus persica]
Length=442

 Score =   254 bits (649),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 164/453 (36%), Positives = 233/453 (51%), Gaps = 33/453 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST------LSPDAIIHS--LRLSL  1586
             VVKP E T    L +S LD + +  ++  +YFY  P+       L  + ++ S  L+ SL
Sbjct  12    VVKPEEETPKQALWISHLDIVISATHLGSVYFYRRPNVQNGAHHLQNNCVLDSEVLKCSL  71

Query  1585  SQVLVHFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFN  1406
             ++ LV FYP AGRL               +CNG G + V AE+D+VL + GDF+P  EF 
Sbjct  72    AKALVPFYPLAGRLKLNDEGRIEI-----DCNGEGVLFVVAETDSVLDEFGDFAPTLEFR  126

Query  1405  HLVPSVDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLAS  1226
              LVP+VDYS    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A 
Sbjct  127   KLVPAVDYSA--GISSYPLLVVQVTYFKCGGLSLGVGLEHRVADGFSGLHFVNTWSDIAR  184

Query  1225  GKPLSSAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLR  1046
             G  L+  PF DR LLRA +      P      +   PP+  G  +   E      VS  R
Sbjct  185   GLDLTIPPFIDRTLLRARDPPQ---PAFDHIEYQPDPPIKTGTKAVGDE---SATVSIFR  238

Query  1045  LSKPQIHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVD  869
             L++ Q++ LKA +  +G + N     YT YE++  HIWRCA  AR     Q T L   VD
Sbjct  239   LTREQLNILKAKSKEDGNTIN-----YTTYEMLAGHIWRCASVARELPDDQETKLHIAVD  293

Query  868   IRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDF  689
              R R++PPLP  +FGN +        +G+I S+P    AS+I DA+  + + Y+  A+D+
Sbjct  294   GRSRLQPPLPPGFFGNVVFSGAPIAAAGDIKSKPTWYAASRIHDAVVRMDNNYLRSALDY  353

Query  688   YRNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLIL  512
                + D++     G      P L++ NW  LP +  D GWG+   M PG    +G   +L
Sbjct  354   LELQPDLLPHVR-GAHTFRCPRLAITNWSRLPIYDADFGWGRPTFMGPGGIGYEGLAFVL  412

Query  511   PGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
             P       +DGSL V   LQ   ++ F+K  YE
Sbjct  413   PSAT----NDGSLSVVISLQSQRMKSFSKLLYE  441



>ref|XP_009354208.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=441

 Score =   254 bits (648),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 163/453 (36%), Positives = 231/453 (51%), Gaps = 34/453 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSP------DAIIHSLRLSLSQ  1580
             +VKP+E T   +L +S LD +    +   +YFY    T S       D  +  L+ +L++
Sbjct  12    IVKPTEETPKQVLWMSNLDLVILGKHTPSVYFYRRSQTGSHHGNSFFDPAV--LKRALAK  69

Query  1579  VLVHFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHL  1400
              LV FYP AGRL               NCNG G + V AE+ +VL D GDF+P PEF  L
Sbjct  70    ALVPFYPLAGRLQQNETGRSEI-----NCNGEGVLFVVAETASVLEDFGDFAPTPEFRKL  124

Query  1399  VPSVDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGK  1220
             +P VDYS    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G 
Sbjct  125   IPVVDYSA--GISTYPLLVVQVTYFKCGGVSLGVGLEHRVADGCSGLHFVNTWSDIARGL  182

Query  1219  PLSSAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESER--MKETKVSTLR  1046
              L+  PF DR LLRA +      PQ       + P          ++    + T+VS  R
Sbjct  183   DLTIPPFIDRTLLRARDP-----PQTTFDHVEYQPDPPSKTPPPSTKDGDAESTRVSIFR  237

Query  1045  LSKPQIHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVD  869
             L++ Q+  LKA +   G S N     Y+ YE++  H+WRCA KAR+    Q T L   VD
Sbjct  238   LTREQLSVLKAKSKEEGNSIN-----YSTYEMLAGHVWRCATKARNLPDDQVTKLHVAVD  292

Query  868   IRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDF  689
              R R++PPLP  +FGN +        +G++ S+P    A +I D +  + ++Y+  A+DF
Sbjct  293   GRSRLQPPLPPGFFGNVVFAGAPFATAGDLKSKPTWYAAGRIHDVVVRMNNDYLRSALDF  352

Query  688   YRNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLIL  512
                + D+      G      P L + +W  LP +  D GWG+ I M PG    +G   +L
Sbjct  353   LEVQPDLSALVR-GAHTFRCPRLGITSWARLPIYDADFGWGRPIFMGPGGIGYEGLAFVL  411

Query  511   PGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
             P P     +DGSL VA  LQ DH++ F K  Y+
Sbjct  412   PSPT----NDGSLSVAISLQSDHMKSFAKLLYD  440



>gb|KHM99609.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=412

 Score =   253 bits (646),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 166/422 (39%), Positives = 226/422 (54%), Gaps = 39/422 (9%)
 Frame = -2

Query  1600  LRLSLSQVLVHFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSP  1421
             ++ SLS+ LV+FYP AGRLS + +          +CN  G  L+EAE+   LAD GDFSP
Sbjct  1     MKESLSKTLVYFYPVAGRLSLSESGRMEV-----DCNAKGVTLIEAETAKTLADFGDFSP  55

Query  1420  GPEFNH-LVPSVDYSGVDPIPDIPLFAGQLTKFRCG-----GISLGFAISHVVADGQGIS  1259
                    LVP++DY    PI +IPL   QLT+F+       G+++G A SH VADG   +
Sbjct  56    SDSIKEELVPAIDYHS-QPIQEIPLLFVQLTRFKGDQQQQHGLAIGMAYSHPVADGLAWT  114

Query  1258  HFLFEWANLASGKPL--SSAPFHDRRLLRAGEsssssSPQGGRRIFHHSPP------LII  1103
              F+  WA +  G  L  +  PF DR +L+    SSS S      + H   P      LI+
Sbjct  115   RFVNTWAMVNRGDSLDVNEMPFLDRTILKFPTWSSSLSLLSPPPLSHSDHPELKPLPLIL  174

Query  1102  GQSSNESERMKETKVSTLRLSKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCAC  923
             G+S +  E+ K+T  S L+L+  Q+  LK   N+  S        TR+E + AHIWRCAC
Sbjct  175   GRSDSTEEQNKKTTASVLKLTSKQVEMLKKKANDQGSTPC-----TRFEAVAAHIWRCAC  229

Query  922   KARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDVVI-HGVSGEIISRPLQDVASK  746
             KAR    +QPT + F  DIR R+ PPLP +YFGNA++  V      GEI SRPL   A K
Sbjct  230   KARGQHHKQPTIVRFNGDIRNRLIPPLPRNYFGNALVATVTPECYVGEITSRPLSYAARK  289

Query  745   IRDAIDGVTSEYVNCAID--FYRNEGDVIKRQELGTF------FVGNPNLSVINWVGLPN  590
             +R+AI  +  EY+   ++  F   +   I+   LG        F GNPNL + +W+  P 
Sbjct  290   LREAIALLRDEYIRSQLEAVFGEEQLKCIRAFFLGQGEGRSEPFGGNPNLQITSWINFPV  349

Query  589   HGLDLGWGKEIHMSPGHDCDGDV-LILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                D GWGK ++   G+ C  D  +I+  P     DDGSL+V    Q+ H+Q F K FYE
Sbjct  350   DSTDFGWGKPVYFGLGYVCALDRGIIVRDPQ----DDGSLIVIMHFQIAHMQLFKKLFYE  405

Query  412   DI  407
             DI
Sbjct  406   DI  407



>gb|ACC63882.1| quinate O-hydroxycinnamoyltransferase/shikimate O-hydroxycinnamoyltransferase 
[Populus trichocarpa]
 gb|AFZ78608.1| hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyl transferase 
[Populus tomentosa]
Length=433

 Score =   253 bits (647),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 162/444 (36%), Positives = 230/444 (52%), Gaps = 24/444 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+E T    L  S +D +    +   +YFY  P+  S       L+ +LS+ LV FY
Sbjct  10    MVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYR-PTGASNFFDAKVLKEALSKALVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               +CN  G + VEA + +V+AD GDF+P  E   L+P+VDY
Sbjct  69    PMAGRLRRDDDGRIEI-----DCNAEGVLFVEAGTASVVADFGDFAPTLELKQLIPTVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  L+  P
Sbjct  124   SG--GISTYPLLVLQVTYFKCGGVSLGVGMQHHAADGFSGLHFVNTWSDMARGLDLTIPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LLRA +      PQ       + PP  + ++  E+ + + T VS  +L++ Q++ 
Sbjct  182   FIDRTLLRARDP-----PQPAFHHVEYQPPPAM-KTVLETSKPESTAVSIFKLTRDQLNT  235

Query  1021  LKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPL  842
             LKA    G        GY+ YE++  H+WR ACKAR     Q T L    D R R+ P L
Sbjct  236   LKAKAKEG----GNNIGYSSYEMLAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTL  291

Query  841   PDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  662
             P  YFGN I       V+GEI S+P    A KI D++  + ++Y+  A+DF   + D+  
Sbjct  292   PPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLSA  351

Query  661   RQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDGD  485
                 G      PNL + +WV LP H  D GWG+ I M PG    +G   I+P       +
Sbjct  352   LVR-GAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSST----N  406

Query  484   DGSLLVAACLQVDHIQDFNKYFYE  413
             DGSL VA  LQ +H++ F K+ Y+
Sbjct  407   DGSLSVAISLQAEHMKLFEKFIYD  430



>ref|XP_006368492.1| transferase family protein [Populus trichocarpa]
 gb|ACC63883.1| quinate O-hydroxycinnamoyltransferase/shikimate O-hydroxycinnamoyltransferase 
[Populus trichocarpa]
 gb|ERP65061.1| transferase family protein [Populus trichocarpa]
Length=431

 Score =   253 bits (646),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 166/449 (37%), Positives = 235/449 (52%), Gaps = 34/449 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAI-IHSLRLSLSQVLVHF  1565
             +V+P+E T    L  S +D +    +   +YFY    T +P+      L+ +LS+ LV F
Sbjct  10    MVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYR--PTGAPNFFDAKVLKGALSKALVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               NCN  G + VEAE+ +V+ D  DF+P  E   L+P+VD
Sbjct  68    YPMAGRLRRDEDGRIEI-----NCNAEGVLFVEAETTSVIDDFADFAPTLELKQLIPTVD  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YSG   I   PL   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  L+  
Sbjct  123   YSG--GISTYPLLVLQVTYFKCGGVSLGVGMQHHAADGFSGLHFVNTWSDMARGLDLTIP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHH---SPPLIIGQSSNESERMKETKVSTLRLSKP  1034
             PF DR LLRA +      PQ    +FHH    PP  + ++  E+ + + T VS  +LS+ 
Sbjct  181   PFIDRTLLRARDP-----PQP---VFHHVEYQPPPSM-KTVLETSKPESTAVSIFKLSRD  231

Query  1033  QIHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRR  857
             Q+  LKA A  +G + +     Y+ YE++ AH+WR  CKAR     Q T L    D R R
Sbjct  232   QLSTLKAKAKEDGNNIS-----YSSYEMLAAHVWRSTCKARELPDDQETKLYIATDGRSR  286

Query  856   MEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  677
              +P LP  YFGN I       V+GE+ S+P    A KI DA+  + ++Y+  A+D+   +
Sbjct  287   WQPQLPPGYFGNVIFTATPIAVAGEMQSKPTWYAAGKIHDALVRMDNDYLKSALDYLELQ  346

Query  676   GDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPN  500
              D+      G      PNL + +WV LP H  D GWG+ I M PG    +G   ILP P 
Sbjct  347   PDLSALVR-GAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT  405

Query  499   GIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                 +DGS+ VA  LQ  H++ F K+ Y+
Sbjct  406   ----NDGSMSVAISLQAQHMKLFEKFIYD  430



>gb|AFF19203.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Erythroxylum 
coca]
Length=433

 Score =   253 bits (646),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 163/451 (36%), Positives = 222/451 (49%), Gaps = 34/451 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT-TPSTLSPDAIIHSLRLSLSQVLVHF  1565
             +V+P+  T +  L  S LD +   +++  +YFY  T S    DA +  L+  LSQ LVHF
Sbjct  8     IVRPARETPTTRLQSSNLDLLVARIHLLTVYFYKPTSSENFFDAKV--LKEGLSQALVHF  65

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               +CNG G + VEAES  V+ D GDF+P  E   LVP VD
Sbjct  66    YPVAGRLQRDENGRIEI-----DCNGEGVLFVEAESSRVMDDFGDFTPSFEMLELVPEVD  120

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS  D I   PL   QLT FRCGG+ LG    H +ADG    HF+  W+++  G  +   
Sbjct  121   YS--DHISSFPLLILQLTSFRCGGVCLGVGWHHTLADGCSAMHFINSWSDVTRGLSVHIP  178

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHS----PPLI--IGQSSNESERMKETKVSTLRL  1043
             PF DR  L AG   +          FHH+    PP I  + Q+       K      L+L
Sbjct  179   PFIDRTPLAAGNPPTP--------TFHHAEYDPPPSINTLDQNGKYQSSEKPACTKILKL  230

Query  1042  SKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIR  863
             +  QI+ LKA              Y+ YE + AHIWRC C AR     QPT L    D R
Sbjct  231   TLDQINTLKATSKQQDGATK----YSTYETLAAHIWRCMCMARELDADQPTRLYIATDGR  286

Query  862   RRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYR  683
              R+ PPLP  YFGN I    +  +SG+I +  L     ++R+++  + +EY+  A+D  +
Sbjct  287   SRLRPPLPSGYFGNVIFTTTVTSLSGDIKTETLVQTIKRLRESLKRMDNEYLRSALDHLQ  346

Query  682   NEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPG  506
              + D+       T F  +PNL+V +W+ LP H  D GWG+ +HM P     +G V IL  
Sbjct  347   VQPDLGALVRGPTTF-KSPNLNVNSWISLPTHDADFGWGRPLHMGPASVLYEGTVYILKT  405

Query  505   PNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
             P      DG L V   L+ D +Q F    ++
Sbjct  406   P----AKDGGLSVIIRLEDDILQRFETLLFD  432



>ref|XP_002277474.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
 emb|CBI36545.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   253 bits (645),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 157/446 (35%), Positives = 224/446 (50%), Gaps = 26/446 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V P++ T    L +S LD +   ++V  +Y Y   +  S       L+ +LS  LV FY
Sbjct  10    MVCPAKHTPKHTLWMSNLDSVVPRIHVPTVYLYKPNAFCSNFFDASRLKEALSNALVQFY  69

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               NCNG G +  EAE+DA++ DLGDF+P     HL+P VD+
Sbjct  70    PVAGRLGLDANGRIQI-----NCNGEGVLFQEAEADAIIDDLGDFTPSHRLRHLIPVVDH  124

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S    I   PL   Q+T F+CGG+ LG AI H+VADG G  HF+  W+++  G P++ +P
Sbjct  125   SA--HISSYPLLLLQVTYFKCGGVCLGVAIHHMVADGSGCIHFINSWSDITRGIPIAISP  182

Query  1201  FHDRRLLRAGEsssssSPQGGR--RIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
             F DR +LRA +      P   R   + +  PP + G S+     +K T    L L+   +
Sbjct  183   FFDRTILRARD------PPAPRFSHVEYLPPPPLHGPST-----LKPTSTLILHLTPEHL  231

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
             +ALKA      S +     Y+ YE + AH+WRC CKAR     QPT L    D R R+ P
Sbjct  232   NALKAKSVRHGSPSPSSVKYSTYETLAAHLWRCICKARGLSHDQPTKLYIPTDGRLRLRP  291

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
              LP  YFGNA+    +   SG++ S    D   +IR+AI G+  EY+  A+D+   + ++
Sbjct  292   TLPPGYFGNALFTSTLTANSGDLQSEAFSDTVQRIRNAIAGMEDEYLRSAVDYLEMQPNL  351

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGID  491
                   G     +PNL V +W  LP H  + GWG+ +HM  G    +G+  I   P    
Sbjct  352   TALVR-GAHTFRSPNLVVGSWTRLPIHDANFGWGRPMHMGLGSGVFEGNACIQRSPT---  407

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
               D  L V  CL+   +Q F    Y+
Sbjct  408   -KDNHLSVVICLEAQPMQLFKDLLYD  432



>gb|AIG20957.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Lonicera japonica]
Length=424

 Score =   252 bits (643),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 158/438 (36%), Positives = 228/438 (52%), Gaps = 25/438 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P++      L  S +D +    +   +YFY  P+  S       L+ +LS+ LV FY
Sbjct  10    MVRPAQDLPPRSLWNSNVDLVVPNFHTPSVYFYN-PTGSSNFFDPKVLKDALSRALVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL                CNG G + VEAESD V+ D GDF+P  E   L+P+VDY
Sbjct  69    PMAGRLRRDEDGRIEI-----ECNGAGVLFVEAESDGVIGDFGDFAPTLEMRKLIPAVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S    I    L   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  L+  P
Sbjct  124   S--QGISSYALLVLQITYFKCGGVSLGVGMQHHAADGASGLHFINTWSDMARGLDLTIPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LLRA +    + P        + PP  +   +NE+  + +T VS  +L++ QI++
Sbjct  182   FIDRTLLRARDPPQPTFPH-----IEYQPPPTMRTKNNET--VPDTDVSIFKLTRDQINS  234

Query  1021  LKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPL  842
             LKA   +    +    GY+ YE++  H+WRC CKAR     Q T L    D R R++P L
Sbjct  235   LKAKSKD----DGNAIGYSSYEIMAGHLWRCVCKARGLPEDQETKLYIATDGRARLKPSL  290

Query  841   PDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  662
             P  YFGN I       V+G++ S+P    AS+I DA+  + ++Y+  A+D+   + D +K
Sbjct  291   PPGYFGNVIFTTTPIAVAGDLQSKPAWYAASRIHDALTRMDNDYLRSALDYLELQPD-LK  349

Query  661   RQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDGD  485
                 G      PNL + +W  LP H  D GWG+ I M PG    +G   +LP P     +
Sbjct  350   ALVRGAHTFRCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSPT----N  405

Query  484   DGSLLVAACLQVDHIQDF  431
             DGSL VA  LQ +H++ F
Sbjct  406   DGSLSVAISLQAEHMKLF  423



>gb|ACZ52698.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Lonicera 
japonica]
Length=439

 Score =   252 bits (644),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 157/448 (35%), Positives = 225/448 (50%), Gaps = 33/448 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST---LSPDAIIHSLRLSLSQVLV  1571
             +V+P++ T    L  S LD +   +++  +YFY +  +     P      L+ +LS VLV
Sbjct  19    MVQPAKNTPEKKLWNSNLDLVVGRIHILTVYFYRSNGSQNFFEPRV----LKEALSNVLV  74

Query  1570  HFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPS  1391
              FYP AGRL               NCNG G + VEAESD  + D GDF+P  E   L P+
Sbjct  75    SFYPMAGRLGKDDEGRVEI-----NCNGEGVLFVEAESDCCVDDFGDFTPSSEMRRLTPT  129

Query  1390  VDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLS  1211
             VDYSG   I   PL   Q+T F+CGG+SLG  + H ++DG    HF+  W+++A G  ++
Sbjct  130   VDYSGA--ISSYPLIILQVTYFKCGGVSLGVGVHHTLSDGVSSLHFINTWSDMARGLSIA  187

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
               PF DR LLR        +P      +H  P +I    S      K    + L+LS  Q
Sbjct  188   IPPFIDRTLLRP---RIPPTPTFDHVEYHPPPSMITKPLSGP----KGVSTAILKLSLDQ  240

Query  1030  IHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
             +  LKA A N G       + ++ YE++ AH+WRCACKAR   P Q + L    D R R+
Sbjct  241   LTTLKAKAKNEGNG-----KDHSTYEILAAHLWRCACKARDLSPNQTSKLYIATDGRSRL  295

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
              PPLP  Y GN +        SG++   P+   A +I +++  + +EY+  A+DF     
Sbjct  296   CPPLPPGYLGNVVFTATPMAESGDLQVEPVTSTAKRIHNSLTRMDNEYLRSALDFLETTP  355

Query  673   DVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNG  497
             D +K    G  +  +PNL++ +W  LP H  D GWG+ I M P     +G + I+P    
Sbjct  356   D-LKTLVRGPNYFASPNLNINSWTRLPVHDADFGWGRPIFMGPASILYEGTIYIIPSTT-  413

Query  496   IDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                +D SL +A CL   H+  F K  YE
Sbjct  414   ---NDRSLSLAVCLDAGHMARFEKCLYE  438



>ref|NP_001289240.1| shikimate O-hydroxycinnamoyltransferase-like [Pyrus x bretschneideri]
 gb|AFF57841.1| hydroxycinnamoyl-coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
3 [Pyrus x bretschneideri]
Length=438

 Score =   252 bits (644),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 159/445 (36%), Positives = 228/445 (51%), Gaps = 21/445 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT-TPSTLSPDAIIHSLRLSLSQVLVHF  1565
             +VKP+E T    L  S +D +   ++   +YFY   P+  S       L+ +LS+ LV F
Sbjct  12    LVKPAEETPKKALWNSNVDLVIPSIHTPSVYFYRPNPNGTSNFFDAAVLKHALSKALVPF  71

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               +C G G + VEAE+ +V+ D GDF+P  E   L+PSVD
Sbjct  72    YPMAGRLKRDDDGRIEI-----DCGGQGVLFVEAETGSVIDDFGDFAPTLELRKLIPSVD  126

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             Y+    I   PL   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  L+  
Sbjct  127   YAA--GISTYPLLLLQVTYFKCGGVSLGVGMQHHAADGFSGLHFINTWSDMARGLDLTLP  184

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             PF DR LLRA +      P      +  +P +     S +      T VS  RL++ Q++
Sbjct  185   PFIDRTLLRARDPPQ---PAFHPIEYQPAPQMKTPLQSAKPGAADSTTVSIFRLTRDQLN  241

Query  1024  ALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP  845
              LK+      +  +    Y+ YE+++ H+WRCACKAR     Q T L    D R R++PP
Sbjct  242   ILKSKSKEAGNTVS----YSSYEMLSGHVWRCACKARELPDDQDTKLYIATDGRSRLQPP  297

Query  844   LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  665
             LP  YFGN I       V+G+I S+P    AS+I D +  +   Y+  A+D+   + D+ 
Sbjct  298   LPPGYFGNVIFTTTPIAVAGDIQSKPTWYAASRIHDGLVRMDDSYLRSALDYLELQPDLS  357

Query  664   KRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDG  488
                  G      PNL + +WV LP H  D GWG+ I M PG    +G   I+P       
Sbjct  358   ALVR-GAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAFEGLSFIIPSAT----  412

Query  487   DDGSLLVAACLQVDHIQDFNKYFYE  413
             +DGSL VA CLQ +H++ F+K  Y+
Sbjct  413   NDGSLSVAICLQTEHMKSFSKLLYD  437



>gb|AEJ88365.1| hydroxycinnamoyltransferase [Cucumis sativus]
Length=430

 Score =   252 bits (643),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 165/446 (37%), Positives = 231/446 (52%), Gaps = 29/446 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V P+E T    L  S +D +   M+   +YFY  P+  S       L+  LS+ LV FY
Sbjct  10    MVTPAEETPHKSLWNSNVDLVVPSMHTPSVYFYR-PTGDSNFFDAEVLKEGLSKALVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL                CN  G +LVEAE+ AV+ D GDF+P  +   L+P+VDY
Sbjct  69    PMAGRLRRDEDGRIEIY-----CNAEGVLLVEAETTAVIDDFGDFAPTLQLRQLIPAVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W++++ G  L   P
Sbjct  124   SG--GIESYPLLVLQVTYFKCGGVSLGVGMQHHVADGYSGLHFVNTWSDMSRGLDLMLQP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSP-PLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             + DR LLRA +      PQ   R   + P P +      + E    T VS  + ++ Q++
Sbjct  182   YIDRTLLRARDP-----PQPAFRHVEYQPAPPMKNPVQADPE---GTTVSIFKFTREQLN  233

Query  1024  ALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
              LKA +  NG + N     Y+ YE+++ H+WR  CKAR     Q T L    D R R+ P
Sbjct  234   LLKAKSKENGNTIN-----YSSYEMLSGHVWRSTCKARELPEDQDTKLYIATDGRARLRP  288

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP+ YFGN I       V+GE++S P    ASKI DA+  + ++Y+  A+D+   + + 
Sbjct  289   PLPNGYFGNVIFTTTPLAVAGELMSNPTWFAASKIHDALTRMDNDYLRSALDYLEIQPN-  347

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGID  491
             I     G      PNL + +WV LP H  D GWG+ I M PG    +G   I+P  +   
Sbjct  348   ISALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSAS---  404

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
              DDGSL VA  LQ  H++ F K F++
Sbjct  405   -DDGSLSVAISLQNRHMKVFEKLFFD  429



>emb|CDG56248.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase 1 
[Glechoma hederacea]
Length=434

 Score =   252 bits (643),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 160/447 (36%), Positives = 230/447 (51%), Gaps = 27/447 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTP--STLSPDAIIHSLRLSLSQVLVH  1568
             +V+PS  T +  L  S +D +    +   +YFY     +  +       ++ +L   LV 
Sbjct  10    LVRPSAATPAVSLWNSNVDLVVPNFHTPSVYFYRPDGGAAAADFFDTAVMKAALGLALVP  69

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL               +CN  G + VEAESD  + D GDF+P  E   L+P+V
Sbjct  70    FYPMAGRLKRDEDGRVEI-----DCNAEGVLFVEAESDGSVDDYGDFAPNLELRRLIPAV  124

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DYS    I    L   Q+TKF+CGG+SLG  + H VADG    HF+  W+++A G  ++ 
Sbjct  125   DYS--QGISTYALLVLQVTKFKCGGVSLGVGMQHHVADGFSGLHFINTWSDMARGLDITL  182

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
              PF DR LLRA +      PQ     +  +P +   ++        ET VS  +L++ Q+
Sbjct  183   PPFIDRTLLRARDPPQ---PQFKHIEYQPAPAM---KTYGAGHYATETVVSIFKLTREQL  236

Query  1027  HALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
               LKA +  +G +       Y+ YE++  H+WRCAC ARS    Q T L    D R R++
Sbjct  237   TTLKAKSKEDGNTVT-----YSSYEMLAGHVWRCACLARSLPEDQDTKLYIATDGRARLQ  291

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             PPLP  YFGN I       V+G++ S+P+   ASKI DA+  + +EY+  A+D+   + D
Sbjct  292   PPLPQGYFGNVIFTATPLAVAGDLESKPVWYAASKIHDALARMDNEYLRSALDYLELQPD  351

Query  670   VIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGI  494
              +K    G      PNL + +WV LP H  D GWG+ I M PG    +G   +LP P   
Sbjct  352   -LKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSP---  407

Query  493   DGDDGSLLVAACLQVDHIQDFNKYFYE  413
               +DGSL VA  LQ +H++ F K  Y+
Sbjct  408   -ANDGSLSVAISLQAEHMKLFEKLLYD  433



>ref|XP_004135880.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cucumis 
sativus]
 gb|KGN45212.1| hypothetical protein Csa_7G431440 [Cucumis sativus]
Length=430

 Score =   251 bits (642),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 165/446 (37%), Positives = 231/446 (52%), Gaps = 29/446 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V P+E T    L  S +D +   M+   +YFY  P+  S       L+  LS+ LV FY
Sbjct  10    MVTPAEETPHRSLWNSNVDLVVPSMHTPSVYFYR-PTGDSNFFDAEVLKEGLSKALVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL                CN  G +LVEAE+ AV+ D GDF+P  +   L+P+VDY
Sbjct  69    PMAGRLRRDEDGRIEIY-----CNAEGVLLVEAETTAVIDDFGDFAPTLQLRQLIPAVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W++++ G  L   P
Sbjct  124   SG--GIESYPLLVLQVTYFKCGGVSLGVGMQHHVADGYSGLHFVNTWSDMSRGLDLMLQP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSP-PLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             + DR LLRA +      PQ   R   + P P +      + E    T VS  + ++ Q++
Sbjct  182   YIDRTLLRARDP-----PQPAFRHVEYQPAPPMKNPVQADPE---GTTVSIFKFTREQLN  233

Query  1024  ALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
              LKA +  NG + N     Y+ YE+++ H+WR  CKAR     Q T L    D R R+ P
Sbjct  234   LLKAKSKENGNTIN-----YSSYEMLSGHVWRSTCKARELPEDQDTKLYIATDGRARLRP  288

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP+ YFGN I       V+GE++S P    ASKI DA+  + ++Y+  A+D+   + + 
Sbjct  289   PLPNGYFGNVIFTTTPLAVAGELMSNPTWFAASKIHDALTRMDNDYLRSALDYLEIQPN-  347

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGID  491
             I     G      PNL + +WV LP H  D GWG+ I M PG    +G   I+P  +   
Sbjct  348   ISALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSAS---  404

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
              DDGSL VA  LQ  H++ F K F++
Sbjct  405   -DDGSLSVAISLQNRHMKVFEKLFFD  429



>ref|XP_007215406.1| hypothetical protein PRUPE_ppa005955mg [Prunus persica]
 gb|EMJ16605.1| hypothetical protein PRUPE_ppa005955mg [Prunus persica]
Length=435

 Score =   251 bits (641),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 159/447 (36%), Positives = 232/447 (52%), Gaps = 28/447 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHS--LRLSLSQVLVH  1568
             VVKP E T    L +S+LD + +  ++  +YFY  P+  + + ++ S  L+ SL++ LV 
Sbjct  12    VVKPEEETPKRALWISDLDIVISATHLGSVYFYRRPNVQN-NCVLDSEVLKCSLAKALVP  70

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL               +CN  G + V AE+ +VL D GDF+P  EF  LVP+V
Sbjct  71    FYPVAGRLKLNDEGRIEM-----DCNAEGVLFVVAETASVLDDFGDFAPTLEFRKLVPAV  125

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DYS    +   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  L+ 
Sbjct  126   DYSA--GMSSYPLLVVQVTYFKCGGVSLGVGLEHRVADGFSGLHFVNTWSDIARGLDLTI  183

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
              PF DR LLRA +      P      +   PP+  G  +   E      VS  RL++ Q+
Sbjct  184   PPFIDRTLLRARDPPQ---PAFDHTEYQPDPPIKTGTKAVGDE---SATVSIFRLTREQL  237

Query  1027  HALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             + LKA +  +G + N     YT YE++  HIW+CA  AR     Q T L   VD R R++
Sbjct  238   NILKAKSKEDGNTIN-----YTTYEMLAGHIWKCASVARELPDDQETKLHIAVDGRSRLQ  292

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             PPLP  +FGN +        +G++ S P    AS+I DA+  + ++Y+  A+D+   + D
Sbjct  293   PPLPPGFFGNVVFSSAPIAATGDLKSEPTWYAASRIHDAVVRMDNDYLRSALDYLELQPD  352

Query  670   VIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLILPGPNGI  494
             ++     G      P L++ NW  LP +  D GWG+   M PG    +G   +LP     
Sbjct  353   LLPHVR-GAHTFRCPRLAITNWSRLPIYDADFGWGRPTFMGPGGIGYEGLAFVLPSAT--  409

Query  493   DGDDGSLLVAACLQVDHIQDFNKYFYE  413
               +DGSL V   LQ   ++ F+K  YE
Sbjct  410   --NDGSLSVVISLQSQRMKSFSKLLYE  434



>emb|CDG56249.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase 2 
[Glechoma hederacea]
Length=430

 Score =   251 bits (640),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 159/447 (36%), Positives = 230/447 (51%), Gaps = 31/447 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTP--STLSPDAIIHSLRLSLSQVLVH  1568
             +V+PS  T +  L  S +D +    +   +YFY     +  +       ++ +L + LV 
Sbjct  10    LVRPSAATPAVSLWNSNVDLVVPNFHTPSVYFYRPDGGAAAADFFDTAVMKAALGRALVP  69

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL               +CN  G + VEAESD  + D GDF+P  E   L+P+V
Sbjct  70    FYPMAGRLKRDEDGRVEI-----DCNAEGVLFVEAESDGSVDDYGDFAPNLELRRLIPAV  124

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DYS    I    L   Q+TKF+CGG+SLG  + H VADG    HF+  W+++A G  ++ 
Sbjct  125   DYS--QGISTYALLVLQVTKFKCGGVSLGVGMQHHVADGFSGLHFINTWSDMARGLDITL  182

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
              PF DR LL A +      PQ   +   + P       + ++    ET VS  +L++ Q+
Sbjct  183   PPFIDRTLLLARDP-----PQPQFKHIEYQP-----APAMKTYDATETVVSIFKLTREQL  232

Query  1027  HALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
               LKA +  +G +       Y+ YE++  H+WRCAC ARS    Q T L    D R R++
Sbjct  233   TTLKAKSKEDGNTVT-----YSSYEMLAGHVWRCACLARSLPEDQDTKLYIATDGRARLQ  287

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             PPLP  YFGN I       V+G++ S+P+   ASKI DA+  + +EY+  A+D+   + D
Sbjct  288   PPLPQGYFGNVIFTTTPQAVAGDLDSKPVWYAASKIHDALAQMDNEYLRSALDYLELQPD  347

Query  670   VIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGI  494
              +K    G      PNL + +WV LP H  D GWG+ I M PG    +G   +LP P   
Sbjct  348   -LKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSP---  403

Query  493   DGDDGSLLVAACLQVDHIQDFNKYFYE  413
               +DGSL VA  LQ +H++ F K  Y+
Sbjct  404   -ANDGSLSVAISLQAEHMKLFEKLLYD  429



>gb|AHA14500.1| hydroxycinnamoyl-coenzyme A quinate transperase [Fagopyrum tataricum]
Length=435

 Score =   251 bits (640),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 157/447 (35%), Positives = 231/447 (52%), Gaps = 30/447 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT---TPSTLSPDAIIHSLRLSLSQVLV  1571
             +VKP++ T    L  S +D +   ++   +YFY    + +   P+ +    + +LS+ LV
Sbjct  14    MVKPAKETPQRSLWNSNVDLVVPRIHTPSVYFYRPNGSTNFFDPNPV----KEALSRALV  69

Query  1570  HFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPS  1391
             +FYP AGRL               +CNG G + VEAE+ +V+ D GDF+P  E   L+P+
Sbjct  70    YFYPMAGRLRRDEDGRIEI-----DCNGEGVLFVEAETTSVIDDFGDFAPTLELRKLIPT  124

Query  1390  VDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLS  1211
             VDYS    I    L   QLT F+CGG+SLG  + H  ADG    HF+  WA++A G  L+
Sbjct  125   VDYS--QGISSYSLLVLQLTYFKCGGVSLGVGMQHHAADGFSGLHFINTWADMARGLDLT  182

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
               PF DR LLRA +      PQ       + PP  + ++  E    +E  V+  ++S+ Q
Sbjct  183   IPPFIDRTLLRARDP-----PQPKFHHVEYQPPPTL-KNPTEPSTPEEATVAIFKISREQ  236

Query  1030  IHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             I  LKA        +     Y+ YE+++ H+WRC C+AR  +  Q T L    D R R+ 
Sbjct  237   ISTLKAKSKE----DGNTIPYSSYEMLSGHVWRCVCQARGLENDQGTKLYIATDGRSRLN  292

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             P LP  YFGN I        +G++ S+P    AS+I DA+  + +EY+  A+D+   + D
Sbjct  293   PTLPPGYFGNVIFTTTPVAQAGDLASKPTWYAASRIHDALARMDNEYLRSALDYLELQPD  352

Query  670   VIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLILPGPNGI  494
             +      G      PNL + +W  LP H  D GWG+ I M PG    +G   +LP P   
Sbjct  353   LTALVR-GAHTFRCPNLGITSWTRLPIHDADFGWGRPIFMGPGGIPYEGLAYMLPSPV--  409

Query  493   DGDDGSLLVAACLQVDHIQDFNKYFYE  413
               +DGSL +A  LQ +H++ F+KY YE
Sbjct  410   --NDGSLSLAIALQPEHMKLFSKYLYE  434



>emb|CBI83579.1| hydroxycinnamoyl transferase [Solenostemon scutellarioides]
Length=427

 Score =   250 bits (639),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 158/444 (36%), Positives = 226/444 (51%), Gaps = 28/444 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+PS  T +  L  S +D +    +   +YFY  PS          ++ +L + LV FY
Sbjct  10    LVRPSAATPAVSLWNSNVDLVVPNFHTPSVYFYR-PSGADNFFDTAVMKAALGRALVSFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               +CN  G + VEAESD  + D GDF+P  E   L+P+VDY
Sbjct  69    PMAGRLKRDEDGRVEI-----DCNAEGVLFVEAESDGTVDDYGDFAPSLELRRLIPAVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S    I   PL   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  ++  P
Sbjct  124   S--QGISAYPLLVLQVTFFKCGGVSLGVGMQHHAADGFSGLHFINTWSDMARGLDITLPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LL A +      PQ   +   + PP      + ++    ET VS  +L+K Q+  
Sbjct  182   FIDRTLLSARDP-----PQPQFKHVEYQPP-----PAMKTYEPAETVVSIFKLTKDQLTT  231

Query  1021  LKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPL  842
             LKA        +     Y+ YE+++ H+WRC C AR    +Q T L    D R R++P L
Sbjct  232   LKAKSKE----DGNTTTYSSYEMLSGHVWRCTCLARGLPEEQETKLYIATDGRSRLQPQL  287

Query  841   PDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  662
             P  YFGN I       V+G++ S+P+   ASKI DA+  + ++Y+  A+DF   + D +K
Sbjct  288   PPGYFGNVIFTATPLAVAGDLGSKPVWYAASKIHDALARMDNDYLRSALDFLELQPD-LK  346

Query  661   RQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDGD  485
                 G      PNL + +WV LP H  D GWG+ I M PG    +G   +LP P     +
Sbjct  347   ALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSPT----N  402

Query  484   DGSLLVAACLQVDHIQDFNKYFYE  413
             DGSL VA  LQ +H++ F K  Y+
Sbjct  403   DGSLSVAISLQAEHMKLFEKLLYQ  426



>gb|AID69225.1| hydroxycinnamoyl coenzyme A shikimate hydroxycinnamoyl transferase, 
partial [Garcinia mangostana]
Length=367

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 149/389 (38%), Positives = 207/389 (53%), Gaps = 25/389 (6%)
 Frame = -2

Query  1573  VHFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVP  1394
             V FYP AGRL                CNG G + VEAE+ +V+ D GDF+P P+   L+P
Sbjct  1     VPFYPMAGRLRRDDDGRIEIY-----CNGEGVLFVEAETTSVIDDFGDFAPTPDLKQLIP  55

Query  1393  SVDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPL  1214
             S+DYSG   I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  +
Sbjct  56    SIDYSG--DIGSFPLLVLQVTYFKCGGVSLGVGMQHHVADGYSGLHFVNTWSDMARGLDI  113

Query  1213  SSAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKP  1034
             +  PF DR LLRA +      PQ   +   + PP  + +S +++ +   TKV+  + SK 
Sbjct  114   TIPPFIDRTLLRARDP-----PQPAFQHIEYQPPPPL-KSPSQTLKPDSTKVAIFKFSKG  167

Query  1033  QIHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRR  857
             QI ALKA A   G + +     Y+ YE++  H+WRC CKAR     Q T L    D R R
Sbjct  168   QISALKAKAKEAGNTVS-----YSSYEMLAGHVWRCTCKARGLADDQETKLYIATDGRSR  222

Query  856   MEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  677
             + PPLP  YFGN I       V+G++ S+P    AS+I  A+  + +EY+  A+D+   +
Sbjct  223   LRPPLPPGYFGNVIFTATPIAVAGDLQSKPTWYAASRIHGALSRMDNEYLRSALDYLELQ  282

Query  676   GDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPN  500
              D+      G      PNL + +WV LP H  D GWG+ I M PG    +G   ILP   
Sbjct  283   PDLSALVR-GAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSAT  341

Query  499   GIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                  DGS+ VA  LQ +H++ F K  Y+
Sbjct  342   ----IDGSMSVAIALQSEHMKLFEKLLYD  366



>ref|XP_004158793.1| PREDICTED: LOW QUALITY PROTEIN: shikimate O-hydroxycinnamoyltransferase-like 
[Cucumis sativus]
Length=430

 Score =   250 bits (639),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 164/446 (37%), Positives = 231/446 (52%), Gaps = 29/446 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V P+E T    L  S +D +   M+   +YFY  P+  S       L+  LS+ LV FY
Sbjct  10    MVTPAEETPHRSLWNSNVDLVVPSMHTPSVYFYR-PTGDSNFFDAEVLKEGLSKALVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL                CN  G +LVEAE+ AV+ D GDF+P  +   L+P+VDY
Sbjct  69    PMAGRLRRDEDGRIEIY-----CNAEGVLLVEAETTAVIDDFGDFAPTLQLRQLIPAVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W++++ G  L   P
Sbjct  124   SG--GIESYPLLVLQVTYFKCGGVSLGVGMQHHVADGYSGLHFVNTWSDMSRGLDLMLQP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSP-PLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             + DR LLRA +      PQ   R   + P P +      + E    T VS  + ++ Q++
Sbjct  182   YIDRTLLRARDP-----PQPAFRHVEYQPAPPMKNPVQADPE---GTTVSIFKFTREQLN  233

Query  1024  ALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
              LKA +  NG + N     Y+ YE+++ H+WR  CKAR     Q T +    D R R+ P
Sbjct  234   LLKAKSKENGNTIN-----YSSYEMLSGHVWRSTCKARELPEDQDTKVYIATDGRARLRP  288

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP+ YFGN I       V+GE++S P    ASKI DA+  + ++Y+  A+D+   + + 
Sbjct  289   PLPNGYFGNVIFTTTPLAVAGELMSNPTWFAASKIHDALTRMDNDYLRSALDYLEIQPN-  347

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGID  491
             I     G      PNL + +WV LP H  D GWG+ I M PG    +G   I+P  +   
Sbjct  348   ISALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSAS---  404

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
              DDGSL VA  LQ  H++ F K F++
Sbjct  405   -DDGSLSVAISLQNRHMKVFEKLFFD  429



>ref|XP_010034043.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
Length=492

 Score =   251 bits (642),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 156/450 (35%), Positives = 233/450 (52%), Gaps = 33/450 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT---TPSTLSPDAIIHSLRLSLSQVLV  1571
             +V+P+  T    L  S +D +   M+   +YFY    +P    P      L+  LS+ LV
Sbjct  68    MVRPAGETRIHALWNSNVDLVVPSMHTPSVYFYRPNGSPDFFDPKV----LKEGLSKALV  123

Query  1570  HFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPS  1391
              FYP AGRL               +CN  G + VEAE+ + + D GDF+P  E   L+P+
Sbjct  124   PFYPMAGRLRRDEDGRIEI-----DCNAEGVLFVEAETSSAVDDFGDFAPTLELRKLIPA  178

Query  1390  VDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLS  1211
             VDYS    +   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  L+
Sbjct  179   VDYSA--GLSTYPLLVLQVTYFKCGGVSLGVGMQHHVADGFSGLHFVNTWSDMARGLDLT  236

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESER--MKETKVSTLRLSK  1037
             + PF DR LLRA +      PQ   +   + PP  +    +++ +   + T VS  ++++
Sbjct  237   TPPFIDRTLLRARDP-----PQPQFKHIEYQPPPALKAPLSQTTKSGAESTAVSIFKMTR  291

Query  1036  PQIHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
              Q++ LK  +  +G + N     Y+ YE++  H+WR ACKAR     Q + +    D R 
Sbjct  292   EQLNKLKGKSKEDGNTVN-----YSSYEMLAGHVWRSACKARDLAVDQESKMYIATDGRS  346

Query  859   RMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRN  680
             R+ PPLP  YFGN I       V+G++ S+P    AS+I DA+  + ++Y+  A+D+   
Sbjct  347   RLSPPLPPGYFGNVIFTATPLAVAGDLQSKPTWYAASRIHDALVRMDNDYLRSALDYLEL  406

Query  679   EGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGP  503
             + D+      G      PNL + +WV LP H  D GWG+ I M PG    +G   ILP P
Sbjct  407   QPDLSALVR-GAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSP  465

Query  502   NGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                  +DGS+ VA  LQ +H++ F K  YE
Sbjct  466   T----NDGSMSVAISLQTEHMKVFEKLLYE  491



>gb|KCW53914.1| hypothetical protein EUGRSUZ_J03126 [Eucalyptus grandis]
Length=497

 Score =   251 bits (642),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 156/450 (35%), Positives = 233/450 (52%), Gaps = 33/450 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT---TPSTLSPDAIIHSLRLSLSQVLV  1571
             +V+P+  T    L  S +D +   M+   +YFY    +P    P      L+  LS+ LV
Sbjct  73    MVRPAGETRIHALWNSNVDLVVPSMHTPSVYFYRPNGSPDFFDPKV----LKEGLSKALV  128

Query  1570  HFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPS  1391
              FYP AGRL               +CN  G + VEAE+ + + D GDF+P  E   L+P+
Sbjct  129   PFYPMAGRLRRDEDGRIEI-----DCNAEGVLFVEAETSSAVDDFGDFAPTLELRKLIPA  183

Query  1390  VDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLS  1211
             VDYS    +   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  L+
Sbjct  184   VDYSA--GLSTYPLLVLQVTYFKCGGVSLGVGMQHHVADGFSGLHFVNTWSDMARGLDLT  241

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESER--MKETKVSTLRLSK  1037
             + PF DR LLRA +      PQ   +   + PP  +    +++ +   + T VS  ++++
Sbjct  242   TPPFIDRTLLRARDP-----PQPQFKHIEYQPPPALKAPLSQTTKSGAESTAVSIFKMTR  296

Query  1036  PQIHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
              Q++ LK  +  +G + N     Y+ YE++  H+WR ACKAR     Q + +    D R 
Sbjct  297   EQLNKLKGKSKEDGNTVN-----YSSYEMLAGHVWRSACKARDLAVDQESKMYIATDGRS  351

Query  859   RMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRN  680
             R+ PPLP  YFGN I       V+G++ S+P    AS+I DA+  + ++Y+  A+D+   
Sbjct  352   RLSPPLPPGYFGNVIFTATPLAVAGDLQSKPTWYAASRIHDALVRMDNDYLRSALDYLEL  411

Query  679   EGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGP  503
             + D+      G      PNL + +WV LP H  D GWG+ I M PG    +G   ILP P
Sbjct  412   QPDLSALVR-GAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSP  470

Query  502   NGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                  +DGS+ VA  LQ +H++ F K  YE
Sbjct  471   T----NDGSMSVAISLQTEHMKVFEKLLYE  496



>ref|XP_011034568.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=431

 Score =   249 bits (637),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 162/446 (36%), Positives = 232/446 (52%), Gaps = 28/446 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAI-IHSLRLSLSQVLVHF  1565
             +V+P+E T    L  S +D +    +   +YFY    T +P+      L+ +LS+ LV F
Sbjct  10    MVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYR--PTGAPNFFDAKVLKGALSKALVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               NCN  G + VEAE+ +V+ D  DF+P  E   L+P+VD
Sbjct  68    YPMAGRLRRDEDGRIEI-----NCNAEGVLFVEAETTSVIDDFADFAPTSELKQLIPTVD  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YSG   I    L   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  L+  
Sbjct  123   YSG--GISTYALLVLQVTYFKCGGVSLGVGMQHHAADGFSGLHFVNTWSDMARGLDLTIP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             PF DR LLRA +      PQ       + PP  + ++  E+ + + T VS  +LS+ Q+ 
Sbjct  181   PFIDRTLLRARDP-----PQPAFYHVEYQPPPSM-KTVLETSKPESTAVSIFKLSRDQLS  234

Query  1024  ALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
              LKA A+ +G + +     Y+ YE++ AH+WR  CKAR     Q T L    D R R +P
Sbjct  235   TLKAKANEDGNNIS-----YSSYEMLAAHVWRSTCKARELPDDQETKLYIATDGRSRWQP  289

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
              LP  YFGN I       V+GE+ S+P    A KI DA+  + ++Y+  A+D+   + D+
Sbjct  290   QLPPGYFGNVIFTATPIAVAGEMQSKPTCYAAGKIHDALVRMDNDYLKSALDYLELQPDL  349

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGID  491
                   G      PNL + +WV LP H  D GWG+ I M PG    +G   ILP P    
Sbjct  350   SALVR-GAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT---  405

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
              +DGS+ VA  LQ  H++ F K+ Y+
Sbjct  406   -NDGSMSVAISLQAQHMKLFEKFIYD  430



>ref|XP_008228828.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=442

 Score =   250 bits (638),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 161/453 (36%), Positives = 233/453 (51%), Gaps = 33/453 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST------LSPDAIIHS--LRLSL  1586
             VVKP E T    L +S+LD + +  ++  +YFY  P+       L  + ++ S  L+ SL
Sbjct  12    VVKPVEETPKRALWISDLDIVISATHLGSVYFYRRPNVQNGAHHLQNNRVLDSEVLKCSL  71

Query  1585  SQVLVHFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFN  1406
             ++ LV FYP AGRL               +CN  G + V AE+ +VL D GDF+P  EF 
Sbjct  72    AKALVPFYPVAGRLKLNDEGRIEI-----DCNAEGVLFVVAETASVLDDFGDFAPTLEFR  126

Query  1405  HLVPSVDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLAS  1226
              L+P+VDYS    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A 
Sbjct  127   KLIPAVDYSA--GISSYPLLVVQVTYFKCGGVSLGVGLEHRVADGLSGLHFVNTWSDIAR  184

Query  1225  GKPLSSAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLR  1046
             G  L+  PF DR LLRA +      P      +   PP+  G  S   E      VS  R
Sbjct  185   GLDLTIPPFIDRTLLRARDPPQ---PAFDHIEYQPDPPIKTGTKSVGDE---SATVSIFR  238

Query  1045  LSKPQIHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVD  869
             L++ Q++ LKA +  +G + N     YT YE++  H+WRCA  AR     Q + L   VD
Sbjct  239   LTREQLNILKAKSKEDGNTIN-----YTTYEMLAGHVWRCASVARELPDDQESKLHIAVD  293

Query  868   IRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDF  689
              R R++PPLP  +FGN I        +G++ S+P    AS+I DA+  + ++Y+  A+D+
Sbjct  294   GRSRLQPPLPPGFFGNVIFSSAPIAAAGDLKSKPTWYAASRIHDAVVRMDNDYLRSALDY  353

Query  688   YRNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLIL  512
                + D++     G      P L++ NW  LP +  D GWG+   M PG    +G   +L
Sbjct  354   LELQPDLLPLVR-GARTFRCPRLAITNWSRLPIYDADFGWGRPTFMGPGGIGYEGLAFVL  412

Query  511   PGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
             P       +DGSL V   LQ   ++ F+K  YE
Sbjct  413   PSAT----NDGSLSVVISLQSQRMKSFSKLLYE  441



>gb|AEK80405.1| HQT [Lonicera japonica]
Length=439

 Score =   249 bits (637),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 155/448 (35%), Positives = 228/448 (51%), Gaps = 33/448 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST---LSPDAIIHSLRLSLSQVLV  1571
             +V+P++ T    L  S LD +   +++  +YFY +  +     P      L+ +LS VLV
Sbjct  19    MVQPAKNTPEKKLWNSNLDLVVGRIHILTVYFYRSNGSQNFFEPRV----LKEALSNVLV  74

Query  1570  HFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPS  1391
              FYP AGRL               NCNG G + VEAESD  + D GDF+P  E   L P+
Sbjct  75    SFYPMAGRLGKDDEGRVEI-----NCNGEGVLFVEAESDCCVDDFGDFTPSTEMRRLTPT  129

Query  1390  VDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLS  1211
             VDYSG   I   PL   Q+T F+CGG+SLG  + H ++DG    HF+  W+++A G  ++
Sbjct  130   VDYSG--DISSYPLIILQVTYFKCGGVSLGVGVHHTLSDGVSSLHFINTWSDMARGLSIA  187

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
               PF DR LLR     + +       + +H PP +I +  +     K    + L+LS  Q
Sbjct  188   IPPFIDRTLLRPRTPPTPTFDH----VEYHPPPSMITKPLSGP---KGVSTAILKLSLDQ  240

Query  1030  IHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
             +  LKA A N G       + ++ YE++ AH+WRCACKAR     Q + L    D R R+
Sbjct  241   LTTLKAKAKNEGNG-----KDHSTYEILAAHLWRCACKARDLSANQTSKLYIATDGRSRL  295

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
              PPLP  Y GN +        SG++ + P+   A +I +++  + +EY+  A+DF     
Sbjct  296   CPPLPPGYLGNVVFTATPMADSGDLQAEPVTSTAKRIHNSLTRMDNEYLRSALDFLETTP  355

Query  673   DVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNG  497
             D +K    G  +  +PNL++ +W  LP H  D GWG+ I M P     +G + I+P    
Sbjct  356   D-LKTLVRGPNYFASPNLNINSWTRLPVHDADFGWGRPIFMGPASILYEGTIYIIPSTT-  413

Query  496   IDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                +D SL +A CL   H+  F K  YE
Sbjct  414   ---NDRSLSLAVCLDAGHMARFEKCLYE  438



>ref|XP_002324532.1| hypothetical protein POPTR_0018s11380g [Populus trichocarpa]
 gb|EEF03097.1| hypothetical protein POPTR_0018s11380g [Populus trichocarpa]
Length=440

 Score =   249 bits (637),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 153/446 (34%), Positives = 220/446 (49%), Gaps = 25/446 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V P++ T +  L ++ LD      +V +L+ Y  P+  S       L+ +LS+VL  FY
Sbjct  10    MVVPTQDTPNHRLEVTNLDLFHAKYHVPLLFIYK-PNGSSNFFEGKVLKEALSKVLESFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL+              NCNG G + VEAE+D+ + D   F P  E   L+P+VDY
Sbjct  69    PVAGRLARDAKGRIEI-----NCNGEGVLFVEAETDSAMGDFVGFKPSDELRQLIPTVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S    I   PL   Q+T+F CGG+ LG    H +ADG    HF+  W+++A G P+ + P
Sbjct  124   SD---ISSYPLLVLQVTRFTCGGVCLGVGWQHTLADGTECLHFINTWSDIARGLPVKTPP  180

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIG---QSSNESERMKETKVSTLRLSKPQ  1031
             F DR +LR         P        + P   I    Q+       K+  V+ L+++   
Sbjct  181   FIDRTILRG-----RVPPNPTFHHIEYDPYPTINTPFQNPIPESGSKDISVANLKITSDL  235

Query  1030  IHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             ++ LKA   N  +   +   Y+ Y ++TAHIWRCACKAR     Q T LS   + R R  
Sbjct  236   LNTLKAMAKNDIASKTE---YSTYVILTAHIWRCACKARGLSNDQATKLSIPTNGRDRFR  292

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             PPL   YFGN         +SG ++S PL   A +I  AI  +  EY+  A+D+     D
Sbjct  293   PPLQPGYFGNVTFLATPIALSGALLSEPLAHTAERIHKAIKRMDDEYLRSAVDYLEKVDD  352

Query  670   VIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDCDGDVLILPGPNGID  491
             +         +  +PNL ++NWV LP +  D GWGK ++M P     G   I P P    
Sbjct  353   LTTVMRSSETY-RSPNLHIVNWVRLPFYDADFGWGKPVYMRPASAFVGKGYIQPSPT---  408

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
              +DG+L +   L+ DH+Q F K FYE
Sbjct  409   -NDGTLSLTIFLETDHLQSFQKLFYE  433



>gb|ACF17657.1| putative hydroxycinnamoyl transferase [Capsicum annuum]
Length=435

 Score =   249 bits (636),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 160/447 (36%), Positives = 230/447 (51%), Gaps = 26/447 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+  T    L  S +D +    +   +YFY  P+  +       L+ +LS+ LV FY
Sbjct  10    MVQPATETPQIRLWNSNVDLVVPNFHTPSVYFYR-PNGSANFFDGKVLKDALSRALVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P  GRL               +C G G + VEAESD V+ D GDF+P  E   L+P+VDY
Sbjct  69    PMGGRLCRDEDGRIEI-----DCKGQGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S    I    L   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  L+  P
Sbjct  124   S--QGIESYALLVLQITHFKCGGVSLGVGMQHHAADGASGLHFINTWSDMARGLDLTIPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPL--IIGQSSNESERMKETKVSTLRLSKPQI  1028
             F DR LLRA +      P     I +  PP   +  +++  SE + ET VS  +L++ QI
Sbjct  182   FIDRTLLRARDPPQPKFPH----IEYQPPPTLKVTAENAPNSEPVPETSVSIFKLTRDQI  237

Query  1027  HALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             +ALKA +  +G + N     Y+ YE++  H+WR  C AR     Q T L    D R R+ 
Sbjct  238   NALKAKSKEDGNTVN-----YSSYEMLAGHVWRSTCMARGLAQDQETKLYIATDGRARLR  292

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             P LP  YFGN I       V+G++ S+P+   ASKI D +  + ++Y+  A+D+   + D
Sbjct  293   PSLPSGYFGNVIFTATPVAVAGDLQSKPIWYAASKIHDQLAIMDNDYLRSALDYLELQPD  352

Query  670   VIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGI  494
              +K    G      PNL + +W  LP H  D GWG+ I M PG    +G   ILP P   
Sbjct  353   -LKALVRGAHTFKCPNLGITSWSRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT--  409

Query  493   DGDDGSLLVAACLQVDHIQDFNKYFYE  413
               +DGS  VA  LQ +H++ F K+ Y+
Sbjct  410   --NDGSQSVAISLQAEHMKLFEKFLYD  434



>gb|AFF57839.1| hydroxycinnamoyl-coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
1 [Pyrus x bretschneideri]
Length=441

 Score =   249 bits (636),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 162/453 (36%), Positives = 229/453 (51%), Gaps = 34/453 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSP------DAIIHSLRLSLSQ  1580
             +VKP+E T   +L +S LD +    +   +YFY    T S       D  +  L+ +L++
Sbjct  12    IVKPTEETPKQVLWMSNLDLVILGKHTPSVYFYRRSQTGSHHGNSFFDPAV--LKRALAK  69

Query  1579  VLVHFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHL  1400
              LV FYP AGRL               NCNG G + V AE+  VL D GDF+P PEF  L
Sbjct  70    ALVPFYPLAGRLQQNETGRSEI-----NCNGEGVLFVVAETAFVLEDFGDFAPTPEFRKL  124

Query  1399  VPSVDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGK  1220
             +P VDYS    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G 
Sbjct  125   IPVVDYSA--GISTYPLLVVQVTYFKCGGVSLGVGLEHRVADGCSGLHFVNTWSDIARGL  182

Query  1219  PLSSAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESER--MKETKVSTLR  1046
              L+  PF DR LLRA +      PQ       + P          ++    + T+VS  R
Sbjct  183   DLTIPPFIDRALLRARDP-----PQTTFDHVEYQPDPPSKTPPPSTKDGDAESTRVSIFR  237

Query  1045  LSKPQIHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVD  869
             L++ Q+  LKA +   G S N     Y+ YE++  H+WRCA KAR+    Q T L   VD
Sbjct  238   LTRKQLSVLKAKSKEEGNSIN-----YSTYEMLAGHVWRCATKARNLPDDQVTKLHVAVD  292

Query  868   IRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDF  689
              R R++PPLP  +FGN +        +G++ S+P    A +I D +  + ++Y+  A+DF
Sbjct  293   GRSRLQPPLPPGFFGNVVFAGAPFATAGDLKSKPTWYAAGRIHDVVVRMNNDYLRSALDF  352

Query  688   YRNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLIL  512
                + D+      G      P L + +W  LP +  D GWG+ I M PG    +G   +L
Sbjct  353   LEVQPDLSALVR-GAHTFRCPRLGITSWARLPIYDADFGWGRPIFMGPGGIGYEGLAFVL  411

Query  511   PGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
             P P     +DGSL  A  LQ DH++ F K  Y+
Sbjct  412   PSPT----NDGSLSGAIPLQSDHMKSFAKLLYD  440



>ref|XP_004235891.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Solanum lycopersicum]
Length=435

 Score =   248 bits (634),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 160/448 (36%), Positives = 230/448 (51%), Gaps = 28/448 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAII-HSLRLSLSQVLVHF  1565
             +V+P+  T    L  S +D +    +   +YFY    T SP+      ++ +LS+ LV F
Sbjct  10    MVQPATETPQLRLWNSNVDLVVPNFHTPSVYFYR--PTGSPNFFDGKVVKEALSKALVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               +C G G + VEAESD V+ D GDF+P  E   L+P+VD
Sbjct  68    YPMAGRLCRDEDGRIEI-----DCKGQGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVD  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS    I    L   Q+T+F+CGG+SLG  + H  ADG    HF+  W+++A G  L+  
Sbjct  123   YS--QGIESYALLVLQITQFKCGGVSLGVGMQHHAADGASGLHFINTWSDMARGLDLTIP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSN--ESERMKETKVSTLRLSKPQ  1031
             PF DR LLRA +      P     + +  PP +     N   +E + ET VS  +L++ Q
Sbjct  181   PFIDRTLLRARDPPQPQFPH----VEYQPPPTLKTTEENVPNAETVPETSVSIFKLTRDQ  236

Query  1030  IHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
             I+ LKA +  +G + N     Y+ YE++  H+WR  C AR     Q T L    D R R+
Sbjct  237   INTLKAKSKEDGNTVN-----YSSYEMLAGHVWRSTCMARGLTQDQETKLYIATDGRARL  291

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
              P LP  YFGN I       V+G++ S+P+   ASKI D +  + ++Y+  A+D+   + 
Sbjct  292   RPSLPPGYFGNVIFTATPVAVAGDLQSKPIWYAASKIHDQLAIMDNDYLRSALDYLELQP  351

Query  673   DVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNG  497
             D +K    G      PNL + +W  LP H  D GWG+ I M PG    +G   ILP P  
Sbjct  352   D-LKALVRGAHTFKCPNLGITSWSRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPI-  409

Query  496   IDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                +DGS  VA  LQ +H++ F K+ Y+
Sbjct  410   ---NDGSQSVAISLQAEHMKLFEKFLYD  434



>ref|NP_001280198.1| shikimate O-hydroxycinnamoyltransferase-like [Prunus mume]
 dbj|BAE48668.1| Alcohol acyl-transferase [Prunus mume]
Length=438

 Score =   248 bits (634),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 161/451 (36%), Positives = 228/451 (51%), Gaps = 33/451 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHS--LRLSLSQVLVH  1568
             +VKP+  T    L  S +D +   ++   +YFY      +         L+L+LS+ LV 
Sbjct  12    LVKPAAETPRKALWNSNVDLVIPSIHTPSVYFYRPNQNGASSNFFDPAVLKLALSKALVP  71

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL               +CNG G + VEAE+ +V+ D GDF+P  E   L+P+V
Sbjct  72    FYPMAGRLKRDDDGRIEI-----DCNGEGVLFVEAETSSVIDDFGDFAPTLELRRLIPAV  126

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DYS    I    L   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  L+ 
Sbjct  127   DYSA--GISSYALLVLQVTYFKCGGVSLGVGMQHHAADGFSGLHFVNTWSDMARGLDLTL  184

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHH-----SPPLIIGQSSNESERMKETKVSTLRL  1043
              PF DR LLRA +      PQ     FHH     +PPL     S +      T VS  RL
Sbjct  185   PPFIDRTLLRARDP-----PQPA---FHHIEYQPAPPLKTPLQSTKPG-ADSTTVSIFRL  235

Query  1042  SKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIR  863
             ++ Q++ LKA      +  +    Y+ YE++  HIWRC CKAR     Q T L    D R
Sbjct  236   TREQLNILKAKSKEAGNTIS----YSSYEMMAGHIWRCVCKARELPNDQDTKLYIATDGR  291

Query  862   RRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYR  683
              R++PPLP  YFGN I       V+G++ S+P    AS+I D++  +   Y+  A+D+  
Sbjct  292   SRLQPPLPPGYFGNVIFTATPIAVAGDLQSKPTWFAASRIHDSLVRMDDNYLRSALDYLE  351

Query  682   NEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPG  506
              + D+      G      PNL + +WV LP H  D GWG+ I M PG    +G   ++P 
Sbjct  352   LQPDLSALVR-GAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAFEGLAFVIPS  410

Query  505   PNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                   +DGSL VA  LQ +H++ F+K  Y+
Sbjct  411   AT----NDGSLSVAISLQSEHMKSFSKLLYD  437



>ref|XP_007146396.1| hypothetical protein PHAVU_006G036800g [Phaseolus vulgaris]
 gb|ESW18390.1| hypothetical protein PHAVU_006G036800g [Phaseolus vulgaris]
Length=455

 Score =   249 bits (635),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 168/466 (36%), Positives = 234/466 (50%), Gaps = 53/466 (11%)
 Frame = -2

Query  1738  VKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFYP  1559
             + P++PT +  L LS+ DQIG + +V  +Y Y          +   LR SLS+ LVH+YP
Sbjct  16    ITPNQPTPNDPLWLSDSDQIGNLRHVSCVYIYKAKHN---KHVTERLRNSLSKTLVHYYP  72

Query  1558  FAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDYS  1379
              AGRL  T +          NCN  G  L++A +    AD GDFSP      LVP VDY+
Sbjct  73    VAGRLRLTKSGRMEV-----NCNAKGVTLLDAHTTNSFADYGDFSPSLSTEQLVPKVDYT  127

Query  1378  GVDPIPDIPLFAGQLTKFRCG-GISLGFAISHVVADGQGISHFLFEWANLASGKPL--SS  1208
                PI DIPL   Q+T F  G G+++G   SH + D   +  F+  WA +A G+ L  + 
Sbjct  128   --QPIEDIPLMLMQITGFHGGEGLAIGIVTSHPLTDATSMMPFVNNWAKVARGEELDPNE  185

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
              PF DR +L+  +      P           P+   Q   + +R      +  +LS  Q+
Sbjct  186   IPFLDRVVLKLPQQ-----PSSPSVKLPEWKPVSQAQGIEQGQR----SAALFKLSSRQV  236

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKAR--SHKPQQPTNLSFCVDIRRRM  854
               LK   NN ++ N  +R Y+R+EVI AHIWRCA KAR  +    QPT + F VDIR R+
Sbjct  237   EILKKKANNDKASNEGVRPYSRFEVIAAHIWRCASKARASAENSNQPTLVRFSVDIRSRL  296

Query  853   EPPLPDSYFGNAIIDVVI-HGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  677
              PPLP +YFGNA+   V      G+IIS PL+  A KIR+A+  VT EY+       R +
Sbjct  297   NPPLPKNYFGNALAKTVTPKCYEGDIISNPLRYAAQKIREAVYVVTDEYI-------RAQ  349

Query  676   GDVIKRQE----LGTFFV-----------GNPNLSVINWVGLPNHGLDLGWGKEIHMSPG  542
               VI  QE    +  FF+           GN N+ + +W+G+P +  D GWGK +H    
Sbjct  350   LSVILGQEQLDSISAFFMGQGHRVNVPYAGNHNILLTSWMGMPVYEADFGWGKPVHYGLA  409

Query  541   HDCDGD-VLILPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
                + D   ILP  +G DG    + V    Q   ++ F   FYED+
Sbjct  410   TTFEEDRAAILPSSDG-DG----VAVTIFFQTALMELFKILFYEDL  450



>gb|AAZ80046.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus]
Length=436

 Score =   248 bits (633),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 156/448 (35%), Positives = 233/448 (52%), Gaps = 27/448 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+E T    L  S +D +    +   +YFY  P+  +       ++ +LS+ LV FY
Sbjct  10    MVRPAEETPRINLWNSNVDLVVPNFHTPSVYFYR-PNGAANFFDPKVMKDALSRALVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P  GRL               +C G G + VEAESD V+ D GDF+P  E   L+P+VDY
Sbjct  69    PMGGRLKRDEDGRIEI-----DCQGQGVLFVEAESDGVIDDFGDFAPTLELRKLIPAVDY  123

Query  1381  S-GVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             + G++      L   Q+T F+CGG+SLG  + H  ADG    HF+  W++LA G  L+  
Sbjct  124   TLGIE---SYSLLVLQVTYFKCGGVSLGVGMQHHAADGASGLHFINTWSDLARGLDLAVP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSN--ESERMKETKVSTLRLSKPQ  1031
             PF DR LLR+ +      P      +  +PP+    +    + E + ET VS  +L++ Q
Sbjct  181   PFIDRTLLRSRDPPQ---PAFDHIEYQPAPPMKTAPTPTPTDDESVPETTVSIFKLTRDQ  237

Query  1030  IHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
             ++ALK  +  +G + N     Y+ YE+++ H+WRC CKAR     Q T L    D R R+
Sbjct  238   VNALKGKSKEDGNTVN-----YSSYEMLSGHVWRCVCKARGLPDDQDTKLYIATDGRARL  292

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
              P LP  YFGN I       V+G++ S+P    ASKI DA+  +  +Y+  A+D+   + 
Sbjct  293   RPSLPRGYFGNVIFTTTPIAVAGDLQSKPTWYAASKIHDALARMDDDYLKSALDYLELQP  352

Query  673   DVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNG  497
             D +K    G      PNL + +W  LP H  D GWG+ I M PG    +G   +LP P  
Sbjct  353   D-LKALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSPI-  410

Query  496   IDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                +DGSL +   LQ +H++ F+K+ Y+
Sbjct  411   ---NDGSLSIVISLQAEHMKLFSKFLYD  435



>gb|ACI16630.1| shikimate O-hydroxycinnamoyltransferase [Trifolium pratense]
Length=434

 Score =   247 bits (631),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 155/448 (35%), Positives = 226/448 (50%), Gaps = 29/448 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+PSE      L  S +D +    +   +YFY + +  S       ++ +LS+VLV FY
Sbjct  10    MVRPSEEVTRRTLWNSNVDLVVPNFHTPSVYFYRSNNGTSNFFDAKIMKEALSKVLVPFY  69

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               +C+G G + VEA++ AV+ D GDF+P  E   L+P+VDY
Sbjct  70    PMAGRLRRDEDGRVEI-----DCDGQGVLFVEADTGAVIDDFGDFAPTLELRQLIPAVDY  124

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  +S  P
Sbjct  125   S--RGIESYPLLVLQVTYFKCGGVSLGVGMQHHVADGASGLHFINTWSDVARGLDVSIPP  182

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQSSNESERMKETKVSTLRLSKP  1034
             F DR LLRA +          R +F H     PP +     +         VS  +L++ 
Sbjct  183   FIDRTLLRARDPP--------RPVFDHIEYKPPPSMKTTQQSTKPGSDGAAVSIFKLTRE  234

Query  1033  QIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
             Q+  LKA              Y+ YE++  H+WR  CKARS    Q T L    D R R+
Sbjct  235   QLSTLKAKSKEA----GNTIHYSSYEMLAGHVWRSVCKARSLPDDQETKLYIATDGRARL  290

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
             +PP P  YFGN I       ++G+++S+P    AS+I +A+  + +EY+  A+DF   + 
Sbjct  291   QPPPPPGYFGNVIFTTTPIAIAGDLMSKPTWYAASRIHNALSRMDNEYLRSALDFLELQP  350

Query  673   DVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNG  497
             D +K    G      PNL + +W  LP H  D GWG+ I M PG    +G   I+P    
Sbjct  351   D-LKALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSST-  408

Query  496   IDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                +DGSL VA  LQ +H++ F ++ Y+
Sbjct  409   ---NDGSLSVAIALQHEHMKVFKEFLYD  433



>ref|XP_008342823.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=438

 Score =   248 bits (632),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 160/450 (36%), Positives = 228/450 (51%), Gaps = 31/450 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFY-TTPSTLSPDAIIHSLRLSLSQVLVHF  1565
             +VKP+E T    L    +D +   ++   +YFY   P+  S       L+ +LS+ LV F
Sbjct  12    LVKPAEETPKKALWNXNVDLVIPSIHTPSVYFYRXNPNGASNFFDPAVLKHALSKALVPF  71

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               +C G G + VEAE+ +V+ D GDF+P  E   L+PSVD
Sbjct  72    YPMAGRLKRDDDGRIEI-----DCGGQGVLFVEAETGSVIDDFGDFAPTLELRRLIPSVD  126

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             Y+    I   PL   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  L+  
Sbjct  127   YAA--GISTYPLLLLQVTXFKCGGVSLGVGMQHHAADGFSGLHFINTWSDMARGLDLTLP  184

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHH-----SPPLIIGQSSNESERMKETKVSTLRLS  1040
             PF DR LLRA +      PQ     FHH     +P +     S +      T VS  RL+
Sbjct  185   PFIDRTLLRARDP-----PQPA---FHHIEYQPAPQMKXPLQSAKPGAADSTTVSIFRLT  236

Query  1039  KPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
             + Q++ LK       +  +    Y+ YE+++ H+WRCACKAR     Q T L    D R 
Sbjct  237   RDQLNILKYKSKEAGNTVS----YSSYEMLSGHVWRCACKARELPDDQDTKLFIATDGRS  292

Query  859   RMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRN  680
             R++PPLP  YFGN I        +G+I S+P    AS+I DA+  +   Y+  A+D+   
Sbjct  293   RLQPPLPPGYFGNVIFTATPIAXAGDIQSKPTWYAASRIHDALVRMDDSYLRSALDYLEL  352

Query  679   EGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGP  503
             + D+      G      PNL + +WV LP H  D GWG+ I M PG    +G   I+P  
Sbjct  353   QPDLSALVR-GAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAFEGLAFIIPSA  411

Query  502   NGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                  +DGSL +A  LQ +H++ F+K  Y+
Sbjct  412   T----NDGSLSLAISLQTEHMKSFSKLLYD  437



>ref|XP_008353756.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=441

 Score =   247 bits (631),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 158/449 (35%), Positives = 226/449 (50%), Gaps = 26/449 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIH----SLRLSLSQVL  1574
             +VKP+E T   +L +S LD +    +   +YFY    T S           L+ +L++ L
Sbjct  12    IVKPTEETPKQVLWMSNLDLVILGKHTPSVYFYRRSQTGSHQGNSFFDPAVLKRALAKAL  71

Query  1573  VHFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVP  1394
             V FYP AGRL               NCNG G + V AE+ +VL D GDF+P PEF  L+P
Sbjct  72    VPFYPLAGRLQQNETGRSEI-----NCNGEGVLFVVAETTSVLDDFGDFAPTPEFRKLIP  126

Query  1393  SVDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPL  1214
              +DYS    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  L
Sbjct  127   VIDYSA--GISTYPLLVVQVTYFKCGGVSLGVGLEHRVADGCSGLHFVNTWSDIARGLDL  184

Query  1213  SSAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKP  1034
             +  PF DR LLRA +   ++      +               ++E    T VS  RL++ 
Sbjct  185   TIPPFIDRTLLRARDPPQTTFDHVEYQPDPPLKTPPPTTKDGDAE---STTVSIFRLTRE  241

Query  1033  QIHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRR  857
             Q+  LKA +   G S N     Y+ YE++  H+WRCA KAR+    + T L   VD R R
Sbjct  242   QLSVLKAKSKEEGNSIN-----YSTYEMLAGHVWRCASKARNLPDDRVTKLHVAVDGRSR  296

Query  856   MEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  677
             ++PPLP  +FGN +        +G++ S+P    AS I D +    ++Y+  A+D+   +
Sbjct  297   LQPPLPPGFFGNVVFAGAPFATAGDLKSKPTWYAASXIHDVVVRXNNDYLRSALDYLEVQ  356

Query  676   GDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLILPGPN  500
              D+      G      P L + +W  LP +  D GWG+ I M PG    +G   +LP P 
Sbjct  357   PDLSALVR-GAHTFRCPKLGITSWARLPIYDADFGWGRPIFMGPGGIGYEGLAFVLPSPI  415

Query  499   GIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                 +DGSL VA  LQ DH++ F K  Y+
Sbjct  416   ----NDGSLSVAISLQSDHMKSFAKLLYD  440



>ref|XP_004293648.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score =   247 bits (630),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 154/451 (34%), Positives = 235/451 (52%), Gaps = 27/451 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAI-IHSLRLSLSQVLVHF  1565
             VV+P+  T    L LS +D +    +   +Y Y  P     D + +  L+ SLS+ LV F
Sbjct  12    VVRPATETPRQSLWLSNMDLVQPSTHTPSIYIYNKPK--GADKVDMAVLKDSLSKALVPF  69

Query  1564  YPFAGRlswttaasgg-gtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNH-LVPS  1391
             YP AGRL             L ++CN  GA+ V A+S + + DLGDF+P PEF   L+P+
Sbjct  70    YPLAGRLKQNMDEGDKGRRRLEIDCNAEGALFVVADSSSCIDDLGDFAPTPEFGRGLLPT  129

Query  1390  VDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLS  1211
             VDYSG   I   PL   Q+T F+CG ++LG  + H +ADG    HF+  W+++A G  ++
Sbjct  130   VDYSG--GISSYPLLLVQITYFKCGAVALGVRLDHHLADGLSALHFINTWSDIARGADIA  187

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
               P  DR LLRA E          R +  H+  ++    ++      ET VS  + ++ Q
Sbjct  188   IPPTIDRTLLRAREQP--------RTLLDHNHHIVYQPPNDHGTTGAETVVSVFKFTREQ  239

Query  1030  IHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRME  851
             ++ LKA     +  + +++ YT +EV   H+WRCACKAR     Q TN  F V+ R R++
Sbjct  240   LNILKAMSTMTKEEDNEMK-YTTFEVFAGHVWRCACKARELANDQETNFYFAVNGRTRLQ  298

Query  850   PPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGD  671
             PPLP  YFGN I       V+G++IS+PL   A  I +A+  +  +Y+  A+D+   E  
Sbjct  299   PPLPPGYFGNVIFRAAATAVAGDLISKPLSYAACCIHNAVVRMDDDYLRSALDYLELEQR  358

Query  670   VIKRQELGTFFVGN----PNLSVINWVGLPNHGLDLGWGKEIHM-SPGHDCDGDVLILPG  506
               + ++L +   G     PNL + +W  LP +  D GWG+ I M   G   +G   ++P 
Sbjct  359   --RHRDLPSLARGTHVRCPNLGITSWFTLPLYDADFGWGRPIFMGRAGIPSEGKAYMIPT  416

Query  505   PNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                   +DGSL +   L+  H++ F+K  Y+
Sbjct  417   AT----NDGSLSLCINLESQHMKSFSKLVYD  443



>gb|KDP38698.1| hypothetical protein JCGZ_04051 [Jatropha curcas]
Length=429

 Score =   246 bits (628),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 152/447 (34%), Positives = 237/447 (53%), Gaps = 21/447 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             ++ P++   +  L LS +D          +Y Y + +T S D  I  L+ +L +VLV FY
Sbjct  1     MICPAQELNNQHLYLSNIDLFLQRSQNSKVYIYKS-NTDSFD--IKLLKEALRKVLVQFY  57

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLG-DFSPGPEFNHLVPSVD  1385
             P AGRL               NCNG+G + +EAE+D+ + +LG D     +   L+PS+D
Sbjct  58    PVAGRLGRDDKGRLQI-----NCNGDGVLFIEAETDSTVEELGGDLMLNEQILQLIPSID  112

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS  D +   PL   Q+TKFRCGG+SLG    H+++DG G   F   W  +A G  +S  
Sbjct  113   YSKTDILSSFPLLVLQVTKFRCGGLSLGTQWHHILSDGSGYILFAKAWCEIARGLLVSHP  172

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             PF DR +LR   +  +  P+     +   PP+     +N       T+     ++  Q++
Sbjct  173   PFIDRTILR---NQVTRKPKFQHFEYDKLPPV-----NNTDPTQNNTRTELFNITLEQLN  224

Query  1024  ALKAADNNGRSCNAKLR-GYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
             ALK+      S N   +  ++ YE++TAHIWRC CKAR     Q T L+  VD R R++P
Sbjct  225   ALKSKVQEENSNNGYGKTKFSSYEILTAHIWRCTCKARGLSNDQATKLNIAVDGRSRLKP  284

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  YFGNA+       ++G+I S  L++   +IR AI+ + +E++  A+D+     D+
Sbjct  285   PLPSGYFGNALFLASSIALAGDIGSETLKETVERIRKAINRMDNEFLRSAMDYIDGVDDI  344

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDCDGDVLILPGPNGIDG  488
             +     G  F   PNLS+++W+ LP + LD G GK + M P +  +G   I+  P+  + 
Sbjct  345   MAIVR-GPEFCRCPNLSIVSWMRLPFYSLDFGMGKPLCMRPPNPVEGKGYIVATPS--NE  401

Query  487   DDGSLLVAACLQVDHIQDFNKYFYEDI  407
              DGS ++  CL+V H+Q F   FY+++
Sbjct  402   IDGSWVLILCLEVHHMQFFKNLFYDEL  428



>gb|AFL93686.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl-transferase 
[Cynara cardunculus var. scolymus]
Length=436

 Score =   246 bits (628),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 157/448 (35%), Positives = 232/448 (52%), Gaps = 27/448 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P++ T    L  S +D +    +   +YFY  P+  +       ++ +LS+ LV FY
Sbjct  10    MVRPAKETPRINLWNSNVDLVVPNFHTPSVYFYR-PNGAANFFDPKVMKDALSRALVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P  GRL               +C G G + VEAESD V+ D GDF+P  E   L+P+VDY
Sbjct  69    PMGGRLKRDEDGRIEI-----DCQGQGVLFVEAESDGVIDDFGDFAPTLELRKLIPAVDY  123

Query  1381  S-GVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             + G++      L   Q+T FRCGG+SLG  + H  ADG    HF+  W++LA G  L+  
Sbjct  124   TLGIE---SYSLLVLQVTYFRCGGVSLGVGMQHHAADGASGLHFINTWSDLARGLDLTVP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSN--ESERMKETKVSTLRLSKPQ  1031
             PF DR LLRA +      P      +  +PP+    +    + E + ET VS  RL++ Q
Sbjct  181   PFIDRTLLRARDPPQ---PAFDHIEYQPAPPMKTAPTPTPTDDESVPETTVSIFRLTRDQ  237

Query  1030  IHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
             ++ALK  +  +G + N     Y+ YE+++ H+WRC  KAR     Q T L    D R R+
Sbjct  238   VNALKGKSKEDGNTIN-----YSSYEMLSGHVWRCVRKARGLPDDQDTKLYIATDGRARL  292

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
              P LP  YFGN I       V+G++ S+P    ASKI DA+  +  +Y+  A+D+   + 
Sbjct  293   RPSLPRGYFGNVIFTTTPIAVAGDLQSKPTWYAASKIHDALARMDDDYLKSALDYLELQP  352

Query  673   DVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNG  497
             D +K    G      PNL + +W  LP H  D GWG+ I M PG    +G   +LP P  
Sbjct  353   D-LKALVRGVHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSPI-  410

Query  496   IDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                +DGSL +   LQ +H++ F+K+ Y+
Sbjct  411   ---NDGSLSIVISLQAEHMKLFSKFLYD  435



>gb|ACI28534.1| shikimate O-hydroxycinnamoyl transferase [Trifolium pratense]
Length=434

 Score =   246 bits (627),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 154/448 (34%), Positives = 226/448 (50%), Gaps = 29/448 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+PSE      L  S +D +    +   +YFY + +  S       ++ +LS+VLV FY
Sbjct  10    MVRPSEEVTRRTLWNSNVDLVVPNFHTPSVYFYRSNNGTSNFFDAKIMKEALSKVLVPFY  69

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               +C+G G + VEA++ AV+ D GDF+P  E   L+P+VDY
Sbjct  70    PMAGRLRRDEDGRVEI-----DCDGQGVLFVEADTGAVIDDFGDFAPTLELRQLIPAVDY  124

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  +S  P
Sbjct  125   S--RGIESYPLLVLQVTYFKCGGVSLGVGMQHHVADGASGLHFINTWSDVARGLDVSIPP  182

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQSSNESERMKETKVSTLRLSKP  1034
             F DR LLRA +          R +F H     PP +     +         VS  +L++ 
Sbjct  183   FIDRTLLRARDPP--------RPVFDHIEYKPPPSMKTTQQSTKPGSDGAAVSIFKLTRE  234

Query  1033  QIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
             Q+  LKA              Y+ YE++  H+WR  CKARS    Q T L    D R R+
Sbjct  235   QLSTLKAKSKEA----GNTIHYSSYEMLAGHVWRSVCKARSLPDDQETKLYIATDGRARL  290

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
             +PP P  YFGN I       ++G+++S+P    AS+I +A+  + ++Y+  A+DF   + 
Sbjct  291   QPPPPPGYFGNVIFTTTPIAIAGDLMSKPTWYAASRIHNALSRMDNDYLRSALDFLELQP  350

Query  673   DVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNG  497
             D +K    G      PNL + +W  LP H  D GWG+ I M PG    +G   I+P    
Sbjct  351   D-LKALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSST-  408

Query  496   IDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                +DGSL VA  LQ +H++ F ++ Y+
Sbjct  409   ---NDGSLSVAIALQHEHMKVFKEFLYD  433



>gb|KHG20214.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
-like protein [Gossypium arboreum]
Length=436

 Score =   246 bits (627),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 162/450 (36%), Positives = 237/450 (53%), Gaps = 31/450 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+E T    L  S LD +    ++  +Y+Y  P+  S       L+ +LS++LV FY
Sbjct  10    IVRPAEDTPKRNLWNSNLDIVMIRYHIPTVYYYK-PNGSSDFFDAGRLKEALSKILVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADL-GDFSPGPEFNHLVPSVD  1385
             P AGRL +              CNG G + VEAE+ +V+  L GDF+   +   LVP VD
Sbjct  69    PVAGRLGYDENGRLEII-----CNGEGVLFVEAETTSVMEHLIGDFTENSQGLRLVPKVD  123

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YSG   I   PL   Q+TKF+CGG+SLG  I H + DG    HF+  WA+ + G   +  
Sbjct  124   YSG--GISSYPLIVLQVTKFKCGGVSLGVGIQHTLGDGAAALHFINSWADTSRGLTPAIV  181

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIH  1025
             PF DR LLRA +  +   P+     +  SP L     S +S+  K + VST  L+  Q++
Sbjct  182   PFIDRTLLRARDPPT---PKLHHVEYDPSPALKSALKS-QSDDHKPSIVSTFELTADQLN  237

Query  1024  ALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP  845
              LKA  N   + N  ++ Y+ + ++ AHIWRC  KAR     Q T L F VD R R++PP
Sbjct  238   TLKAKANVA-NANGGIK-YSSFNILAAHIWRCVSKARGLSADQDTKLYFPVDGRYRLDPP  295

Query  844   LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  665
             LP  YFGN I    +   +G++ +    D   +I + ++ +  EY+  AID+      + 
Sbjct  296   LPPGYFGNVIFTTALIAEAGDLETESFTDTIKRIHERLNQINDEYLRSAIDY------IE  349

Query  664   KRQELGTFFVGN-----PNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGP  503
             K  +L T   G      PNL V+ W  LP +  D GWG+ I+M PG+   +G + +LP P
Sbjct  350   KVPDLNTLVRGPHTFRCPNLVVVPWNWLPIYEADFGWGRPIYMGPGNVVQEGKIYMLPSP  409

Query  502   NGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                  +DGSL +AA L++ H++ F K  YE
Sbjct  410   ----ANDGSLTLAARLEIPHMKVFEKLIYE  435



>ref|XP_006341413.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Solanum 
tuberosum]
Length=435

 Score =   245 bits (625),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 158/448 (35%), Positives = 228/448 (51%), Gaps = 28/448 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAII-HSLRLSLSQVLVHF  1565
             +V+P+  T    L  S +D +    +   +YFY    T SP+      L+ +LS+ LV F
Sbjct  10    MVQPATETPQLRLWNSNVDLVVPNFHTPSVYFYR--PTGSPNFFDGKVLKEALSKALVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP  GRL               +C G G + VEAESD V+ D GDF+P  E   L+P+VD
Sbjct  68    YPMGGRLCRDEDGRIEI-----DCKGQGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVD  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS    I    L   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  ++  
Sbjct  123   YS--QGIESYALLVLQITHFKCGGVSLGVGMQHHAADGASGLHFINTWSDMARGLDITIP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSN--ESERMKETKVSTLRLSKPQ  1031
             PF DR LLRA +      P     + +  PP +     N   ++ + ET VS  +L++ Q
Sbjct  181   PFIDRTLLRARDPPQPQFPH----VEYQPPPTLEATEENAPNADTVPETSVSIFKLTRNQ  236

Query  1030  IHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
             I+ LKA +  +G + N     Y+ YE++  H+WR  C AR     Q T L    D R R+
Sbjct  237   INTLKAKSKEDGNTVN-----YSSYEMLAGHVWRSTCMARGLTQDQETKLYIATDGRARL  291

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
              P LP  YFGN I       V+G++ S+P+   ASKI D +  + ++Y+  A+D+   + 
Sbjct  292   RPSLPPGYFGNVIFTATPVAVAGDLQSKPIWYAASKIHDQLAIMDNDYLRSALDYLELQP  351

Query  673   DVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNG  497
             D +K    G      PNL + +W  LP H  D GWG+ I M PG    +G   ILP P  
Sbjct  352   D-LKALVRGAHTFKCPNLGITSWSRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPI-  409

Query  496   IDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                +DGS  VA  LQ +H++ F K+ Y+
Sbjct  410   ---NDGSQSVAISLQAEHMKLFEKFLYD  434



>ref|XP_011011266.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=433

 Score =   245 bits (625),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 157/450 (35%), Positives = 225/450 (50%), Gaps = 34/450 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P +      L LS +D +    Y+  +Y Y  P+  +       L+ +L +VLV FY
Sbjct  10    IVRPVQEMPKQSLWLSNMDLLHPRYYLPTVYLYK-PNGSANFFEATVLKEALGRVLVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL+              NCNG G + V A++D+   +LG+F P  E   L+P+VD 
Sbjct  69    PVAGRLARDENGRIEI-----NCNGEGVLFVVADTDSTTEELGEFMPSMELRQLIPTVD-  122

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S ++ I   PL   Q+T F+CGG+ LG    H +ADG G  HF+  WA LA G  ++  P
Sbjct  123   SNLEDISPNPLLLLQVTSFKCGGVCLGVGWHHTLADGTGALHFINSWAALARGLSITIPP  182

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQSSNESERMKETKVSTLRLSKP  1034
               DR +LR         P+    IFHH     PP +   S N     K   ++  +++  
Sbjct  183   LLDRTILRG-----RVPPKS---IFHHVEYDPPPTMNTLSKN----TKSHSLANFKITLD  230

Query  1033  QIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSH-KPQQPTNLSFCVDIRRR  857
              I++LKA  NN  S       YT YE++ AHIWR   KAR+  K  Q T L   VD R R
Sbjct  231   HINSLKAKANNVESETK----YTTYEILAAHIWRSISKARNFPKNDQKTKLLISVDGRSR  286

Query  856   MEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  677
             + PPL  SYFGN I       +SG+++S   +    +I   I  +  EY+  A+D+    
Sbjct  287   LNPPLQSSYFGNVIFTASPIALSGDLLSESFKCTVERIHREIKKMDEEYLRSALDYLEEV  346

Query  676   GDV--IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDCDGDVLILPGP  503
             GDV  +     G+     PNL+V++W+ LP +  D GWG  + M P    +G   I P P
Sbjct  347   GDVGDVNTIARGSATCACPNLTVVSWMRLPFYKADFGWGAPLLMRPATMFEGKGYIHPNP  406

Query  502   NGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                  +DGS  +A CL+ DH++ F K FYE
Sbjct  407   ----ANDGSFSLALCLETDHMESFRKLFYE  432



>gb|EPS67739.1| hypothetical protein M569_07035, partial [Genlisea aurea]
Length=428

 Score =   244 bits (624),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 159/448 (35%), Positives = 230/448 (51%), Gaps = 40/448 (9%)
 Frame = -2

Query  1738  VKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFYP  1559
             V P+  T  G L +S +D +    ++  +YFY  P+  S       L+ +L++ L  FYP
Sbjct  12    VLPAAETPRGSLRISNVDLVVPNAHMSTVYFYR-PTGASDFFDSGVLKAALAKTLDAFYP  70

Query  1558  FAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDYS  1379
              AGRL               +CN  GA+ V AESD V+ DL DF+   EF+ LVP+VDY 
Sbjct  71    VAGRLKREEDGRVVI-----DCNCEGALFVVAESDGVVDDLCDFTATSEFHRLVPNVDYF  125

Query  1378  GVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS-AP  1202
               D I   P+   Q+T F+CGG+S+G    H VADG    H +  W++ A G   +S  P
Sbjct  126   SED-ISASPILVSQVTYFKCGGVSVGVGTDHRVADGFAGLHLVNTWSDFARGCHATSIPP  184

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LLRA +  +   P     + +  PP +       +    ET  +  +L++ QI +
Sbjct  185   FLDRTLLRARDHPNPKFPH----VEYLPPPQM-----KSAAAAPETVEAIFKLTRKQIAS  235

Query  1021  LKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPL  842
             LKA   +           + Y ++ AHIWRCAC AR+    Q T L   V+ R R+ PPL
Sbjct  236   LKAQHGDNT--------LSTYVILAAHIWRCACSARALPEDQETQLDIAVNGRSRLRPPL  287

Query  841   PDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  662
             P +YFGNAI       V+G++  +PL+  A+KI++A+  +  EY+  A+D+       ++
Sbjct  288   PPAYFGNAIFTATPLSVAGDVTGKPLRHSAAKIQEALWRMDDEYLRSALDYLE-----LR  342

Query  661   RQELGTFFVGN-----PNLSVINWVGLPNHGLDLGWGKEIHMSP-GHDCDGDVLILPGPN  500
             R EL     G      PNL +++W+ LP H  D GWGK + M P G   +G   ++P P 
Sbjct  343   RLELKGLVRGRESFRCPNLGIVSWIRLPVHEADFGWGKPVFMGPAGIGYEGLCYVIPSP-  401

Query  499   GIDGDDGSLLVAACLQVDHIQDFNKYFY  416
                 DDGSL VA CL  DH++ F K  Y
Sbjct  402   ---ADDGSLSVAICLLEDHVEAFRKSLY  426



>gb|ACJ23164.1| hydroxycinnamoyl CoA quinate transferase 2 [Cynara cardunculus 
var. scolymus]
Length=443

 Score =   245 bits (625),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 147/434 (34%), Positives = 224/434 (52%), Gaps = 26/434 (6%)
 Frame = -2

Query  1705  LSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFYPFAGRlswttaa  1526
             L  S LD +   +++  +YFY  P+  S     + ++ +L+ VLV FYP AGRL      
Sbjct  32    LWTSNLDLVVGRIHILTVYFYR-PNGSSKFFDPNVMKKALADVLVSFYPMAGRLGRDETD  90

Query  1525  sgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDYSGVDPIPDIPLF  1346
                      NCN  G + VEAESD+ L D G+  P PEF  L PSVDYSG   I   PLF
Sbjct  91    RIVI-----NCNNEGVLFVEAESDSTLDDFGELKPSPEFRQLTPSVDYSG--DISSYPLF  143

Query  1345  AGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAPFHDRRLLRAGEs  1166
               Q+T F+CGG++LG  + H ++DG    HF+  W+++A G  ++  PF +R LLRA E 
Sbjct  144   FAQVTHFKCGGVALGCGVHHTLSDGLSSLHFINTWSDMARGLSVAIPPFIERTLLRAREP  203

Query  1165  ssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHALKAADNNGRSCN  986
              +   P      +H  P +        S  + ++  + L+L+  Q+++LKA     ++ +
Sbjct  204   PT---PTYDHVEYHSPPSMNTTAQKPGSGSLSKSSTTMLKLTLDQLNSLKA-----KAKS  255

Query  985   AKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDV  806
                  ++ YE++ AHIWRCACKAR     Q + L    D R R+ P LP  Y GN +   
Sbjct  256   ESGSTHSTYEILAAHIWRCACKARGLPDDQLSKLYVATDGRSRLSPRLPPGYLGNVVFTA  315

Query  805   VIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELGTFFVGNP  626
                  SG++ S+ L + A  I   +  +  +Y+  AID+  ++ D+       ++F  +P
Sbjct  316   TPVAKSGDLTSKSLSNTAKLIHTTLTKMDDDYLRSAIDYLESQPDLSALIRGPSYF-ASP  374

Query  625   NLSVINWVGLPNHGLDLGWGKEIHMSPGHDC---DGDVLILPGPNGIDGDDGSLLVAACL  455
             NL++  W  LP +  D GWG+ I M P   C   +G + +LP PN    +D S+ +A CL
Sbjct  375   NLNINAWTRLPVYDADFGWGRPIFMGPA--CILYEGTIYVLPSPN----NDRSVSLAVCL  428

Query  454   QVDHIQDFNKYFYE  413
               +    F K+ YE
Sbjct  429   DANEQPLFEKFLYE  442



>ref|XP_007033659.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
isoform 1 [Theobroma cacao]
 ref|XP_007033660.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033661.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033662.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033663.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033664.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033665.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033666.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033667.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04585.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
isoform 1 [Theobroma cacao]
 gb|EOY04586.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04587.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04588.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04589.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04590.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04591.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04592.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04593.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
Length=433

 Score =   244 bits (624),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 153/450 (34%), Positives = 234/450 (52%), Gaps = 34/450 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P++ T +  L +S +D+I    ++  +YFY  P   S    +  L+ SLS++LV FY
Sbjct  10    MVRPAQETPNQWLWMSNMDEIVIRSHIPTVYFYI-PDGSSNCLDVERLKGSLSRILVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADL-GDFSPGPEFNHLVPSVD  1385
             P AGRL +              CN  G + +EAE+ + +  L GDF+   + + LVP+VD
Sbjct  69    PVAGRLRFDENERLELI-----CNAEGVLFIEAETSSEMDLLTGDFTDSSQVSRLVPAVD  123

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YSG   I   PLF  Q+T F+CGGIS+G  + H +ADG    +F+  W+++A G PL   
Sbjct  124   YSG--GISSYPLFILQVTSFKCGGISIGVGVHHSLADGTSALNFINSWSDMARGIPLCLE  181

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHH-----SPPLIIGQSSNESERMKETKVSTLRLS  1040
             P  DR LLRA        P   R  FHH     SPPLI    S+     K + VS   ++
Sbjct  182   PLFDRTLLRA------RVPPTPR--FHHIEYEPSPPLITESESHP----KSSIVSVFNIT  229

Query  1039  KPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRR  860
                ++ LKA      +  +  + ++ + V+ AHIWRC  +AR     QPT L   VD R 
Sbjct  230   ADHVNTLKAKSQENIADTSTTK-FSTFNVLAAHIWRCVTRARFLSNDQPTKLYMAVDGRS  288

Query  859   RMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRN  680
             R+ PPLP  YFGN I       V+G++ S P+ D   +I+ A+  + +EY+   +D+   
Sbjct  289   RLHPPLPSEYFGNVIFTTATIAVAGDLQSEPITDTEKRIQKALTQMDNEYLRSILDYMEL  348

Query  679   EGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHD-CDGDVLILPGP  503
              G  +K    G+  + +PNL +++W+ LP +  D GWG+ ++M P     +G V I   P
Sbjct  349   PG--VKDLARGSRTIHSPNLGIVSWMRLPIYEADFGWGRPVYMRPAKVLVEGLVYITRTP  406

Query  502   NGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                  +DGSL V   L+   ++ F +  Y+
Sbjct  407   K----NDGSLSVVTRLEASEMKLFGELLYK  432



>ref|XP_006493385.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Citrus 
sinensis]
Length=430

 Score =   244 bits (624),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 158/445 (36%), Positives = 231/445 (52%), Gaps = 27/445 (6%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+  T    L  + +D +    +   +YFY  P+  +       L+ +LS+ LV FY
Sbjct  10    MVRPAAETPRVALWNANVDLVVPRFHTPSVYFYR-PTGAANFFDAGVLKDALSKALVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               +CN  G +LVEAE+ +++ D GDF+P  E   L+P++DY
Sbjct  69    PMAGRLKRDDDGRIEI-----DCNAEGVLLVEAETTSLIDDFGDFAPTLELKQLIPTIDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W++ A G  L+  P
Sbjct  124   SG--GISTYPLLVLQITHFKCGGVSLGVGMQHHVADGFSGLHFVNTWSDFARGLDLTIPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LLR+ +      PQ       + PP  +      S   + T VS  +L++ Q++ 
Sbjct  182   FIDRTLLRSRDP-----PQPAFEHIEYQPPPPLKHPLKSSS--ETTAVSIFKLTRDQLNI  234

Query  1021  LKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPP  845
             LKA A  +G + N     Y+ YE++  H+WR AC AR     Q T L    D R R+ PP
Sbjct  235   LKAKAKEDGNTIN-----YSSYEMLAGHVWRSACIARGLTADQETKLYIATDGRARLRPP  289

Query  844   LPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVI  665
             LP  YFGN I       V+G++ S+P+   AS+I DA+  + ++Y+  A+D+   + D+ 
Sbjct  290   LPPGYFGNVIFTATPMAVTGDLQSKPIWYAASRIHDALVRMDNDYLRSALDYLELQPDLS  349

Query  664   KRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGIDG  488
                  G      PNL + +WV LP H  D GWG+ I M PG    +G   I+P P     
Sbjct  350   ALVR-GAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSPT----  404

Query  487   DDGSLLVAACLQVDHIQDFNKYFYE  413
             +DGSL VA  LQ +H++ F K  Y+
Sbjct  405   NDGSLSVAISLQTEHMKLFEKLIYD  429



>gb|ABO77957.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Coffea 
canephora]
Length=430

 Score =   244 bits (624),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 149/446 (33%), Positives = 230/446 (52%), Gaps = 29/446 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P++PT +  L  S LD +   +++  +YFY  P+  +       L+ +LS VLV FY
Sbjct  10    MVRPAQPTPTKRLWNSNLDLLVARIHILTVYFYK-PNGSANFFDTRVLKEALSNVLVSFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL+              +CNG G + VEAESD+ + D GDF+P  E   L+P+VD 
Sbjct  69    PMAGRLARDEEGRIEI-----DCNGEGVLFVEAESDSSVDDFGDFAPSLELRRLIPTVDC  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T+F+CG  +LG  + H ++DG    HF+  W+++A G  ++  P
Sbjct  124   SG--DISSYPLVIFQVTRFKCGAAALGAGVQHNLSDGVSSLHFINTWSDIARGLTIAVPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERM--KETKVSTLRLSKPQI  1028
             F DR L+RA +            + ++ PP +   S  +  +   + +  + L+++  Q+
Sbjct  182   FIDRTLIRARDPPVPVF----EHVEYYPPPQLKSDSRIQELKTGPRASTTAVLKITPEQL  237

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               LKA  NN  S          YE++ AHIWR ACKAR     Q T L    D R R+ P
Sbjct  238   SQLKAKANNEGST---------YEILAAHIWRTACKARGLTNDQSTKLYVATDGRSRLIP  288

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  Y GN +        S  + S PL + A +I +A+  + ++Y+  A+D+   + D+
Sbjct  289   PLPPGYLGNVVFTATPIAESSNLQSEPLTNSAKRIHNALARMDNDYLRSALDYLEIQPDL  348

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGID  491
                   G     +PNL++ +W  LP H  D GWG+ IH+ P     +G V +LP P    
Sbjct  349   SALVR-GPRHFASPNLNINSWTRLPFHDADFGWGRPIHIGPAIILYEGTVYVLPSP----  403

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
             G D +L +A CL  DH+  F ++ Y+
Sbjct  404   GKDRTLSLAVCLDADHMPLFQRFLYD  429



>ref|XP_008790160.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
 ref|XP_008790161.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
 ref|XP_008790163.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
Length=434

 Score =   244 bits (623),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 154/452 (34%), Positives = 227/452 (50%), Gaps = 37/452 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAI-IHSLRLSLSQVLVHF  1565
             +V P+EPT    L  S LD +    +   +YFY      SPD      LR +L++ LV F
Sbjct  10    LVGPAEPTPRRRLWNSSLDLVVPRFHTPSVYFYRPDG--SPDFFDAERLRAALAKALVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               +CNG G + VEA +D ++ D GDF+P  E   L+P V+
Sbjct  68    YPMAGRLGRDEDGRIEI-----DCNGEGVLFVEAVADGMVDDFGDFAPTMELKRLIPKVE  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             Y+  D I   PL   Q+T F+CGG+SLG  + H  ADG    HF+  W+++ASG  +S+ 
Sbjct  123   YT--DDISAFPLLVLQVTYFKCGGVSLGVGMQHHAADGTSGLHFINSWSDVASGLGISAP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETK-------VSTLR  1046
             PF DR LLRA +  + S P        + PP  +  ++     +   K       V+  +
Sbjct  181   PFIDRTLLRARDPPTPSFPH-----VEYQPPPSMKAAATSPPSLSAVKSGDPVTAVNLFK  235

Query  1045  LSKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDI  866
              ++ Q+  LKA    G S       Y+ Y + +AH+WRCA  AR   P Q T L    D 
Sbjct  236   FTRAQLDLLKAKTPKGSS-------YSTYALFSAHVWRCASLARELPPDQLTKLYIATDG  288

Query  865   RRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFY  686
             R+R+ PPLP  YFGN I        + E++S   +  A +I+ ++  +  +Y+  A+D+ 
Sbjct  289   RQRLRPPLPAGYFGNVIFTATPVAAAAEVVSS--EGAAGRIQASLARMDDQYLRSAVDYL  346

Query  685   RNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILP  509
               + D ++    G      PN+ + +WV LP H  D GWG+ + M PG    +G   +LP
Sbjct  347   EIQPD-LRALVRGAHTFRCPNIGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLP  405

Query  508   GPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
              P+G    DGSL +A  LQ +H+  F K  Y+
Sbjct  406   SPDG----DGSLSLAISLQAEHMLRFQKLIYD  433



>dbj|BAF49306.1| putative acyltransferase [Clitoria ternatea]
Length=436

 Score =   244 bits (624),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 157/453 (35%), Positives = 237/453 (52%), Gaps = 37/453 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFY-TTPSTLSPDAIIHSLRLSLSQVLVHF  1565
             +V+P+E     ++  S +D +    +   +YFY  T ++   DA I  ++ +LS+VLV F
Sbjct  10    MVRPAEEVARRVVWNSNVDLVVPNFHTPSVYFYRATGASNFFDAKI--MKEALSKVLVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               +C+G G + VEA++ AV+ D GDF+P  +   L+P++D
Sbjct  68    YPMAGRLRRDEDGRVEI-----DCDGQGVLFVEADTGAVIDDFGDFAPTLQLRQLIPAID  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  +S  
Sbjct  123   YS--QGIETYPLLVLQVTYFKCGGVSLGVGMQHHVADGASGLHFINTWSDVARGLDVSIP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQSSNESERM---KETKVSTLR  1046
             PF DR +LRA +          R +F H     PP +   + ++  +        VS  +
Sbjct  181   PFIDRTILRARDPP--------RPVFDHIEYKPPPAMNNNTPSQPTKPGSDPTAAVSIFK  232

Query  1045  LSKPQIHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVD  869
             L++ Q+  LKA +  +G + N     Y+ YE++  H+WR  CKARS    Q T L    D
Sbjct  233   LTRDQLTTLKAKSKEDGNTVN-----YSSYEMLAGHVWRSVCKARSLPEDQETKLYIATD  287

Query  868   IRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDF  689
              R R++PP P  YFGN I       V+G+++S+P    AS+I +A+  + +EY+  A+DF
Sbjct  288   GRARLQPPPPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRMDNEYLRSALDF  347

Query  688   YRNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLIL  512
                + D +K    G      PNL + +W  LP H  D GWG+ I M PG    +G   I+
Sbjct  348   LELQPD-LKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPIFMGPGGIAYEGLSFII  406

Query  511   PGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
             P       +DGSL VA  LQ DH++ F  + Y+
Sbjct  407   PSST----NDGSLSVAIALQPDHMKVFKDFLYD  435



>ref|XP_003530223.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Glycine max]
 ref|XP_006583084.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X4 [Glycine max]
Length=438

 Score =   244 bits (624),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 157/454 (35%), Positives = 232/454 (51%), Gaps = 37/454 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSP-DAIIHSLRLSLSQVLVHF  1565
             VV+P+E     ++  S +D +    +   +YFY +  T +  D  +  L+ +LS+VLV F
Sbjct  10    VVRPAEEVARRVVWNSNVDLVVPNFHTPSVYFYRSNGTSNFFDGKV--LKEALSKVLVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               +C+G G + VEA++ AV+ D GDF+P  E   L+P+VD
Sbjct  68    YPMAGRLRRDEDGRVEI-----DCDGQGVLFVEADTGAVIDDFGDFAPTLELRQLIPAVD  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  +S  
Sbjct  123   YS--QGIETYPLLVLQVTHFKCGGVSLGVGMQHHVADGASGLHFINTWSDVARGLDVSIP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQS-----SNESERMKETKVST  1052
             PF DR +LRA +          R +F H     PP +  Q      S+         VS 
Sbjct  181   PFIDRTILRARDPP--------RPVFDHIEYKPPPAMKTQQPTKPGSDSDNAAAAAAVSI  232

Query  1051  LRLSKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCV  872
              RL++ Q++ LKA        +     Y+ YE++  H+WR  CKAR+    Q T L    
Sbjct  233   FRLTREQLNTLKAKSKE----DGNTISYSSYEMLAGHVWRSVCKARALPDDQETKLYIAT  288

Query  871   DIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAID  692
             D R R++PP P  YFGN I       V+G+++S+P    AS+I +A+  + ++Y+  A+D
Sbjct  289   DGRSRLQPPPPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRMDNDYLRSALD  348

Query  691   FYRNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLI  515
             +   + D +K    G      PNL + +W  LP H  D GWG+ I M PG    +G   I
Sbjct  349   YLELQPD-LKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPIFMGPGGIAYEGLSFI  407

Query  514   LPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
             +P       +DGSL VA  LQ DH++ F  + Y+
Sbjct  408   IPSST----NDGSLSVAIALQPDHMKVFKDFLYD  437



>gb|KDP41953.1| hypothetical protein JCGZ_26971 [Jatropha curcas]
Length=431

 Score =   244 bits (622),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 159/448 (35%), Positives = 228/448 (51%), Gaps = 32/448 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYT---TPSTLSPDAIIHSLRLSLSQVLV  1571
             +VKP+E T    L  + +D +    +   +YFY     P+   P+ +    +  LS+ LV
Sbjct  10    LVKPAEETPRRGLWNANVDLVVPRFHTPSVYFYRPTGAPTFFDPNVV----KEGLSKALV  65

Query  1570  HFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPS  1391
              FYP AGRL               +CN  G + V AE+ +V+ D GDF+P  E   L+P+
Sbjct  66    PFYPMAGRLRRDEDGRIEI-----DCNAEGVLFVVAETSSVIDDFGDFAPTLELKKLIPT  120

Query  1390  VDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLS  1211
             VDYSG   I   PL   QLT F+CGG+SLG  + H VADG    HF+  W+++  G  L+
Sbjct  121   VDYSGG--ISTYPLLVLQLTYFKCGGVSLGVGMQHHVADGFSGLHFVNTWSDMTRGLDLT  178

Query  1210  SAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQ  1031
               PF DR LLRA +      PQ       + PP  + ++  ++ +   T VS  +L++ Q
Sbjct  179   IPPFIDRTLLRARDP-----PQPAFHHIEYQPPPAM-KTPVDNSKPDSTTVSIFKLTRDQ  232

Query  1030  IHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRM  854
             ++ LK  A  +G + +     Y+ YE++  H+WR A KAR     Q T L    D R R+
Sbjct  233   LNILKTKAKEDGNTVS-----YSSYEMLAGHVWRSASKARGLVGDQETKLYIATDGRSRL  287

Query  853   EPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEG  674
             +PPLP  YFGN I        +GE+ S+P    A KI DA+  + ++Y+  A+D+   + 
Sbjct  288   QPPLPPGYFGNVIFTATPIAQAGEMQSKPTWFAARKIHDALVRMDNDYLRSALDYLELQP  347

Query  673   DVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLILPGPNG  497
             D       G      PNL + +WV LP H  D GWG+ I M PG    +G   ILP    
Sbjct  348   DPSALVR-GAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIPYEGLSFILPSAT-  405

Query  496   IDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                +DGSL VA  LQ +H++ F K  YE
Sbjct  406   ---NDGSLSVAIALQTEHMKLFEKLIYE  430



>emb|CAR92145.1| hydroxycinnamoyl CoA quinate transferase 2 [Cynara cardunculus 
var. scolymus]
Length=443

 Score =   244 bits (623),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 147/434 (34%), Positives = 224/434 (52%), Gaps = 26/434 (6%)
 Frame = -2

Query  1705  LSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFYPFAGRlswttaa  1526
             L  S LD +   +++  +YFY  P+  S     + ++ +L+ VLV FYP AGRL      
Sbjct  32    LWTSNLDLVVGRIHILTVYFYR-PNGSSKFFDPNVMKKALADVLVSFYPMAGRLGRDETD  90

Query  1525  sgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDYSGVDPIPDIPLF  1346
                      NCN  G + VEAESD+ L D G+  P PEF  L PSVDYSG   I   PLF
Sbjct  91    GIVI-----NCNNEGVLFVEAESDSTLDDFGELKPSPEFRQLTPSVDYSG--DISSYPLF  143

Query  1345  AGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAPFHDRRLLRAGEs  1166
               Q+T F+CGG++LG  + H ++DG    HF+  W+++A G  ++  PF +R LLRA E 
Sbjct  144   FAQVTHFKCGGVALGCGVHHTLSDGLSSLHFINTWSDMARGLSVAIPPFIERTLLRAREP  203

Query  1165  ssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHALKAADNNGRSCN  986
              +   P      +H  P +        S  + ++  + L+L+  Q+++LKA     ++ +
Sbjct  204   PT---PTYDHVEYHSPPSMNTTAQKPGSGSLSKSSTTMLKLTLDQLNSLKA-----KAKS  255

Query  985   AKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDV  806
                  ++ YE++ AHIWRCACKAR     Q + L    D R R+ P LP  Y GN +   
Sbjct  256   ESGSTHSTYEILAAHIWRCACKARGLPDDQLSKLYVATDGRSRLSPRLPPGYVGNVVFTA  315

Query  805   VIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELGTFFVGNP  626
                  SG++ S+ L + A  I   +  +  +Y+  AID+  ++ D+       ++F  +P
Sbjct  316   TPVAKSGDLTSKSLSNTAKLIHTTLTKMDDDYLRSAIDYLESQPDLSALIRGPSYF-ASP  374

Query  625   NLSVINWVGLPNHGLDLGWGKEIHMSPGHDC---DGDVLILPGPNGIDGDDGSLLVAACL  455
             NL++  W  LP +  D GWG+ I M P   C   +G + +LP PN    +D S+ +A CL
Sbjct  375   NLNINAWTRLPVYDADFGWGRPIFMGPA--CILYEGTIYVLPSPN----NDRSVSLAVCL  428

Query  454   QVDHIQDFNKYFYE  413
               +    F K+ YE
Sbjct  429   DANEQPLFEKFLYE  442



>emb|CAT00081.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=430

 Score =   244 bits (622),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 149/446 (33%), Positives = 230/446 (52%), Gaps = 29/446 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P++PT +  L  S LD +   +++  +YFY  P+  +       L+ +LS VLV FY
Sbjct  10    MVRPAQPTPTKRLWNSNLDLLVARIHILTIYFYK-PNGSANFFDTRVLKEALSNVLVSFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL+              +CNG G + VEAESD+ + D GDF+P  E   L+P+VD 
Sbjct  69    PMAGRLARDEEGRIEI-----DCNGEGVLFVEAESDSSVDDFGDFAPSLELRRLIPTVDC  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T+F+CG  +LG  + H ++DG    HF+  W+++A G  ++  P
Sbjct  124   SG--DISSYPLVIFQVTRFKCGAAALGAGVQHNLSDGVSSLHFINTWSDIARGLTIAVPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERM--KETKVSTLRLSKPQI  1028
             F DR L+ A +            + ++ PP +   S  +  +   + +  + L+++  Q+
Sbjct  182   FIDRTLIHARDPPVPVF----EHVEYYPPPQLKSDSRIQELKTGPRASTTAVLKITPEQL  237

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               LKA  NN  S          YE++ AHIWR ACKAR     Q T L    D R R+ P
Sbjct  238   SQLKAKANNEGST---------YEILAAHIWRTACKARGLTNDQSTKLYVATDGRSRLIP  288

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  Y GN +        S ++ S PL + A +I +A+  + ++Y+  A+D+   + D+
Sbjct  289   PLPPGYLGNVVFTATPIAESSDLQSEPLTNSAKRIHNALARMDNDYLRSALDYLEIQPDL  348

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGID  491
                   G     +PNL++ +W  LP H  D GWG+ IH+ P     +G V +LP P    
Sbjct  349   SALVR-GPRHFASPNLNINSWTRLPFHDADFGWGRPIHIGPAIILYEGTVYVLPSP----  403

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
             G D +L +A CL  DH+  F K+ Y+
Sbjct  404   GKDRTLSLAVCLDADHMPLFQKFLYD  429



>emb|CBI25231.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   243 bits (620),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 155/444 (35%), Positives = 223/444 (50%), Gaps = 49/444 (11%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+E T    L  S +D +   M+   +YFY  PS  +       ++ +LS+VLV FY
Sbjct  10    MVRPAEETPRRSLWNSNVDLVVPRMHTPSVYFYR-PSGAANFFDPQVMKEALSKVLVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               +CN  G + VEA++ +V+ D GDF+P  E   L+P+VDY
Sbjct  69    PMAGRLRRDEDGRIEI-----DCNAEGVLFVEADTGSVIDDFGDFAPTLELRQLIPTVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I    L   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  ++  P
Sbjct  124   SG--DIGSYSLLILQVTHFKCGGVSLGVGMQHHVADGASGLHFINTWSDMARGLDITIPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHA  1022
             F DR LLRA +      PQ     FHH                       + +++ Q++ 
Sbjct  182   FIDRTLLRARDP-----PQPA---FHH-----------------------IEITRDQLNT  210

Query  1021  LKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPL  842
             LK    N    +     Y+ Y ++  H+WRCACKARS    Q + +    D R R+ P L
Sbjct  211   LK----NKSKEDGNTISYSSYVMLAGHVWRCACKARSLPADQDSKMYIATDGRSRLRPAL  266

Query  841   PDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIK  662
             P  YFGN I       V+GE++S+PL   ASKI +A+  +  EY+  A+D+   + D+  
Sbjct  267   PPGYFGNVIFTTTPVAVAGELMSKPLWYAASKIHNALARMDDEYLRSALDYLELQPDLTA  326

Query  661   RQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGH-DCDGDVLILPGPNGIDGD  485
                 G      PN+ + +W  LP +  D GWG+ I M PG    +G    LP P     +
Sbjct  327   LVR-GAHTFRCPNIGITSWTRLPIYDADFGWGRPIFMGPGGIALEGLAFALPSPT----N  381

Query  484   DGSLLVAACLQVDHIQDFNKYFYE  413
             DGSL +A  LQ DH++ F KY YE
Sbjct  382   DGSLSIAISLQEDHMKLFQKYLYE  405



>ref|XP_009375480.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
 ref|XP_009375481.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=438

 Score =   244 bits (622),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 156/454 (34%), Positives = 228/454 (50%), Gaps = 39/454 (9%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST-----LSPDAIIHSLRLSLSQV  1577
             +VKP+E T    L  S +D +   ++   +YFY            P  + H+L    S+ 
Sbjct  12    MVKPAEETPKKALWNSNVDLVIPSIHTPSVYFYRPNQNGGSNFFDPAVLKHAL----SKA  67

Query  1576  LVHFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLV  1397
             LV FYP AG              + ++C G G + VEAE+ +VL D GDF+P  E   L+
Sbjct  68    LVPFYPMAG-----GLKRDDDGRIEIDCGGQGVLFVEAETGSVLDDFGDFAPTLELRRLI  122

Query  1396  PSVDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKP  1217
             P+VDYS    +    L   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  
Sbjct  123   PAVDYSA--GVSTYALLVLQVTYFKCGGVSLGVGMQHHVADGFSGLHFINTWSDMARGLD  180

Query  1216  LSSAPFHDRRLLRAGEsssssSPQGGRRIFHH-----SPPLIIGQSSNESERMKETKVST  1052
             L+  PF DR LLR+ +      PQ     FHH     +PP+     S +      T VS 
Sbjct  181   LTIPPFIDRTLLRSRDP-----PQPA---FHHIEYQPAPPMKTPLQSAKPGAADTTTVSI  232

Query  1051  LRLSKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCV  872
              RL++ Q++ LK+      +  +    Y+ YE+ + H+WRC CKAR     Q T L    
Sbjct  233   FRLTRDQLNILKSKSKEAGNTVS----YSSYEMFSGHVWRCVCKARELPDDQDTKLYIAT  288

Query  871   DIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAID  692
             D R R++PPLP  YFGN I       V+G++ S+P    AS+I DA+  +   Y+  A+D
Sbjct  289   DGRSRLQPPLPPGYFGNVIFTTTPIAVAGDLQSKPTWYAASRIHDALVRMDDNYLRSALD  348

Query  691   FYRNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLI  515
             +   + D+      G      PNL + +WV LP H  D GWG+ I M PG    +G   +
Sbjct  349   YLELQPDLSALVR-GAHTFRCPNLGITSWVRLPIHDADFGWGQPIFMGPGGIAFEGLAFV  407

Query  514   LPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
             LP       +DGSL +A  LQ +H++ F++  Y+
Sbjct  408   LPSAT----NDGSLSLAISLQSEHMKSFSRLLYD  437



>emb|CDP02827.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   245 bits (625),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 150/446 (34%), Positives = 230/446 (52%), Gaps = 29/446 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P++PT +  L  S LD +   +++  +YFY  P+  +       L+ +LS VLV FY
Sbjct  64    MVRPAQPTPTKRLWNSNLDLLVARIHILTVYFYK-PNGSANFFDTRVLKEALSNVLVSFY  122

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL+              +CNG G + VEAESD+ + D GDF+P  E   L+P+VD 
Sbjct  123   PMAGRLARDEEGRIEI-----DCNGEGVLFVEAESDSSVDDFGDFAPSLELRRLIPTVDC  177

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T+F+CG  +LG  + H ++DG    HF+  W+++A G  ++  P
Sbjct  178   SG--DISSYPLVIFQVTRFKCGAAALGAGVQHNLSDGVSSLHFINTWSDIARGLTIAVPP  235

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERM--KETKVSTLRLSKPQI  1028
             F DR L+RA +            + ++ PP +   S  +  +   + +  + L+++  Q+
Sbjct  236   FIDRTLIRARDPPVPVF----EHVEYYPPPQLKSDSRIQELKTGPRASTTAVLKITPEQL  291

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               LKA  NN  S          YE++ AHIWR ACKAR     Q T L    D R R+ P
Sbjct  292   SQLKAKANNEGST---------YEILAAHIWRTACKARGLTNDQSTKLYVATDGRSRLIP  342

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  Y GN +        S  + S PL + A +I +A+  + ++Y+  A+D+   + D+
Sbjct  343   PLPPGYLGNVVFTATPIAESSNLQSEPLTNSAKRIHNALARMDNDYLRSALDYLEIQPDL  402

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGID  491
                   G     +PNL++ +W  LP H  D GWG+ IH+ P     +G V +LP P    
Sbjct  403   SALVR-GPRHFASPNLNINSWTRLPFHDADFGWGRPIHIGPAIILYEGTVYVLPSP----  457

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
             G D +L +A CL  DH+  F K+ Y+
Sbjct  458   GKDRTLSLAVCLDADHMPLFQKFLYD  483



>ref|XP_006583083.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X3 [Glycine max]
Length=462

 Score =   244 bits (623),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 157/454 (35%), Positives = 232/454 (51%), Gaps = 37/454 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSP-DAIIHSLRLSLSQVLVHF  1565
             VV+P+E     ++  S +D +    +   +YFY +  T +  D  +  L+ +LS+VLV F
Sbjct  34    VVRPAEEVARRVVWNSNVDLVVPNFHTPSVYFYRSNGTSNFFDGKV--LKEALSKVLVPF  91

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               +C+G G + VEA++ AV+ D GDF+P  E   L+P+VD
Sbjct  92    YPMAGRLRRDEDGRVEI-----DCDGQGVLFVEADTGAVIDDFGDFAPTLELRQLIPAVD  146

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  +S  
Sbjct  147   YS--QGIETYPLLVLQVTHFKCGGVSLGVGMQHHVADGASGLHFINTWSDVARGLDVSIP  204

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQS-----SNESERMKETKVST  1052
             PF DR +LRA +          R +F H     PP +  Q      S+         VS 
Sbjct  205   PFIDRTILRARDPP--------RPVFDHIEYKPPPAMKTQQPTKPGSDSDNAAAAAAVSI  256

Query  1051  LRLSKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCV  872
              RL++ Q++ LKA        +     Y+ YE++  H+WR  CKAR+    Q T L    
Sbjct  257   FRLTREQLNTLKAKSKE----DGNTISYSSYEMLAGHVWRSVCKARALPDDQETKLYIAT  312

Query  871   DIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAID  692
             D R R++PP P  YFGN I       V+G+++S+P    AS+I +A+  + ++Y+  A+D
Sbjct  313   DGRSRLQPPPPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRMDNDYLRSALD  372

Query  691   FYRNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLI  515
             +   + D +K    G      PNL + +W  LP H  D GWG+ I M PG    +G   I
Sbjct  373   YLELQPD-LKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPIFMGPGGIAYEGLSFI  431

Query  514   LPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
             +P       +DGSL VA  LQ DH++ F  + Y+
Sbjct  432   IPSST----NDGSLSVAIALQPDHMKVFKDFLYD  461



>gb|KHN04193.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=436

 Score =   243 bits (621),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 156/452 (35%), Positives = 231/452 (51%), Gaps = 35/452 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSP-DAIIHSLRLSLSQVLVHF  1565
             VV+P+E     ++  S +D +    +   +YFY +  T +  D  +  L+ +LS+VLV F
Sbjct  10    VVRPAEEVARRVVWNSNVDLVVPNFHTPSVYFYRSNGTSNFFDGKV--LKEALSKVLVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               +C+G G + VEA++ AV+ D GDF+P  E   L+P+VD
Sbjct  68    YPMAGRLRRDEDGRVEI-----DCDGQGVLFVEADTGAVIDDFGDFAPTLELRQLIPAVD  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  +S  
Sbjct  123   YS--QGIETYPLLVLQVTHFKCGGVSLGVGMQHHVADGASGLHFINTWSDVARGLDVSIP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQSSNE---SERMKETKVSTLR  1046
             PF DR +LRA +          R +F H     PP +  Q   +           VS  R
Sbjct  181   PFIDRTILRARDPP--------RPVFDHIEYKPPPAMKTQQPTKPGSDSDNAAAAVSIFR  232

Query  1045  LSKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDI  866
             L++ Q++ LKA        +     Y+ YE++  H+WR  CKAR+    Q T L    D 
Sbjct  233   LTREQLNTLKAKSKE----DGNTISYSSYEMLAGHVWRSVCKARALPDDQETKLYIATDG  288

Query  865   RRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFY  686
             R R++PP P  YFGN I       V+G+++S+P    AS+I +A+  + ++Y+  A+D+ 
Sbjct  289   RSRLQPPPPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRMDNDYLRSALDYL  348

Query  685   RNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILP  509
               + D +K    G      PNL + +W  LP H  D GWG+ I M PG    +G   I+P
Sbjct  349   ELQPD-LKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIP  407

Query  508   GPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                    +DGSL VA  LQ DH++ F  + Y+
Sbjct  408   SST----NDGSLSVAIALQPDHMKVFKDFLYD  435



>ref|XP_006583082.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Glycine max]
Length=465

 Score =   244 bits (623),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 157/454 (35%), Positives = 232/454 (51%), Gaps = 37/454 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSP-DAIIHSLRLSLSQVLVHF  1565
             VV+P+E     ++  S +D +    +   +YFY +  T +  D  +  L+ +LS+VLV F
Sbjct  37    VVRPAEEVARRVVWNSNVDLVVPNFHTPSVYFYRSNGTSNFFDGKV--LKEALSKVLVPF  94

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               +C+G G + VEA++ AV+ D GDF+P  E   L+P+VD
Sbjct  95    YPMAGRLRRDEDGRVEI-----DCDGQGVLFVEADTGAVIDDFGDFAPTLELRQLIPAVD  149

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  +S  
Sbjct  150   YS--QGIETYPLLVLQVTHFKCGGVSLGVGMQHHVADGASGLHFINTWSDVARGLDVSIP  207

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQS-----SNESERMKETKVST  1052
             PF DR +LRA +          R +F H     PP +  Q      S+         VS 
Sbjct  208   PFIDRTILRARDPP--------RPVFDHIEYKPPPAMKTQQPTKPGSDSDNAAAAAAVSI  259

Query  1051  LRLSKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCV  872
              RL++ Q++ LKA        +     Y+ YE++  H+WR  CKAR+    Q T L    
Sbjct  260   FRLTREQLNTLKAKSKE----DGNTISYSSYEMLAGHVWRSVCKARALPDDQETKLYIAT  315

Query  871   DIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAID  692
             D R R++PP P  YFGN I       V+G+++S+P    AS+I +A+  + ++Y+  A+D
Sbjct  316   DGRSRLQPPPPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRMDNDYLRSALD  375

Query  691   FYRNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLI  515
             +   + D +K    G      PNL + +W  LP H  D GWG+ I M PG    +G   I
Sbjct  376   YLELQPD-LKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPIFMGPGGIAYEGLSFI  434

Query  514   LPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
             +P       +DGSL VA  LQ DH++ F  + Y+
Sbjct  435   IPSST----NDGSLSVAIALQPDHMKVFKDFLYD  464



>ref|XP_007011895.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007011896.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29514.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29515.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
Length=449

 Score =   243 bits (621),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 151/446 (34%), Positives = 226/446 (51%), Gaps = 21/446 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+  T +  L  S LD + +  +V ++YF+      S       L+ SLS +LV FY
Sbjct  10    MVRPARDTPNRRLWNSNLDLVISRYHVALVYFFYKSDGSSNFFDTQLLKESLSNLLVPFY  69

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL +              CN  G + +E+E+ A L DLGDF+P  +   LVP+VDY
Sbjct  70    PMAGRLGYDENGRLEIV-----CNAEGVLFIESETAATLDDLGDFAPSSKLRQLVPTVDY  124

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T F+ GG+SLG A  H + DG  + +F+  W+N   G  ++  P
Sbjct  125   SG--DISSFPLVLLQVTSFKHGGVSLGAAFQHTLVDGSSVCYFMNSWSNTTRGLSITVTP  182

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSS-NESERMKETKVSTLRLSKPQIH  1025
               DR LLRA      S+P      +  SPPL    S+ N     K +  S  +++  Q+ 
Sbjct  183   SIDRTLLRA---RVPSAPAFHHVEYDQSPPLNTSISALNSQVGPKPSSTSIFKITADQLK  239

Query  1024  ALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
              LK+ A  NG   N      T Y+++TAH+W C CKAR     Q T L   +D R ++ P
Sbjct  240   TLKSKATMNG---NTTKTNRTTYDILTAHVWHCVCKARGLSDDQATKLYIPIDGRSKLHP  296

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  Y GN I       +SG++ S P  D   +I   +  +  +Y+  A+D+  +  D 
Sbjct  297   PLPPGYLGNVIFIAATTALSGDLQSEPFADTIQRINRMVKRMDDKYMRSALDYIESVPD-  355

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGID  491
             +K    G     +PNLS+ +W+ LP +  D GWG+ +H+   +   +G + I+P P    
Sbjct  356   MKTLMRGAHTFQSPNLSINSWMRLPLYAADFGWGRPMHVGLANVIHEGKICIVPSP----  411

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
              DDGSL +  CL+  H++ F K  Y+
Sbjct  412   VDDGSLSLVVCLETSHMKQFEKCLYD  437



>gb|AFP49814.1| caffeoyl-CoA quinic acid caffeoyl transferase 4 [Coffea arabica]
Length=430

 Score =   243 bits (619),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 149/446 (33%), Positives = 229/446 (51%), Gaps = 29/446 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P++PT +  L  S LD +   +++  +YFY  P+  +       L+ +LS VLV FY
Sbjct  10    MVRPAQPTPTKRLWNSNLDLLVARIHILTVYFYK-PNGSANFFDTRVLKEALSNVLVSFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL+              +CNG G + VEAESD+ + D GDF+P  E   L+P+VD 
Sbjct  69    PMAGRLARDEEGRIEI-----DCNGEGVLFVEAESDSSVDDFGDFAPSLELRRLIPTVDC  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T+F+CG  +LG  + H ++DG    HF+  W+++A G  ++  P
Sbjct  124   SG--DISSYPLVIFQVTRFKCGAAALGAGVQHNLSDGVSSLHFINTWSDIARGLTIAVPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERM--KETKVSTLRLSKPQI  1028
             F DR L+ A +            + ++ PP +   S  +  +   + +  + L+++  Q+
Sbjct  182   FIDRTLIHARDPPVPVF----EHVEYYPPPQLKSDSRIQELKTGPRASTTAVLKITPEQL  237

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               LKA  NN  S          YE++ AHIWR ACKAR     Q T L    D R R+ P
Sbjct  238   SQLKAKANNEGST---------YEILAAHIWRTACKARGLTNDQSTKLYVATDGRSRLIP  288

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  Y GN +        S  + S PL + A +I +A+  + ++Y+  A+D+   + D+
Sbjct  289   PLPPGYLGNVVFTATPIAESSNLQSEPLTNSAKRIHNALARMDNDYLRSALDYLEIQPDL  348

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGID  491
                   G     +PNL++ +W  LP H  D GWG+ IH+ P     +G V +LP P    
Sbjct  349   SALVR-GPRHFASPNLNINSWTRLPFHDADFGWGRPIHIGPAIILYEGTVYVLPSP----  403

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
             G D +L +A CL  DH+  F K+ Y+
Sbjct  404   GKDRTLSLAVCLDADHMPLFQKFLYD  429



>ref|XP_006465544.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Citrus sinensis]
Length=437

 Score =   243 bits (620),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 155/445 (35%), Positives = 221/445 (50%), Gaps = 22/445 (5%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +++P+  T    L  SELD +   ++   +YFY  P+  S       L+ +LS+VLV +Y
Sbjct  10    IIRPAHETPKHCLKNSELDLLVPSIHAPGVYFYRRPNNSSDFFGAGLLKEALSKVLVPYY  69

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               NCNG G + +EAE+  V+ DLGDF        LVP+VD 
Sbjct  70    PMAGRLGRAENGKFTDI----NCNGEGVLFMEAETTCVIDDLGDFESNTILLKLVPNVD-  124

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
                  I   PL   Q+T F+CGG SLG  + H +AD   + HF+  WA +  G  +S+ P
Sbjct  125   -STKDISSCPLLVTQVTHFKCGGASLGIGVYHTLADATSVFHFINAWAEMTHGISISNFP  183

Query  1201  FHDRRLLRAGEsssssSPQGGR--RIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQI  1028
             F DR +L  G       P   +   I H  PP I     +++ R   T +  L +S  QI
Sbjct  184   FIDRTVLEIG------VPTCAKFHHIEHDPPPSINNAPIDQNPRPISTAI--LNMSVDQI  235

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
             + LKA           +  +TR+E++ AHIWRC CKAR     Q + L F ++ R R+ P
Sbjct  236   NTLKAKSKENYGPTNTI-NFTRFEILAAHIWRCLCKARGLSNDQVSKLYFPINGRSRLNP  294

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  YFGN I       +SG+IIS PL     +I  A+  +  EY+  A+ + +   DV
Sbjct  295   PLPSGYFGNVIFPGTSLALSGDIISEPLSSTCERIHKALMRMDDEYLKSALAYLKQLPDV  354

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDCDGDVLILPGPNGIDG  488
             +  +  G+     PNL+V N   +  +  + GWG+ +   P    DG   ILP PN    
Sbjct  355   MVLRR-GSHTFKCPNLNVSNLCHMCVYDANFGWGRPMFFRPIAVSDGVGFILPSPN----  409

Query  487   DDGSLLVAACLQVDHIQDFNKYFYE  413
             +DGSL +   L+   IQ F K+FYE
Sbjct  410   NDGSLYLVINLETQRIQLFRKFFYE  434



>gb|KEH28560.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=433

 Score =   243 bits (619),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 155/449 (35%), Positives = 227/449 (51%), Gaps = 32/449 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+PSE      +  S +D +    +   +YFY  P+  S       L+ +LS+VLV FY
Sbjct  10    MVRPSEEVTQRTVWNSNVDLVVPNFHTPSVYFYR-PNGASNFFDAKVLKEALSKVLVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL               +C+G G + VEA++  V+ D GDF+P  E   L+P+VDY
Sbjct  69    PMAGRLRRDEDGRVEI-----DCDGQGVLFVEADTGGVVDDFGDFAPTLELRQLIPAVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  +S  P
Sbjct  124   S--RGIETYPLLVLQVTYFKCGGVSLGVGMQHHVADGASGLHFINTWSDVARGLDVSMPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQSSNESERMKETKVSTLRLSKP  1034
             F DR LLRA +          R +F H     PP +               VS  +L++ 
Sbjct  182   FIDRTLLRARDPP--------RPVFDHIEYKPPPSMKTHQQPTKPGSDGAAVSIFKLTRE  233

Query  1033  QIHALKAADNN-GRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRR  857
             Q++ LKA     G + +     Y+ YE++  H+WR  CKARS    Q T L    D R R
Sbjct  234   QLNTLKAKSKEAGNTIH-----YSSYEMLAGHVWRSVCKARSLPDDQETKLYIATDGRAR  288

Query  856   MEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  677
             ++PP P  YFGN I       ++G+++++P    AS+I +A+  + +EY+  A+DF   +
Sbjct  289   LQPPPPPGYFGNVIFTTTPIAIAGDLMTKPTWYAASRIHNALSRMDNEYLRSALDFLELQ  348

Query  676   GDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPN  500
              D +K    G      PNL + +W  LP H  D GWG+ I M PG    +G   I+P   
Sbjct  349   PD-LKALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPS--  405

Query  499   GIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                 +DGSL VA  LQ +H++ F  + Y+
Sbjct  406   --SANDGSLSVAIALQHEHMKVFKDFLYD  432



>ref|XP_008228811.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=440

 Score =   243 bits (620),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 157/454 (35%), Positives = 229/454 (50%), Gaps = 38/454 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST---------LSPDAIIHSLRLS  1589
             +VKP+E T   +L ++ LD +    +   +YFY                P      L+ +
Sbjct  13    LVKPAEETPRQVLWMTNLDLVILGNHTPSVYFYRQNQNSVHGHHNNFFDPQV----LKQA  68

Query  1588  LSQVLVHFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEF  1409
             LS+ LV FYP AGRL       G       +CN  GA+ + AE+ + + D GDF+P  EF
Sbjct  69    LSKALVPFYPLAGRLGKEGNGRGEI-----DCNAEGALFIVAETSSTIEDFGDFAPTLEF  123

Query  1408  NHLVPSVDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLA  1229
               L+P+VDYS    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A
Sbjct  124   RKLIPAVDYSA--GISTYPLLVLQVTYFKCGGVSLGVGLEHRVADGLSGLHFVNTWSDIA  181

Query  1228  SGKPLSSAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTL  1049
              G  L+  PF DR LLRA +      P      +   PP+  G  +   E      VS  
Sbjct  182   RGLDLTIPPFIDRTLLRARDPPQ---PAFDHIEYQPDPPIKTGTKAVGDE---SATVSIF  235

Query  1048  RLSKPQIHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCV  872
             RL++ Q++ LKA +  +G + N     YT YE++  H+WRCA  AR     Q T L   V
Sbjct  236   RLTREQLNILKAKSKEDGNTIN-----YTTYEMLAGHVWRCASVARELPDDQETKLHIAV  290

Query  871   DIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAID  692
             D R R++PPLP  +FGN +        +G++ S+P    AS+I D +  + ++Y+  A+D
Sbjct  291   DGRSRLQPPLPPGFFGNVVFAGAPIAAAGDLKSKPTWYAASRIHDTVVRMDNDYLRSALD  350

Query  691   FYRNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSP-GHDCDGDVLI  515
             +   + D++     G      P L++ NW  LP +  D GWG+ I M P G   +G   +
Sbjct  351   YLELQPDLLPLVR-GARTFRCPRLAITNWSRLPIYDADFGWGRPIFMGPGGMGYEGLAFV  409

Query  514   LPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
             LP       +DGSL VA  LQ  H++ F+K  YE
Sbjct  410   LPSAT----NDGSLSVAISLQSQHMKSFSKLLYE  439



>gb|ADL62854.1| hydroxycinnamoyl-CoA transferase 1 [Cynara cardunculus var. scolymus]
Length=443

 Score =   243 bits (620),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 146/434 (34%), Positives = 224/434 (52%), Gaps = 26/434 (6%)
 Frame = -2

Query  1705  LSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFYPFAGRlswttaa  1526
             L  S LD +   +++  +YFY  P+  S     + ++ +L+ VLV FYP AGRL      
Sbjct  32    LWTSNLDLVVGRIHILTVYFYR-PNGSSKFFDPNVMKKALADVLVSFYPMAGRLGRDETD  90

Query  1525  sgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDYSGVDPIPDIPLF  1346
                      NCN  G + VEAESD+ L D G+  P P F  L PSVDYSG   I   PL 
Sbjct  91    RIVI-----NCNNEGVLFVEAESDSTLDDFGELKPSPVFRQLTPSVDYSG--DISSYPLL  143

Query  1345  AGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAPFHDRRLLRAGEs  1166
               Q+T F+CGG++LG  + H ++DG  + HF+  W+++A G  ++  PF +R LLRA E 
Sbjct  144   FAQVTHFKCGGVALGCGVHHTLSDGLSLLHFINTWSDMARGLSVAIPPFIERTLLRAREP  203

Query  1165  ssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRLSKPQIHALKAADNNGRSCN  986
              +   P      +H  P +        S  + ++  + L+L+  Q+++LKA     ++ +
Sbjct  204   PT---PTYDHVEYHSPPSMNTTAQKPGSGSLSKSSTTMLKLTLDQLNSLKA-----KAKS  255

Query  985   AKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEPPLPDSYFGNAIIDV  806
                  ++ YE++ AHIWRCACKAR     Q + L    D R R+ P LP  Y GN +   
Sbjct  256   ESGSTHSTYEILAAHIWRCACKARGLPDDQLSKLYVATDGRSRLSPRLPPGYLGNVVFTA  315

Query  805   VIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDVIKRQELGTFFVGNP  626
                  SG++ S+ L + A  I   +  +  +Y+  AID+  ++ D+       ++F  +P
Sbjct  316   TPVAKSGDLTSKSLSNTAKLIHTTLTKMDDDYLRSAIDYLESQPDLSALIRGPSYF-ASP  374

Query  625   NLSVINWVGLPNHGLDLGWGKEIHMSPGHDC---DGDVLILPGPNGIDGDDGSLLVAACL  455
             NL++  W  LP +  DLGWG+ I M P   C   +G + +LP PN    +D S+ +A CL
Sbjct  375   NLNINAWTRLPVYDADLGWGRPIFMGPA--CILYEGTIYVLPSPN----NDRSVSLAVCL  428

Query  454   QVDHIQDFNKYFYE  413
               +    F K+ YE
Sbjct  429   DANEQPLFEKFLYE  442



>gb|ABO77956.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Coffea 
canephora]
Length=430

 Score =   243 bits (619),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 149/446 (33%), Positives = 229/446 (51%), Gaps = 29/446 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P++PT +  L  S LD +   +++  +YFY  P+  +       L+ +LS VLV FY
Sbjct  10    MVRPAQPTPTKRLWNSNLDLLVARIHILTVYFYK-PNGSANFFDTRVLKEALSNVLVSFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P AGRL+              +CNG G + VEAESD+ + D GDF+P  E   L+P+VD 
Sbjct  69    PMAGRLARDEEGRIEI-----DCNGEGVLFVEAESDSSVDDFGDFAPSLELRRLIPTVDC  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             SG   I   PL   Q+T+F+CG  +LG  + H ++DG    HF+  W+++A    ++  P
Sbjct  124   SG--DISSYPLVIFQVTRFKCGAAALGAGVQHNLSDGVSSLHFINAWSDIARDLTIAVPP  181

Query  1201  FHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERM--KETKVSTLRLSKPQI  1028
             F DR L+RA +            + ++ PP +   S  +  +   + +  + L+++  Q+
Sbjct  182   FIDRTLIRARDPPVPVF----EHVEYYPPPQLKSDSRIQELKTGPRASTTAVLKITPEQL  237

Query  1027  HALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRRMEP  848
               LKA  NN  S          YE++ AHIWR ACKAR     Q T L    D R R+ P
Sbjct  238   SQLKAKANNEGST---------YEILAAHIWRTACKARGLTNDQSTKLYVATDGRSRLIP  288

Query  847   PLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNEGDV  668
             PLP  Y GN +        S  + S PL + A +I +A+  + ++Y+  A+D+   + D+
Sbjct  289   PLPPGYLGNVVFTATPIAESSNLQSEPLTNSAKRIHNALARMDNDYLRSALDYLEIQPDL  348

Query  667   IKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPNGID  491
                   G     +PNL++ +W  LP H  D GWG+ IH+ P     +G V +LP P    
Sbjct  349   SALVR-GPRHFASPNLNINSWTRLPFHDADFGWGRPIHIGPAIILYEGTVYVLPSP----  403

Query  490   GDDGSLLVAACLQVDHIQDFNKYFYE  413
             G D +L +A CL  DH+  F K+ Y+
Sbjct  404   GKDRTLSLAVCLDADHMPLFQKFLYD  429



>ref|XP_004507045.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Cicer arietinum]
Length=449

 Score =   243 bits (619),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 157/453 (35%), Positives = 232/453 (51%), Gaps = 37/453 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSP-DAIIHSLRLSLSQVLVHF  1565
             +V+PS+      +  S +D +    +   +YFY T S  +  DA I  ++ +LS+VLV F
Sbjct  23    MVRPSDEVTRRTVWNSNVDLVVPNFHTPSVYFYRTNSASNFFDAKI--IKEALSKVLVPF  80

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               +CNG G + +EA++  V+ D GDF+P  +   L+P+VD
Sbjct  81    YPMAGRLRRDEDGRVEI-----DCNGQGVLFIEADTGVVIDDFGDFAPTLKLRQLIPAVD  135

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  +S  
Sbjct  136   YS--QGIETYPLLVLQVTYFKCGGVSLGVGMQHHVADGASGLHFINTWSDVARGLDVSIP  193

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQSSNESERMKE---TKVSTLR  1046
             PF DR LLRA +          R +F H     PP +     N+  +        VS  +
Sbjct  194   PFIDRTLLRARDPP--------RPVFEHIEYKPPPSMKTSPHNQPTKADSEATAAVSIFK  245

Query  1045  LSKPQIHALKAADNN-GRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVD  869
             L++ Q+  LKA     G + N     Y+ YE++  H+WR  CKARS    Q T L    D
Sbjct  246   LTREQLVTLKAKSKEAGNTIN-----YSSYEMLAGHVWRSVCKARSLPDDQETKLYIATD  300

Query  868   IRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDF  689
              R R++PP P  YFGN I       ++G+++S+P    AS+I +A+  + +EY+  A+D+
Sbjct  301   GRARLQPPPPPGYFGNVIFTTTPIAIAGDLMSKPTWYAASRIHNALSRMDNEYLRSALDY  360

Query  688   YRNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLIL  512
                + D +K    G      PNL + +W  LP H  D GWG+ I M PG    +G   I+
Sbjct  361   LELQPD-LKALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLSFII  419

Query  511   PGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
             P       +DGSL VA  LQ +H++ F +  Y+
Sbjct  420   PSST----NDGSLSVAIALQHEHMKVFKELLYD  448



>ref|XP_004507046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Cicer arietinum]
Length=436

 Score =   242 bits (618),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 157/453 (35%), Positives = 232/453 (51%), Gaps = 37/453 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSP-DAIIHSLRLSLSQVLVHF  1565
             +V+PS+      +  S +D +    +   +YFY T S  +  DA I  ++ +LS+VLV F
Sbjct  10    MVRPSDEVTRRTVWNSNVDLVVPNFHTPSVYFYRTNSASNFFDAKI--IKEALSKVLVPF  67

Query  1564  YPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVD  1385
             YP AGRL               +CNG G + +EA++  V+ D GDF+P  +   L+P+VD
Sbjct  68    YPMAGRLRRDEDGRVEI-----DCNGQGVLFIEADTGVVIDDFGDFAPTLKLRQLIPAVD  122

Query  1384  YSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSA  1205
             YS    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  +S  
Sbjct  123   YS--QGIETYPLLVLQVTYFKCGGVSLGVGMQHHVADGASGLHFINTWSDVARGLDVSIP  180

Query  1204  PFHDRRLLRAGEsssssSPQGGRRIFHH----SPPLIIGQSSNESERMKE---TKVSTLR  1046
             PF DR LLRA +          R +F H     PP +     N+  +        VS  +
Sbjct  181   PFIDRTLLRARDPP--------RPVFEHIEYKPPPSMKTSPHNQPTKADSEATAAVSIFK  232

Query  1045  LSKPQIHALKAADNN-GRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVD  869
             L++ Q+  LKA     G + N     Y+ YE++  H+WR  CKARS    Q T L    D
Sbjct  233   LTREQLVTLKAKSKEAGNTIN-----YSSYEMLAGHVWRSVCKARSLPDDQETKLYIATD  287

Query  868   IRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDF  689
              R R++PP P  YFGN I       ++G+++S+P    AS+I +A+  + +EY+  A+D+
Sbjct  288   GRARLQPPPPPGYFGNVIFTTTPIAIAGDLMSKPTWYAASRIHNALSRMDNEYLRSALDY  347

Query  688   YRNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLIL  512
                + D +K    G      PNL + +W  LP H  D GWG+ I M PG    +G   I+
Sbjct  348   LELQPD-LKALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLSFII  406

Query  511   PGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
             P       +DGSL VA  LQ +H++ F +  Y+
Sbjct  407   PSST----NDGSLSVAIALQHEHMKVFKELLYD  435



>ref|XP_003543709.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Glycine max]
Length=439

 Score =   242 bits (618),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 156/453 (34%), Positives = 225/453 (50%), Gaps = 31/453 (7%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPSTLSPDAIIHSLRLSLSQVLVHFY  1562
             +V+P+E T    L  S +D +    +   +YFY  P+ +S       ++ +LS+VLV FY
Sbjct  10    MVRPAEETPRRALWNSNVDLVVPNFHTPSVYFYR-PNGVSNFFDAKVMKEALSKVLVPFY  68

Query  1561  PFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSVDY  1382
             P A RL                C+  G + VEAE+ A + D GDFSP  E   L+PSVDY
Sbjct  69    PMAARLRRDDDGRVEIY-----CDAQGVLFVEAETTAAIEDFGDFSPTLELRQLIPSVDY  123

Query  1381  SGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSSAP  1202
             S    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A G  +S  P
Sbjct  124   SA--GIHSYPLLVLQVTYFKCGGVSLGVGMQHHVADGASGLHFINAWSDVARGLDISLPP  181

Query  1201  FHDRRLLRAGE-------sssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTLRL  1043
             F DR LLRA +             P   ++     P   +G  S          VST +L
Sbjct  182   FIDRTLLRARDPPLPVFDHIEYKPPPATKKTTPLQPSKPLGSDSTA------VAVSTFKL  235

Query  1042  SKPQIHALKAADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIR  863
             ++ Q+  LK         +     Y+ YE++  H+WR  CKAR+    Q T L    D R
Sbjct  236   TRDQLSTLKGKSRE----DGNTISYSSYEMLAGHVWRSVCKARALPDDQETKLYIATDGR  291

Query  862   RRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYR  683
              R++PPLP  YFGN I       V+G+++S+P    AS+I DA+  + +EY+  A+D+  
Sbjct  292   ARLQPPLPHGYFGNVIFTTTRIAVAGDLMSKPTWYAASRIHDALIRMDNEYLRSALDYLE  351

Query  682   NEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPG  506
              + D +K    G      PNL + +W  LP H  D GWG+ I M PG    +G   I+P 
Sbjct  352   LQPD-LKSLVRGAHTFRCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPS  410

Query  505   PNGIDGDDGSLLVAACLQVDHIQDFNKYFYEDI  407
                   +DGSL +A  L  + ++ F + FY+DI
Sbjct  411   ST----NDGSLSLAIALPPEQMKVFQELFYDDI  439



>gb|AEO00530.1| hydroxycinnamoyl transferase [Nicotiana benthamiana]
Length=369

 Score =   240 bits (612),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 144/389 (37%), Positives = 203/389 (52%), Gaps = 25/389 (6%)
 Frame = -2

Query  1567  FYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEFNHLVPSV  1388
             FYP AGRL               +C G G + VEAESD V+ D GDF+P  E   L+P+V
Sbjct  1     FYPMAGRLCRDEDGRIEI-----DCKGQGVLFVEAESDGVVDDFGDFAPTLELRQLIPAV  55

Query  1387  DYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLASGKPLSS  1208
             DYS    I    L   Q+T F+CGG+SLG  + H  ADG    HF+  W+++A G  L+ 
Sbjct  56    DYS--QGIQSYALLVLQITHFKCGGVSLGVGMQHHAADGASGLHFINTWSDMARGLDLTI  113

Query  1207  APFHDRRLLRAGEsssssSPQGGRRIFHHSPPL--IIGQSSNESERMKETKVSTLRLSKP  1034
              PF DR LLRA +      P     + +  PP   +  +++   E + ET VS  +L++ 
Sbjct  114   PPFIDRTLLRARDPPQPQFPH----VEYQPPPTLKVTPENTTNPEIVPETSVSIFKLTRD  169

Query  1033  QIHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCVDIRRR  857
             QI+ LKA +  +G + N     Y+ YE++  H+WR  C AR     Q T L    D R R
Sbjct  170   QINTLKAKSKEDGNTVN-----YSSYEMLAGHVWRSTCMARGLAHDQETKLYIATDGRSR  224

Query  856   MEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAIDFYRNE  677
             + P LP  YFGN I       V+G+I S+P+   ASK+ DA+  + ++Y+  A+D+   +
Sbjct  225   LRPSLPPGYFGNVIFTTTPIAVAGDIQSKPIWYAASKLHDALARMDNDYLRSALDYLELQ  284

Query  676   GDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSPGHDC-DGDVLILPGPN  500
              D +K    G      PNL + +W  LP H  D GWG+ I M PG    +G   ILP P 
Sbjct  285   PD-LKALVRGAHTFKCPNLGITSWSRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT  343

Query  499   GIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
                 +DGS  VA  LQ +H++ F K+ Y+
Sbjct  344   ----NDGSQSVAISLQAEHMKLFEKFLYD  368



>ref|XP_008228810.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=440

 Score =   242 bits (618),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 159/454 (35%), Positives = 229/454 (50%), Gaps = 38/454 (8%)
 Frame = -2

Query  1741  VVKPSEPTWSGLLSLSELDQIGTMMYVKILYFYTTPST---------LSPDAIIHSLRLS  1589
             +VKP+E T   +L ++ LD +    +   +YFY                P      L+ +
Sbjct  13    LVKPAEETPRQVLWMTNLDLVILGNHTPSVYFYRQNQNSVHGHHNNFFDPQV----LKQA  68

Query  1588  LSQVLVHFYPFAGRlswttaasgggtalaLNCNGNGAVLVEAESDAVLADLGDFSPGPEF  1409
             LS+ LV FYP AGRL       G       +CN  GA+ V AE+ + + D GDF+P  EF
Sbjct  69    LSKALVPFYPLAGRLGKEGNGRGEI-----DCNAEGALFVVAETGSTIDDFGDFAPTLEF  123

Query  1408  NHLVPSVDYSGVDPIPDIPLFAGQLTKFRCGGISLGFAISHVVADGQGISHFLFEWANLA  1229
               L+P+VDYS    I   PL   Q+T F+CGG+SLG  + H VADG    HF+  W+++A
Sbjct  124   RKLIPAVDYSA--GISTYPLLVLQVTYFKCGGVSLGVGLEHRVADGLSGLHFVNTWSDIA  181

Query  1228  SGKPLSSAPFHDRRLLRAGEsssssSPQGGRRIFHHSPPLIIGQSSNESERMKETKVSTL  1049
              G  L+  PF DR LLRA +      P      +   PP+  G  S   E      VS  
Sbjct  182   RGLDLTIPPFIDRTLLRARDPPQ---PAFDHIEYQPDPPIKTGTKSVGDE---SATVSIF  235

Query  1048  RLSKPQIHALKA-ADNNGRSCNAKLRGYTRYEVITAHIWRCACKARSHKPQQPTNLSFCV  872
             RL++ Q++ LKA +  +G + N     YT YE++  H+WRCA  AR     Q T L   V
Sbjct  236   RLTREQLNILKAKSKEDGNTIN-----YTTYEMLAGHVWRCASVARELPDDQETKLHIAV  290

Query  871   DIRRRMEPPLPDSYFGNAIIDVVIHGVSGEIISRPLQDVASKIRDAIDGVTSEYVNCAID  692
             D R R++P LP  +FGN +        +G++ S+P    AS+I DA+  + ++Y+  A+D
Sbjct  291   DGRSRLQPQLPPGFFGNVVFAGAPIAAAGDLKSKPTWYAASRIHDAVVRMDNDYLRSALD  350

Query  691   FYRNEGDVIKRQELGTFFVGNPNLSVINWVGLPNHGLDLGWGKEIHMSP-GHDCDGDVLI  515
             +   + D++     G      P L++ NW  LP +  D GWG+ I M P G   +G   +
Sbjct  351   YLELQPDLLPLVR-GARTFRCPRLAITNWSRLPIYDADFGWGRPIFMGPGGMGYEGLAFV  409

Query  514   LPGPNGIDGDDGSLLVAACLQVDHIQDFNKYFYE  413
             LP       +DGSL VA  LQ  H++ F+K  YE
Sbjct  410   LPSAT----NDGSLSVAISLQSQHMKSFSKLLYE  439



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5003565261950